,``@00ھ0\4 `@# ` "" $@` `T@   b@w"@H*/+  "bH  0  "  "  * " !` " @ %s: can't open device㿐@K#@  b("b( @ "   @`@)  @   "H@@%s: alloc failed%s: block table corrupt%s: read failure%s: short read㿐 `@    !@`  @ D ? c' / - + ,`2 @      @@ @`a@@?@2 @a aa @` @Ȳ@  ? Ċ`Ī@` Ē`IJ@` @ dvma_mapin㿘? #@(1? @@#1?dvma_mapout㿘 #@(1 @. 1㿘@ " ْ㿘 @  promprom0㿘  ` @ "H `  "  ` ""J  *@J` )*@Can't open device `%s' 㿘@   ` @ "H `  €b  $€b 2$   " @!X0   $   $`$` 㿘# bH`   ``*  `bH   '@`2`0`,6 * '@ 㿘  2& `& $& (   €5 " '@ 㿘 "H  @@ 0(@  㿘  @ $ ? `$ *㿐 "H/  0T@㿘  㿘 "H`t€Invalid controller number prom_iopen: "%s" error=%d 㿘) " ?N  @  "bPbP$` $`$`$`$`$`$` $`$$`($`,$`0$`4$` $`  $` $`  @ `+  " * @F $`0 "$`4 " @$` @ 2" &  %"   @  㿘# b  @ 4 "$b  & 4$b prom_mapin: length=%dprom_mapin: invalid maptype %d㿘  *`@   "H@ Ę    L         "`@{` `  @   8 <?*  Ș آ&@  `   Ȱ@㿘?( ,1 \&"H H L` T ` X P d l$ p  t @  .@ ДЖ ? * `:```?  `Ԕ "`"     А?"  㿘 b'H'L'P'T 'X "b@0H @  exit㿘 !@ ( 㿘!  !X'L'P'T'X$"@L"*㿘 'H'L'P'T'X @ H㿘  @8N@`N@`%` N@`|`  `*` € @L` L   ?,@` < ,L L  LL 4 L  ` >0 `L` L` N@ ` - @L N@ @C N@ @: N@ 0 x  @, N@ % w ls4l404x444444444444444d44444444444@444444440123456789abcdef㿈  @ @,@"  ?L?|/-\㿘  ؀`  "  a8J@ #" @ @   @ *0   @ *`( `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &" bootxx .....//(4444444H44\4   4444#4p,4\74=4F4M4 pV 4 c4m4t4 |4 4H44 4(4@4 4H @ ;J   @@;Jx i@@`p!/mntW@M8M<@@<@`bT @ ;Jx   @@;Jx i@@`@@<@`bT U;J(GA ;Jx;J!`;J!`HOZA;JyC;J;JA6l/;Jz,;J|!;Ju*PX`hpxl ;J;J;J../../instbin  ;J8;J8;J8../../instbina ;J /;J /;J /../../instbin䟚% ;J#F;J#F;J#F../../instbin ;J'V;J'V;J'V../../instbin~2 ;J*T;J*T;J*T../../instbin9/  ;J.};J.};J.}../../instbin3: ;J2b;J2b;J2b../../instbinXj ;J5;J5;J5../../instbinp\۝;J8;J;J h p x nJ2 ;J$s;J2b;JNBҝv;J5 R;J5 R;JNe ;J;J;J../../instbin  ;J8;J8;J8../../instbin ;J /;J /;J /../../instbin{R ;J#F;J#F;J#F../../instbinC ;J'V;J'V;J'V../../instbinO ;J+;J+;J+../../instbin8( ;J.};J.};J.}../../instbingG* ;J2b;J2b;J2b../../instbinux"o ;J8C;J8C;J8C../../instbin4  ;J;J;J../../instbin ;J;J;J../../instbinkb* ;J';J';J'../../instbin^N ;J ;J ;J ../../instbinܚ ;JN;JN;JN../../instbinB ;J;J;J../../instbin*a;J'c;J'c;J*Q :Gx!;J)';J)';J*Q*Oa;J,;J,;J*Q bC!;J-D;J-D;J*Q*ݸza;J0G;J0G;J*Q g.!;J1xˀ;J1xˀ;J*Q*Sa;J4s;J4s;J*Q S.h!;J5;J5;J*Q*nOa;J8C;J8C;J*Q ˜!;J9;J9;J*Q*פ:a;J;J;J*Q G:!;JÀ;JÀ;J*Q*n$a;J,;J,;J*Q F!;J;J;J*Q*7a;JX;;JX;;J*Q !;J h;J h;J*Q*sa;J X;J X;J*Q @!;J ;J ;J*Q* La;J߀;J߀;J*Q !;JI ;JI ;J*Q* Va;JC;JC;J*Q 5!;Ju*;Ju*;J*Q* FOsa;Jׄ;Jׄ;J*Q 5@U!;J;J;J*Q* *a;J;J;J*Q F!;J4΀;J4΀;J*Q* b@a;J(;J(;J*Q 3W!;J U;J U;J*Q*T^@a;J#F;J#F;J*Q !;J$s;J$s;J*Q*ɇca;J05;J05;J7n jx!;J2b;J2b;J7n*hia;J5;J5;J7n :!;J7n;J7n;J7n*_a;J9;J9;J7n X$!;J;3;J;3;J7n*sIa;JÀ;JÀ;J7n !;J;J;J7n* a;J;J;J7n s!;J';J';J7n*JYa;J h;J h;J7n WYa;J!`;J!`;J7n 8'h!;J";J";J7n*|(a;J$s;J$s;J7n w%w!;J&%;J&%;J7n*a;J(;J(;J7n O;!;J*Q;J*Q;J7n*Մa;J,;J,;J7n !;J-D;J-D;J7n*\h-a;J05;J05;J7n  F!;J2b;J2b;J7n*qxa;JbZ;JbZ;J S+ `!;J;J;J * M?-a;J;J;J S+ ! Z!;J;J;J *!"a;J !;J !;J S+ ".1!;J S+;J S+;J *"F(,a;JN;JN;J #3!;JI;JI;J *#?a;J;J;J $Ov!;J;J;J *$Va;J ;J ;J %\!;J>;J>;J *%]a;JG;JG;J &cд!;Jt;Jt;J *&a0a;Je;Je;J '!;J;J;J *'>qoa;J!`;J!`;J (w錚!;J";J";J *(eTa;J% ;J% ;J ) !;J&6;J&6;J *)=a;J) ;J) ;J *)!;J*Q;J*Q;J **d8a;J-L;J-L;J +jF]!;J.};J.};J *+Ya;J05;J05;J ,!;J2;J2;J *,Ʊa;J8ـ;J8ـ;J -P I!;J9;J9;J *-e9a;J1-;J1-;J .Xo!;JbZ;JbZ;J *.5[Xa;JĴ;JĴ;J /l!;Jw;Jw;J */Ja;Jz9;Jz9;J 02!;Jf;Jf;J*0_bKa;J>;J>;J 1^.!;Jp;Jp;J*1<ӡPa;Jt;Jt;J 2g!;J8;J8;J*2(Oa;J;J;J 3΃!;J /;J /;J*3I4ba;J";J";J 4Վ!;J$[܀;J$[܀;J*4Ya;J&6;J&6;J 5W!;J'c;J'c;J*5a;J*Q;J*Q;J 6+!;J,;J,;J*6\a;J.};J.};J 7ty#!;J/;J/;J*7/Na;J2b;J2b;J 8q!;J3%;J3%;J*8qa;J6=;J6=;J 91!;J7n;J7n;J*9֙a;J:i;J:i;J :V0!;J;J;J*:}a;JbZ;JbZ;J ;E!;J;J;J*;}a;Jw;Jw;J <,!;J;J;J*<"97ya;J !;J !;J =) r!;J ;J ;J*=a;JN;JN;J >w!;JI;JI;J*>"#ha;J;J;J ?_!;Jf;Jf;J*?Tc a;J(;J(;J$s> ΃!;J U;J U;J$s wa;J#*;J#*;J$sy_t!;J$[܀;J$[܀;J$s 0a;J'V;J'V;J$s}!;J(;J(;J$s EFa;J*T;J*T;J$sk!;J,;J,;J$s R@a;J/q;J/q;J$s!;J0G;J0G;J$s ⵟa;J2;J2;J$s+!;J4s;J4s;J$s ^&a;J6;J6;J$s^!;J8C;J8C;J$s a;J;3;J;3;J$slZcq!;J;J;J$s Όa;J;J;J$s**!;J,;J,;J$s ga;J';J';J$s vw!;JX;;JX;;J$s pW'a;J ;J ;J$s ˥!;J ;J ;J$s Ia;J沀;J沀;J$s aJ!;J߀;J߀;J$s J9Ga;Jz9;Jz9;J$s L!;JC;JC;J$s a;JW;JW;J$s j}!;Jׄ;Jׄ;J$s 0ba;J9;J9;J$s?!;J;J;J$s a;Je;Je;J$s6!;J(;J(;J$s Ta;J+;J+;J3B !;J,;J,;J3B Okda;J/;J/;J3Bbq!;J05;J05;J3B ,a;J3%;J3%;J3B .8!;J5 R;J5 R;J3B ]H9a;J8C;J8C;J3BANF!;J98p;J98p;J3B 5za;J;J;J3BH<!;JÀ;JÀ;J3B a;J,;J,;J3B] -e!;J]J;J]J;J3B a;JX;;JX;;J3B!;J h;J h;J3B ]a;J ;J ;J3Bw${!;J ;J ;J3B da;J߀;J߀;J3Bh!;J;J;J3B oa;JC;JC;J3B!;Ju*;Ju*;J3B a;Jp;Jp;J3BL~!;JG;JG;J3B Da;J;J;J3B/!;Je;Je;J3B Na;J /;J /;J3B_`!;J!`;J!`;J3B  ܄a;J$[܀;J$[܀;J3B3!;J% ;J% ;J3B a;J'c;J'c;J3BJt!;J)';J)';J3B P'a;J,;J,;J3B !;J-D;J-D;J3B }Jha;J9;J9;J]J TWY!;J;3;J;3;J &d^a;JbZ;JbZ;J]J!R!;J;J;J !a;J;J;J]J"Za!;J;J;J "y za;J !;J !;J]J#QAx!;J ;J ;J #oia;JN;JN;J]J$$a!;JI;JI;J $#,a;Jz9;Jz9;J% !;Jf;Jf;J %{a;J ;J ;J&ސ!;Jׄ;Jׄ;J &!\a;J9;J9;J'\ !;J;J;J ')*a;Je;Je;J( !;J(;J(;J ( a;J";J";J)K!;J#F;J#F;J )Ua;J&%;J&%;J* !;J'c;J'c;J *ةWa;J*Q;J*Q;J+I?$!;J+;J+;J +z[a;J.};J.};J,i!;J/;J/;J ,DUa;J2;J2;J-!Z!;J3%;J3%;J -65%a;J6=;J6=;J.h!;J8C;J8C;J .fa;J:i;J:i;J/(!;J;J;J /MIa;J X;J X;Jܓ0GQ!;J ;J ;Jܓ 0=AT  . ..chflags ftp gzip gunzip gzcat sed  sort tip  build vi basename1Ѹ cksum sum cut getopt grep egrep fgrep netstat rsh strings tset reset less morek ;; Xdone|X) break ;; Xnone) _mount_points[${_i}]= break;; *) echo "mount point must be an absolute path!";; esac done _i=$(( ${_i} + 1 )) if [ $_i -ge $_npartitions ]; then _i=0 fi done # Now write it out _i=0 while test $_i -lt $_npartitions; do if [ -n "${_mount_points[${_i}]}" ]; then echo "${DISK}${_partitions[${_i}]} ${_mount_points[${_i}]}" >> ${FILESYSTEMS} _mount_points[${_i}]= fi _i=$(( ${_i} + 1 )) done rm -f /tmp/fstab.${DISK} done echo echo "You have configured the following devices and mount points:" echo cat ${FILESYSTEMS} echo echo "============================================================" echo "The next step will overwrite any existing data on:" ( echo -n " " while read _device_name _junk; do echo -n "${_device_name} " done echo ) < ${FILESYSTEMS} echo echo -n "Are you really sure that you're ready to proceed? [n] " getresp "n" case "$resp" in y*|Y*) ;; *) echo "ok, try again later..." exit ;; esac # Loop though the file, place filesystems on each device. echo "Creating filesystems..." ( while read _device_name _junk; do newfs -q /dev/r${_device_name} done ) < ${FILESYSTEMS} else # Get the root device ROOTDISK=`df /mnt | sed -e '/^\//!d' -e 's/\/dev\/\([^ ]*\)[a-p] .*/\1/'` while [ "X${ROOTDISK}" = "X" ]; do getrootdisk done fi # Get network configuration information, and store it for placement in the # root filesystem later. cat << \__network_config_1 You will now be given the opportunity to configure the network. This will be useful if you need to transfer the installation sets via FTP, HTTP, or NFS. Even if you choose not to transfer installation sets that way, this information will be preserved and copied into the new root filesystem. __network_config_1 echo -n "Configure the network? [y] " getresp "y" case "$resp" in y*|Y*) donetconfig ;; *) ;; esac if [ "`df /`" = "`df /mnt`" ]; then # Now that the network has been configured, it is safe to configure the # fstab. ( while read _dev _mp; do if [ "$_mp" = "/" ]; then echo /dev/$_dev $_mp ffs rw 1 1 else echo /dev/$_dev $_mp ffs rw 1 2 fi done ) < ${FILESYSTEMS} > /tmp/fstab munge_fstab /tmp/fstab /tmp/fstab.shadow mount_fs /tmp/fstab.shadow "-o async" fi mount | while read line; do set -- $line if [ "$2" = "/" -a "$3" = "nfs" ]; then echo "You appear to be running diskless." echo -n "Are the install sets on one of your currently mounted filesystems? [n] " getresp "n" case "$resp" in y*|Y*) get_localdir ;; *) ;; esac fi done resp= # force one iteration echo echo 'Please enter the initial password that the root account will have.' while [ "X${resp}" = X"" ]; do echo -n "Password (will not echo): " stty -echo getresp -n "${_password}" stty echo echo _password="$resp" echo -n "Password (again): " stty -echo getresp -n "" stty echo echo if [ "${_password}" != "${resp}" ]; then echo "Passwords do not match, try again." resp= fi done md_questions install_sets $THESETS # Copy in configuration information and make devices in target root. echo cd /tmp echo -n "Copying " for file in fstab hostname.* hosts myname mygate resolv.conf; do if [ -f $file ]; then echo -n "$file " cp $file /mnt/etc/$file rm -f $file fi done echo "...done." if [ -f /etc/dhclient.conf ]; then echo -n "Modifying dhclient.conf..." cat /etc/dhclient.conf >> /mnt/etc/dhclient.conf fi # If no zoneinfo on the installfs, give them a second chance if [ ! -e /usr/share/zoneinfo ]; then get_timezone fi if [ ! -e /mnt/usr/share/zoneinfo ]; then echo "Cannot install timezone link." else echo "Installing timezone link." rm -f /mnt/etc/localtime ln -s /usr/share/zoneinfo/$TZ /mnt/etc/localtime fi if [ ! -x /mnt/dev/MAKEDEV ]; then echo "No /dev/MAKEDEV installed, something is wrong here..." exit fi echo -n "Making all device nodes (by running /dev/MAKEDEV all) ..." cd /mnt/dev sh MAKEDEV all echo "... done." cd / remount_fs /tmp/fstab.shadow md_installboot ${ROOTDISK} _encr=`echo "${_password}" | /mnt/usr/bin/encrypt -b 7` echo "1,s@^root::@root:${_encr}:@ w q" | ed /mnt/etc/master.passwd 2> /dev/null /mnt/usr/sbin/pwd_mkdb -p -d /mnt/etc /etc/master.passwd dd if=/mnt/dev/urandom of=/mnt/var/db/host.random bs=1024 count=64 >/dev/null 2>&1 chmod 600 /mnt/var/db/host.random >/dev/null 2>&1 populateusrlocal test -x /mnt/install.site && /mnt/usr/sbin/chroot /mnt /install.site unmount_fs /tmp/fstab.shadow # Pat on the back. md_congrats # ALL DONE! exit 0  . .. bin dev etc mntmnt2<sbin< tmp usr varinstbin install.subinstallupgrade bsd.profileKh install.mdhbootR    @D, @' ($p+#@  /@Z / "%8 %8 @<@`@yI`Ƃd??/usr/libexec/ld.soNo ld.so Failure reading ld.so Bad magic: ld.so Cannot map ld.so crt0: update /usr/libexec/ld.so ld.so failed h! Р!ؒ$   Ŗ ?$   `""      ؐ        ?@ ?# @! ?؀a ?@ ?# @ ؀`     | ??"  #\@ #`?# @!  3 @@! -? ?c@  ̀@ ! @ ̀@? ?c@ ! @   @! @     #d#h  Ŕ  ( ? $ ( !    ?#\#`ؔ@ ?# @!   a ?@  ?#  ?FB?? ?# ! 2 ?1@! ,? ?c@  ̀@2 ?@ ̐ ? ?c@ ! @" @! @2 #?:  ?# !  ?/ @! )? ?c@  ̀@ ? @ ̐ ? ?c@ ! @   @! @   #d#h   Ř u ?  ( o  l 䀣 !  #\܆ ؔ   #d#h`#`  R ?2  ( ( L  I  (`p8ؠؐ $ $ $ $  ` ?2 @  !1 `  ?2   h %  "  ""`@E"㿘"€ 㿘"``@?㿘"€ 㿘" ?Service unavailable㿐"     ?1 !P  @*`:` J " %s: %s not compiled in instbin㿘@6@ J 2@@F@@ْ /  @ @`"@); 2   €   a@DH @!㿘 ?@?Œ`Usage: %s ..., where is one of: %s㿘  c@D `@ `@) + @x[@  O4@D #P@@DcX`@ @C#P@vq hostnamedmesgexprmvsleep-shshkshsedmkdirmtshutdownstringsrmtipgetoptmount_mfsnewfsinitsortfsckfsck_ffschrootchflagschownchgrpchmodgzcatgunzipgzipcutcpedhaltrebootffsmount_ffsdhclientftprouteinstallbootslattachmknodrshumountbasenamefgrepegrepgrepnfsmount_nfsmorelessresettsetsumcksumsysctllsifconfigcatpingcpiotarpaxdisklabellnsttyvibuildsyncmountnetstatdfcd9660mount_cd9660dd㿘@!/4/5/7/58/5d@@/5/5/5/5 /5@@/6skipseekofobsifibsfilescountconvcbsbsout of memoryunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs cannot be zerocbs meaningless if not doing record operationsbuffer sizes cannot be zerobuffer sizes cannot be greater than %useek offsets cannot be larger than %qd㿈 "b("`#"  # $b%C+) 5 7 / - 3 @ $@q' @ = 2,b @q  L bb(@q  ' @A  @q  "`H@p  €$  $`@"@ $` @ @r x` `@p֐ " ` `@pΐ c!, !"@!   !,$%c `@p " ` "( `@p  p%c"(  c` % a@p  ? @4+  2` $ 8 `  @4`   `$   aH @pn?㿘@&@㿘@"b8"㿘@"b 㿘@ "b`?"b`㿘@"b㿘#`@"b8 @㿘#`@"c 㿘@:㿘@:H7 Fp77 Gp7 Hp77x7p7` Cp7P Dp7H Ep7@78707(7 unblockucasesyncswabosyncoldibmoldebcdicoldasciinotruncnoerrorlcaseibmebcdicblockascii,unknown conversion %s%s: illegal conversion combination㿈 ,'D) % !' # 1D@o#'0  @@& @o `"`c@o ` `"&#D ߐD㿘@%@%s%s: illegal numeric value%s: %s㿐@ ?2"`@ 2J"`@oM `k`m`b". `w . . . 8 'J`x 4``*2 @w>"! @` "@o "`@o  㿐 @    "`@( 2K"`@n  k m b .J w(J4`,  ,` 4`,  ,` 4` ,  ,`4`,  ,`& 2 @" 'J`x 4#`%`*2  @4Ւ @"! @ސ "@n "`@n 㿘# b(  "@    *b(``$   $ @   $`$`0 㿘"?`$)"(  "(     "("(" "  "(@k"@ "("(?"`"`%"(# "@ "h '` @8#    +@ `  0 +@`    "(` *`"(` " "`?"`     @s=" *#` " "` %` "(  "(`? "`  "(` ? %"`#` ` ` $` $`@> ` `"("( @ " 㿘"(` %!h#` "@ "@k7 c `` `  ( ! " @rה" "  "㿘#+󀢠b(  ??  @? ?,@ b( @ <b(#    @?*" ?   " " " @j@$$ $*@` $@   @ " % b(   b(@j"@ b(  $ %s: short input record㿘b(  2  @"hb(  %   b( ? *b( "?b( $  `@j``@$`$` `"* "㿘@0E@9a@p a@p @>Ð#Db`? 3@Vb??&b@@pu stdin%sfiles is not supported for non-tape devicesstdoutinput bufferoutput buffer㿘"(   #$  $ @M $  `@ (@"`   `@le #   8 $ $ ')c# "& @M! $ #" & @M! $ `$ ` ` @f`@# @2((`` @oC? $(`@@P $! " @*" @o1@  $(`" @o*@ $`P@7 ((`$"`$ ` " @  $@#@&#  #   @2     @4 #"@L`!&b (㔔 *  +@ ( 5!㔔 *  +@ ( $ (  *  +  !  *  +   㔐@L  @q5` h `@ <     a@qN     @g+ ?   ( x`  & 㿘 )b(#"h/1"`"h` # -` @p`( @p`(  @g  h$ 6. 㐀$2   @S  @~@K        @fҔ @ @j㐀``$` "h@  $`%"h   $ "h@  $ %"h $  $  $ ` %`㐀` `@w&`$`@@ (`"`` %``@B`` 㘒@€$`x㿘c p@Z!,@  Ԁ@# !#`#@  " @o #@o #`"`# `@ %s: end of device%s: short write on character device%s: short write on tape device㿘# #``#35/+-  ?# #`   2 `` "@Ԑ`#` "$` @j;@f bh (@j.  x` @X bh  > B; Ǥ@2   # #  " &   #   #@g"@ #  & %u+%u records in %u+%u records out %u odd length swab %s blockblocks%u truncated %s %qd bytes transferred in %ld.%03ld secs (%0.0f bytes/sec) Ȑ@K bb" '"@ 'Вb@ ?*"@ "X*`" *  *  ' B?8 ?8`   d #\@J@D @o7'@ $ "Ȁ "" @J d-`@o%% "h (" "" @Jƒ d-`@o%%`h`!#@ar##\@.]b` B d8-` ª`@J;`@n%%@n 㿘! (g x$ x㿘a@m %sskip reached end of input㿘b( 2   @/M     @dՖ ?CAa@<  9 +-(@d  "  &!D?D? b ?"b@h #d @:a a@ (㿐#      @.      @dz ?vt a@   $  '7a@n c a@А    X $ Tc c@dl  4A6  a@   7 'a@nX? a@  D 4c, $ (cc @dI    a@  D 4c $ c0  D4c $c㿘@`VVVVVVVVVVxVpVh V`updateunionrdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotaegjo:Rcd9660%s: Filesystem not supported by kernel%s on %s @+V '+) ('%/5 0* `@€     @ @w@5??* & @ @h@?` '' ' '''@g  ( x`-b@g c@ @kP WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWtWW|WWWWWWWWusage: mount_cd9660 [-egjR] [-o options] special node 㿘aP@8 @k  ,-o %s: option not supported㿘@  @Z 1' n L  o  @ = 2*`"@ 2   @2    &*@&a@f  @0~ᨠ 2L@j4㿘@9hiklnPt:only one -t option may be specified.-i is incompatible with -Pretrieving information on mounted file systems%s%s is not a local file system%s mounted as a %s file system0@*+5%!';/-+ ()+9 $&* 8@€ $ $# $ $#$ 'c % "cH c@f~ @`@J@3Д#?Ґ?"*@` & c @8@2@(%d)%x%c%10lu %10lu%8lu %5lu %8lu %5lu %5lu %4dX`@ǐ"0Y "@0SX@Fc  NXbȐ"Ж@"ax   "b@*#c(08#@@cH*a耢  #P@cXBa  #P@c` ``?"`  * % @L ` `%* @F  ؀ H4@i+ )#d/W`$@H 䀦` @ T` *,@`,@,*#@`|h l p t x 耢` WRa Ĕ" \#h@%H``!#@#x#@xx@E ` " ``*"*` €!#@#x#@Vp@X*8`  @eC  @e> ! @ܐ#@X 8` @e-  @e(  #@ǖa( "Ԁ #! @Ea $@W c@#4  p`? ?  '*8` $`$`,` ,` @X8` @d  @d ! @#@Y8` @d  @dՐ  #@ta(  #%@E  , @ .8`  @d  @dВcȖ @P p? `* * @' `* `* `* @@K@[Ր@/#!#@ZC!  @^ @!!  @^4?`# `*` '7 @@@[@ !#@Y`(@#x ```` 2 ` `! #@(ѐ@@Ep  @ `@ܐ 0 @ @ @ 8L@ "8 ?  8 @ `  .@? " ?  `?`$``@  * % @ځ ?px | @@ h Plpt@x耢 WR@ pa @ p ` ?"` * % @O ``)*w|0w|0|0|0{H|0|0|0|0|0|0|0|0|0{ |0{|0|0|0|0zx%s%s: %s: unknown interface %7.7s in %8.8s %6.6s out %5.5s %5.5s in %5.5s%5.5s out %5.5s %5.5s %5.5s %7.7s in %8.8s %6.6s out %5.5stotal %5.5s in %5.5s%5.5s out %5.5s %5.5s%10.10s %8.8s %10.10s %5.5sbytespacketserrscollsdrops %10.10s %8.8s %10.10s %5.5s %8.8s %5.5s %8.8s %5.5s %5.5s%10lu %8.8s %10lu %5.5s %5d %10lu %8.8s %10lu %5.5s %8lu %5lu %8lu %5lu %5lu㾨'D@C   )A"@cd< ?'# )4'A 7"5-1B+' @y  "h@>Ζcd`"`0@ "`0@ $ @CJ ؀ 2 x) 8cd @.bp@a @aK *D"a@3x  ␒@  !b @w ! @p<#$ *` *  *  *  :  x   @V  !c  @K ! <b@C<Ap@:`&`&`&`&`&` &`$&`(&`,`0@*&```?"`` * %`@ x  c`@ @ !#hpc  @ x! b@<㰒$ *` *  *  *  :  !x  c` @ !#hpc  @ۚx! b@Ӓ``?"`` * %`@ء @Xi` <`$ $ $ $ $ $ $$ ($ ,rc@o" @BR ؀ ` @.hx |`Ȓ" ` @#@ !`Ph`" l`" p`# t`$#@ x`(@ ! `,@{" h&`|&`l&`p&`&` t&`$x&`(&`,  $ `  $ `  $ `  $ `   $ `$ $@$ $`( ( $ ( ,`,$@$ ,`0@  <c$ *` *  *  *  :  ,x    " # @( ! ` "  "  #  $$#@  ((@ !  ,,@ " ``?#`  $ $ $ $  $ $ $ $ $$  ($$ ,$($,` * %` @ @W`*a`'@F5 *D @1i I<*  $OpenBSD: inet.c,v 1.53 2001/08/26 09:42:04 brian Exp $TIME_WAITFIN_WAIT_2LAST_ACKCLOSINGFIN_WAIT_1CLOSE_WAITESTABLISHEDSYN_RCVDSYN_SENTLISTENCLOSED㿘@V 㿘@O tcp??? Active Internet connections (including servers)%-*.*s %-5.5s %-6.6s %-6.6s %-18.18s %-18.18s %s PCBProtoRecv-QSend-QLocal AddressForeign Address(state)%-5.5s %-6.6s %-6.6s %-22.22s %-22.22s %s %*p 6%-5.5s %6ld %6ld %d %sp 'L"@#a`?@@Ҕ ""X'9"7"5"L 3 a(`!3`!a(  *0@O'䀢 * 8a@@ `<*H@@ !x#`@%*"@!a(`"@!Ȓ`` ?"``* $`@ֶ * \`""0#\"b8"""#`Ha"#d#h  " @š($x""b`"0b8"#\" (@H$x\  `<@ ` @`! @*"b@x``"`8"@`a 6$@*  4@*  `0@  4 @  `*cH`* 2` :""@k: `L"@c"`` ?"``* $`@1   @?  @)"@H!%s: %u packet%s sent %u data packet%s (%qd byte%s) %u data packet%s (%qd byte%s) retransmitted %qd fast retransmitted packet%s %u ack-only packet%s (%u delayed) %u URG only packet%s %u window probe packet%s %u window update packet%s %u control packet%s %u packet%s hardware-checksummed %u packet%s received %u ack%s (for %qd byte%s) %u duplicate ack%s %u ack%s for unsent data %u packet%s (%qu byte%s) received in-sequence %u completely duplicate packet%s (%qd byte%s) %u old duplicate packet%s %u packet%s with some dup. data (%qd byte%s duped) %u out-of-order packet%s (%qd byte%s) %u packet%s (%qd byte%s) of data after window %u window probe%s %u packet%s received after close %u discarded for bad checksum%s %u discarded for bad header offset field%s %u discarded because packet too short %u discarded for missing IPSec protection %u connection request%s %u connection accept%s %u connection%s established (including accepts) %u connection%s closed (including %u drop%s) %u embryonic connection%s dropped %u segment%s updated rtt (of %u attempt%s) %u retransmit timeout%s %u connection%s dropped by rexmit timeout %u persist timeout%s %u keepalive timeout%s %u keepalive probe%s sent %u connection%s dropped by keepalive %u correct ACK header prediction%s %u correct data packet header prediction%s %u PCB cache miss%s %u SYN packet%s received with same src/dst address/port h h#@"@>D!0`!#:"``  !#"@>T@  @!#:"``4!#"@>>@>:@p   $@!#:"``4(!#"@>! @>$@S(, (:"`` 0(%#@> @?0  耢 !#:"``4 8!##8@=@)8`!#:"``4 4!##`@=ߐ@4`!#:"``4  max ip packet size %lu tunneling packet%s that can't find gif %lu datagram%s with bad address in header %lu input datagram%s checksum-processed by hardware %lu output datagram%s checksum-processed by hardware  x@8F |#"@x !*:"``4 |!* 8@8R@| !*:"`` !* X@8A@z*:"``4* x@m *:"``4* @` *:"``4* @S *:"``4* @F Ȁ*:"``4*!@9 Ѐ*:"``*!0@,  !*:"``4 !*!X@7@ !*:"``4 !*!x@7ѐ@ ؀ !*:"``4 !*!@7@ !*:"``4 !*!@7@ !*:"``4 !*!@7@ג !*:"``4 !*"@7@ƒ !*:"``4 !*"8@7|@ !*:"``4 !*"h@7k@ !*:"``4 !*"@7Z@ !*:"``4 !*"@7I@ !*:"``4 !*"@78@qԀ !*:"``4 !*"@7'@` !*:"``4 !*#@7@Ò !*:"``4 !*#P@7@> !*:"``4 !*#@6@- !*:"``4 !*#@6@Ā !*:"`` !*#@6Ґ@ ܀*:"``*#@  !+:"``4 !+ @6@䀦 !+:"``4 !+ H@6@ܒ耦 !+:"``4 !+ x@6@˒쀦 !+:"``4 !+ @6@ !+:"``  @6q@address mask replyaddress mask requestinformation request replyinformation requesttime stamp replytime stampparameter problemtime exceededrouter solicitationrouter advertisementecho#7#6routing redirectsource quenchdestination unreachable#2#1echo reply %lu call%s to icmp_error %lu error%s not generated 'cuz old message was icmp Output packet histogram: %s: %lu %lu message%s with bad code fields %lu message%s < minimum length %lu bad checksum%s %lu message%s with bad length Input packet histogram: %lu message response%s generated ( @5!l#"@ !-:"``4 !-"p@5@ !-:"`` !-"@5@ϒ!| P)-'-  (  `"@"Ȣ @? 8 2!-:"``4  !/:"``  0@3@.localhost0.0.0.0%ldP`?`q'  ?  /?#`/@{\# @Kt  </#@" < o'7ab'  2@! [''`#\@ ,T   ` ``€ 0A "(`+-/@P   `$%`4 $ @aP "  @.Ґ@8$  `$`@  . 2  2 "  2  %.*s.%.8s*%d[%.8s]%d %-*.*sH* \0!H`  ';㨀 " @b P@.@ 㨀  .`2  @2 ?.`2 `?0%aP0!X@.e %\㨀 2?"a@4     0?% `@.J \?0% p@.A4 \   0!x@! %s%u.%u.%u.%u㿈aȀ %; G "aȦ H@! 2 ,H@0 . @抒`,H .  *'@%@2'  `@ 5  2`2 @{t  "@ . `H@` ",@` `!0X @-֒ 2  !08 @-̒ 2  `2`2`0#\2`@ ` @- 2  %u input AH packets %u output AH packets %u packet%s from unsupported protocol families %u packet%s shorter than header shows %u packet%s dropped due to policy %u packet%s for which no TDB was found %u input packet%s that failed to be processed %u packet%s that failed verification received %u packet%s for which no XFORM was set in TDB received %u packet%s were dropped due to full output queue %u packet%s where counter wrapping was detected %u possibly replayed packet%s received %u packet%s with bad authenticator length received %u packet%s attempted to use an invalid tdb %u packet%s got larger than max IP packet size %u packet%s that failed crypto processing %qu input byte%s %qu output byte%s @ 7@1{ X#"@ђȀ1:"``41! @Ē ̀1:"``1!8@ !1:"``4 !1!P@1m@!1:"``4 !1!@1\@쀤!1:"``4 !1!@1K@!1:"``4 !1!@1:@s!1:"``4 !1"@1)@b!1:"``4 !1"8@1@Q!1:"``4 !1"h@1@@!1:"``4 !1"@0@/!1:"``4 !1"@0@!1:"``4 !1#@0Ԑ@ Ā!1:"``4 !1#H@0Ð@Ѐ!1:"``4 !1#@0@耤!1:"``4 !1#@0@ڒ!1:"`` !1#@0@ɒ܀ :"`` %2@0} @䀒 :"`` %20@0j @ %u packet%s were dropped because of no interface/bridge information %u packet%s dropped for other reasons %u input ethernet-in-IP packet%s %u output ethernet-in-IP packet%s h @0 0#"@gȀ!1:"``4 !1!@0@V̀!1:"``4 !1"@0 @EЀ!3:"``4 !3!0@/@4Ԁ!1:"``4 !1!@/@#؀!3:"``4 !3!x@/ِ@܀!3:"``4 !3!@/Ȑ@!3:"`` !3!@/@쀒 :"`` %2@/ @ܔ :"`` %20@/ @ɔ %u input ESP packet%s %u output ESP packet%s %u packet%s with bad encryption received %u packet%s with bad payload size or padding received @ P@/> X#"@̀!4:"``4 !4 @/J@Ѐ!4:"``4 !4 @/9@r!1:"``4 !1!P@/(@a!1:"``4 !1!@/@P쀤!1:"``4 !1!@/@?!1:"``4 !1!@.@.!1:"``4 !1"@.@!4:"``4 !4 @.Ӑ@ Ā!1:"``4 !1"8@.@~!1:"``4 !1"h@.@~!1:"``4 !1"@.@~ْ!1:"``4 !1"@.@~ȒȀ!1:"``4 !1#@.~@~!4:"``4 !4!@.m@~Ԁ!1:"``4 !1#@.\@~耤!1:"``4 !1#@.K@~!1:"`` !1#@.:@~s܀ :"`` %2@.' @~_䀒 :"`` %20@. @~L %u total input packet%s %u total output packet%s %u packet%s with possibly spoofed local addresses %u protocol family mismatches %u attempts to use tunnel with unspecified endpoint(s) h @- 0#"@~ Ȁ!5:"``4 !5"@-@}̀!5:"``4 !5"@-@}Ѐ!1:"``4 !1!@-@}ؒ耤!1:"``4 !1!@-@}ǒ쀤!5:"``4 !5"@-}@}Ԁ!1:"`` !1"@-l@}܀ :"`` %2@-Y @}䀒 2:"`` %20@-E @}}!5:"``4 !5#@-3@}l􀤠!5:"`` # @-#@}\ %u input IPCOMP packet%s %u output IPCOMP packet%s %u packet%s that failed (de)compression processing P  @,ܔ H#"@}2̀!6:"``4 !6"H@,@}!Ѐ!6:"``4 !6"h@,א@}!1:"``4 !1!P@,Ɛ@|!1:"``4 !1!@,@|쀤!1:"``4 !1!@,@|ݒ!1:"``4 !1!@,@|̒!1:"``4 !1"@,@|Ā!1:"``4 !1"h@,q@|!1:"``4 !1"@,`@|Ȁ!1:"``4 !1"@,O@|Ԁ!1:"``4 !1#@,>@|w耤!1:"``4 !1#@,-@|f!6:"`` !6"@,@|U܀ :"`` %2@,  @|A䀒 :"`` %20@+ @|.#255#254#253#252#251#250#249#248#247#246#245#244#243#242#241#240#239#238#237#236#235#234#233#232#231#230#229#228#227#226#225#224#223#222#221#220#219#218#217#216#215#214#213#212#211#210#209#208#207#206#205#204#203#202#201#200#199#198#197#196#195#194#193#192#191#189#188#187#186#185#184#183#182#181#180#179#178#177#176#175#174#173#172#171#170#169#168#167#166#165#164#163#162#161#160#159#158#157#156#155#154#153#152#151#150#149#148#147#146#145#144#143#142#141#140#139#138#137#136#135#134#133#132#131#130#129#128#127#126#125#124#123#122#121#120#119#118#117#116#115#114#113#112#111#110#109#108#107#106#105#104PIM#102#101#100#99#98Ethernet#96#95#94#93#92#91#80OSPF#88#87#86#85#84#83#82#81ISOIP#79#78#77#76#75#74#73#72#71#70#69#68#67#66#65#64#63#62#61destination optionno next headerICMP6#57#56#55#54#53#52AHESP#49#48#47#46#45fragmentrouting#42IP6#40#39#38#37#36#35#34#33#32#31#30TP#28#27#26#25#24#23IDP#21#20#19#18UDP#16#15#14#13#12#11#10#9#8#7TCP#5IP#3IGMPICMPhop by hop%s: %llu total packet%s received %llu with size smaller than minimum %llu with data size < data length %llu with bad options %llu with incorrect version number %llu fragment%s received %llu fragment%s dropped (dup or out of space) %llu fragment%s dropped after timeout %llu fragment%s that exceeded limit %llu packet%s reassembled ok %llu packet%s for this host %llu packet%s forwarded %llu packet%s not forwardable %llu redirect%s sent %llu packet%s sent from this host %llu packet%s sent with fabricated ip header %llu output packet%s dropped due to no bufs, etc. %llu output packet%s discarded due to no route %llu output datagram%s fragmented %llu fragment%s created %llu datagram%s that can't be fragmented %llu packet%s that violated scope rules %llu multicast packet%s which we don't join Input packet histogram: %s: %llu #%d: %llu Mbuf statistics: %llu one mbuf%s two or more mbuf: %s = %llu %llu one ext mbuf%s %llu two or more ext mbuf%s %llu packet%s whose headers are not continuous %llu tunneling packet%s that can't find gif %llu packet%s discarded due to too many headers %llu failure%s of source address selection source addresses on an outgoing I/F %llu node-local%s %llu link-local%s %llu site-local%s %llu global%s %llu addresses scope=%x source addresses on a non-outgoing I/F source addresses of same scope source addresses of a different scope deprecated source addresses %llu forward cache hit %llu forward cache miss  &x@(,9#(@xk|x x:"`` x%90@( @xW@:"`` 9#P @xG @:"`` 9#x @x7 @:"`` 9# @x' @:"`` 9# @x  2:"`` %9@'ː @x 2:"`` %:@' @w 2:"`` %:0@' @w۔ 2:"`` %:X@' @wǔ䀒 2:"`` %:@'{ @ẁ 2:"`` %:@'g @w 2:"`` %:@'S @w 2:"`` %:@'? @wwĀ 2:"`` %:@'+ @wcԀ 2:"`` %:@' @wO 2:"`` %:@@' @w;܀ 2:"`` %:p@& @w' 2:"`` %:@&ې @w쀒 2:"`` %:@&ǐ @v 2:"`` %:@& @v 2:"``  %:(@& @vה $ 2 :"`` ( %:X@& @vÔ(, (:"`` 0(%:@&w @v0  8hhh4 ;:9:0@@":@vb ,!  @> 2 @vb"@v|`װ :@vt"40 0:"``  0%:@&( @v`  9:+: @h@vP#( h@%@vGc@  8< 28:"`` @8%:P@% @v.@D 2@:"`` H@%:h@% @vHL 2H:"`` PH%:@%ΐ @vPT 2P:"`` XP%:@% @uX\ 2X:"`` `X%:@% @uޔ`d 2`:"``  `%;(@% @uʔ  +: ;;9; @ j;@u`X "#` V-?P`t b` 4M@%_ ;@u B|  b` 9 @%L@;@u /`(  b` % @%8@;@uo `p܀  b`  @%$@@u\`  @uU    +: ;;9;7;@ @@ i;@u?a "# U->O b` 4L@$ ;@u A  b` 8 @$@;@u  .(  b` $ @$@@t`p\ b` 4@$ @t   @tܐ   ': ;;9;7;3;@ @@ h;@tŐa0 "#  T,=N t ` 4K@$k ;@t @|  ` 7 @$X@@t`. ( ` 4%@$E @t}  p܀  `  @$2@@tj  @tc`   ': ;;9;7;3;+; @ g;@tKaX "" S+<M ` 4J@# @t)`@  ` 7 @#@@t .( ` 4%@#̐ @tp\  `  @#@@s`  @s`   ': ;;9;7;3;-;+; @ g@sѐa "" S+<Mt  ` I @#w@@s @| ` 48@#e @s.(  ` $ @#R@@s`p܀ ` 4@#? @sw  @sp` 쀒@:"`` ;! @s\ @:"``;! @sM Warning: socket(AF_INET6)ip6 on %s: Warning: ioctl(SIOCGIFSTAT_IN6) %llu total input datagram%s %llu datagram%s with invalid header received %llu datagram%s exceeded MTU received %llu datagram%s with no route received %llu datagram%s with invalid dst received %llu truncated datagram%s received %llu datagram%s with unknown proto received %llu input datagram%s discarded %llu datagram%s delivered to an upper layer protocol %llu datagram%s forwarded to this interface %llu datagram%s sent from an upper layer protocol %llu total discarded output datagram%s %llu output datagram%s failed on fragment %llu output datagram%s succeeded on fragment %llu incoming datagram%s fragmented %llu datagram%s reassembled %llu datagram%s failed on reassembling %llu multicast datagram%s received %llu multicast datagram%s sent x  @Z @@䛐"0@@@rP"0HaS@Aߐ @@䈐"0쀒 :"`` %@@! @r1 2:"`` %@@! @r 2:"`` %@(@!ѐ @r  2:"`` %@P@! @q 2:"`` %@@! @q 2:"`` %@@! @q͔ 2:"``  %@@! @q $ 2 :"`` ( %A@!m @q(, 2(:"`` 0(%A0@!Y @q04 20:"`` 80%Ah@!E @q}8< 28:"`` @8%A@!1 @qi@D 2@:"`` H@%A@! @qUHL 2H:"`` PH%:@!  @qAPT 2P:"`` XP%A@  @q-X\ 2X:"`` `X%A0@  @q`d 2`:"`` h`%A`@ ͐ @qhl 2h:"`` ph%A@  @ppt 2p:"`` xp%A@  @pݔx| 2x:"`` x%A@  @pɔ 2:"`` %A@ } @p@6%node information replynode information requestrouter renumberingredirectneighbor advertisementneighbor solicitationrouter advertisementrouter solicitationmulticast listener donemulticast listener reportmulticast listener queryecho replyecho#103#97#89#60#59#58#51#50#44#43#41#29#22#17#6parameter problemtime exceedpacket too bigunreach#0 %llu call%s to icmp6_error %llu error%s not generated because old message was icmp6 or so %llu error%s not generated because of rate limitation Output packet histogram: %llu message%s with bad code fields %llu message%s < minimum length %llu bad checksum%s %llu message%s with bad length Histogram of error messages to be generated: %llu no route %llu administratively prohibited %llu beyond scope %llu address unreachable %llu port unreachable %llu packet too big %llu time exceed transit %llu time exceed reassembly %llu erroneous header field %llu unrecognized next header %llu unrecognized option %llu redirect %llu unknown %llu message response%s generated %llu message%s with too many ND options %llu message%s with bad ND options %llu bad neighbor solicitation message%s %llu bad neighbor advertisement message%s %llu bad router solicitation message%s %llu bad router advertisement message%s %llu bad redirect message%s %llu path MTU change%s h ?#@9#(@o` :"``4?!C"@ @n?#  2:"`` ?!C#@ @nؔ?# 2:"`` !C#H@ @n?#aА ?cx@?"@#?"#?#b@?"@"?""?#b@?"@"?""?#c P@?"@"Ȑ?""ܐИ?#bؘؒ@?"@"Ԓ?""А?#b̒@?"@"  PX`hp"3C#: @ ",@nTc ,@nNbؤ ?# 2:"`` ?!C#@ @n3?#$ 2 :"`` ? !C#@ @n?#,( 2(:"`` ?(!C#@͐ @n?#40 20:"`` 0!D @ @m!а  +:': @@ ",@mܐb ,@mՐؤ` D@m͐ 0?c  H  :"`` ? D ` @m ?#`P  :"`` ? @D x @m ?#`X   :"`` ? D  @m ?#```  :"`` ? @D  @mu ?#?# `h  :"`` ? @D ؒ @m[ ?#?# `p  :"`` ? @D  @mA ?#?# `x  :"`` ? @D! @m' ?#?" `  :"`` ? @D!0 @m  ?#?" `  :"`` ? @D!P @l ?#?" `  :"`` ? @D!p @lٔ ?#?" `  :"`` ? @D! @l ?#?" `  :"`` ? @D! @l ?#?" `  :"`` ? @D!В @l ?#<8 28:"`` ?8!D!@< @lt?#?#  `@  :"``? @!D"@ @lV?#?" `  :"``? @!D"8@ @l8?#?"ܐ `  :"``? @!D"`@ @l?#?"ؐ `  :"``? @!D"@Đ @k?#?"Ԑ `  :"`#!/bin/sh # $OpenBSD: install.sh,v 1.79 2001/10/14 02:35:57 millert Exp $ # $NetBSD: install.sh,v 1.5.2.8 1996/08/27 18:15:05 gwr Exp $ # # Copyright (c) 1997,1998 Todd Miller, Theo de Raadt # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by Todd Miller and # Theo de Raadt # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # Copyright (c) 1996 The NetBSD Foundation, Inc. # All rights reserved. # # This code is derived from software contributed to The NetBSD Foundation # by Jason R. Thorpe. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by the NetBSD # Foundation, Inc. and its contributors. # 4. Neither the name of The NetBSD Foundation nor the names of its # contributors may be used to endorse or promote products derived # from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE NETBSD FOUNDATION, INC. AND CONTRIBUTORS # ``AS IS'' AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED # TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR # PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE REGENTS OR CONTRIBUTORS BE # LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR # CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF # SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS # INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN # CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) # ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE # POSSIBILITY OF SUCH DAMAGE. # # OpenBSD installation script. # In a perfect world, this would be a nice C program, with a reasonable # user interface. FILESYSTEMS="/tmp/filesystems" # used throughout FQDN= # domain name trap "umount /tmp > /dev/null 2>&1" 0 MODE="install" # include machine-dependent functions # The following functions must be provided: # md_get_diskdevs() - return available disk devices # md_get_cddevs() - return available CD-ROM devices # md_get_partition_range() - return range of valid partition letters # md_installboot() - install boot-blocks on disk # md_prep_disklabel() - label the root disk # md_welcome_banner() - display friendly message # md_not_going_to_install() - display friendly message # md_congrats() - display friendly message # md_native_fstype() - native filesystem type for disk installs # md_native_fsopts() - native filesystem options for disk installs # include machine dependent subroutines . install.md # include common subroutines . install.sub # which sets? THESETS="$ALLSETS $MDSETS" if [ "`df /`" = "`df /mnt`" ]; then # Good {morning,afternoon,evening,night}. echo ================================================== md_welcome_banner else echo "You seem to be trying to restart an interrupted installation!" echo echo "You can try to skip the disk preparation steps and continue," echo "otherwise you should reboot the miniroot and start over..." echo -n "Skip disk initialization? [n] " getresp "n" case "$resp" in y*|Y*) echo echo "Cool! Let's get to it..." echo ;; *) md_not_going_to_install exit ;; esac fi echo "You can run a shell command at any prompt via '!foo'" echo "or escape to a shell by simply typing '!'." echo # Deal with terminal issues md_set_term # Get timezone info get_timezone if [ "`df /`" = "`df /mnt`" ]; then # Install the shadowed disktab file; lets us write to it for temporary # purposes without mounting the miniroot read-write. if [ -f /etc/disktab.shadow ]; then cp /etc/disktab.shadow /tmp/disktab.shadow fi while : ; do if [ "X${ROOTDISK}" = "X" ]; then while [ "X${ROOTDISK}" = "X" ]; do getrootdisk done DISK=$ROOTDISK else DISK= while [ "X${DISK}" = "X" ]; do getanotherdisk done if [ "${DISK}" = "done" ]; then break fi fi # Deal with disklabels, including editing the root disklabel # and labeling additional disks. This is machine-dependent since # some platforms may not be able to provide this functionality. md_prep_disklabel ${DISK} # Assume partition 'a' of $ROOTDISK is for the root filesystem. # Loop and get the rest. # XXX ASSUMES THAT THE USER DOESN'T PROVIDE BOGUS INPUT. cat << __get_filesystems_1 You will now have the opportunity to enter filesystem information for ${DISK}. You will be prompted for the mount point (full path, including the prepending '/' character) for each BSD partition on ${DISK}. Enter "none" to skip a partition or "done" when you are finished. __get_filesystems_1 if [ "${DISK}" = "${ROOTDISK}" ]; then echo echo "The following partitions will be used for the root filesystem and swap:" echo " ${ROOTDISK}a /" echo " ${ROOTDISK}b swap" echo "${ROOTDISK}a /" > ${FILESYSTEMS} fi # XXX - allow the user to name mount points on disks other than ROOTDISK # also allow a way to enter non-BSD partitions (but don't newfs!) # Get the list of BSD partitions and store sizes _npartitions=0 for _p in `disklabel ${DISK} 2>&1 | grep '^ *[a-p]:.*BSD' | sed 's/^ *\([a-p]\): *\([0-9][0-9]*\) .*/\1\2/'`; do _pp=`firstchar ${_p}` if [ "${DISK}" = "${ROOTDISK}" -a "$_pp" = "a" ]; then continue fi _ps=`echo ${_p} | sed 's/^.//'` _partitions[${_npartitions}]=${_pp} _psizes[${_npartitions}]=${_ps} # If the user assigned a mount point, use it. if [ -f /tmp/fstab.${DISK} ]; then _mount_points[${_npartitions}]=`sed -n "s:^/dev/$DISK$_pp[ ]*\([^ ]*\).*:\1:p" < /tmp/fstab.${DISK}` fi _npartitions=$(( ${_npartitions} + 1 )) done # Now prompt the user for the mount points. Loop until "done" echo _i=0 resp="X" while [ $_npartitions -gt 0 -a X${resp} != X"done" ]; do _pp=${_partitions[${_i}]} _ps=$(( ${_psizes[${_i}]} / 2 )) _mp=${_mount_points[${_i}]} # Get the mount point from the user while : ; do echo -n "Mount point for ${DISK}${_pp} (size=${_ps}k) [$_mp, RET, none, or done]? " getresp "$_mp" case "X${resp}" in X/*) _mount_points[${_i}]=$resp brea#!/bin/sh # $OpenBSD: upgrade.sh,v 1.18 2001/10/11 23:14:59 krw Exp $ # $NetBSD: upgrade.sh,v 1.2.4.5 1996/08/27 18:15:08 gwr Exp $ # # Copyright (c) 1996 The NetBSD Foundation, Inc. # All rights reserved. # # This code is derived from software contributed to The NetBSD Foundation # by Jason R. Thorpe. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by the NetBSD # Foundation, Inc. and its contributors. # 4. Neither the name of The NetBSD Foundation nor the names of its # contributors may be used to endorse or promote products derived # from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE NETBSD FOUNDATION, INC. AND CONTRIBUTORS # ``AS IS'' AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED # TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR # PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE REGENTS OR CONTRIBUTORS BE # LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR # CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF # SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS # INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN # CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) # ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE # POSSIBILITY OF SUCH DAMAGE. # # OpenBSD installation script. # In a perfect world, this would be a nice C program, with a reasonable # user interface. ROOTDISK= # filled in below trap "unmount_fs -check /tmp/fstab.shadow > /dev/null 2>&1; rm -f /tmp/fstab.shadow" 0 MODE="upgrade" # include machine-dependent functions # The following functions must be provided: # md_get_diskdevs() - return available disk devices # md_get_cddevs() - return available CD-ROM devices # md_get_partition_range() - return range of valid partition letters # md_installboot() - install boot-blocks on disk # md_labeldisk() - put label on a disk # md_welcome_banner() - display friendly message # md_not_going_to_install() - display friendly message # md_congrats() - display friendly message # include machine dependent subroutines . install.md # include common subroutines . install.sub # which sets? THESETS="$UPGRSETS $MDSETS" # Good {morning,afternoon,evening,night}. md_welcome_banner echo -n "Proceed with upgrade? [n] " getresp "n" case "$resp" in y*|Y*) echo "Cool! Let's get to it..." ;; *) md_not_going_to_install exit ;; esac # Deal with terminal issues md_set_term # XXX Work around vnode aliasing bug (thanks for the tip, Chris...) ls -l /dev > /dev/null 2>&1 while [ "X${ROOTDISK}" = "X" ]; do getrootdisk done # Assume partition 'a' of $ROOTDISK is for the root filesystem. Confirm # this with the user. Check and mount the root filesystem. resp= # force one iteration while [ "X${resp}" = "X" ]; do echo -n "Root filesystem? [${ROOTDISK}a] " getresp "${ROOTDISK}a" _root_filesystem="/dev/`basename $resp`" if [ ! -b ${_root_filesystem} ]; then echo "Sorry, ${resp} is not a block device." resp= # force loop to repeat fi done echo "Checking root filesystem..." if ! fsck -pf ${_root_filesystem}; then echo "ERROR: can't check root filesystem!" exit 1 fi echo "Mounting root filesystem..." if ! mount -o ro ${_root_filesystem} /mnt; then echo "ERROR: can't mount root filesystem!" exit 1 fi # Grab the fstab so we can munge it for our own use. if [ ! -f /mnt/etc/fstab ]; then echo "ERROR: no /etc/fstab!" exit 1 fi cp /mnt/etc/fstab /tmp/fstab # Grab the hosts table so we can use it. if [ ! -f /mnt/etc/hosts ]; then echo "ERROR: no /etc/hosts!" exit 1 fi cp /mnt/etc/hosts /tmp/hosts # Start up the network in same/similar configuration as the installed system # uses. cat << \__network_config_1 The upgrade program would now like to enable the network. It will use the configuration already stored on the root filesystem. This is required if you wish to use the network installation capabilities of this program. __network_config_1 echo -n "Enable network? [y] " getresp "y" case "$resp" in y*|Y*) if ! enable_network; then echo "ERROR: can't enable network!" exit 1 fi cat << \__network_config_2 You will now be given the opportunity to escape to the command shell to do any additional network configuration you may need. This may include adding additional routes, if needed. In addition, you might take this opportunity to redo the default route in the event that it failed above. __network_config_2 echo -n "Escape to shell? [n] " getresp "n" case "$resp" in y*|Y*) echo "Type 'exit' to return to upgrade." sh ;; *) ;; esac ;; *) ;; esac echo "The fstab is configured as follows:\n" cat /tmp/fstab cat << \__fstab_config_1 You may wish to edit the fstab. For example, you may need to resolve dependencies in the order which the filesystems are mounted. NOTE: 1) this fstab is used only during the upgrade. It will not be copied into the root filesystem. 2) all non-ffs filesystems, and filesystems with the 'noauto' option, will be ignored during the upgrade. __fstab_config_1 echo -n "Edit the fstab with ${EDITOR}? [n] " getresp "n" case "$resp" in y*|Y*) ${EDITOR} /tmp/fstab ;; *) ;; esac echo "" # Create a fstab containing only ffs filesystems w/o 'noauto'. munge_fstab /tmp/fstab /tmp/fstab.shadow if ! umount /mnt; then echo "ERROR: can't unmount previously mounted root!" exit 1 fi # Check filesystems. check_fs /tmp/fstab.shadow # Mount filesystems. mount_fs /tmp/fstab.shadow # If Xfree86 v3 directories that would prevent upgrading to XFree86 v4 # are found, move them and replace them with links that the upgrade # can replace with new values. ( if [ -d /mnt/usr/X11R6/lib/X11 ]; then cd /mnt/usr/X11R6/lib/X11 for xf3dir in twm xkb xsm xinit rstart; do if [ -e $xf3dir -a ! -L $xf3dir ]; then mkdir -p XF3 mv $xf3dir XF3/. ln -s XF3/$xf3dir $xf3dir fi done fi ) echo -n "Are the upgrade sets on one of your normally mounted (local) filesystems? [y] " getresp "y" case "$resp" in y*|Y*) get_localdir /mnt ;; *) ;; esac # Install sets. install_sets $THESETS # Get timezone info get_timezone # Copy in configuration information and make devices in target root. ( echo "Installing timezone link." rm -f /mnt/etc/localtime ln -s /usr/share/zoneinfo/$TZ /mnt/etc/localtime if [ -f /mnt/etc/sendmail.cf -a ! -f /mnt/etc/mail/sendmail.cf ]; then echo "Moving /etc/sendmail.cf -> /etc/mail/sendmail.cf" test -d /mnt/etc/mail || mkdir /mnt/etc/mail mv /mnt/etc/sendmail.cf /mnt/etc/mail/sendmail.cf ed - /mnt/etc/rc << \__rc_edit 1,$s/etc\/sendmail.cf/etc\/mail\/sendmail.cf/g w q __rc_edit fi echo -n "Making devices..." cd /mnt/dev sh MAKEDEV all echo "done." md_installboot ${ROOTDISK} ) populateusrlocal test -x /mnt/upgrade.site && /mnt/usr/sbin/chroot /mnt /upgrade.site unmount_fs /tmp/fstab.shadow # Pat on the back. md_congrats # ALL DONE! exit 0  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpxhpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx@HPX`hpx `? @!D"@ @kޔ?#?"А `  :"``? @!D"@ @k?#?"̐ `  :"``? @!D# @j @k?#?" `  :"``  @!D#@@M @kicmp6 on %s: Warning: ioctl(SIOCGIFSTAT_ICMP6) %llu total input message%s %llu total input error message%s %llu input destination unreachable error%s %llu input administratively prohibited error%s %llu input time exceeded error%s %llu input parameter problem error%s %llu input packet too big error%s %llu input echo request%s %llu input echo reply%s %llu input router solicitation%s %llu input router advertisement%s %llu input neighbor solicitation%s %llu input neighbor advertisement%s %llu input redirect%s %llu input MLD query%s %llu input MLD report%s %llu input MLD done%s %llu total output message%s %llu total output error message%s %llu output destination unreachable error%s %llu output administratively prohibited error%s %llu output time exceeded error%s %llu output parameter problem error%s %llu output packet too big error%s %llu output echo request%s %llu output echo reply%s %llu output router solicitation%s %llu output router advertisement%s %llu output neighbor solicitation%s %llu output neighbor advertisement%s %llu output redirect%s %llu output MLD query%s %llu output MLD report%s %llu output MLD done%s x  @, @@m"0@ͳH@j"!0HaT@9 H@Z!0쀒 :"`` %H@ː @j 2:"`` %H@ @i 2:"`` %H(@ @i۔ 2:"`` %HX@ @iǔ 2:"`` %H@{ @i 2:"`` %H@g @i 2:"``  %H@S @i $ 2 :"`` ( %H@? @iw(, 2(:"`` 0(%H(@+ @ic04 20:"`` 80%HH@ @iO8< 28:"`` @8%Hp@ @i;@D 2@:"`` H@%H@ @i'HL 2H:"`` PH%H@ې @iPT 2P:"`` XP%H@ǐ @hX\ 2X:"`` `X%I@ @h`d 2`:"`` h`%I @ @hהhl 2h:"`` ph%I@@ @hÔpt 2p:"`` xp%IX@w @hx| 2x:"`` x%Ix@c @h 2:"`` %I@O @h 2:"`` %I@; @hs 2:"`` %I@' @h_ 2:"`` %I0@ @hK 2:"`` %IX@ @h7 2:"`` %I@ @h# 2:"`` %I@א @h 2:"`` %I@Ð @gĀ 2:"`` %I@ @g̀ 2:"`` %I@ @gӔԀ 2:"`` %I8@ @g܀ 2:"`` %I`@s @g䀒 2:"`` %I@_ @g쀒 2:"`` %I@K @g 2:"`` %I@7 @go@,ߐ %llu message%s received %llu message%s received with too few bytes %llu message%s received with bad checksum %llu message%s received with bad version %llu register%s received %llu bad register%s received %llu register%s sent ` @Ȕ 89#(@g :"`` %L@Ґ @g ̀ 2:"`` %L(@ @fԀ 2:"`` %LX@ @f܀ 2:"`` %L@ @fΔ䀒 2:"`` %L@ @f쀒 2:"`` %L@n @f :"`` %L@[ @f%.*s.tcp6tcpudp6udp%.8s*%d %-*.*sH* \`   *c8  @i@5:!M@b@5!M@Z!p@  @Y;#``Max@< MMa@5 M@pM`.`M!aaM!@`\Ma@2`\   #8  @5p@5kM!@f  ?paЀ %; > "aЦ"P@! 2 ,P@Y . @x`,P %         @^k  "@Y[ . bP@嶐` ",@ `  `   ` `!Ma!!P@d!2!P    ?  ???  ?//''''' /'/ !#\ؐؔ! @q M#7!!P@3!!P$OpenBSD: ipx.c,v 1.7 2000/10/23 19:17:09 mickey Exp $dropresponduseroutputinputspx??? Active Internetwork Packet Exchange connections (including servers)%-*.*s %-5.5s %-6.6s %-6.6s %-*.*s %-*.*s %s PCBProtoRecv-QSend-QLocal AddressForeign Address(state)%-5.5s %-6.6s %-6.6s %-22.22s %-22.22s %s %*p %-5.5s %6ld %6ld %-22.22s %-22.22s %d %sX 'HNbH@`?@ NB#ah'ܨ 7N5N!(`    * *D  a@  0@x h!!`D'*N@dȐ"X(`N@d" ` ?"` * $ @ * \`N"NNbNN#\#h#t"b#`#d#l#p#x  @d%aNNN"bN#\ؔ@d%a\ ND 0cH@d a 8N `H@dy#P@N@dsh@?N@dmcx ` N@db#  *`LN@dZ# ` ?"` * $ @( ܀@ B!D@ \ @QN@d<"P%s: %ld %s%s%s -- %s connection dropped due to no new sockets x terminated due to our end dying dropped due to inability to connect incompleted due to mismatched id's dropped due to mismatched id'spacket dropped out of sequence duplicating the highest packet refused as exceeding allocation initiated accepted established droppedembryonic connection closed (includes drops) where we tried to get rtttime we got rttdelayed ack sent dropped in rxmt timeoutretransmit timeoutpersist timeoutkeepalive timeoutkeepalive probe dropped in keepalivetotal packetdata packetdata byte retransmittedack-only packetwindow probe sent with URG onlywindow update-only packetcontrol (SYN|FIN|RST) packetrequest to send a non-existant packet received received in sequencebyte received with ccksum errs received with bad offset received too shortduplicate-only packetduplicate-only byte with some duplicate datadup. byte in part-dup. packetout-of-order packetout-of-order byte with data after window rcvd after window rcvd after 'close'rcvd window probe packetrcvd duplicate ackrcvd ack for unsent datarcvd ack packet acked by rcvd acksrcvd window update packet  @m O"@bÒW* !O#O"Тb@}OO"@bcW4 !O#O"Тb@kOO# @bcW* !O#O"Тb@YOO#H@bcW, !O#O"Тb@GOO#H@b{cW. !O#O"Тb@5OO#p@bicW0 !O#O"Тb@#OO#@bWcW2 !O#O"Тc@OO#@bEcW8 !O#O"Тc@OO#@b3cW6 !O#O"Тc@PO @b!c< !O#O"Тb@ېPO (@bc@ !O#O"Тb@ɐPO 8@acD !O#O"Тb@PO H@acH !O#O"Тb@PO X@aٚcL !O#P"Т`h@PO X@aǚcP !O#O"Тb@PO @acT !O#O"Тc@oPO @acX !O#P"Т`@]PO @ac\ !O#P"Т`@KPO @ac` !O#O"Тb@9PO @amcd !O#P"Тa@'PO!(@a[ch !O#P"Тa0@PO!(@aIcl !O#P"Тa@@PO!(@a7cp !O#P"ТaX@PO @a%ct !O#O"Тb@ߐPO!h@acx !O#P"Тa@͐PO @ac| !O#P"Тa@PO @`c !O#P"Тa@PO @`ݚc !O#P"Тa@PO!@`˚c !O#P"Тa@PO!@`c !O#P"Тa@sPO @`c !O#P"Тa@aPO @`c !O#O"Тc@OPO!@`c !O#P"Тa@=PO @`qc !O#P"Тb@+PO @`_c !O#P"Тb8@PO"@@`Mc !O#P"Тa@PO"`@`;c !O#O"Тc@PO"p@`)c !O#P"Тb@PO"p@`c !O#O"Тc@ѐPO"@`c !O#O"Тc@PO"@_c !O#O"Тc@PO"@_c !O#P"Тb@PO"`@_Ϛc !O#P"Тc@PO"`@_cĀ !O#O"Тc@wPO#@_cȀ !O#P"Тc8@ePO#H@_c̀ !O#P"Тc`@SPO"`@_cЀ !O#P"Тcx@APO"`@_ucԀ !O#O"Тc@/PO#@_cc؀ !O#P"Тb@PO#@_Qc܀ !O#O"Тc@ PO#@_?c !O#P"Тc@PO!(@_-c䀦 !O#P"Тc@PO!(@_c耦 !O#Q"Т`@ՐQO @_ c쀦 !O#Q"Т`8@ÐPO!(@^c !O#P"Тb@QO H@^c !O#Q"Т``@PO!(@^Ӛc %ld %s%s%s smaller than a header smaller than advertised with bad checksumsh 8@Y ,O"@^Ԁ !U#O pc@iU@^ Ѐ !U#O pc@YU@^ ̀ !U#O pc@IU@^ 㿘a*`  *` *` *` *` *`  *`  *`  *`  *`  *` @#:*`$OpenBSD: iso.c,v 1.7 1998/02/27 12:07:36 deraadt Exp $%s: %d esh sent, %d esh received %d ish sent, %d ish received %d rd sent, %d rd received %d pdus not sent due to insufficient memory %d pdus received with bad checksum %d pdus received with bad version number %d pdus received with bad type field %d short pdus received 㿀 -@   (U@]"pU@]"xU@]"U@]"U@]"U@]#U@]ܐ#0U@]ؐ#`U@]Ԑ#%s: %d total packets sent %d total fragments sent %d total packets received %d with fixed part of header too small %d with header length not reasonable %d incorrect checksum%s %d with unreasonable address lengths %d with forgotten segmentation information %d with an incorrect protocol identifier %d with an incorrect version %d dropped because the ttl has expired %d clnp cache misses %d clnp congestion experience bits set %d clnp congestion experience bits received 㾀 D@ ! ? V@]; hV@]7 V@]3 V@]/ V@]+ !V! @ @]"V@]!@V@]!hV@]!V@]!V@]!4V@] "8V@]"0V<@]"`%s: %u incomplete header%s %u bad data length field%s %u bad checksum%s 㿀 "@   !V#@ @\ِ!V#@ @\А!V#@ @\ǒ%s control block: symbol not in namelist tpprev %p next %p isop_prev %p isop_next %p??? 耦 WW @\0G`@܏ 2 H@S0=WԐ ؒ@\06@ 2 0!!Ԓ@+2 !Ԥ@&'*!Ԓ@  `ߔ ` @ @^ ` ?"`* "@; ԀActive ISO net connections (including servers)%-*.*s %-5.5s %-6.6s %-6.6s %-*.*s %-*.*s %s PCBProtoRecv-QSend-QLocal AddressForeign Address(state)%-5.5s %-6.6s %-6.6s %-22.22s %-22.22s %s %*p %-5.5s %6ld %6ld () *.* x" `N!*W@\"Pa( W@\"p`?"`ࠒ * "@ΐ * \`WWWW ؆WWWW#\#h#p#t#x"⸘"b#`#d#l@[Ҕ $b WWWWWWW#\#bȖИ"@[b$b  \  !*! Wc0@[ ! `WW 8#8@[`Ѐ`;!a  Wa@DPW@[#X`!` lW@[#``!;`l @*6    @ (  @֒ `;!`΀  W`@PW@[q#X0!` W@[g#`0!B`!@*  ! !@  !@ undefined tpcb state: %p %d %-12.12s㿈 @ *`@( h@ ޒ*` ^ -X+*)'X`N;! @ Ȕ! `@[`!(`2    8 6 5 a@   `  @4 !@     `*`X@Z"@Z` ?"`* "@  * @*%8lx tpip㾰;b @ na(  *H@X' * \`"*Y h@Z*a``W`8#8Y@Z`p!W NHL8TP not configured 㿘 Y@Z!80 U@Z"p!"!@ .@u %*sReceiving: %*s%ld variable parameter%s ignored %*s%ld invalid parameter code%s %*s%ld invalid parameter value%s %*s%ld invalid dutype%s %*s%ld negotiation failure%s %*s%ld invalid destination reference%s %*s%ld invalid suffix parameter%s %*s%ld invalid length %*s%ld invalid checksum%s %*s%ld DT%s out of order %*s%ld DT%s not in window %*s%ld duplicate DT%s %*s%ld XPD%s not in window %*s%ld XPD%s w/o credit to stash %*s%ld time%s local credit reneged %*s%ld concatenated TPDU%s %*sSending: %*s%ld XPD mark%s discarded %*sXPD stopped data flow %ld time%s %*s%ld time%s foreign window closed %*sMiscellaneous: %*s%ld small mbuf%s %*s%ld cluster%s %*s%ld source quench %*s%ld dec bit%s %*sM:L ( M mbuf chains of length L) %*s%ld: over 16 %*s%ld: %d %ld: %d %*s%ld EOT rcvd %*s%ld EOT sent %*s%ld EOT indication%s %*sConnections: %*s%ld connection%s used extended format %*s%ld connection%s allowed transport expedited data %*s%ld connection%s turned off checksumming %*s%ld connection%s dropped due to retrans limit %*s%ld tp 4 connection%s %*s%ld tp 0 connection%s LOCAL, PDN LOCAL,~PDN~LOCAL,~PDN~LOCAL, PDN %*sRound trip times, listed in ticks: %*s%11.11s %12.12s | %12.12s | %s CategorySmoothed avgDeviationDeviation/Avg %*s%11.11s: %-11d | %-11d | %-11d | %-11d %*sTpdus RECVD [%ld valid, %3.6f %% of total (%ld); %ld dropped] %*sDT %6ld AK %6ld DR %4ld CR %4ld %*sXPD %6ld XAK %6ld DC %4ld CC %4ld ER %4ld %*sTpdus SENT [%ld total, %ld dropped] %*sRetransmissions: %*sCR %6ld CC %6ld DR %6ld %*sDT %6ld (%5.2f%%) %*sXPD %6ld (%5.2f%%) %*sE Timers: [%6ld ticks] %*s%6ld timer%s set %6ld timer%s expired %6ld timer%s cancelled %*sC Timers: [%6ld ticks] %*s%6ld inactive timer%s cancelled %*sPathological debugging activity: %*s%6ld CC%s sent to zero dref %*s%6ld random DT%s dropped %*s%6ld illegally large XPD TPDU%s %*s%6ld faked reneging of cdt %*sACK reasons: %*s%6ld not acked immediately %*s%6ld strategy==each %*s%6ld strategy==fullwindow %*s%6ld duplicate DT %*s%6ld EOTSDU %*s%6ld reordered DT %*s%6ld user rcvd %*s%6ld fcc reqd B㿀%'YYa@@!Y!@@ `!Y!@@` !Y"@@`!Y"8@@`!Y"X@@ِ`!Y"x@@͐`$!Y"@y@` YbЖ@`!Y"@f@`H!Y#@Z@`L!Y#(@N@`X!Y#H@B@`P!Y#`@6@~`T!Y#@*@r``!Y#@@fa!Y#@@ZYc@T`D!Z @@H`@!Z @@<`\!Z H@@0Z`p@*a !Z @֐@a$!Z @ʐ@aZ`@ a!Z @@Z`@Za(a@a( %Z/Z, @, @ , #`#\(@a  $, alaZa@@ԐatZaX@͐ap!Z@z!p@Za@`,!Z@h!@`0!Z@\!ؔ@`4!Z@P"@`!Z@D"@@a|!Z@8"x@ax!Z@,"@sZb@mZchZ#x#\#`ZZZc #HcX@]aa"   a#d#\#`@K `dZ`h# `a' " B[cd'􀢠"" Bą"?  `<#`#d#\@`#[``Ħa`̢`#\#`@ `![` 0`Ȗ`#\`#`#d@`l[`8`p@````#\#`@````#\`#`#d@ܐ[`@֐`t[`|``x#\@̖`[` `'  B[cd' "" Bą"?  @#\`[``a' b B[cd'􀢠" Bą"?  @|#\`Ԣa[a@s`@!'[`@0`@+[`ܔ#h`ؚ#``#\#d@[`[ax@T`@a`@1[`@!`#h`#``#\#d@<`)[@@1[a@+a"@ؐ@ a-[@͐@a0@@ a[bX@[bx@a[b@a[b@a[bЖ@a[b@a[c@ڐa[c @Ӑa[c8@̐[aĐcP@Ŗ{}[]<>㿘 _@J   2    2   "   W`  @7P 2   "   _ ` @ @&   _ `   @ @ @`?"``ࠒ * "@< %s㿘@ $#X@ "( .@*`  :  ** *@ *@_(X"8X*@T4*$OpenBSD: main.c,v 1.27 2001/08/26 09:42:04 brian Exp $_ipcompstat_mclpool_mbpool_mif6table_mf6ctable_mrt6stat_ip6_mrtproto_pim6stat_ipsec6stat_ipsecstat_icmp6stat_ip6stat_etheripstat_ddpcb_ddpstat_ipipstat_espstat_ahstat_ipx_errstat_spx_istat_ipxstat_ipxcbtable_viftable_mfchash_mfchashtbl_mrtstat_ip_mrtproto_igmpstat_file_nfile_cltpstat_cltb_rt_tables_nimp_esis_stat_tp_stat_tp_refinfo_tp_inpcb_clnp_stat_ns_errstat_spp_istat_idpstat_nspcb_unixsw_rtstat_icmpstat_imp_softc_ifnet_udpstat_udbtable_tcpstat_tcbtable_ipstat_mbstatipcompetheripipencapespahigmpicmpipudptcppim6icmp6ip6spxipxns_errsppidpesisclnpcltptpddpAabdf:gI:ilM:mN:np:qrstuvw:inetinet6localunixnsisoencapatalk%s: %s: unknown address family %s: %s: unknown or uninstrumented protocol %s: kvm_open: %s %s: %s: no namelist %s: no namelist %s: no stats routine 㷘@%'D*   " X# ('A;;9*7*5*-*1` 8c* @€ *"`\ "( "ax B"``@Ҵ ` $X`@ҫ ` $X`@Ң {``@Ҝ u``@Җ ` z$X`@ҍ ` q$X`@҄ ` h$X`@{( ` _$X`@r0  V$X 8`` @톒c8@  BI"b` )$pC"d @$p ;<"a:` ;6"4` 1'c@E`    8`` @[cX@ΐ *"c< '#@ *":b` "b` &  $X  &8@` %D$p@wD@7"؀?C?* @@b @ `" @@ %D@Z $p`@  ``   @/M@/S@/I@/W  @B  "( 8` c@@d @/1@/7@/-@/;Bb(@J    2;   8` c@Ж0 8` @ɒc@< a * "x@"l@2 <     * @*`  0` @Q#@ @Ð @ p "**cD P@ c܀  :"``@Q t0@!@ B 4:"``X  *!X@y!L* X  H@o<0  *!|!L!d@!p* X  `<@eT@Ȑ X  % @m @ 0!@  @  2     @@m @lX   Xa@  2 X   XP@~  2 X   X"@n  2 X   Xb@^  2 X  :` 2X"@6`X   c@B  2 @C   T          ,D                  dt     4L X㿘:"``  * b* `@  * b* `@    * X` %s: %s 㿘!B"(@ۃ  8#"(`!c@"8@V?s c_ es c_ 㿘c0 c0@      2 㿘  @k@@kΐ 0 @   2@k 2`@kѰ usage: %s [-Aan] [-f address_family] [-M core] [-N system] %s [-gimnrs] [-f address_family] [-M core] [-N system] %s [-n] [-I interface] [-M core] [-N system] [-w wait] %s [-M core] [-N system] [-p protocol] 㿘#! `8cc@껐`8d`8@궐`8d`x@걐`8d@ꬒ`@ $OpenBSD: mbuf.c,v 1.8 2001/05/18 02:41:38 provos Exp $socket optionssocket names and addressesfragment reassembly queue headerspacket headersancillary dataoob datadata%s: unexpected change to mbstat; check source %s: mbstat: symbol not in namelist %u mbuf%s in use: %u mbuf%s allocated to %s %u mbuf%s allocated to %lu/%lu mapped pages in use %u Kbytes allocated to network (%d%% in use) %lu requests for memory denied %lu requests for memory delayed %lu calls to protocol drain routines 㿘#a  8d @ b0  : 8d @bH0"d" ; a 耢 ) cp 耢 #T` ` ); @`* ` !d"p@N#T` :;"c 1d@*` *& @* k`@N"`` 2@㔐  @ %#:"#%d,``㔑,`@  K@N㔢`@&,`cp %d Т$@ D@ K 4@Nq@4 @* 4*@  @ :#@   @ 4" @,`* * @% d`"c@NI:` d d@ND#  d@N@#@d @N<#h%lu%c㿘  # k2  m21#eȐ@9 ip_mrtproto: symbol not in namelist no multicast routing compiled into this system multicast routing protocol %u, unknown mfchashtbl: symbol not in namelist mfchash: symbol not in namelist viftable: symbol not in namelist Virtual Interface Table %s%sVif Thresh Limit Local-Address Remote-Address Pkt_in Pkt_out %3u %3u %5u %-15.15s %-15.15s %6lu %7lu Virtual Interface Table is empty Multicast Forwarding Cache %s%sHash Origin Mcastgroup Traffic In-Vif Out-Vifs/Forw-ttl %3u %-15.15s %-15.15s %7s %3u %u/%u Multicast Forwarding Cache is empty Total no. of entries in cache: %d 㶰 'He@Mb#00ג$ $``e@MW#X0e@MR#0H e@MJ#0e@MD#0;f@M> 0#x' "#ڔ(    ;f9f/f+f)f  #.2  (H@M`p   @H @M f` @; f  @M $*`2   ְ D2Hf@L H    `R N  .`@ `?`9f/f-f+f)f2!(@LДX (q P0@ @LĐa4@ \8@L! @:#f.2  "@La*`2  @La(`'@ ff@L!0!@L@La;"#mrtstat: symbol not in namelist multicast routing: %ld datagram%s with no route for origin %ld upcall%s made to mrouted %ld datagram%s with malformed tunnel options %ld datagram%s with no room for tunnel options %ld datagram%s arrived on wrong interface %ld datagram%s dropped due to upcall Q overflow %ld datagram%s dropped due to upcall socket overflow %ld datagram%s cleaned up by the cache %ld datagram%s dropped selectively by ratelimiter %ld datagram%s dropped - bucket Q overflow %ld datagram%s dropped - larger than bkt size X e@K#00 ``e@Kߐ#X0ve@Kڐ#0q`g@KӐ!0ju 4g@K̐!!g!@KÐ!g"@K!g" x@K!g"Po@K!g"f@K!g"]@K!g"T@K!g#(K@K!g#XB@K{!g#9@Kr!g#0@Ki$OpenBSD: ns.c,v 1.5 1998/02/27 12:07:38 deraadt Exp $dropresponduseroutputinputspp??? Active NS connections (including servers)%-8.8s PCB%-5.5s %-6.6s %-6.6s %-18.18s %-18.18s %s %-5.5s %-6.6s %-6.6s %-22.22s %-22.22s %s ProtoRecv-QSend-QLocal AddressForeign Address(state)%8lx %-5.5s %6ld %6ld %-22.22s %-22.22s %d %s8 Ƹh@bx`?! T!|@ T!|@7* ;ha(     *  *  at  (` xk h2~#%`;!*h@J"a(`h@J"` ?"`* $@ * \`hhb@J \ h"h"h#`#\ h(h0h#8hc@h@JP% \ "!h#h@Jy! `h 8@Jr#p@C@Jmc@>h@Jgc*x ` h@J\# *`Lh@JT#` ?"`* $@" |  T @Zh@J7"%s: %ld %s%s%s -- %s connection dropped due to no new sockets x terminated due to our end dying dropped due to inability to connect incompleted due to mismatched id's dropped due to mismatched id'spacket dropped out of sequence duplicating the highest packet refused as exceeding allocation initiated accepted established droppedembryonic connection closed (includes drops) where we tried to get rtttime we got rttdelayed ack sent dropped in rxmt timeoutretransmit timeoutpersist timeoutkeepalive timeoutkeepalive probe dropped in keepalivetotal packetdata packetdata byte retransmittedack-only packetwindow probe sent with URG onlywindow update-only packetcontrol (SYN|FIN|RST) packetrequest to send a non-existant packet received received in sequencebyte received with ccksum errs received with bad offset received too shortduplicate-only packetduplicate-only byte with some duplicate datadup. byte in part-dup. packetout-of-order packetout-of-order byte with data after window rcvd after window rcvd after 'close'rcvd window probe packetrcvd duplicate ackrcvd ack for unsent datarcvd ack packet acked by rcvd acksrcvd window update packet  g i"@HW* !i#i"cwii#@Hc0W4 !i#i"ceii#8@Hc0W* !i#i"cSii#`@Hc0W, !i#i"cAii#`@Huc0W. !i#i"c/ii#@Hcc0W0 !i#i"cii#@HQc0W2 !i#i"c ii#@H?c0W8 !i#i"cii#@H-c0W6 !i#i"cji @Hc0< !i#i"cՐji @@H c0@ !i#i"cÐji P@Gc0D !i#i"cji `@Gc0H !i#i"cji p@GӚc0L !i#j"`ji p@Gc0P !i#i"c{ji @Gc0T !i#i"ciji @Gc0X !i#j"`Wji @Gc0\ !i#j"`Eji!@Gyc0` !i#i"c3ji!@Ggc0d !i#j"a(!ji!@@GUc0h !i#j"aHji!@@GCc0l !i#j"aXji!@@G1c0p !i#j"apji!@Gc0t !i#i"cِji!@G c0x !i#j"aǐji!@Fc0| !i#j"aji!@Fc0 !i#j"aji!@Fךc0 !i#j"aji!@FŚc0 !i#j"aji!@Fc0 !i#j"amji!@Fc0 !i#j"a[ji!@Fc0 !i#i"cIji!@F}c0 !i#j"b7ji!@Fkc0 !i#j"b0%ji!@FYc0 !i#j"bPji"X@FGc0 !i#j"aji"x@F5c0 !i#i"cji"@F#c0 !i#j"bݐji"@Fc0 !i#i"cːji"@Ec0 !i#i"cji"@Ec0 !i#i"cji"@Eۚc0 !i#j"cji"x@Eɚc0 !i#j"cji"x@Ec0Ā !i#i"cqji#0@Ec0Ȁ !i#j"cP_ji#`@Ec0̀ !i#j"cxMji"x@Ec0Ѐ !i#j"c;ji"x@Eoc0Ԁ !i#i"c)ji#@E]c0؀ !i#j"bji#@EKc0܀ !i#i"cji#@E9c0 !i#j"cji!@@E'c0䀦 !i#k"`ji!@@Ec0耦 !i#k"`(ϐki 8@Ec0쀦 !i#k"`Pji!@@Dc0 !i#j"bki `@Dߚc0 !i#k"`xji!@@D͚c0 %d %s%s%s smaller than a header smaller than advertised with bad checksums㿀 8S i"@D耦 !o#i cco@D 䀦 !o#i cSo@D  !o#i cCo@Dy Ё too large to be forwarded forwarded too many times while gatewayed Refused due to lack of space at DestinationPacket at SocketNo ListenerBad Checksum at DestinationUnspecified ErrorNS error statistics: call to ns_errorerror ignored due to insufficient addressingerror request in response to error packetserror packet received incomplete received of unknown typeOutput Error Histogram: Input Error Histogram: 㾰   o@C" !o#o bo@Cޘ" !o#o bo@CΘ" !o#o c o@C#0p !o#o cPxo@C#`l !o#o cPho@C#x Ъ)o,` ",`@C# ,``@+`,`  %o,`@ ",`@C{ ,``@`,`in transitat destinationUnknown XNS error code 0%ox *` * c ` 2``p!p"p@V   !o @C1㿘` 2`  2` 2` 2` 2`  @C2` $OpenBSD: route.c,v 1.42 2001/10/09 09:21:10 brian Exp $Routing tables rt_tables: symbol not in namelist Netmasks: p@B#*`\    |` @y Bp@B#08b,   !*'p% .  &y t  X`\ "  X 2 @BƐ@G  2 @1 $x@0@@4  ֑. InternetInternet6XNSIPXISOX.25EncapAppleTalk %s: Protocol Family %d: 㿘?`q"<*` €q!q!q!(q!0q !8q !@q!Hq!P `q@Bd!`0q!h@B_ŨŴ%-*.*s Address%-*.*s %-*.*s %-6.6s %6.6s %6.6s %6.6s %s DestinationGatewayFlagsRefsUseMtuInterface㿀* \`qq"⸒ @B q  ";#`  "   ;#`q "q  ";#`     ;#`q qqqqqq#c# c(#\#`#d#h#l#p@AК%-*s %-18s %-5s %-18s %-5s %-5s %-22s SourcePortProtoSA(Address/Proto/Type/Direction)㿐* \`rq x@A r rrrqr#\ ``@A 㿘!" 6 "0%-16p (root node)%s => 㿘%*#*  T `K`\ r!@Am `\ 8r `!r!r!@A[ ,  x`!*" @`\  @N    @\ ,`?"`ࠒ * "@      0    x`r@A!@$ `` mask (%d)%6.6s %16p : %16p %d refs, mk = %16p {(%d),%s ->㿘*# T#   r@@#`W  @?``_%0!A#drp @r#x@@Ւ`%?A)*r#dc#-r+r l  @אU# 8 r#@@   @̖?` }?"``* $@y } `@@c`͒`?"` * $@b route-sysctl-estimateout of space sysctl of routing tablex   ?''''   @? s@!@  @ /ܢ 2s@@S!@ ؐ   @( 6s@!@ ʐ @ @  %-6.6s 㿘 L% `" $ 2    @; $  @5  L ?  M@ P  @(  s @b`?"`ࠒ * "@Ӑ defaultlink#%d%s%x: %02x%02x%s  x?`t#*` €  `@@X`s# ? ?  ? ? & 2`@7` @@Ȑ@y|    2  s @ꥒ m  " `  s @ _c+s)t?$@ꍔc? : `@H@D@I ? z $rp @k: 2*:)+t)t?$@W`   2?$@F    2 ߐ?;t @?0#`r x@?0q"@?  P0000000000000<0000,МpR 4Ѐ`  4R@"` `*`R@ *@>ے %6d %8ld %6ld %6s - %.16s%s => expire %10lu%c recvpipe %10ld%c sendpipe %10ld%c ssthresh %10lu%c rtt %10ld%c rttvar %10ld%c 㽐 @p  (   @g  2 @\0 " @X  (  @O     4;#`  "  0   ;#`"    ~  4slb 8u t@>X P T`u@>R ` Puu h@>K`p P   L ``?"`` `* $`@   @!  c˔  @$ u `x u s#@> ``?"`` * $`@ *#8`+u P \   L `  L d  L#\@= Pu h Ȁ   L l@  L p  L#\@=ِ%u.%u.%u.%u㿐` 'D"`!@ƒ! 2 ,a@ . @H;,a;#` D @6I  @ג . a@ ", #`@4 , D! 22v#\X2 ` @蜒! %u/%d%u.%u/%d%u.%u.%u/%d%u.%u.%u.%u/%d㿐;#`   `@ڹ  2`" @>& !"@ #b@ , 6` `!v 6 "@^!*" `!6 v 6   !6 6 v#\6  `"@D!"!6 6 v#\#`З6  `"@5!"illegal prefixlen invalid%s/%dp`    ' `' '  ' ''' E @C`@ + 3` "$  "  `` " `"  "   ` 2 `  ` ``2+ + `@ Ĕ  ` `䀢  `耢  `쀢 `1s&#v @׭c@;#`2 !#\ؔ! @~ vX@眒!1#v`@瓒!㿐  !!#\ Ȕ! @` s #, ȁrtstat: symbol not in namelist routing: %u bad routing redirect%s %u dynamically created route%s %u new gateway%s due to redirects %u destination%s found unreachable %u use%s of a wildcard route 㿀 w@<'"03ʔ w@㿈 7 7 77  // 7 7 7 7 //Xx"p@  " %-18s %-5u %-18s %-5u %-5u %-42s %-5u %-42s %-5u %-5u %s/%-u/require/acquire/use/dontacq/permit/deny//in /out / 㼰 @  0 @  0 0h@  0ʀ  !y!ڒ@:!y!ܐ@:ʀ 2@jx@Ȓ X@Ē   /Y/y/X/x@ ɔ ` @ Ē!y"@9@ @ /y/x/Y/X@   @ !y" Ȑ@9j ilr А #\  @糖!y@9"8:y@9"@9`%*`z" €y@9"Hy@9"Xy@9"hy@9"py@9" y@9"y@9"`  y` * *y@9}"02 `` ` y yy@9k"0@9h"<P( J(8f4 a* J TP_CONFIRMING(0x8)TP_LISTENING(0x7)TP_REFWAIT(0x6)TP_CLOSING(0x5)TP_OPEN(0x4)TP_AKWAIT(0x3)TP_CRSENT(0x2)TP_CLOSED(0x1)ST_ERROR(0x0)T_ACPT_req(0x18)T_NETRESET(0x17)T_DETACH(0x16)T_USR_Xrcvd(0x15)T_USR_rcvd(0x14)T_XPD_req(0x13)T_DATA_req(0x12)T_LISTEN_req(0x11)T_DISC_req(0x10)T_CONN_req(0xf)XAK_TPDU(0xe)XPD_TPDU(0xd)DT_TPDU(0xc)AK_TPDU(0xb)CC_TPDU(0xa)DC_TPDU(0x9)DR_TPDU(0x8)CR_TPDU(0x7)ER_TPDU(0x6)TM_data_retrans(0x5)TM_reference(0x4)TM_notused(0x3)TM_sendack(0x2)TM_retrans(0x1)TM_inact(0x0)$OpenBSD: unix.c,v 1.6 1999/12/08 12:30:17 itojun Exp $Out of memory (file table). Bb(!X  @# #{@8!(00 *` *   "c$"㠤 h T  ( `   `  (@L㠠 0* seqpacketrdmrawdgramstream#0Active UNIX domain sockets %-*.*s %-6.6s %-6.6s %-6.6s %*.*s %*.*s %*.*s %*.*s Addr AddressTypeRecv-QSend-QInodeConnRefsNextref%*p %-6.6s %6ld %6ld %*p %*p %*p %*p %.*s( 綔 8 h `  笔! 2  'D '{@7"{{{{!{ # #\{{{{#h#t###""b#`#d#l#p#x#|#@7ה $DV!,*`   `{ 8#(`#x`#\`#p` #`#h#d#l#t@7 { #P@7 `?"`* "@} ????*%hu㿘`` ?#@2 1| ! 1| !(1#|0@⛒ 2bcast%d㿘` `  2 11| !1| !(1 `#|@} 2ddp%s㿘   ;#1|!(1|! ` !| @}b 2 !|  @W 2  !|( @O 2 %d-%d㿘   !|ؐ P@? 2 P| P@8 2 P%s.%s.%s㿘```7* } *` €/,!|"(i!|"(@ 2`!|#8Vr@ 2 `!|"(@ 2`"@1@. 2$@!|#@p@|888888888888-%s㿈` !| 7`"( ` @᷒ dc c" `?#@` 27 d!}$ ؒ`n@ᘒ   c" 2` d!|$#@V@ဒ`Active ATALK connections (including servers)%-8.8s PCB%-5.5s %-6.6s %-6.6s %-18.18s %-18.18s %s %-5.5s %-6.6s %-6.6s %-22.22s %-22.22s %s ProtoRecv-QSend-QLocal AddressForeign Address(state)%8lx %-5.5s %6ld %6ld %-18.18s %-22.22s@ 'H弔  !0@ H/}-};}9}5}7}3}夔 H |*!`< `4)* s!#`7!*}@5"a( }@5"8`` ?"``* $`@{ * \`}bP}@5ʒX \ }"`}"}#\}Ȓb"И@5$ \ }#@5!``c`8@5H \` 0 !@@5 \` 00| @5`` ?"``* $`@{` %s: %ld packet%s with short headers %ld packet%s with long headers %ld packet%s with no checksum %ld packet%s were too short %ld packet%s with bad checksum %ld packet%s with not enough data %ld packet%s forwarded %ld packet%s rcvd for unreachable dest %ld packet%s dropped due to no socket space p Ĕ $ ~!@5Ѐ !~:"``4 !~!ΐ@5Ԁ !~:"``4 !~!佐@4؀ !~:"``4 !~"䬐@4 !~:"``4 !~"0䛐@4Ԓ܀ !~:"``4 !~"P䊐@4Ò䀦 !~:"``4 !~"xy@4耦 !~:"``4 !~"h@4쀦 !~:"``4 !~"W@4 !~:"`` "G@4mroute6pr: symbol not in namelist no IPv6 multicast routing compiled into this system IPv6 multicast routing protocol %u, unknown mf6ctable: symbol not in namelist miftable: symbol not in namelist IPv6 Multicast Interface Table Mif Rate PhyIF Pkts-In Pkts-Out %2u %4d %5sreg0 %9qu %9qu IPv6 Multicast Interface Table is empty IPv6 Multicast Forwarding Cache %-*.*s %-*.*s %sOriginGroup Packets Waits In-Mif Out-Mifs %-*.*s %9qu %3d --- %3d %u IPv6 Multicast Routing Table is empty  @3ؐ!0G#?blx ``g@3ː!0:@3Ɛ"05`@3"H0.;@3"p0(?h ? " Nbx  b/-%  '? ؀`. @3☪ .  2`@3 `"0@֒#@3  (  @3w *`2  ? Ҡ ``@3j# $  *``?cpc`#  `73;@3O#Ha`#p㨀    'a  '㨀   a`#㨀    a  㨀  #\@3#` a`#㨀    'a  '㨀   @3a`㨀    a  㨀  q@2`#Ȓ @2ߔ   3|    @2ϐc8?#@@2Ɛ#?@2#?c   3. 2 2 *  ,@  @2c *`2  @ @22M `$>*``@2 @2`?h$㨁mrt6_stats: symbol not in namelist multicast forwarding: %10qu multicast forwarding cache lookup%s %10qu multicast forwarding cache miss%s %10qu upcall%s to mrouted %10qu upcall queue overflow%s %10qu upcall%s dropped due to full socket buffer %10qu cache cleanup%s %10qu datagram%s with no route for origin %10qu datagram%s arrived with bad tunneling %10qu datagram%s could not be tunneled %10qu datagram%s arrived on wrong interface %10qu datagram%s selectively dropped %10qu datagram%s dropped due to queue overflow %10qu datagram%s dropped for being too large ( ᎔ ``g@1!0@1ܐ"0`@1Ր!x0w h@1ΐ!!ጠ!@1Đ!ጠ!@1!x"@1!n"8@1!d"X@1!Z"@1!P"@1!F"ؖ@1~!<#@1t!2#8@1j!(#h@1`!#@1V!#Ȗ@1L㿘@unionsoftdepsynchronousroot file systemread-onlywith quotasnosuidnoexecnodevnoaccesstimenoatimelocalexported read-onlyanon uid mappingNFS exportedkerberos uid mappingexported to the worldasynchronousffsAadfo:rwt:uvonly one -t option may be specified.rorwrqnoautogetmntinfounknown special file or file system %s.can't find fstab entry for %s.%s: unknown special file or file system.%s has unknown file system type.:@nfs/var/run/mountd.pidr%dsignal mountd㿀@۠ #   75B# (%/B+2'쀢 8-*  @€ (  %&"`J@ @[ 4 c@, @` `@  % ?@@vc?ː?b * & ^@   0406.`? @8  @2  @, @   @  @     @g#\ 2 @« 0@  @`@G  @} D "@!@4 @@Z@@D@ '@`(@ @ž T 2& @`P@ ) T@‘@  @w@ @`p@  @  @   @ " @`@l    #\ 2`@@XȀ  @@ 2`@#\ @@`&@G !`@  @  @$ ?  (`x a@GR @@ t x       ,㿘N@ n N` o `@ # n J` o  `@}ђ "   @}ʒ 2 `?  @?c 2J@@/usr/sbin/sbinrealpath %s/statfs %s%s on %s type %.*s: %s already mountedforceupdatemount_%sexec: mount_%s %s fork%s/mount_%sexec %s for %swaitpid%s: %sX@ `#   O@   @@y`@ \@( %@⭒ Ԣ@ Z @  B"Ȁ` `8n@.n  @A`H@:c@@2`PX$@d'h $'@KB* $  '* $  * '$ @.0 h  6 #,  @.%`x , @. o @n?  0.@F( @ _ #;9 (5$`@@ 4 x`@F  2 ( x` @F@m @@!J @E +   >  B0"  !@* @F B"Ȁ` @ے  @E˰ 0@k %s on %s type %.*s%s%s (, %sunknown flag%s %#xsv3v2udptcpsofthardintrnoconn%s%s=%dwsizersizerdirsizetimeoretransmaxgrouplistreadaheadmfs%s%s=%lu %ssizeadosfs%s%s=%u, %s=%uuidgid%s%s=0%omaskmsdosshortlongnowin95gemcd9660norripgensextatt) 㿐  T !@-? DB>bȮ *   !a @-+ "8` D#3"8 `-+)@`  2 a !(@- ,@`  뀌@`!0! !(@"!H  @,`@ܐ !!! !( "!P!X@,Ґ   @H~ !! !(@,  !! !( !`!h@,   Ȥ!! !( @,p  " !! !( @,x  @" !! !( @,v  Ȥ!! !( @,eȀ  !! !( @,OȀ  $!! !( @,9Ȁ  (!! !( @,#Ȁ  , !! !( @,Ȁ  0 !! !( @+Ȁ  4!! !( @+Ȁ  8(!! !( @+ϔa@ @1>!! !(!!x@ݠ"@+b@ 7Ȁ  ! l  p "! !(  l  p@+"(Ȁ  t̀"0! !( @+s@bH@_ {Ȁ  ! l  p "! !(  l  p@+M"(Ȁ  t" x"0! !( @+8@ x !! !( @+'P x !! !( @+X x !! !( @+` x K!! !( @*h=@bp 7! l !! !( @*ڔx l !! !( @*ɔ l !! !( @*" @*㿐@w  @6  @  @ T `@! 㿘"4  b`?  #B@    2b@ empty type list㿘 N  nb@  BN  oBB "b "" %  @t , ` @*  $4 @B$ $@ , `$@  @] , 2*@, $@%s,%s㿘 L@ @u@r @  @A @`@`@-o㿐@'!%  -, &@ =  ,  .&`@ѐ  ,  c, &&  @B^ 2N&@usage: mount %s %s mount %s mount %s [-dfruvw] [-o options] [-t ffs | external_type]special node[-adfruvw] [-t ffs | external_type][-dfruvw] special | node㿘` a @ġ @ ufs%s: fstab uses outdated type 'ufs' -- fix please%s: fstab type %s != disklabel type %s㿘 @^`Ѐ  @|`Ȁ 2( @Ԓ "" @M   @Ga 2 c@@ 2 @A!  !@A  ,-o %s: option not supported㿘@  @A 1' n L  o  @J = 2*`"@w֐ 2   @2    &*@&bȔ@  @8 2L@㿘@㿘@ @㿘@㿘ߠ x ?R$  x @ 4  H @ x0? @ x  @2 x   x@"`  x@V}?`  x"  smcuprmcup㿘 ` $`"4$0T!܀ )3! `$!a8@@!! @n 0 3! $!a@@,!! @Z @ `@`' !  @F !@@ @   x@" x"`@ 㿘 `$@! "&"X K"""X 2 ! n  !!,""X    !"X$"&@ "X!&@ 㿘$ c @힔 1 !̀ " !! *` * 8`0 @v 0@Ue 0 " !! *` * 8`  c @n  㿘@T`x8`?߆x"?P"@x"?P" H@ "@㿘%߀ /@ & x`?R@x?R4@x@H ? @U ?x?  @& x@Ux@Ӓ?8`?㿘 ` $`w! @Y !!`l"Ԑ @D @J ! `?"``ࠒ * "@m !@/ 0F!    ?`&  @  * $ @m<     ?`&  @  * $ @l<  `?"``  * $ @l֐ @자 0@I 㿘`x@H 8`? ` $ ` `"  *`?"" Error: move: l(%u) c(%u) o(%u)㿘 Hx@@T?   Hx@  㿘  $a ``|@1 @T`x8`?xterm]0;%s㿘  \ $!  aH@  !`&!!P@&@" 0 !` &!!P@&r @  `   $&@$ !"@   @! @  !bT  @P  x`?R@`x?R"Ԕ `x@Ts@T`x`x@n   @Fx !@d  @ݐ !`" ! ?$$! `x@nn `x@TMf    @Ā    "   $a" %susage: ex [-eFRrSsv] [-c command] [-t tag] [-w size] [file ...] usage: vi [-eFlRrSv] [-c command] [-t tag] [-w size] [file ...] 㿘 c@TERMunknown]0;%s㿐@Bc  "c@@@_!B@x$#8@> p 2@ x@@@* $`\$``@@   @p "@  $`D$`H`$`8$`<   @U@֒ @  @@2@؀  `? @  @%m@ @ @ @@㿘@)ݒ / 2  @{( 2&@W &/dev/ttytcgetattr㿘 @e!䰒 2$`$@@A $`$@ "hT!"&! $hT!" @!?"@0" @ ?@!?@@b@ @~@ѐ%s: No terminal database found %s: %s: unknown terminal type 㿐 @qx?  0 c@@k  c@@c B8  $ ᤄ  B8$!@"!B8  $ ᤄ B8$!"!signal-reset㿘`4 $ 3B&c<H@T! 2&c< &c<l @I! 2c< &c< @=! 2c< &c<!̔@1  ", @ ' H @$ l @  @   @  @V  㿈'''@1㿘 $ !@)  !@%  !@! !̐ @ 㿘3579;!#%')XaH̶㌸ |` 8aȖ ` X`X !D&(&(X&(\&(`&(d&(l&(p&(t&(x&(|&(&(&(&(&(&(&(&(&(&(h&(%s:%s 㿘 c@`@ (`x!@#Ȕ@@f 㿀  $! @ !`@ $! X&` U&`$   N&`! I&` >$! @䀢 <   @  2&` @p#'#@R* "@*`@*`'0!@$`!*` € &`&` &` &` &`@ AAA@D@|input`$!" @ 2'    ??p?x?' 'pp 'p  @7 ? `0 `0, @ÒȀ 2(T`  ̐ '''''''Ԅ '''' @KT  @E!\T @  ?pp??x?'p p3@ d"`2`*@ `.  #@ 42d  @ј ?$ p@* @L] Ű 06 @`2d!  1$! ! .'  ( x`  @ `   ?` "' !*'$! `  @Δȁlines=%lucolumns=%lupР?X''''$@͖@א'@ 2 h$@ͅ@Ɛ'@s @ 㿘 (T   $@j 2e (T ?$(T`$`2[ ``2V $  ?&$$  &$ ! H  4 x@Pk @  x 4  H@ x@Pb@P| x)@ 2. a $a$`"' a"# " " " "  *` 8* ? @ @    @]  a ? $a 㿘 $!  # @ 2 ! ""2!@ 2 ! "" @ 2   @!! $!016|Vi's standard input and output must be a terminalTERMLINESCOLUMNS%s%s: unknown terminal typetcgetattrtcsetattr㿘  $a a\"@   @   >@ 2 #耊 " ## * * `8@! @В @t @" "  * * `8@ؒ @a @!` !X * * `8@@Q `! ($ x@; ` x  @3 e @+ ]  @Q`Ȁ @LЀ2 @G j@N!@N@j x@i  x@ie  $aܒ @ǐ  @a\ @ + a"$a\"$a\a$"aha\$$a\ah  $ah,a~,aw,au,av,a{,az@ 2 a\ @   @Ӓ  @ 0 㿘! $ @i x!` x @N  x@ ? x @N@O  x@@@&!܁ cupsmsormsoelcuu1㿘  $! K!0"N`@Y!`@T!`@O!a@J!a@E!!` ! 2! `@w $!! "! @p$!! $!8!!$!@!$!D!$!H!a!! %!$$!L!($!P!,$!T$!X$!<$!0$!4!0 @   @F  㿘 $@# 㿘@c " @ "  @  & @&  @珔 㿘! "!@&!! "!@&!! "!@ &!! "!@&!! @&!%lup`  (@@ S SSSRRRRRRRRRRRRxRpR`RXRPR@R8R0RRRQQQQQQQQQQQQQQxQpQXQPQHQ8Q0Q(Qcursor upkkcuu1cursor rightlkcuf1delete to end of screendGkedscroll upkripage upkpppage downknpcursor lefthkcub1delete lineddkdl1insert at cursorikich1go to sol^khomego to eol$kllscroll downkinddelete to eolDkelcursor downjkcud1delete characterxkdch1insert lineOkil1RSRQSQQ0SQQPSQ8lakahaja㿈 `%  @ "@H@E@B#\#`#d@K 2  #(`0)   @ " ! !ܢ`@ 2``"@@`#\#`#d@ 2_  #8`"B   -@ 4"3@ ". @@#\#`#d @@ѐ@#\#`#d@    !D " $     @=  2 $ 㿘!D`  `$ @@a 2 `$ 㿘$    " @ kf%d233|This terminal has no %s keyfunction key %dH#c @j @@!@,  " @Z ` ` !(@6  #H@j@ @ ?8 ?@= #d#\#`@E㿘 ` $`>` `" (T0,`I"0' (T`"(T$  &$  @0`?0   "  0 " ```   stderr%s046|messages not turned on: %s045|messages not turned off: %s8@"'    <@@u 7 @ȅ 6a؀ .(H     &a؀@ג` 6 P?c @Ȑ 6  p@?  TERMlinestigetnum: linescolstigetnum: colsLINESCOLUMNS㿐  '`h @캔?  `1 ` 2q'0oi" " " "  *` * 8 0YW!` " !X!X *` * 8@ ܀0G@؀0C`( @p" ! `@Ԑ" 6 @ђ `` @Đ"Ȁ 6 @  " `" P@E"  @o @<"耢  @o 2&2& 㿘 `? "`` *:   * # @bh 㿘  `C  @  2 @ @" ` `  "  (*@ `" ` ` (*@  ` !@ $ `      2   @" @ 1 !$  @O  2,  @   $ $  a@ $ !@"` "a@ !@$  @B $ ,  "  , @8>  ?@ ^`@/ @"  ?@ I  ?@ >`@ @  @~ ,   "! " `2  1 ( `e 1 !@  `  }  z  2s  m  @ΐ , $  㿘 !@) ?π` "h*` € 2* 3* 4* 5* 6 * 7 * 8* 9* 2  `"  "` "@@ @Qaaaaaaabb 㿐 @x 2(  @F    "" @ْ@&  & &  2 ' "'     ' 㿘!@  "@F `"  "` "@@!@ 2 !,!,@0㿘 @ <  @  & @縐 &  @Ք   `@Ґ  @{& 㿘@& "`@&"@@ 2㿘  @@禐002|Line length overflow㿈/ @  ' @x\  d d@& d  (T`Đ  @u;   (T`@? ' @y 2      @w쀢 2  쀢@`? k @'' @x _ d d@\& d  (T`  @t   (T`@? '@ @wr쀢 2s    `T! ' @5耢 !x t@)x "Q &ttx'T!&T@``@@x * < @ 2Q` @w/쀢 20    T!"x ' @耢 ޤ` t@x " &ttx'T!&T`@W `" `@M`# @@xk" נ ՠ 6 @vݘ 2ް    !T!"x ' @耢  t@x " &ttx'T!&T@ @v쀢 2 쀢 [?@W"  @:       T!"x/''   "TtTx >&T  t@Cx "k &ttx'T! &T@2耢  `@禔" "@ @@wĔ 20 @ '' @v # d d@& d  (T`  @s   (T`@? '     ` `thT >"hT@姐script 170|Interrupted㿘`@a "lܰ  `x   `"  "` "@@{ @yl 2T ! $$?#a( *  p+$d @i 2 @&@  $d@ @2d`L@̔ d $d@< a<`"a4a4`*` * 8@2 @ b ` @ b  8bؑ*` * `Tb؀ T "T :@\8 2Y `(T`  @r–   `(T` a @;@;͐ @ `x` 2` $$$`$ $@ "`T 2% `(T`  @r  2T`(T` T "T @a0T 2&dV & !#&*<=>@~080|Unknown command name1bca1082|%s: command not available in ex mode083|Count may not be zero084|%s: bad line specification085|Internal syntax table error (%s: %s)lr086|Usage: %s088|Flag offset to before line 1089|Flag offset past end-of-file090|@ with range running when the file/screen changed091|Global/v command running when the file/screen changed092|Ex command failed: pending commands discarded093|Ex command failed: mapped keys discardedx  |` "`` %`%`@ @v` L  ѐ & P`*@$`` @   %` ``* $` $``   3@`Q`@$`@z 2 T` $` `` $`$`` &:`J   %` `$`  2`  :` ?  $```$`J`:"``  "`?  $`` $`J  2``J 2|` `@ ?$`$`y$`"`` J`?$`  $`J "` "``   $ `("`@ !  3 |` " /'L``   *`J` *$` @    쀢 2`` u ` J`?$`  $`J "` "`:"`` ] `J`|X` V@` ؀   ``?$`$$`` `" @ ` "` ``$``$`  `2``2 L * : I #* €c0! 'JL   'JL L l p + - ^ ##0``"@! $`0!Ę!!`$!$`!$`!$`$$`($`,$`4$`8$`0a$` `(+   ,@  T$` L k s0> <``?`$`$`@$` ?L  L c" g" r"#0`?`" $$`($@$$`$$$`$$`$`$$`,$`0$`4$`8$`($`  a*  ,@ Ɛ`` !@$ `$` ` ! " H !Ӏ"#X "#P#P *` * 8`2  @_ `# `0L < `02&` L >! `+ `: `J@2```$``$`J"``" @ 2S`` #`@  "@$`@2`%`(`*@"$` ``(``@$`$@2 ` $`` L`$`d P$`h` $`" """ *` * 8`2` ` " ``@`| b$`4`|@*@$`$  ` $"` $` >$``` !  @  $`@h@@v8``"``J !2 ``|!$`4`|$`$``  5` J`$`` $`J "` "```" ``J +2``$`$`:``@ J 0  'S ` 0 'R @n  `` ` $`$`J    "`,`` $``$`ʨ `$`֮"@x@P@0X` ` 5`J\ `` J  $`$` J`%`  $`  ,`` $``$` @Ȁ@:' 5``?`$`$```  J   '쀢~!2}`` #h@쀢 "t`J "p```$``g$`J 2`b`@ ]5`  J`$`` $`J "` "``"  `*:  |2`#0$$`($$`$$$`$$$`,$$`0$`4$`8$`(($` `%$``$` `J \2 ```$`$``J@ "`` $``$`2`` `J@ @ Y```@ J 04  'S ` 0* 'R &@l " `  `J ` '쀢`|2%, 2 ` %` `$` ` ` $`$`쀤 |2, 2``  $``? $`,`` $``$` ```$ "`$`` $` $` $`   L \",` `c`` 050 `` "  "`l~@$`` $`@qْ耢 2`耢 2 L`$`d $` L$`d Pd$`h$```p$`d_$`h] 0( & @ $`$``  $`l@q`l 2```   `l  `$`$`d$`d`$`p $`6$`h "*`d2 20` ` $``$` L 2$`d @q耢 2`耢 2  L`$`l $`$`d L$`d$`l P$`h $`p `h$``$`l$`p 2` ` 0@,  $`` L`$`d#4   L#, *` * 8 #,$`l P$`h$`p@qE耢 2\`耢`" `  L@(` `l 8$`l` $`\ L`- !2``""`J@ !2`|`!$`$`4`| "`` J`$`` $`J "` "``  ϑ* : Fݘ "ԓ* €` ?#`J ^"`\ l +"`\ - #"`٤" `\դ p"`|Ϥ $`\?$`\`| b$`4`|`(" %`(`|$4`|`(d 4`|`(@ %`(`` $``$`` "`J ."`| = + -" `| ^" `|   @`| ( L 32`| 4`|`` $``$`y`J + - ^ #2 `@Z 1 2h`"  ` 2_``|?`,`Q$`$`T4`|` b ` L +2H*:  + -2A`J - +`| 2``| 4`|`@ 2G䀢 L 0*``"@ " $`$`L a `l`p$`d$`h ?$`l$`X`|  4`|`@ ـ @a u쀢 ܀ `@oƐ $`T ` #H@ ``?@ Q ``'``?``@ J 0  'S ` 0 'R @jW  `  ?`$`$` ,  2 ,`` $` $``` $``$`$ @  2`` "` ` J`$`` $`J "` "`` "` `'``6!``@J"`",   'S `"`, 'R @i 2,`  ?`$`$` ,,`` $``$`$ @  2U`]```@ KL NQ?'L o`$ "J`` 2>` E``` a ` *` *  !X@+ :`@i@w L  ` `? $`" ``J  $` ` 2 ` @bYa " ```  @w ``` ( 2@$`l```2`d$ 2` @2`d` ֔ @n 2`d`| ʐ@n耢 2`$`l`d`` $ 2` @2 $`  @nn $ `@B@=<``  21``l L   '`# " & L& P@ P``d L   `  " & L& P@n P``$`$`@ L  P''`* $` '@vM 2\`$ "  , & ,  $@2`@n` @" `   "`$ "`T 2`@2|` 0@2`|€ ` *@$`` `€ 2T (T`2T  @iu  2$ (T`" $T " `$$&$ " @x?  "&$`\""$ L @ٔȐ8   @ `@ @m 2 LƔ L`\ & L$ G  C L ?`|`:! @4`|`@@<`|! @4`|`|"@ $@ ! "!! *` * 8`2`  ` @2   L''@/ 8`@J?`"`!` ?   'S `"`` 'R *:`@g 2 `` $`*` $```"$` @ܭ$``@$```$`$`$"Ȥ   |`# `P`"*` € 2@ 2 @P @u͒ @@#@`2 `P pn$"@2y'|@@u ```@v `  @Ֆ ` @ϔ ` 2@`` "<`! `J` @$` 0  'S ` 0 'R @gZ  ``` $` $` |2 `` 8 $```? $`` |@" @uP @v@jA  Ȑ@uD  '%$*@&$t$tl@lll@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@X@@@@@@@@@@@@@4@@@xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxw094|The second address is smaller than the first㿈&`  &``` @ ?* : `2r ؓ*` €`@2    @k`l ǖ `l` `@ `?&`d&``&`&`&`p&`h`@2հ    "!``` " L  " L`" `l` &`d P&`` &`h`p&`d&`h L &`l P&``&`p`J`;2``` "`d  `" `l `@٥& L`h& L`p& P` `?&`9&`@ޘ 2  쀢 - \`` "   ` ` &`d&`h&`` &`l&`p &```l&`d`p&`h&`l&`p ` 2O``@2M ;`` "2 L   02"&`l.`` L&`d P&``'&`h  @ .   @  (   @ ! !   @  `p&`d&`h L &`l P&``&`p`` 2 `d`l p@s  & p$0123456789'\/?.+-^095|No mark name supplied096|\ not followed by / or ?097|Reference to a line number less than 0㿈'&`* &`  2``J@!     @t '` @ ?ܑ* : `8!T*` € &`@&`&@js 2 `` ? &` &`` @ޔ @? z'&&``""@&`&` &``  &`@r _'`J @q "`T'` &`j&`` K  / ?" `@rҒ  ` ?&`&`K `/2;:#T;" L@& P&`` ` p!p#\ m  ``" " &`&`&` )&` & P& L 2&@iߒ "  "`&`  `b  ` ++` ?&`&`` Ơ `J "` 2```?&`  &`J` "`` "``  `  b `2 *:  + - ^2 2 ` & L& P&` &`` `J "` 2```?&`  &`J` "`` "`` i`  ` 2 *:  + - ^2Y  `2`  `2 `+2? ``?`&`&`J@ - ^ ``?&`&` ` @2  ` " $   ` $ :  { `$``" " &`|&`  "    @q ^ 8   S @& |㿘$*@ &$|@2 ``@n @I`i$` 2g `P "A@`<`<  @@ $`@"` @$`<"@@&`<2 2,`H `P `D`@h+ " `D@hU L " L+   & L@`H@`"``"``@"@@|`L   @נ$``L$` & L$`D`$  `P $ &$ 㿘 `|`"1`| P ` < <@@`& @"`@& <"@ս  <@2@@շ H`"  "` "@@լ`|2 P`|"  098|The %s command is unknown㿐    (T!" x ' @ 1(  t t@ x %$ t t x'(T!$(T,@@ @q   ` `t@hT >"hT@U㿘@$    @%@ 㿘@J?`!  @   !H@`?㿘c0 c0LJ@4 2  @   2 099|Address value overflow100|Address value underflow101|Illegal address combination102|Illegal address: only %lu lines in the file103|Illegal address: the file is empty104|The %s command doesn't permit an address of 0㿐"      @o 0:,h)  ` @@Q 0('!. €@f @o 0@o 0 @@ @o D \d105|No abbreviations to display106|Abbreviations must end with a "word" character107|Abbreviations may not contain tabs or spaces108|Abbreviations may not mix word/non-word characters, except at the end㿈`x  "`t0 @ 2q @o5 j @ԋ@` ?✒@ ` 2 @`_R@ "@  B  @ `"  ` _2    ` _   @ `  #\#d@L#` 2  hT  "hT(@n̒  109|"%s" is not an abbreviation㿘 `t(T @@`@˖ "  @x@o  㿘@ 㿘@ 㿘@  273|Entering ex input mode.㿐    `  @P` 0`d & L`22``d `d`l   2Ѱ Ɩ  2ɰ ` C`%    2? 2$ $@&   .2  ?@dS  }`  ?  P@dD n` ǖ 2&`&`$@u``&蠟€  `  @O 0o$!2  ``&$!X@) @sa`@)!X@)@)Đ`|!! "!! *` * 8`2!< "!<!< "!4!4 *` * 8`2@  @  ?''@Iߔ  @```@cʒ  `@@2`` & L@d   & L 111|No more files to edit㿘`x `(   2`XK `!"`|`x 2`( @ʐ@  @R}@}y a@[  r `x Jd@2d`$ " d@F  @@`$d* $d$`(`x @a   $`$  @m,I `t `"$@ $ `  $`$$`(@R d $d `(@R d@  2`|!  $ @S_    "d`( $`(d ($d㿐 @ 3 @7 `t@R  `|2 @S2  @5 @ 0 @"`("`$  "$@ $$$ 112|No previous files to edit㿘`(`$@2 `@l 5 !"`|@@ ' @o" a@Zה   `(@RZ  `|!  $@RԔ   `( d($d$`(113|No previous files to rewind㿘 $ 2 `|8@lF !  a@Z  2  $& (@R" " `|!  $@R 2 $ &$ 114|No file list to display %s%s%s[]㿘 $ @l 0Q   H)'-@X (  8@ ?@   @'#0  (" ( @'8 ( #@ #HP #XP @'` hT   @^  2  (T`  @'j#0 㿘` `x @֒   @k `2`t@@5 &  @ `"$@@$ $`@`  $㿘  @Y$ $ &`t $&`x 㿘 @N $ *  @ $ *` * $ * "` $  $ $&`t $&`xx    (T!" x'' @m" "e '쀢!  t x@a" "Y $ t t x''(T!$(T#\#`#d'@ʚ    ` `thT >"hT@ /  @ @  J@  J@ "` "`@ y   ` `thT >"hT@א  echo x  ` (T!" x'' @" "̰ '쀢!  t x@" 2$ t  t x''(T!$(T X X*@  *`  *` *` + '#\#`#d@5 2  3@y  R  4@y  K cp " chch`* * `8@N    " ` J?  ? # N@vw  0  %N   @ `2 ? @v`  ?   ?'N * .@@]  @` `` `thT >"hT@ 㿘z "xN N " ""j )`N  0  'S ` 0 'R  @[     ؤ@$*@ " @ ))`" @L@ "` @   'S `"` @ 'R  *:`@[a 2 @` @,`ܠ ,$ $$&`t$&`x 115|No previous command to replace "!"116|No filename to substitute for %%117|No filename to substitute for #㿐\`@d'@+N #"`  % ! '`@ \'`"`  @І'@    "(T t(T x >@  '(T t x@C " ' t(T ta x' '(T@ @1 ӠN  @O'@    "(T t,@@:'@    "(T t(T x >@  '(T t x@ " ' t t x'(T! '(T@ @ @\`@@&`(`N % # !2`'`    "(T t(T x >@  '(T t x@ "^ ' t t x'(T! '(T@ @ B, "'`   `"hT`thT`x >@  &hT`t`x@~ * &`t`t`x'hT!&hT@@l  @@h)   ,'@%` "㿘 ` `$@&"`` @,  @&,  $` @h `2` @e? * @ P$` `,   @ ` "@ @g ``!`  #$  $ @̬  @ $ @gŔ   $ , $  @g   , `,@   @ؐ ` "@ @g ``, "`㿘   "& $  @ ,``"  ` " @̄@ @́@ `@& @z & $& &  ./%s304|Shell expansion failed㿘@ / !  ! ,@έ @Ω@z 2M$@h _ 2  L  .? @Γ@Ύ@ 4@* -@ `$`*` @Ȕ`M / /, `@ͺ$ *` " $`$$' t$' x@| @{$@  .` "$@|  @f  㿘@@@~289|Shell expansions not supported when the secure edit option is setpiperfdopenvfork-c118|Error: execl: %s119|I/O error: %sx'D#X'H'L 'P#P *` * 8`  DDcP DH/  cd  Dc\`* * `8@'#\'@ / '' 'H?@'L'@''@  D @fa @`  'D@fT @3 D@fC 쀢 "@?"@î? @è @ @â@à@Þ @ Dܖ@ga @Ð @ÍC쀢`9D     t@L(T >&(TL x*`  x t@,D "Z & t t'L x"(T!&(T@*  D@L "E 'L@"@'. ?'`? "`@'@  "@䀦( .N?  2.?.P"@H"` @@N  D@f   D @*q 2 N  N " "" ``D@e{ `@ 㿘`|  @`Q ` @ *2 . $ @2  9 . " $ ` &$ ` (+ @  `  !@     2  +  * !X@ @Vk @G  0^@R 4`<$`<$`@ @J  ,``d " `P"   `P`l " ,`P`<"`@"$`@"`$`<    `   @ϑ.` $` @d " $`L$`H*   @˒  @ .@ ` `| $@`|"  "`|  |$` !!%s 303|File modified since last write.! 㿀`t@` 2  `  @F 0  @ɨ@t(@ $  @d  `@$@2```@`x@ ``@`@ @ \`` L  > X ";$!$ "!! *` * 8` $T  @Sb  "#$m $T "$L$L *` * 8`2$$ "$$@2 $`@i\ $ @`?@(b:$ 2 ``  @F 09 `d @`&``l 2@@[g쀢 (  2@&`l&`d @`d`l#\@ $ & L& P@_ P$& P$ @2 @` 120|File modified since last complete write; write or use ! to overrideHOME121|Unable to find home directory location%s/%s122|New current directory: %s%s㷘  `X "`x`|!2`x  J@/@c  `x  "#`t0$@2 ( L @@    "J  0@c k @@@Ð 2`x_ V`t `/"P  `.H `.2 !H  .2 !H  /; :!H " !@!@ * * `8@ ')`N@ @ :2`(`.@@V.@@{ 2N@@ (  h@dr   N@ ږ`@df   V0ܴUpXPH Bx%1pX@8B1txXP\H( h "xXP8X0LB(xBp8#XpPH#X0P( &@hXP/P01xp@Bh8IUN4B`80IFdJtxX( US,HV0XH@S4H0S4HT,hX(@_8q_`1HxH@T0iXHHH kL~h`8X80(HHLB(xtpX0(żpƴxp`H@ 4H0X@I0xXP/$H(,!X#X8 p$$`0($$`XdP(Hreplace previous RE with previous replacement string,[line [,line]] ~ [cgr] [count] [#lp]~display different screens of the file[line] z [-|.|+|^|=] [count] [flags]3c01zcopy lines to a cut buffer[line [,line]] ya[nk] [buffer] [count]bcayankexit[line [,line]] x[it][!] [file]xitwrite the file and exit[line [,line]] wq[!] [>>] [file]wqwrite the file and switch to the next file[line [,line]] wn[!] [>>] [file]wnwrite the file[line [,line]] w[rite][!] [ !cmd | [>>] [file]]writedisplay vi key usage statement[viu]sage [key]viusageedit another file (from vi mode only)[Vv]i[sual][!] [+cmd] [file]enter visual (vi) mode from ex mode[line] vi[sual] [-|.|+|^] [window_size] [flags]2c11visualdisplay the program version informationversionexecute a global command on lines NOT matching an RE[line [,line]] v [;/]RE[;/] [commands]vdelete an input or command mapunm[ap][!] word!w1runmapdelete an abbreviationuna[bbrev] wordunabbreviateundo the most recent changeu[ndo]undorun the tcl interpreter with the commandtc[l] cmdtcldiscard all tagstagt[op][!]tagtopmove to the previous tagtagpr[ev][!]tagprevreturn to the previous group of tagstagp[op][!] [number | file]tagpopmove to the next tagtagn[ext][!]tagnextedit the file containing the tag[Tt]a[g][!] [string]!w1otag[line [,line]] t line [flags]tsu[spend][!]suspendsuspend the edit sessionst[op][!]stopread a file of ex commandsso[urce] filef1rsourcesuspend editing and run a shellsh[ell]shellset options (use ":set all" to see all options)se[t] [option[=[value]]...] [nooption ...] [option? ...] [all]wNsetrun a shell in a screensc[ript][!] [file]scriptsubstitute on lines matching an RE[line [,line]] s [[/;]RE[/;]repl[/;] [cgr] [count] [#lp]]re-edit all the files in the file argument listrew[ind][!]rewindgrow or shrink the current screenresize [+-]rowsc+resizerecover a saved filerecover[!] filerecoverappend input from a command or file to the line[line] r[ead] [!cmd | [file]]readexit ex/viq[uit][!]quitappend a cut buffer to the line[line] pu[t] [buffer]putedit the previous file in the file argument list[Pp]rev[ious][!]previouspreserve an edit session for recoverypre[serve]preserverun the perl interpreter with the command, on each lineperld[o] cmdperldorun the perl interpreter with the commandpe[rl] cmdperldisplay lines[line [,line]] p[rint] [count] [#l]printenter "open" mode (not implemented)[line] o[pen] [/RE/] [flags]openchange display to number lines[line [,line]] nu[mber] [count] [l]numberedit (and optionally specify) the next file[Nn][ext][!] [+cmd] [file ...]!fNnextwrite a .exrc filemkexrc[!] file!f1rmkexrcmap input or commands to one or more keysmap[!] [keys replace]!Wmap[line] ma[rk] keymarkmove lines elsewhere in the file[line [,line]] m[ove] linelmovedisplay lines in an unambiguous form[line [,line]] l[ist] [count] [#]listmark a line position[line] k keykjoin lines into a single line[line [,line]] j[oin][!] [count] [flags]!ca1joininsert input before a line[line] i[nsert][!]insertdisplay help statementhe[lp]helpexecute a global command on lines matching an RE[line [,line]] g[lobal][!] [;/]RE[;/] [commands]globalbring a backgrounded screen into the foreground[Ff]g [file]fgdisplay (and optionally set) file namef[ile] [name]filedisplay ex command usage statement[exu]sage [command]w1oexusage[Ee]x[!] [+cmd] [file]exbegin editing another file[Ee][dit][!] [+cmd] [file]f1oeditdisplay buffers, connections, screens or tagsdisplay b[uffers] | c[onnections] | s[creens] | t[ags]w1rdisplaydelete lines from the file[line [,line]] d[elete][flags] [buffer] [count] [flags]bca1deletecreate a set of tags using a cscope commandcs[cope] command [args]!scscopecopy lines elsewhere in the file[line [,line]] co[py] line [flags]l1copychd[ir][!] [directory]chdirchange the current directorycd[!] [directory]!f1ocdchange lines to input[line [,line]] c[hange][!] [count]!cachangeput a foreground screen into the backgroundbgdisplay file argument listar[gs]argsspecify an input abbreviationab[brev] [word replace]Wabbreviateappend input to a line[line] a[ppend][!]append@ [buffer]@shift lines right[line [,line]] >[>...] [count] [flags]>display line number[line] = [flags]1=shift lines left[line [,line]] <[<...] [count] [flags]<execute a buffer* [buffer]b*repeat the last subsitution[line [,line]] & [cgr] [count] [#lp]s&display numbered lines[line [,line]] # [count] [l]ca1#filter lines through commands or run commands[line [,line]] ! commandS!scroll lines^DD ,h( lDiscard all current cscope connectionsresetkill numberKill a cscope connectionkillhelp [command]Show help for cscope commandshelpfind c|d|e|f|g|i|s|t buffer|pattern c: find callers of name d: find all function calls made from name e: find pattern f: find files with name as substring g: find definition of name i: find files #including name s: find all uses of name t: find assignments to nameQuery the databases for a patternfindadd file | directoryAdd a new cscope databaseadd309|Use "cscope help" for help㿘 $8   @l " $8_  ,$8`t@ " @ `      `2"7" @ ` 2 L   `"L , L  "@ `   L  @ `2 @ 2  @ZĒ  CSCOPE_DIRS :㿐@@ "T @      (T!" x`' @~̖ @  t x@~ 2$ t-  t x'(T!$(T`@1'# @!@ ` 2J   ` `thT >"hT@` %s/%scscope.out8 @`x 2 `x@ @gby @@< q `t,  @B @Z( a <  2"80$@1@& @Z  E @ / .@`@` @*`8  4 @Y /  $ @$ $ @. @  $" $$ @ @>   @ː cscope.tpath%s:8`˜ 0(@ϐ@Ē Q@` &`, @Y \  @ `,@4@Zؒ  G @C @`, *@ `,:2`J` 2`J@  @@  #&`(`, `@ "! & @   @h` &`, @  &`(`,  "@`,  @L&`,pipevforkcd '%s' && exec cscope -dl -f %s/bin/shsh-cexecl: %swr㷈?''''D'H'L@o @j耢 D@Y @vH?"`  0DD@Y ?"@v?"@p耢?"@j쀢?@ @d@⪒ @⧒ @⤒ @Z@XH L(@–bȘ @▐"D”@Z @r @< @:Hb"$@ HH"` ’b @"H"`310|No cscope connections running%d%s 278|No matches for query㿐 ` 2 @Ð@X     @ $$  @ , % % 2$ " $$@ ~   L  P` !`?` '+ a@k @ @?  @H@1>` 2  2  Ð@X4 R $ ``|! a @.M <   @. 3@2 $$`2@$`" $@@$ $`2@$`" $@@` "  "` L"  P"`" "` "  @  @ sgdct efi311|%s: unknown search type: use one of %s㿘`SN@N@ "` "`N@ FN`  A&J    &L`"LN@@2L 2N`@Ė `  (* *  !X@*`:`@HҐ`@W n `L  "  " L  "@bY ) L  % L  ""  `  (*@  `  !@ `     2  @ @n`#  @W; @.&& & *`& @ݔ@ *` . cscope: %d lines%1[ ]%s: "%s" x@c= '*@`8 @V`@>X( Ēc @.  ??'`@>C(  @c '``? "`@1``@  "@ 2`*@' #"   "   @@  @9cH 値  Z耢 U`"T@@m܀ 2  Đ@nP   .@`@`@  ; ( $ @( / *@  ' @`@$  $  $ $  @ $  $$ &"@&  &??_'@  @V=  ` `  ( "`x`@Wv @  8`( ""'%$0@5@* 2 &@n'`   '@ 2'㿘@"%s doesn't match any cscope command Command: %s (%s) Usage: %s cscope commands: %*s: %s 㿘`N@ `@ 2 Őc@\#  c@U Ő@Pc `@K`( `(3 ` @?   2 㿘@:M@  312|%d: no such cscope session㿐 `` ``@ 2@`2 `Ɣ0@Uy * ` "` @` "`@`@ה @`"``"``@"@`, "`(@[`( @U@S 1㿘   " #Ɛbh "    No cscope connections. %2d %s (process %lu) 㿘   Ɛ@b0  %  @ ` 㿈 2$@L! 2` ' #\ '' @s ` @.6 0  "& & L & P@y@ P 㿘@9 (` (@oG   2 㿘``? "`@``@  "@>2`2` % `? "`@` >` @`">``? "`@` ` @`" 2` 㿐  2 `|`  @6[ 0&  `Q`d`l  2 ̖  2 `d& L@K " L  8& L buffersconnectionsscreenstags㿘`t `c" `s`b"  >`  `t", 8` 4ǐ @,b` 2/` @@0 'ǐ @bh 2"` # ǐ @bx 2` @ ǐ @b 2` @+w`  @5ؔ 123|No cut buffers to displaydefault buffer㿘 a@ 2  a 2 ǐ@Sג 0\!@ "( # b 2  @@]  (T`D  @F|  2 (T`8 2  !@ "' # b   @@4  (T`  @FS  2 (T` 2  ! ǐ@ ********** %s%s (line mode) (character mode) 㿘Ȁ!``*` *  !X@@D` !Ж!@ܐ``3% & ` *` *  !X@@Do@ hT   @E   (T` ޴@͒2 㿘`x  "`t0       @8 7  @@8 . `t @B#`@@`!@`|@A a 2 `|!,@9;  $ ($$ 㿐 @o = @ `|2 @9 @ @pn 0# "` ""`   `2 L"`L P"P֒ "`("`$$ &$&  %ld 㿐  2 ``  @4Q 0@ @I   `d'@ a 㿘  2 `x`  @4/ 00 ) %`t@ @v 2`!  `@Am@5``?#? @`6`&`   h @z L@T  piperfdopenvfork-cexecl: %sfilterforkwparent-writerp'L'T'`'D'P'X"'ܐ "D 3@` ? ''''\  '@* D8@"耢 D 8@c@  'DH@Q’ @#(?DP@Q ?"@#?@`@|E 쀢?"@쀢?: @ ؀?"@M @J @G ?"@?@@@D d` D\ * * `8@Dc\@ / D d  D\ * * `8@Dc\D d  D\ * * `8@Dc\ XX@ D d` DD\ * * `8@c\Dɖ`@Rs @Ր @@\`'@cpDL@͚   'D\`\D "\L TT" "D  `X @M*`X? 0$Dɒ @Px @['@YkD@U@c 2 @ #`DcpL#\P@5D @u@?\ @kD  'cpDP@o   'D\ "\D @~   '܀`T\TD L P   L PD  'T` D@GD DT@?"@D `X *`X\  Dd @ DX@= 2 ܀2 filter read㿐   @ s 2` @0 2`  (T`  @B  2`, (T`"`,` @ː0@P+ @zϐ 㿘`|2@ 㿘@ 124|The %s command can't be used as part of a global or v commandppp  2 $`  @1ܔ 0I@ ` @@O > `x "` `t@ "  "  " ` 2 ` \|   `  @1 02   \ 2 *  *   ꀢ \ " * @   2$ @1~  @2 L Đ #\   @ؚ " Lٰ #\"   @̚ 2ϰ  &  L P '' '@NĔ 2  @ `<$`<$`@`t@$ " '˒ #'@1*  $` @ON  ؒ  $`H@$`L `P$`D  ,`P `| $@`|"  "`|  |$` `l`d@z d( (T`2@  @Aߖ   (T`@`"``"``@"@@ `@ U@pj  d @DV؀  ؘ    ??ܐ @|   0 "/` `@"*``@@!`@ @ $  @   @Nǔ " $ $ $`@$ `<@2`@$`<"$`@`@(@p  㿘``@2  [  @N U  |"Q P G<<B  : @ `2`? $ -$ $<2 ?@%$ @ $@$` @"@@m@  $` `$` $ $@$`2" $@$2 $D2 P 㿘 @q$< 2&`$$ $  $ $    "@] $  @N)   @&+   㿘 2$$ @@ @9@ w 2  , " @  @@' 2 @& 㿘`= @'M/etc/vi.exrcNEXINITEXINITHOME%s/%s.nexrc.exrcΠ   @~  2  @Ɛ 2   |`"$Γ$&2 ΢ @@ " @  @ H  @/ " @ @ 7 @ "5 L 0΢8 (Θ 0$@ @,  "    Δ 8$@ @  2  @` 2[   |`"$-$&2O ! "!! *` * 8`? ;΢ 08 @ "%   8 ΢ 8 @՘ 2 8@<@ @ "    |`"$$&  X#\   5  @-w@Q@-@㿘 `| ` @  2`| @Lؔ 3  $`|" `|$`|$ ` $ $ `2 $ @q] $  `$ $ @@qM $    $ $  125|%s/%s: not sourced: not owned by you or root126|%s/%s: not sourced: not owned by you127|%s/%s: not sourced: writeable by a user other than the owner128|%s: not sourced: not owned by you or root129|%s: not sourced: not owned by you130|%s: not sourced: writeable by a user other than the owner㻐@`  @` "` `" ``  `?`   w @Q@XX / ?`@$ 7@Q~`  ` ϔH @L ϔx @K -   ` `thT >"hT@`  `  @KԖ ϔ @K̖    ` `thT >"hT@ 131|No following lines to join.?!㿈 2 `d`  @- 05@B  А@K )   "'(T!"  x' @o! `|   t x@o! "  & t t x'(T!&(T`| "`d`l &`l`d`l@2`d`&`l`d `l   쀢`   "(T t(T x >  &(T t x@oo "а & t t x'(T! &(T @o] L `|!I쀥  쀢 ?J 쀢 9'`0'J "쀢 "(J`)#А @W* ",@,`` ,@` ` J'` 'J "쀢 "쀢 @@ @J?@  $@?"$P " ?"$P  @@쀢 ]&`l`d$L`d`l @@v ?$@@As  ` `thT >"hT@  ` `thT >"hT@u`d h`l`" @$h132|No input map entries133|No command map entries134|The %s character may not be remapped㿈`|!  `x  "`t0@m  2 `!"@J/  @ @ #:" @ ` 2    `2 '`  ` #\ #d#`@ks " Z ( `t KI `27`t  23`t ` 'S 'R  @;  "  " `t2`t р` "8*` *  !X@@:@I   ` #\#`#d@k 135|"%s" isn't currently mapped㿘`t ``|!@ @k 2`t  @@Jʒ  136|Mark names must be a single character㿘  2 `t`  @+L 0 `   @H`d@IV  .exrc137|%s exists, not written; use ! to override%swabbreviate map map! 138|New exrc file: %s8`x  "`t0  "P@@8[`|@x`|! @, ҐX] &@! RҒb@|2 ! ( x@wE@lO 9! (` @6 xҔ@lB  2,! (` @2(! (Ҕ@l5  2! (` @2! (@Z> 2! (` @2! (@sq  ( xҐ@J   x@sa" xҐ− @I X    `  @* 0?`d `h ?`l'`p'''??''' ؐ  G Ƞ `T /'' @^:   & P"  & Lť139|Destination line is inside move rangex 2 `d`  @*1 0`h'`l'`p'`T@ '쀢@ Ӑ@H;    8`T   '"  8    . @@ 2   "'(T!"  x' @l@! Р耢   t x@l4! "ư & t t x'(T!&(T耦@"@G` &@ @=@܀ 䀢   @l 䀢 ܠ@ܐ @= ` 8 `  '" "&  2 @= wŐG A @<܀ d䀢   @kȔ䀢 Xܠ@Aܔ @= K`` 8 "   '" "&  2  @== 1Đ ` `thT >"hT@Y$L`$P 8 "l  '"   @@ 2 l $l140|The open command requires that the open option be set141|The open command is not yet implemented㿘" " "" *` * 8` 2Ԑ@G  306|Vi was not loaded with a Perl interpreter㿘Ԑ@F  142|Preservation of this file not possible143|File preserved㿐  2 X`  @( 0$ @ Ԑ@Fǒ  @^ې 2 @> 2 @_,  2 Ր@F  㿘`t@5ܐ`|@5O a 2 @, "  2`|a  $ @,  $ ($$㿘`|$`d@8`l  `l $ L`p$ P㿘`|"`d@%`l  `l $ L`p$ P㿘`|`d@`l  `l $ L`p$ P%6ld TOOBIG x  2 `  @( 0VU Pզ"?b#!Հ"'䀦 bx@;''  @ 24  @;g܀ ܀  $@"  @ 2  (T`  @8  2 (T`2 " $㿘 'PP$@ 28  (T`  @8  $ (T`2' $ ֒` P @ "   (T`2   @8i   (T`2 Ր@Pb  [ynq]㿈" '" *` * 8`@" ֐!@'  @Q 2J @ @:Ę쀢 2A  ` @= 26 `  '&  @+ ^ 2$  (T`2   @8   (T`2 ֐!P'  @  2 @ %c㿘", ""$"$ *` * 8`2$#Ā "#ĸ$#Ā " ## * * `8@@ 4`$2 @ 8 }%@??y֢#` @x hT p  @7  2 8 (T`2e& 8:\??‧`V  , *  !X@@5 ,  * a] @@5`2 ? 8@@Y-??"*)# 8 @I"c @ hT   @7F  2? (T`2 &??ݤ2v@& 㿘$'L'P'T'Xd4`4$ @@@DLd4$  #" @$d4J`3 @)㿘N@    4$4$(@@@$4* , :`$$4 ` N@  `@㿘 $4 4 h $$4 㿐  2  L`  @% 0  P'`|`'`Q `d @Yš    $ L$ P㿘`| !@2 2 @$ `  $$"&$ !!%s ! r%s145|Only regular files and named pipes may be read146|%s: read lock was unavailable `x   "`t0'( @ @ !`#X`   #P 8*` * `2 `  #P " `  @%o 05 @   @)i  @) 2!   `x  2 `x2  `  @%> 0?` "`t@U`t, @R@ $` Ȕ $ `@`t`8@$`@ `t`@0ؒ`Hܐ$`2$@&$$ (€  `  @$ 0$ &$`t  @#\`d 2 ` @&`$ & L& P@gO P  J  2 `x 7  "`t2`t@2!   ` ! @gi "  @` "  ?#? @2   ` 3   蜟@ ؐ@1 `t@ @$ 0Nؒ`P@+ T @  ؐX@Cْ ; < @  @" T @m)ؐ` @B} 0'T   @1Ƙ  ؔ @Bm`d@! $ `d & L``d & L 147|Reading...148|%s: %lu lines, %lu characters㿐 "H   0@_ d 2, (T`,  @4  ` (T` `2 ,   hh , @8: >@" ͐ @1@l ,؀ 2'`/ @G\ِX @A    ` `thT >"hT@ې  ؐX@C @lt `hh  㿘@;㿐``x` !`t@  @Ĭ    $ &$&  㿘`|     "  ` "  `  @#o 0`X@149|No background screens to display 㿘     ڐ@Ak 0I     @` 8@ ?@ ڢ a    ڒa   T   @4  2  (T`єT   @3   (T`ڐؒa 150|The script command is only available in vi mode㿘$  ڐ@A   `x    @@ tcgetattrptyforkTERMemacsTERMCAPemacs:EMACSt-iexecl: %s㿘 3@O 2 @ ? @@̔  $ & $  \$ $  @S?2 `ڐ T d ? $ `$ d`h @I?ڐ   @ ?ڐ@@  @?$ 0bڐ@@  ?" @ ?b @xڐ#c@  ?ڐ#c@ ? ې `@ ?@ ~@  @`a@  @  @  @ @ #d`" #\#\ * * `8@@˒ / 2 ۖ @ې@Az @ܐ @  2  $@ @&$T  "TselectError: timed outError: shell: EOFshellh    ????'' Й2+ @  * "@      @G   $@? $f $@$"  @{?  @۔8@?Ւ 0dPP)  'S 'R  @1   2 @7̀ C̐ @5Ҙ$ ;  * $@@ @a"''    @G " ?0 0۔@? 0@6Ȓ̀  $@̐ @5 @ @-151|No command to execute x@6 2   @4쀢 2ܰ  @* 7耢 5      (T!  ' @c_䀢  x   t@cR x " $ t t x'(T!$(T@~ @4;܀ ܀ {  @ܐ   ܔ@> f "@  ''  @@ ` ܒb @{   ` ( "`xP@>ʒ D A   `"hT`t@hT >&hT`x  `t@b`x "; &`t`t`x'hT!&hT  @bΔ䀢 % @@@5e 2    ` `t@hT >"hT@vp Ш  ????'' @ $"  2`* `(  "  ` 4 2$   @F8? "'  ې@>2  '@$" `2* @ :@ `"@  2 2$ `@5Ỳ 2̰     "'(T!"  x'Ȑ @b.$  #  t x@b"$ " $ t t x'(T!$(T  `@y$?  @ ۔P@=ϒ } (  'S 'R  @/   2 ̦$ '̖ @3Ϙ V  * C$@Ā Ā %a  ????''`Й2+ @  * "@ `   @Eu @@2 +  '̐ @3  ̀& L& P& P@S    ` `thT >"hT@E㿘  @:@ $  @=.   @ $ *@ @I   5 1 . K2!K )? K"? "" J@K `J@2" KJ@ `?Ԕ  2" script-shell㿘` 2d  @*@$d@ ?" @? ?"@9ߔ  @  @ @$`   "(T@䠀 "(T 2(T߁"(Tttypqrs0123456789abcdef㿘@!( ? J!0`T!0"+ a8Ma8 F-"  p,,  @o   t ( x`/:?@,@Ȑ!@ݐ@[ @U ?&&@@7@o   `g@ܔ @L 2  M 2  ( "`x?㿘`x 2` @Kc   `t @H0 " %s -i㻘 3@K" 1  #dߚ#0`  #\ * * `8@#\  @$ h  $3    @  h $@$$ vfork-cexecl: %s㿘'D  3D'L@Jݔ D d  (€  D`  @ 0u(\  D$`"$ D`` D[DW` zD@` DO D(@; L D cd " c\c\`* * `8@@  / D cd  Dc\`* * `8@#\D cd " c\c\`* * `8@ L0@% D #d` D#\ * * `8@c\D8@< @ L@ waitpid%.*s%s: received signal: %s%s ...; core dumped%.*s%s: exited with status %d㿈# (`x $`x@Ƌ ?  N L  I`N #N " "@@e@[@_ `b` `"" #\""#` @:ݘ \   ` `thT >N"hT@̐M `2J :` E2D N #N " "@@@ bؖ `"" : #\@:    ` `thT > "hT@  @:    x`P@0 (   pX@(Filesize limit exceededCputime limit exceededWindow size changesVirtual timer expiredUser defined signal 2User defined signal 1Urgent I/O conditionStopped (tty output)Stopped (tty input)SuspendedTrace/BPT trapTerminatedBad system callSuspended (signal)Segmentation faultQuitProfiling timer expiredBroken pipeKilledIOT trapI/O possibleInterruptInformation requestIllegal instructionHangupFloating point exceptionEMT trapContinuedChild exitedBus errorAlarm clockAbort trapUnknown signal: %d㿘! @  ``1B#@| (㿘@ 㿘@  152|shiftwidth option set to 0㿈`    @E 0k c| " ctct`*` * 8` @9L V  dlŘ  N t @'J " ctct`*` * 8 `'J` >" c| <" c|` ` "'(T!"  x' @]G! d   t x@];!  $ t t x'(T!$(Tdl  @.M쀢 `쀢 = @. M  # &  cĀ  c`* * `8@ c  *`  8*  @&`@*M   $ ``L"  ` ` "(T t(T >$(T x   t@\ǔ x " $ t t x'(T! $(T@\ ~ c, cĀ`  c`* * `8@& c& cĀ  *`@ *` 8    , ?@@"" "@/  ` `` `thT >3"hT@4; `L2  `P$ `P%@@ "@$`P %` `$`L$`P@\p`P` `` `thT >"hT  @d `pl`" @$`p%s8`t  @z F@T AȀ   ( @ ( 2"`x@`  @7͔ `@@2 ,@@]@6 ș>`̀@ ȕ>`̀ ( "`x@@8    걚 㿐`|!2  @&  2  h€    2  @\  㿈`x `t`@L@ `L@ " "2L@@hdb  ``\2.  P . 2 @L` \`2 @,`  @,` L@  @ꀢ \"`,L $ 2$ @ % @  Đ #\   @W 2    #\  @H  #\ ؘ @< Ȁ 2  & L@` @@`%@"` "& @& & L``@2@``Ϣ*`:   :  ~` L@ 2*`   ` hT!"`x' @Zה  `t@Z˔`x " $`t`t`x'hT!$hTL ' ~L` \?` ~,` 827 @"D `"< *` * 8`2) @ "< 2# @ 2 @"D ""<"< *` * 8`2  @ " @  @`   @,` L@  @ \"`'&  @/@ &  @6#   ` `thT >"hT@ @   ` `thT >"hT@@㿐 ؀2$ @͔ !  @  ܐ #\   @' "`x `x  `t@@b 㿐 2$ @ ! @  Đ #\   @ "`x `x  `t@@6 153|Count overflow155|Regular expression specified; r flag meaningless156|The #, l and p flags may not be combined with the c flag in vi mode169|Confirm change? [n]157|No match found㾈 'L  'P`  @A 0<! L ' P '!| *` * 8`!| L. . L ''`'J@ y @?* : `i}#*` €`\ b&`\`\?^&`\m5 (LL&x@!  "&xLJ x'Lx "2`l֔0 @5   &`l&`d@, 0L@,@`l *LѰ  $' $`?`.   ?'' `?.  '  ' $@  'PL 'LJ 2 @LJ`2 ` 2 $ " $`  @ 0$ "`d `  "`di`d `l'' '''' L@) C  C    T!"x/''   "TtT >&Tx t@Xx "= &ttx'T! &T@X ZL@'L ' '   L   ? ?(P@ @  Ӓ `'8` $@24 (,@2/     !*!@' @  @% ' @4  " 'L? *@  ' $',@''̀'''$ 4 ' 'Ԑ& P& L@ʒ  a@8 @I ؐ @&} o ")  (k @(\f иȐd 2[  2T  @( I  @/䀢 q"E  y"H(   B    &L@ $@  2!a ! ' @=  @{ ' @3V  )L@,@,@T' 'hT !"hT& L  @ B  $ & P2)@ & @ B 4  2! !   ' @  @5 ' @3   L@$@$ L'@ @֚ 2 ',` $ú  ` * @  !*!@' @  @ ' @2̔  "'L@u@@'  ! @  / "  @)0 b   \`  & \ $@ " '&  @)p I L@' A   "TtT >&Tx t@Vx "R &ttx'T! &T@V oL@ 'L' "!@' @%  @c ' @2>  "J'L@@' `   L `  )  !*!@' @  @( ' @2  "'L@@@'   @  / "  @(h    \`  & \ & " ' @(   X `& X & `` 2' "!'''̀`'ԐЖk$Жb" ЖY쀢`8  (T`  @$K   (T`  L@ 2& P P & P@U͔ P  `    ` @&`P@  $@ @1J   !   ``thT >"hTH@13   @   9'@* @$ll0<H㿐\'H'L T ! "!! *` * 8`2 ! "! ! "!! *` * 8`2`!䀢 "!`!䀊 "!! *` * 8`L  LH" @ `    `""`  $@ @ $*@&$  $ @ @ $ *@&$S  HL@y 2e ` HL@ L@^ 2T   @ & L'L@  & @0  H@LL*@    ` H`thT >"hT@ `" 'HH@i  2 @ `$ &$ $ &$ [[:<:]][[:>:]]㿐 @` L ["l"D \ *f ."e"Dv ~"H"Dp`(m L < [ *' ."&"D_"""D ~ >"  V""DR O " "<"< *` * 8` 2A ' "D " "<"< *` * 8` 2/ +  ""<"< *` * 8`2   "   "D " "<"< *` * 8` 2   2~L  &&    T!"x' @SZ   t@SOx 2&tȰ tx'T!&T`@ ``h ~ \L [  \ * .""D. ~"q"D.`(. L < [ *F ."E"DZ."A"D ~ >Q."#"DM. `. . . . . .  h. . . . . . .` ""<"< *` * 8`2R.6 "3 K."D ""<"< *` * 8`2. " . 3. /. ""<"< *` * 8`2  . ". @#   "D " "<"< *` * 8` 2 . .Q &&@& ^.[]$*㿐 &   , T!"x ' @Ri  @ t@R^x 2&tY tx'T!&T@  J? / ? ?  J?`$ ?   N / ? ^ ?N ^,@ `?  ' \N \2 NN  / ?2N  ?@:` ".?.   $.&&@& ([ ]|/\*([^*]|\*/)*\*/)*\^.[]$*+?()|{}㿐  @L@ "?` &* @* $@   *     ` hT!"`x ' @QȔ @ `t@Q`x 2$`t9 `t`x'hT!$hT@ ^. `h@(  ) \L@` h@   @9 " @.  @. ?`h@   $. &&@& RE error: %s㿘p@xv @  @-4 0 @xhx @-)@*㿘'P 'L'TP'H N L & \ ” `"D ""<"< *` * 8`/   )*  `L?ڀ`O  *` €"D  "< *` * 8`"<   *: ?Ц* @ ?@ @  {@ `?2`` ?t `` H"@3 @ `   'R  @ ' "    b0  b0b ` `  ( b ` ` !*@  `@!*! @R@  @,j M-`      ` 'S 'R  @!   &   @2  ` & @*` @F*` &  @,!  耢 2 & Z  * "  +& ) "    0  0" ` `   ( " ` `  !*@  `@E!*! @@  @+Ӕ -2LL "P"T"\\\\\\\\\DDDDDDDDDD\\\\\\\\\\\ \\\\\\8\\\\\\\\P\\\\\\\\\\\\\\\ \\\\\\,\\\\\\\\DX#\   9  @ @@ @   > $158|No previous tag entered㿘`x . 6` "`t@>`t@:@ $` @+0  #Ѐ " ## * * `8@ "`@}`(``*` 2 `X@+  @e`@ " @   @c* j$$  @c" , b% % 2$ " $$   L  P`  a2`| `|a !@ >  @Ð 5@2 $$`2@$`" $@@$$`2@$`" $@ $@g "  "` L"  P"`" "` "   @ @@ 282|Already at the last tag of this group㿘 2  @ &  @ 2 `|@*a   @V "   $ B `$ @ `  255|Already at the first tag of this group㿘 2  @x &   @ 2 `|@*#   @ "   $  `$ @`  㿘` `@ &`` @ @R   ` @Y   $ >($$ 㿐` `@  &` @G G @*    @ @G09` @@$ @( @G| 0( "` "`"`   `2``  "`("`$䠐 >" "$@ $$$ 159|Less than %s entries on the tags stack; use :display t[ags]160|No file %s on the tags stack to return to; use :display t[ags]㿐 @@2`x @ b   "`t0ST  @&J@ $L @4;@). 9 @@@ /   @š'  @C 22 @@*L  2`|  @U`|@ 㿘 @  ``|@  @,  㿘@   @  & L & P@/  2)    "   #`  `3 @,  "$ (&$@@  2@@@2 @ 292|Display too small.%2d ... %*.*s %*.*s*%s%.*s 㿘 2 8 @Ɣ 0 "@(u 0xd @] ;9753/@a(`!0` 2 `@  8 ޖ  H ֖ 2ϒaX@"` 8?• @  8݀ 8 @!`!h!p 㬐㩒x@@2 (T`  @ʖ   (T`2 㿈 @G`@ e``(@ 2[ `"``" "`@2 ""@"` ݐ" "@2 $"@$ @@ "@"쀢 " "` "$     @7 $  @'  㿘@a  2` @'~  `$ ` @$` $ $ @6$  $ &  㿘`  ` !@;  @'X  @ $ $ $ `  $ & 㿘`  ,` -` ``$ @  @'0  @ߐ`` ($ ` "&`   $ & 㿘@` `"``" `@"@@ `@  㿘`` @&` "`@&`"@@ `2@` @`$ "``@@"@@ߐ 164|%s: the tag's line number is past the end of the file165|The tags stack is empty166|%s: search pattern not found㿘`  ` 0 0p@& 0@' 0@㿘  N@ @  /`&@`()@@b   @& $ @X` $  @&u   @r @ *@, $ $  "@$ @``ʲ` 㿘 Q@ 6 `  @F 㿈"@ `@ '@L 1#  ' '#\@E @£ (  " #\ @E "   Q 0 2 & & L & P@JY P 162|%s: tag not found%s㿘@I @^`! K & &   & `& @ ` @J  `   ,`@` 2)& @'   `' (! `  2 @` `#$x@&  ` ,`@`2 `@   163|%s: corrupted tag in %smunmapclose  'P@h}  ( x ' @  (#\    @  ( x @' 0P@ @P@( 'M  `'J` @"J@  *@ '%`"`'@``@ն@ ``2P P@v 2>PP@*w' @*r!H @%     t@T >"T@    ` `thT >"hT@ݐ@< <@P.@`@`@\  , ( $ @q / *@  ' @d   $ $ $ @X$ $ $ &"@G& @֐ h@$ @ p@$  %s/%s8'N /"@g `@ / ,@`$@g@gw  /`@&' /,@㿘&2  : @L  @3 2&2  : @L  㿘@@ "@? @0@@N@ `뀦@ J(88   ?J` @ : JJ@  @ *J  @  J@` ` 2?302|Vi was not loaded with a Tcl interpreter㿘@#ؒ  8@  8$   і "m @$ $`2@&`" &@ L $  T    Q*  * L#   L  @sz 2C @e ؐ @I 3?`  "*` €C @$?      @G " $ ?`"\*` €0&@쀊 䀎   ` @J?`\‎   @ @J?`.@ &`"` @"@ذ  5 Ѐ  $` @r 2 @   @r  @ז$`$ @@2`&@"i&`  @2   @~2| {䀎+  @ J@  J "` "`@  $   *  *`?`" @ e) `"&"  *" 01 @''  @F͔ "G '  @D  '' @ |€ $ $  @@ 2( |@| €@B䀎@ " `  Ґ  * `$  4DPll%c%6lu %.*s㿘@("" """ *` * 8`  `@ ""`"@`@ 㿘#Ā " ## * * `8@#| " #t#t * * `8@` ` @ `L 2`@$@ *L@$@  @$@$$@  `@E` 2&` &` &` ``* `&`    `?`* `&` 㿐`L`P'' '@ ז  , ` X 2 4  . X& 4 4   @ 2   & 4@    & 4@ $`L$`PTo see the list of vi commands, enter ":viusage" To see the list of ex commands, enter ":exusage" For an ex command usage statement enter ":exusage [cmd]" For a vi key usage statement enter ":viusage [key]" To exit, enter ":q!" 㿘ÒbHܿbܻbbܷܳc8 The %.*s command is unknown Command: %s Usage: %s ^D%*s: %s 㿀`x S `t@b  ` `(*  + #0@`" @@@a` 2`@  "``!2`  @ a*  *@`9c0g!`3#!@ @[@ 2 ```##0Q#06@2`(#!$ [/@ @ ]*  /@` //@ ``*  / * +`  @`` @  (T`  @   c0 (T`c00@ The %s key has no current meaning Key:%s%s Usage: %s %s 㿘`x e `t `" `  @ 0 `~4,`[`]`~ #`~B$ "## *` * 8`|B |!B".`@` `` "*` *  !X@@fQ ` J bЀ ""T? B" #| !.`$ "## *` * 8` a.` a.`` /"``~4  (T`  @R  Հ`~ (T`Ѐ`~ @ 㿘\  @.`@*`#0 @& & `& d& l& h`& p |!6 |& t & x$ x t( "`"@ x t(" x"@㿘  (`," x `0  `,@Cw`0 "2 $`,`,`? &`@M@  &@`  x 2  $x6` ` 2 ,2&2&   Ť167|%d more files to edit㿘`2$  0 , @"  ("  " & 0 `@ 2` ("@ :`@  㿘 (€  "(\$   "`" " "  * * `8@!`  & 4!X * * `8@!X$& 8 ? &$ 168|Buffer %s is empty144|%s: expanded into too many file names283|The %s command requires the ex terminal interface272|That form of %s requires the ex terminal interface274|Command failed, no file read in yet.173|The %s command requires that a file have already been read in171|No previous buffer to execute172|No previous regular expression230|This screen may not be suspended290|The %s command is not supported when the secure edit option is set284|That form of %s is not supported when the secure edit option is set174|Usage: %s㿘 C <. €0@S 02% !X`2 0X@ 0Ȗ@ 0@ْ DTpVersion 1.79 (10/23/96) The CSRG, University of California, Berkeley.㿘h@  175|The visual command requires that the open option be set%luz%c%lu%luz%c 㾐" " "" *` * 8` 2 `d@   " & L`| (b  - @  ^  ( +  . L P#  "`@A L ` 72``|   L`X@`o!  L @`g! 8  @4 `|" @d"4$b2$ !  @+ $   @+ $`2$@&$$@  `& "@{' 2 2 2  ؾa(  &$ 㿘@j 2  @ В 2 g&`x㿘@U  2 @  2 `| aӒ `  $$"&$ 㿘@4 㿘  2 X`   0! @   2 @  2 `| a `  $$"&$ ! 㿈  2 `|`  l 0!  `x `t@L  "  " ^2]`dL !2Y`d#X "#P#P *` * 8`2`      `  5 0L  "  " L `  " 0@  2 $ &$`t `d#\`l% 2 $ @2 ̒aH `d `l@'` "``x L >L  > L`L  "  " L `l`dP @? 2I `x 8  4@&`t!   ` ! @@\ "  @` "  ?#? @2   ` 3   蜟@  @ ْ~   `l`d@253|Writing...%s0 `\`%'@!` Q 6   h  @ X @HՖ@O  ?`& * &@- `   @c d Ґ (T`  @   ` (T``@xԐ 2 V@  <  @N;V 2  @E 2    X`p@K @E ``h  `%'@㿘  2 `|`  ɔ 0  `Q`l`d[ ---------------------------------------- 㿈  2 `|`   0 "$``X " $X$X *` * 8?`| `d ( @('  @``4(cZ`, @ "@ &`d&`d`d?X&`l"@  &`dO&`l?2 @ "@&`d&`d@&`l L ' P''@ 9`?2 @ "@&`d&`d&`l 2>  8 &`d&`l 20 @?`&`d&`l@ ' @?&`l&`d` @z쀢 2 `l쀢 8&`l̐  2& L /tmp㿘`,`0`0'   $`4$  @ "@  @~@~ $`0@1 52  @R   @ `# c0@1͐ `0@)V  & @~ϐ @Ȕ  `0&`4& `02`4$`0"$`4%s/vi.XXXXXX237|Unable to create temporary file238|Warning: %s is not a regular file%s239|%s already locked, session is read-only` `   ?#ߐ @6`@5 `6` @Q \ 2 `X @x  ? $`T,`X$`H$`$`x@t  `t f` 2M` @(d 2F`!xx `  !p * * `8@!p  @\Y$@Zq?@w!? Ȑ@. ?" `@v0"@v``` 6`@(  &` ` 2` @( &`` "@~ @ @`` $` 6`@(`D-  @>M cB + gB + 3`   8 " < `X x|  ,`X$`<$`@$`D,  @  ??  ?/''T2   '`@0N `L'@(7 $`L @ ` `X' ,`X  ! @3*؀  $`@ؒ  @g 2}`@e 2w` "     "@  ``6` @ @ X``?# @6` ` @`H@ "   0 `! 6`  @  $@`  `@H    )  @& @ )  @& @&  $@@& $ @&$2 "` @} &`` " `X@@}` &` `X @"`L@`L`L "`@|$`L`  @@|`P %s/%s㻘`2Lf& / .L / . L / @ZӒ`?P&@Z͒ 2"Ȑ H&   " * * `8@" - !  L : 2 ?:L,$0@Z#8#,@Z 2L ` @|Y  @v   @~%@|r`&`& -c option㿈  & L& P $   `2 $@ L q L 2 & L& P #a@~ [  \I$ $ @ L Q L 1 ; ` `& L`&$& P!l "!d!d *` * 8`  & L  @ & L  L  @ ^쀢  & L& P P쀢@8  L& P@;M P P L ''& T '@7240|%s: remove241|%s: close242|%s: remove243|%s: remove㿘`" @? &@ 0"0  L $  P`$ `/4  ",`@Y  @ @{   $  0@ "4"`  0@"@  @{@{& ` `"@   @Ē @  C&@@r@P`X` 2`H`L " `P@  `L0@ `P " `H@ `P@@ `H?"`T@s`T?"`L@s`L "`P@{B`P @{<@{: 244|Read-only file, not written; use ! to override245|Read-only file, not written246|%s exists, not written; use ! to override247|%s exists, not written248|Partial file, not written; use ! to override249|Partial file, not written250|%s: file modified more recently than this copy; use ! to override251|%s: file modified more recently than this copy252|%s: write lock was unavailableaw254|%s: WARNING: FILE TRUNCATED256|%s: new file: %lu lines, %lu characters315|%s: appended: %lu lines, %lu characters257|%s: %lu lines, %lu characters   @-     ` "쀊 """ *` * 8`    D"A# B$ " $$ *` * 8` 3`  @Xd   # #Pk  `@XN  #p#@- 0 @X< $ `   X  <@ @@ D@ # -   &"  @$   !0 !( * * `8@@ " @Wݔ!  ` @ 0  @  H @  p x@G  `@ @r) @ ''@  2 '@#\#`D`@W " X@$!D  ,X$<$@$D  2 @ y  ?  5  X ,X `@㿐 5 @Ô<0` !@f HD@$@@W]?8$? 8@y 8 !@{@@ OH /@  N@ /2` 8?:`@  ..@.@.@@ <    ` `t@hT >"hT@y 258|%s expanded into too many file names.%d259|%s: not a regular file260|%s: not owned by you261|%s: accessible by a user other than the owner?b'H! ($ x @V ?    x :H` :#\    , N N  @zϔ 2B   @ג @q5      (T!?# '`*  2#  @7 @ x*  2 (  t t@7 x ހ$ t t? x# '(Ta$(T @L*`: `% `/L  %" *"  *L    % d,@,`,`@&z# ,@&t /,2 @$@9#`@L 4@(' ?@'?  `"@@V# @@V "*<  @[@  6  0@ Q$`@UŔ! @! @@p4@~^: @pW 1 ?#@@pA 4"H@p H@p `݀   ` `t@hT >"hT@w+ @o`@~@o`@ `   ` `t@hT >"hT@w\ 㿐  @  "  yJ@#$! &$ <J`#2j& L  @ 0^ ,/*J` *&$!&$ ( J@ *J` /`?' '  @\ 032& L/J@ /+J` /'$!&$'' ( J@ /J` /`?' '  @) 262|File modified since last complete write; write or use ! to override263|File modified since last complete write; write or use :edit! to override㿘 2 X7 1!$ "!! *` * 8``  `@   `   x  @k  @B264|File modified since last complete write; write or use ! to override㿘  X   ` @=  @265|File is a temporary; exit will discard modifications㿘 "   `@"  4  `2  @  266|File readonly, modifications not auto-written㿘  `X !$ " !! *` * 8` 2"  """ *` * 8`    `@Ӓ    1 㿘 `@u` & @ @ &  @ 㿘"8 " "0"0 *` * 8`   @Q ?2 1 (@ے 1 (& x@̒   x #@? ` 177|Empty file㿐@`` @    @m  ` ` @i`  &`&``&`` .` 㿐`` ``"*` 056`2@ &@ @`  @?&`$&@` `&`@i "` &`&`&`&` @.``?@`  &``&` .`@up 㿘` 2 ` 2  ` "  㿘 "`  " " 2  ` "  㿘``; !*` €@' &@ `@(`  @ '&@` ` @i`  &`&`` &``  ?@    &` &`?`&` .`@t 0080081㿘 "`  " " 2  ` "  079|No non-printable character found㿘  a@c @ @N  @J  @F  @B #!!b P@$,RbS R@:  ,R ` *  bJ`    ,p  b @J`2 ,p p   @  㿐 h " !ܘ` !  2" 2   b!ܗ*` * `# #b㿘  ] *` , !X@   - ,@`  㿘@ 㿐bԀ /b`. (8b``@" b"'/``@b" bxbx`. (8` 1@ `@"H"/`_ "   2b ^/`@ ?/`I b"bb`(( 8! \6  \/`/`   8 8  (@6`?'` \ x/`/`  @0@ /@@`/'`)㿐"/aܘ P@@e   㿘 a (aaa a`2 a 8 aa ("&$aa@ @ `@* @@ "aQ a .a*"@ "a* + " #H*` @mE* $aaa*`" a* @0$a `"$ @$`$ `$ ` $ `$ `$ ``$ ,  'S   'R  $  $ , ՠ  㿘`  ` !  `@!!! "@@ `@ @@!!*`" !* $!*"@ `*` # -` $ @, ` 'S   'R  :$  $ ,  0@# `$ `$ ` $ `$ `$ `$  h`   @2p `A6T "xι 2b x1 2Y `?` *` €  @RF   hT "hTg 28 A25 * "@*` ` ` &@`&``&`` &` `&``&``&`? $$ $\ ` Yb"W ` L`  ` 2H @ : I  #\ @. Ԁ 5 $ "$$ *` * 8`2`| y ` 2!! "!! "!! * @*`8 * *  _* *` *  Y* &b `  `2@* a@&@`&``&`` &` `&``&``&`? $$ $"  "  2  a .` &`.`&`} * "@*`  @0Y `? "@`$$  $  # "## *` * 8` J F  @Yʒ xؔ  2     (T `"(T3&`     " ݘ  2&    Ԙ   * "@*`a    Ř  "       O ;X;;;;X;X;;x㿘   "  @$&   @$276|Unexpected character event277|Unexpected end-of-file event279|Unexpected interrupt event280|Unexpected quit event281|Unexpected repaint event285|Unexpected string event286|Unexpected timeout event316|Unexpected resize event287|Unexpected write event㿘`?` .*`#8 €!(Hp  0@ # ` @py @pBxBCBBBCCBBBB   """  ( (  㿐 !@*`.`" "**   '!@/ 2$! @t $!   ` 㿐 '@ ` @ 2 `  @W  ' 㿈`K'H `  H 2H$@"#` x |`      @`2@ `'? ;`H@" "@'H`H 2&` *&` H ?`  ? 2H H@ 2'2&  &`&` &`' `& 003|unable to delete line %lu㿐  'H   @ @ ђ  29 Hq  22 H@ H ''    HH@    @($   ?$  X " X@"  X`, XH @ 004|unable to append to line %lu㿈  'L 블 J L ?''   ? LL@  4  @*$    $  X " X@!ǐ X`, XL @`L@ N L@   2 L@B   005|unable to insert at line %lu㿈  'H Z F H ??   ? HHx@ a 1  @:$    $  X " X@!j X`, XH@ H@ H@   2 H @    006|unable to store line %lu㿈  'H  3 @ H ''?   ? HH@    @"$  X " X@! X`, XH@] H @ 㿘  ` Ô  2  $@  x |`"   `?   `?007|unable to get last line㿀 `2` ꒔ G  &@$@"?  x |`" 6 ''`  ?   @ &@ &@ / ,  ,  , $`$`$` $`$  | @  &@ 008|Error: unable to retrieve line %lu㿘@S 㿘$ 2&  @   "  2  @ 2    @009|Log file㿘 &`$&`,&`(&`&` &`0 "! @" &`  @  `X  .`X㿘` "` @&`` " @l&` &`$&` &`,&`0&`( 㿘 X  , L",P "0 ",P @"0/usr/src/usr.bin/vi/build/../common/log.c㿈     @+ "& $   ,*  @g"  ( ''  ''   ? (  $ $$ (`H@̔ Ű 㿀 'H X " ,b ` , X  2X $ ,H Ԙ H`E !@' '  29    (   @+ ", $  H*  @f   @f ( ''  ''   ? (  $ $$ (`H@`! 㿈  X " ,; V  23 $ ,    @+E  "' $   *@  @fs  ( ''  ''   ? (  $ $$ (`H@!Y 010|Logging not being performed, undo not possible011|No changes to undo`  `X`  `( `8 @ 0`H@!z ,`X`( '' `(`$`(   ?`["*` €"`( @e  `X `P,`X @e U B  d & dĒ @e  Ė 1  \ & \Ē @eה  Ė?    XĀ "`( `& X & `  @eؐ''@  `(@k `X  ,`XU8TUhUUhTUV@012|Logging not being performed, undo not possible`  `X`@ ~ `(  `x `H@C!q ,`X`( ''`(`$`(   ?`S!$*` € @e[  L@2 `X`( 2`( `XB  @eK  L@"`(`( `X` ,`X3$`( @e:  L@2  X   X "  `& X & `  @e!ؐ''@ 2 `X`(@j `X  ,`XWXW|W|W|W|XXX013|Logging not being performed, roll-forward not possible014|No changes to re-do`  `XH  `(`$@ @i 0`H@"K} ,`X`( '' `(`$`(   ?`^ *` €"`(`(`$`( @d  `X `P,`XĒ @d  Ė ?  \ & \ @d  1  d & dĒ @d  Ė    XĀ "`( `& X & `  @dhؐ''@D  `(@jD `X  ,`XZ4ZZ[ Z[DZ4[015|%s/%d: log put error267|Log restarted㿘! (@)_ @Ę   @ H@ exnexnviewviewc:eFlRrSst:vw:only one -c command may be specified.only one of -r and -t may be specified.only one tag file may be specified.-s option is only applicable to ex.window=%s0(h "&(h(  #4&(& &  & &   | & |& &  . p 0& 4& 0!,&!0&!,&!@&!D @I`Ѐ @C`؀  @;` @5`耢    @ "(T   @&(T     7%`80"*` €!  ( (&! %`(T ?!&(T  t r  rt (   t  ` ( ( 0@3?ƒ?b*  `  x@   (T 2  @! `"  "@"` 2 & "`|& d "d ""` 2 & "`5&  f    6 ?Ȁ` )"@` 2"@`?"@@  L `!@F@j''''''@    @/  (  @)  C  @#  G  @  "  "   * * `8@"4 ` " XX* * `8@"8   r\  d& r  2 `@  ~ ` X* @*`8  2 "!   ` ?"d "d׎   ( "@jN @gɐ   & ( x @ ` @q" $" (rd "d " 6$`2 @ 譒  覐 |$@   2  n  | `}d&  @ k ] [ $`!@~ @`/ ؟@ E B  2(d耢  2(d ?" `  "`") $`ʐ @`ؐ  2$   ((P@   @E________D____________\_x__________________8_______T______d_____%s%.*sex/vi: 㿘   " @   @  @  @ @  @(T  @4c l  c%#  c  @4ْ` "` " l 2 ---c$-s㿘)' ؤN+L +$L  @fx  '&@ `* `* `*8*@h@fh  &@ - c**@ )` -2&`L   c@fS   &@ ( x @*   * ** T t w2`J` "``@ " @J`Ѐ 2@ %s: %s 㿘 bh@4Wbp@4P` ! (`x@8"p@4E@4Abx"`8 㿘 `8`""`"@@f `82 017|Mark %s: not set018|Mark %s: the line was deleted019|Mark %s: cursor position no longer exists㿘``" '@   `#X`*`#  `#p ` "  2 `` #*` *  !X@@  & &㿘``" '@C  %@e{    @ / 2 `8 "`8"  "`8  8 " "" $"  2     $ , $  , ,   8  *2㿐`  ` 0<@e  8 "6  * ? `. &  2 ! F  2  q      8 "     &  2  020|Error: %s, %d: : %s%.*s㿐'P'T  'X` C `"@ ?B `7 *` €$ / $$  8$*` * `$   T $T$$  8$*` * ` 0$  $@Bc0@eBc0   "c0$   ` `t@hT >"hT@d, '    (T!' @# "%c0 x  t x@# "%c0$ t t x'(T!$(T` c`@ @f @ ``@ <; 7L $ #p ` "* *  !X@*`:`t@BM ' L  "@@B;x 'n@0 "@@P^' X`2  (`x!$@@#@B' D   ?  . 蔒  c@1   ` `t@hT >"hT@cŐ%c0oppppX㿐! (0  x@$ x    ` `thT >"hT@cuuuuuuux299|yanked298|shifted297|moved296|joined295|deleted294|changed293|addedvu301|lines300|line%lu 㿐$@#  & X# * * `8@# \  ,    t   ,"@0    "'(T!"  x' @"V" y"  t x@"J" m$ t t x'(T!$(T!aX     9 3" ; , , ` "@A ` ` @ ' @ @@d ,@ @ @d`@  $Ȧ , `h    ` `thT >"hT@b317|%d files to edit021|new file022|name changed023|modified024|unmodified025|UNLOCKED026|readonly028|empty file027|line %lu of %lu [%ld%%]029|line %lu㿈  @d` '  * (Ta  ' @! z   x  t@! x m$ t t x'(T!$(T  L@ , @  * @ *`!] '*:`e' @ ` *`* *  !X@:`\@cΐ`L@` @ :, ,$@' $ #@  `@   a@ @@dM :, ,$*@&$ `  ?# @2"a`a(@@c   ,, ,  X`a@aP@є@cc   a  ,, ,a`@@cJ  "쀊 " "" *` * 8`0  ,, ,ap@@c$   :, ,,쀢 |쀢 a@q@c" @ea.`@*`@*`@en@0 a@Q@@c ,$'* 8@&M /   L /2 $@8  .$? ,?,?,?,$'Ր h    ` `thT >"hT@`LC_MESSAGESLANG%s%sVI_MESSAGE_CATALOG030|The file %s is not a message catalog㻀@L / "#L  2 @bH   K   @b> ( K   0@>$   @'  `T 2*"`Tp*   ?'`  2` 2 ` `8@"hT@_l  @_? + .&  (T!" x!' @ 1!  t x@v  1!$ t t x'(T!$(T1!7!( &L `(?& `*` * !X@*:`VJ@ `.J@ * @ L  * .0xhXP@È80 ÈÈ€ 00xhXPH0@0T( @ @@p`X@H@8 0( | Ĭ h writeanywrapscanwrapmarginwraplenwindownamewindowwarnw9600w300w1200verbosettywerasetimeouttildeoptersetermtagstaglengthtabstopsourceanyslowopensidescrollshowmodeshowmatchshiftwidthshellmetashellsecuresectionssearchincrscrollrulerreportremapredrawrecdirreadonlypromptprintpathparagraphsoptimizeopenoctalnumbernoprintmsgcatmodelinemesgmatchtimemagiclocklistlisplinesleftrightkeytimeignorecaseiclowerhardtabsflashfilecextendedexrcerrorbellsescapetimeedcompatibledirectorycommentcolumnsceditcdpathbeautifybackupautowriteautoprintautoindentaltweraseh`XPH@ 8 0 ( !$%+)/139675=<A;x>p>hH`MXHPJHK@Lwswmwlwiwawttytypettytstotltagswsmdsmslowshsectscrroreparaoptnumodelinesliichtexedebdircobfawapaicdpath=%sCDPATH:directory=%sTMPDIR/tmpescapetime=1keytime=6matchtime=7msgcat=%s/usr/share/vi/catalog/report=5paragraphs=IPLPPPQPP LIpplpipbppath=%srecdir=%s/var/tmp/vi.recoversections=NHSHH HUnhshshell=%sSHELL/bin/shshellmeta=~{[*?$`'"\shiftwidth=8sidescroll=16tabstop=8tags=%sscroll=%ldwindow=%lu031|Unable to set default %s optionhР?'''' >  @  e#`.#   @  Z!"`."   @v N!!``.!` 2  @j  2B!#X$"p`$.#X@](" $"$@9@]' @ $" "$@] " $"$@9@]ѐ'@~ $ " " ?/'@]'@i $ " "7?@]'@V $ "Ѐ "'?@]'@C $ͮ $$@9C@]'@1 $ # # /?@]q'@ $ -#  #????@]Z'@ $ %$8@$@9@]H'@ $ &$HX$@8@]6'@ $m *#p  #p  ? ?'7@]'@̔ $V 1#$@\A# $#$@8Đ@]'@ $< 3#  #  ? ?'/@\'@ $% 4# # ?/'@\ِ'@ $ 5#Ѐ # ?7'@\Đ'@q $ 8# #7?@\'@^ $ ;#@$@8^@\'@L ""֮ = "  * @*`8 ?2 '̀ ̐ '$$@8:@\{'@( "  /h`€̀ 2 ̀"X$  " " " "  *` * 8?'%$@8 @\K'@ ! H##`_  !     O  "" 0G   @  @ >  " @? * * `8@ @x ,  "@?*`  * 8`    "  * * `8@ @T + @Y  ` @?!#@* @@@[А'@} 2 @`@?*   !#- %Y  all032|Usage: %s291|set: the %s option may not be turned off313|set: the %s option may never be turned on034|set: [no]%s option doesn't take a value035|set: %s option isn't a boolean036|set: %s option: %s037|set: %s option: %s: value overflow038|set: %s option: %s is an illegal number314|set: the %s option may never be set to 0039|set: %s option isn't a boolean㿀  `  '@ ْb@ 2 $   L ' = ?2  =`HÒ   L ꀢ =`'-@`@( !L n L o  '@ !@kR c% :`,*  `2 ` 2  @ `?2    "  0-   'X   '∀'⸀` 2  ,*  a "   *` * 8`   *  a "    *` * 8` 2     @    @ܘ     2²   2  @&7 2  ( 2  2    @   @  ' 耤` b @ `_@v `N"䀤` ` ` ' '( @W    ` `thT >"hT@W䀢 뀦   ` `thT >"hT@Wx+ J A ? "> ͐Ȑ'P Y耢    ` `thT >"hT@WH䀢    ` `thT >"hT@W4  @   'X   ,*  a    *` * 8 @À   @ʖ 2     2  2 @%# 2  ( 2  2   '㰐  ` 2 "   s- 2. ,*  a "  *`  * 8`   *  a "    * * `8@@  "F   @J 29     2.  2& @$ 2  h 2  2  @ " @V `2` @|㿘.`*  !`  @ * *   8@ @       2&`` "&`@V&`&` 2 &@@ "&@@V&@&@ 305|No %s edit option specified㿘.`*  !`    * * `8@ J 2 2  !#.` *  %ld%*s  5!  8@Y ?  8  ? @Yߒ 'l   %`: `, ``"0`  ,* *  a   @  * * `8@@ *  a "   *` * < ܐl* אg* *  a   @  * * `8@@ *  a "    *` * < *  a "   *` * <`3*  /*  a "    * * `8@*  a "    * * `<@@ }*  !`v* @U[* @ ! ,!@WX` `.?S ! " @@ *` * 8` "A@? !p+ p`  @ * * `8@@  @2 @W&' ! "@@*`  * 8`   *  a "    * * `8@@W?l/`" `* " l'l `=@ @I\@=> 2`   @,l!#/+-$ `'x@ , @*`@=@@l +&ߠl @+!#,``*`@@l@ l+l@,`+%s%sno%s=%ld%s="%s"㿘!#&@`: `+ `"A+`0q+` *  a,"   *` * 8` $ ,  `$#@,"@ 0M+` *  a,@ "   * * `8@   l03 *  a,@#  *`  * 8` $  ` *  a "    * * `8@$#@9set %s set no%s set %s=%-3ld set 㿘!#`# 2  %`):  `>,` ,*  a "@ @  *` * 8`- - -a-a@!y` ,*  a- ! @  * * `8@@   @!`` *  a "@ @ *`  * 8` `  -a0@!C-  \2`` \?`&``@ \@* &@@`?`&``@ @* &@@`L@ Ӏ ` =?`&``@ =@* &@@˒*  a "5   * * `8-@  \2`` \?`&``@ \@* &@@˥`?`&``@ @* &@@˒`L@ Ӏ ` ?`&`@* &@ @` @ 햔    2  㿀$.` "' %@Ж  1! * #7'!.#' N@  0(' @TƐ㨰  JL & 4@.Z 2 `  " JL & 033|set: no %s option: 'set all' gives all option values㿘.t 㿘@@㿘@@㿘`@S˔#!#`  a  ,@2l @ 2h  @  `*`` * 8` 2 @      F " `* * `8@      ( @ "`*` * <`2 @ " @ " `* * `<@ m  졔  `  M`㿘!#   !  ,@2F @ 2B @ "*`  * 8`  @  @ "  * * `8@@Qh @ " *` * <`2 @ " @ "  * * `<@@QH`  M`㿘  B    040|Screen columns too small, less than %d041|Screen columns too large, greater than %d㿘/В    / ! 042|Screen lines too small, less than %d043|Screen lines too large, greater than %d㿘 !/   / !ڰ 0   `?$`  & $X * * `8@ $X $`   *@ *` <  $\  *@ *` 8  HS (P  H   a H  [ B $`2 ` & $X * * `8@ $X $`   *@ *` < @ $\@  *@ *` 8 ? ( ? H  !? H   044|The lisp option is not implemented㿘0X@  㿘u 048|The paragraph option must be in two character groups㿘@R 0   㿘+$ $$ $($"$ 㿘$@  @Y $*@&$$ @@Y $ *@&$ 䠐   049|The section option must be in two character groups㿘@R2 1 ʒ  㿘      㿐 (`€   $@8 㿐 (`€   ;P.@  㿐 (`€  "@@   *` ( 8: 0    *` (8?" " 053|The default buffer is empty054|Buffer %s is empty㿈`H ! `2A1p+  " `  (*@  ` !@`` `  `@`` 2@`21`"*` * !X7 b  '`6 2X  2``   \ '`& \ '' 9 ` $B? `' '   \ '`& \ @'   ' 쀢 2     "(T!   ' @ 耢 U  x    t@  x "߰ $ t t x'(T!$(T쀢 @ @P@@'@P 쀢 `?"  ` '` @  P  ' `@@Oݔ$ ~  X y  `& X t& `` $'쀦    "(T t@2`(T >'(T` x@(  t t@ / x "h ' t t x'(T! '(T @ 耢 `@`@O`@O` ߭$ 2,  X " `& X & `   \ '`& \Ғ    \ & \     ` `t@hT >"hT@M%s055|Files with newlines in the name are unrecoverable%s/vi.XXXXXX056|Modifications not recoverable if the session fails8 *y T3" " "" * * `8@@+l " ( x`3@+Z 3XF 233`? +3@}#N` N 3$@+F@!?3@E@ &`L  @S3  `X  @.`X057|Copying file for recovery...058|Preservation failed: %s059|Modifications not recoverable if the session fails㿐  X @, XB  P `0, X @m 13 +3 3(h cx  € 3 L  hh  3 hh   L@}'! X `@, X砒  060|File backup failed: %s061|Copying file for recovery...㻘 "| X @ v ` €  4 X ,XL(跒 c `` X ,X`P@`K  *k 2D " " "" * * `8@3$@*b@8!?'4 (haH L@  @D  @ " @RƐ@D  hh  ` ` @  2 062|Information on user id %u not found%s/recover.XXXXXX063|Unable to lock recovery file%s%s %s%s %s %s %s%s %s%s %s X-vi-recover-file: X-vi-recover-path: Reply-To: rootFrom: root (Nvi recovery program)To: Subject: Nvi saved the file Precedence: bulk%s%.24s%s%s%s%s%s%s%s%s%s%s%s%s%s%s On , the user was editing a file named on the machine , when it was saved for recovery. You can recover most, if not all, of the changes to this file using the -r option to : -r 064|Recovery file buffer overrun065|Recovery fileX @@  4p\   *g 2 " " "" * * `8@? 4$@)[@1!ؒ   Հ  4)  2 @%T %P   L  / @ `!?"@#@!@ 5 8#d55?`(`##`#h#\@55 h`#l#p#x445#tؖ`@)6@Cn5@F@55555`!@ax#`#p#x#\#h#l#t#d5a#|#5a##555#Ț`А@( 5婒 A , <@@В & <N 2& <8N .&@C%25٢ ?@@ @B 5l    ?%T @Bؐ .recdir: %srecover.r+066|%s: malformed recovery file%.24s: %s vi: no files to recover. 8 *H ""  " "" * * `8@@]k  66@q"(   60` x 96765435/6d-6"@@  ]@!P WT  M   @0I$@N !@a  @ $@; `@N   @ 2* X0,@! ($ x@'֐   x 2T@P]0 T@L# @x@|@S@ː  `6@|"@O %s/%s067|%s: malformed recovery file068|No files named %s, readable by you, to recover069|There are older versions of this file for you to recover070|There are other files for you to recover('H *t ""  " "" * * `8@@ H3Xƒ ?  ' ''6b@@  7! $@'N @'*   t       ''@A0$@ #4c@  7@6 $@ٔ 5`@k   7@" 2 ,7 -!(0N,@! ($ x@&   ' x @Ov0;@Œ 6@K7 `'*@B  㵔 @6  ` 㪔 @H@H@H'@A@A @ Q @<  7H ̰ 01 `7y  7p Hږ  @Hi@Hg@@ڐ   "`P"`TH!2 `X  @*`X?c @&F ? ? @@ @?@@ 43  3Xo  㿘@@?@N  "  ;   @@ 0 㿘@$=?.@jC2`?3X@ ?@@k@N?/usr/sbin/sendmail071|not sending email: %s%s -t < %s 8#@% 8 0 9@%(@.㿘& @$ 2& ⶔ    ` $ $ $ $ ,&  x$ |`$ xa$ ` "d@# B$ d "`$` $$, ``@ `$ `@% +$ ``Ā`$ `@  $ ``܀`$ `@ $ ``䀢$ *@GB $  _  耢 2` W 0`$ `$ @I1 d$ @$$  @  &@ 㿘 ? & m ""$ ` "` "  @"@$ @(&$@  2 $@2 x $ "  x@G  @F $ x " _/ x " @F "$@F$@" @P  ؀ "$@F$ @" @Pw  " @F 耢 @F-@FĐ``"`0!"```  "`    `" "` 2`"` "` 㿈 L Ғ 2s   ` `!@ h ` K2N   'N2 ' 2$@ K @D`@ Ě `  #\  2  \2 @J` 2 @` @*`J@ 퀦2` 2'"  Ě `  `2 `2 #\g 2 `@2&  㿀\ | 2ڰ  B @ S 2ʰ @`20/ `  ' ;  $ " $$ *` * 8`  @  `  d  t @  d @   $ `p@Ӓ l`$ " $$ *` * 8`   `Y@ U`;  "7  ? ?    @;  "  ` d@0` @ & &@   ?&     (T`    ` (T`{``@ x\   "``@`('䀢 #@ $ " $$ *` * 8` @0  瀧 '`  d  ɸ @M  d`@@ ``4` ʐ@ ƀ $ " $$ *` * 8`   @  䀢 䀢 2   @  '  ܀ ܘ ?    ?   @;  b +   X쀢T䀧`/-@ *  ?쀒   @: )  e d@I   쀢 `B ?  쀢䀌 &܀@   ?&&  ?'>` (T`  ٖ  +  (T`& @p 072|File empty; nothing to search073|Reached end-of-file without finding the pattern074|No previous search pattern075|Pattern not found076|Reached top-of-file without finding the pattern077|Search wrapped㿘`!=!.` €<<< = ==Pޫ 0@D078|Searching...㿘 =ha㿈`#\\d @Ț 2 ``  @  (  "$ @Cn$ |$  @ (  _ ` ( x8 $ @ $  ( x&$ @ $  ( x`$ $  @Д $  (`x @C-  @C'@C%$`x  0 $ $ , $ 2 !D`$ !D"` "aD !D $  $"`"$  J@  @ 2H  * @*  㿐#\ @&  @㿘`"  "` "@ @B@B   @B@BÐ 㿘\ 2$  C!D*@ 2< $ 28  @  @85`*' 2# $ 2  @ 4 `& 8  " `2&@0  $@    `2&@ 㿘!D " @B_  " @BY  "@BS`"  "` "@@BH!D 2  㿘 !D  @2 $ 2}  -> @` *` *  !X@Vː? `@*ʒ %@$ !>"$   @` *` *  !X@*? ` , (@* %@ !>"$  @` *` *  !X@o? `h2}%s㿘 !D2 $ ?`@`G  |     'S ` `? 'R Y 2`` ?`&``@ @* &@@F`?`&``@ @* &@@32 ` ?`&``@ @* &@@ "H` `C  |   'S ` `? 'R  2`` ?`&``@ @* &@@`?`&``@ @* &@@ْ2 ` ?`&`@* &@ @Ȓ2@ " `   ?"` 㿘"*! @@@@Ւ  ۰  &@BȐ&& 㿈&Θ쀢 쀠'`?   "  '' J ? ' 'J   B&㿘@w / 2 㿘@@<  Z @B. 㿘! (@7$ x& x``"  ?  㿘! (@$ x& x  "   #@  @   %lu㿀`0" @` @ * $$ @  8  "  &$ ` (*@  `  !@` `  `@` ` 2@`2. * * !X@   < ` ` '@ `   0 ̧ 2&    ̞ 2  2 ``0(`@8@ 8  ̄   㿘 !.` !`A"*` €@- @̒@e@ @?@?㿘 !.` !`A"ؓ,` €@ @:@@ @z@? "!`p㿘@ "`@ ?`, &`@ @2 `<&`H&`D  "a 㿈`0 ` *!  "a`42쀢 쀢 /6  ( @`8`0@h'` @ 'J @  `," `&`@`@" `<`4 `8@ `<`@&`D&`H 㿘@ 2  `@ `< &`H&`D&`@  "a㿈`0 ` *!  "a`4И쀢 쀢  9  @L0  `8?`0 '` ?@ 'J?@  " `<?`,&`D&`H &`@@ `8?&`8 178|No previous F, f, T or t search㿘B0K 179|%s not found㿘 `B "x* *  !X@q. vT@"$$hn $X$@$8$m@ ##pp##m ##h#`#PJD #@# lPD#"`0""lDH""lPD""pkD"`"H`0"@"(*@ " "l "!!!h!!p !!p(!h!P!@!&! )@   )  eD   h*d,  @ 2  gDRD@"&OC(xPD@"@(0D@"lPDH$D kDHp@8p@"O@ ,hD `', H(($, p@"< =8 D pX@ xD F iEHp`j,EP(> '\ jEj|Eu@"x`? P8] (&F4 F h8Ѩ 0D  x`}\D@ X@zXD@ 8 LD KD@OB"= ,D hA H0$ ۔D \F JD h? X@lPD0kDeD Ou@"x? h^ X0`p G F  hD X@ (x @@xZ`D@"hPMD @(VhD@"H  ~ reverse case[count]~ } move forward paragraph[count]} | move to column[count]| { move back paragraph[count]{ z reposition the screen[line]z[window_size][-|.|+|^|] y copy text to motion into a cut buffer[buffer][count]y[count]motion x delete character[buffer][count]x w move to next word[count]w u undo last changeu t before character in line forward search[count]t character s substitute character[buffer][count]s r replace character[count]r character p insert after cursor from buffer[buffer]p o append after line[count]o n repeat last search m set markm[a-z] l move right by columns[count]l k move up by lines[count]k j move down by lines[count]j i insert before cursor[count]i h move left by columns[count]h f character in line forward search[count]f character e move to end of word[count]e d delete to motion[buffer][count]d[count]motion c change to motion[buffer][count]c[count]motion b move back word[count]b a append after cursor[count]a ` move to mark`[`a-z] _ move to first non-blank_ ^ move to first non-blank^]] move forward section]][[ move back section[[ZZ save file and exitZZ Y copy line[buffer][count]Y X delete character before cursor[buffer][count]X W move to next bigword[count]W U Restore the current lineU T before character in line backward search[count]T character S substitute for the line(s)[buffer][count]S R replace characters[count]R Q switch to ex modeQ P insert before cursor from buffer[buffer]P O insert above line[count]O N reverse last searchn M move to screen middleM L move to screen bottom[count]L J join lines[count]J I insert before first nonblank[count]I H move to count lines from screen top[count]H G move to line[count]G F character in line backward search[count]F character E move to end of bigword[count]E D delete to end-of-line[buffer]D C change to end-of-line[buffer][count]C B move back bigword[count]B A append to the line[count]A @ execute buffer@buffer ? search backward?RE[? offset] > shift lines right to motion[count]>[count]motion < shift lines left to motion[count]<[count]motion ; repeat last F, f, T or t search[count]; : ex command:command [| command] ... 0 move to first character0 / search forward/RE[/ offset] . repeat the last command. - move up by lines (to first non-blank)[count]- , reverse last F, f, T or t search[count], + move down by lines (to first non-blank)[count]+ ) move forward sentence[count]) ( move back sentence[count]( ' move to mark (to first non-blank)'['a-z] & repeat substitution& % move to match% $ move to last column [count]$ # number increment/decrement[count]# +|-|# ! filter through command(s) to motion[count]![count]motion command(s) move right by columns[count]' '^^ switch to previous file^^^] tag push cursor word^] ^\ switch to ex mode^\^[ exit input mode, cancel partial commands^[ ^Z suspend editor^Z^Y page up by lines[count]^Y^W move to next screen^W^V input a literal character^V^U half page up (set count)[count]^U^T tag pop^T^R redraw screen^R^P move up by lines[count]^P^N move down by lines[count]^N^M move down by lines (to first non-blank)[count]^M^L redraw screen^L^J move down by lines[count]^J^H move left by characters[count]^H^G file status^G^F scroll down by screens[count]^F^E scroll down by lines[count]^E^D scroll down by half screens (setting count)[count]^D^C interrupt an operation (e.g. read, write, search)^C^B scroll up by screens[count]^B^A search forward for cursor word[count]^A㿐`0 2 " ` `4`<  N, 2I P  2A `Dɷ` 2 24   &`D+&`H`D     ٖ  &`D`0   >`H @ &`0 &`H`0  > @&`0 `4X#\   ֒ I @207|The Q command requires the ex terminal interface 㿘 (€  I(\   I L#  b P "  3 $ $$0x  `4`0(`` `4p#\  ~ @/<`4`<X#\  l I @>`4`<X#\  T J m @suspendX#\    6; JT @180|No previous file to edit Jћ     2 X#\      @8"@X#\   9   !0@8ɐ@p#\ ;   ך @!`0@ `,C#Ȁ@"@b`4p`< #\   J" $` e  2?  $'4@. ! /  x 8  L &`D P$&`H@;~`4p#\`<    "`$  e     $'@$'`   p0p #\ , #\ G  V @6*@㿘`  €@   㿐  K f`!T "!L!L *` * 8`   @ 2i       2_ @:$ ` ?"`* "@] QSR@=Y < #` ,  & ,| `@တ@r : 2-  x 8    @Ő 2  ` $ &$@=* 2 @ 2    @&㿐 L \  $ L $ P P ` $ P L`0&`D P ~` &`0&`H 㿐   @ 2= @ 4 @Q[  ° 0*  "` " ` "  ` 2( L`L  "`L@&  "$@&$&  307|No ex command to execute㿐 L    L   @)K   Lϡ      $  "$$$ 㿐 ` 2 @  2    `2&  Ò 2 & ` Ŕ`&  㿘 N 잔  "   Ė     X `*X 22222%#0*lo0x%0*lx0X%0*lX%+ld%ldabcdefABCDEF181|Cursor not in a number # +. + -( @( 00(   @Ԓ  4:  L 8" @ `      `2w&`P@=ؒ J`0+"`( J  X x2#K@" @ `   *L"@:` EJ `XLbx M bx I K@ 0``" @ ` & *:  8! 9Lbx . `#K@ + - @ "L bx   L @ b   xLd  D!L !  b03"00  ` *:  8 9' @?Ȑ 8&$x b @ ` $b  ` *:`@["  $@3z $` ` (T!  2' 9  x 2   t, x " $ t t x'(T!$(T @@-S- 7x|  t - |  `#" b  |`6   " W | '|x @ "x|@ǒ d$ Y @ + xx8  6 @:"/  'xx@ d`c c@,@,"@@,""@"@ 4'D @(` `` `thT >"hT@2R182|Resulting number too large183|Resulting number too small㿘`  `` N0 @2Nh+ 0' 㿘 @M!̢  &`$a,$a !H "!|@1 $aD    !D@,s!H!H$aH!| " !@4\ $a|   !,a!$a!$a 㿘 !0 "!D@1!D "!|@1!| " @1 ! @1@1ΐ&  㿘`1""`H`%"#L% " ! #D * * `8@ " "" * * `8@@@*Ɛ㿐`4   2    ?& P   *`" *  `č@x @& `4 & L쀢 쀢 2 ' `"  P @& P `0#\( `#`#d @ 㿘& P`4 P "    *`" *  `:@x @G & `4 & LB쀢 쀢 2'  " `0#\( `#`#d @2 㿘@  㿘@ x@   L `&  2\  2 ''D  & PP ` '*`" *  `ʐ2 L L/ 25  L 쀢 2,  L   2!  L & L 쀢 " L ?`0#\쀊( `#`#d @ x`0`4 >`< &`0 쀢  쀢 ܐ @ & `02`&`8! "!! *` * 8`2`4`4 " `4`4`8 2ܰ `4& L`8 & P  *`" *  ``5`2*`0`4`<@%`0" ``<`4F 2  "`0h#\ `#`#d@4 " ``4`<  Fi 2 `= `8 9`4 5 2~     `8(T! ' 耢 > x  t x "\ $ t t x'(T!$(T@*`8H  2G ``4`8 2= `4& L`8'& P`4쀢 쀢 2'* `8 :`0#\( `#`#d @    ` `thT >"hT@/_x@  & `4쀢  쀢 2'!   " H `4 &`<?`0&`@(`<#\ `#`#d@c x@K  & `4H쀢 쀢 , ' " `4`0&`"7  ] )"  < ( &   { [ ޔ } ؔ"< )  ("< ]  [ "<  }  {"< >  <`4' 'c 2   `2`    `Tƻ m `4&`< &`@2`<`8 :`<`, " `< @"`<`8&`D&`H`@&`D&`H`, "M  @"H `4`<@`<@`4  'Ѐ 24  Ѐ :`4- `4`<@`4Ȕ    ܐ @' ؐ"  ?J@    ؒ`?'܀ '`0  &`0㿈`, "`4 @"`4`8 "`0`4&`@&`<ꖔ`@ 2 `8`@@8`4`0 &`0`4  ~ 2`4`0( ``, @e "?  ` a h@0``"?@H ?> J  .?"6`,ۨ2٨ (ը !|J` H*:  2J` 2H "?H@2?J  `"@  2?2 `, "&`D @ &`<&`@&`@`4S`8&`D&`H&`<P&`@@*`4@@2!`,Ř쀢 쀢 = :&`8 `8?@ `,`2`,@> ) @ D!(`0 > @&`0&`<` `,  &`@ @"`<`4`8`<`@&`D&`H 㿐`, `4 @"`4`8 ?`2`0@e`4  &`4&`0&`8`4 |   2s `0( ``, @i "`8 ?  ` c S@0K`"?@J ?C J  .?";&`Dݢ2ۢ (ע !|J` H*:  2J` 2H "?H@2?J  `"@ 2? @* &`D&`H&`<&`@ 㿘` @, @+`@"! @)s  2  Đ  !| `@)`@#`@#&!| 㿘`0@@p`0(* (``0" ` `4`D% 2 `D`H&`4&`8 (T`2       (T`  ؠ? 㿘`0@@5`0(* (``0" ` `4`D  2 `D`H&`4&`8 (T`2   ֖    (T`  ؠ?  `πX ( 2  3  4  5 6 7 8 9*`(________㿘 h€ 186|No characters to replaceh``4 Ѐ 2: Ѐ2 `0XPõ /  ``8`4? &`<&`@@`4 F  $`@2 2 ؐ R 2 ?` +Y!*` € 耢    .!<&!@d $$d @  @2A Πڰ  հ ` ` (T!" x '̐ z̀ Ԁ  to x " $ t t x'(T!$(TԐ@"Ѐ'!@ "`4!@ 2`8`4&`@Ԑ`&`<`8 2~ `8ԐД"@'Ԁ`(' a "aa`*` * 8`Ѐ Ѐ  JԒ'Ԁ` 'J Ѐ А? 6Ѐ "$&`@ a "aa`*` * 8`2`4&`@ "&`@`4  @ '    ?&`@   ?&`@`4     ?  !<@)`4x` `` `thT >"hT@'`<`@&`D&`Haaaab bb b b b a㿐`4   !G  `0(`8`@`&`@`8?@2`@`, " @2`@@1 & 􀢀 ?`,`&`@`@"`<`4`8`, "`< @`4&`@`8&`D&`H`<`@&`D&`H 㿐`0("(`<` #`4&`@t`@ 2N `, "` @" ``8`@@8``0 &`0`&`@+ 24 `< &  "( ' 2`,`,@D!@  ?` &`@`@"`<`4`8`<`@&`D&`H 308|Enter to execute a command, :q to exit187|No other screen to switch to㿘$@@Z  @" #  2 # Z      "$ @ #$㿐`0(` `   2  " @1`4     " &`<@; 㿘`0(`<`? @Av   @' 㿘`< @Ah   @ 㿘`0(`<`? @AT  @  < @" D ,"" H 0 4@@ " 02 4 8:  4Dx @  8" D" H 8" D" H㿘`0( ``4@ "@ `@&`H&`D&`< @`4 㿘$@"0 @2`4@0y㿘`0(`4`@` 2`,@`4   &`< @"`<`4`8`<`@&`D&`H 㿘`0(`&  `<@;ޖ   `< `@&`D&`H㿘`0(`&  `<@;Ȗ   `< `@&`D&`H㿘`0( ` @   ""$`$` @  $X8*` *  0 $X @*6  *` * 8   8$X* * @*"  $X@*  ?`<@;w   `< `@&`D&`H㿘`0( ` @   ""$`$` @  $X8*` *  0 $X @)  *` * 8   8$X* * @)ѐ  $X@)̐  ?`<@;&  `< `@&`D&`H㿘`0`<( `@;   `< `@&`D&`H㿘`0`<( `@:   `< `@&`D&`H㿘@" 㿘@ search+%lu188|Characters after search string, line offset and/or z commandx`0@   @ p` / ?#@ "#8#8 *` * 8`"" ""  @x 2߰  x`8 ـ 2` L&`< P`,  &`@ @T `< `@&`D&`H $ `$!$  !`2 L@$! L  PJx܀ 2 $ ܀ 2&`H`  "l `<d&`<h&`<p&`@`<1 2`,`< `   O: &`H " @  @Ks`[ @L zc\" @ `    `2 Ӑ *`:  + ^  ;\   \   25   2, `<\@Œ 8   2  aȐ!2a`<`@&`D&`H`0 > @&`0   &`H&`D 㿘 ``"     @t 㿘   @j %s%s%s[[:<:]][[:>:]]㿐 !4 `   (T!" x' —  (  t tt x 2$ t1  t x'(T!$(T ]!0]]b@F : @@    ` `t@hT >"hT@#189|No previous search pattern㿐`,   @2  !`"!`" #\ `#\`4`<ݼ  `4`<Ϛ " `, ]pԒ  @#* "`< @ @  0`<`@&`D&`H 190|Search wrapped to original position㿈`4`<@`8`@@ ^ M "`4`0 &`0`4`< 8 `82`4`8`@@( `4&`4`@&`<&`8&`@''`4`8&`D.&`H`< (`@ &?&`<  ˘ 2 쀢  ?`4&`@'쀢  `8쀢@  `0 &`0?&`@ 㿐#L " #D#D * * `8@ " `, "`0 @"`0`8 "`0`4&`@&`<ጔ`@ 2 `8`@@`0 &`0`0( ``4R NJ{ `, "J @ }2 J?2<`{")`,0&` H&`4&`0&`8`< `@&`D&`Hx`8`4 '' 2ư `0( `  j   e 2 ?2[ `4@o`8䀢@k  ``2H ?2E   T 0 O0-?I̒ ݠ?B )?`T#`"x*` € ` `" `` 2 ?2   T  C   `4@ `8䀢@ @J ; `,&`< /&`@ @"+`<`8 2!`@ 2`42`@`4  &`<  ܀  ܀  ?&`@`0 &`0?&`@`4`8`<`@&`D&`H ((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((x`4 `8 2`4 `8 ''f 2 `0( `  ; 2ذ         {   2 p  ."  ? e !0QP ^ \8 ` )" ]" "" '`   2 `4s 2t `4@9`8@6 \`` " `!''` `   ) ] " ' V 2 |&`<`, ,&`@ @"(`<`8 ! 2`4`4 &`4  k܀  ܀  ?`0&`8 &`0  &`8`< `@&`D&`H㿘`4  㿈 L&`D P@^&`H 2Y  !`$$ L ! $$ $ P  *` * 8`2  $ " $ $ "$$ *` * 8`   #`#d#\  @  $*@$$@h   4 2`D$ @$$`D $ L`H$ P4Pa"a"a"a@"aD"a<"a@D"((aa : a !!  !"!a *a "   (.!"!@"<"@"D 㿘 4 M a& <a& Da & @ 8 < (  hl€  @ (  < *` * ?@"a?$a" " "" *` * 8` 2a @8  2  !a@a a$a 4aȰ 191|Abbreviation exceeded expansion limit: characters discarded 192|Illegal character; quote to enter㾨`xd`x` \'H`$d   @:$ (5$ $$  $  $ @  $ 5 " $ $ 2& " & $ 8`L $ `P$ d@ ' "  $ (' $ $ d@@   d    @@ ߰   $   $ $$ $ $d@d  *   $` $ $ $ $d    *      $ @/$ d@'' d " d|d|`* * `8@" dx`8" " dpdp`* * `8@ T ', 'd2  d@  *@'d d@'  /#/#d@'''4 '('( $`L  @&$`P ` H 0@d( Q 4 "d 2 '!\ `4@'4" ''Ē%!\%!X%!T@&@& ?` j"*` €d $&$d@&z؀ ɰ 0 @4 >d @ ` `!D  + 'd `2e  !% aT aL`* * `8@ `@aL `*` * `8@ J @" @& a a`* * `8@ `a `*` * `8@ J @"  "D$ 8  $@=$ 82 @O4  !'  c d@h'' $`. "!H*   !D!H "j%!D-`!D"* #"" " """d@ -`"!D* @``"  '    $( ? '( '(`?   ' ( $ 7$ ( 2' 0''`b   `D`2 @  '?`j!*` €dh@  @-   d@@cX  N   $@q o$ 8@T  @  0@, 2Đ0d2 (  d@@h(d "   ` ?$ $   $ 4$ $ 0 @-  d@ (@ 7$ ,4`x  J@ @  ,  $ ,J " , " ,B"@ J " , 29  , 1$ ,J " , " ,)   a  a`*` * 8` `xa `x `xJ J " "  2 0&`|& `x@2`|$`x"$`|& & ( d `*& ` x@u 2` `` `thT >"hT@    @Z    `8& \` X2 `"-'         ى "֐& `\  X@@@ \`X@  @  & \  & `& (X& '  ( 2! 2      Y "& d    'd*    `& &  @,  d @>`  *@ ` '` 'd@$* ($ $ ('d  $@ $ 8#   $  @  $ 8(d@(T  @  0@r, K0;d(  d@@(d  d ` ?$ $ d@@`x@  (d "    @   (" $ d @ Ȓ`x         ر "$   *@  ?$  @+  ذ 0  @d 2   @d 2 d  W`"  <`"" 0F`}d $@ wd''   h "'  @  ' '`^d $@ Xd     *? $  $ ("@  $ ($  `Ed $@?@  @Y  $ @d a$ 8 `x@(d kΔ$ #   *@  (   @ $ ($   2  `x@d J  $@(d  @ $$  @ (   @ (?`$   $ ( J? "  "    d   ( $ ($ # "  *   @J?  @ 8 (# ( $ ($ #   *@    J? v u    ?b ` _2'0 '0 @ c  ( $ ($ # "  *    @ ✐ ` _0 0C J? ? = @ 8 (9#  2  `x@]d   $@8  d@@  @ $$   (" @$ (#     ?$ * @ 8 #$ #  /#d$"@c  g d@ ' d*' ^, (   ?'i'( d'd @b  `   c `d@2d"  ` 5_12 2 T   0@9, 0d @"  (  d@@( "  ` _  d@ޔ `   (?`$ $ (  `'@u '"@'o$ $ d8@ I0 0 "     ' '       K "$ d  'd  *  ` $ $     '  'd@$2 `!`  @)^  h  "!\`!`2 '@c Y '!\ 2dT d@4   @4 @ 2 `!`2# $`L @ $`P@  - #  H@# " d@(Ɛdd*  $d%!Ld@   H"`D H" H@ x 0Dtttptdt@Ld$PPPPP8㿈'``$@ ` 0  ? , *" ` ?_? ` ? `2?_"?? ` ? `_  2?"``$2 @@Ē  D'@'@ 2@ #\  D 4/    2+    ߘ  " `"&` *` `(&`("  ``(   @C@ `( &`( `$@ " &`' 㿘` ` J  2``  @`$@2@  `$@2  @i  ? &㿘&``y`$ u` q@8#&`&`k&` " ## * * `8@` `?`  ` 2 2 @& ?`? L@  @ ꀢ` <  7 @u&@o&%$@ "" %@$@``"@"`&`&` ,@`  ,@` &㿐'P`' A  iP P8 'P `? 'P J@ "P P@2        '  "  @J @'   @B' 193|Already at the beginning of the insert㿘2 4@26lX / ( $  2  *   `$ $   ?&@&`"`@"@, `@'   㿐#Ā " ## * * `8@#| " #t#t * * `8@` @  `J  @$ ` * @ *`!]   ``@ @i%@@b$`$ `    (`` `(?`$`&` &`(`J? "` "`` @  `J  @3$ ` * @ *`!]   5``@*`   @$@ @$@$`&`  /@S ?  /@G ? 㾨&`  ` `` ` ``` L@  2` ```$  $@ ͔` "$ &`` * @,@#\      C  2 C` ,@ ,@ " 6 2  d@ @@@[@[ R@b  <  @2ΰ  d@Ȱ &@ϒ 2 ? (`-  `* ?@ @ 2 : @@@  " ݠ`@   ` ?,@`` ``("@&`&`( `(  ?,@`(` `&`&`(`2 + ```  $@ ` "W &````@` &`&` @@ '??  ?,@?` 29 @ 21 <  2* `( ?` ``  $@ ”` 2&` `` `@ ` &`&`(` / &`,@  %s %s%*s 㿐'L @'H@I / L@H$L` `$H`*  L@@I  H `%L @ @  * @ *`!]   ]  2 8`ߤ@< $ "@ *&$ '' 8,%nf@H` АhT`"    ` `thT >"hT@Tf @ ?H@  @H@ 2    Jn :;n9n7nL,`@ahD    ` `thT >"hT@T (H@@ !&h#T` Lnh;T`* nah0T`2ThOT ?%T $ &$ 㿐` 'L!]J@ ؀  @`L@! * *   '(Q```   `p` 2&`K `  "`L@ @@ ``&``(L@`&`(J`  $'L , ` * *  !X@CL 'L @,` ` $L+ `@#i 㿘@  `2`& L & L$& P @&$㿘` ` *``J   @"``$@J  2` ! ($ x @  x 2`(`` `"* `* ``"`" &`&`*`("` `` @ ` "  ```(  @  㿈@`( Ȑ?&`(` `*@ &` "`` '` @ *@ `@!``*@*  * a] @ '~ &`(`J`   `@  *  * a] @j'"c'" 'V``   `R` " &`"` @ `(@` `@ { ``(@`&`&`(J `   ??(  *@??`*'  * *  !X@@ $ ?`?    ?*@?` ' `( `"  &```( `  @ ) "'```    `` 2&` ``  &`2``` @  * ``(  @  ` `* `&`㿈 4 2M 8`4 `8&`D&`HJ?`\2 #p" J? \2 #p " #h#h * * `8@ @J "`" `4@J?`\"`4`8&`D&`HJK? 2 "`4K? \"  `4 `8&`D&`H o.!Ȑ`3!$* &$ 2b   @`4`8`D H`H''J / #\?`D  #\?`Dۚ 2`D& L`H& P . a  @ )  .` 2"  ?Ȑ# @2$  &$@& a@  @Ζ 2  h€  㿐@#`'``` 29  `@!%  2/ ` x@@$`'``  2   `@!  "@  @@ $*@&$ Unmatched %sx`& L`& P@k  2{ ؔ @)  2s ``?' 'ܐ 2g `) { ( %rk N   `` *` *  !X@q. > ڠ ِ?؀  ܀@*'  & P& L@ 2 "P ""H"H * @*`8 * *    *` *  *   @ ` `H @"J"`$@?D"I  2` "`"`$` 3  "` `( "`(`  #``( ` ` #` #` `(` ` #`#` #`(I   ```#`@#``$@2? " 㿐( / @ x@2``, @@ &(8  Ә @#@("@ " & &&(194|No more characters to erase㿘sV 㿐`0 `4(#`8!``&`H *&`H#@$@&`H? @O ` 2  `  ؀ ? @  &`D 㿐`4 f 2!  `4`8`0  `<"`@@ "`< `< ܐ 㿐     (T!" x'    t x 2$ tF  t x'(T!$(T@&@`@  @   a (*`@ ` / * o 2    ` `t@hT >"hT@ 㿘&`H   X`*X L"4㿘 , "a  X 2`0   *X@4   "44   `D В`D@ 195|Movement past the end-of-file㿐`  @@ t @̔ 0' 196|Movement past the end-of-line㿐`@  m `?@t @ 0 197|No cursor movement made㿘t 198|Already at the beginning of the file199|Movement past the beginning of the file㿘`t@ utʒ 0Œ 200|Already in the first column㿘u " J     201|Buffers should be specified before the command209|The file is empty202|Already at end-of-file203|Already at end-of-line204|%s isn't a vi commandWindow resize interrupted text input mode205|Usage: %s㿘.u"ؓ. €u u XupuG 0  u>0 u8 0u2 8HXhրրּ֤㿘@  㿘@ 㿀`0( ``4`8 '' 2   '  !`,@ D! `a` 2װ ? ?D"x%5D|     2 `,` `(@Y@0U  l נ?h`,   " ` 5񀢠_ 5  `_ 0  `_ + S :   ހ `,@D!(!P2 `,J "`,O    O   ?`, " @`4  `8@`4" `,&`<  &`@ @ 2`,&`@`, " `< @"`<`4`8`@&`D&`H 㿘@  㿘@ 㿀`0( ``4`8 ''p 2ǰ     2      ђ 2 w w?l  n  2 E t "\`,?   " ` 5񀢠_ 5  `_ 0  `_ * E ,   ހ   "`,A    \   ?`, " @`4  `8@`4 `,&`<` &`@`@"`<`4`8`<`@&`D&`H 㿘@  㿘@ 㿀`0( ``4`8 '' 2     2      O 2 w w? ~ n  2 E0 k \?   " ` 5񀢠_ 5  `_ 0  `_  < ,   ހ  - 6    ڒ   ?`4@  `8@`4 `,&`D&`H&`<` &`@`@ `8?&`8 206|No characters to delete㿐`4 l   x7  2 `0x' , (`@`? &`@`@?@*`8`8&`@` &`H`0" ``<`4 2  e 㿘`8`2`0:' ( ` "@ &`8&`8`@ `8?`0&`@b&`H``<`4 T 2  5 㿐`0" `3  `4<`< 2# `4 t `<`" @ & t`D   `0   >`H @ &`0 &`H 㿐`0(` '  Ғ  `4'`8&`D`0 *&`H` "'`$` $X * * `8@  ``$X `"  * * `8@&``@~ 2y ` -" . + `K ^% `E@T = @N 7 `0(@E  2Q `D @"J &  <`D `0(@/ 2; `D @"4  23 `D@    <`D @< # 0" 'S 'R  А   `(  0 @    4"<@"D"D"<< (a("a@"㿘  X`            $ "$$110|Vi command failed: mapped keys discarded231|Interrupted: mapped keys discarded236|Interrupted0`  L@0` @h$0  ``  h  ```  h`Ȓ`40@ 20` L@ `Ȑ "0d``Ȑ("```Ȑ >"`0 ! "*D % "0 " @"$H0!" D0D@ @$H @ 4DzH )D@nD$`LH$`P0@@@  @ 'H  " `  z  `(T`2`    2d`(T`"d`T  "T zPȒ dzx d@*@ $d` `` h`Ȑ`4@  2+ d( 7`$d` h  (T 2&d "`&@ `  *`" *  `2 Ȑ @  2 Ȁa?" @ 4Ȑ $`@j 2 0!` ?Ȑ# @4Ȑ@`T` *`" *  ` '` X' | `C"$(  L@Y`` @` |!*` €=~ ( @ "'0 cX "cPcP`*` * 8`2 0 "0 `*` * `!X@<ޔ  @  `"`(p`0 $0`L'`P'`L$4$D$<`P0$8 $H$@``@֔ "0`(T`2`    Ґ`(T`2`ː0 ((2`,<? $<`, $`,(@€ dF Β @"   @#G  W&   @ D,  ~ change case to motion[count]~[count]motion234|Only one buffer may be specified208|No command to repeat210|%s may not be used as a motion command211|Already in command modexب@ `? @   2& &&&&& $&$耢  쀊  '@ "0      @  耢 쀊 2'@0b.&0 @  耢 쀊 2'@"  `  0 @Z װ 0 (&0' @  耢 쀊 2'@'"4 0"  |   @d  耢 쀊 2'@0b.&0 @P  耢 }쀊 2'@  ~  , * `!X@ u B, "@ D .0("'0& 7&0  ~@ X ~2&( d "cc`*` * 8`|&( |!&( 2F0 . , * `!X@k耢   Ő& `t``,! 2 `00D 8&0&( @20|X0(h&`0&`0".`@ L hD2" @b:@ @  耢 쀊  '@0".&0 `[`]`Z>z @{  耢 쀊  '@䀢(2 ~ d "cc`*` * 8`|耢 |!Ȑ*  +  z8 @=  耢 j쀊  '@.✔ `  @ j 0 &0 @  ]耢 G쀊  '@.  |` "P*` * `!X@x5 6  @  *耢 쀊  '@.@ @      " `0 |  d@ @0#  ?????????'  @ Lئ@ '؀( 0( '@0'ؒ w(d'&0@(|0` &0 L &4&8  L@  &< < I c !Cs&@  ?m&@(!@'D"x&(  0  !А >&0`ؒ ~ L  P'''''''@€ 2O < `<  c !  : &@`&(0 !@!&0&0&,䀢   耢@( &4&8&< &@&4&8&<&@&D&H( @ @ה L&` 214|Windows option value is too large, max is %u㿘  (€  2r (\  $ " `  $$"  * * `8@" $a !`  $ 4!X * * `8@!X $`  $ 8$X * * `8@$X 4$ D$ <@ $ <$ D ƒ  4?$ @$ @ $ Ha @  "a <  *` ጑* ?@"   L" a"  a"$ $$aȒ`4aȐ   %d screens backgrounded; use :display to list them㿘 ``, ` ! "@z "!@` $`  "` @ $`"@$`$ `@2`$`"$``ڨ `@ $` "` @ $`"@`&` & `2` $`" $` H?1 212|Cursor not in a word㿐 L { 2j   P" @ `         `2   C & P@   @  ` _  "  :"  ` _   ""'a4 a0a4   $a0 a0@@&a0*@㿐@ D S C $0 Y  _0  c $ d _ c y/.@     @B*`"@235|Number larger than %lux/ %, *  ?Ѐ! @( 2# "  ^?  @  b `Ց, &  㿘  2* ?` ! #P*` € 2   hd€ 0@  ޖ  ` Ē $8888D$%7lu $@'L'P !\`8J $ "` !&@ *` *  *  *   @  4 :  2/ `L@ `'T " #  tpp a &@ *@ *`@ *`@ *`@ 萟:`@ lh"  8" *` * 8`2 ` `" "`` ?@t", " "$"$ * * `8@'`'`$@.'\"`  '\" *` * 8`0" @ `x@@| 8 XLh _L T@ L@T !&@ *` *  *  *  L : "@ 8P"@"T`~`&`&` .`/.`" \@  ~\ `" $  , *  !X@N ,  * a] @:Xl@萰 tp0E`T &`  l` "``3'l" *` * 8,` !@ . "+"@@2&"    l&` .`"` 'l" *` * 8`" 2 8@L 8"    " *` * 8` 0K" H >l   !'l`` #Ā  # * `8* @ # *`  * 8@$ *  * a] @h  lS 8l$?'lJ$@ Cl   !'l`  #Ā  # * `8* @ # *`  * 8@N$ *  * a] @Q h$ 8h  ll$@?'l&` .` &` .`L`T@ L@ T P@  "@T 8 h hx `? 'P'X'dަ l   $'l` ! #Ā  # * `8* @ #*`   8* @ߐ$"   * @ *`!] "ޒ"   2.`$$@.`.` $$@.` 'd&`h HT?F`$ 2 d =` !&@ *` *  *  *  L : "@$@ P$"@" """ *` * 8`2$T T$@ T` P@ "@T T`@  X9x X $,X,(h x,$Xxx ` *` *  !X@@P   @,`h & BP` .`&`&` .` * @ *`!] .` .`h`?&`.`\   b5X ,x$Xxx  "0 @,`xl@x $ ,X萰 tp㿀$  d  a`p aa@M)" """ *` * 8`2`` "`` 2- @` 2  ( a $@ + @ *`@ *`@ *`@ :`@ @t# 8 X `a@(" 㿈$  F " !`h"\!\h!\ `$!` 2h $!d@!thp!l!p7 4 @? h hXhp!hhl@ 4 @? !hhch!``^!\ $!``2!p 4 @? h hl@!ph!lDh 2Ah!` < @z!t G#@ *"@ *`" *  !x* "@  +$!t!d`$!x$!d 4 @? !hh!dc  $!dhX  4 @? !hhh€ 㿘 4 @?  萔  h€ %s 㿐$  !`!!PQ?hp 4 @? h hl@` @ 8 8 hX@ 8 @ "hXhh€ %.*s. ; 㿈$ @ hT ` hT hd€$hT$hT $hT$@`5``` h€  v ߀`h\  #@,`2h\  @ $*@`&$ h€ 0`2hp@g0` @ J?` " 4 2'  'X 8`?   P@ P @ ( @y $P'iJ J " "[X($  J  J  2  $ N " & J " "& & 2 " "  J?`."" @' 0@   (T`     (T`hh€   'H @ '!X 8  "@ 2[ 4 4.!\ 2!\ @ ? l@@k!!\`!T 5!%!\%!T!\ @@2!\!Ȁ ?!T? %!\%!T5!!\  @  4 @?  !\!T`%!\%!T (T`  f  H (T`v  H @? H ?\  ?x&=N "   ,* a] @@ $@,@X,*  !X@??  @?,@`?` 2Nx@  ,@X$@ H 2l\  l@%!X `4' p!Xt.x  &@!!X ` 4!!P   $!P$!X$`  h€  "$s @2 $!\ *@g&$$* @ '&$ (T`2#$    2$ (T`2$$" @`?`@@@@ 2< $ " !Ȑ 4!  @"!$ @&$!Ȁ "h\$ &$h\  $?# @&$!\  '!\ 4@ " ''$!T$!\$!X@p $!T$!\$!X p ` hpԟhT  ?$hThd@$@*@&$ L  `l "(\$ 2`l@_  "`lJ    `"  "` "@@N @L`l 2hȐ 4\  2 @'  Ȑ 4  @  4 '\  "@'' $T $\$X@h԰ Ё㿘 4 & a\   @@ "@ "( (t€ `  4 @? ( (@aT @@ @p 4 @?   h  4`       @hX!\$!T`$!\hl€h `2&@؟@ ]   2hd q/hT $hT   q hT $hT :`2&@+=+=+=+=+=+=+=+㿘 8`8   (\ (Xa(\  %.*s 㿘 @Ƀ  )@- $ @ $ $  l`2@$ l& l$ @ 2@@ $@" "@$  @0 b(@>㿘` `8  *@ !*`  *  "`   `  &`  㿘$ @  @"$ &$  "  " *` * 8`2  1" " 1"$&2 ` aȀ" aȐ `@9` aȐ 2a耦`  $  !`  @"   '$  2$`€ $  $$h$    $$!  L L   @ 24 $ @&$ D @ "  ! L@:*!@a @`2` V 4 R   < @@`@T" 蠄? < v& < @@ r@(m @5 @`2` * 4 & \  < @@W@`  a "a  ! ? < ?& < @@ ; 4 @? ( (l@ < D($ L  aa" *@ *`@ *`@ *`@ (:`(l€ < & <?" < D@8  L   L@ 0@("$!2 2 L <  2  @ <`2` 0E C??""@  @??"$!x 2r L <  2   @ <`2`* > 2;  a ??"_"@z ??U"܀ 2"    L'!`' <@S' <`2` * L 2' Lܐ(  '!`  <' L`'2` @1 <`2`   L 2 L   @- 2ٰ $ @&$" " "" *` * 8` 2t$  L   2h$  P@R a L@2* `@:&  <`"2`8  (  a" @ $`@ &$@ ڐ 2  !`@  ! L@2-$@()$ <`$@2`8᐀( ᐐ"` @ $`@&$ @ ($@  2[  !`@ $ @`" """ *` * 8` !  !""Ȁ 2  L2  P@ ؖЀ Ѐ 2   P Vؐ 'Ԕ"@ @     ? 'ؔ  * @ *`!]  dؐ   ? ,`@*`!]  `L ` ,` * ]  "@ < "@ \"S$` '" 2   K'ؔ  * @ *`!]  " """ *` * 8` 8  8?:$$" """ *` * 8` 8  8?:  (p̟ ! L " "  2  * @ *` 8  ?   P@" "`" * * `8@2  "   )$# "## * * `8@ M   * @ *` 8 # # < `8 "  * @ *` 8  8   8?   ".$ 8 :)$# #* $ `* `"   8   `" ,$ !! ' $   a($   @2 ?'$ ! 8Z L@T ̀?" H$ !!  ?,   a(, ?'$ !! 8$ ì?" Ā "$  a$ @  D @ " <@ 8( (l@ @`@ (( Ā 2  P$` &$T$ L$" """ *` * 8`2` `Ȁ  ` 23 `2`` 4 `Ȁ  `$@`@<` (̟`@w T (€ `$? >&$ȔJ @ 4Ȱ ??>>>219|Replace218|Insert217|Command216|Change215|Append%lu,%lu x A 4 @?  (   @   "(l  L` 8 L 2 ?29 ` *`* @ *`!]  :`}(#   bq b*  #   ` *`* @ *`!] $ :`|$8  ?`L /  9   bq(Xbl  b(Xb'L `* *  !X@*`:`|ː `8 *` * * a] @:`|(X L  (l@ 8#( #  *` * 8`8## 3@ܐ L  @l 2`$@ 2` ' 4 @? (  (Xc( ؐ (X؟# # *` * 8`2  #   X`2 * &تؠ$- 4 @? (#`" ## *` * 8`2 0   X`  bY(XbT(X؟㿘 " " *` * 8`2  " " @` 8@?"  " *` * 8`2 &@" "&@&@ 㿘  " *` * 8` ) 2 a a   @ 8@8@@ " "!"a㿐` 'H H` H  2'̰ ", " "$"$ * * `8@" " "" * * `8@"   " *` * 8`2  "  2M??' !`#Ā  # * `8* @ # *`  * 8@&@*  * a] @{ @ 8  $ @$@ ??'E` !`#Ā  # * `8* @ #*`  * 8@Ԑ&@*  * a] @zג @ 8  $ @$@ 2`   "5@ $@'㿐  ~ј    ?0  T @ 㿐 ~` ˰ ", " "$"$ * * `8@" " "" * * `8@ 8@h@ZQ : 8 $ `" #Ā  # * `8* @ #  *`   8* @/$@+$  * @ *`!] @ z-@ 8@* a 2 8  8$@Q ! ` #Ā  # * `8* @ #*`  * 8@ߐ$ *  * a] @y@@* %?80 @ 8@  &@ @$@ 2 ?㿐 ` `      ` @ ( @1"  < " <s @"  L?" L ?& L"  L " L  & L!Ȑ 4!!$! 4! L2$`4!$@2 `2! !\`( !Ȱ  04!Ȑhp􀦠"00@ @ 2 !Ȑ  4!@# "   @K h 㿀  <??!*??$ @ &$ jK`0 <'''䀢  2 @ʔ < 2 @`1 Ȱ '  < `'2`@ < 2 @( 2 <`8/ < !" !" !j" "    a" a"  a"   maximum option value is %d -- %soption requires a numeric argument -- %s㿀b `P'  @z 2aȘ @p 2] `&` 2 N"(@*`@ gN u2 NbP@ "  N <2  bX@  `( 4*@  @dΔ `"` @*5@ <J`"@*+@ 2 `(* N ^N `(`? `-   * `(*  &`  illegal gfmt1 option -- %sillegal gfmt1 option㿘 `@f `@c gfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d 㿘 ! @ `P `P%  8 @ @  2 @ɐ@$!@@s:%lxcflagiflagispeed%ldlflagoflagospeed㿐'H@ : 'H H+ 'H/-@y = 2,@,@`@vN@ c b@) 2N@s&  i2 N@b@ 2N@f& i2N@b@ 2 N@b@MU& $ l2 N@b @ 2N@H& o2 N@b(@ 2N@;&  ob0@  b@"*& ( P`  P' N@J@2  @ː 2  ? @  , 2 H H  H@)F N@ ittyspeedsizesanerowsrawostopostartospeedoldnlnewlcaseispeedextproceverythingekdeccookedcolumnscolscbreakall㿘@p@illegal option -- -%soption requires an argument -- %s㿈@L@ -2&` &```!' @ 2 # 2  ` !@(@   "  & &`!@(@  @ 㿘   D@ 㿘  " $@0 " `  & & & & $㿘@\  & 6 F $  ߆C w   " * +* -* 0" $"    " * +* -㿘   D@Ö 㿐    ``'@v   '``@n & 㿘 @\x @3 &  @$**@"" "$@$   """$ "     " "  " 㿘 @\? @,2 & 㿘  @0 @  ?` # & & 㿘@\!  & 6 D   $g`  ˒  " " " " $" %d %d 㿘 F"0@X D%d 㿘!"X@ @MTIOCSETD㿐 `'@Ԕ b@'$ TIOCSTART㿘@Ē`n b@' TIOCSTOP㿘@޴`o c@' xph ` X#P3H#@38203(3 #@@@@-mdmbufmdmbuf-crtsctscrtscts-clocalclocal-huphup-hupclhupcl-pass8pass8-oddpoddp-evenpevenp-parityparity-paroddparodd-parenbparenb-creadcread-cstopbcstopbcs8cs7cs6cs5xph`XPH@80(  @@xp ` -imaxbelimaxbel-decctlqdecctlq-ixanyixany-tandemtandem-ixoffixoff-flowflow-ixonixon-iuclciuclc-icrnlicrnl-igncrigncr-inlcrinlcr-istripistrip-inpckinpck-parmrkparmrk-ignparignpar-brkintbrkint-ignbrkignbrkxp`P@80( @@@@    @x@ph` X PC$HC@C$8C(-xcasexcase-kerninfokerninfo-nokerninfonokerninfo-newcrtnewcrt-crtcrt-pendinpendin-flushoflusho-tostoptostop-noflshnoflsh-icanonicanon-isigisig-prteraseprterase-echoprtechoprt-ctlechoctlecho-echoctlechoctl-echonlechonl-iexteniexten-altwerasealtwerase-crtkillcrtkill-echokeechoke-echokechok-crtbscrtbs-crterasecrterase-echoeechoe-echoechoxph`XP H @80( @@-onoeotonoeot-oxtabsoxtabs-tabstabs-onocronocr-onlretonlret-onlcronlcr-olcucolcuc-ocrnlocrnl-litoutlitout-opostopost㿘cP cP @/ 2    ` *@&`   &` U&`  2!`! @ 2    `*@&`  &` ;&` 2 `  @ 2    `$*@&`$  &` !&`$ 2 耢`  @ 2    `*@&`  &` &` 2 tablet disc; slip disc; ppp disc; strip disc; #%d disc; ispeed %d baud; ospeed %d baud;speed %d baud; %d rows; %d columns; lflags-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extproc-xcaseiflags-istrip-icrnl-inlcr-igncr-iuclc-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrkoflags-opost-onlcr-ocrnl-onocr-onlret-olcuc-oxtabs-onoeotcflags-creadcs5cs6cs7cs8-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbufcchars%s = %s;%-8s%s Ȓ& ```" `"@  @@  P@  ` @  p@  @Q@  @  @ `@@  " @   @ ! 4  `@@  4  `@@$ 4  `@@  4 ! `@@  4 ! `@@  4 ! `@}@ ! @s@  4 ! `@h@ @ 4 !( `@]@  4 !8 `@R@" 4 !H `@G@ !X4 @=@4 !` `@1@4  !h `@%@4 !p `@@4 !x `@ @( 4 ! `@@4 @"! `@@@ސ!  4 ! `@@! 4 ! `@ܐ@ @ 4 ! `@ѐ@  4 ! `@Ɛ@4 !Ȓ `@@" 4 !В `@@$ 4 !ؒ `@@( 4 ! `@@4  4 ! `@@ ! @@  4 " `@w@  4 " `@l@  4 " `@a@ "  4 " `@V@ @>"  "( @H@  4 "0 `@=@  4 "8 `@2@ @ 4 "@ `@'@  4 "H `@@  4 "P `@@  4 "X `@@ "  4 "` `@@ @"h(2 #4 "p `@@ #!""  4 #4 @ؐ"x4 @Ԑ" 4 @ϐ"4 @ʐ"4 " `@Đ@4 " `@@4  4 " `@@4  " `@@$ 4 " `@@4 @" `@@4 "В `@|@! @b" P` P%` @@ d@@b` @ 2`@G 0C@D  P P`2 "b d,`` " ` @%@t`( @c@i 2 ` @L @H` @ ؀ !"@<@9(㿘!B#H @/ $#HB"#L%s: %s %s %s㿘!B#H  B#L@#$#H@m#H@`H @ ##@ $#H@# #H@$#H%d㿘 ?  1B#@@ 0%B1 #Ȱ #@ M.#@ -*  ^* ? *4* ^*@**#@-aefgaef:g%snot a terminalTIOCGETDTIOCGWINSZgfmt1illegal option -- %stcsetattrTIOCSWINSZH@'H"" '#'H@?2 e"  f a b+ gb% ! ( @q  ' `@]  b@H*` @`bH*`@ּ bH* @'H `@  `@ `@0 `h@֔ `@T ؀` `H H` HHH''@ GH -+ 4Hђ .H (Hb  `  @S @#@W'@_  H`'`@*@1H 'H Ő  @ a@    `g@W @֐! usage: %s [-a|-e|-g] [-f file] [operands] 㿘 8`@ @. 㿘@ Ffhns.%s8@+)B'B%B!B#5/B97 -* c @€  %#X  $` $T $#P@@a8??\#P* @ & Ȁ "  . " `. @@a@@c @ @^@@?@Q aH@% <  "@@@  @@? `@@@ӫ%s: is a directory%s/%s8B#P`B@ U!HB#X`B<  B@#G #T`^#^#€ B<  B@ 5 /  @$B#`` B@< B ( x`2 B#\€ !H@ 0 usage: %s [-fhns] file1 file2 ln [-fs] file ... directory 㿘 8a@ @ 㿘@fRAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedadoscd9660lfsmsdosffsBEFf:NRWb:cdenrs:tvw%srioctl DIOCWLABEL㿈@6 '7!)D'T5 (#T-T+T%D/9T_'쀢 8Z* @€!,  @* $!,N'!,  @  E$!,!,  @  ':$!,  6% $ 2$$!,  @ )$!,!,  @  $!,'`  $`  %!,  @  $!,`, %`, $@@h??!,*@`&  $!, `  $   !, "D@!,D @` "   `@ݢ  !, c@F ?`*` € @@ @ΐ @~ @@o  @Ѿ @m @r@] @Ѭ  @o0`@@ ĐR? L@VLT0@`@U `c@ @  4/`, . @ӂ`m 'c@Ґ ? (`@(`  `T0@]L @@}!@ y @@KdXXXXXXXXXXXXXXXXXX0XXXXTXXXXXXXXXXXXXXXXXX8XXXXXHunknown disk type: %s㿘@8 a@+ @!&&& `&$@R DANGER! The disklabel was not found at the correct location!To repair this situation, use `disklabel %s > file' tosave it, then use `disklabel -R %s file' to replace it.A new disklabel is not being installed now.ioctl DIOCSDINFOwriting label to block %lld (0x%qx) lseekwriteioctl DIOCWDINFO㿐T ( ` @Q" !D @L"` @H"@E"  !W&&6@T` p6T`,   e`f@y  D ( x  i#D `#  aD + 3` @;   aD + 3` @ ;  @, 2H'  @* 6 #@' `m@8 6@t#@8 #H@tְ 0%, !' `m@  @tƐ# T ,`2  e`g@   #P@J 0 %s: No disk label on disk; use "disklabel -r" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of disk㿘 ( x   0 0@\"0@X"H0 @T"0@P"0@#reading label from block %lld, offset %lld disk label corruptedno disklabel found. scanning.no disk labelfound at 0x%lxioctl DIOCRLDINFOioctl DIOCGPDINFOioctl DIOCGDINFO㿘T `tD `  * 2`   :  @@ # @  @) TL @;c 4 @T c@  !W@ @  T@ *  bT(@ʐ#T(S"`"(   !W !2  2   #@ *  8#ذ (@#2 D ` `s@ T`0@2 T $`T 0e`r@є `H@!  0e`e@Ŕ  ``@  @o& Bootstrap doesn't leave room for disk label㿘`( 2 @"&`&`( @!@$ !Ԁ@ J c @ʷ *J\ :%.*s|Automatically generated label:\ :dt=%s:unknown%d:se#%u:ns#%u:nt#%u:nc#%u:sc#%u:su#%u:%srm#%d:%sil#%d:%ssk#%d:%scs#%d:%shs#%u:%sts#%u:d%d#%up%c#%u:o%c#%u:t%c=%s:t%c=unknown%d:b%c#%u:f%c#%u:㿘N``#cА @`N` cА @`#@F`8  (* `@`(`@`(@``,@` `0@`(`4`0@`8`8@`<`@@|`H`H@tc``J`X@jc``L`h@`c``N`x@Vc``P`@Lc``T`@B `\`',@6,` L  h)@975/-+@ 7@ȡ= @ @`@ ` a *@@ ` @ `  2` ` ,`@ѹ< ؔ@`@``@ ¢` @[@s `*`@R`K   %c: %*u %*u %c: %*.1f%c %*.1f%c %8.8s%8d %5d %5d %5.5s %5d %5d %5d %22.22s # %s # (Cyl. %4d- %uH. `@  !*`@ `?* : `  ܓ*` €' !0B`('`!0BD?' !0B'`!0B̉D' !0B`8'`!0B?' !0B'`!0B' ?!0B?`($@L' !0B艠?' ?!0B?@3$' !0Bp' ?!0B?`(@' !0B؉?' ?!0B?В@' !0B<' ?!0B?`(@' !0Bȉ?' ?!0B?@' !0B /?a8`!8/ #\`a@  : #l #\#`#d#h`Ȑ@a   h* `@u `@o  !  @% #`# a@@Oa `@I .ma(@?i `8`d!@M!0@2@<`8  ?`&  @& * *@C?`&  @&  * &@Cג!!@`8  @??@`8@  ?`&  @ * ** &@C ?`&  @ ) )* &@C ?`&  * &@C ѨDTTTԄTTTTӴ# %s: type: %s type: %d disk: %.*s label: %.*s flags: removable ecc badsectbytes/sector: %ld sectors/track: %ld tracks/cylinder: %ld sectors/cylinder: %ld cylinders: %ld total sectors: %ld rpm: %ld interleave: %ld trackskew: %ld cylinderskew: %ld headswitch: %ld # microseconds track-to-track seek: %ld # microseconds drivedata: %d %d partitions: # %*.*s %*.*s fstype [fsize bsize cpg] sizeoffset㿐T a@+` * ( a@ a(@`a8@ aH @`aX@ `X`a`@`X ap@`X ax@ ?`&  * & @B`(@a`,@ݒa`0@ؒa`8@Ӓa`4@Βa`<@ɒa`H@Ēb`J@b `L@b8`N@bH`Pb`@`Tb@b@`\`    ,``"`&  4 `', @ $, `@bВ #(#`b# #\@r` @    ``@@w # Notes: # Up to 16 partitions are valid, named from 'a' to 'p'. Partition 'a' is # your root filesystem, 'b' is your swap, and 'c' should cover your whole # disk. Any other partition is free for any use. 'size' and 'offset' are # in 512-byte blocks. fstype should be '4.2BSD', 'swap', or 'none' or some # other values. fsize/bsize/cpg should typically be '1024 8192 16' for a # 4.2BSD filesystem (or '512 4096 16' except on alpha, sun4, amiga, sun3...) No changes.re-edit the label? [y]: !@?@b ?@'#@ɒ| @㿐 `@J@Fs b@b@@:-/+LP) !@ʪ@ @  ْ@1!`n @@x p`@?`? "`@ ?  $? ? n%H`? $`@H  $H` 2` n N@+  @LT 2`@P@Ԑ sh-cEDITOR/usr/bin/vifailed to start editor%s %sfork/bin/sh㿀b''"'@ə' #@ba@]@א  @#I c(@^' @Ȫ  @ȧ  @Ȥ 1 ( #@ @5 & x#8@@} @#0@А '@ː@3  ``@:  @u  @r  @o 䀠 `? 㿘@`L  㿘 @ŒL   , @͒L  # line %d: syntax errortypeIDEline %d: warning, unknown disk type: %sflagsremovableeccbadsectline %d: bad flag: %sdrivedata%d partitionsline %d: bad # of partitionsdisklabelbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindercylinderstotal sectorsrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: bad partition name: %sline %d: too few fieldsline %d: bad partition size: %sline %d: bad partition offset: %sline %d: warning, unknown filesystem type: %sline %d: unknown field: %s㻐&`  &`a@L ,$ "@m : !@  ,a@y 2 "a@Ht "h (`<@@ "`@Ha v(`@*@@F: '!@Ԓn6`a@yw :'􀤠3L /-+'#א@yc  '@yZb  '@yQ  'b@ L 0&`Xb(@y9  &L "`\@E,`$  `L `b8@] ? "H@d 6``6`#`bh@x  `bp@x `@G bx@x @E 'a"&`("@0˨ b@xԐ @E  '"@ &`,b@x @Eo  '"@ &`8b@x @EZ  '"@ &`0b@x @EE  '"@ޒy w&`4b@x @E0  '"@ɒd b&`<b@xk @E  '"@O  L6`Hc@xU @E  '"@9  66`Jc@x? @D  '"@#   6`Lc @x) @Dِ  '"@r    6`Nc0@x @DÐ  '"@\ &`Pc@@w 2 @D  '"@G &`T L  *`: `@ `Ȑ#X6`*` @>@D  '#@ &@#x@ %@Dg  '#@ $4, `h `P@  @ "`@Fe h`@*@b  `  @D6'$@ : ' #ؔ@ʒ' ,  "^#YӐ@D Q$#x@H @D@Ȅ'>, #x@5 @C -$#x@$ @C@_'􀤠, #x@w @Cΐ 4$@: 6` @f #@Fq >@`?sector size %dsectors/track %dtracks/cylinder %dcylinders/unit %dwarning, revolutions/minute %dboot block size %dwarning, boot block size %% sector-size != 0super block size %dwarning, super block size %% sector-size != 0warning, number of partitions (%d) > MAXPARTITIONS (%d)warning, partition %c: size 0, but offset %dwarning, partition %c: size %% cylinder-size != 0warning, partition %c: offset %% cylinder-size != 0this architecture requires partition 'a' to start at sector 0partition %c: offset past end of unitpartition %c: partition extends past end of unitpartition %c: block size < fragment sizewarning, unused partition %c: size %d offset %d㿘 (  #x , 2 0# 2 4#@   2 H#@   H 2 8#@v  8 2 < ,@ 0& 8 < 2  8@ 4& < #@^  @1 ( @U   8@M  @  ( @D P ` @=   \)@ 753/-+  a @&= @ 8 ,`:`@ @ 8 ,`:`@a 2  "    @!X  <@,`:`@ ᘦ  < ,`:`@  2    ,`:`@ a @  4, !a  " @ ͐"( h`!@&Ȓ!@!Ȑ'`LX'P'T7'@b! usage: disklabel [-nv] [-r|-cd] [-t] disk%s (read) disklabel [-nv] [-r|-cd] -e disk%s (edit) disklabel [-nv] [-r|-cd] [-f temp] -E disk%.*s (simple editor) disklabel [-nv] [-r]%s -R disk proto (restore) disklabel [-nv] [-r]%s -w disk dtab [id] (write) disklabel [-nv] [-N|-W] disk%s (protect) `disk' may be of the forms: sd0 or /dev/rsd0%c. `dtab' is an entry from %s, see disktab(5) for more info. /etc/disktab`proto' is the output from the read cmd form; -R is powerful. For procedures specific to this architecture see: %s installboot(8)x'`b( @a@ #`,bH@bP@b@!"@?@c@c@@cx@c c@(c@`8@`x@@  (   @*`2 RAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedadoscd9660lfsmsdosffsout of memoryYou need to specify a type for this disk.can't run when there is partition overlap.No 'c' partition found, adding one that spans the disk.This platform requires that partition offsets/sizes be on cylinder boundaries. Partition offsets/sizes will be rounded to the nearest cylinder automatically. Initial label editor (enter '?' for help at any prompt)> unable to get default partition tableThis option is not valid when run without the -f flag. PAGER/usr/bin/lesswunable to execute %sIn no change mode, not writing label.No label changes.Write new label?Write the modified label to disk?yunable to write labelRecalculated free space.FilenameName of the file to save label into.cannot open %sNothing to undo!Last change undone.%s expert mode EnteringExitingUnknown option: %c ('?' for help) 'P0@Ŕ!P    @5   @/    @)  2cx@ c@,@1((@w$@y@   c@  䀢 2@#`8$  7$ l'$ , 4 , @ؐ `' z'z 2 7z@Ð `@Y!05@9$@A?   ?`$ * &@8k  q/0/1!@ɒ @Ð @*`:` p=* Ò@€ #p@uȒ!@@!`@9@6@@N! `@!`ِȒ!@!@@#@2! 2АȒ!@ؐ!@Ԑ@v@! 2uȒ!@!@e`r@ @\@ !Ȓ!@@!`@ː@Ȓ@<@! `@!`3kȒ!@!@|@ @Ĕ! 2bȒ!@j!@f,(@q@! 2IȒ!@Q@M!`@v@s@ٔ@! `@5!`` !8@7֒`@R@O@<@k "@B  L@ @ @ܐ!p L !xa@S !"@ @@Ð!@ K@ T ,`!`P@K@! 5!@(ݰ %# @b(   `(*  R  y n   (*`@ R` y L ސ @! @ ,"0 @ m@"H4 "hbx@ L $a@Aܐ "@ג@Y@! Ȁ` @ @ع"Ȓ!@M!@I!@E@ "`@k@؟"T ,`@ؖ!`P@@s! L@؃! Y @"0@ !D`?`""#@M Ȓ@!@!@L@@:# P H<T     ( H   \No space left, you need to shrink a partition Partition must be between 'a' and '%c' (excluding 'c'). Partition '%c' exists. Delete it first. partitionThe letter of the new partition, a - p.Partition '%c' already exists. Partition must be between 'a' and '%c'. Please re-enter an offset and size for partition %c. 㻘  @5`0 N    , Đ `@c p0 `E  `AĐ @Ua0 -Ā` +Ġ   , @`2  "    a//%)'Ē@4 p@@-aP N,  ` @ @!x   6 ,     6 & &&& & @ &.  . $  &. 6@ " {&$&@ .   +  ". +      "  +  2  `+ . @[  2N& ϐ@J Đ!@ a&&@ 28&@c 21&D `" 2@ 2"&@ 2&@ 2&C" & @ ? @Cpartition to nameThe letter of the partition to name, a - p.Command aborted Partition '%c' is not in use. You cannot name a filesystem of type %s. 㿘Ő"0bH@; 2J"x@4`07*   & Đ a@%`0&    `Ő b@0 `   * a*@ Ő @b0@partition to modifyThe letter of the partition to modify, a - p.Warning, need %u sectors but there are only %u free. Setting size to %u. Please re-enter an offset and size㿈Ɛ ` @ 2J"x@4`0,`    `' ' '' @&  Đ a@`0    Ő b@0@ w    `  " ` `      ƒ`P @f , &" &@d D@ 2T$ N$@ڔ @E $ $@ #D `"'   2! @L @   2 @  $$ $ $  Cc @? @ϐpartition to deleteThe letter of the partition to delete, a - p, or '*'.You may not delete the 'c' partition. The 'c' partition must exist and should span the entire disk. By default it is of type 'unused' and so does not take up any space. 㿘ǐ `@ 2J"x@2`0q*!  j" `  " "``""` &"`"`"`"` `0O   .Đ a@`:` `  ` Ő @nb(`   P@2`` CcC#      ` &" " " " ` .@ @)&@device: %s type: %s disk: %.*s label: %.*s bytes/sector: %ld sectors/track: %ld tracks/cylinder: %ld sectors/cylinder: %ld cylinders: %ld total sectors: %ld free sectors: %u rpm: %ld %d partitions: # %*.*s %*.*s fstype [fsize bsize cpg] sizeoffset㿐T .@͐# !* @Ő# ǔ  @#0ǔ  @뻐#@ (@뷐#P ,@볐#h 0@믐# 8@뫐# 4@말# <@룐#@럐# H@뛐# @뗐 >ːȠ`X#\Ȓ P@뇚  #`> 㿐@ Cb#CcC# `@@   * @  8? @ ?   + @@  @  #@S    "&@+  "@ @    +  +   `+ &@@partition to change sizeThe letter of the partition to change size, a - p.Partition %c is currently %u sectors in size (%u free). new sizeSize of the partition. You may also say +/- amount for a relative change.Invalid entry Only %u sectors free, you asked for %u 'c' partition may not be larger than the disk 㿐Ȑ#c@ 2Jj"x   ,Đ a@`0o `  Ő b@0c@@~#@ 0 ` ` @#\`  #`@ڒ??/"x2@) 9 `   # @ ɐ @\`0'" &@"@ @ &@ ` <  @0`0`Cc  $@@˔? @㿐@  @CC#c  @ # `@@@"@%s: [%s] 㿘B ɤ#*ch'򀦠#p@Hch$@96 2ch ` ,ch X ?4  " X* $ X @/ $ ch@ $Lh?L ", Lh ?h@Ɛ Lch Lch@8E#,#Lch ?ch%s: [%u] Rounding to nearest cylinder: %u 㻐 8` \@  H/+ʒ@逐a0$@8Ԕ  ` /X ?4  "X* $X @/@ Ӱ?@ ?L@ O ,@O ?O@dO ? *`O `tr p`&? @   (*`@ `?* : ` ː!t*` € 8 (,@  ($ ( (@E,@O + -   ! ('$ x@ x "4?J` $ x-? ' B" '@Đ ' " 7ā@' B'-:  + -"'`@?> '"B 8' "B"B"7ƅB' B' @y"8@r" @l"ʐ!@@葒+++H+H+H+0+H+H+H++H+$ Error, partitions %c and %c overlap: size offset fstype [fsize bsize cpg]Disable which one? (^D to abort) [%c %c] 㻐@ܒ  0@O @`@ s  ˑ-`,`@@   `l?l""@2 2``a`aᨒ@+@;!В  艚   肚 Ŧ/ˤ -`'%"$* @H/$@7Y O X` ?"` X* $ X@-̐ # O` ڐ?*  *  @ @ @&`@ -`(2 @@ː Changing device parameters for %s: disk typeWhat kind of disk is this? Usually SCSI, ESDI, ST506, or floppy (use ESDI for IDE).IDE"%s" is not a valid disk type. Valid types are: "%s", label name15 char string that describes this label, usually the disk name.sectors/trackThe Numer of sectors per track.tracks/cylinderThe number of tracks per cylinder.sectors/cylinderThe number of sectors per cylinder (Usually sectors/track * tracks/cylinder).number of cylindersThe total number of cylinders on the disk.total sectorsThe total number of sectors on the disk.You may want to increase the size of the 'c' partition.Not enough free space to shrink by %u sectors (only %u sectors left) rpmThe rotational speed of the disk in revolutions per minute.interleaveThe physical sector interleave, set when formatting. Almost always 1.`!@T@Ӑ  ;975/ *` Ғ` "I@5!    a  , @5w 2  )@櫐 @@-ࠠ #)̦a%̑, @某!X `@,`  , `` ?"``* $`@,d   6 !hax 2 "x@,ђ`0" &@`@,Ȑ"x@!0ޒ@5 . ')'%# ,#\#` !Ś ?〤?@,` ,& ,)'%# 0#\#` ! ?ˀ?@,` 0& 0)'%# 8#\#` "(@ ??@,z` 8& 8)'%# 4#\#` "} ??@,b` 4& 4)'̀ >c <"@ ̐ @cP <" 4 @  4@ #\#`L ?j?2  < @,.` <#CΔcˀ @$ @&@@Ԑ#c8$c& <)'%# H#\#` # ?  ἑ.`@36 ",6 ``(.`@h @@* !̑.`@@^!X` !`@*``.`` ?"`* $@*# Őc؁Starting sectorThe start of the OpenBSD portion of the disk.Size ('*' for entire disk)The size of the OpenBSD portion of the disk ('*' for the entire disk).㿐)'%C!##\ <"#` x⸔2 <"x@*^`0' -+#C')c"@" #\#` \c2 <x@*B 0 "@c $c$@i㿐W 2C#CCch"ch" " L"   ` 1CC##h&#h  " 64#hCcC#h(@ *2 @ *@``  #``#  *@` ##  *2 &ّ*#h( "@& @y <CC "#CC  "@ @    "  #  c* @ "@ `@ The 'p' command prints the current disk label. By default, it prints the size and offset in sectors (a sector is usually 512 bytes). The 'p' command takes an optional units argument. Possible values are 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, and 'g' for gigabytes. The 'M' command pipes the entire OpenBSD manual page for disk label through the pager specified by the PAGER environment variable or 'less' if PAGER is not set. It is especially useful during install when the normal system manual is not available. The 'e' command is used to edit the disk drive parameters. These include the number of sectors/track, tracks/cylinder, sectors/cylinder, number of cylinders on the disk , total sectors on the disk, rpm, interleave, disk type, and a descriptive label string. You should not change these unless you know what you are doing The 'a' command adds new partitions to the disk. It takes as an optional argument the partition letter to add. If you do not specify a partition letter, you will be prompted for it; the next available letter will be the default answer The 'b' command is used to change the boundaries of the OpenBSD portion of the disk. This is only useful on disks with an fdisk partition. By default, on a disk with an fdisk partition, the boundaries are set to be the first and last sectors of the OpenBSD fdisk partition. You should only change these if your fdisk partition table is incorrect or you have a disk larger than 8gig, since 8gig is the maximum size an fdisk partition can be. You may enter '*' at the 'Size' prompt to indicate the entire size of the disk (minus the starting sector). Use this option with care; if you extend the boundaries such that they overlap with another operating system you will corrupt the other operating system's data. The 'c' command is used to change the size of an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. You may add a '+' or '-' prefix to the new size to increase or decrease the existing value instead of entering an absolute value. You may also use a suffix to indicate the units the values is in terms of. Possible suffixes are 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, 'g' for gigabytes or no suffix for sectors (usually 512 bytes). You may also enter '*' to change the size to be the total number of free sectors remaining. The 'D' command will set the disk label to the default values as reported by the disk itself. This similates the case where there is no disk label. The 'd' command is used to delete an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. You may not delete the ``c'' partition as 'c' must always exist and by default is marked as 'unused' (so it does not take up any space). The 'g' command is used select which disk geometry to use, the disk, BIOS, or user geometry. It takes as an optional argument ``d'', ``b'', or ``u''. If you do not specify the type as an argument, you will be prompted for it. The 'm' command is used to modify an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. This option allows the user to change the filesystem type, starting offset, partition size, block fragment size, block size, and cylinders per group for the specified partition (not all parameters are configurable for non-BSD partitions). The 'n' command is used to set the mount point for a partition (ie: name it). It takes as an optional argument the partition letter to name. If you do not specify a partition letter, you will be prompted for one. This option is only valid if disklabel was invoked with the -F flag. The 'r' command is used to recalculate the free space available. This option should really not be necessary under normal circumstances but can be useful if disklabel gets confused. The 'u' command will undo (or redo) the last change. Entering 'u' once will undo your last change. Entering it again will restore the change. The 's' command is used to save a copy of the label to a file in ascii format (suitable for loading via disklabel's [-R] option). It takes as an optional argument the filename to save the label to. If you do not specify a filename, you will be prompted for one. The 'w' command will write the current label to disk. This option will commit any changes to the on-disk label. The 'q' command quits the label editor. If any changes have been made you will be asked whether or not to save the changes to the on-disk label. The 'X' command toggles disklabel in to/out of 'expert mode'. By default, some settings are reserved for experts only (such as the block and fragment size on ffs partitions). The 'x' command exits the label editor without saving any changes to the on-disk label. The 'z' command zeroes out the existing partition table, leaving only the 'c' partition. The drive parameters are not changed. Available commands: p [unit] - print label. M - show entire OpenBSD man page for disklabel. e - edit drive parameters. a [part] - add new partition. b - set OpenBSD disk boundaries. c [part] - change partition size. d [part] - delete partition. D - set label to default. g [d|b] - Use [d]isk or [b]ios geometry. m [part] - modify existing partition. n [part] - set the mount point for a partition. r - recalculate free space. u - undo last change. s [path] - save label to file. w - write label to disk. q - quit and save changes. x - exit without saving changes. X - toggle expert mode. z - zero out partition table. ? [cmnd] - this message or command specific help.Numeric parameters may use suffixes to indicate units: 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, 'g' for gigabytes or no suffix for sectors (usually 512 bytes). Non-sector units will be rounded to the nearest cylinder. Entering '?' at most prompts will give you (simple) context sensitive help.㿘?* : `6S*`א"< €@"0@#0@ 0@"0@"0{@!0w@ `0s@ 0o@ݐ"H0k@ِ#00g@Ր 0c@ѐ"0_@͐"0[@ɐ#X0W@Ő h0S@ 0O@Ľ!x0K@Ĺ"00G@ĵ"0C@ı#@Į#0@ī#P@Ĩ#@ĥ#@Ģ#@ğ @Ĝ 0@ę P@Ė x@ē @Đ @č!@Ċ!0@ć!P@Ą!x@ā!@~!@{!@x" @u"H@r"\\],],],],],],],],\ ],],],],],],],],],],\],],],],],],],],\,\<\L\l\],\|],],],],],\\],[\\\],\],\] ],]㿘'  @ "@@u@ @1 $@x@ː @?@ ` "`@$@`<@㿘   `" `2 @[ݐ ` ``  /dev/%s%s%s%c %s %s rw 1 %d x @ |   , @ " "@ "    `eآ 0@^)  N r ؔ8@$@( / "`N@`r2G ؔ8.@$@`.@@?,ܒ @Y" @,a  )  " @bP|   @*  ` a*@ @#\#\@vv  `@ 2@@m Starting sector for this partition.The OpenBSD portion of the disk starts at sector %u, you tried to add a partition at %u. You can use the 'b' command to change the size of the OpenBSD portion. The OpenBSD portion of the disk ends at sector %u, you tried to add a partition at %u. You can use the 'b' command to change the size of the OpenBSD portion. This architecture requires that partition 'a' start at sector 0. 㿐.` ش`X"X!-+)'% ` #\`   #`< x@!" % 2C`@!  ` #  @uɒ" ` C#  @u( ` ` @u ` $` Size of the partition.Sorry, there are only %u sectors left The OpenBSD portion of the disk ends at sector %u, you tried to add a partition ending at sector %u. You can use the 'b' command to change the size of the OpenBSD portion. Size may not be larger than %u sectors 㿐.` %%#ـ``2   < 7  "N$ " @&E$ِ @u@b( P a8#\``  #`? ?"x@ p`&   @ g` " ِ @uaP  Cc ِ @uax $ fragment sizeSize of fs block fragments. Usually 1024 or 512.Zero fragment size implies zero block size㿐.` -+)%'`#\#``, ??"x@  @ ` 2$`@ H$` block sizeSize of filesystem blocks. Usually 8192 or 4096.Error: block size must be at least as big as page size (%d). Error: block size must be a multiple of the fragment size. Error: block size must be at least as big as fragment size. 㿐.` ` 9, J "x@`C 7)5/-+ @@#\#`! 淪0?߀?@Y<: @Y7 @t9h @A @D a@r  @:,  cpgNumber of filesystem cylinders per group. Usually 16 or 8.㿐.` ڪc#)#%   #\#`R ??"x@9`  24 @2`  FS typeFilesystem type (usually 4.2BSD or swap)Unrecognized filesystem type '%s', treating as 'unknown' FS type (decimal)Filesystem type as a decimal number; usually 7 (4.2BSD) or 1 (swap).㿐.`  ` `(!*` ې p`x   , @@'D 2 ,` 'ے@v  !,` "x@ʒ` +)'% ` #\#``!Κ ?ꀤ?@ ` ,`  mount pointWhere to mount this filesystem (ie: / /var /usr)noneMount points must start with '/' 㿘. `E A ? = ;.#!ۀ /@ @@O *&@cx@Ɛ "@f`@bp"۔"  "x@U` b@& 2N@  @&@ 㿘 2 @@ 2  2@ `?@WCan't stat deviceioctl DIOCGDINFO8@'? ܒ`x@ @wݒ! #ecx@g `r@? 6 &@`e@8 6&@ܒ`@ &[d]isk, [b]ios, or [u]ser geometryEnter 'd' to use the geometry based on what the disk itself thinks it is, 'b' to use what the BIOS says,or 'u' to use the geometry that was found on in the label.dBIOS geometry not defined. Note: user geometry is the same as disk geometry. You must enter either 'd', 'b', or 'u'. 㿘  ܐ!HapH 2 g"x?* : `3dݐ *` €2(U" & (,& ,0& 04& 48& 8<Q& <`2`(B" & (`,& ,`0& 0`4& 4`8& 8`<>& <2(/" `& (,& ,0& 04& 48& 8<*& <(`(@%,`,@ 0`0@4`4@8`8@<`<@ "@@'`0"x@!`sts`ttttttttttttttttsttttttttttttsts`tttttttttttttttts㿘 " " " "   <& 㿘@9Failed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed chdir to %sFailed stat on %sCannot write an archive on top of a directory %s`"Ā?"@ h?TTT $"""8"#!" ؀r#bߐ ( € ݐ!"b$"Ē @!  $" ( xݔ@J "ĀR"`N @ K"Ā  ݐ" "b$"Ē&@!  $" ( xݔ@Iސ "Đ $"Ā+"`' @t $"Ā  ݐ" "b$"Ē @! $" ( xݔ0@I  "ݐ"P """Ā ?1" "T@  ( x"X@I T!آ"@ 6   ( x"ݔp@I "< @ "ݒb@IL "@??$"$؀@2 "a@   @"Đ $Ȓ  @ؖ ?2 $Ȁ2 $ ( x`2$ Ȁ`2$ h  `" "h"bs#"iߐ *` €c? h  a""#hZ"ba @>c? !"""b h !Ȁ ">"#h?;"ch h !"  : a@c 0@%"?""%1>$""  : a@c 0@"  h $" h ?" &#h&#h""ch"% $а {zzzzwLwLwxpx%s: Waiting for tape drive close to complete...done. %s: unknown format, %qu bytes skipped. cpio%qu blocks tar%s: %s vol %d, %lu files, %qu bytes read, %qu bytes written. 㿀bĀ   TT"""a"b䀢 # "Ȁ`#"Ѐ`'|?`" * " @A #|@oq`@|#b؀ T!@  <    4 0 @b$b h`# ` !"܀ @ "ܒ@ǘ @"䀢`"Ȁ`2 T! |@{  |@"bT!Ȓ?$T̀  l"Ȁ`"b̐ "b"䀢 f"""Р`'|?`" * " @Ő $"`l !"c|`@n@~|>"b#@S!  a |  @a % @nȒ0#@S!( %`l#b̒a0Ș?|#\#`#d@n#h@@|$?c"Ȁ`bЀ   %#?Ē@? 4$ЁUnable to truncate archive file㿘""bԀ 1"Ĕ  @    "@f7    ( x@GV ?Cannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s spec㿘"Ȁ`Tb`@F ?"8` "#b@F ? Failed read on archive volume %dEnd of archive volume %d reached㿘"Ѐ 3"Ȁ b@ T  ""!Ȁ!"T""8b@z T "a $" ( x"̔H@FҐ 0"cp@F Write failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWED㿘"Ѐ bĢ @  T"a"6$"$""Ȁ @ & : !bĔ  @ג .  > b b@e( $  $"Ѐ  ( x?倢` E0  ( x  `@F  $"C    $"а  "T "aԀ  `@E 0' "cp@E 0  ( x"̔@F 0 l``"@ a@Eɐ 0aP@EŐ Cannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.㿐T!Ѐ`g?bЀ b `h? WcT!ȀT "a"Ȁ 4=#!Ȁ9T" #!2$b7  a'@+ 6&$%Ѐ #!bȀ %"%Ē  @  > @`c@ dĒ@   $#!Ѐ `H@E9  `@E3 ?Foward positioning operation on archive failed㿘  >2@ `(= "Ѐ 45"Ȁ`21 !"Ē  @   T!ؖ@ 0C 4 2 > 4(>0@ b >0  "@    ( x @E0?$bа?Reverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsTape drive unable to backspace requested amountUnable to backspace tape %d blocks.㿐"Ѐ 6"Ȁ K  { `(y$А @Dcp? !n `(l$"Ĕ  @    ( x @DX?b "̀` @DYcI?    "@ B  ( x @Du7?@r 1 ""0 `(.$Т :`@_G@ @D+`0? 7@]' a@ߔ    ( x @D?`?$?$а Unable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Unable to backspace tape over %d pad blocks?c"Ъ `'?cĒ @? 4   ( x@C }?  7'!  @o!    ( x@CА h?7'Ē!@^  ? ( x@C W?#Ē@O?   ( xH@C F?@A? 4   ( x@C 6? 7'# a@*   ( x@C #?!%bА@= `0@CP ? 7@J'Ēa@   ( xx@Ci ?Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > .Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Ready for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again ..Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again 㳈bԐ @~  ( x@B|  @p  T ( x0@Bm TaЀ  "Ԁ` @NQ!( @A"P @NEb b@N?a؀ {"Ȁ w u  "b@A"@Aݐ" "b@A֐"@AӐ"`h?  @Aʐ#( ; $" @A#P;75/9!+3')@AcX@A@A@AА@A, @Mc  O ?%`@A'"""Ѐ`O 2 `Y `s`S 0 `y b耢 b@A0@A{ P' @Av"@Ao x'!!`@Ah@Ae@Ac @Ar, c@M O ? %@AN#"8""Ѐ 2@AE `@M @A; @,@A2! Q !" @b$"@D X$b? "%Вa@@AC ?could not pipecould not fork-c-dccould not exec㿐@ a@A @`""b@6 @0@@@0" @ @  b@ @ b@@@3 b @ ?#p@x@ \ l`D T`l`  N"䀢` @  E@  @@D  x %@ (`l@, #`l@1w @, `l@-X `l2@ @B `l`(bԔ @ *@+Cannot chdir to %sCan't fchdir to starting directory?#p@@  l`D `l`  @8 #`@6P @D  f/@1   x @#b܀ ?"`8?#@w\ 0b܀ b 8 #@ ( xq@b  ? `@(  `` `8 V`@+j `l@, `l @4q x E@b  "`B?#@w 9b "`8 +@ ( %x@b  ? `@( `8  `@`x @ @B0"䀢   |@  |@ "b  "  "@   (x @?   6 4? @@ x @ @ @xB`@3א䀢 n"Ѐ`j | `?"`@* "@@J Y$"@ `l x @ @ @KB@30F? < @䀢 `"Ѐ` | `?"`@* "@@ $"Ѐ`2 ?# x @ @B     @?c  ( x@? @ `l@* `l`(Ԕ @ t@7@*Unable to open %s to read㿈 l?`'@2 @   l`,  l` 0@4 @B` /5@@2       @u  ' ( x @>0@+' @@2` "` @Ð  @@2ܐ0"䀢   |@  |@u  "b`ŀ" @e|` b䀢 "Ѐ` | `?"`@* "@@* $bА@F0H l @ @:b䀢  "Ѐ` | `?"`@* "@@ $bЀ 6耢   @耢 ( x`  ` x @ `@ `@. "ܒ?+'@3& $` l`4@KԔ @ڐ R؀ @6@5Cannot mix current archive format %s with %s%s: Reading archive to position at the end...done.  l?cp@    l `X@=u 0w l`D q l`  kb܀  @2X b l @4  Xb䀢   `|@d` "b x b܀  @2 " l@3  @1  l@-  @;B  l`(@1Ӣ @# 䀢  !"Ѐ  |@ $"А; "܀`@1 @@  l`D ?#p@ directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %s?b?@?#@? '   @?,l ?L+ /?c &c#@M / /*@-`,"c @sò   ( xc @< 0I<  c c@@0^ :@D 5@4 0#`@2Y '@B50'??'@-  #b܀ 2 "`; * :  /`? @?$c@<0 0@sY !-b܀ b  8 @ b  @ 8 @e@0 ɒ@( Ē?c @)ה b  "`(@s 2"" "` 8 @ "  @ 8 b䀢    |@ "b"`"@, @G "䀢 f"Ѐ`b | `?R"`0U   ? @ @ "@0"  @r ?b  ' ( x @;0 @% 6@@/0"@@Y@"䀢 "Ѐ` | `?"`@* "@@ M $"@ Ԕ @` @4H@Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.㿐 lT`@ ? ' 5-19 "b?  @ `P0 h A @:Ғ" @@䀥 `l@ $€ #`l` ``8 % ` h  @:"Т `@; Ӑ` "`8@ 0bX+ ?b@: ?b  "bCannot identify format. Searching...Sorry, unable to determine archive format.㿘#X"` !*` * & 6@ To?@* @*`@"l@Yc b@ " 97퀦 T@ N"  b@ h K? @:( @ 4 cX@ !cXT"@@*` *  . `@  2  h ? @9  @""@Ơ"b@¤ a@9 ?Write block size of %d too large, maximium is: %dWrite block size of %d is not a %d byte multipleWrite block size of %d larger than POSIX max %d, archive may not be portable㿘b U"@ "b@ l`&""? cp  !c   "" c  @9?0b"hs"b  "@ "@ ?"  @8"bD#"H Write block size %d too large, maximium is: %dWrite block size %d is not a %d byte multiple㿘 hUb@""@"? aX a "@91?0"b耢   ?b"@  #"H:#bD U?@ @"""chCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.㿘#`b ⬀  ""⬪ "ch"#h  sD "H " ch  @ :; F@R?@TԖ  @ch :@ D E@d ("@`%"@ch@$H@ %"DH⤔ -H"D $HH@"  : @ch $H%"Dch$H@ %"Db@chb  %;b&8Ȁ   "`h c @8^?Unable to append when there are archive read errors.Archive read error limit (%d) reached㿘#l`L  h`a@83 C? ! 7? ;  "@B@ ""D8"bH(   :!#  : "@4ch l   a@7 0^ "@ ?㿘bH" "bH@Ē㿐  p?bD H" :   2 @"H  "H@fU%"H" :`@RВ @Q5@Sʖ  :?@ f @ B D (8. "H"@:`   ` @:   2@"H"H  d%"HbD"H 㿘#bHb@ !"D "@ "Dch@$bH㿘`$" '#%DbH"@  @@h @?bH@bH&@@$bH` 㿘`$'#DbH"@  @N &@ bH@bH&@$bH 㿘' "DH"  @ech &!?< 2 @H H@3 H@ < f $H ` Read fault on %sFile changed size during read %sFailed stat on %sFile %s was modified during copy to archive8 H@' "DH"  @ch &G>: 2 @H H @Z  H@ :d $H 4`8   ( x  c@6q !>@   ( x@6 >?8 c@6Q > Unable to obtain block size for file %sActual crc does not match expected crc %s( H@  '@Ē "  ؀ 2   O> ( x @6G  >'/0- :2 @   H#\@ "` :"H   #"H H: $H  @ d D` H"@%@ Ē   H`4   `@ʒ 4 ` " ?"`2   @a @5  Failed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %s(HP  * 2`  *` '     "2  @   @  (؀ 2  ' x @5x'#'b@@ #\@ <@ Eb@@h 怦! ( x x@5K 0 H    @   ` @5  @   8 ( x@5)   ` @4   H`4 `@㿘cp  )  $p% # !l   :b@#h  "c? b@> B@""D8"bHUser specified archive volume byte limit reached.㿘"" ` 4+  1%"Ȗ""  "'% @3'`X@4w      =bi"#h"@   "bD@=b] && %'  =bȀ Mh@ "bD&& h@h@ `bȒ <`B=bȀ "D@@@h &"bH$ @ ""HbȖ@@ <`C &!=b@$"H`l@ @$"H@u  "c?Unable to allocate memory for user id cache table㿘!#  1#Ȁ 2?!=@`<  $#  # &#Ȓb@3ِ ?Unable to allocate memory for group id cache table㿘!#  1#̀ 2? @`  $#  # &#̒c@3 ?Unable to allocate memory for user name cache table㿘!#  1#Ѐ 2?!=@_  $#  # &#В`@@3 ?Unable to allocate memory for group name cache table㿘!#Ā  1#Ԁ 2?!=@_  $#  # &#Ԓ`@3Z ?%lu㿘#`Y >1!=@#* @ "!`$! $2 !`28 `2'13 #  @" #`$# @& (@ɐ   & & $@jU `21!2& $  @5  &㿘#`+ >1 @;#* @ "!`$! $2 !`28 `2'13 #  @ #`$# @ΐ (@ɿ   & & $@i `21!2& $  @5  &㿘@) "[?N Vc   &N?@+!=* @ #  @>  # 7?! $c  @k c`$c  @+Ӕ!=@j (, "@  @ή ?` &@ @5? @΢  $` $ $&@ $?㿘@Ȑ "[?N VcĀ   &N?@+ đ* @ #  @>@  # 7?! $c  @Y c`$c  @+r @  (ġ, "@  @ȫ ?` &@ @4ސ @ȟ  $` $ $&@ $?㿘@%TRAILER!!!㿘c@=   ? H`@  ?㿘 <    < & +& $")40,H'H#"H(0  #&  &  &  &  &  & H   o @6 &  <@%v ? %?p#` @ $c`" 4 ` $c ` `t` l$$, $ 4 0@Cpio file name length %d is out of rangeCpio file name in header is corrupted㿘lb@1 ? 2 L 2N   b0@1 ?Cpio link name length is invalid: %quCpio link name read errorCpio link name is corrupt㿘 H   @   4!  H H@ @0Ғb? H,   @"&, c,@ N,  c(@0 ?070707㿘`K `@?M   ?㿘 L h! x   :` @  & `  @ڔ  & ` @Ԕ  6` @Δ  $& ` @Ȕ  (& `$ @”  "6 `* @  ,& `0 @  @&  H 8&  0& `A@ : `;@ ` &0 < (  @ &,., W z?  W㿘@&File is too large for cpio format %sUnable to write cpio header for %sUnable to write cpio link name for %sCpio header field is too small to store file %sHc@'. ư?``x   :`,& ",    A4  #`H  A @  `b8 A @P  !ǒ @G  ~#`   @=  t`   @4  k`    @+  b`$   @"  Y`(   @  P`"   $@  G`,   *@  >`8   0@   5 ; @   -  L  `  ``b`     2 ,, 6 `b@/>  ? b@/6  070701㿘`m b(@=ɔ   ?070702㿘`m bh@=   ?㿘 @""b㿘"` n ђ n #`x  :` @ = `& ` @ 7 ` 6` @ 1 `$& ` @ + `(& `. @ % `@& `8& `0& `6 @  `H:`& @  `"6 `> @  `F @  !?# @ `*  * `& `N @  `V @   @ `*  , `,& `f @  `&`^ @   ??&j 8 n ` "  .< (  @   @  b  `:&,., |   @  b v ` ?  |㿘 @$"bFile is too large for sv4cpio format %sCould not write sv4cpio header for %sCould not write sv4cpio link name for %sSv4cpio header field is too small for file %s(?@%C? #?` ``,&"`!’ @   `   ! @ x    @ p  ` "(`x  (x% #x#`H   `  b `x ;@ 6 @ Ϙ  `Òa,   ;x   ;@ 6 @ 2  %   @ (      @   $   @   (   @   8   .@   "   &@   v `  >@   l'? @ `2 @ F @   _, `  N@ ږ  U V  2  @ Ζ  I ^ @ Ɩ  Aݒ n  ؒ   n  $   "b    # 2! ,, & , $   6 b0@,  ? b`@,  ` (:`((!Dž0: 2`(0 ?P   P?㿘ڒ  "P! x   S;` `*  & ` `*`@& ` `* 6 `  $`*`@& `  (` *  & `  "` *` 6 ` ,`*`@& ` 8`*  & `* `*`@  & ` H`*  :`*`+ 2 *  @ :`R`` `*  & ` `*`@& ` `* 6 ` $` *`@& `  (` *  & `  "` *` 6 ` ,`*`@& ` 8`*  & `* `*`@  & ` H`*  ;`*`+ 2 *  @ :``*#`8`@`0& `B&& :` ! 3` < @ (@ `H   &,.,   `  b`x ;   @  b  ` ?   &File is too large for bcpio format %sCould not write bcpio header for %sCould not write bcpio link name for %sBcpio header field is too small for file %sx?c@"Ŕ !D?  ?  ,& ؀ J  `x] [x  H * 2` * 2` `@  c * 2`  x  ` `+=  `-5@ *   - @ (`(`(`(``-) c, x; ;  , ; *  ` **   : .`.`.`.` )x   :(`(`(`(`)  q :  *   ǀ(@(`(`(`  2 *   (`(`  *`2`*  2`@(`(` $ 2 *   (`(`  ( 2 *   (` |(`  " *`2`*  2`@(` n(`  , : *   (`a(` 8: ::*` @ `*  * (`(`(`J(`<  *` @ (` ?(`9  3    |   "`    $ 2" ,,   , "  Z 6  `0@*X  ? `X@*O  Unable to create %s㿘%   c*`.@ab4` 6*@ !?# ( `x ( $ @А  @*I  ?&@a;4 &Unable to close file descriptor on %s㿘`@ @{   ( x @*" #`  ( $ @, b  ``  36   @m  p` t` 08  @ Unable to link to %s from %sA hard link to the directory %s is not allowed8, @`Ԓ   ( x @)ɐ ?<   @g `@) ?㿘`    @P  Unable to copy %s, file would overwrite itself8 @` #$`  2    a(@)G   Unable to link file %s to itselfUnable to remove %sCould not link to %s from %s8@`T >% (#$`2Q @@`@ a@) @?<   @i] % (  (@̐ % (+  ( x@) "?(@) ?#  x` @`   @K c %s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCould not create: %scpioCould not access %s (stat)8  c# ! x  @ ``#`  $ ( @3   @( ް? ` > x*` € ,2`@_ 75  ,  *2` @. ,  *2` @! ,2`@W   c , @  c@(4 ? (#`` $( @( @[`rb  "  36 "  @%`H)#@4 8 @@6  )"@_  ( x @@( *`2`@s  c@ma"  6 @  )   p  t` @   p 2 t`"  08 @  0\    Unable to remove directory %sCould not unlink %s8@^ !#$`2&?<  @gː 6 ` (  x @2  (   x@' ?8L /? " /#` @@  6,@^j 2 , c@Βa$@ , @' / ,@^Q @^T! ,?Unable to obtain file stats %sAccess/modification time set failed on: %s8 X" X%$ 3`p  t``X@^  (`p $`X t` `X $  x @'`X@  ( x@& paxUnable to set file uid/gid of %s㿘@|J 6 #3 (@2Ґ#Ȁ `x  "䀢` `x@@ 2 ?`xЖ@&ɐ ?㿘@U 6 #3 (@2#Ȁ `x  "䀢` `x@ 2 ?`xЖ@& ?Could not set permissions on %s㿘o@   ( x0@& File seek on %sFailed write to file %s㿘\H% (-+ 2 '&"&`"& N  @ `@ L@ "`@ 2'<   @wÖ  x @wݔxa@&6 ?2&Failed seek on file %s㿘??@w    ( x@& 0`h@w   ( x@& 㿘@ @wq?&@"؀`  0   8  File changed size %sFailed stat on %sFile %s was modified during readFile rewind failed on: %s?c8  `  &a  X @8 :D  ? @  @?@w>  #`H `   `c?#@  `8` ( x  ``(@%L ?  @v  ` ( xP@%h ? & Unable to allocate memory for file name buffer㿘"  "bX  "X"`X "X"`X @"X `@~ , "b\b(@$ ?@  ?"؀` @? 6 Invalid file name argumentUnable to allocate memory for filename㿘 N cP@}А  cp@$Đ ?@I?`$N /". `$$  $ $ ` " "`" "` 㿘 ` "`# ` "bd#(` `  ` @v WARNING! These file names were not selected:%s 㿘"؀` @F )'%  4   2 `2 @$X  @K 2 Can't fchdir to starting directoryCan't chdir to %s㿘 -@t$`1 (+%)'`!"\,@H #"\@$~ 2/*. "$  $ +? ` "@@yZc   x!@$/ ?@k@   x @$!?0 !%b\"X @sΐ"\ $` File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s㿐bd %|"bd  %#@t  $`q а? 8?` 5#*` €"؀`` @ @ ` `0` c`@# 0`  ` @# 0`  ., `x   ::&,@ : ;` ;` ;` ;`  (;`( 0;`0 8;`8 @;`@ H;`H P;`P X ;`X< "9("140NO``K -0 H?`7:`"ؒ 2&  8 0@ (`$ " @ & : & , @~i, 6 ,` (x @# 09&,  & ` @%͔,`&` & 444|4444%b %e %Y%b %e %H:%M%s%2u %-*.*s %-*.*s %4lu,%4lu %9qu == => 0"䀢` @ג?`& * & @@to0 `@Q #2  ` ;!@@#Ȳ#ؠ@ ` @e @ /` " `v `  #h #`#dc#\ @I ` ? ?` 2   ``@I`0`@I@Ґ`&@  * &@A @` ?` @ , @S  2 @ , @G?`& * & @@sߐ%s%s %s @#  8;a @% 4#Ƞ#%8@ K@ϒ @ "/  @Pߒ"ؒ@! 㿐@}qV` N N N @Fϐ@N N 2N0@F   J " 0" * 1 Є *`(8*`8( Ʉ*`8(  0(Ѕ8   J`/ `7$(@    8W0*2   0*2    0* :* ? 㿘@  @ O@ "`0"`A@I@Є  2`.* >а*`>@F.> +.>2`* ` >F *`@`@*@2`* >а*`@>F`@ O@/@7$. 㿘@  (  `0 8W.W.* 2`@2   * 2` ` 02 .   0.:. ? %s: unknown option %c %s: %c argument missing 㿘"h ( "``4`I?"hJ@ - bl *bl "bJ"l`@CĔ3h . :  "h"h'?@ ͒  :2J @ `0 :2.  @ `H@G  ?*@$". > ustartarsv4crcsv4cpiocpiobcpiopax㿘@@ /`"#`@$##@,L!Ѐ @0#@,B!耢 @0!$#@Wab:cdf:iklno:p:rs:tuvwx:zB:DE:G:HLPT:U:XYZInvalid block size %sInvalid -p string: %cUnknown -x format: %spax: Known -x formats are: %s gzipInvalid write limit %sWrite limit is not a %d byte multiplenoneError count value must be positiveDestination directory was not suppliedP  5O-`8J #*` €E# (`@!$"`=`b@ @5 "b/ "c(* ( "b$ "c  "c$@ "b "c  (`@  0 ( -* : ` #|*` €" p " t""# p" t  "c  "bLb@G @l L  ӤѤ (@ ` ɤ ""ä  ""   "" @! ( !'  @E H "`l c@  # @` '+@ @F<@  `H @cH0P#P"b! (@ :    bcX@ِ @b a cp @͔"@] ""W ! (  @*ܐ# ?J"cl@  D"clc@ 0 (@D` 7 ""1   ""+ @""&  (@`  (@`  ""  ""   "" @@A??B  sې "`| !%hqȐ   @@  !  @  ! " %h @a@S@Z hh `#"`lh`A #h*` €!!"7" *@ @ "@6" $"0&"@c@ @%?. @"c "" *@ "@" $""#l&x&x' ' &!`!!!!l!!!!!!!!!!!#<%4##%4$H$h%4%4%4$%4%4%4$%4%4%4$$%4%4$%%%4%4%4%4%4%4 ( 0 t %4 %4%4 %4  %4 !!$%4!"" "8"P"h"t%4#(b:cef:hmopqruts:vwxzBC:HI:LOPXZ014578write_opt=nodirUnable to allocate space for option listcompress/dev/rst0/dev/rst1/dev/rst4/dev/rst5/dev/rst7/dev/rst8The -O/-o options are only valid when writing an archive-I-rUnable to open file '%s' for readProblem with file '%s'-CTAPE㿐 " x'    )7 ;`J "*` €# (`@!` $"`b@ @"* $" % h"#l ( `J@ -2 J` "" '""'}" t @t Ȁ w @s  "cm" i"c  f% h (@+` a@w]Z% hb U"b Q"c " tL% h0#P ( D"b @"b@u-`   (  @`@vY  (`,"?'"? #"b!' x "b !"b !  !(  !8 !H !X !h"b@ϔࠀ?I? *`@ &  h 2  '`| h?   h?@v  h?  " "`l# "`l ax@; @ h   y -; 9 7 T5 ` 7 @(C )  H@_aȢ ! !@@ !@  @@M !@(! "p@:ː"p ! @@@@( 2 @`@ )`% `@` 6 @@  @@'  `@ 2`""" p+  k+@Vh` D В  ! @F! @'!  H a@א ! aА @@. ! @%@Đ !@' "p@:B"p ( a@j @! @@'b 2@`@ ".%cl`  @  y` @@  @@'Xa  `@ %cl !"耢 " J  @uِ" $"J  !$",,--,,-,----------- ,----,,(--,--+T,-------,-,-------*x*-**-,----+(-+4+\+t+++++++-+/%s8 #Р% + (@Y(@L `?,@Q `x @Qܒ! @ ?<  ؐ @  ?` /,`ϐ abcdfiklmoprstuvzABC:E:F:H:I:LO:SZ6Unknown -H format: %scpio: Known -H formats are:Problem while reading stdinP !?#$" ("h"c#c$"t#"     / 9`D"*` € "b!&# "b %`h "b &t" "`l%`h %`h "c "`|%`h&$ "bw#P ~%`hz"b (@`t"b! (  @CaȢ  %  a@ @%@ @5 @8p`V  a@ @O (`J - J  B% ?%! ( !'  @@: H /"`l  a@   !@>` %)@@@@  `H@0#H@ "b ! "b!"`l@@<Д؀?@?"`h* `G@"*` €@ ? @~` 6@@y@ 2@01@  c@d @j@"c `@a@ @["#l%!x @ H p   a8@@ @F@D88999@88888888888666867877888p88788888888888888888585686886886$6486@6\86h86x668886%s: Invalid combination of options: -%c㿘#!c0@@   !J 6 cX@@ @Ő 2@  `?"`  * $ @ʐ 㿘@$@᠀   ᠁These format options are not supported %s = %s 㿘!``@@ !1 @?ђ h 2@ Invalid option nameInvalid options format㿘 N  `@  `@g :?` `@_ @q0?L@ ", '@ , 2,@ = @qN 䀤,"@ "`"`  "" `$L@ ې 㿐 @  "a 2\ `(Y "V J k" m b /J w)J4`,  ,` 4`,  ,` 4` ,  ,`4`,  ,`& @8"  'J`x 4 ``*2   @3 @  㿐@  2  J?` '@p  @r~@* "bp  usage: pax [-cdnvz] [-E limit] [-f archive] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdiknuvzDYZ] [-E limit] [-f archive] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [pattern ...] pax -w [-dituvzHLPX] [-b blocksize] [ [-a] [-f archive] ] [-x format] [-B bytes] [-s replstr] ... [-o options] ... [-U user] ...[-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-diklntuvDHLPXYZ] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [file ...] directory 㿘! @` @\ %@W#a@R@N!8@J!H@F!x@B!@>!Ȑ@;@7!@3"@/"0@+"X@'"@$#b@@"@"@#@#0@ #`@@p1 usage: tar [-]{crtux}[-befhmopqsvwzHLOPXZ014578] [blocksize] [archive] [replstr] [-C directory] [-I file] [file ...] 㿘! @!!H@ܒ@p usage: cpio -o [-aABcLvVzZ] [-C bytes] [-H format] [-O archive] [-F archive] < name-list [> archive] cpio -i [-bBcdfmnrsStuvVzZ6] [-C bytes] [-E file] [-H format] [-I archive] [-F archive] [pattern...] [< archive] cpio -p [-adlLmuvV] destination-directory < name-list 㿘! @!@{"@w"8@s""@o@o Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %s㻘 N cp `L@` `\*`: @2``gc@n  c@ t?,@@m& @Tז$c@n @n^?`,@ J \2N22 *@x$ @n*c$ $J + !*:  P" g G" 0  p"0 $ $@w @nW,@ @$ ?J  c $cİ " "c"#"c Empty pattern stringUnable to allocate memory for pattern string㿘 N  b@m  b@ ?$@pk$ $ $ `$ $ c " "c"#" WARNING! These patterns were not matched:%s 㿘#  )'%  2 `2 @# @;  2 Pattern select out of memoryPattern list inconsistant㿘#`  # `   \$  W #(`22# 2 *`2)#2*@   $`h@a  ` /*@6$  ` /*@$ @o?$ J / * $ $ & #       2    @m[" &`@& ?㿘c  &# `/"`4?2   #@.         J@ /2 @" 2  bb`? `&  T &?& 㿘&N ?  [  **`:N@-*`6N@N@ #(`2/1?&. N@ ߲`(? N *`"   N@Δ `N@ ?N@` `@ 2N?:  `?J!`?   82J! -(J  ] 4  @$  (8 "   ](  Removing leading / from absolute path names in the archive㿘 x`! N  /xN    . .  @nÐ@fΐ&x   $xax@) x )N, /% `N, 2,  . ., , @n@f,&,x 4  $xax@ #` @B  )     , ,@2 #`@j     ,, @ T, ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > ..Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s 㳐#@A#Ȥ-+)'#!e@6@4`0@2 X@A, %@yh @%`p0@mِ,O@ 0〢  .@ !  O  @   ? @ @_@,&`? 㿘 @ ? ` ,, @ ? File name %s/%s, too long㿘N@`/ "@l$&@b@ ?  ?*@  * . ?*@ .  Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s ?#Pc@hPPB X/ @aU /\  ,@` @* @!@d 6 @ U㨔@| W d@\"  L  ͐2Ũ>@0,@` @@L  @,@L  $cȔ@I $ OP OP   c@8z OP `@8rOP  @,& 㿘 =:  & \*N / 94 *?Ѐ$, @*:  \2 .N  . ` `  "  '@? @범:&* &.Can't open current working directory.TMPDIR/tmp/Cannot allocate memory for temp file name.can not gzip while appending㿘@* @GӐ#  "c ( x @єe#@kV# L@ #@l ' %J?`/"?@i  $c@~ A @kT"Ē /* "Đ0@w &+@  % h`"*` €X"``@b Ҽ ӍV]]]]]Cpu time limit reached, cleaning up.Signal caught, cleaning up.㿘 "b䀦 "b@ 0b@@ Ǵ@ $"؀`@@i LC_TIMEUnable to set up signal maskUnable to set up signal handlerh @b   ?@N= @bڒ   ?@N2 @bϒ   ?@N' @bĒ 2?@N @j|"   "@   ?؄\ؔ""Ԡ  '''@i   Ȁ    @i Z ( @i  Ȁ    @i H ( @i  Ȁ    @i 6 ( @i  Ȁ    @iw $ ( @ip  Ȁ    @ie  ( 'ؐ @i\ @iV     ( x@k ?㿘 Ȁ`@ 2  ̀`@ 2   `" @B   Unable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memory㿘 "S?N #`Ȁ   !=@;A  $`8bN # \N  #" @* 2 b@А ,?  @ @!=@m`ȑ, @ " 2@g  `b@ ?, "  "" 㿘 $!=@l`ȑ* `"  @ 2` `2@ Unable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memory㿘 "S?N #`̀   !=@:  $`8`N # \N  #" @ 2 a@< ,?  @O @!=@l`̑, @ " 2@g%  `a8@ ?, "  "" 㿘 (!=@lV`̑* `"  @ 2` `2@ Empty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]㿘  N c(@I / "N,@`N & ?А , *: * :  .2c@ 2c@ @ p J 2 @fm  `ch L@ 2$  *$ L@ & @*:  M"  c C"  L@ m2 L@   $   $ c@ 7 S`L@  @@ N$`$ @ 6  c $ (L $@~  6   c@ @f5$  $  @ `@  @f#?` $ " "`  `İ " "`Ē`(@  ?`A@8` "$ #  @ &)  `$   @    @   ` ` `2` `?㿘@@  . "$@, @h 2a?L?Г* @L *`В@ `=$@T?@h?`8N?"\*` €N?Г* @N *`А@ D$` d$` N?Г* @N *`А@ $`?$` N?Г* @N *`В@`$`  N?Г* @N *`В@`$` N?Г* @N *`В@ `;$`@&@?? n mmmmmmtmmؖ !  @X 6!  @XЀ .ؖ !  @Xt &"`쀢 W p` t`߮ x ! ??@XP  ! @XC! x? $!  c@ 㿐`@  @6` `   *  `'  * @d㿘 [$ $  J" ?`   " @ 2(* * * *( ( 0(2    0( :( ?   @  2*( ( ( (* * + 3` ` 03 *   0*:* ?  !    ustar㿘a$?N "`!@M     Ғ"? ?write_optnodirUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.㿘-)"'"+"/"$%"@ !" @   `@Y Д  `h?  @L  ? % ۢ  㿘" !?  &   "6 & @,&`d q  / 6`l j  $& `t d  (&  `|ʒ  H :  W` @&     ; 8& 0&  x:N` `1`2,``5"'.,   & `,@Ր,  (  &  6`,@ɐ,  @ 69&,@  & 6 6., .&,., &,L /`  `"` &  6 6 `H@`  a"@   b  `` & `x6 a : :L /2 ,?& Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %s㾐 ` -$!$*` €"`$%Ű  #` #` #` #a, d#, a8%   c# aX  d@ x  : d@_C- ? /-  2  1- , @֔ d l   g"! d @_#- H lǘ  #Vax" @  b a:!   `dz < $  `lq 3 (  `th * 8  `_  !!Ȑ` U  7!  ̂  ?       #a@v  (p@Xpp㿘 ?  ?㿘g ?ό  ?㿘a$?N "`!@  2?  ᄔ f"? ?㿘ߒ"  ?# `"6  `& `& &NaY   aY@, /,  , @"&`d L  /` 6 `| ᱒ `H :  >``@& `8& `0& `(.aHa)Щ 6`$`t , &`$.a(a ; ``l  &``x  ;@ :`,& ., &,N``7m%"*` €  @ 6 x&     "  &6  6 L /2g &c,N` 4 `  ` `  ` & 6 aI Ӕ  aQΔ ?c , *`  ,:&N` 2 `  (` &  6 `   `"` &  6 6 `, @H,&,`H@`  a"@   b  6` `x& ` a: : ppUstar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sFile is too long for ustar %s00Ustar header field is too small for %s㽠`  `%2b    , c%, %c @0 %c(x   @ :,@Y@  /,@`Y @\ @ d` ?` c*`'  € 5,   d@\ϐ =,!I ` 4 3,   d@\ `, !I 1  ? @ `2 @!Q $  '  6,   d@\ ,!I ` 1 2, ,  d@7 ,!I,!J,!K,!L,!M,!N,!O,!P,!Q,!R,!S,!T,!U,!V,!W,!X  |   9" `  0 7,  d @\m #`H @" a  b `x ;@,!I,!J,!K,!L,!M,!N,!O,!P,!Q,!R,!S,!T,!U,!V,!W,!X |   `%bcH"` @!%ch @۽!#`    d  J`$ l   A`( t   8`8     2/w  @ۑ! Ȓ  @ۊ!)!  w  Y!  ɤ `?       %cp@  00x0`c`  H /" J J/2 J" `4 ` /dev/ttywrFatal error, cannot open %s㿘'!P@7y  '@'a`!  $!'ah@'  "a@!@Q#`' apaP@3 ?㿘!!'H'L'P'T'X H@7@Q!㿘` !@ۛ 2. ?@i 2* %s: 㿘'L'P'T'X L "c"䀢` !1"Ѐ @Q`| @U &"# 'b@'"@7@U  <%s>㿘'P'T'X P "c"䀢` 1!"Ѐ @Q`| @Uw $"# 'b@&@7|` !'#@ڐ@&@U^ 㿘@icmpunknown protocol icmpsocketDI:LRS:c:dfh:i:l:np:qrs:T:t:vw:bad number of packets to transmit: %s%sbad interface address: %sbad timing interval: %s%s: only root may use interval < 1sbad preload value: %sbad packet size: %spacket size too large: %sbad tos value: %sbad ttl value: %sttl value too large: %sbad maxwait value: %sunknown host: %s-f and -i options are incompatiblemallocbind-R option and -D or -T, or -t to unicast destinations are incompatiblerecord route not valid to multicast destinationsping: record routesetsockopt IP_MULTICAST_LOOPsetsockopt IP_MULTICAST_TTLsetsockopt IP_MULTICAST_IFgetsockoptsetsockoptCannot set the receive buffer sizeCould only allocate a receive buffer of %i bytes (default %i)PING %s (%s): %d data bytes PING %s: %d data bytes ping: recvfrom@  (// @#''/ '(`@T   @Ð  "`(`@ @0 @g# (@,%@g+bX Ȕ'T'`'d'h'l'p'X/ն9'P'\'t'x'| 3,* @€` @b  #`(``@T8 | $/$|| @$|@  |!(!@n @T! `$|@Q (`@z |@` 2 (`a@T   / -  -  - |"$|`@Cɒ ☁ =b`b (`a(@S " b`@  b`!(!@@# @S֐ b)=b`| $|/ {%@ " `!(!@ @S  @ؔ i((`ah@S | _$||`@ \$|X(| S$|| O$|| K$|` @ܴ `"T(`a@S ?#@9((`a@S | $|`@ݩ )'(`a@Sp | $|`@܊ /(`a@Sa |!$|` @z   "h(`b@SP @ (@ `??b* & @ @ b`D#aHaH"" ’    H`D" @X@ *-`@փ "@ 2 (b@S -` @X @ !#`|  (b0@R "T` "` @V' |(bX@  T @ ,T`@@V?c| Հ##aX`< 8  % "  +` *" "" @A  |(b`@ | @?c @H | ?c @> | <` 8  %$|| d $ d(bh@R %  @  <* @ *@@ "``, `4 4 4 , ` $ , $ | <` 8  (b@RQ   '/// T @ ( 6(@ː"@V    ` @ט  (c@`   d @ǘ  (c @P    @   (c@@@  '!?#h#l@` (c`@/ @1?#p`@  1?(cp@ ! #("< '"c@ # "@}  ";#@4 `(c@_< ` `'@ώX(bT@ 1 )@T1`@U ,"l@U ,4@U @2| 2@ 2 * @T  (bX@ |#'|  @ ''@V 2 * +  & P  @ | ' \@t  x (x |)@` |'@U \@Z @U  `| |@T@@U  PPPP,PP`PPPPP,PPPPPPPPPPPPPP|PPPPPtPP$4P 㿘 ( x@E,bl@U ` x@  ՒaH @Ԕ $x ` x @ `" 1"h1`@Tސ @&$x㿘! ( x@N $ xping: sendtoping: wrote %s %d chars, ret=%d 㿈+bX -- "PxZ 5 `5 "x, 4 5 #բ`Ȓ@<: @<   @*@* ,@ @1͐''bX** * * * * **"T`@`|  5  `5 @5 `  @ܵ  @|`6,@#X ,#h@|  b] @L0 packet too short (%d bytes) from %s%d bytes from %s: icmp_seq=%u ttl=%d time=%d.%03d ms (DUP!) wrong data byte #%d should be 0x%x but was 0x%x %x %d bytes from %s: LSRR: 0.0.0.0 %s (truncated route) (same route) RR: NOP unknown option %xx @1* `*`@  |a !-'!p@ͫ@n0&@ !X@ `   V"  / / / / / / //?" "@ ''Вb@ ??*`" * "* *‪ :@B:—@ƒb "p "pB;b(8p"x "x1 @"P:x1"P Ȓ@;l: L@;g <    `?"' @;W: "P@;S   *@ ,  |`j`b\ @K' y!-'@!@|-@x!``!-! #@  @N# @c `-@^!"XT  `E- @ bT@J!bT  7)-#-  2 @=" @:b bT  &  ޒ` |a  *  @&@ !-@"(@@s |+)-  "-   - `E "-- @"@   ` '-#-'` ?"`* "@ʴ     *   @ *   *  @ŐH@@bX`Ӥz    nc0 'c8@- ' |  '-@"x S%'c8$c0@S9-$c0-@" '-#-`'3` ?"`* "@L     *   @ *   *  @]H@?@VbXԲ`@O"@K"`  `@F"   ?5  |  ``?"`  * $ @ @Iΐ `  ` `? (?888* 2 --- %s ping statistics --- %ld packets transmitted, %ld packets received, %ld duplicates, -- somebody's printing up packets!%d%% packet lossround-trip min/avg/max/std-dev = %d.%03d/%d.%03d/%d.%03d/%d.%03d ms 㿀 `"@  * $@ɕ @I] ! /@#! x/@#/ @# ``/@# x "/@#*` *  !0  @EX* @`?"` * $@R  _ `[: @ @ @B@ @Ddp )0 0 #@? @*#  #@  #@x  #@  #@#\ #@v#` #@#d @㿘     (   @V@B: 2   B* 2`@ : b`D 8 怢`  㿘 @P   @Pg`?Echo Reply Destination Net Unreachable Destination Host Unreachable Destination Protocol Unreachable Destination Port Unreachable frag needed and DF set (MTU %d) frag needed and DF set Source Route Failed Network Unknown Host Unknown Source Isolated Dest. Net Administratively Prohibited Dest. Host Administratively Prohibited Destination Net Unreachable for TOS Desination Host Unreachable for TOS Route administratively prohibited Host Precedence Violation Precedence Cutoff Dest Unreachable, Unknown Code: %d Source Quench Redirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect, Unknown Code: %d(New addr: %s) Echo Request Router Discovery Advertisement (%d entries, lifetime %d seconds) Router Discovery Solicitation Time to live exceeded Frag reassembly time exceeded Time exceeded, Unknown Code: %d Parameter problem, required option absent: pointer = 0x%02x Parameter problem: pointer = 0x%02x Timestamp Timestamp Reply Information Request Information Reply Address Mask Request Address Mask Reply (Mask 0x%08x) Unknown ICMP type: %d 㿐`ޓ*`3!  €1@ 00 `O13 ̓*` €1@ @01@ `01@} 01@y 0 `1@r 01@n 01@j!01@f! 01@b!801@^!H01@Z!`01@V!0{1@R!0w1@N!0s1@J"0o1@F"(0k1@B"H0gd"`1@<"0a  " 11"11@'" 1@"" 1@"  @" @# !1'#0@Ȑ@ 011@#@0M1@#P1 #p@ 0D1@#0@  1#1@#01@#0  22 @ 0  X@@ 02@Ր 02@ѐ 02@͐ 02@ɐ 02@Ő 0 2 @ 02@!ɐɠɰ ,<L\l|ʌʜX̴̴hʴ̴̴˄˔˸P`p̠̀̐Vr HL TOS Len ID Flg off TTL Pro cks Src Dst Data %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %s %02x㿐3 ` *`@f!X3 2` 2`  @\! 8 3?* 2` @S! 3 ! @L) !3'!@Ɛ@B @ǿ'@;` !3 @3!` `?"`  * % @ %s (%s)㿐 |` ' @x  2!('!@NJ#c`@+!c`!3#8'@|#c`@+ !c`TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) 㿘j * `  * 3*`@ @Đ#0`   * 4*`@ @ patterns must be specified as hex digits%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0x (N@ ĠȢ̂ЈԖؘܚ4✐  `D`@I) H 2#l;p4#\#`#d#h;x;#a@a ?#" 8 @ @ `. @ (  |`4@:!P @ 4#3@2a`@&4@+!`< @2 2 2`((  X``? usage: ping [-DdfLnqRrv] [-c count] [-I ifaddr] [-i wait] [-l preload] [-p pattern] [-s packetsize] [-t ttl] [-w maxwait] host 㿘4c@ @Lh 㿘@benstuvusage: %s [-benstuv] [-] [file ...] stdout㿘@ 5`P@r /5%#)!+-1'55-9Հ 8"* 8@€ $h!$a %!$!t $a %ax %p$!t @   $!t 85 @``@L @X?А?h* `@! a  ax p !t @,0@@ 5`@J @K!|dd dddddddddddd(4DXstdin-r%s㿘5Ւb H "l+5)5'5%բ b @`H  "@< @9$|   %l@@ 2%6d 㿘    %<` +!x` 2 `?"`` * $@Ɛ"  !`!h`` !` 5cx@ `@2 `  !`` $?"`` $* $@Í $Ē`` +!p`` ^?"`` ^* $@m ^` I?"`` I I{*!t`f`/` M?"`` M* $@C Mz` -?"`` -* $@- -"e `b ` ` /` ^?"`` ^* $@ ^E` ?`@`? "`` *:    * `? "`` ,`:    `* $@"  ? & @J  &瀤  @ !l5@" Ր "| 6  `@5`@ 㿘 H5R Ւb "l+5)5'դ b @   @' "@$| T` %l@T` @B 2buffer8R`!d`)+Ր@K !l5b@q d*$ @IW%a` %!d7a8@d %5!d@@B 6@X @!d@Aa` 4  !l5@w"Ր "a|㿘@ؔxph`XPdH`@8@(   0 .p / 2 2   x p7 h 6` 7pP 80@8((  @`4instinstance-mediaoptmediaoptmedia-link2link2-link1link1-link0link0deletetunneltunnelgiftunnel-vlandevvlandevvlanEtherIIsnap802.3802.2tr802.2nsellengthsnpaoffsetphaserangevltimepltime-tentativetentative-anycastanycastprefixlenipdstbroadcastnwidmtumetricnetmaskdelete-aliasalias-debugdebug-arparp-trailerstrailersdownup  & 't i@i#X#W  * + ixi#YH#X0 | - i@i#W#W  0 i@i#X#W T 1p i@i#X#W $< 240iti#W#Xisoipxnsatalkinet6inet-a-A-ma-am-mA-Am-mextra address not accepted'%s' requires argument'%s' requires 2 arguments64encapsulation routingSIOCDIFADDRSIOCAIFADDRH@   @`9@`@a? 9E @@Y` 9 < @@P` 9@@Ja 9 ,""@@@a 9@@:a 9 "" @@/a !֐ ?"b `@@"@˔ ?@"@Ŕ ?` 7)5֦Ь;֤8c""@ " "@@ 2`$$"?`"" ` * & $ @{ @_@G ֒"А@Ȑ  0@Q @Gr ?"p@"t  @Gh Y)59/97"h`"@@ 2  2 b " $ 9  a @Ct 4  +? @ ` @@Ca ?`@` "``X@CN ?`@ " %"? `@   9ax@     >c7 8c@[3̀ -ՠ#  @H  @H`,̀ ՠ#  @G  @G`,  @虘 "  9@Qa@Ac ֒`@Ȕ `,`@H`  (`x 19 9@/a ֒` @ǫ `,` @H` 9@a@F 㿘#` ?!@>k , @ $ ,?$` $` socketSIOCGIFFLAGSSIOCGIFMETRIC㿘`֢ , !0;`@ !@He 6V ;@ !?"c`,!@HW 6 ;@Ր """"`,0a~@HG 6 """"Ȱ getifaddrs%s: no such interface 㿐@y   ;a@} `~ ֨" `@  2p@`@ - ` ` ՠ" @G!  `""Р"$ $ $ $ $ $ $ ` @`  @G @` `  `y &B@@? < " ` `@= 25@` `ր`"`"*@"  8` T   @ ` c c` T   2 $ @  $ 2` ` ` " @` @z􀤠 ;֐ a @@E 㿘 "`"" "#"8  2`error in parsing address string: %ssource and destination address families do not matchinvalid sockaddrSIOCSLIFPHYADDRX֐  ????R ''@ " !<@, @Af  @  !<@,z @AX  ` ` " <`(@AL !<`!``@AB  "@F֒b @@F*@F%`, @GaJ <@ x@Z@XSIOCDIFPHYADDR㿘`, aI@FЀ <@m"㿘"` € 㿘"` € 㿘@  Ր """` 㿘"`!"  `6$""` ` @E͐ `$"Ւ "#" "#Note: trailers are no longer sent, but always received 㿘<@w#h㿘" b #bSIOCSIFFLAGSx֒"@I `, 0a@Fr ;`@ ֒b @oWՔ`"# @@"  7,a@FS <c@ ` ք0d d0d d㿘8"@㿘8"@invalid %s%s not allowed for the AF㿐@ @n @=aP@@3 "R`8=a`@@) b@_ 8֐ 0@" p " h@SbЀ ֐ 0@" t" lSIOCSIFMETRIC㿘!֠"֒b @@$ `, @Eגa =@V"PSIOCSIFMTU㿘!֠"֒b @ΐ@Ր$ `, @Ea =@;"SIOCS80211NWIDp  ????В/@Ĭ  !֠"/֒b @ģ`,0$ @Ea怢 =@#0 nwid %s H֠"""Д$ ֒b $ $ $ $ $ $ @ā`,0@Era瀢  ђ@t =#В@u/ȁSGIOCGIFMEDIA%s: no link type?p"`#֖  ?????֒b @Q`,0 @EBa6   ( x`>`p@ """ >֒`@?O SIOCSIFMEDIA㿘"` (#bc * !֠"$b֒b @b`,$ 0a5@E >a`@W only one `media' command may be issuedmay not issue `media' after `mediaopt' commands㿘"  >b@? %>b0@>  `4`@,`$only one `mediaopt' command may be issuedmay not issue `mediaopt' after `instance'㿘W"  >b@>ː >c@>Ő b@ "`(only one `-mediaopt' command may be issuedmay not issue both `media' and `-mediaopt'㿘%"  >c@> >c@> b@R "conly one `instance' command may be issuedmust specify `media' before `instance'invalid media instance: %s㿘"  ?`h@>a '?`@>[ ?# @ ` `@A`?`@>J *` $⌁  @@`IEEE802.11FDDItokenTokenRingetherEthernet  x p h# `# P# H# @$ 8$ ($  $ % % % % & & ' ' ( ( ) ) * * x+ h+ `, P, H, @- 0- (-  . . / / 0 0 1 1 C C D D E E xF hF `c Pc Hd 8d 0e He (    DS11DS5DS2DS1FH2FH1CDDIMMFMulti-modeSMFSingle-mode16UTPUTP/16Mbit4UTPUTP/4Mbit16STPDB9/16Mbit4STPDB9/4MbitHPNA1HomePNA11000TX1000baseTX1000CX1000baseCX1000LX1000baseLX10FLFL10baseFL10STPSTP10baseSTP1000SX1000baseSX100T2100baseT2100VG100baseVG100T4100baseT4100FX100baseFX100TX100baseTX10AUIAUI10base5/AUI10base510BNCBNC10base2/BNC10base210UTPUTP10baseT/UTP10baseTnonemanualautoautoselect          @ @ @ p@ h@ X@ P` @` 8 0adhocdasdual-attachALLRAllRoutesSRCRTSourceRoutingETREarlyTokenReleaseloophw-loopbackloopbackflag2flag1flag0hdxhalf-duplexfdxfull-duplex?` @2```2@A ?`"A  @2` 2```2@A punknown %s media subtype: %s㿘?!@D? !A @ %s xA"// "@@֒b @_`,0@APaK , @ !#\! @ `B @ @ʐ!#\ @ B H@q   `  @   no networkinsertedno ringactiveno carrier%s: flagsUPBROADCASTDEBUGLOOPBACKPOINTOPOINTNOTRAILERSRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST metric %d mtu %d%s: no media types?mallocSIOCGIFMEDIA media: status: , unknown supported media: p֢ Bb@q"(BB"0@28"`B@q""Ȁ`B@p" ``?"` * $@Ɛ @ xb'֐  ????? @w,#0 a6@@i  B"@퀦`@=*  ,Bb@ a6@@P' 6BBb@ @p#  @;`?"`` * $@u `?"`` (* $@c ( U `?"`` )* $@M )`?"` * $@? 耊 U-B@p\#B| @ 7   'B )*!|ABA @2 @2 b   ` ` @p,  *@`2іᄀ B@p#(`?"` * $@  )   @  /B-B+B  2@o0 @oH  @ocP`@ $ݢ @<ܐ`" 8 @ 0#`#֠"  ,  € $ 2   inet %s SIOCGIFNETMASKSIOCGIFDSTADDR--> %s netmask 0x%x SIOCGIFBRDADDRbroadcast %s㿀 `,    ( x`+;`@ #֪"Тb @)!D  ''''@'@oy @ ,0a%@?  ( x`1D@~ $$ $$bh" 'c . #$bb$ 0 ,$ $ a"@>ݔ? 6 ( x`12D$b$ $ $ @R ТВb @Ґ`!D '@@o,h D@o' `0#$bb$ 0 ,$ $ a#@>? 6 ( x`1D$b$ $ $ @ Вb@    '!D!@y@n`?"`ࠒ * "@ 㿘"`€  "``??` *` "`*`  inet6 %sSIOCGIFDSTADDR_IN6 -> %sSIOCGIFNETMASK_IN6 prefixlen %dSIOCGIFAFLAG_IN6 anycast tentative duplicated detached deprecated scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime %s0infty vltime p} `,    ( x`+I;`@[    ! #\ ! @T "EA "/E@nY c؀ H)֒ ! @=h" @ 0H a"' ' ' ' $' (,''@=̔  ( x`1" E@E   ?  ?//?'L !#\! @ "EA "/E @n  ! @="" @ 0H a%' ' ' ' $' (,''@=  !E ( x`1 E@    ؒ @@mߐ ! @<" @t 0H aI' ' ' ' $' (,''@=X   ( x`1#E@Ґ  ` E@m!耊 E@m!耊 E@m! 耊 E@m!0耊 E@m!@`E!P@m `b ! @<" @& (0H ' aQ' ' ' ' $,'@= ' 6  ( x`1"@BE@!`;B 耢 "4B@ E@m[!x`@E!@"@E!@mLEE@mG!E@mD!`@E!@"@E!@m5BE@m0!B@m-#P㿘"SIOCGIFADDR AppleTalk %d.%d range %d-%d phase %d--> %d.%d broadcast %d.%d㿈  `,    ( x`+;`@ ֠"""Ш b $ $ $ $ $ $ $ @,0a!@<{ 6" ( x 1 /2 F ] $ " " " @# "Д @k  ?? ` `F #0 @l c # ,0a"@!H#@ Ǥ@j ,0 a%@:( 6!I ( x`1 I  ??? ?@  ՠ @ @j{#`" ,0 a"@: b ( x`12 I  ????@y (b @!D @ @jV`?"`ࠒ * "@# %s: bad value㿐 $.`  `, ,  @M @au @8 0@    #@ @ $ Ib@3ɐ 㿘 $.`  @ߒ   Ib@3 `, ,     @9 0$  * "@  * *%s=%o%s=%x㿘  N  J.`J @@iɕ2J,  H@i•2r ``?"``` <* &`@ * &`@+ >%s: %sp 4.`  ?ؐ ??? 'E'a@Ԁ  !J@"@2 ` "`Ib@2ِ  @7̐ ? @?@       $ 4 @ԁ㿘 4.`  @ؒ  Ib@2 `, ,    @8 0$ $ $ $  * "@  * *      " 2 $ " 0   8 2 `8 씂8 2  &  AppleTalk does not use netmasks%u.%u%s: illegal address㿐Ւ #*#Ȁ`,`KaP@25 Kap@J K` ?#@  (`Kax@2  4`,`%hu-%hu%s: illegal net range: %u-%u㿐 {77KbH@J|  K@ KbP@1 "2 2 12%s: illegal phase㿘Kb@ K֐ *bc@ K֐ *bc@1Ð  atalk %d.%d range %d-%d phase %d AppleTalk address is not in range㿘# b b ,b  2  4 4  K #  @g b   8K  Kc@1 b6  6  6 Attempt to set XNS netmask will be ineffectual 㿈 D.`   ,, #@@FB 耦`4 4 4 4 4 4 L@g Attempt to set IPX netmask will be ineffectual 㿈 T.`   , ,#@@G , 逦`, , , , , , , , , , ,  4 L@ga!@㿘.` d @ 2 @6 `  ,,  , ,㿘@"a@negative NSEL length is absurdsetting NSEL length valid only for iso㿘@ѐ "`Lb@0ې " LR  b@0ϐ  * 㿘! d d  usage: ifconfig [ -m ] [ -a ] [ -A ] [ interface ] [ [af] [ address [ dest_addr ] ] [ up ] [ down ] [ netmask mask ] ] [media media_type] [mediaopt media_option] [ metric n ] [ mtu n ] [ nwid netword_id ] [ tunnel srcaddress dstaddress ] [ deletetunnel ] [ vlan n vlandev interface ] [ arp | -arp ] [ -802.2 | -802.3 | -802.2tr | -snap | -EtherII ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] ifconfig [-a | -A | -am | -Am] [ af ] ifconfig -m interface [af] 㿘Lc@ @4  vlan: %d parent interface: %s 㿀 @)`,֖0a: @5"?` M!M!@fQ SIOCGETVLANSIOCSETVLAN㿀@,2  "t"x@ ְ"#`,0& a:@5Ô?`,Mbx@~  7a9@5?Mb@~ must specify both vlan tag and device㿀 x`McH@/ @ ֢"%,0a:$`@5?Mbx@}ݐ  @`v,7 a9@5|?Mb@}̐ 㿀@ ֢"%,0a:$`@5f? Mbx@} @, a9@5W7?Mb@} %dd%dh%dm%ds%lu㿘!ՠ!N@!㿘@㿘 D@勒`D㿘 D@児`D㿘`@ @ ` 4   ? $`$  ?㿘`@ @ ` 4?    $`$ ? 㿘`@ @ ` 4   ? `  ?㿘`@ @ ` 4?    ` ? 㿘`@ @ (`( 4   ? ,`,  ?|㿘`@ @ (`( 4?    ,`, ? i㿘`@ @00@4 2  @44@( @ `@00@4? 44@?>㿘`@ @00@4?2  @44@( @?`@00@4  44@ COLUMNS1ACFLRSTWacdfgiklmnopqrstux㿀'H@4  !'O@3' 耢 @?"a``h @4& `"!`֒ "#"l9֐ "cH -@|   "c'֔#)71/3;+'~%ր GyP* ,@€ '#H%#,$ch %%#,'#H$0j$ch $ch&(%#,'#H$0b% %#,$0%\'#H $0%#,'#H$chU% &($ch'#HO% &#$K%\ %\G&#$ C"c ?@  =&c<  8" "3&c< /"cT +"@$ 'cL&' ""cP "8 "l "c4 %ad "   "p %ad "cX@OH@?~?"H*ch'H`& c@ ch ch  chc8 chad " ch    cX " cX 2 ch  րcL@icLcL &!: 'cLc4 $ad O  #H>  #H: N4P2T\ N,b#$ N&\N#̀ N  #H  #H Na8\ N 0#$ NbNh$#H S0 Uch Sa"#, Vd"bT"H@f!l@_ @0c` >0 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? >D ? ? > ? ? ? ? ? > ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? > ?( ? ?< @ ? ?L ? ?\ >` > > ?p ? ? ? ? ? > ? ? > %s: %s: %s: directory causes a cycle%s: %sfts_read㿘#T` R#@&o   @z @(@r #`d#<` `  @L5 ( ":Q  "N`D0B6 "5`0= . !V`6 #`3# Q`@b P  Q`@bx X $#@(f@0<  @(N 0 `@z`D0 `!Q@^ `D@z֐ "c`@& 2`8x Q`@z4 %u-%lu%qu'H'D`H #@` 'h#h` # `H 'hH''' ''|'x't'p  'l8 D@DQ@zS $ "#` 2 LD2(#`2($ .2 (#`2( $  8'h  @`8`< (``<` 8'`  8'`08 `0`4`0#h` v'#(`Q"`   @ ɐQ"` @ ”  ` @kw `@k @0p4'p@0t 4'tcP  @`DM Q"@0ݐx@ 4'x    @.M    @y[  @$   @$ `<  P '|P `  $ @ޒM`-"$@.H$l 'l2-8l`L'h'H 0'|#Q''̢b @ B@0't x''@ 6@0w' @ .@0o'Q @ $@0ep?"@#h֐  "cH@-㿘`8"2 @ 8`+ `  ` #   ? < R`6 #`2 ր`  ?" €㿘@ 㿘  "  @ ` ?"`* "@r   2 total %lu %*u %*qd %s %*u %-*s %-*s %-*s %3d, %3d %*s%*qd xR 6`"#h`# ` cL!S !p@1@`\+S)<7S9S3S5S-S/S "#@`@ @`C`# `L ; `8 @ 8@텐C @`.a`@ !` #\ $ , @`#`cP a @` `  "`2  `? 2 `@`ր    (`0"@ @_ (a@_`0#\`@<`0 #$`@5`(0@2` @vDc  #8` `  2`@``(  @*` ?"`* "@ 2h 㿘#@`   # `  #`2#8`!``*  @!_&@@![֐ 㿐͒ # a@!#@,*` @w 0| &$a  .`"@`2 @!%@ 2R 6`#h`# ` cL!S!p@0`@_4 B7)     `?`$``@  * % @ ,  @ِ ` ?"` * % @А Ĥ㿘֤#@ `@S`!@^# `L!S?`8  ;` ; @@!! @^ʒ@]Dc #8` <`  @`㿘'D@D#`  L?`&  @  `* $` @r  $ #p`   L?`&  @  `* $` @S  $ U`D;!@    L?`&  @  `* $` @.  $ 0```?"``` * $`@    L?`&  @  `* $` @  $ ``?"``` * $`@ total %llu 㿐R mR 6`#h`# `cL!U #@/  @]  >' 6􀥀` ? "`* $@   ٬􀥀    `?`$``@ * $@ 2 `?"`ࠒ * $@q 㿘#@`   # `  #`2 `M%` E >` ,?"``* $@? , `(a` ` ?"`* $@(  ` ?"``* $@   H ``2` `?"` * $@ 㿘<(@- @@ I0L0@-8@8 I0D`?"``M /F /`?"``@ |9 |`?"``3 @, @`?"``% = =`?"`` % %`?"`` *ࠒ ** "@  %s%s/%s ls: %s: %s -> 㷘V 6 2  W D@$  W D@$@+Ɣ#W (`x!#W @za@0, @\p!(@㿘N *%#J `*cl  ?*:  `?"``  * # @   N  usage: %s [-1ACFLRSTWacdfiklmnopqrstux] [file ...] 㿘 8Wb@9 @) 㿘@$OpenBSD: sysctl.c,v 1.76 2001/08/02 11:09:39 art Exp $vfsddbusermachdephwdebugnetfsvmkernsysvipc_infostackgap_randompoolmsgbufnprocsfscaleccputtynselcollforkstatnchstatscp_timemallocmsgbufsizearandomsysvshmsysvsemsysvmsgfsyncnosuidcoredumprandomusermountsominconnsomaxconnosversiontimexntptimerawpartitionmaxpartitionsdomainnameboottimesaved_idsjob_controlngroupsposix1versionprofilingfileprocvnodeclockratehostidhostnamesecurelevelargmaxmaxfilesmaxprocmaxvnodesversionosrevisionosreleaseostypenkmempagesswapencryptuvmexppsstringsloadavgvmmeterposixkeysipencapnatmisdnpipinet6ipxrtipcntcoipxtplink_layerrouteappletalkhylinklatdec_dlidecnetibm_snaccittdatakitemcaisoxerox_nschaospupimplinkinetunixdiskcountdiskstatsdisknamespagesizeusermemphysmembyteorderncpumodelmachinetzname_maxstream_maxposix2_upeposix2_sw_devposix2_localedefposix2_fort_runposix2_fort_devposix2_char_termposix2_c_devposix2_c_bindposix2_versionre_dup_maxline_maxexpr_nest_maxcoll_weights_maxbc_string_maxbc_scale_maxbc_dim_maxbc_base_maxcs_pathkmemstatkmemnamesbucketbucketskthread_pagesrfork_pagesvfork_pagesfork_pageskthreadsrforksvforksforks2passespass2long_namesmissesfalse_hitsbad_hitsnegative_hitsgood_hitstk_cancctk_rawcctk_nouttk_ninvsyncblankled_blinkconsolepanictab_stop_widthmax_linemax_widthradixAanw㿘@c!Y# n A0 w 0 "`  "cؐ "` "`@ @"耢?߀ ab* @  `#` @H @# PbT @@ `0 2 @@ @@ `@ 2@ %s: name too long㻘@ 0@Ї$#Z P@qے` ., @  $"+Z)@,`` @k `P@@q @~``@&@must specify -w to set variablestop%s: class is not implementedsecond%s: kernel is not compiled for profiling%s = %s offrunninguse dmesg to view %suse pstat to view %s informationuse ps to view %s informationuse xntpdc to view %s informationuse vmstat to view %s information%s = %.2f %.2f %.2f can't find ps strings%p use vmstat or systat to view %s informationuse netstat to view %s informationuse nfsstat to view %s informationnfsillegal top level value: %dname %s in %s is unknown%s: illegal value: %s%s: value %s out of range%lld%s: value is not available%s: specification is incomplete%s: type is unknown to this program%s(calls = %llu total_allocated = %llu total_free = %lld elements = %lld high watermark = %lld could_free = %lld) (inuse = %ld, calls = %ld, memuse = %ldK, limblocks = %d, mapblocks = %d, maxused = %ldK, limit = %ldK, spare = %ld, sizes = (%d,%dnone)) tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s = %s%ld 0x%x %u %s: %u -> %llu %llu %llu %llu %llu %llu %llu %llu %llu %llu %llu %llu %llu %llu %llu %llu %llu %s%s: = %s%hd, -> %ld%s%d %s: %d -> %s: %s -> %lld %s: %lld -> %qd %s: unknown structure returned%s: unknown type returned㺨Ȓ''$@ސ'@K =   '#Z*! ` =Za8@!Đ @8**b'   ` ' @ `  @'G''#a`@ S?B '@ @+#ĥ,   "TZ@p!h0* ZbT@ 0 a@ *?,  'Ȣ   Z'`!ԓ* €̒?`%T`!<*` € ''АȒ  @t ?؀` `ZZ!@WZ@?!0 `Z`!Z!Z!P @0͒Ȗ@ '@h0Ȗ@b Ѐ "$ 2'`Z!`Z!`Z" `Z"@   ެ"(۴ ̀ `Z{"h̀   @` Z"@WZ"@W#\0d)  'Ȓ  @ٚ ?؀`T `ZZ!@VZ@>"0H `ZZ"@VZ@Vߐ"0; Ȗ@<`.Z%"̀ ) Ȓ@Ϙ Ѐ``Ԁ `fԀ c` ]  #\@YR Ȗ@ h`E` `Ȗ@ Zސ" '1 Ȗ@g`(0̀  Ȗ@%Ȗ@˘` `ZZ# @ncH0Z#P@n 0`Z#p@n0 7  )$2' (" x@! '@  'J`Z # x "Z#@nh0|  'Zc@8L ''$'Ȕ@?#`b ( x "[  [ 8 -2 [ZI#ZF#D @H 8@m0C5 `[Z"@Uܒ[@Uِ @[  @UӐ H[  @U͐ X[  @Uǐ p[  @U [  @U [  @U [@U 0F ` Z"@U[Ȟ ؖc̖gؗ: Ԑc֐gܑ: #\:` #`#d@Uc )[%[ `!X@U| `@Uw , `[@Um!h[@Uj!p0ƀ `[Z"@U_[̐!x@UW0 ` [!['|!@|@UD!0  `!Z!   ` !Z! @@U'0[!@U" 0~   `2[Z"@U[ `[Ȑ!@U[@U!0^[ `2Z"@T[;`0!;8;@;;h;p ;x;;; ;(;;#\̤ )[@TԬHH,@@"8 @TŔ , ,"8 @T , ,"8 @T ,[@T"@0 f`  [`"H["P["X @T "- )[%[#[, 2~2 * Ȓ `@.  +  "`hbp@Tw2 *`2 #  )` ["x@ " 1[)[%[, 2~2 *  `@.@  +  "`"hp@TL2 *`2 # `?("`0,- `Z"@T3-["%[#[ hbp@T#2`?"` * q%@ 0m?`e`!(*` €   `2[Z"@S[ `[Ȑ"@S[@S"0E   `Z"@Sݒ@;07 `["@SҔ@;0,  `Z"@SÒ["@S0 `["@S[@"Ȓ @S 0 ["@k0["@k    t r r r r r q, v` v` v` v` r v` v` v` r v` v` v` v` v` r v` v` v` v` v` r v` r8 r r q v` q v` v` v` r q s u tx u r v` v` v` ukernel does contain bad dynamic port tables, cannot mix +/- with full listinvalid port, range is %d to %d㿐@x + !@r - ]!֐ @'#x @ ?`\ `Z!@S*`@;:"0s ;`%`-5` + -8@А @`~* 2 ! +X "@–# *`2 >2* ,@@ $ 2 >2`*` ,@*$  ;b0@kz 7cxJ@  @1cx#x @! @@ * 2 !*`bX "@#22*cx  * @#   `b0@kJ cxJ@ cx& @'㿀# (`(`# ( ײ  ' ' $ %''  @m ?$$&`confmaxtypenumdoasyncfreedoreallocblksdoclusterwritedoclusterreadiothreadsnfsstatsvfsinitffsmountsX# P`   ''''  @' !ؒ`*`@' $  @!S*!@ *  $#@-0 @!D*!@*  $ @@0n @!3*  ( `' N' 4׸`\  5a3a1Z?'  @ښ   ( x`-/@j  @`0@@ޒb(  ""`@Ӓ#H  ""`ԑ- "@@` "@@"`@!$  `a"`"0 ""#?c# "P"Tthirdvfs print%s has %d mounted instance%s sh #Ő0>#b`@6 &&  ('̐& Ж̘ @]   ( x`-"b@i!0耢 `b ab!0["p @p0[ b@j ?No variables defined for file system %s㿘#* @  @$b"X@i ? bb ?@`?`* + &&@   '?setuid㿘 b=`?!`@r   & *`  '?keysdeletedkeyscreatedenable㿘 b`?!`@H   & *`  '?ipcompetheripmobileipahespgreudpegptcpipipggpigmpicmpipipsec-comp-algmtudisctimeoutmtudiscipsec-auth-algipsec-enc-algipsec-firstuseipsec-soft-firstuseipsec-soft-timeoutipsec-timeoutipsec-bytesipsec-soft-bytesipsec-allocsipsec-soft-allocsipsec-pfsipsec-invalid-lifeipsec-expire-acquireencdebugmaxqueueporthilastporthifirstportlastportfirstdirected-broadcastsourceroutettlredirectforwardingerrppslimitbmcastechomaskreplallowrstppslimitmssdfltsackidentsendspacerecvspacebaddynamicslowhzkeepintvlkeepidlekeepinittimerfc1323checksumfourth level name in %s is invalid㿐@  b֒ @#a0V`ᤐ@P?M&@ c@h!#0C3a ؐ '֐  @ 2 &a `?Z"@O?`$d!`*` €## # ####[@O!0#[@O!?   , D㿘 ba?`@ᬀ? & '?㿐@  b֒ @$#a0U`ᜐ@Ȕ?L@ c@g#0C3a ؐ '֐ؒ  @ 2 &a `?Z"@O5?`$d#|*` €## # ####[@O"0#[@O"?  $ 0 < H `.fourth level name %s in %s is invalid㻈@ ba?`ᔐ@R? K&d@ghc ?$' &'  @ &Ű?& @  J ,"`  *J`@ݒ  '' 5[  "  h@g0/ "@  W@A&     ' $' &'  @` d&@gc @ @  J ,"`  *J`@  v'' 5[  J` ? "` h@fڐ/ "@   "  n"@9?05@ d#@fz+?@L`, @L` 耤L? ,  @   J ,"` @*J&  ?' %s: no variables defined for this protocolfourth㿘@ bb$9?`$@P.`l &",*`  @  e@f#?@ e?cА@+  & *`  '?pim6icmp6ipsec6ip6udp6tcp6rr_pruneuse_deprecatedkame_versiondefmcasthlimauto_flowlabeldad_counthdrnestlimitlog_intervalkeepfaithaccept_rtadvsourcecheck_logintsourcecheckmaxfragpacketsmrtprotoforwsrcrtmtuhlimnd6_debugmtudisc_lowatmtudisc_hiwatnd6_maxnudhintnodeinfond6_useloopbacknd6_mmaxtriesnd6_umaxtriesnd6_delaynd6_pruneredirtimeoutrediraccept㿘@ b[bd9?`d@.`g &"l*`  @  e@eW#?@ e5?cА@j  & *`  '?spxnetbios㿘@ bb9?`@F.` &"*`  @  e@e#?@ e?cА@!  & *`  '?%s: incomplete specification%s level name %s in %s is invalid㿘  d@ec  g!@dϒ? . @`" @k 2 g!0@d?usage: %s %s %s %s sysctl [-n] variable ...sysctl [-n] -w variable=value ...sysctl [-n] -asysctl [-n] -A㿘gggggb @"hbx@N @ 㿘@sumo:12illegal argument to -o option%sstdin㿐@O'Dgb@@ `8g@b iji cli!Ȥc$! (7g1g-j+i)g#g9g ;g o @  ji cl@ڒ#  c@d)#@QD@MD@b?݀ ?b * @  @  `@ #0@cג   #0c8@cȢ 0Ā@@ @*cksumusage: cksum [-o 1 | 2] [file ...] usage: %s [file ...] 㿘!h 8@{a( h @敒a00h 8 @插aX@  ;n C&vkkMGP&"/+Ka5 d1͆< 8OLpHEAR_[԰VRVuj6n+c gZy@}]p{zt^f͘#W`9'<݋Rd+[XF﷩`6h}/-03l ]2mp'ݰVqKI6Lδ "u=:(Fy>C͚}-4pw0Gm=K9V'#C.=* rOx ͻK} x|VqiuԍkoRlbf^FZ^[W}S`fM0cIZ-D @Ɨd 'NK`#%▒+/l6/A ]h@D+f{*uP6&;>k;qv2PUMƼ_}>1ֆոy4:Zi mY`ۀdO7z2~ɋs\wKO VKF68BG+\{Xf=U@QC]S%;!&),(^G6MB2P?v,;Zk&ˑ HVнMR#/VKm`lp+ =eh 'ޥdo#j͡`볽>~ɴ}:̣y{6`Ɵ}q[uF2 -tq0]YK.TPɶ@NEJOG +C{}!C`rFOv[h lGJa0e-$KZV^pm0=5^ [7Q3R>?:Ѐ$Ѝ V:-)Tũ&yh;+֭PlM/kv|`v#d'sĉ yྀ:gК՞}b> q 2+ߢ6hfmu{ڵ6]@?cc( 8"c(  !h#(!4`0 @ * *` ,`(  $#(?@ 4ߤ  &h(!Ȑ 4`@3`*` * ,`+`4  (8&@#( 8%#(%lu %lu %s 㿘i#@J "ii#@Ji@J# 㿘i#@J 2 "ii#@Ji@J# 㿘i#@I2 "ii#@Ii@I# ?c  ?#@`2@ 4`  ?@a 4  &@& ?c    @@`?@? 4  ?# @4`@ @4` &@&  㿘@tsetJ񀠠0 J@, @(b  * PJ ( P"J@"2  J` J@ @ b ((P* 8 @b@ *`(P"(8"tset: 㿘! jH'H'L'P'T'Xb@4@j@,b@ 㿘j`@n"@S@ write to stderr㻘 @   @?2jߐ#x@$ Ԑ@Z㿘 `? "`` *:   * # @ Terminal type? [%s] Terminal type? 㿘 H @j@ƒb@9 %'+k)k-j``@㹔@㴒 @E!@?P 2 `2@㣒@ @ 2*L `"`  2 K n , X   `  % K K K  x23040011520057600384001920096004800240018001200600300200150134.513411075500unknown baud rate %s㿘N B  k!` ` 2  `2 k#ڒ malloc><@=!:illegal -m option format: %s㿘@t@Ȑ  kҐ#b$ $"b$"" b ""b k$ c@$  $ K$ @2$  @?ߑ* : `l!Г*` € : $  4 $     $ `*:  : "k `@ǒ : .@u`$ ` $ , 8 $    "$ k#N$                             㿘"$ G  " @= 2; `1l#*` €+ Rc @$`?R# @  R# @  R# @    R# @    `"  2  4 X TERMunknownTERMCAPTERMCAP=tset: unknown terminal type %s tset: can't initialize terminal type %s (error %d) 㿐 2ll@g# @K{  " l@@I "l #tl@O# ,J /")N% (p@ "#N)l `p#@"  `pp`" (p  ` "N @ `pN ? !N    !%l#l @ᖒ0 @ᒒc  @ 㿘ؠ! @  "  `,    ,   `,    ,   `,    ,   `,    ,   `,    ,   ,  ? ?  c @ # k!, $$ $ $  @L 㿘1#J `"  ܀ "  @^ 2 # `J㿘ؠ! `耢 & a耢 ,  `, a  c쀢 & ac쀢 c  `*a  c  c c  `*ؔ ! cȄ" " H  cHcȄ >"#!cH* ! !  㿘@I c䀢$!# a耢 k@/y  # a쀢 k@/o  # a `̀ " f   ``?"``  * $ @2 @  @r# 㿘#Ȧ`b I ` E ``?"``  * $ @  k  `@/ b  #n @wbpȒ  @/    `?"``  * $ @ڐ  %s %s isset todelete. backspace. control-%c (^%c). %c. 㿘ؒaؒ` @!  @: n#Ȁ`n#n#ؐ @ؒ `n@ђc0"#`܀`` @@ `J` `n@߾c0 o`@`@ߵ 0o`@߯-q-e^H-i^C-k^U㿘 >'o%o#o!oJ@ -  J 2J@(H -2)   "J`J -2! J` e i k2 J` 2 J i" aX k eP  !` @&  2usage: %s [-IQVrs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] 㿘obx @G@  (H^ `H?  `Hstandard errorreseta:d:e:Ii:k:m:np:qQSrsVarpanetdialupplugboard%s Terminal type is %s. EraseKillInterrupt%s No termcap entry for %s, only terminfo.SHELLcshset noglob histchars=; setenv TERM %s; setenv TERMCAP set noglob histchars=; setenv TERM %s; unset noglob histchars; TERM=%s; TERMCAP=export TERMCAP TERM; TERM=%s; export TERMCAP; '; 㻐ؠ!@ @7 ao#8a !"! "` "` "`  "` "` "` "` $"`  ("`("`$@72c@9@o@ucH   *c      L!o`4Gq"T*` €B  ( oo#h< ( oh#p5)* : -"c+  * : $"c* : "c ( K  ( oD#x      @, @+?L@@:#P??"*`& @ @5@@ &/ <%1 !R@&"R` $"`h@"`" "  "   `77`g@| "`Jؒ!a@֔ ,  @  @@ o#@Bɒo c@єo# Ք o# Д o# ˔ O  o#@B@fo#oAo@ # "p@p?@~`  pO p p @p hp `@ByO`! `?"``  '* $ @? '@%p @ @   \  $ @ d € œ  ´ ()%'&*+#   $ "!$"#%&!     tsr2  u0kbok p r3iv4jzj`% w.-/f l43n5m+, 601279:O=SW;<@?ABCDEFGH    IJKLVMNTPcQRU>8Z[\]^_`abcd1vwxPJOIQKRMHdLg*)hstuiN!\~]ye"}qAB&()C*Xe|~+,z{|DEFG@lmnoZ-S[6hg/x.'7y8TUVpWXqY9Yf{}#$:;<=>^?_5 !"#$%&'(a%#&(*  )$ '+!"$ "% !  #&tsr0123b ku  v4jzw56789:;{!"} <#=>$?%&'()@*ABC|~D+EF,G-./f0123+,456789:;<=>?@ABCDEFGH    IJKLMNOPcQRSTUVWXYZ[\]^_`abcdefHIJKLMdgN*)hijkOlmnoPpQqrRstiuvwxyez{|}~Slmnohg/TUx-.VpyWqXYZ[\]^_` !"#$%&'(a() !"#$%    '&*+  $"#%&  !hgn ijk    fl+,copqdpez{|}~mq/.rrytuvwx0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abs&5 k  j%)*./ 024361ABDEFGHIJKCN9;?TPM<>QRU@V87=XLOSY:WZ[]^_`abcd\' fe!"g*)hwstxvuz{|~}ylmno+#-( !"#$%&'(,$- i㿘     @& & @ @& * 㿘`xc& 0@ Uג㿘@C @J ",  "R  0! 0R # `!p ( ` #R  P `!\*  SVr1SVR1UltrixHPAIXBSD, , :\ :%s: sorting by term structure order %s: sorting by terminfo name order %s: sorting by C variable order %s: sorting by termcap name order %s: width = %d, tversion = %d, outform = %d 㿘آ*b@"< 5""y`@Y y`@S y`@M y `@D y `@; y  @2`؀ ؐ "b( غ""(ذ`I"",z!t.` €ƒaT؆"t#"h#bl py˒c$0؆"t#"h#bl py y y  "bxyy!pc\!!#bh l p#t$"x؀""0 0E- 0@>#y @a7 #y @ڒa0qqr#(c t #y @ʒaXsst"c8#y @Իauuu"c`"\#"`#bd  #yb b(a@ԣ",  L     0  0|H ? |*` P? ? |*` ? (Pz(" ` 0A 0>`< : `"` 1 ````(& "瀢`݀ `   0  0   ( P   \ 㿘!"x"4ؐ"D"8 $"4㿘@Mآbt@H "4` "@ @ !!ؠ"DאtԐ4$4%?%pe%? %%%%c without %%?%%; without %%?㿘{``@f    @ 2{`h@Z@ N +ئbP 7{*`:  e"$  p ;"j  ? % 9 \  9 t   bPa    9bP{`p *?@   -{  #{"P`xD ?"P= 9 n  -{%{`"Px- ?"P& " N ?~`P`2NNN@qINA9؀` bP  *? -{3{"P`x ?"P  0+{@L  9؀`bP-{  *?#{`"P`xڔ ?"P"PӔ  9ؒ"P ˔ N F@%s@%s#%dim=ei=%s=!!! %s WILL NOT CONVERT !!!..%s=%s=%s=meml=%smemu=%slqkxjmwuvtnbox1=x?#?'Tc*@  "@` z""|a!ؠ"D "t  ""4? ܶ"P5?#7| + "0`"\-  +  " " $ * @"h,    (,  #耢`  L O L T"  @@ @204X    +4 " =  V?#+|%| & "0`"`-  &  $  "" $  * @"l,    *,  #耢`  L O L T"  @?,  R@@` 0@( 4    &b4 -@7 2 , 2  &,`"  Ȁ "  @ 2  "  a쀢 "  @f, 2  "!  ?#ض"P! "0`"d-  !  & "" $$@   * "p,   2  ,  #耢` ,L O,L T" , )   Ѐ`ᰀ   ,  |@   |  0਀@    | 8 ^' @?/  ,    ?  ?c@"@ ,|` @7   ^"V4 w, tRT @o@CA <,  ?|`@@ϐ6  c |``@@R @*` ,!` \L : \, ,2 @ @ ,` @ *` ,`  |`h@   @'@֐,  T@`? |`p "@` #,   bP @@ bP  ?"(*   &l ?#|`x@L  &pD|?#`@>09 ;` "H?5 3|?#@  `L@`  @H " , ,| ? ccc7 , ' T`?@@H `9ؖ"D  "DJ?`  J?  ?"  D J :DJ J  J \ ?" ؐbD bD* 8"4?ܖ@QbDolder termcapterminfo# (untranslatable capabilities removed to fit entry within %d bytes) # (sgr removed to fit entry within %d bytes) # (acsc removed to fit entry within %d bytes) # (terminfo-only capabilities suppressed to fit entry within %d bytes) warning: %s entry is %d bytes long # WARNING: this entry, %d bytes long, may core-dump %s libraries! 㿘",` ~#آ# @y ~##   V` S~@4s# Fb  @bH"b @4b "bH p@4T #3b( &b(@4C { #!`@r @A!@4*&b("" "bHbD@z|`%s%suse=tc=ؠ"D  ?#``c8#@#H@Ȑ ?# "D@zV`"D` comparing booleans. comparing numbers. comparing strings. use㿘2`#@z3`` 5 + "0`"\,  + `"`" #`* @"h+  ",` #耢`  J OJ T"`  ` р +2`#@y`` 7 & "0`"`,  & `$``"" # `* @"l+  ",` #耢`  J OJ T"`  ` π &2`  @y``  9! "0`"d,  !`&` `$" `"#@  `* "p+  ",` #耢`  J OJ T"`   `  ̀!(   㿘  ? " @7 *  @ `"  2 D !? " @# *  @ `"  2 F f(? 2  `Ȁ? " "f( "  f,? 2 a쀢" a耢? 2  a? 2 "f, "! R`B?2 R`? `  ? 22`B  !  `@#``?, )  8? " @Ē *  @7 `"  2 H "? @ *  @# ` 2 J㾘 "H?[ Y  * :     "H J` 2J *  `< !@e  H `H J@ +@   HJ `2H  ,`K@ "  "H*@   H *@  (K@  "H*@   "H*@ TERMCAPTERMPATHHOME%s/%s.termcap /usr/share/misc/termcap@x >@#` L /.@v#h @$)$@@k#x "L "@2 !# c@$@c@$*@|$$@`O  J@  :2`*@`J@  "` :"`  $@`@ܒ`J@ 瀢 $@L  / @% +?'t@ot t t@:$@5 : ?L 2,? t ? ?@c? ?termcap names not colon terminated| %s%s:\E\040\041\054\042\047\140㿐 :@g'D 'b0@I *@ 'bXD)!- bh@Ӑ 2 "`"p@1"`@I 2N `?"``  :*" @ `   N  `2 oWN倢`E?!ԓ*` €@0ݐ"@0ڐ"FN@0Ր"AN@0А"8!@1p"@03.2#+ ( & # !              ܐ 2cԐ ے ~ݐ ?' #8""\''//bb (' ' ' ' ' ' ' ' ' $''c@Ӓ ?2$WARNING: terminal cannot %s㿐"` #`'!P@/kLINESliCOLUMNSco㿐c?  !@e  $# $## @`h  "# @! "@y@N!"c c # "c #`h@Ք  򀢠""@! "@y@+!"bb  P"bkrklkukdkPkNkh@7kDhЮ#('@8  1٢ H@@V  ,@  ,@ @@I  ,@ #0'@  H@m@7  ,@  ,@ @`@*  ,@ #8'@  3آ H@M@  ,@b@C@   ,  #@'@ ْ  H@1@  ,@b@@'@` , `#H'@   b@@@ސ` ,@`#P'@   b@@@̐` ,@`#X'@    H@@  ,@ #`'@    H@ޒ@  ,@ #h@ t'̦  H //Ҧђ@Ȑ@  ,  , @@  , c; //ђ/@@v c\ ,c\   //@@d , b@@@UTERMunknowndumb:hc:hcamxndadbsgpcksketitececlear to end of linecdclear to end of screenclclear screen cmsoseusuemdmembvbbsbchohome cursor|^llmove cursor to lower left of screen alsrscroll backwards㷐@# #@  4  /?@ O#@.>@ H#"c@ C#"c,@ >#"c@ @ 8#"b @ Z  "bl"blbl#""cD#c " <"p  ""ْ '@ i ڀ`"! @*#@ ] ڀ "b  "b @ R ڀ "b$ "b$#!ڀ`##`2 "(@ < ($"( 0@ 7$b,"( b, $"(b, 2 $b,@ $ 8ڠ "!`J@ 2 V @ $!@  X"ڀ`"!􀤠 J 2 < ` $!@  xڠ "!쀢`J@ 2 %  $!@ ܐ ڨ "!耢`J@  %!"b "b@ Ð ڢ"!`2 $a@  ڠ"!`2 $!@  ڀ"b 2a"b@  ڀ"b !"b @ ڀ" a!" " @ y ڀ "b  "b  @ nڀ" 2a!" "@ ^ ڀ "b "b@ S ڀ"b 2 "b@   @ < ڀ "bJ  "b @ -`! !J@    @ Ԓ @t@= @'@r"a!@ `! !J@  #  @  @G@ @' @EH"a!P@ Ւ` !X@ ɒ c@ c@  "!`@"a !J`""0 0㿘# !@`$"0"0㿘N  N@ 2Nϐ "N@  ݐ6㿘#$`b(#!!hc @2b @-c  "c㿘#$`% b$#!!hc @b,@c $㿘ah@ 㿘a @h㿘ah@ 㿘a@ h@ 㿘"`@@*Y 㿘"J`#  @ϔh㿘a @Ŕh㿘ah@ 㿘"̀`ah@ 0ah@ 㿘ah@ 㿘ah@ 㿘bh@ 㿘bh@ 㿘bh@z 㿘b h@q 㿘bh@h 㿘bh@_ 㿘#!!hb @U@)ϐ b@O 㿘bh@F Nothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracket㿘 ?@*?@  "!"p"!@v ?"0񀦠@  !("@) 0!   @A ?@D$?쀢"@)Ò seek errorread errorWaiting for data㿘ڢ"8 `$  2 `( @+b8 2 b8  ?b8b    #X b8@ 2$"b8 $ & & b8  $ *` @ @Ҧ ? 4b82?@(?b8`2``` 2` y ?@ ? b82 :  P@)E g?: # ? #  $b8 # @'   `  ?*##  ?怤   `@)! j #   `@ʒ b8 <  B;  & "` ; 0  p@)? @ط  #4`2?b8b8 "` "& &" "b8  ( jb8  ch_ungetchar overrun㿘? !# ?#@(ɒ $# Finishing logfile㿘c $ $ #"8`0?`4? "$ 8@( !@?#4 @&?$$c Warning: log file is incomplete㿘"8`cB  gB 3` +    )'b8b8@2 `  @(m    2@` @`b88"  2  2 㿘@ U? 4Y @ 8T  cF "83` + @ 1 @*b8Ð %b8b8`42 `8,  `@?#4`b8`2 `@ b8  $+   cF + 3` @* @ ( 㿘1"8` @` "8:0@;? 1  2 @B?#4 㿘 w  "82  b8@&  2b8 "`("`$?80?8$(( 8㿘"8$@ (  ?"8 ?`(#4`$ "`("`( "`$㿘"8`( ?"`(`$$#?`  "8 "8?# $" (" $"8$@ ( @ Cannot allocate %d buffers㿐!#"8 @6 @I "8"8b` & @''"8 `2  "8 seek error to 0㿘b8  ??#:0  ?"  2" "8@` "8 :0  :"$"(  @x ?#@&ޒ 㿘 @$ "8?   " """"@" 㿘"8@ "8 # @""8@ "8b8" 㿘  @5 ?  㿘#@$bڠ  "b8 8@͐ ?  ??" : " : 0$"8" "" " " $" (Ր "8` "`b@"8"8` ?""` d㿘"8`  b8 b8` 2   2b8@` b8?"`  @`b8b$b8@֒ 88bcccbcc18b95.bb125.bbnext8bcccbcc18b95.b128.koi8-r8bcccbcc12bc5b95.b.dos8bcccbcc18b95.33b.latin18bcccbcc18b95.basciiinvalid chardefchardef longer than 256㿘N"H` : +*:  9   06,  . b0 b cb0     * N?? @% R ڦ#H%@*,@@%ے G ,@? ` N ڐ#H@,@`@*,@invalid charset name㿘 "  N   0#(` #(@ "   2 H@%  㿘`@ "  bH  J ` * "* *  *s<%X> J*pJ*"J ksd  \ u \  \  \  \  \  XLESSBINFMTLESSCHARSETLESSCHARDEF㿘@ؐ"8@Ӑ"Hv @̐"X  J@  0ڐ H ڐ H %cESC^%c㿘   !c !c@֐"@"@ @ܐ  !c @Ɛ"@"@#X!ڔ@"@"@ڄH"#(H"c"ȝ㿘@A#H㿘ڦ cĨ#H@J !$J#@+#Ē"@$#. N 2 @j@N *: @$8@ N@`@L@#`  Đ#H@M#H   㿘1#J " f#Ġ`@$ &#@ِ @"㿘ڠ#Ĕ cH (#J? #İ #ĀJ? 0H J?   o#ĀJ?  㿘cJ  #J@ 0 #J@   㿘%ڐ#H@!cĐ$cJ@v#"@$#N  Ācā 㿘J#H`  c4*# `?㿘1#J " #Ġ`@#t&#@D @"㿘ڐ#H@"J!@/#"@$#yN    㿘#`̰ 08 # ` @" # `  ڐ#H"cN %cİ *cuJ@@@$@#cĐ $cN`İ *㿘c * ڤ@Ґ#H #cc  @^H 2cc  Hc$ $`$ `""`c"`㿘# @?cd  `@ Đ`!8*` €@"#`R"#`#"c`J``  #,#J@  #J` { #J@  0rĢ cH"#`  K? #İ #ĀcHJ? #ĒcH U J? %  #Ā(K J? E "#`@"#`J@  #J@  0/"#`, "#`'"#`"G"#`*"#`l"#`ڐ "c"#`  @ "#`  L L J J Kl J Lx L L$ L8 L L L L M M$ M M L㿘ڨ#H@ߐ uK!#_@פ#␔  $#@ː "@|$0G@ÐĠ  , Ġ? : * $J?`%?0L@﨤b@@ @$@@ @VG 0@! L @ Ӣ@ 㿘 *`:   (L   㿘cJ   !ڀ ##J@  #H@ #ĐcH  J " #Ĕ#H@  N?   ? N? 2?㿘%̀ @$ 'ڀ`"#@쾐 !#Ē " #Ē"@nS$#Đ @@ *@#$*@?㿘   1 !@#@#ܰ㿘#`` !#̀`2  "#ڐ#@N$c` Ґ"c #ː$#%Ġ cԀ  ##Ԁ@؀ c$c`9 $c`d 㿘cȀ "c@<      㿘@kՐ#H㿘@ @@"ځ#H㿘@ q㿘O" LGL @ @*!/?㿘`P   ې ("`L P!# P # P @# P ##ct!done|done㿘`L`*e"`*` € T@:0YL@!L@ +"` "`" "L@@L@ D$"@$" \!L X@m8, X T L`WL@00 T L@PL`0)@0&L@ ! !# @n@ 9$## @p @l @ G 0 J``@ْ @ >  T VX VX VX U T VX VX VX VX T VX VX VX VX VX VX VX VX VX VX VX U VX VX VX VX VX VX VX U U V8 VX VX VX VX VX VX VX VX VX U`㿐 L`/!*` €?Ѐ v@  dr "`T$L #8 d"Ā `ۢJ X  + -X + -!  \ې "`\ې "`\ ,`X@  L`X \@`P L`X + -1,`X@  -/// / 8   *  @ !0 0 @! `P  "`P0  M L  ?݀    ̰  Wx Y Y Y Y X W< Y Y Y Y Y Y Y Y X Y Y Y Y Y Y Wx Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y W[Press 'h' for instructions.] [Press space to continue, 'q' to quit.]㿘#`ڐ#耢@Z@ [ "X "X? "X  @ "X"X@ "P`!" @+$"$"#` "` @ %b a E!"  T@"@X$"@## @e :0C@w"x`@p"`Aless version %s㿐c' @㿘`ڐ#耢@"J" @  L   g   0 @(ungetcc overflow㿘!# #ڐ#$##ې L@ !@}  #* $#㿘@? Lݠ?:LPattern not found㿘ۢ `P"a `@ @ 0`P  >$`P%@Ɛ  @ؐ  ` P@%  `P 逊 `!@&  @ 튐 :%s helpExamine: -Cannot edit standard inputCannot edit file processed with LESSOPEN(N-th) No %snext fileNo %sprevious fileNo such file_+mark: goto mark: |mark: Brackets: 㿈c ې 2  :    "P"+%3)1Z%`L#4$T  .`X@&#`#?#4 #4 `L "/  `L "/[  '/'@D쀢 ` ``c/"T*` €b l #4T`""T @M$TUT @ Y 0T`""T @:$TBT @  0}T  $T6=TT  $T-?TT  $T$T+ T  $TT, @ #4  " "b  @  #4  A$"T 4% @  05T 4% @ G 0* @@ pT  $TT@ ўHT &$TT d d$T@ T0T @ T &$TT :@ -0@ 'Ő" T  $P$TT `$P $TT PT $P` $TT& 0P P ?  ? T" P P ?  ? "@PT $P` $T[T $P@!6L#`x0@"F@  0#cD 0!@ "@Cc 2[#!T`T#8'b@  @F@" ]댐 0YT  $T@T P#`"`Tw T $#h '#pT  $T@T 0T #h '#@0"T  $T@T #@ْ 0c /֔ ې $"`\c ͐  c8 "Ā `@ 0c  0#c 0c  c8 "Ā ؀ ր @0c  c8 "Ā   @0cД z %c8 "Ā    .@i #*`c] %0cW 0`L  cN m0"x  |"b bp b cl d a h j8 f4 hl c bL a c@ d d, c i e f c j g\ d c h h d b b d fP a b i i i` g e j8 j8 j8 d e eH e| g j8 j8 b dL j8 j8 j8 j8 j8 j8 j8 j8 j8 j8 j8 j8 j8 j8 j8 j8 j8 j8 j8 j8 j8 j8 j8 j8 j8 j8 j8 j8 j8 j8 j8 j8 j8 j8 j8 j8 j8 j8 j8 j8 j8 j8 j8 j8 j8 j8 j8 j8 j8 `<㿘#@)!L!@= C@O㿘  @  @&""" ?Warning: some commands disabled㿘!Dߔ  x@ Warning: some edit commands disabled㿘!Hǔ  @ @ 4J@K)`J@ g`"#!" ?J`g2J@ fJ@`J@`J@2``@ И  d㿘 d     d"㿘aD㿘aHH"H("@㿘@J J ?l 㿐@N E26?N n22?N d2.? ' J `e'`x`c0 0ĐC S'@?  㿘@ H @z  @    @Q ?  @̐@?)?@^@7< "N@乐? N  M N  +N  Glz .lessCannot use lesskey file "%s"㿐@:!(   !0'@p@䃐x#8 I "Ā C `` ܲ` `$--,   ` 6 d` "  d   d  d ܀  M`0 㿘z@&@@  & N@ ".@ `@*N@㿘`@m@ @   N@ "`@  `2 @ J"?8J?   ?J?8?㿈b " @耢?쀢?@7@L#aT " $@%`h@@aT$aT$㿘 "@0 @-%s"%s" may be a binary file. See it anyway? 㿈" b  " @'@   S `@j !P H'@ϐ '!@Q@d쀤`@@\@_r @L  '@'!@4@G䀤`"耢`@ @s !'@s쀢 y Y@۠Ȁ`"""!T"`h@%bb@bX "f# `#c @ " !y"@X`?c `$"@@ @  "`'!@Ғ 㿈#b  @    @'" @⼐ " @"     㿘""@  㿘""@ 㿘"`  @? ` 㿘"`  @?Ґ ` 㿘 @z "  @Missing filename ("less -\?" for help)㿘@aP " "P@+ 旐  㿘0@?@Warning: "%s" exists; Overwrite, Append or Don't log? Overwrite, Append, or Don't log? (Type "O", "A", "D" or "q") Cannot write to "%s"㿐 H@ @r #` O"'@1!? 0$*  @€!@1"c @֒ !$#  @S ?# @C#? $#" #0@ א?# '#p@ |$ | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | |$ | | | | | | | | | | | | | | | |x%s/%s㿘 % L@ !@א@Ԑ @   a@x3@` @b @HOME㿘@"8В  LESSHELP/usr/share/misc/more.help㿘@ʐ"p "d㿘L@ # @'%*`:  # %2  0  G4@x`@p`L@  @ I L@  @1'*`:  # %2,"@W`@w@L `L@  @,%s*㿘@;  @w`@@ƒ @͐ @ʐX  !  @; ?2    @I @  y @   㿘  @ ??? 㿘 dɒ  d@ ,,佐@w @y@Ґ, ? $@Ő  $` ݒ$,SHELL%s -c "%s"r㿘@⯐`@⪐" @⤐ 䃒 @w@Ȑ"0 N bH@⏐@⌐ k b8@v@$bH@/@echo %s㿘#@ |@N`@0@LESSOPEN-㿐 ?@z# " #А@ڒ ". L |    `T @i  @Y O&&@ 2@JN@` LESSCLOSE㿘"@:@5 Ѐ P@08@ @)'"耢`# < @   @ Ð @vaX@ @Ր 㵐 @vah@|Q8@Ԓ Đ 㿘"`gq㿘"`#4`@??  @ b "b㿘b @<"b...skipping... 㿘    c ?4 #  c ?   F)"`c ?Eb@   ! Ѷ 0#)@G? @ @ '@ @\b  '7?! '@J#'-?@C &! 3ဤ?b b  !Ȁ` b!Ѐ`b  "bb @x? ` ͢ @?Ǣ Ő¤ @ߐ ? "" #4`b "b %!"%!@i%!@ ?㿘@   c ? ""@`&@? @1? `@)@ܐ?㿘#`"` w  E[ 0A@d??5 3` #  @ )"`@   @E     @=??  rb  "b 㿘@! ?  `@?@PU쀢   # ?Cannot find help file-%s -m -H -+E -+s '-PmHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when done ' %sEnd of help㿘+ !X@O 0@߽#@߹c ᘐ c@tap@Q@[ !@4 @G   " 2 㿘`2@!@ && @" `&@& a "a㿘 ?" "a?"a㿘 (I 4& ??> & ʐ㿘 !"@#$"Ӑ@ @     㿘 2  㿘!! "   @ 22  㿘  "   @: `:  :@ :` "   " 㿘?%"`!*` : @ F @> @@? @?Z? +# (#B? @ "|`! ?  B? c4 ̀ ?y!  @`"t 0c4 p  ?[ 㿘 `"`!*` :  @ @ f   @|F? q"t`'-42US  -%4 ZF  ?-0N `B 4 D0 ?4 = 2 @Ǩ@Ғ1/B? @  | 2" @Ð D@?4 @? ?D  @Cannot seek to end of file㿘W "@@4 0I?   #   @”0#   @Cannot seek to beginning of fileCannot seek to line number %d㿐@x?  粒  "Ԓ@0,  X@"@ 0'#@ݒ㿈@,@@rDetermining length of fileDon't know length of file㿘!?   @ ?   0@ 0> @ @ d   2@ 8D?"Ԓ @ 㿘=  ?  @Cannot seek to that file position㿘@А@l & @ΐ?   ?@Ɛ   g  !@< 0}@  @??   @ @8;'+ဤc @8 "?   0N#? ހ@c "b""P%?  0/+ဤ4 @  0c ? h? 瀤@ ""P@c ?   p t" |"`"x*%6d㿘#H`B@q1 p!"`@pz p@ `t   "`tۚ p`p * ?`#`p#(  ##(#("`p1ܢ ! p t& p , , @<$ t  p t" x      0   0  <l      0   0  Dp㿘 &? !  p`  ې pJ ` ` p`ې pJ 㿘 p۔ pJ # pJ ! t"@$ t㿘`B @7 2 "Ѐ`t@␒@@ 4J ܶ p# B %#ۀ`?J ` p`pN `Y  p t?."t p`5ܒ`pJ   p`2 `pT t ?&tp`p* * t &t㿘J `    @ ",   #P`,:  @㿘#`| /! p"J . :`@$`|  _ _   - U G   p $ p $ #P     0|8y  * r l p`k   f$`|c(   $c(!1ܐ    N p`$ p t@c(  J ڐ 7"Ѐ`ɖڐc\{@It@@␒@@4' N "!ܑ*: і  p  $ pN`   `p "`p 㿘J ` ` ܀ 2    2 `t#` #,` "` pۘb +p *"pppb*@*~ "@Ȁ H ۄpH "@ ܄  㿘??  ?? ?", `   "瀤 B?,b&㿘 42 ?`ÐF? ??  "?<,, ?8?a`B 2&܆ ܒ   ݘ& `   #`  8"& 8܄  @ b ; 㿘  O`  4   8   @5# """"`:`"@"`$  &@ #``  `   4 2  8` 2 #b " "@Calculating line numbers㿘!@   "a㿘!"   d$"@ $"` ?$"㿘#H`?   2 `      4 @8 x@ u@  ݀ "c   b@ f 46 4 2Y "" 48 ?"E @"!421@.0+q 2( "" 4 ? T@"!ې㿘`ܰ a     & R @  "     "@$@ !   25? 6 % 4& ? "!?"  2?  %( 4 ??? ?q㿘@ ⃢ ? ? ?c   @ ?   # & ?Ò@"?! /dev/ttySHELL%s -c "%s"sh㿘N -  ,@ t#@ r@ o#"G ް@ 8W @ @B @I #@ɒ 6@6@T#  L@  N @@  c@ks  N 2#@u@Ԛ@  @@ @n   H "bP ݐ @M 㿘@͐ 7?@ א ?   @ ̐? .   4 ??   @Cannot seek to start positionwCannot create pipe㿘ʒ  "b@- "@  {?Q@#@@#ٰ?@a؀ @ސ  @Լ  `E 4' @# P?  ?` $  @ . :    * $@LӀ #?!+? ?` $  @ . :    * $@L߀ @7 @c @  Z  ""P@f ݄ А?? 38ߐ ??: Invalid mark letter㿘? . 1ۑ* "? !@^  . 1ܑ* #xCannot seek to end of fileMark not set㿘 '"3 . $0.! ^+"  > & 3"K )" c> & #cݰ> & "   ?  ?" @  㿘`?㿈  @ B> &> 㿈@ 6耢?쀢? " # ;`;`㿈 &ߐ` ?2  ?2  b""`  ; #  ? ?b@"& EMark not in current file㿘T  "@  @ ??Input is not a pipeLog file is already in useNo log fileLog file "%s"㿐 %  0-0*)"#  !0#`!HֶQ]" ޿<#`!h@C 0# '!x@<㿘 "cÒLine number is required after -l㿐  l'@d 2` "@ 0"a蛐Cannot use lesskey file "%s"㿐  ' '# @㿘  0)'"!L@`#T`"> @?   L  : 0"Ԓ e Tags file "%s"㿐   ""#0"c#' @@/㿘   "!(% %s㿐 )  "N@0,+N@ M" m = " " `"`#`"@уծ &cL"* ' @`㿘   !)#X$#X㿘   @ 㿘   x զ Use "h" for help㿘#`   "x@" 0հ ب@f "bՁ 䀠4 There is no %s flag ("less -\?" for help)㿐 'Dߦ " J@ € $ $  DJ ?`0+'D!*` €DJ@ +`?`f`d'D D"J + 'D"bM D@O'DD z?'D@ 2  @'#8@    "`   `, # D&     `?"N   @[`? J@  @'DD@  "@  €DJ`2J t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t  t t t d d d d d d d d d dThere is no %s flagCannot change the %s flagCannot query the %s flagCan't use "-+" or "--" for a string flagCan't use "--" for a numeric flag㿐'H@f @'"x ` @ @ڐ' "2 ! @ΐ'"@0   HJ`"  ` @ h "m``  "&   a`> 5[`"Q` "` R`" `N` `?H"` `?C"@":` "N@;`" N@7`` @`@b`?` )"@4(`$"Ѐ"`  ``H@ 2 ``  "`"@#@c 05`  €H`  @ `  "`   ``  *@> '@7``  "bP` @  ` -%s㿘!# b@e㿘@n    S@ 㿘@b  ` 2` @ String is required after %s㿐͐'#@㿘 J@㿘N A $2``*@J@  @ Number is required after %s㿐 L -2    ?А  &%?' @@   А  * .  @*`: В@ Ѐ$&`2 Scroll window size is %d linesScroll window size: Forward scroll limit is %d linesForward scroll limit: Don't use init/deinit stringsSend init/deinit strings to terminalTab stops every %d spacesTab stops: Display ~ for lines after end-of-fileDisplay nothing for lines after end-of-filePrint backspace as ^HBackspaces cause overstrikeDisplay underlined text in underline modetags file: tag: Chop long linesFold long linesSqueeze multiple blank linesDisplay all blank linesDisplay control characters as ^XDisplay control characters directlyNever ring the bellRing the bell for errors but not at eof/bofRing the bell for errors AND at eof/bofprompt: Log file: log file: Constantly display line numbersUse line numbersDon't use line numbersLong promptMedium promptShort promptPosition target at screen line %dTarget line: Ignore case in searches and in patternsIgnore case in searchesCase is significant in searchesDon't allow help commandAllow help commandBackwards scroll limit is %d linesBackwards scroll limit: Highlight all matches for previous search patternHighlight matches for previous search onlyDon't highlight search matchesOpen even non-regular filesOpen only regular filesQuit immediately at end-of-fileQuit at end-of-fileDon't quit at end-of-fileBe helpful in promptsBe less helpful in promptsRepaint by painting from top of screenRepaint by clearing each lineRepaint by scrolling from bottom of screenAutomatically allocate buffers when neededDon't automatically allocate buffers%d buffersBuffers: Search skips displayed screenSearch includes displayed screenH؀  "    J2 HؒJ   ( P  J򀠀  㿘'D'H'L@ ( @! $"hD?H@!L $"h""h@D ?㿘ߐ (@ 㿐@w%s: %s㿘 (`x@in@Ð@ П a@c##?㿘!"8"8`@ "8 @ d<"8"8 . `@   d@ . 6` .`@B2`* @ *`B2*@ *@t 㿐#4` m"bP  M>    0  l z ֈN       D R `&  `v@9D 2   0  0 .>㿘%@ߠ P@"`  @8 "bP$@㿘!"@ P@ b "@ս"b"@* $"@㿘N  * : N`㿈6 2 @ 0,@.   -, $?L?㿘N) *`:  % `N d  s2N@L`  *`:  L`  N@ `@N 㿘"#b`"" J]"lb`q 0'"HU" @ 6@  q F   ?@"  "bP2㿘$T"`%! "b㿘!" q@ "   0 ԧ" @  "bPP6????    08* 㿘7   b.8 b "(8   b* 8"8#  @ ??b*`:# `@b㿈  `P$ b  @c@""c ???c Y c $"$P耢?쀢?"*  :?4 ?    6?42 ( ?㿘#  @  *      @  2`"``"@??:   $  6?㿘"!$""ͼ"$ ͸#$ ʹ#x"ć!TH aT"aTH aT%qd㿘aTa@`3%d㿘aT@`&b㿘aTR"uT ?( T㿘? ? ?c   ?   c & ?k -㿘?. > `6U *` €!T`X@ J@ 7 C"]b@{c@88#H#H`3 :!?&  $* 0(&"? % 4 `  ?2    b@   l t ߐ ߠ ߬  l 㿘?`6#ē*` €4? V0tc00phbb& Aզ B 8 4`2  -?0LߞՊ ? 4ڐȞv   0$ОT X@ J  aT? "aTJ? aT0 b ` < 8 ㌆  J:" ?." \ J2 02 0?㿘N l"   p b" 0"! ?* : `2!ؓ*` €&@?&@? &@? &@b&@&@? 㿐 X"TN` 1T"N :( ? %' .2aT* \aT* ($aT aT*@`!$aT N n 2 E N ?Zs N Ā :TX@ ""  `*@T@ "X㿘c 㿘#L"bl"@*"@  J@ @&   뀢 "`(* *` @2* (**`J@ @*J    J  耠@ 㿘!X `4 %!X"`*%!Xc  ?# Ȑ    @  ˒R/c ?%!XNo previous regular expression㿘 " 0X  `?"XInvalid pattern㿘 \ @ė  1@#  ?#耢 "&#@ϫ&# 㿘!#耢 "$#@ϟ$#㿈c @| `? &@ & 㿘#Ѐ "?@ ??:`$c:h- X2' Ѐ"" 42 2" 4 2 ( 2 㿘`@@ 2 ` @` ` 42` " `4 >`2`` 8>``>` ` @ 4 >`2`` 8>``>```@4 `` @8@L0&@#㿐    6    >    2 J@ 2J@> J@ `'@`J`C '`JC `Ҁ J ̀ 㿀'PD'T A'PT  0 PT "@@ 8 F :`@ F :`:`HT(N  P۔T P#P`` 1@'&#`2@㿘!t`""ap㿈耢?쀢? ? @g 㿘""aX㿘   ( ?"  {ѿ"`  ? b   㿈\`/4 ? 4 2(<y  Δ   ? ဦ #H??<S#H` @, $8!p`P  P @ "0쒏 @ 2 `  "4  4`4"` 쀥2= Nothing to search㿈`N@ , 2R""`% " 3aX "5&aX&aX1&aXb  Ȕ h O? "!t "!p"!p"` "!X" ߐ???2 #\`% @  ?#\#`??  "  Đ 0 ""    㿈!`ah !`? ``?#??" !h@ !h`@!h!h? @??O*  ; B?D !h?!h?? !h2`` (`*  ; B  ??`` !h`*` :  a@*   * @ :`@ f !h?Da:  2 !h@a  !h: @ c @? @ 2#=`(=`#\#`  @? @4 2=`(=`=`=!h㿘b@@ 4bh "4㿘b@ 4bh "4㿘b@ 4bh "4㿘  b@@ې b@א b@Ӑ 0 @А  @͐  @ʒ Line numbers turned off㿘#4 Q ""#4 @· 7 On  @¬  @© @—@ b@¡ ^ ˚ "bP #%bL b   2  :  ""P a H "a "bP"H#x tagsrNo tags fileNo such tag in tags file㿐c@E` !} {"#T@)f-@v 2axL  2[x "b@ @%#T"D'J@ K %#T'J   *` ũ''J`3 `)$D$DJ@`'J@ ^`'%b@J \`'  *'J@  2J@J $"*@ɐ0x @C{ @! %#TTag not found㿐"D "  e5 #X ?/?곒   /-+4 鍔   H" b@@4@vH 4/dev/tty㿘 @ h "bH "bH㿐# bH ? ?O O "/ bH㿘@         x p h ` X P H 8 0 (  @       @ noacnfsv2porttcpsoftresvportmntudprdirplusnfsv3intrdumbtimerconnbgupdateforceunionrdonlysuidexecdevautorwrogroupquotauserquota23a:bcdD:g:I:iL:l:o:PpqR:r:sTt:w:x:U-2 and -3 are mutually exclusiveillegal -a value -- %sillegal -D value -- %sillegal -I value -- %sillegal -L value -- %sconflicting version optionsport=illegal -R value -- %sillegal -r value -- %sillegal -t value -- %sillegal -w value -- %sillegal -x value -- %snfs%s: Filesystem not supported by kernel%s@! #$ (`'x't@9 X+)! (|'xt75;y9 FtÑ* P@€a  c@' g%!! "`c@   =%aZ$` @E5 |J@ 6` `@ @$`8C$` ?$` ;$` @E |J@ 4` `0@ @$`@$$``( $` @D |J@ 4` `H@̐ @$`( $`` @$` @D |J@ 4` ``@ @$`<$``@ $`8 @jt` $`t` $`t t`($`t t` @$`t  a  `x@| %!t@ ! "``x@o   =%a$`t @@` $`t 2&(t` $`t@  $` & t@  @U>`@>7 2at @ ` $`$`H$`L$`P$`T{'t @DV |J@  `@' g" ( @DB |J@ 4` `@ $`$ Q$`` M$`  $` H&  @D# |J@ 4` `@ $`, 2$` @D  |J@ 4` `@ސ $`  $` @C |J@ 4` a@Ȑ $`0 $`&@o@#Ȁ??b* & @ @_@@` 2@v ax@  ( x`-a @ aH@Đ @_      d 0    t   T x (no : or @ speccan't resolve address for host %sNFS PortmapCannot MNT PRCMNT RPCbad MNT RPCnqnfs 2/can't access %s: %sh?' [@g#@d @ @d : @!p #d*@=_ @燐 2Ð!@ @ !` ' ` Ԑ =$(&`'   'ش  (;'( `'cp7`-a+ cp9!  o-` 5`   ؐ@_v,`  a 2v(@Yf!q(!`2`''` 2  ܘ @Y  `''@ ܠ  a 2L(@Y<!G(@$ $''$'' #\b@Ęc  " a؀ !`wÒa@W`@!Ha 2(Òa@W~@Ӑ!H ( @ @$((? #$(!!  ?@$!  ?Òb@U @ @@א @Ր @Ӑ @Ϝ"!`$!@ <( Lcpcp!` (@ѐ " x!à"@YF @ #`2  &`&`&` &`D&` 㿘'HH@i$㿐@h J @ "`E    >  &` `@i- 6@g` "1 `  ?+@i` &@gԒ ! @@gʒ `@"` `2  ` P`  P&@ usage: mount_nfs %s %s %s %s [-23bcdiklMPsT] [-a maxreadahead] [-D deadthresh] [-g maxgroups] [-L leaseterm] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-w writesize] [-x retrans] rhost:path node㿘Œ``ธ a0@ @ ,-o %s: option not supported㿘@e  @b ;'ŀ n L  o  @b = 2*`"@=$ 2    @2   "*@ "!H`2 Œa@  @|ሠ 2L@2㿘@eMemory exhausted㿘@H @FH#㿘@ @F>#㿘@$ @F3#2 (@  (2 *@  ("@ 2 (@  (*"@    ("  `8 `     㿘 ` 6`, @ `" ````, `* "`*`"@@" #` "ଁ+                D          J          :blank:]:cntrl:]:graph:]:print:]:alnum:]:punct:]:space:]:xdigit:]:digit:]:lower:]:upper:]:alpha:]㿘@O @  @o^`? Unfinished \ escapeunfinished repeat countmalformed repeat countUnbalanced [X  -D  @?`" r%ː!* €   @Dڐ     ` !`?!! !"!  ]`Y`J `)` J@ \2J` )G @ J `|  J@ \J` |1( J$`   }!"`"Ȱ! r  n!"`! e  a!"`! X  T!"`! K  G!"`! >  :!"`! 1  -!"`z! d#2` 《` Ā`!"`c!  ` Ā`! "`Q!  d2` 《` Ā`! "`:!  2   《 Ā`Uบ??@*`: +` *  ?АВ`@ ". J@?Ѐ  @@ "& J@ ,2! `@ J@?Ѐ  @* : +  *  ?АВ`@  J@?Ѐ  @@ @ J@ }〣`#4〣  ~` " ǐ 0 @Co ?А &฀ "% $``̑*` * ?$`  ǐ 0 "?@CQ  ?&฀ % ,@CB H ,G`  ǐ 0 "o?@C4 ?А &฀ %?0"`"   Б*` * ?$   ǐ 0 "N?@C  ?&฀ % Ѐ` `̀@ @B H" @ } \@B H  ǐ 0 "#?@B  &% }@Bא H! ""`$!  $22     $2〣 2《( ! ""! `2      !# #`"!`2`    Ȁ2@!# "`"װ! rx#` @  `T` " M"  e  aؐP %#b @ ` _2 $  b W2n$?j$Ā ?/  ǐ ` @B/ @?`&฀ ^%  ǐ ` o@Bด ' @`?&%'93/〦 [T \` N P H!PƠaԴ!)+, Ң 4  @ ư!    @ @@% `"@`%` ` " ?@A `  % %`,`ē, \`   ` ` "?@A`  &`%  ` ` "?@A` @?`&`-A%ༀ  ` ` "А?@A`  &` ]%༐?&+% \`  ` ` "?@Ai`  &`%  ` ` "?@AX`  &`%༠////ɰ Т//@X 4) @RȀ 4#  `"  `  * (@ R`   !*@ R`  $/ ] [   a `+"  〢O"`% @ `Gǒ@ `  (,`@ R` !,`@ R`!%"   @"""  ""?"`? %T ,\ ,\ ,\ ,\ ,\ ,\ ,\ ,\ ,\ ,\ ,\ ,\ ,\ ,\ ,\ ,\ ,\ ,\ ,\ ,\ ,\ ,\ ,\ ,\ ,\ X ,\ ,\  % % $ l ,\ ,\ &T ,\ ,\ T T T T T T T T T ,\ ,\  ,\ ,  ,\ ,\  ,\ ,\ ,\ ,\ ,\ ,\ ,\ ,\ ,\ ,\ ,\ ,\ ,\ ,\ ,\ ,\ ,\ ,\ ,\ ,\ & ,\ ,\ ,\ '`  ,\  ,\  ,\ ` ,\ ,\ ,\ ,\ ,\ ,\ ,\ ,\ ,\ ,\ ,\ ,\ ,\ ,\ ,\ ,\ ,\ ,\ ,\ ,\ & ,\ ,\ ,\ % 㿘 ``!`* "`` *``"` `?  *`"` "̐ X+  € ?`` "` ؐ $ ` @4" 0, 0 0 0 0 0 0 0 08 08 08 0 0 0 0Unbalanced (㿘! Ԁ !!! ! !!!!!`$`$ @  Ԁ!@?Đ $ !㿘 ` ,  ?! !  ! !  ?  ? $ 㿘` . !  Z@ 㿘! Ԑ> H+ Ԁ! 8````Ш `";! `̀  4!̠ 6  А˒*! ̠  Ѐ !!  Р Q%K$ Ԡ Ԑ>  ԁ㿘 !  Ԁ!!  㿘`Ԁ!  #$ Ԁ ߐ! ې!  Ԁ! No syntax specifiedUnbalanced )㿘 ?  "# "# ฀ #`@> 0!$ "   Ԁ?" @>ې H 8!   !  & `  @+ @ "@@"`&@` ` ` @@: `  + @* `@+ @2 ` " `#h#l#`@+ @@#` h#d"@l"`#h`d#l#㿘 `` ; ) +`@.`  ` `% :``@.`  ` `@( `  `@.``  ``6` &@`6 @) `.`@`&`'  `` &@ +`.`@`&`'  ` &   6 "    *@2 # *@  "  "  &㿘@ `@    @?@  ( 8 $  @2, ``&K` 2# K` @2    @@@   `Ј  ,@  . *`$ ,@* @ $:*`$ $ $* "@`(*  $@"` $@` $ @*`  $*  $@*` $*  $@"``6p (   @  * @ V!  @` `24 $@` `2% $` `2 $` $ `2 $  $" $ $@ ` *` $ `2`@  *`  "2 ` $ *  $@ *``` ( $ (㿀` * `6  , $@`  ,   a,  ` *@ T!R!4Q ' '' ''* @ `?;  $@ ` *` >`ϐ"̓*` €      ' ,  '''ƒ `0*  * ?  &@8 > > > >( >4 >@h & 4* '  * '  * ' Г*`  * ' * '  *`̑*   @ .`% `@ &.`  * ' ג  @  & 0 .`  ?` ѐ!*` €` %$%@ ''@6`,` 0*` *` ? ` * * %  *` ? 6 ** 0*`  0*`"  0*` @ϡ,` a  %?`'' * ?@ 6'ȡ,`@ 0*` E@*` ? `@ * * % @ *` ? 6@ @** 0*`] @ 0*`" @ 0*`Ē @ϡ,`? " %* ?  $*  ,` @@""?* $?  ?@ %?3 @%$? ? "%? %?`? !`?"$%@$?' $' %  0.`" ` ` @&   @6+' .`@ !!$  0.`=' 0 @ 6 0* 0"@ 0*@ `@& ' @' .'`@      `2  `0 2  & ,& (} & $ @@@@@@@~ @ Cx Cx Cx Cx Cx Cx Cx A @$ @$ Cx A0 C C?b؝`'D ?#t'H'L" "` '!%✒ `@ ``_2`SH``$ `K h!?#ؤbD#@*#H  $D *  `@6H##l"#p"? c`@"@#h"cL@#P"@#D? *  ,`@ #@ ?P" `?cp@@H"`  *` ?# ?!H?a* ? #ؐ ?#l ?Hh`$ J `  ? `?#ג ?Hh`$?l J ` @ ??!#ؘ h     "?Hh`$?l J `  ??cؘ H     *@" ?Hh$?#l J `   ??cؘ H      "?L   ?ؔ   - `"  ??#t ?+ ? ?  #   #d #  ?c H*  @ ? x?? #؄  @   @`"  `??cH?@㘐#ض   "@ @,@*   * #  `"?@ ?㸐@ H  * ?t*$  *?t?t"?#H?+ @ @"@?#d? cH#`@@  "@?t ` ` r ?t 9??#`?*L ?LH f* ?t*"  "  ??t??tcP"@@@ ?p## ?H#@ $`D *  @ =DH!?0* #H% ** #H% 4 T  $ `     2  0 2  2   2 ?# H u ` H m  H?c  a  ✒ `@ `,``_ L``"  ఑*  "L?# "? 6"?#t @Q??c c\@T"@"$#X?c8?#@H"@"?#\,`#  ? #<?,`D"`:" 3?@ H0*` `!?ccc@,*`   &&H@ 0*   &@?cH@@@ ͪ`H4 "?$ `??〠ㄤ`- @ @$`$H $`&`?X?< ` ? ?\ ?T?#    `2  `0 2 ???#X#<H  @ ?#8     @"  ?c   ??` ` 2  ` 2   ?㐠 H ? ` H 7  ?#H  + ?#<?  1-L- - @   - @:  # @ `*_*L"4L*"@  L??Dt@ ?#t @ !?,` @z`?#t@,`!?#@o #@l㿘`<#+`8 @6&`<`@,` "`H@X `@ "`8@P`H"`8`@&`@&`<`<. ``L&`<"`$* @J`  ``$ `$*` J ` 2`L `$"`$`L@ "@`$*` J ` @`$`$*` J ` 2`L `$"`$`L@ "@`$*` J ` @0* J ` 2`L0`L@ "@Ð$h ,``8` -*&`8  `D`ﵓ*``8`H&`@*`&`D&`H`8`L﨓*`&`L`8`P*``8  &`P`@, " `H " `8&`@`Η,` `?* `P*"@ `* $`$@ ` "`@`H"㿘 & 8& < a & @ 8 Z& D 8& Ha*` 8& L]*`& P 㿘   ""  `*_   ( " `8 2`@`@   .* @ .`` * @, `  `.``H ` `L* @   `.`$* @J` @ &'@@   ? '` `@? , `P@㿘 & ̐ && & ǐ & & T& & & & & 4& 8out of memory㿘 `;@  @4 ` $`"`(  `* , ,  * А@@Đ& &&&& $`a0 @U㿘@} @{  (6 $  $ @`@p` (& $ $@i  6 0 0, @ " @]  & 0 0@U  86 D @,  " H@I  8 " 8@A 8 & @ D " H@6 H " P@0 P " L@* L " T@$ T   @ @ 2 㿘` @l   @b @@ِ @` `@?㿘ِ 㿘@D @^W  N  㿘 @㿘    @$  㿘 "B ɐ 2.@9     * ` ,` &$`"` 2@@?`@*`  ,`&" @|0 㿘  `"< @I  22$5 *`:`@O   N J  N J " 8 *` @O{:`  ` " N 㿘 `  ,`@  @g `㿘  `2 @  2&+ A'   "@ ",@ Ɛ)@ `@ 2,`2@㿘   **@*㿘  a@*    ` `    "@"`"`"` `  @( @ $@ $ @ $ @  @$  <  8`6`*@**" @ ߠ   @( -`@! " !!!?~ 0 !!   ! ?0瀤?0    @ZZ " * @ * : `"+J@2 + `J`"+J@"`+@@   @  JJ  `@JJ@"`  $ * *  @@ $ *`"  @T@@Q`@ 2 @Yܐ "} 0{ y p$J " J`" ݐ a \@$@ O J`"   D$ J`* 8$ J@    J@ ")* "$ "*% #!   **@+ * *`* $ `@ܤ@Đ " @< $@@6 @<$  T& T$   @`us q o  @ @?word-regexpwith-filenameversionunix-byte-offsetsbinarytextsilentinvert-matchregexprecursivequietnull-datanullno-messagesno-filenamemmapline-regexpline-numberignore-casehelpfixed-stringsfixed-regexpfiles-without-matchfiles-with-matchesfileextended-regexpdirectoriescountcontextbyte-offsetbinary-filesbefore-contextbasic-regexpafter-context%s: %s: %s %s: %s 㿘`!\!#۠ `@B@sŖ !\ `@s "ad㿘ߒ@& memory exhausted㿘@l  ې!8 㿘 @`@W` ې!8Ւ 㿘 NА   ?N `@%  &@㿘!  @ @k @%  &@!@g  !@b!"@  fstatlseek㿘!`#a@W a@S @G᐀  a@K @?"@ "!|9@X# $@f@ * @) )@"ᐒ"@@ , %〤%!| $@      at〢  "axې!8? x"a"@B  ( x "0C!h` < <7 < /〦`  :  @, :   ( x "0!X:a  ᐐ   @f} @`?"!"! 㿐at |"  "  5!#%a7%@ @"@ <  ? 8@ d@f@`$ @C @C   @ " !#%7|*  :%!|%!|!|*` @ !|%!|!| @*! !  `$!at $axې!8v !|ax at"@@x$!!|᠀`I"8  b `@  ``<ᐲ"@&@`!ax !|#\@ ?!!&᠀ @ a @F   ( x "Ȁ'! (ax!|@N  x ax`6  !|axB >"a㿘!!`B : @>& 2$aX/ @ej `0. @cΖ  $ @k %s%cwriting output㿘!` !`!@[ !Ā``B :"!!Ȁ` &  :@ C!  &@@k `@ ( xk""!㿘!`!$!b ! %b! $b@& `! -b ! b--㿘 `!`- !ɐ! G+!􀢠!!̄ 6̚ ,@   ; @  L 2 @ ̀ `!Ѐ`@`  @@@@ʐ#@,&@Z< D -@*&@ ,<@G&@  ! 2* :@   &!   :! !В  "%`㿐  ')   g "`  0) \!p&@ ἀ@-`N: @ἀ@ἀ  ;Binary file %s matches 㿘  c`!h` <   @  ( xM@?  :!"b   ;a#! o     ( x!`a`& Ұ ! !`- `- 〢`! ?! @w" 2 `!  @""  #!s/"  J- : @" !@ !N 2!"& b`l   !`f!!̖  a  - :   J 2   22$a !" "@ĐC > ɒ 2a ( x!`#a` !a %$!" @!*a "$!b`!!""@8%@  '! !`@"(standard input)%d 㿘  1 (#`"a` F @~  x  81 ( x !h`@~`  x"_ @rZ!`V !h`2  @~ܒ`  `<  = "!` 2 !Ԁ`!`!`ݐ!@ӧ :ߐ#x@ӣ〠!ذ`?.  "  `!`ݐ!@Ӓ ` 3 (@ `x`Ð%s: warning: %s: %s recursive directory loopMemory exhausted0@   ` @2`@2 2e a\ᨖ@nc!] 2 `<   @+   ( x !`2Gt B! @  J /@ !a b?'"aL   /@n `@6@@6,@@N@`  B?`%@@Usage: %s [OPTION]... PATTERN [FILE]... Try `%s --help' for more information. Usage: %s [OPTION]... PATTERN [FILE] ... Search for PATTERN in each FILE or standard input. Example: %s -i 'hello world' menu.h main.c Regexp selection and interpretation: -E, --extended-regexp PATTERN is an extended regular expression -F, --fixed-strings PATTERN is a set of newline-separated strings -G, --basic-regexp PATTERN is a basic regular expression -e, --regexp=PATTERN use PATTERN as a regular expression -f, --file=FILE obtain PATTERN from FILE -i, --ignore-case ignore case distinctions -w, --word-regexp force PATTERN to match only whole words -x, --line-regexp force PATTERN to match only whole lines -z, --null-data a data line ends in 0 byte, not newline Miscellaneous: -s, --no-messages suppress error messages -v, --invert-match select non-matching lines -V, --version print version information and exit --help display this help and exit --mmap use memory-mapped input if possible Output control: -b, --byte-offset print the byte offset with output lines -n, --line-number print line number with output lines -H, --with-filename print the filename for each match -h, --no-filename suppress the prefixing filename on output -q, --quiet, --silent suppress all normal output --binary-files=TYPE assume that binary files are TYPE TYPE is 'binary', 'text', or 'without-match'. -a, --text equivalent to --binary-files=text -I equivalent to --binary-files=without-match -d, --directories=ACTION how to handle directories ACTION is 'read', 'recurse', or 'skip'. -r, --recursive equivalent to --directories=recurse. -L, --files-without-match only print FILE names containing no match -l, --files-with-matches only print FILE names containing matches -c, --count only print a count of matching lines per FILE -Z, --null print 0 byte after FILE name Context control: -B, --before-context=NUM print NUM lines of leading context -A, --after-context=NUM print NUM lines of trailing context -C, --context[=NUM] print NUM (default 2) lines of output context unless overridden by -A or -B -NUM same as --context=NUM -U, --binary do not strip CR characters at EOL (MSDOS) -u, --unix-byte-offsets report offsets as if CRs were not there (MSDOS) `egrep' means `grep -E'. `fgrep' means `grep -F'. With no FILE, or when FILE is -, read standard input. If less than two FILEs given, assume -h. Exit status is 0 if match, 1 if no match, and 2 if trouble. Report bugs to . 㿘 #! a\c@ka\@k `0!!\@ @!\@ p@ @!@#H@ @ @ߐ#X@dconflicting matchers specified㿘 Ā " $ @O "$  @! 㿘!`" %#@O 2    $ap$l 2   b " Jb 2J# + " "2*@ (8*@\`J *J *@̒`㿘 (@ʐ  @  * &@&$ * $`$  GREP_OPTIONSinvalid context length argumentegrepfgrepgrepreadskiprecurseunknown directories method-rwithout-matchunknown binary-files type%s (GNU grep) %s 2.4.1 Copyright 1988, 1992-1999, 2000 Free Software Foundation, Inc. This is free software; see the source for copying conditions. There is NO warranty; not even for MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. default㿐'D@['HH  "a\@A / a\@; / "\? '!#%,$a'$!$@0"D=H  ' %'-+;7%/! * €.*  ?'؀ Ѐ "ْ ؀ !̀ "̒ ؀ "   " 'b# ' "aTv "Ȑ #!%@N* %ah@N"#  %ah@N { # ~ @xؠ @1 -@M#@ @H H` ` (Yx 8, (, h ?2` , ]`   $  @ 4`H@@@`r@]J?` Y .V  R"ܐ N# В ?'a&H% &%C'aؐ ?"aĐ %;& 8%ah 4" 0#! ,"`Ԑ ("%#!"* @M $@My"  $@MpP  $ᰐ#`Ӓ k !!D @HӀaЀ "à " Ā a\# T  @I#!#@E@B#@?#@=@ aP  ,  2? "(D H* %(@z Z Ā  T` @c!l€D(" a܀   #!(D@6 (@H* @Lސ  ے ( @D`@%( ϐ @_v`?2 (x "ad  @M p p p p p p p p p p 0 D X l x H , h   ( 8 T ` J(8  J  㿘3`(@.@,((`'@ @'@/`/ @ &@`@ / @&@ `@@ۆ'@(b" """bPOSIXLY_CORRECT㿘 ("b"#"@l#""N - + "b  `""   ""  "b --%s: option `%s' is ambiguous %s: option `--%s' doesn't allow an argument %s: option `%c%s' doesn't allow an argument %s: option `%s' requires an argument %s: unrecognized option `--%s' %s: unrecognized option `%c%s' %s: illegal option -- %c %s: invalid option -- %c %s: option requires an argument -- %c %s: option `-W %s' is ambiguous %s: option `-W %s' doesn't allow an argument 㿘 ('D'P"`؀! 〢D %`(DT $ " "J P"`(@ $"b  $bb ( b" @ ""`( 2$b(DD "(  *@J`-2(J  ($"`(D@ !*`@ @J` `(`(b "@  %`(b Db"@D`($bD$"%`(`(D  *b"@2%`(R?@J`- J 2P C?"%`(> J   -`?`%P `(* @J `- `"J  X  P L ?L  =2P` @@L$ 2`@@Ҡ$2 `@    ,` `(*`@  @@em`@ ?`(@%%`("0g`(%`(L , M"` ,`*?J`- @ @eA` @ J`@e8@| ? @%"0 &D *@" %`( ,` *@@ @ea@Z @%"0N ? :"{ :0y@L @%'`2- l ``(* @J`-J ' ,``(* @J`- @ @dْa@ `(@ Ja`@d`(a %%`("09 ? @`. :%iJ `( %`( :2J ,`"` @ a@d . @ a@d. : "`0 ? W `;ő*`J    `( "`$%`(`(D* ,`@ a@dp" 0N`:۰ ?ٰ :, @" %`(`%L@  =2`P  @K$@ 2@$@݀2     ,` `(*`@  @@d(a@l ?`(@%%`("P%L@  `6" ,`@ @db@J ?@r% !`(D *@" %`( ,` *@@ @ca@* ?@%N@" @%'`"D   @"@> W*`:  :28. J : J@  `(+" J@ `( ""%`(`(D* ,` . @ a@c:. : "`0N:  ? :@" %`(%. > 㿘   㿘 㿘 㿘%H F L#@  $ , "@` 6 @    $  ( $ (    *  " " $ $  $ 0 $ # 0"  0"` 0?"  0"` 0"  0"`$ 4$ 8$%D$%<@O memory exhausted8@( 0%D`@ @@''   @  Ȕ  "@ :" "@  ` ` 2"@ 2  " 6 @v     &  ( & (    *  " " & &  (& $$   " 6 @Q    &  ( & (    *  " " & &  & $ 1İ#x# "  "` ,`"  "`  " "`, ,    "@ "``,`,` J`   2@  ` ? `  *`  J` `g,`   *` *  2Y `*`Q* J` ? `0=`*     0  "#+ /*  `@e*   `""`*` * ` ""`"#J " *` J 8`?+ * @@@>* `""    ,*  $ , & , 4@&& 4 8@4& 8 㿘    @" &@㿘 . `"# ``  `  :`@`"` ` `"``#``2` " 㿘   @*.㿘`2@&  "! `   `  @  ` :     ` @ 㿘     * &@㺐 4    < 7*@   ( 7  ,  < *@   (*@  , 2Z 0%D 2V 0   4" 6 @   &  ( & (    *  " " & &  &%< 4& ?  0`%< *@ `?  4 6 4%<  @  7 " (  4 &%@%<@ J K@2 " &%@  &J u%D'`5!<` 4$` 4$``.``` 0` "`  5` 2 @`  " &$ @ "  `  " 4$   2 ` `2` 0 ` `` @4$``` 4$`` `2` +   "@ 0%%D + *   #@  %D    " %D  +@   ( 0  *@   (  㿘 42 %<%<J@є&(@%@*  <@K@" @G? @ ? @# ? @ ? @ ? @ ? @ ? @ ? @  ? @ ? @ ? @?2Ӱ 4A&?@   & @ " 4/&? @ @ 4'  ? @ @?2 4?@   & @ "  @߰  㿘 4 a%D!< <   0X)  M K"@@?@@@@@@ @*@`@ 21"@(!`@@@  :  @ 2  8"@ W  8"@4"@ C @ 2:"@(3"`@@@"   :   @@ @   "@ "@6‚@`0#@#`#`㿘 , %D   && 4&(㿘@  @㿘" `"/ ( * & & `& && ( $`&  8@`& & @&@& &` (* *@& ( 㿘" `"/ (  & &  & && $& (`&  8@`& & @&@& &` (* *@& ( 㿘  "@<@`d@    ( 6  € $@ 2&  8@& $ & $   4 ? `*  * #? +`€ $! (  `   *   (2  2  (`$  ( &  @ (@* & (& &   : *@ 㿘    € $ ( @  (@& (: (* (`& & & & @㿘    € $ ( @  (@& (: (* (`& & & & @  memory exhausted㿘! @А!@ @`<㿘`@  !" !@{ "   `2,@  "   * _$@ ,Hex D_alnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigit"'D'L@'̀    '' & **  '*@ L&'& &&  @  &@Ő &  @ 0 &    '̐  ?`r !l*` €D̐@ L2  @ Ԕ *   р`$@  (%@@ *`&&@ & $@$@@ %@ %@`%@@$@  ݀@ M ̀ L`2 L@ *   `$@  (%@@ R*`&&@ ^& $@$@@ %@ %@`%@@$@  ݀@  L a`  L   X``+@ `? ̐@   =    '̐  *#L` + ?` \̀   '̐` ` + ?2'̐?'̒ `+@ `? ̐@ @ @ǘ  +` l$@  *%@@ ȑ*`&&@ & $@$@@ %@ %@`%@@$@  ݀@ ?M J?`.M.@`&%#`/` "K M M `%`L @ `% @ {`  `% @ r$@  *%@@ ^*`&&@ j& $@$@@ %@ %@`%@@$@  ݀@  $@@ G/`   `$@  (%@@ $*`&&@X 0& $@$@@ %@ %@`%@@$@  ݀@ @  ̢`$@  )%@@*`&&@# & $@$@@ %@ %@`%@@$@  ݀@ ̀ $@ "  +%@@*`&&@ & $$@@@ %@ %@`"%@@$@ "  ڐ$@  )%@@*`&&@ & $@$@@ %@ %@`%@@$@  ݀@̔J``^  *J@ ^2`'$@̐  )'%@@K*`&&@ W& $@$@@ %@ %@`%@@$@  ݀@ ,@` @] ` L@ ` ,`̀@` @'̐ L  \]` `'̐` `2` @ ` * ,@ ]Ȑ`2 -#K ]耢-2KD? DK? ["K? * KK? [2KK? ^K ]LK -LK  ] '̐L@ J @0ꀊ[22K :22 '̀ ̀@` @'̐  :J` ]` `  +`/:v,J`]2rؒ @>`?/"@>~`?/ @>v`?/ @>n`?/"@>f`?/ @>^`?/#@>V`?/ @>N`?/#@>F`?/# @>>`?/w#(@>6`?#0/o@>.`?/g@>& K̒@>  E̒@> > @> 7"ؒ@>  1̒@> +̒@> $ @= ̒@=  @= "@=  @=ޒ ̀ ' '\'X      o wg  \b @ ` X b @ `    b @ `  ` 2  @ (@,@ `b @  ` b   `` b @   b @J  2 @ (  ,@`b @  b @  b @   b   `D` 2 @ (  ,@b"  @  22` 2` @ `(  ,@  h\  `   ̒ `  ' `  `` ,` ,`2 @  * @,@ ִ  ,  ?` @L@7 `LÀ`L`L`L @YL`L" @р`0̀"   ـ`U' *` €L׀`' 쀢 &**@@Γ*` '* '*` $ * "*` * % ""* @*` Đ$@" * * Ē@?"`* * $@ @"`$@  &%@@O*`&&@ [& $@@%@ %@`%@@$@  ߀@ ,@Ģ`,@`,@`  '  L@M @EE:$@  * 3@@*`&&@6 & $@$@@ %@ %@`%@@$@  ݀@ ,@`$@  @ݒ  ?L`@ 0* @*` '  ?  *` * ` ~Đ"* $@  (%@@*`&&@ & $@$@@ %@ %@`%@@$@  ݀@ ,@`,@`,@D`L!L$`$@  *$@%@@^*`&&@ j& $@$@@ %@ %@`%@@$@  ݀@$@@I  `$@@3 $@  '%@@!*`&&@U -& $@@%@ %@`%@@$@  ߀@` ΦLb+" @@&D ̀@̰?? ?L    ' @`'̀ А  & . * ̐ @?Ѐ,2'̀  ' '̀ А  & , *  ̐ ?Ѐ  #  #LLL@ \ẁ|  '̐  } L @ 0  L _  6 $@  (%@@Z*`&&@ f& $@$@@ %@ %@`%@@$@  ݀@$@ @F`  $@ (%@@#*`&&@W /&@ $@$@@ %@ %@`%@@$@ ݀@ `$ $? @ @  ˢ`?% @`$@ @` '  '̐ L`D@ `J \`0L@`$@  )%@@*`&&@ & $@$@@ %@ %@`%@@$@  ݀@n L`$@  )%@@{*`&&@ & $@$@@ %@ %@`%@@$@  ݀@9 L`$@  (%@@G*`&&@{ S& $@$@@ %@ %@`%@@$@  ݀@ L@U`$@  (%@@*`&&@G & $@$@@ %@ %@`%@@$@  ݀@ѐ L!`$@  (%@@ߑ*`&&@ & $@$@@ %@ %@`%@@$@  ݀@ L퀥`$@  (%@@*`&&@ & $@$@@ %@ %@`%@@$@  ݀@i L@`$@  (%@@w*`&&@ & $@$@@ %@ %@`%@@$@  ݀@5 L`$@  (%@@C*`&&@w O& $@$@@ %@ %@`%@@$@  ݀@ ,@`LO`Ē`@ '?@Б*  ?`$@  )%@@*`&&@0 & $@$@@ %@ %@`%@@$@  ݀@ ,@`,@`L`  `"4 @@  2.`*J`*&`^#L `\ LK  + ?0`+`?LEK { ? \2;K  {27$@  )3@@*`&&@ & $@$@@ %@ %@`%@@$@  ݀@ ,@`,@`$@  (*,@3@@X*`&&@ d& $@$@@ %@ %@`%@@$@  ݀@,@` @ -@̀r$@ @, #@? 0Y@< 0V@9 0S@5 0O@1 0K@- 0G@) 0CB @# 0=< L@2$@  ( %@@*`&&@$ & $@@%@ %@`%@@$@  ߀@ ,@`@ $@& ܄ ެ < l $ 4 \ | ۴ ʀ p < p @ Ȁ *@*`:*`*@*`:*`*`:*`㿘   .㿘   ??? /ِ H\`?J`(  2 2  `| 2 2 J  \`?     )` J@)"  `J|"  0 `J@|"   * (   㿀@2 C `// @@&//    //@ 4(`@耢 4"``:`:   :    !"@ ?",* ``(/㿈    ` '? '' @J! @  *@&  ``  2* * @& *' ߠ # *` €   &   ,@ * ? ͠   : *  " : 2,@  *    ,@ $,@ * ?   : *  " : ",@  "  J@ ",@   "    K`2,@  ~ L`  `*? 6* @2 n,` u oL  *  g  b  L *   W*@PM'L  *   "쀢!*@ *`"@ 8;?*#*@` '* '* "  '   & `    L * @` ?Ī     @  2* * @&         P P P P P  P     `(#`"`"@ "``(#`"`"@"`㿈#\#`#d @ 㿐\ `d4?  4$  `   `  ` 4? ``2   `j?`r?`KJ  E 3 &$&@` # @O@ ? # @O@  #? # O@`#&@&`" @J   2 #\`"#\ 6?#\#`@- ? " ?$ ? ??㿐#\#` @ 㿐\`#\#`@@'D ! `'''H 'L@`''T'X'Բ!'' ` ' '쀢`2'*  ?#`#`#`#`#`#`#`#`#`'''''`}' zx v t`r p`nX^?'''''ȸ  ' XQ?LT K̰ 7# c;=#c0 İ """"  "̀ T` LHL 'T'H'LLH T '''L" 'L X XH XL "؀@2 @UL`  H  ܔ ܒ@ `? @  `k̖ '' c   " " V`2\H (̰      "" \`D2` X2` # ̒`* \*`#@~'\@#`@~ϑ*`\ $  `D`* @ D "\\  :@"*@~'\#`@`@~*`\ $  i`Z?\@ `X@ "\ H$ L$"@ ?3   @   \\  " ""@ L  H @"@L" " \L`  H"L" "@  \  *̀ X?\.    " "  \X܀@ $L& "@H"@ `w` !*` € @Ѐ``k@ Ц  @@]`? W@LL@@K`?  -@  "@`4@D` @ Ѐ"L J` "Ѐ " L K`    -@  "@`j  `?  @@Ѐ`" @ @ *`  2  :@ `2 Ӣ@ ̖ Ȕ-@  "@`/ ' @* 2``2 @ؔ'@@ @0* * * @%  @*` 2   @ #  @ $ @*  @ @ *  % @*` * %  @`' @*` 2    #   Ā" @* ' @ *` * % @!!` @`?  `*` 2  " !!+  2  Ԑ2 ؀ ' ' `  ` `  ` J *  ''䀦 '  2 ` 2 ` @@2} *` 2` &@*@% @ `*" @:" @ `  `' `J* `' *  " @ #a*` * " L*#'*@~W` B'* '" a-@*" '@*" '@*`" '`*`"`'*`"`'* # `'* " `' @-@ # @ ` ~L   H@ L L   -H@ @`? -܀  - %@@K@%@$4Ѐ ''@ ''@X * ɦ Ŕ-@  "@`LH T`2LD 2  D `  D2  f2LN 퀢 D  TL`HIT C ?L` @* &@`*`  " !`%*` * " -*#''*@}7` !'* '" @-@*" '@*" '@*`" '`*"@'*"'*`# L` @* `'؀@  @  `ؒ@ ' @ `؀  &@  &@   &@ * @`" :"@ %*` * " *#''*@|` '* '" @-@*" '@*" '@*`" '`*"@'*"'*`# '* " L` @* `ؐ    ?    @  @'  D ` / .   `     "  ,u  o *``? `  2  :@ ` `?V V `  *  I2  :@ `C     6 "   "(*  @  @@   @ `@ @@@ @ `  "`@  @2 ,   .,'*  *`' @  +`?'*  @#'*` # *`' # ? L` @* `x@&@ * @`" " %*` * " m*#''*@{w` a'* '" -@*" '@*" '@*`" '`*"@'*"'*`# '* " '&@ * @`" % %*` * " *#''*@{` '* '?" -@*" '@*" '@*`" '`*"@'*"'*`# '* " 'L` `*  ?`,@> ,``,`,`L` `* ?,`> &,``L` @* `@' @L`* `*> *`LH T`@@" @@2 J  `? 2 J `? ]L H T " @@2 J  `? 2 J `? (" 2 J@ L H T  @@ @2 J L H T}Tz" @@2 J 2k 2 J@  0WV@〤" 2 J@ B : 6-@  "@` ,@〤" 2 J@    -@  "@`t @x3g* ' 2'*  '*  * ' @ `+`?'*  @#'*` #'*` #?`ʈ ؀@ :'H @    H H `' `J *` `@' @ "H @  ؀(  @ H?  \ p x T T @ 8   @     p  P t    H x " # !` "  㿐 R' ? A' J *` ?'' J`* '  2'   @/*  (@' @ J? ?*` @*    '& @/*  " 􀢀*  㿐'  @*   'J  *` '*  㿐@'  `B' !*` € q, 2` 2,*0*@* &%*J  *`  ' #'' K * '' J*  ' *` 2      ' $@ ) ) ) ) ) ) ( ) )` ) ) ) ) ( ) ) ) ) ) ) ) ) ) ) ) ) ) ) ) ) @ JJ` 2  㿘** @@  "%  "*` 1 H 㿘"@"$$ $ @u!$ @u! $ H 6 " @ `   *@ "6$ @  ?$ ! @*@$   `**` $ @xG͖ "     ?@u $ h@x* 2`  @  *@ * 7   ` * *`  ' * ' (''''' ''@uy. '' .@'? Ȁ         & & @uw6 㿘 @u. b@  H@w @w*@w㿘 " @uN &&  & @uF  *@& & @u< & 㿘@#S`D @u ?@$АF #0 . J )   $@wn&@@  `2@0D 4d@8d@u "@@ @ @%  2J.@@$ 0@$ @t fgrepawkegrepgrepdefault㿘/ memory exhausted㿘 І`!"`(#(  `*   (  Ѐ #( M $   h 㿘`4 T @ ) T`4'   $@vߐ{ "ڒ 2`4 T 2 @vŐa " 2* ζ ^\(\(^\|[^[:alnum:]_]\)\(\)\([^[:alnum:]_]\|$\)\)$㿘+ + %Ώ Ԁ '̀ E@s`2 "X,@̀   "` ` "`,@ `,` `,`,`Ԁ  bh@u @vf@@uԀ` b@@u ̀  @ "" ,@ +  + + @vH 4 04 D^((^|[^[:alnum:]_])()([^[:alnum:]_]|$))$㿘` @&`8  !.!x  7  n# -#` % Ԁ '̀ A@su`2 "X,@̀    8  8,@ ,`,`Ԁ  `@@u6 @uߐ@@u/Ԁ` `X@@u& ̀  @ p p ,@ + + @uÐ 4ɕ 04ɏ 㿀 'L *`; 2$ e谒 ? @u$ " N? ? N? 2?  `4  ȳ䀢 ,# `4  Ȥ䰒 ,? @u$ "N? ?N? 2?p`( ?c $&    Y`" Ԁ`TO Ԁ`D?)#` @ ?" ` _5@ " ` _+ @$@ o(`@` $$@ `@"`ŀ` >  L@"@㿘!@@ J@  `@  N@ 2` c&@ @’ *`@ ) ̵ 㿈 [  ,: +`$ d谒 M ̀`,N?2?  B,N :@26 :  Ԁ`4+3 ?* b `2`_  `,   ?b `_ސ    ,:`@t$  &N?  ?N? 2? @*J@ `?㿘@㿘@1?`@ `@j@ N ( /@` /?"``* "@z /` ?"`* "@k @r Հ ` N 2 ?N /"? .@?*N /2?  @s@sĐ@ "@$U ".@r@q usage: basename string [suffix] 㿘b@@?_ @qҐ 㿘@aFfh:t:vonly one -t option may be specified.nfs㿘@1f @z%#,'`0' *` €"  "`"` (  $#d` (b@mÐ @`  "`@@;b?ђ?* @   @  #d` @" "@@F   @@ 2 `@  ?, ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ?$ ? ? ? ? ?< ? ?L ? ? ? ? ? ? ? ? ? ? ? ?` ? ?/㿐@Ca  2 @w " ,`* * * %P T@% Z @g D @, T 2 >X%s: not currently mounted%s: not a directory or special device%s: unmount from %s %sCannot MNT PRCBad MNT RPCx@X{ @NH h< @   @ٔh  h")@"0#h @ǒ  2! @   @ 2 @  "@D 2@  b@%_  !@ @  ,@+ @,@  :  @ , :, @!  쀢`"X@Ĕ 耢`2f ! @W "p@̒Y "@%   2S O @L ,  ? ?/7  @i ?`'\'`'ab''d @\ @ "x( @8~$ '`'x'|'d #\,Ȗ"  @ ےb   @ @ getmntinfo㿐@B   @c"P7 @64  ``@". ` `D@p  T2`@" T 2` `D@pʔ  @Ҡ! 㿘#d  ``?  #@$o    2`@ empty type list㿘 N  nc@k  N  o "` "  %  @ , ` @n*  $d @ $@ , `$@  @ , 2*@, $@㿘  "- @i "( @͒ . " * @\ 2  @U " @ . "  * @H     㿘'HH@;$usage: %s %s umount [-fv] [-t fstypelist] special | nodeumount -a[fv] [-h host] [-t fstypelist]㿘a0@<^ @nѐ 㿘@Grsh8KLdel:nwrlogin/usr/bin/rloginrsh: can't exec %s. rsh: must be setuid root. rsh: unknown user id. shelltcprsh: shell/tcp: unknown service. RSHrsh: can't establish stderr. rsh: setsockopt: %s. rsh: fork: %s. 㿀@.3 @ ''@z /       @b@ ې " ' ,` `J@ -",`' `? |*`    (  @},`@ @7Ԑ&??!"  $"*@$"`'@d"* @ "&@@!@}ܠ"@@}@ΐ b@;@n @@  @;b@n  @@   @;c@m "@@ݐ#(@8c0 2  @;vc8@m @}#` )@#\@I[  @mِ    @;\ch@mϐ *'? @    ( x!# @ 6c@;C  @   ! ( x# @ #c@;0@}Z@}` '@n   @mɒ  a@mÐ  @m  a@m  @m  a@m `2@F 6 ( x!# @ c@:@mi !  "~@oq"~@om@O`@m  L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L Lt L L L L L L L L| L L L L L L L L L L Lrsh: select: %s. 8 PN @d  (" x @e $ <  @n6* @ *@$@  @S 6@ ( x "!# @ Sa@:`@lӐ : ؐ@d & (Ĥ΢ x #ɐ@w @l  @m* ؒ  @nF  2 * +@6$ * +  $ ؒ@mĔ '     @  ( x "K6@  @: a@l 2*  :  5 (&x@d$ x # 2`*@ `* *&@ @du 6* : % ($x@d_$  x #  @**@&@@dX 6* : 2 *` :@`؁㿐! ( x/ @d; $ xrsh: %s. 㿘@   @@m `@`@k\ !# aH@~ @9@k @ @@@@L 2 `  , `@ 2@usage: rsh [-nd%s]%s[-l login] host [command] 㿘bHx@9S @kƐ 㿘@mkfifom:invalid file mode.㿘@+^ b@ `8@b`? ' (%+ m@ 2b@g @!@k@@5耢?倢 ?b* @ @&@ڐ `  `J`p   &``@ǐ`"!@ѐ - @2@kU@%2@kOnode must be type 'b' or 'c'.non-numeric major number.non-numeric minor number.major or minor number too large%s㿐`J c b `@gN `@z `@"J@ `@g< ` @i ` @"J@ `@g+ ? *# 2* @ ? 2`  ", `@g @@2` @a@;  㿘@  .!@@@6 6`@@W! `@ usage: %s [-m mode] fifoname ... usage: %s [-m mode] name [b | c] major minor usage: %s [-m mode] name p 㿘  # 8 @8 b0 ! `8c@8`8@8c0@j 㿘@;hms:r:t:/dev/%s%sopen: %stcsetattrTIOCSDTRTIOCSETD%sslip.%s.pid/var/run/w%d Failed to create pid file %s: %munable to delete pid file: %m`@)#')!+-Ȁ`5 *` €@@,@ (@K` $\ (@`%!`@@3#؀??b* & @ @@@   !!@G @Gn  6kc@Z  '\/'''/@@@7  `@E `y@k  `@: `@k!` `(@0 @| Y! @i @i @i%"a @kN@ /'1)N@ /`4N@ /"`@ H8$@G.  @XX@'  &!a@7``@.! '`h@W ,'@PX!(`L @o   ( x``@@  ]8 ]8 ]8 ]8 ]8 ]8 ]8 ]8 ]8 ]8 ]8 ]8 ]8 ]8 ]8 ]8 ]8 ]8 ]8 ]8 ]8 ]8 ]8 ]8 ]8 ]8 ]8 ]8 ]8 ]8 ]8 ]8 ]8 ]8 ]8 ]8 ]8 ]8 ]8 ]8 ]8 \ ]8 ]8 ]8 ]8 ] ]8 ]8 ]8 ]8 ]$ ] ]$  (slipstrip㿘`@   @a  @usage: slattach [-t ldisc] [-hm] [-s baudrate] ttyname 㿘aX@6 @i 㿘@o_block_size_block_count_block_tableusage: installboot [-n] [-v] [-h] [-s isofsblk -e isofseblk] [-a ] 㿘b@6_ @hҐ a:vnhs:e:sysctlSUN-4sun4csun4boot: %s proto: %s device: %s architecture: %s sun4mUnsupported architectureopen: %sproto bootblocks too biglseek bootstrapwrite bootstrap㿈@(A!+7)#%5-'/%耢` #,*` € ( $!А %aԐ &8 %!4 (@` "a (@`"a@1b?ؒ?& ~* @&0 % !Ѐ`%$!@   '''  @a ?b@   b@  ""$!!4 0@"@"@"!@"!@{Ⰰ %a!@sb !@mc  %aԒc@d+ @ƒ @g  @E^ 0ܒc(@J @ڒ @g @_ɐ8`2"@c8@d  @E= ܒc(@)  "@_ 2bcX@ @p@_ʐ耢 ch@ @_ c d4 d4 d4 d d4 d4 c d4 d4 d4 d4 d4 c d4 d4 d4 d4 d d4 d4 cnlist: %s: symbols not foundnlist: %s: wrong typefstat: %smalloc: %s: no memoryread: %s%s: invalid address: block_table = %x%s: invalid address: block_count_p = %x%s: invalid address: block_size_p = %x%s: entry point %#x %s: a.out header %s left onstripped offproto bootblock size %ld room for %d filesystem blocks at %#x 8!h@B #   h  "   #@԰ 0@D #(@ @h #@0HȚaB + cB + 3`  *`  @9  #@01@^: Ȁ̀@h#0@^aԨ      a,c?   ?# ! ? ?#   F?2B  ?  ?# !  ?0@! *? ?c@  ̀@ ?@ ̐ ? ?c@ ! @  @!   #?9 ?  ?# !  ?/@! (? ?c@  ̀@ ?@ ̐ ? ?c@ ! @   @!  2 ? ?# !??? ?c@ ! @ ?%" @!  ?" "  ?c@ ! @  @!  #? "? ?c@ ! @  " @! @" " h     @ #!"!Ȁ"a<#`     H@J@e-@]3 a4"! @ p!`   @ @ h!ؐ @&@!@a &&  `  %s: devread: lseek%s: devread: read㿘. >@]^ 2@cД@Đ @]lc@ statfs: %s%s: Too many blocks%s: %d block numbers: %d ffsufs%s: must be on an FFS filesystemfsync: %ssuperblockNo memory for filesystem blockinode%s: block numbers: %s: block numbers (indirect): indirect block㽐@Bw c(@c @{ `@Y a F !<""!" aȐ * "a؀ `@a  !4` @H aȠ @4'%!, * ̘"@ 4  @4aȠ @!4 @( 04`А@   `@  `@`ː @2/ a@ @fo c@ @\pa0!  @c0 a(@` ฐ@h@h༠@h * @h @h@gx`* d0!H, ߒ@hxa<* 0@"0 ;  @ C@&Օ8 !آ @ `@`c !"@4  !P@ ( (  `43/d,a̙*"@ 4  @   `2d4 `@x Ȁ`>4 !h@o X0!}t4+)d,a̙*"@ 4  @S t `2d4 `@@ Ȁ``@_  㿘@eroute: botched keyword: %s usage: route [ -nqv ] cmd [[ - ] args ] keywords: get, add, change, delete, show, flush, monitor. 㿘 !b@1  c@1@1 cP@c} route: %s: %s 㿘 (` xc@0 c@0!#@ސ@0@c^ nqdtv/dev/nullsocket㿐@# ' /+)'#%!795;- * @€ %a  %!  $ $a $, @, X??* @ @c?&@' 0a`&4``@@ %  @ % 6@`p@ @B?`)H*` €&4@;'&4@U0 @ >@0U@@b y z8 y z8 y z8 z8 z( z8 z8 y z8 z8 z8 z8 z8 z8 z8 z8 z8 z8 z8 z8 z8 z8 z8 z z8 z8 z8 z8 z8 z8 z8 z8 z8 z8 z8 z8 z8 z8 z y y$ y$ y$ y$ y$ y$ y$ y$ y$ x y$ y$ x y$ y$ y y$ ymust be root to alter routing tableroute-sysctl-estimatemallocactual retrieval of routing tableExamining routing table from sysctl (address family %s) route: write to routing socket: %s got only %d for rlen %-20.20s done x 4 `  ( "`xސ#@` @ B .`@J@ -)@`?`#  4*` € ,"a  ("a  $"a   "a  "a  "a  "a @ (`x#!`@#@/ @0   ?''''   @[Q 6#h܀ @a> 2s#  @[8 6f#ܪ`  @K#a @#@B`` [- " @  ,J! ` L ` 2C ` > ,`2; , @Y$ !`* @ ]#  0`@m@T@ @ `? @`@[@`0@@  @`ސ | | } }4 }$ }T }T }T }T }T }T }T }T }T }4 }T }T }T }T }T }T }T }T }T }T }T }T }D }  Q( φ:* bP0  .*  ?** *adefaultinvalidiso %s(%d) %s`bd  "bd#А@! 2 ,А@ . @ ` ,Т  2  !@:bВ?`! *` €  ' ` !@`!`̒ @  @w . c@4` ",@"Ѐ`̐@ڶ'@ !l"!`  !  ???ؒ'@a̐  /Ѐ/؀``ِ  `!ِ    耢 !/'/! Ф"#\! @@ - aH@ኔ!("@d$@ڐ @+]! !P@5 #b@=!! !X #bЖ@=ݒ!!"Ё  d d d  4 d d d d d d d d d d $ d d d d  af %d: %sh ?` !#ܓ*` €  !@(!!`$! 0?    ??   !:@ 2:@` 2``2 @/Ò  2 ` '@@ !l !`  !  ???ؒ'@`  /Ѐ/؀``ِ  `!ِ    耢 !/'/! Ф #\! @@ - aH@༔!( @$@  @*! !P@48 #`@=! !!!@#`Ж@=! Ё < < l \ L ,㿐 `$'"!L*` €! ! ! !  !$  !(  !, @!0 a "8 a "a8 2"8@B$ x h 0%s,%sold usage of trailing 0assuming route to if old usage of trailing digit, assuming route via gateway %s %s %shostnet: gateway %s (%s) not in tableentry in userouting table overflow: %s 㿐 4"a ('5 ( &x2#@@M@ g"?`@X ? '/#7`@J@ -@ Ӑ``-*`$! €          *   ,   " "L( $( 7$ "a8 "a| %|  !"(?2`@ @ ?2`@ @ ?2`@ @  ?2`@ @ @ w??2`@ @ @@i?2`@s @ @ a [$a`@@?  $aQ $aN ?2`@X @ D?@P !    @6  @z0?@ ?᠀ "@@+a耢  """!a@1 & $(  ᠀ 2$("@""("@"H$(@ @K ? 4`| 2 a 2   ( "  3'a 2$M@M " M@`"M@` "`l`@^ &xM@@ x 3߀ a M@ g@]] 1x""h""x"" @ƖM` ""@` ! ` !l!""'@.@  "@" `" "`7`""0 ""0 """@"@"@  H H |  H L ( H  L L  0 d l | H H  \      H  $ ᤀ   '  ? ( ?* ??* ? *  ? ???"`<"`(<*``H 8 *@64128㿈    2   2   2    2 "!    ?? @7  $$#P#X `@"Internal Error%s: bad value route: %s: bad value H! `  #"L" a?  "a&#* € !h!<#    `,% 8"L  ,a@,@ ? "',   0n  0k "  b ,`&#H*` €  ?ؐ ??? '"''a@  ` `  % `H@)b@[Ր ` @\? ? ? ?    $4  @  0 "n`"n2<a <*<2 $a2 2 2 2 2 2 * #@@l Ȱ 444Γ*`4Ѐ`4 4     "z"z 2< <a2` 2` *<*`$a*`*`*`2`2`2` 2` 2`*`#@@nJ  ,,,,,, , , , , ,`,  @/@\_   2   ,@"@ J@ ""@ ,@%} @ >  @sq ,,@j "&@ /   @@ڇ,@?   @W`N ,@@w? 2$!` $'@  7 @,?  |`@+/   !   @| '& `  ,`` @[0 % `X@(0@Z  T @ 0 0 0 0 0 0 0 0 0 0 0  0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 㿘@م! ` "!% `H@'@ZV  *<< `*`"`>  $`$` $`  @[Ք?#:, >   "  (*( (< *.**.0x%xany*0x%02x%02x%02x%02x%02x%02x.0x%x0x%x.%s%sH 7  7 7 * 77777+  2+` 2 2,2 211'D!@!'aH@"0="n@5R  '!P"h@5H  2 '!X '#` a`    #\ `@,2 'a@/К1!'@75!2*.0x%XH%02X%02X%02X%02X%02X%02XH.%XH%XH.%s%sx ? / / // 7  / / / / / / // ////2 2 2씓211'Z!@#'c@@0S"z@4Ɣ  ', !P"t@4  2  ',!X1#'%'# `P '#` cH  #\ `@jL`P,`01#%'    K 0 *  2'ch@N`@#,`@#p`@@6!2actual retrieval of interface tablex   ?''''   @R< 6j#h܀ &@X) 2^#  @R# 6(Q!ܢ @*@X.got message of size %d on %s㷐 , "`@X )'( @P(@ '@r@@X uwriting to routing socketroute: read from routing socket: %s 㿘 (!"`x  @Y"L a c  g      5  & *+ 5lᜐ! `$ ``" ` " `* `" `" $`" (` " ," 0" 4" 8" <" @" D" H*  l" @ % ?   `@Y8`  (@rc  !h ?   ah@Y`(@Xc  !< ?   a<@Y`(@>c  # ?   c@X`(@$c  ?   `@XΔ`(@ c  ?   `@X`(@cᰠ% 5ᰐ@H ,`25 ` @O  (@'#'?2% %@Oq"L  l`@`0@  x!#( @ǢcД@$Ԓ @ <<?(<@J@@"@ +!<8*(` !< 4 !< (? * !<!< @  ? @@ *@`"( l l l l H l l l l l l l l l l l l l l RTM_IFINFO: iface status changeRTM_DELADDR: address being removed from ifaceRTM_NEWADDR: address being added to ifaceRTM_RESOLVE: Route created by cloningRTM_OLDDEL: caused by SIOCDELRTRTM_OLDADD: caused by SIOCADDRTRTM_LOCK: fix specified metricsRTM_MISS: Lookup failed on this addressRTM_REDIRECT: Told to use different routeRTM_LOSING: Kernel Suspects PartitioningRTM_GET: Report MetricsRTM_CHANGE: Change Metrics or flagsRTM_DELETE: Delete RouteRTM_ADD: Add Routerouting message version %d not understood %s: len %d, if# %d, flags:metric %d, flags:pid: %d, seq %d, errno %d, flags:㿘 `D `" +@ h0;* +@   "  2  +@   @p @ T0 +@   @ @ 0 +  @o   @֔@r route to: %s message length mismatch, in packet %d, returned %d RTM_GET: %s (errno %d) destination: %s mask: %s gateway: %s interface: %.*s flags: %s recvpipe sendpipe ssthresh rtt,msec rttvar hopcount mtu expire%8d%c %8d%c sockaddrs: 㿘!+" y @     + @#`h0+ b8@#   !#+ @bp @"0  L 3+9-/+5+7++;+  #" "  @" ` @  2 @ ` 2 @ ?` @` ܀ `` `,` !+"@ #a $a!+"@$a`   !+"@ + "@} @{b @ @t $P 4   L@k $  8 L@c $  < L@[ @#@X! $ @  L@O D#@Xt! $   L@C $  , L@; $  ( L@3 0`" $@  0"@& 0 $cX 0   L@!  `" @%0?H+@#`  @{ ?`$   * ' @ܐ  locks: inits: 㿘,@#!# $ b@X,@# @Q @  L sockaddrs: %s㿘`@-@Ӑ 8` @8 ?`$ ` * $`@̙  %-"$@H ?  @ ``?"`` * $`@u @L=`㿘`Y ?>@ 6  , < ?`&  @  * & @Q !  ?`&  @  * & @: 4  8  ?`&  @ >* &@ >㿘  " @  2  %s: link %s; %s: iso %s; %s: inet %s; %s: inet6 %s; %s: xns %s; %s: ipx %s; 㾀 ?`Z*`.  €!-#@}*!-# @(& $ !-'#0@t!-#@  @|! !- #P 7 7 7 777@\@Ԓ# !- #` / / / / / / / / / ///@]N@@KU   h 㿘@@ @T    `А *`: ?А *`: ? *`: ?ɀ`2    ."x,  €* ,`  *  **".@ ,  < h P P$OpenBSD: show.c,v 1.20 2001/07/07 18:26:20 deraadt Exp $UGHRBD M@dmCXLS1@2route-sysctl-estimateout of space sysctl of routing tableRouting tables x  %  `@J@ -̐`?`/!H*` €         @   ?''''   @K 6.@#@RW  ".@Q 2.@Ő#0@RJ   @K 6.@#@@R< @.@#X`@  L 2@K @Q                      %-*.*s %-*.*s %-6.6s DestinationGatewayFlags㿐//a//#\#`!ؒ   @^ %-6.6s 㿘 L p  @P"p 2  @ $ @  L ?  M@ P @  / @Gb@`?"`ࠒ * "@ InternetInternet6XNSIPXISOX.25AppleTalk %s: Protocol Family %d: 㿘?`0 X*` €/#8/#H/#X/ #`/ #h/#p/#x `/@ݐ#0/#@ؒ $ $ $ $ $ $ $ $ $ $  $ $ $ $ $ $ link#%d%s%x:default(%d) %02x%02x%s %-*s %-*.*s  x x  "9 u "C o     2  0 `@N   `  0 @ w`)0'0@@9  `@ `h@d `0^ ʐXT `  `  `   `ﱐ0 ؐ@f : 4@R/@R*&0  @` z:)0'0@ڒ   @Ғ *0 @0!`0!@00!@ p.R"ҔЀ` "ҐR@"` `*`R@  *@͒ xresolvexnsx25staticssthreshshowsendpipesarttvarrttrejectrecvpipeproto2proto1prefixlenosinostaticnetmasknetmtumonitormasklockrestlockllinfolinkisoipxinet6inetifpifainterfaceifacehopcounthostgetgenmaskgatewayflushexpiredstdeletecloningchangeblackholeadd㿘 @Ql *  *.`.@L p r h2*LN p"L rL h p h r .`2 ` .` L p h r p h뀢 pL ,r  L`N `,`%`* :  . :2 ^ @ί6`  .` А 20 .L ` `,* L A 6` L``* @8``6`L   ,V` "6`L 2V`!  `   L`,@L   V` 2 &6` J\2 J/7$ !*@J ЄД ** 8?А ?Ї+ 8* Ѐ4*@*@ 㿘@4/LtenexEebcdicimageIbinaryAasciiusage: %s [ %s%s | ] Using %s mode to transfer files. %s: unknown mode. TYPE %s %sTYPE %s㿘 !!@2#@Gb02"@`2# @:bH 2`"P#2@y"X$  #2b`@#5"#$!`"@` 2  2  #2`@ b?"c$ 2J 22 @!"  @!"  @m   "#X"binternal error: unknown type %d.㿘! #D %X4  `"$#D!!` "2  3 P@02  J 22@ " @ " "$X$#Dtype㿘2"b@"`H 㿘2"(b@"`> 㿘2!b@"`4 We only support %s mode, sorry. 㿘#3 a@o?"c$We only support %s format, sorry. 㿘#3bP@Y?"c$We only support %s structure, sorry. 㿘#3b@B?"c$local-fileremote-fileusage: %s local-file [ remote-file ] STOUSTORAPPE㿘 'D'H  'D` &`D  3D@=(H D  D3D@=H D $ HH#3@c( ``@>` H?D"c$`"H`""`H@J a   3#P3#X3#`   !  @`H"`  ! H@k H"`H  @  @!H @Llocal-filesusage: %s local-files Continue withmput%s: not found`'H 'D4`D@<H HH#4@~ap?u"c$H   "6# c@M '@"` H  """ H@= y "̀ 8J  "  2J J  @  "J  *` /"    (+  * *` * ! @$ ! @   3#P3#X  "(    @!.! " H" 1"( 44&"(!@=da " $"&"(H @ ! "@ `! @    3#P3#X@  "(  @ j # b 2 " !"( 44$"(!@<a b $b$"(   @YtD?@K  ""r+w㿘5@( w㿘""`5#6 @ usage: %s remote-file [ local-file ] local: %sRETR㻘 'D'H   'D` &`D  3D@:ْH D  D3D@:ΒH D $ HH#6@`` ``@"`-H !  &""" "H@5t <"@" H" 1"( 4<&"(!@5]cH " $"&"(H @4a 2N@Du  ""from-nameto-nameusage: %s from-name to-name RNFR %sRNTO %s㿘'H  'D=ؐD@3ĒH HD  =D@3H D  HH#=@`? "c$=`@! H=`@!-usage: %s remote-directory local-file nlistNLSTLISToutput to local-file:㿘   &`  =!&`   #=@@Ua=@@.b =="("0`!=@"! " `@5 ` 2`?1"c$!@ 6`J |"`@4` =`@4"8 6? "c$`` @i @;#`@B@Busage: %s remote-files local-file 㿈'H  'D7D@3 H HD =3D@2H  DH#=@ݒc!=H*  ?a''"?@ HJ |H@4 =@4@"8 H?P"c$   "6# c@CW '@"` "+  a w/H,`@="0 @ 3 b  " 1"( H&"(@4@4! b &b&"( "` D?@Ҁ`@C  ""耢@@BV SHELL/bin/shsh-c%sTry again later㻐 @B  @B @U S @:   @B  @B >@C"X >"`@y / " -/ @֔#>@bh  +/   !#@d#@> @:#  > !p@f >@f >"x@?"c$@Bq @&.@B @B ?>@""#$"#$usernameusage: %s username [password] [account] USER %sPassword: PASS %sAccount: ACCT %sLogin failed. H'H 'D ?hD@1ϒHD?  H#?@`x?U"c$H?`@ 7 D  H?@ H"`D 'DH?`@ # D H!#?@͐ @:#H O@@C?,H" D 'DH?` @w ؠ  #?@ 0  D 2 ?H?` @b ?"`PWDPWD command not recognized, trying XPWD. XPWD㿘!#D ?$#D@D" 2$#D#$!2 $#D#?@w"?@4"$#DLocal directory %s getcwd㻘@)ڒ$  ?#c`@?@#x"#$directory-nameusage: %s directory-name MKD %sMKD command not recognized, trying XMKD. XMKD %s㿘'H  'D?ؐD@0H HD  H#?@Ւc?"c$H@`@֐  #$!#D H#@@ H@`@ @RMD %sRMD command not recognized, trying XRMD. XRMD %s㿘'H  'D?ؐD@0H HD  H#?@c?"c$H@`@!( #$!#D H#@@!0H@`@y!`command line to sendusage: %s line-to-send 㿘'H 'D@HD@0nH 3H#@@Lb`?"c$3D!p@.Harguments to SITE commandSITE㿘'H 'D@D@0DH @H#@@"b`?"c$@D#@H㻘@鼔$`>@BS  $" @鮐 @BH    *@ . >"x/@ @{ modefile-nameusage: %s mode file-name SITE CHMOD %s %s㿘'H  'DApD@/ݒH HD  AxD@/ђH D  HH#A@ `?"c$A` @`SITE UMASKSITE UMASK %s㿘!#D  $#DA!xA!@`$#DSITE IDLESITE IDLE %s㿘!#D  $#DA!A!@z`$#DHELPHELP %s㿘!#D  $#DA"HA"P@d`$#D㿘!  @ @!   @ @? QUIT㿘#` A@D"! ! "@ Đ?"b$! $`"!usage: %s [password] Account:㿘  #A@@ c`? "c$2A`@ $#x?@ ؁㿘@5  @!]   "c<"#<@!Q "8@; commandusage: %s command ?Ambiguous command. ?Invalid command. ?Invalid proxy command. 㿐'H 'DBPD@.ےH  HH#B@ `XPH@' ? '!#B@ p@7>#h"#$ !#B@ @7/#2J`  !#B@ڐ @7"#%@ Ő"8  Ac@?+ @  J    !#7@#@7#@ А @? ?("c$#B`@`z  `@@"@8DH? €`  "c<"#<@  @> Case mapping㿘 B"c$Carriage Return stripping㿘B0ϖ@"c$Ntrans off. 㿘   #! B#@U$!!"#$ ""c$`"@稔   * ` @矔  `ܖ &a8J!$J J@` J2`@  ` @* 2  * J *a8Nmap off. mapoutusage: %s [mapin mapout] 㿘'H  'D#!C!@$!!C"#$  DCD@-H D   H#C@ a?*"c$1 "c$! @"``  L " &!@䍒 , !# @# L " "@#nmap: unbalanced brackets.  #   *``` NLC *`:  $ \2%J*J!: J 0$JKJ@J?ϕ+`   "@  K`J 2 " K@2 K 2 J 2 K J   K +`" Jb1 !8.!8bJ [  \ $+2+J ٖ +J $1 "   "* J 0?L  @`+J@  f +` ` @ "Z  +@  Q  *`A: :  \ $921J"   ")JJ 0?L & @`+J@  J+`  @ "J +@   J  + J  , ]*`J ^  J2J 2J  ]`\J <EJ ,b ]"4^"   ")+J 0?L ! @`+J@  +`  @ "  +@   J  +N!8 !80#C@:"Passive mode㿘#D`#HE H "c$Store unique㿘Ez"c$Receive unique㿘Ej"c$CDUPCDUP command not recognized, trying XCUP. XCUP㿘E@! ``#$!`#D "E#E@ِ!(E@!X`  "`restart: offset not specified. restart: invalid offset. Restarting at %lld. Execute get, put orappend to initiate transfer 㿐 #E@!0 `@T # J #E@"0 #Eb(@ <:"SYST㿘E@<#Limit of 16 macros have already been defined. macro nameusage: %s macro_name Enter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4K buffer exceeded. 㿘!!'H 'D#E#8  DEhD@*H D  H#E@Ԓcx"( #E@#!#*`H * `@j ! "("@ #E@#z"#$" " `$!q"$*` *  @* *  "@!`* * ` @'%H`? "`@͐ H  "H?̑. :  .@!`*` *   @ƐN "Ė.@`(@3`H`? "`@ `H  &`H ?23?`H`?  "`@  3`H  ` &`H#E#@?"c$filenameusage: %s filename %s %lld 㿘'H  'DF(D@*5H HD  H#F@c8?"c$H @, ?  HF#cP@"#$%s %s㿐'H  'DF(D@*H HD  H#F@ےc8?"c$H @,1 ?'H#!G` (@@@"#$STAT %sSTAT㿘 G!G!@ `Local file "%s" is newer than remote file "%s". 㿘6Ĕ? G#aH`@`PAGERmoreCan't allocate memory for $PAGER|%s㿘'H  'DF(D@)H HD  H#F@fc8 H @+.  G?@"c$@:ΐ!Ƞ GL G!@;@9  2GGa@5 b@)Đ" % '  ="5D$H$D  6  @|@9< H="$$D @@9?verboseuserumasktypetracetenexsystemsuniquestructstatussizesitesendportsendruniquerstatusrmdirrhelprestartresetrenameregetrecvquotequitpwdputproxypromptprogresspreservepassivepageopenntransnmapnlistnewermsendmputmoremodtimemodemlsmkdirmgetmdirmdeletemacdeflslpwdlesslcdimageidlehelphashglobgategetftpformexitepsv4disconnectdirdeletedebugcrclosechmodcdupcdcasebyebinarybellasciiappendaccount$!macro nameusage: %s macro_name '%s' macro not found. ?Ambiguous command. ?Invalid command. Not connected. 'H 'D  HPD@(VH   H#Hb`  1! H`  @턔 2 !0H#Hbx@?"c$ c@Ή/఩,`* ` @ Ѐ#b  2 N+  Tc*`:  $ \"B A b@  %*`    * ,  * :`  ?D?#?H,  @@H :  i2D  H,@.H@9@.@`N 2 N @ .@#`@  `#H@ܐ"Q"#$2N` #H "   #H"@?9"c$#D !#@c#@3 `! ` €# !  N`  #`?"``@* "@@  @#@ w#`'D@'Hఐ* `@2 6#񀦠D#/unknownCan't allocate memory to parse URLhttp://ftp://file:url_get: Invalid URL '%s'Invalid URL (no `/' after host): %sInvalid URL (no file after host): %sInvalid URL (no file after directory): %sCan't allocate memory for proxy URL.Malformed proxy URL: %sCan't open file %s-Can't open %sWriting %sReading from fileSuccessfully retrieved file. host %s, port %s, path %s, save as %s. %d%s: %sTrying %s... socketconnect%sRequesting %s (via %s) GET %s HTTP/1.0 Requesting %s Can't allocate memory.80GET /%s HTTP/1.0 Host: [%s]:%s GET /%s HTTP/1.0 Host: [%s] GET /%s HTTP/1.0 Host: %s:%s GET /%s HTTP/1.0 Host: %s Sending request: %sWriting HTTP request200Error retrieving file: %sContent-Length: Reading from socketRead short file. Auto-login using ftp URLs isn't supported when using $ftp_proxyImproper response from %s?'?#"@IH@?c@"@  IcP@2 ?Icx@ܔ  ??#* Ic@̔   ??#  Ic@  ?#   #Ic@2 `@ /  L@ 2,@ 2JI.#` L@  2JI!#؀?#"@ %?!?#@"@%?   J  ` {JJ @Ӓ0=`@$ IJ`0@24 cx@W  I  c@M   J JL  /J X@0W,@܇ / ?L@ 2,@?c@@`$@? 'Ԁ??J p@X09#H@@7?2 0??:0?#J@`  &@!'Ѐ ?JR '?c" @_" 2?P``@5Ő  ` ?c:#    ;c@(c?O?@B :&  В@-?ڀ 2  7" 24? # +#2 @&# #`?"``@* "@@ #   : @ F @(@-U#?#ؒ@Ԓ@-= 2   H" C #`#<  8   # :` #2 #?`"@  #* "@I ##?`" * " @9 @-#J@m 0N@' #D #?#J@ #?c@4 @,R Ѐ c@,c ? @4+?L [@k ] " J ``:2* @k :  ,   ?#@J`@ؐ @6  '' t!?#@G` t`#(J  P@@0  !J!@ @0Q?#?'ԀJ!??cؠ  #\  @#Ja @@֥ 'Ԁ?J'!0@ ? ( x @,?J'a8㸔   #\ @s  !??!?#@eԀ J!@@~0f# #D J#aH@n#J`@k\?#D J#ax@\@u : 0@ Ja@/ @g % 2*Ja@!  J#ؐ@;0 ?#J@Ж@0@3?Ja@  J#ؐ@ ??#J@ @?#ؒ@@5M ``J#b@@Ԓ@+J@}"X0ِ @4??#ؒ@&0:./Ԓ@+c  JL   ./@  Jbp@)  J"x@}0 @4 Ԓ@+;  JL  2 `    ?#ؐ/ ?cؐ */L   (* R  c2 Jb@X  2 L (  @ٝ?c _' * @< : #0:#0#0 ?PJ  K?#J FJ???:0?#J@2` &@0!'Ѐ  ?J@}I 0*R '?c" @t"  P?#@ @ @2Ԑ 0`@2А  ` ?c:#    ;c@%n?O?@B :&  В@*?倢 2  7" 24? # +#2 @&# #`?"``@* "@@ #   : @ F @(@*`#?#ؒ@Ԓ@*H 2   H" C #`#<  8   # :` #2 #?`"@  #* "@T ##?`" * " @D @* #J@|x"0Y@$Ð #0#0? ## @ #D @#J@"0:#D #?#J@ #?c@1 @)R Ѐ c@)c "? @1?c@@@1 0'@|\"0 ?#@J@|$ 0J# @|OԀ??@)r?#@ "?@ @0?@0? http fetch aborted. 㿘@' !#O@<#@)#"@=  file fetch aborted. 㿘@' !#P@( H@)p#"@) ftp_proxyhttp_proxyCan't allocate memory for auto-fetch.Invalid URL: %suser %s:%s host %s port %s dir %s file %s Can't connect or login to host `%s'cd/*?[]{}Retrieving %s/%s %s/%sgetmgetp'D'H'L#`'@    F  hc@1' hc@1# P@1 P@1 { ܪ H* @@ר   P`@- Icx@)   Ic@"   IL!?P0Lc@  O L??0; /@Q @@M :@I $`!@``,`   *@L `J`  `PH*` @{? 0 `@ : `. @ :`L@ ` .@``N@  @gO /  *    P#`#\#`@Ț!8@⢒ 8@9  w  8'''耦  N !'' ! !$! @  $!  @ 2 P! @zÒ0 PP!HaP? 'Ꙓ    !  ` N@ PaX@@  `L PaX@ 2 `N@ `P!H' ''e  K"J?L D?#D  #P`!`P!x @0` P@ *$P!''䀤` '耥  L!P"(!'$"( K $"( " ''  #$@# d ܰ @.ܐ '܀ D 6 ܒ :H* @ x ?  :/㿘Ic@  Icx@  Ic@  R@Z`   unknownftp%dftpgatehttp%s: bad port number `%s'%s: %sTrying %s... socketconnect to address %sconnect%sgetsocknamesetsockopt TOS (ignored)rwfdopen failed.Connected to %s. setsockopt@R!"cT)  @0v"ؒ  @0q  ''''@.`Ra/@4 Ra(@.  RR  @ J Oa0@   OR  @ < PO @y` !RR!8@y[ !X@@yR?"c$ `"8@׻!"8@׵!"8%$@ G?     #\! @Ӛ R#a`@  @ 6 R%!p@1   ( x " ``     #\! @ R!x@x̒R@&"a?  `6  R@x!?@"$w " @/G @'`X'@ٔ 6 R@x!E R '  @֘  RR@x!Ra@! $ Ra@ #  $a `2R@x! #D R#a@g@@  "a @a @?"c$ '?c!@ϒ     R@xF"#@@% 㿘@#ѐ !#?`" * " @ @%#bؐ `" 0@h ---> PASS PASS XXXXACCT ACCT XXXXNo control connection for command. QUIT㿘  !'H'L'P'T'X 7$"3cS@1#SH#@@  SSc@$#c#Ȓ@3  cSc@#c@ Sc?`" * " @ @%Kc3 a  SS@w#?"c$& c@-O a @ -Ha T@ @%0a   "T@t`@%`?"Ԁ ƀ @-. %c%c%c421 Service not available, remote server has closed connection. %s:㻘 # @.n$9S @- #    "#$ ֦ '@h `΀` `@h ! T! a  4! @h ! T! a  @4@$! ! ` @#D !T#@j!@$#!"c$ ` >#D`45 541 # ,#<  ` #T#b8@@#`? "`` ,`:  @* "@@ " `   $*` * ?А"$  #$?    #$ " d  " `  2   d` `)"---  d`("  `- "#$ "! ,! @h, ` '`#D 4 !? 5 # !#`?"``@* "@@&@## $8$#@ #$`"# 1, "  @+#$!a@'"Ԁ  #@`"?П@  ?ƴ@+Ȑ  "c$ 㿐''   @ send aborted waiting for remote to finish abort. 㿘@! !# U""@?#@###@@ sentlocal: %s remote: %s -local: %s%s: not a plain file. STORAPPEREST %ldr+w%s %snetout  V :D?x @'l   ?? ,8;c0'D'H'L'  LJ -V#`H@L`V#`X@L DH@ L0 b#X  ܣ '''Ra''t@# /U    1"Ѐ @"?&" @+  @*  l@* l?""A"$c@* 'ca @* 'VH@`h  H H'`"c"0aJ@ |(R @*А H'Ra@N' R!@u@* @* @* b ""b!'07H@a' FHV@t p@* @* "('@,AR  <  "HV#@ܒ`@* @*~ @a:0@~ @*o @*l  ?@*e ?"$l"b@# d1IJ""`@QVD@܅`  VD@~` EL#X ?` @    "R  @!  1HV@t p Đ :l G"" Vu    >"l 7"bV  >"'tLDV \ ,@) @) l`""RJ! @) @)ߐ l`""@)Ր  "@pt@ 4' @o? @) cX'`7`` (" xS # >`B;#`  R @! 4&@  ;" #0 3 ##x *x  | !|# #`?"``@* "@@ #   :x B ?x#@!L#pR @!6$    M`"  #0 C` #`#<`  8`   # :` #2 #?`"@  #* "@= ##?`" * " @- @ #`VH@s_ p ( x]  3 ##x 8x  | /|# #`?"``@* "@@ #@ #    :x B?x  "  #0   @;  `?"``@* "@@Ɛ  `B :`? "`` .`:  @* "@@ `B :@d`   B" #0 : ##x x | |#?`"@  #* "@n ##?`" * " @^ @ %# @VH@r p @  ( x  V@r  ??:@ː l`""@@ @(  @(   " @(  #`#M  I@ 0E@' @' l`""@'   1?."c$"Ѐ @?&" @ ? "c$ " @ #`#  @C  receive aborted waiting for remote to finish abort. 㿘@ !# Y""@6#@~##@7 receivedRETR./mallocnetin%s: short writeWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %s  'H :''X''?'T??Z'D`   :#0Z ,;'L'P'X`p'@i`?'܀ ##D  H X HJ -V#`HH@kL`V#`X@bL  ܀ HD@ L0T'"0'䀢 ' ܀@ '@# +Z Ґ   !"Ѐ @?$"䀢 @&Ӑ 耢 X@&̐ X"bT?""$`@& 'ca @& X'耢 VH@`h lHJ |gH@  UH@]j / ( x   HV@p p0m 2,H ZH0 xZ @   /,HV@pՐ p0O  ( x  H@V(! HV@p p0;  ( x H@ w'HH 0*  H@ j'HH ܀  #X  ״ 0 b#X  ׫ L@ :0@4  @&% @&" ?w"c$@# #܀  Ē"`" Vo cL  DV d  R0R\! R0@]!' X 2XVH@`h X '5"b`#HJ | @%Ԑ 'HR @I!a' HR!@p"`0b ""b!"bH@P' FVH@p  p0"('h@'UR   !$'!#8@#c< @$@$ $c<Z@o $#8$#8p<  b ""b""@$?#X "  Đ    ( R  @   (" x^  c<R @5@2  ( x   $ P c  <` B <;c" #0 3 ##Ȁ *Ȁ  ̀ !# #`?"``@* "@@, #   :Ȗ B ?#@#R c<@8   M`"  #0 C` #`#<`  8`   # :` #2 #?`"@  #* "@ِ ##?`" * " @ɐ @#` ( x Z@n  ??:@ZVH@n p08H@o 04"" @ @]  ` @`x? "   @F  HV@n pXT"""b@q` Ԑ 'l`  3 ##Ȁ 49 Ȁ  ̀ 0 # #`?"``@* "@@H #@#    : B?Ȁ  "  #0   cB@` :c` ؀ `  @< `?"``@* "@@  ``  `? "`` ,`:  @* "@@ `B :@_n` Ԁ  !Z#`@ Z#@S   B" #0 : ##Ȁ Ȁ ̀ #?`"@  #* "@ ##?`" * " @ @X# @  ( x Z@m  ??: @VH@m p@ XT"b "@@#C @#@  @#9 @  #`#܀ `  @ " uF"(@oL@ʒ ?j'\@ '`\`H@H'd?_#!ZH!@x\@@Q0PXT"b "@"  @"    ?"$@"ߐ @"ܐ 03@e#b?`"#$@ $b쀢   @ " @ #`#  @A @" @" use of scoped address can be troublesomesetsockopt (ignored)EPSVwrong server: return code must be 229 disabling epsv4 for this connection PASVLPSVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u%c%c%c%d%cparse error! setsockopt (reuse address)bindlistenEPRT |%d|%s|%d|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d㾸X  't` '` ? ?@_?@_@ln cH &X @"ɐ  @ Ā""R@l'!p- @|bА?" H$#(#8  ?c t@R  _@l  0c   7 S "Ā ,#cT '_ Hc$@    # _@$ P   `$cT#_@ x!_ _ H͐c$@|    # _@ P_ !#(  @А? "#Hd$#(#_@ߐ !Ā`_`@l D_c  2#$ @>   #_@ v!Ė#\#` _#a @5Ā   @"e*`* @*ÖǕ*@  ( @ 4 , )$ `@$ _#$ @ 2  #_@}!p4!#  ? !Ęh#\#`#d#h _#l#apl@58 Pp ^l Zh V  @" * *` *Ö Ǖ* *c 6.&ĘȚ̄ІԞؠܢh#\#`#d#h _#l#p#t;x;;;;#apl@4 #_@ !8!p  l h #_@ !Ē  @!˦ϗ*ۅ(ߕ*+ *  Ó*`ӡ, @+`@(+(@+ @ǐ (, @$ @6.&$Q$`H@L m!#$'@#   #_@ P[!#\ _#a@4r OO@ O@O@#_@";!#b@ ͔ 4  ( x  !#( R@j)!$!!b #@k# #  " В 't'`X@  )  ؀ 24 #bЀ?" @\  @   $bR@i!p` %  ؀ bА ?c t@)  b_@i"!Ē@ _@i֐"8!#8 b?c t@    _@iĐ 0 'dbВ@d bR@i!!@o  6 _@i"@ ؀ ` ``  6 "Ā /#T ,      x #\ . @a   _"H  ` "#T#_@ x A#    9  _"X #\*   _"p#\#`#d #h #l#p #t #x #| # ## # # ##1  ؀? % '`&@ ` %    'tbВ  t@P   R@i! !@]"`?$"  "`ذ acceptp XcH ''"#bВ@Ԡ  c@h 0b@8 ?$b@3bـ $bА 'А  @  6bR@hǐ!b@Ғ㿘 ## (`x`#2 $`x  ($`x@ $`x㿘@A bԐ "bԁ㿘'caX$@@   ਀  "ਰ  @ #@`" %&@@"   @!`. `!"$@ @! a @ ! X @!a @  &!<a<  "&!@a@"" &!DaD X#"&!HaH"X&!LaL "&!PaP `# &!TaT #`&!XaX!"&!\a\"" @Ӑ!`@a`!  ܔ @ʐ!qaq@a! &!a#"a$@Ƽ!@a!"$@Ƴ%e@ @Ԁ $ԟ 㿘@ !#?`" * " @ @x#  `" #""Ԑ 0@) STOUproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s aborthZ p'D''H'L'@ό '   d V ' "  1#P  # 2 1#X"_Ψ _ #d@ǐ 0 ݐ   #X#d@ ѐ ?"c$Ά d  jc @떐 0 < d`@ V`'DWL @  0@Ԑ  `'CH  !"ؐ `$" ￐ @ѐ  d#$"H`@L0@Đ ""ZD@`p   Zp ! ZD@`p  !   ` !  2!  2 ! V H &0 "@  C`? 2#!  2! V H "! 1  @ )  ?"c$@d 0J "@  `? )Ȓ  @   R 2* + @ $  6d@f! ?"c$@~    ߐ  ?"c$@ resetxؐ @o    R 2*@ + @ $@  Be  b8@fY?@D"c$    runique: can't find unique file name. 㿘@R / ` 1,@@`Z xZ @* ` /,@+V@f p; # e@Z"03bP@@P .*&`  d,,@: ` 9,@ 0bP@ ,:  02 L .  1,`,"ߨ 1"PLost control connection for abort.%cABOR x! ! f@e  ?"c$@Ta   @h! R  @  "! d@e!! f`@裔 @5! ؒ  @   R  2`* `*   $ V 2 * *@$ l 4 6d@e! ?"c$@h V 2 *` :@` V @$ 4V  #$"(  ftphttpFTPSERVERPORTftpgateFTPMODEpassiveactivegateautounknown FTPMODE: %s. Using defaultsgate-ftpFTPSERVERNeither $FTPSERVER nor $GATE_SERVER is defined; disabling gate-ftpTERMdumbemacssuAadegimno:pP:r:tvV--r requires numeric argumentRetrying... 㻀'D'H@ ffbf"x# t@a"   "`f""`   $3#% "`#a ( ""D#"&cH$c(@$"` f"b"T@9"ࠒ ")f@̛b耢 2f&cH$c(b@̒ 2f&cH$c(b@̉ 2f$c@́ f$c(&cH#@dϒ 8f@sc0 2f  "bf@#@ "bJ ! f#P"b! "  f "J 2ff@d#X$"f@#  f@Gc fc@A f@;c 2  H@T  "b  "cD XR@"c j`h@ $ c `"b`5[h"Г*` "#(S"cH  O"b 8 `"8F" C"!@""(?<"b9"! ( fc@ 0 ,"c "#H&"( ( !" x ( "    @! $#fc@   "` "cD"#D@\HfD@ڔ" D*`" 'DH@   " 'H# "@i"0 @[ @d@] @)"@. wa@P D $JH  H "D &;@@̐#` h@ c@1 hc@-  8H'@H'`H'`''D@t 1 # !  #g"@ @#  "#@畐#``?  hc@ hc@ @  , | | | | | | | | | | | | | | | | | | | p | | | | | | | | | | @ | | P | t | | | | |  | P | `㿘@ #`@^ 㿘' (x@ #` ! ! " !R @@* @݈! $! !"Ѐ & $`@@  @P"А?$"$`N `  ! ! " $`R @@ @l! $! $`"#<; $xftp> i sorry, input line too long. ?Ambiguous command. ?Invalid command. Not connected. 㿘 #?`" * " @l {L dƀ`"h, #i@ې  H`? "`@͐  H  & H` v Hsh@# c P1 @r? #i@ B2 L #i@ 9     #i@!+  "a €c ! " L  # `?"``@* "@@  j#䀢@h" "  Q!@i#@# #1$@\ H  ׼ @V nhc@ hc@  - ܚ   `"J@ KJJ@J`J2  "  " `2J@?㿘  %#b"\"##L#`# $c $c@@ c!$c\J@ b!$ L J@ `"L#c\J@!jjf0d8 "L J@ "` ?L`L  J@ "L "L J@ ' @"" 0 \2 *` `J@ @ *` J@ @"2*ݒ``  " b* b #c\#L    "#L "#L  %sommands may be abbreviated. Commands are: Proxy cC?Ambiguous help command %s ?Invalid help command %s %-*s %s 㿘 U?@)%#j`#Xj#j# @ 3b1à ܑ* `  L b@b ܑ*   *@ @( 0!@Ȑ? j#c j#c@㸔 ?j#c  @? `usage: %s [-adegimnptvV] [-r ] [host [port]] %s host:path[/] %s ftp://host[:port]/path[/] %s http://host[:port]/file 㿘 8k   aX@x @ macdefmachineaccountpasswdpasswordlogindefaultHOME%s/.netrc%s/.netrc: %sr%sanonymousError: .netrc file is readable by others.Remove password or make file unreadable by others.Remove account or make file unreadable by others.Missing macdef name argument. Limit of 16 macros have already been defined. Macro definition missing null line terminator. 4K macro buffer exceeded. Unknown .netrc keyword %s8k@n"`   @7 # !k"x@ؐ ?@` kbh@kb@ݐ  "bP ( x k"@_Ӓ @! &/@ݒ . \kZ" 0T F@{ L'X@\ :#c@@V 4c@@ . "@L c@@`$ c@$L @ . #@5 $X@H L@ 0"'@   kD `k@, @  !"X@@ @&@0@-bX؀ k@&b  "P@R   ?k@  !"X@t@ @&0"P@wR   ?k@  !"X@V@ѐ @&0 )@P"P ") ")  '#k@7#P`%*` *  *    ``@P"P "   ",  ,@Pp"P s` "("@ *` * ?`"-$*` * @ * * `"%* @ *` #@P<"PE*:  ,L? , b("( #k@#7#@^bX@7    @,   @^"k@^#"P@ 0#k@#p#k@#@^w"k@^t""P@Ȱ?㿘!"P T @O"P  ` `,3#`"bX02.@O"P. @O"P`"`\.,bX2.@O"P. @O"P ` ` ` `,퀢`\.LbX  #؀` #@ƒbX "    stringlist: %m㿘@ 2 n`@] & & @ P &n`@] 㿘  @2 *@&  &n`@]  * "  & 㿘  `  @ .` @}` @*@w@u㿘  : , @\ 2  * Already connected to %s, use close first. tousage: %s host-name [port] gateserver not defined (shouldn't happen)PASSERVE %sConnected via pass-through server %s non-printstreamfile8binarySYSTRemote system type is %s. 215 UNIX Type: L8Using %s mode to transfer files. 215 TOPS20Remember to set tenex mode when transferring binary files from this machine. 㿘#`'H  'D#n@b8 DnhD@HD  H#nbp@?"c$! "    xH " H "Ȁ"nJ nb@d E  A  " Hn`丐" #D  n#b@ߡȠ nb $`@5 "  nc @-  "nc @%"n# `  #*+  "4)nc   @ ! "#X"bH  @   ' D?$Dnh#( #!`!n%@o  @i  L? ."? ,#nc0@> 2,!ncP#@Ɣ    "c "cP` n#ch@  $D "#"#P`n#c@n 2$D#n@Q#$Danonymous%s@ftpName (%s:%s): Name (%s): USER %sPassword:PASS %sAccount:ACCT %sLogin failed.init$init'L`'H  '|HLؖ| H?"c$԰ H L -  "Ѐ ' !!@ !@@Z  'H@\@U 2o#'H!@oH@! o#'L'H 2p /'H@8  @[@T 2 p#`@} p#`@uH/ O@@?.@O 2'H'HH pHh (`L 2pp@n 0'LpLY @``| `p@^ H'|p|I X`p`|`p< X p@[c ` 25  "Ѐ \    0' p`x @#G   #@05? @ "` `p p@ޒ `@  sorry, arguments too long. (%s) 㿘 #@+$ #q@& (#q@Ԓ`H ,@ $"@H@ @  ?L@ ",@   #@$ $ &@TMPDIR/tmp/unable to create temporary file: %sftpXXXXXXXXXXunable to create temporary file %swNLSTarcan't find list of remote files, oops. can't find list of remote files, oops.㻘 "  ! !?"" T  @$ T ! + ""`"` ""0`T 2q@!H q!P@J? /  $d !q!X@ ?@Z_ @?L /" /, qa @;@2 q!@Zj @i1#D?&#D&#D' `$ [`?`@q`!@q! > `@q`!#$@ d #&` 5`?qa&#D$@ϐ%`T@T`T 2 q#q@! "&!Ţ" T@$  T@9 $ T@Ò 2.%s %s? Interactive mode: off. Prompting off for duration of %s. n, y, p, a, are the only acceptable commands! 㻘%( B# a 2? !r#ax@q@#H@$ , `(*  R  n"$  p ar# yr#r#$(@!  r$a#a@B @>a! %s: not foundh ! ! Ȓ  ,@.@, @ʖ 2@Ȁ  @r@YM#@x  @}$@@pSIZE %s㿐# %`D ???$Dr#Ѐ  #@  $  @'# J  "@  2$D??"$D` 2 $D!#@##@ F $DMDTM %s191Y2K warning! Fixed incorrect time-val received from server. %*s %04d%02d%02d%02d%02d%02dCan't convert %s to a time. H# '-`D $?$Ds ؀ a`1##   "    2 s`@ٔ  2#s@r`  2 0, ,, #\#`#sĖa(@"Ȓ  ,@a?'''Ę?x''''@Ґ?쀦``  s#aH@8$D"$D` 2 $D!#@r##@  $D?"%$㿐! X?@3w$ X`w @?  X `?㿘# (`x "?2$`x@N $`x %3d%% |%.*s%*s|********************************************************************************************************************************************************** %5lld %c%c %2d: %02d:%02d --:-- ETA - stalled -%02d:%02d ETAh!"ؒ @ꀐ`"""# :А@s " +c0 c01 5#ஂ@ B `5- -@B2`* @ *`B2*@ *@̳c0  d & d4 dt !@g!?․`@@ d@@t`ؒ!"@tt#\( 8@J$@  4`  <    4  a"@ , @u@rŒ``J@!"@t`  #\ B#\@ Ē"@'" 'А"@''"Ѐ"`"" ;"ؘؐ  "ؒ@ # '"ؒ"" `'" `'А"@@''ʼn h` 腠DA?؅B.'@ @ @!"@t@鼖.@ @ !"@t@鯔.@M@ @ !$@!t! <@Y <@;@锖%# #`  p  c0c0`(@ @ !"@t@l^% c0@ @ !"@t@\ N% @b #!@?ؒ. ЅąB'@ @ @ !"@t@7.@ v@ s!"@t@*.@Ȑ@ f@ c!$@!t!0 <@Ԑ <@@%R @ L@ `sc@  @ 0@ ?`" * " @ @v%lld byte%s %s in %.2f seconds (%.2f %sB/s) sMK ETA: %02d:%02d:%02d #D  @虒 "ؒ"" `'" `'А"@@''ʼn x! # 腠D@M?xx B3? ?  @˿  v(v v# x#` #  vt v ",x#\@;``  B`;hv v #p@X d V# #Q ` M x E0`A0"#@ D 4: 030@ @ڐb !@?px. pąB'@ڐ.@@ [@ W d$@!v  <@Ȑ <@@  #R @ <@}㿘  @ ,`@ ,@4 `@* ?a@ "  @ ? @I 6C`@,` #@  # `?"`@* ("@@t %`@ -`#   ?`"@ * "@W 逤Ħ`@ 㿐## (`xR `h@ ?   P"! P"a$`x㿈'''' @> 㿘@k/etc/dhclient.conf/var/db/dhclient.leases/var/run/dhclient.pid-pbinding to user-specified port %d-d-D-cf-pf-lf-q-u-1specified_interfaceInsufficient memory to %s %srecord interface%s %s2.0pl5-OpenBSDdhcpcudpcan't open and lock %s: %mNBINo broadcast interfaces found - exiting.PREINITalias_㿐@  @@@W / @ @ @  ` w@@b `@K@@[! .* w4#@82`w@@c( w / }"c@@c0 w 1 s"` @@c8  w`@@c" @@vc@  w`@@S" @@fcH  w`@@C" @@VcP w  /9"#@@LcX w0" @@Cc` 2@Ő &"`J -w@ؐch@ ` 2  ww@#@7c  `@ L@ @  /Ԓ $$ L" "Ԥ``` ww#aP@7! ." ! .#  #ww#@ؒc؀ 2  D4##' 1! 1?4 @$  1?"  * * 2  /##@ @#`" @ w`@7I#@% /@ @RԀ x` @  @  x@7 @W #` x L  2x @ s`8 P x`@@ ѐ@  2#`` @ Ԁ   @`@ R  @$@*@Ԁ "  P "`@N 2 P  1@"a %sUsage: %s [-c1u] [-p ] [-lf lease-file] [-pf pidfile] [interface]㿘!y!ŒaP@70Œ`@7,Œa8@7(#ya@7$Œa@7 Œa@7@7y!@6y@6!Ё㿘 P@  02  @!0@*"` P"`, P@{@ PŔ `@ِ  1 $ P" 4 P @ "8 P@a"`<㿘 P@@ PD ", P`@  P "` 1 $ P" 4 P @ @"8ARPCHECKcheck_㿘y#@~"@ P  ! ` ,yc@ ycА@ @  $@@@@ ې値` P`"  P "`0@a܀ ! P 1" `$  P""` P c@   " P   @ @ "  P@"`0Ŕ `@F  P "` 1 $ P" 4 P&  @# 8 PD@ ",@ŐDHCPACK from %spacket_to_lease failed.㿀 (P ,@ @a P     !z  !@@7@6@ 2Pz@6 !0r"` @ P aЀ "@:8P` "`P ` 6P#"`P  "@:"P`"`2  : "P  "@:P` "` 2`@ : @:@" P 1 $` "`P ` 6P#"`P $` "`P ` 6P#"`P $`  "` P ` #"` @REBOOTREBINDRENEWBOUNDold_new_bound to %s -- renewal in %d seconds.㿀 P`< `"`, P@ {` P   2{{  x { {  ,@ I P {  {`@  P{ `@  P x`@@ @  P " P@ P{b" P"  P@  P!{`  @ @6 P 1@`$" @5 P @$"`@ j㿘 P@@ P`D"`, Pa䀤 2 a @  P"  `@  1 $ Pb" 4 P   "8 P@h"`  BOOTREPLY from %s rejected.h * (`P",f @   @Ȧ @@6E   @@6S{@4#@0@DHCPOFFERDHCPNACKDHCPACK%s from %s rejected due to bogus yiaddr of 0.0.0.0.%s from %s rejected.` z|0Q~0N|"h ` | `0|!`@"'Ē`@࢔  2 (#|  `H@I@5   @?@5@4S0  (`P",f @  @+Ȧ @%@5 2!|BOOTREPLY%s from %s%s isn't satisfactory.%s already seen.ARPSEND㿀!܀  (| |"P` `,@ @3 !|  " @ې@5@3P&  &  4 * @ w 2& P    2  `@  g| 2 @ 2!z@3!0e 2P 0 $ 0P| <b` $ ,@ycД@@ P b@?  4@  @ʐ  P $P" P   1 $4 $P` 2"`@ 2@"@ 1 $$@ &@`y0|"0@3f0 "H@30 c@~"@`dhcpoffer: no memory to record lease. dhcpoffer: no memory for option %d Invalid lease option - ignoring offerdhcpoffer: no memory for server name.Bogus server name %sdhcpoffer: no memory for filename.㿘@)(4 }@2!x{  @a(4 , 4@ "@  8W$ 8 @@@ 4"*@ @  L, & ` @Δ !Ԁ "! 2!J , "!@ A & $}.! @@`, $* @@  $ 2! $}@2"0 "! "J l @ & (} "0}@2!0}!@2z@  @`l (* DHCPNAK from %sDHCPNAK with no active lease. 㿀 (P ,@9 4@ޱ /P     $!~   p@M@3@2bP ~@2Z 0@P"@ @XP "`kNo valid media types for %s!Trying medium "%s" %dMEDIUMDHCPDISCOVER on %s to %s port %d interval %ld㿈 P' 14$b "@  @ߐ0 6 b 1   P`< " P "`< P < 2 P`" P~!@1  P "@ "< P~`<`@1! P~ <a@֐@L 2 P * P8  b  "8@% P: `8@Ó, $`8 P"f `8@$ P@% P: f @2`@@ꮡ<  $`88 2 P b "8 P "@$84@ "@  "8?#  P2 H2 H P# 1`H`2`0`'!~!@|I P`8`@1  / P #'@#\@" P~$b 8@*No DHCPOFFERS received.Trying recorded lease %sTIMEOUTbound: renewal in %d seconds.bound: immediate renewal.No working leases in persistent database - sleeping. FAIL㿀 P@@1<! P` 2Z P`s P' 1$ I! ! @@2@1 Pa@ ,@ P{`@` P x`@@X@h 2% P P$   " P@!H`@0"@  P{b @0"@0!hӐ@@58 P` "%@ P @ 2@ "@" P` "@ P` "`  P" 2 P ܀ @x "`  P"@0! @a P x`@@@ P "` Pf " @ 1$ycD @J@EXPIREDHCPREQUEST on %s to %s port %dx P! 1 $4"@2 b $  P "` @s0J 2 P< 2 P ,~a@F@ 2 P P`," < P 1 $ @,`@/  P{`@ P x`@@@x @`8 P x`@@w@ P "`?08  b  "8@# P: `8@, $`8 P"f `8@$ P@# P: f @4  `8@< $`8 P`   1 $@ `8 "  "`8 P   1 $ @$?' 1 P   7//    2?0#42H2H2H'! @zp @/쀢?" P .#   P' @#\@   1 P'@#\ @ ՚ 1 P $`8@ADHCPDECLINE on %s to %s port %d㿈# 1``'!  @z0`@/r / P#'@#\@  DHCPRELEASE on %s to %s port %d㿈# 1``'! !@@z `@/L / P#'@#\@  ??c  /  @ $@| P %@w @ Ԑ$@ $@  " @ ?" @  " @ "  P($@ &  $(&  `@ "  P&  @ " @ " @ "  P` @% Ȑ$@ `$@ `"`@ `" @ " @ "  P"%   @ 2" P( , ? @#@ ?, "@ , @"  P& , @" @" @" ښ` P`@#\#`#d   @"p  P"e Pe!+ !,"e P *`@ P *`A P *`B P@k* C P"`D P@ t2`H " P P2 J 2`J P " L P" P P" T P" X P @h \?c  /  $@Ő P %@ @? Ԑ$@ $@  " @ ?" @  " @ "  P($@ &  $(&  @ "  P&  @ " @ " @ "  P  2 Pa ؐ$@ $!`4@  "`@  " @ " @ "  P ``2"%` @ % Ȑ$@ `$@ `"``@ "`@ " @ "    @ 2" P( , ? @#@ ?, "@ , @"  P& , @" @" @" ښ` P`@#\#`#d   @!  P"e Pe!+ !,"e P *`@ P *`A P *`B P* C P`,"`D P2 H P`? `L`@`  P"`L@ " P P2 J 2`J P " P P" T P" X P @ \  / $@ P %@ @ Ԑ$ '  "  ?"   "  " a!$ '`4@   # @ ` "  "  " $ ' `"`` "  "  "  Pf -耢  $ f -'f - "  P& - "  "  "  P`@#\#`#d   @!  P"e Pe!+4 P!,"e P * @ P *A P *B P* C P,"D P2 H P2 J P" L P" P P" T P" X P @ \P /ǒ $@f P %@a @ Ԑ$ '  "  ?"   "  !" a$'Ȳ`4@  # @   "` "` "` P#\`@#`@ #d P"e Pe!+4 P!,"e P* @ P *`A P *`B P@ * C P "D P2 H P2 J P" L P" P P" T P" X P @ \㿘 $ " (@ (  @,  4  8@   , @֐wcan't create %s: %m㿘% . !@g @ْ`X $ @, ` /#Ԁ` /`P " @{  `P`@p @`2`P /#̀``P " @^  `P`@S @`2`P@&lease { bootp; interface "%s"; fixed-address %s; filename "%s"; server-name "%s"; medium "%s"; option %s %s; renew %d %d/%d/%d %02d:%02d:%02d; rebind %d %d/%d/%d %02d:%02d:%02d; expire %d %d/%d/%d %02d:%02d:%02d; } p2 `0! ! `$![$!`0 5 . 2! @0`X & @+v `@!a`02  "@a @aآ!` !@@-X@`(@b`$@b `,   @b8 ,`4 Ő#, `8  @  bH@ה,@'`! . b`l #\#`#@ɿ#d@`  bl #\#`#@ɬ#d@`bl  #\#`#@ə#d#@ɕb@'#script_init: no memory for environment initializationPATH=/usr/bin:/usr/sbin:/bin:/sbinscript_init:n no memory for environment initializationinterfacemediumreason㿘 : d P"f P&@*  P"f P& 2@*!@! Pf"@ P& 2 P@*" Py&a"  PP@ ` P@ Ph@ip_addressnetwork_numberbroadcast_addressfilenameserver_nameno space to %s %sprepend optionappend option%dexpiry P! #h@@,?@c< M @@<8' @x  @sh#@@+oh 3! P #x@b@,@7 2#( @S @OP#@@+P # P c@>@+@( P@ $ P@   P&  V 4M-  "  P O  $0M& `H@  - Ő# #@)c P @ P8& @  Ő#-  #@)ђc P8@ڐ P& @@,  4 8 Ŕ-   @!   P @  @  ` @ P@vREASON=NBIfork: %mwait: %mexecve (%s, ...): %mh`@  P& b   & )!b  Ŕ''''@ '  @̀    (@)  '̔@ 8@)@" "@z Pρscript_set_env: no memory for variablescript_set_env: no memory for variable assignment%s%s=%s㿘@͐ f,  @۔ 2fJ =2f@ "f@WD 2  @j$f $f@(!hf" @@@@ f,"@f 2f@(!f@@@@`Ȗ@6㿘& "&& &@&"&  2&&& "* 2 H-2* _* H*  . ..group master.passwdZpasswd protocolspwd.dbservices"spwd.dbdisktab.shadow disktab fstab resolv.conf  hosts ...wheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root bin:*:7: news:*:8: wsrc:*:9: users:*:10: auth:*:11: games:*:13: staff:*:20:root smmsp:*:25: popa3d:*:26: guest:*:31:root utmp:*:45: www:*:67: network:*:69: named:*:70: proxy:*:71: dialer:*:117: nogroup:*:32766: nobody:*:32767: root::0:0:daemon:0:0:Charlie &:/root:/bin/csh daemon:*:1:1::0:0:The devil himself:/root:/sbin/nologin operator:*:2:5::0:0:System &:/operator:/sbin/nologin bin:*:3:7::0:0:Binaries Commands and Source,,,:/:/sbin/nologin smmsp:*:25:25::0:0:Sendmail Message Submission Program:/nonexistent:/sbin/nologin popa3d:*:26:26::0:0:POP3 server:/var/empty:/sbin/nologin uucp:*:66:1::0:0:UNIX-to-UNIX Copy:/var/spool/uucppublic:/usr/libexec/uucp/uucico www:*:67:67::0:0:HTTP server:/var/www:/sbin/nologin named:*:70:70::0:0:BIND Name Service Daemon:/var/named:/sbin/nologin proxy:*:71:71::0:0:Proxy Services:/nonexistent:/sbin/nologin nobody:*:32767:32767::0:0:Unprivileged user:/nonexistent:/sbin/nologin root:*:0:0:Charlie &:/root:/bin/csh daemon:*:1:1:The devil himself:/root:/sbin/nologin operator:*:2:5:System &:/operator:/sbin/nologin bin:*:3:7:Binaries Commands and Source,,,:/:/sbin/nologin smmsp:*:25:25:Sendmail Message Submission Program:/nonexistent:/sbin/nologin popa3d:*:26:26:POP3 server:/var/empty:/sbin/nologin uucp:*:66:1:UNIX-to-UNIX Copy:/var/spool/uucppublic:/usr/libexec/uucp/uucico www:*:67:67:HTTP server:/var/www:/sbin/nologin named:*:70:70:BIND Name Service Daemon:/var/named:/sbin/nologin proxy:*:71:71:Proxy Services:/nonexistent:/sbin/nologin nobody:*:32767:32767:Unprivileged user:/nonexistent:/sbin/nologin /udp # AFS remote cache manager service # # Unofficial services # supfilesrv 871/tcp # SUP server rsync 873/tcp # rsync server cddb 888/tcp # Audio CD Database supfiledbg 1127/tcp # SUP debugging datametrics 1645/udp sa-msg-port 1646/udp radius 1812/udp # radius authentication radacct 1813/udp # radius accounting webster 2627/tcp # Network dictionary webster 2627/udp mysql 3306/tcp # MySQL canna 5680/tcp # Kana->Kanji server icb 7326/tcp # Internet Citizen's Band hunt 26740/udp # hunt(6) # # Appletalk # rtmp 1/ddp # Routing Table Maintenance Protocol nbp 2/ddp # Name Binding Protocol echo 4/ddp # AppleTalk Echo Protocol zip 6/ddp # Zone Information Protocol # # Internet (IP) protocols # # $OpenBSD: protocols,v 1.12 2000/12/21 14:48:26 reinhard Exp $ # # Updated based on RFC 1340, Assigned Numbers (July 1992). # See also http://www.isi.edu/in-notes/iana/assignments/protocol-numbers # ip 0 IP # internet protocol, pseudo protocol number icmp 1 ICMP # internet control message protocol igmp 2 IGMP # Internet Group Management ggp 3 GGP # gateway-gateway protocol ipencap 4 IP-ENCAP # IP encapsulated in IP (officially ``IP'') st 5 ST # ST datagram mode tcp 6 TCP # transmission control protocol ucl 7 UCL # UCL egp 8 EGP # exterior gateway protocol igp 9 IGP # any private interior gateway bbn-rcc-mon 10 BBN-RCC-MON # BBN RCC Monitoring nvp-ii 11 NVP-II # Network Voice Protocol pup 12 PUP # PARC universal packet protocol argus 13 ARGUS # ARGUS emcon 14 EMCON # EMCON xnet 15 XNET # Cross Net Debugger chaos 16 CHAOS # Chaos udp 17 UDP # user datagram protocol mux 18 MUX # Multiplexing dcn-meas 19 DCN-MEAS # DCN Measurement Subsystems hmp 20 HMP # host monitoring protocol prm 21 PRM # Packet Radio Measurement xns-idp 22 XNS-IDP # Xerox NS IDP trunk-1 23 TRUNK-1 # Trunk-1 trunk-2 24 TRUNK-2 # Trunk-2 leaf-1 25 LEAF-1 # Leaf-1 leaf-2 26 LEAF-2 # Leaf-2 rdp 27 RDP # "reliable datagram" protocol irtp 28 IRTP # Internet Reliable Transaction iso-tp4 29 ISO-TP4 # ISO Transport Protocol class 4 netblt 30 NETBLT # Bulk Data Transfer Protocol mfe-nsp 31 MFE-NSP # MFE Network Services Protocol merit-inp 32 MERIT-INP # MERIT Internodal Protocol sep 33 SEP # Sequential Exchange Protocol 3pc 34 3PC # Third Party Connect Protocol idpr 35 IDPR # Inter-Domain Policy Routing Protocol xtp 36 XTP # Xpress Tranfer Protocol ddp 37 DDP # Datagram Delivery Protocol idpr-cmtp 38 IDPR-CMTP # IDPR Control Message Transport Proto idpr-cmtp 39 IDPR-CMTP # IDPR Control Message Transport il 40 IL # IL Transport Protocol ipv6 41 IPv6 # Internet Protocol version 6 sdrp 42 SDRP # Source Demand Routing Protocol sip-sr 43 SIP-SR # SIP Source Route sip-frag 44 SIP-FRAG # SIP Fragment idrp 45 IDRP # Inter-Domain Routing Protocol rsvp 46 RSVP # Reservation Protocol gre 47 GRE # General Routing Encapsulation mhrp 48 MHRP # Mobile Host Routing Protocol bna 49 BNA # BNA esp 50 IPSEC-ESP # Encap Security Payload ah 51 IPSEC-AH # Authentication Header i-nlsp 52 I-NLSP # Integrated Net Layer Security TUBA swipe 53 SWIPE # IP with Encryption nhrp 54 NHRP # NBMA Next Hop Resolution Protocol mobileip 55 MOBILEIP # MobileIP encapsulation skip 57 SKIP # SKIP ipv6-icmp 58 IPv6-ICMP # ICMP for IPv6 ipv6-nonxt 59 IPv6-NoNxt # No Next Header for IPv6 ipv6-opts 60 IPv6-Opts # Destination Options for IPv6 any 61 any # host internal protocol cftp 62 CFTP # CFTP any 63 any # local network sat-expak 64 SAT-EXPAK # SATNET and Backroom EXPAK kryptolan 65 KRYPTOLAN # Kryptolan rvd 66 RVD # MIT Remote Virtual Disk Protocol ippc 67 IPPC # Internet Pluribus Packet Core any 68 any # distributed file system sat-mon 69 SAT-MON # SATNET Monitoring visa 70 VISA # VISA Protocol ipcv 71 IPCV # Internet Packet Core Utility cpnx 72 CPNX # Computer Protocol Network Executive cphb 73 CPHB # Computer Protocol Heart Beat wsn 74 WSN # Wang Span Network pvp 75 PVP # Packet Video Protocol br-sat-mon 76 BR-SAT-MON # Backroom SATNET Monitoring sun-nd 77 SUN-ND # SUN ND PROTOCOL-Temporary wb-mon 78 WB-MON # WIDEBAND Monitoring wb-expak 79 WB-EXPAK # WIDEBAND EXPAK iso-ip 80 ISO-IP # ISO Internet Protocol vmtp 81 VMTP # Versatile Message Transport secure-vmtp 82 SECURE-VMTP # SECURE-VMTP vines 83 VINES # VINES ttp 84 TTP # TTP nsfnet-igp 85 NSFNET-IGP # NSFNET-IGP dgp 86 DGP # Dissimilar Gateway Protocol tcf 87 TCF # TCF igrp 88 IGRP # IGRP ospf 89 OSPFIGP # Open Shortest Path First IGP sprite-rpc 90 Sprite-RPC # Sprite RPC Protocol larp 91 LARP # Locus Address Resolution Protocol mtp 92 MTP # Multicast Transport Protocol ax.25 93 AX.25 # AX.25 Frames ipip 94 IPIP # Yet Another IP encapsulation micp 95 MICP # Mobile Internetworking Control Pro. scc-sp 96 SCC-SP # Semaphore Communications Sec. Pro. etherip 97 ETHERIP # Ethernet-within-IP Encapsulation encap 98 ENCAP # Yet Another IP encapsulation any 99 any # private encryption scheme gmtp 100 GMTP # GMTP pim 103 PIM # Protocol Independent Multicast ipcomp 108 IPComp # IP Payload Compression Protocol vrrp 112 VRRP # Virtual Router Redundancy Protocol reserved 255 Reserved # # $OpenBSD: services,v 1.35 2001/09/13 01:44:39 millert Exp $ # # Network services, Internet style # # Note that it is presently the policy of IANA to assign a single well-known # port number for both TCP and UDP; hence, most entries here have two entries # even if the protocol doesn't support UDP operations. # Updated from RFC 1340, ``Assigned Numbers'' (July 1992). Not all ports # are included, only the more common ones. # # from: @(#)services 5.8 (Berkeley) 5/9/91 # tcpmux 1/tcp # TCP port service multiplexer echo 7/tcp echo 7/udp discard 9/tcp sink null discard 9/udp sink null systat 11/tcp users daytime 13/tcp daytime 13/udp netstat 15/tcp qotd 17/tcp quote msp 18/tcp # message send protocol msp 18/udp # message send protocol chargen 19/tcp ttytst source chargen 19/udp ttytst source ftp-data 20/tcp # default ftp data port ftp 21/tcp ssh 22/tcp ssh 22/udp telnet 23/tcp # 24 - private smtp 25/tcp mail # 26 - unassigned time 37/tcp timserver time 37/udp timserver rlp 39/udp resource # resource location nameserver 42/tcp name # IEN 116 whois 43/tcp nicname domain 53/tcp nameserver # name-domain server domain 53/udp nameserver mtp 57/tcp # deprecated bootps 67/tcp # BOOTP server bootps 67/udp bootpc 68/tcp # BOOTP client bootpc 68/udp tftp 69/udp gopher 70/tcp # Internet Gopher gopher 70/udp rje 77/tcp netrjs finger 79/tcp www 80/tcp http # WorldWideWeb HTTP www 80/udp # HyperText Transfer Protocol link 87/tcp ttylink kerberos 88/udp kerberos-sec # Kerberos 5 UDP kerberos 88/tcp kerberos-sec # Kerberos 5 TCP supdup 95/tcp # 100 - reserved hostnames 101/tcp hostname # usually from sri-nic iso-tsap 102/tcp tsap # part of ISODE. x400 103/tcp # ISO E-mail x400-snd 104/tcp csnet-ns 105/tcp cso-ns # also used by CSO name server csnet-ns 105/udp cso-ns rtelnet 107/tcp # Remote Telnet rtelnet 107/udp pop2 109/tcp postoffice # POP version 2 pop2 109/udp pop3 110/tcp # POP version 3 pop3 110/udp sunrpc 111/tcp portmap rpcbind sunrpc 111/udp portmap rpcbind auth 113/tcp authentication tap ident sftp 115/tcp uucp-path 117/tcp nntp 119/tcp readnews untp # USENET News Transfer Protocol ntp 123/tcp ntp 123/udp # Network Time Protocol epmap 135/tcp # DCE endpoint resolution epmap 135/udp netbios-ns 137/tcp # NETBIOS Name Service netbios-ns 137/udp netbios-dgm 138/tcp # NETBIOS Datagram Service netbios-dgm 138/udp netbios-ssn 139/tcp # NETBIOS session service netbios-ssn 139/udp imap 143/tcp imap2 # Internet Message Access Proto imap 143/udp imap2 # Internet Message Access Proto bftp 152/tcp # Background File Transfer Proto snmp 161/udp # Simple Net Mgmt Proto snmp-trap 162/udp snmptrap # Traps for SNMP cmip-man 163/tcp # ISO mgmt over IP (CMOT) cmip-man 163/udp cmip-agent 164/tcp cmip-agent 164/udp xdmcp 177/tcp # X Display Mgr. Control Proto xdmcp 177/udp nextstep 178/tcp NeXTStep NextStep # NeXTStep window nextstep 178/udp NeXTStep NextStep # server bgp 179/tcp # Border Gateway Proto. bgp 179/udp prospero 191/tcp # Cliff Neuman's Prospero prospero 191/udp irc 194/tcp # Internet Relay Chat irc 194/udp smux 199/tcp # SNMP Unix Multiplexer smux 199/udp at-rtmp 201/tcp # AppleTalk routing at-rtmp 201/udp at-nbp 202/tcp # AppleTalk name binding at-nbp 202/udp at-echo 204/tcp # AppleTalk echo at-echo 204/udp at-zis 206/tcp # AppleTalk zone information at-zis 206/udp z3950 210/tcp wais # NISO Z39.50 database z3950 210/udp wais ipx 213/tcp # IPX ipx 213/udp imap3 220/tcp # Interactive Mail Access imap3 220/udp # Protocol v3 ulistserv 372/tcp # UNIX Listserv ulistserv 372/udp svrloc 427/tcp # Server Location svrloc 427/udp nnsp 433/tcp usenet # Network News Transfer https 443/tcp # secure http (SSL) kpasswd 464/udp # Kerberos 5 password changing kpasswd 464/tdp # Kerberos 5 password changing photuris 468/tcp # Photuris Key Management photuris 468/udp isakmp 500/udp # ISAKMP key management kshell 544/tcp krcmd # Kerberos remote shell ekshell 545/tcp # Kerberos encrypted shell submission 587/tcp msa # mail message submission submission 587/udp msa # mail message submission # # UNIX specific services # exec 512/tcp biff 512/udp comsat login 513/tcp who 513/udp whod shell 514/tcp cmd # no passwords used syslog 514/udp printer 515/tcp spooler # line printer spooler talk 517/udp ntalk 518/udp route 520/udp router routed # RIP efs 521/tcp # extended file name server timed 525/udp timeserver tempo 526/tcp newdate courier 530/tcp rpc conference 531/tcp chat netnews 532/tcp readnews netwall 533/udp # -for emergency broadcasts uucp 540/tcp uucpd # uucp daemon remotefs 556/tcp rfs_server rfs # Brunhoff remote filesystem kerberos-adm 749/udp # Kerberos 5 kadmin kerberos-adm 749/tcp # Kerberos 5 kadmin kerberos-iv 750/udp kdc # Kerberos authentication--udp kerberos-iv 750/tcp kdc # Kerberos authentication--tcp kerberos_master 751/udp # Kerberos 4 kadmin kerberos_master 751/tcp # Kerberos 4 kadmin krb_prop 754/tcp hprop # Kerberos slave propagation # # From ``Assigned Numbers'': # #> The Registered Ports are not controlled by the IANA and on most systems #> can be used by ordinary user processes or programs executed by ordinary #> users. # #> Ports are used in the TCP [45,106] to name the ends of logical #> connections which carry long term conversations. For the purpose of #> providing services to unknown callers, a service contact port is #> defined. This list specifies the port used by the server process as its #> contact port. While the IANA can not control uses of these ports it #> does register or list uses of these ports as a convienence to the #> community. # socks 1080/tcp # Socks kpop 1109/tcp # Pop with Kerberos ingreslock 1524/tcp ingreslock 1524/udp prospero-np 1525/tcp # Prospero non-privileged prospero-np 1525/udp nfsd 2049/udp nfs # NFS server nfsd 2049/tcp nfs # NFS server eklogin 2105/tcp # Kerberos encrypted rlogin rkinit 2108/tcp # Kerberos remote kinit kf 2110/tcp # forward credentials kx 2111/tcp # X over kerberos kip 2112/tcp # IP over kerberos kauth 2120/tcp # Remote kauth krb524 4444/udp # Kerberos 5->4 iprop 2121/tcp # Kerberos incremental propagation rfe 5002/tcp # Radio Free Ethernet rfe 5002/udp # Actually uses UDP only sip 5060/tcp # SIP sip 5060/udp # SIP # # # Kerberos (Project Athena/MIT) services # Note that these are for Kerberos v4, and are unofficial. Sites running # v5 should comment these out and uncomment the v5 entries above. # kerberos-sec 88/udp # Kerberos secondary port UDP kerberos-sec 88/tcp # Kerberos secondary port TCP klogin 543/tcp # Kerberos authenticated rlogin kshell 544/tcp krcmd # and remote shell ekshell 545/tcp # Kerberos encrypted remote shell -kfall ekshell2 2106/tcp # What U of Colorado @ Boulder uses? kerberos-adm 749/tcp # Kerberos `kadmin' (v5) kerberos-iv 750/udp kdc kerberos # Kerberos authentication--udp kerberos-iv 750/tcp kdc kerberos # Kerberos authentication--tcp kerberos_master 751/udp kerberos-master # Kerberos authentication kerberos_master 751/tcp kerberos-master # Kerberos authentication krb_prop 754/tcp # Kerberos slave propagation krbupdate 760/tcp kreg # BSD Kerberos registration kpop 1109/tcp # Pop with Kerberos eklogin 2105/tcp # Kerberos encrypted rlogin rkinit 2108/tcp # Kerberos remote kinit kx 2111/tcp # X over kerberos kip 2112/tcp # IP over kerberos kauth 2120/tcp # Remote kauth # # AFS Services # afs3-fileserver 7000/udp # AFS fileserver afs3-callback 7001/udp # AFS callback server afs3-prserver 7002/udp # AFS protection server afs3-vlserver 7003/udp # AFS volumelocation server afs3-kaserver 7004/udp # AFS kerberos authentication server afs3-volser 7005/udp # AFS volume server afs3-errors 7006/udp # AFS error server ? afs3-bos 7007/udp # AFS basic over-see server ? afs3-update 7008/udp # AFS server to server update afs3-rmtsys 7009 @ ;Jx   @@;Jx i@@`@@<@`bT U;J``(1A;Jx:i;J X;J XRNC;Jy;Jy;Jy E>;J;3;J;3;J;3 Y{;JbZ;J;J Ax;J;Jw;Jw ٗ(pW;J h;J h;J h ;d{N;J ;JN;JN   ( 0P2-Ea";J;J ;J  =14;;J;JG;JG 8 @ H P XPp~a;J S+;J S+;J&%s!;J X;J X;J&%n a;J沀;J沀;J&%tW5!;Jv;Jv;J&%n(Ma;J;J;J&%-!;JC;JC;J&%nO7a;J>;J>;J&%!;Jp;Jp;J&%nrija;Jt;Jt;J&%d!;J8;J8;J&%n"0'qa;J;J;J&%竼!;J /;J /;J&%nWsna;J+;J+;J2bъ!;J,;J,;J2bnJxa;J/;J/;J2b#[!;J05;J05;J2bnt,%a;J3B;J3B;J2b!;J5 R;J5 R;J2bn@]a;J7n;J7n;J2b;_!;J8ـ;J8ـ;J2bnVa;J;3;J;3;J2b衮!;J1-;J1-;J2bnئAa;J;J;J2by!;JĴ;JĴ;J2bnZba;J;J;J2b~?!;Jр;Jр;J2bnKa;J S+;J S+;J2bFG!;J X;J X;J2bnKa;JI;JI;J2bW!;Jv;Jv;J2bnCa;J;J;J2bE!;Jܓ;Jܓ;J2bnCNa;J>;J>;J2bL0!;Jp;Jp;J2bn>*a;Jk ;Jk ;J2b*X!;J8;J8;J2bn3?a;J;J;J2b!;J U;J U;J2bnkva;J#*;J#*;J2b='!;J$[܀;J$[܀;J2bn,KKa;J'V;J'V;J2b9r!;J(;J(;J2bn=a;J*T;J*T;J2b8 !;J,;J,;J2bn Fa;J9;J9;J !;J;3;J;3;Jn Ka;JbZ;JbZ;J!7Ԅ!;J;J;Jn!ya;J;J;J"A!;J;J;Jn"Na;J !;J !;J#_!;J S+;J S+;Jn#ˋa;J ;J ;J$ !;JI;JI;Jn$Jpa;J;J;J%!;JC;JC;Jn%dJa;JW;JW;J&;!;Jp;Jp;Jn&{}a;Jt;Jt;J'1Yx!;J;J;Jn';a;Je;Je;J(~ !;J /;J /;Jn(ڣza;J";J";J)!;J#F;J#F;Jn)8Sa;J&6;J&6;J*Ne!;J'c;J'c;Jn*6a;J*Q;J*Q;J+!;J,;J,;Jn+a;J.};J.};J,!;J/;J/;Jn,a;J2;J2;J-P!;J3%;J3%;Jn-\݊a;J6=;J6=;J.&KI!;J8C;J8C;Jn.Kta;J:i;J:i;J/Ե`!;J;J;Jn/a;J S+;J S+;J6!;J X;J X;Jz9nTa;JI;JI;JU!;Jv;Jv;Jz9n̺Ba;J;J;JGi'#!;Jܓ;Jܓ;Jz9nda;J>;J>;J:Wr!;Jp;Jp;Jz9n'0 a;Jt;Jt;J5!;J8;J8;Jz9nj`a;J;J;Jԯ~!;J U;J U;Jz9nV Dma;J#*;J#*;J!;J$[܀;J$[܀;Jz9na;J&6;J&6;Jr!;J(;J(;Jz9nJ a;J*T;J*T;Ji匃!;J,;J,;Jz9nKa;J/q;J/q;J7!;J0G;J0G;Jz9nLa;J2;J2;J!;J4s;J4s;Jz9na;J6;J6;J\l!;J8C;J8C;Jz9n~a;J;3;J;3;JW@!;J;J;Jz9n V|a;J;J;Jz9㒸!;JĴ;JĴ;Jz9na;J';J';Jz9~!;J;J;J#*n>sSa;J;J;J#*?o4f!;J4΀;J4΀;J#*n?Aa;J(;J(;J05!;J)';J)';J05na;J,;J,;J05Qk9H!;J-D;J-D;J05nQA-a;J0G;J0G;J05~S4!;J2b;J2b;J05nٚٯa;J4s;J4s;J05t!;J6=;J6=;J05nXa;J8ـ;J8ـ;J05`2!;J9;J9;J05nyAa;J1-;J1-;J05u\!;JbZ;JbZ;J05n+<a;J]J;J]J;J05:T!;Jw;Jw;J05nPa;Jр;Jр;J05Dn!;J ;J ;J05nhma;J ;J ;J05c½!;J沀;J沀;J05nE 1Va;JI ;JI ;J05͡31!;Jz9;Jz9;J05nZa;Ju*;Ju*;J05!;JW;JW;J05n}bYa;JG;JG;J05y!;Jt;Jt;J05nzUa;J4΀;J4΀;J05,K+!;J;J;J05nja;J!`;J!`;J05rS!;J#*;J#*;J05n`I*`" @,0@(  * "@@  *  ~"@ x *  s"@ m *  h"b @ 0``@4`0Z#@& c @2ܐ0R!!@  "K&! @Ĕ!@0@b b  bbbb @4+0+@3b && `@%Ԑ#8@G0@ 0@  0@0@%#X@2@ ;@%#p@2,---------------------------------------+-,,-- -,-h---------+,x---8--D-P---+, ,L---expecting hexadecimal constant.hexadecimal constant too long.string constant too long.expecting string or hexadecimal data㿐@~   @p> .@ @4 ) @`:@[`: 'a@O@"  #@m0 ##@#`@% @1Րexpected option name.%s: expected option name.%s: too many options.expecting semicolon.㿐 @ !!? &  Ő#,  @v? 2 !.@ ! @ ,"ۤ ; 0!@$!(0!@@$@1} expecting interface name (in quotes).expecting left brace.unterminated interface declaration.㿐@!!"P@F P 2& @w P& 2 L@ LŐ ?$ L "`@ { "x@$a@140@$["0@? } Pf @Insufficient memory to record interface %s㿘 /#Ԁ  @ؒ 2   /#̀  @̒ 2 @ `  #@#/  `@ @  /c$"ćno memory for state on %s 㿘@& & P @#  P @”& no memory for config for %s 㿘!@p"0 P"f  P& 2 P!@"  P"0&  @ P& @2no memory for lease. unterminated lease declaration.㿐@ {@#"x@00@;(4 2 @"! @t(4 0 * .`@$ 0'@?a }@u@Ȑ`2`PL0^ ` ` PT"   P `  2 @!  2`  P"` $``P $`P/"  P& 1 $ 6  @    P@#9!0  P " P@"`  P"expecting lease declaration.㿐@U>`:@*`! `0 ;&`0@D!@#"P@/ې0+&`@0ʐ /0$`,@ 0(@0%&`(@0!&`$@3l&`@3h&` @3d&`@’`40@"ِ 8@/@  ;@"ϐ!@@/989d9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9$9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t8949D9T9t9t89t9t9t9t9expecting identifier after option keyword.no memory for vendor information.expecting identifier after '.'no vendor named %s.no option named %sno option named %s for vendor %sexpecting string.option data buffer %soverflowexpecting number.expecting identifier.trueonfalseoffexpecting boolean.Bad format %c in parse_option_param.out of memory allocating option data.pԐ@O   !!? @" " ;"J @.ِF @ @  @!"@ @a@L .' /@@ !!?2  1@!ؐ# ;" @.  0@9 2  # #'  @,Ԥ  Ԁ@2#8ؒ#P@!0@`* : `2!*` $@"Y@В!@Ԕ  $Ԑ;@ @/Q؀ ؒܠ $@ې;{@!" @!n# ;" @.> Ԕ @0  @!Ԕ @0Ֆ є @!Ԕ @0Ŗ  @s !!? @!/#Ѐ ;"p @-l @rc耢 @rc  /@rc @r` /@!  ۀ ; L@@ Q 0"`L@` @`AK?@+L@`A ," ;@ #p0 @ #x0c#@ @- @` *`@ "` * @  2 @ߐ H * @ @# * &@?@@@@@@>@@?@@@@@@?h@@@@>T@@@@@@@@@?@@@?@@@@@?@@@@@@?h>tExpecting media options.parse tmpno memory for string list entry.㿐@   2 @ b"@-504 ,* ;@!2@]b@  @]"@O @$$&@@mؤ ;@ .!@@-expecting IP address.no memory for reject list!x@- @  @@,0@  2@ X @d b,@ &@ $@2 , ;@!@@,ƐNo memory for %s.㿘@  !(@1dfree %s: free on null pointer.㿘 @!p0@{㿘ݐ(8㿘א%㿘ѐ 㿘 ˒  & unable to allocate tree cache for %s.㿘 .c  "c  "0@㿘.  "㿘 㿘. * * 㿘 㿘 P㿘~ 㿘x 㿘r$`㿘l 㿘 1, ",^$ܰ㿘W 㿘Q 㿘`㿘Z㿘$ Q 1`,&"`,㿘G㿘A㿘;㿘5㿘/㿘)㿘#㿘 ." 㿘㿘 㿘㿘Can't create addrlist socketrealloc: %mioctl: SIOCGIFCONF: %mCan't get interface flags for %s: %mdiscover_interfacesInsufficient memory to %s %srecord interfaceno space to remember ifp.Multiple %s %s: %s %sinterfaces match thesame subnetInterface %s matches %smultiple shared networkssame shared network%s: not foundNo subnet declaration for %s (%s).Please write a subnet declaration in your %sdhcpd.conf file for thenetwork segment to which interface %s %sis attached.(  @  "@P!" '@ 0@D!0a$'@o?@8!$@ (,` /#Ԁ         ɀ  `   В @j0a@< !@@ 2! / ! /#Ԁ`` @ 2@`2 b `  ` "(bH@ޔ` @4 #$`L$@$`X$`\$`T$#     ,` ,` ` @ @`ig@  @]`H 2   @! @"`@$`H$` 'Đ@  @@͐ 7  $  @Ҕ  ` "b @` `    "@`  $`  $  "b @` = u' /Ԁ`^ `L @ 2`H ?$`L`H``L 2``L #@9` 2@$$ /c$@6"c̐@t `   Đ@g<'` c @Scx@N#H#@ `      2  $ $   2 @ (@  2`L /#Ԁ` `0` @L@`2`0@@&Insufficient memory to record fallback interface.fallbackparse_statementNo memory for shared subnetfallback-net㿘b `1 . &#@!# @c `#a @ ,"# "`@"#  @N # "8"`㿘 /#Ԁ   .@ ܐ@ ؐ  .#  @   "a$Can't allocate poll structures.No live interfaces to poll on - exiting.poll: %m㿘 1    @Ǒ,  1@N#` 1  1 $ @ 4 1 "@  a $"a  "@ @4*`" *  * ?) 1    "L   \ 2   "@2`2`` 2 @ #@h? 1 ( x # 2 1@' $ 1@# 1@  $  `  "L` 4`  `\`2 € !$   ` "!$receive_packet failed on %s: %sInterface %s appears to no longer be valid@!? #А@ $` ( x!@C" @ې X`@@& X   T ' X #@Ȑ"  & \ "!$) 1!  '@Ȕ # @!ioctl(SIOCGIFFLAGS) on %s: %mioctl(SIOCGIFMEDIA) on %s: %mP 0   @  @0a@}  c@r7 4 A A20  T 2,   (@ @0 a6@]  ( x  c@r & T` ̐  `   h`  '`' @K@8 "& 0  ( & 0 0@ Can't allocate timeout structure!㿘 1`   "  2 2"`  1 a  "a "@-  2$ @!x$ $  1`$ `  $""  4$  2"$ 1 " 2  2  "  " can't allocate protocol struct for %s㿘@ݐ   1#`@c 1 $ " $ $ $㿘# 1`  "$` @ new_hash㿘`( a   @!0 㿘  :  :2 @padd_hashCan't add %s to hash table.㿘 2@Вc ؖ 2" @10" ,  @ """@ delete_hash_entry㿘 6 2@Ӑ*   &    @Y  2 @Z 2 $&a0 2 㿘 ! 2@또l*  @ "  2  @) "  2  㿘   &% 0 7$0ɒ  0  _ "  @ 2@$@ !T &@ !% 4 2  $4aT`@  `@ 2@ $@ !T`4-@㿘 !0㿘 !4h`1 ` ")@@L "$@` '`@ @Y@Ȥ @S@h @J  %`  @`2` No shared network for network %s (%s)Address range %s to %s, netmask %s spans %s!multiple subnetsAddress range %s to %s not on net %s/%s!new_address_rangeNo memory for address range %s-%s.No hostname for %sno memory for hostname %s.'L'D 'P$ @@ @L!8 !@ې@@! !8  C$!8 a< ! ; "<!@ 23$!@D @鸐L8 @鱐#@@ @馐h @顐P @霐#@@@0 2,DД @鋐@< @ @逐@1 @ @u@& @~!@!ؒ @cL  $@]@ 22DД @R@ @[ @G@ @P @<@ @E! !@0@@ݘ @$ @ @D @ @@ @  @@&'D` 2,DД @@ @ @@ @"8@,**@?   "'  @6a-  @Ɛ @#@@@@跔 L$ 0P$ ($ ,$ l $ p $ $ L L'H`L !H @   HL@al'L@"` @<@ @涐 $ `@@<"x@@ ` $ $'  2"  <  D``@ - D V h  @cL8 @\P#@@X @Q @M@̐ @EL $@@@ڒ " 4`%@%D$* @*`@ `*` &"`` d "`d@Q   hP !("# Ȓ @ 8@#@@$ @@ "Ȱ P  "" Ȓ @  8@ې#@@ $ @А@j   Ȱ %ssubnet %s/%d conflicts with subnet %s/%dWarning: PȬ $ @笐`8 @秐#@@`$ @盐@5 2 < @瑐 8 @獐#@@ @烐@ E <      =  "  : " `<`   < " @ : " @W@@` !# #`c@G@ #@@-#@  㿘% (  |  `"$($@ & (&$( ," ,enter_leaseNo memory for lease %s 㿀  @@ 2 `(" !"  @@@@  aD$`$@ "aD$`` d$`d@ Lease conflict at %scorrupt lease uid.㿀`    2; 4 1 $ , $5 4 4" 4`4`"  4 8`82@ 2 4 2 4 t?`t @ 2  u v@`v " 4!  "@敐@F@ݰ  @c 4 @@ @ѐ & <& 8& 4 t ? t`t @  v u@`v " t@  " `(& (`4`"& 4`8 @@[ & 4& <`@@& 4`<& <&`4&`<@#`8& <`8 t& 8`h`t& h@@ `  ?@& `4 `@`"  `t " @& `" p"@"``" p "` p`2 p "` p` `2,"` pB" `, $`" , `, 4 , $" p& &("  & "&!"` 6 , `",, & ,`,@6" p&& "  &" & " p" `,  & , @ Released lease for IP address %s`@塔  1 $ 'Ȕ H! # @吐@A@Abandoning IP address %s for %d seconds: %s l` L   &  @q 1 $H'!   H@f@@O//'' 㿘  Z!<㿘 !8R㿘 !@J㿘 4 8   !8 4 80` 2`"`㿘 4 8 !  8!8 4  4!88 & ` 2` "`& 㿘 v u   !@ u0` 2` "` 㿘 v u # a@ u ` `ua@`v & ` 2`  "` & add_class㿘#@@j@ % H ! *$H!L `#$!L` H !L  &@H&  @ &!L@>70 H@5.㿘  !L !H%s: can't allocate new group㿘  @@]$`Can't rewrite lease databaseCan't commit leases to new database: %m㿘 !,`"` "@ u   8  " d 2@ߐ! 2 u@`2`R @А! Subnets: Subnet %s netmask %sShared networks: %s Last Lease:㿀@" !(`" `$@@@0`8 @@@&"(@`2@"8 !,``@"P` " `@q ` "@@"X@d`@`%02x㿘 "` 1   1@!P@  $1 @K@H :,`"@ ,? !P1 !Pc@㋔  Lease %s%Y/%m/%d %H:%M:%S start %s end %s stamp %s hardware addr = %s host %s `!   H@V@@@t  (#ؖ`X @kT@ p@s , @kI@| @s 0 @k>@q  u! t vs @h h` ` @] packet length %dop = %d htype = %d hlen = %d hops = %dxid = %x secs = %d flags = %xciaddr = %syiaddr = %ssiaddr = %sgiaddr = %schaddr = %02.2x:%02.2x:%02.2x:%02.2x:%02.2x:%02.2xfilename = %sserver_name = %s %s = %s㿈 @ " ` @"( `@ ``` "X@`` '!"x@[@`!'"@[@`!'"@[v@`!'"@[m@ې ` `" ` ` `! `@#\`l@͐"#@ɒ`,  ,` 8 Ő#,`  4   @ #@``,`@#(%03x: %02xH  P */ @i@$@  *@ @$@ڠ@Ghash bucket %d:㿘 % !,  !@0 " ` @"  2 ,/dev/bpf%dNo bpf devices.%s%s%s Please read the README section for your operating system.Can't find free bpf: %mCan't attach interface %s to bpf device %s: %m`  2@& @  ( x ` "b@]@Z#` Hbl@ℐ # @LSending on BPF/%s/%s%s%s/㿘 /# 0 & 4    Ǡ   8 @ @@ Can't get BPF version: %mKernel BPF version out of range - recompile dhcpd!Can't set immediate mode on bpf device: %mCan't get bpf buffer length: %mCan't allocate %d bytes for bpf input buffer.Can't install packet filter program: %mListening on BPF/%s/%s%s%s㿀 'T& 0bq@ 6@Ð   2 0@  0 bp@䀢 6 0@!( 0bf@ٔ < @!X@ < & 8@!x .#Ŕ8& @& D""D 0 ''bg@ἔ耢 6 /@! /# !      8 @ @@̔ fallbacksend_packet: %mx\c'@  '#\@@``#\@~#`' 4 '''@,谒 @e#㿀  @ D@2  D 0 8@O < W$ @$ D D @"@  8@ @X  @ D <$ @*`2 $ @37 $ @ 8@ 6 @ @%   8" $ @  '@  @  $ @"  ' 8@@  @$ @ $ @ " @   㿘  @ .#4#Cpattempted to reinitialize icmp protocolicmpunable to create icmp socket: %mUnable to disable SO_DONTROUTE on ICMP socket: %m㿐# a  @ ""$a@͐ 2  @  !  $!@ l"!?c' @[  @ ^"!,attempt to use ICMP protocol before initialization.icmp_echorequest %s: %m` ! 2 @ 8#    ///'77/77Β  @C@^7 !  @f  6  !'Ġ @X0Ē@ J `?icmp_echoreply: %mp  'Ԓ%ܖ @@|Ԁ  /@ .!0?쀢`'  '' @+ԐcSc㿘  4@߈( a@f  " &  `@d !؀  `l@T ! `,@K @option %s (%d) %s.larger than bufferMany bogus options seen in offers.Taking this offer in spite of bogusoptions - hope for the best!rejecting bogus offer.parse_option_bufferCan't allocate storage for option %s.Can't expand storage for option %s.㿘@u@`o`@'@`@ ',!"#, $""@ {""  & $"@ o"@ l"@ i# 0M@ f#@J&  8  4cX"  Ő#, @ #p@]. 4#"@cX   2 Ő#, @ #@D@@@?@$@.%@@ ` @ ` & ``d "` ! @} * 2 \ !* @8Ȑ 5*@  6*@   3*@   8 *@ !` `! !,8!(@ `  !,8!(@  ! c@ې  ?"Т@ y 2`@Ȁ#\#\#`@e!ؒ &`@ݷ` T` *@  N`z 4 * * **?"А`@@ݛ  ' @`l@@ݎ . . $. @`l@z ?bА@' @m`,?`l *@ * ?`l㻘\'H'P @$ i P ,`"_` 2[` %@( S`` Ő# , J t ` A  `<`    '@ 4% H ޖ-* ,@@@@* ,@@@  @@Ȧ`@Ppretty_print_option: bad code %d %s: Excess information in format string: %s %s: garbage in format string: %s %s: expecting at least %d bytes; got %d%s: %d extra bytes%s: %d extra bytes at end of array \%03o%ld%d%xtruefalseUnexpected format code %cdhcp option too largep;  ? a' "@ 9  ,Őc .    a@jŐ .   @+ @?* : `3=#*` +;  @N@ @ @ N@ @ ✐J  2`@ x t+?+` : @*?ِ t+`+?` ` `` @ # @ Őc .  `J @Ő#.  #H@ 1c` @ @ "쀥@@ Ő#.  &@ #x@ @Ő#.  !#@&@ Ȓ&  @a @ʐ` ?* : `6*`"  5 "- 1  " @J  `"@@"@   `'`$```\2 - \-  -  @*L "i- "- c-@ ѐ'@TKԒ@!#@ ̐!#@ @˒k$D!#@ ː* : !#@ * 2 @U$.LȐ@ Ȑ@ А@ ##@3,$0J@ #@Ő@$`@  : -  @<ؐ`- @+ a@ 1#pht HhDiscarding packet with invalid hlen.do_packet`` @ X06 (8@Ր'''В@c '?'̀  " 'Ȁ ސ Ӌ ,    "  `  , consno memory for cons.㿘a  2&@ڐ!&& tree_cache㿘!耢 " " "" " " tree_host_lookupNo memory for host lookup tree node.㿘ݐ"0 2 @"H &@& enter_dns_hostCan't allocate space for new host.㿘" 萒 " @舐  $@"@n$ $ $ $ tree_constNo memory for constant data tree node.㿘#`蒐 ` & @X#p & @ٝ& tree_concatNo memory to concatenate constants.No memory for data tree concatenation node.㿘 `?2@; ,@ 2(```  2`@ `@_```@Z``#` $``` $`, 2 @ 8 && & tree_limit㿘  4$  !x  && &  tree_evaluate㿈 ' ''0 @3$ 쀢$   ! 紒 '  '@' "綒 $$ $ Bad node id in tree: %d.㿘 "  0/ !0*!@A@1̐&@"1#%s: host unknown.%s: temporary name server failure%s: name server failed%s: no A record associated with addressdo_host_lookup㿘) 1 $@t@ 2* ( | "    $  $@@  $@;   $@5 @ $@0 X $J < @ "  `,`@ 2` @W @ ݒ 2    $ <(& "&&&   @7,`@ @` @&@ $n&&@㿘" $@@ &㿘 % % 5 /7 % % /3 1 /9 )&&D&` ""H"c**' x㿘 ? & @h  & %bX 2)"bX`  / %!@  %! 1"` " %H %  "H#"D* %DQ D /c*?cD*@D "D 㿘4:  "    / -  / /"#"c@0F"     / /"#"c@06 % / / %"#"c"\*ᐐ++  %"H %"D   /#܀  #  #"    % # "@\ %2.  / /"#"c@m㿘 %bT %"P /#쀢  /# /"# %"L## /"#  #bT /c /"c؀  %"\$㿘) %"T  % /' /# %$bP! %$"Lk%"TbP  1  /"#$"L$bP$$"L  %"\&"T㿘? eof in string constantstring constant larger than internal buffer㿘  "`* %%`@O#% %"`* `\`"  %%2 %@:#0% %"` %"b\*!numeric token larger than internal buffer㿘# %,b`   x  "   D  b`@n  % "bXb`* %%2 %@ % %"` %"b\*!token larger than internal buffer㿘! %,"`! z-_"    @2  % "bX"   D "! "`* %%2 %@!(% %"`* %"b\@lways-reply-rfc1048ppendllowliasbandoneduthoritativeackoff-cutoffootpootingoot-unknown-clientslassiaddrlient-identifierlient-hostnameomainenyefault-lease-timeynamic-bootp-lease-cutoff-lease-lengththernetndsxpireilenameixed-addressddiroupet-lease-hostnamesostardwareostnamenitial-intervalnterfaceeaseax-lease-timeediaumameserveretmaskext-serverotptionne-lease-per-clientrependacketangeequestequireetryenewebindebootejectearchtartsubnethared-networkerver-nameerver-identifierelect-timeoutendcriptupersedeimestampimeoutoken-ringser-class-host-decl-names-lease-addr-for-default-routeidnknown-clientsendor-class㿘N  (*  ?* : ` *`  b@@U# !ObX@U !Fb`@U !6bh@U  !=bp@U y!?@Tb sq!M b@T g!@b@T _!7b@T W!9@Tْb  O!" b@Tϐ E!b@Tǐ =!b@T 5!*@Tb /-!I c@T #!Cc@T !8c@T  N  !: @Tc !c(@T 2N  !c8@Tz ! @TrcH !! cX@Th ް!c`@T` ְ! @TXch аΰ!4 cp@TN İ!cx@TF !@T>c !K b@T4 !c@T, !%@T$c !' c@T !c@T !@T c !H c@T v!A@Sc؀ pn!1 @Sc耢 ge! c@S [!`@S  2T `@SԐ J!;@S̒` DB!< `@S 8!B`(@S 0!`0@S (!#@S`@ " !N `H@S !@S`P !& `h@S !G@S`p ! `x@S| !`@St !+`@Sl !,`@Sd ڰ!.`@S\ Ұ!2`@ST ʰ!3`@SL °!>@SD` !J `@S: !D`@S2 ! b@S* !`@S" !`@S !`@S !`@S  !a@S x!/a@R p!)a @R h!0@Ra( b`!E a8@R V! aH@Rؐ N!-@RВaP HF!$ a`@R   ah@R 3!ap@R +!(@Ra %#!La@R ! @Ra !5 @Ra   ! @RbЀ ! p tD,t,` exiting.exiting. 㿘! ( @'H'L'P'T'X@$ ' @H$@gj .#Ē@Wݐ ! "@ِ@ a @  @Wɒa  ! a(@|@@ 㿘! ( @'H'L'P'T'X@u$ ' @H$@g/ .#Ē@W   @Ҟ@ߐ a @ڔ  㿘! ( @'H'L'P'T'X@K$ ' @H$@g .#Ē@Wx   @t@ȵ a @Ȱ  㿘! ( @'H'L'P'T'X@!$ ' @H$@fې .#Ē@WN   @J@ȋ a @Ȇ  %s㿘 ( x %`N m`@lؐ@ &@(. *` 2: .%s line %d: %s%s^^ 㿘 ' @'H'L'P'T'Xƒ$ /## /! (c @$@H$@fv! .#Ē@V #1 /#@V c쀢 P  /c#Ĕ"  @V֒` & )@Ґ@ #a @  #@Ő@  @  /#Œb@ `ؐ @  ) "`x 㿀@'@@@ 0 ' `  @ *  @ߔ  x@'ؒ@Ք  ?` ؐ8 @  '@м 0<     *  * ۘ?@Ч  㿀@@@'@Й 0 6  `  @ 2@*   '@Ђ  x ' `  @ *@*  ܒ @h ܁㿘@2  @``?㿐   ) @ a'@I  ) @@xK 1 ) @a@xD 1 ) @     @ ?8" *@  ? @ (8"?(㿘@x<*@ * @`@'   \7///''777  7@ @   & .#*`77ܕ277ސ  7ސ@ @  &㿘@y%d bad IP checksums seen in %d packetsip length %d disagrees with bytes received %d.%d udp packets in %d too long - droppedaccepting packet with data after udp payload.%d bad udp checksums in %d packets㿘@@5 )` `* &` B]  3 )`d`  h&`d@… 4h?`d#t&`d[&` @# %&5 )p``  &p1 ) t ?& t@\ 4?? t#Kp&p2& t"`m ` ` 6` ! ) h $ h 1 ) l & l@+ 4? l P h& l$ h?@ 6Can't create dhcp socket: %mCan't set SO_REUSEADDR option on dhcp socket: %mCan't set SO_REUSEPORT option on dhcp socket: %mCan't set SO_BROADCAST option on dhcp socket: %mCan't bind to dhcp address: %mCan't bypass auth IPsec on dhcp socket: %mCan't bypass ESP transport on dhcp socket: %mCan't bypass ESP network on dhcp socket: %m㿀 .#   ?/7'  @oٔ  :" #?'c @o'  6'*"'c"@o  c"c @o  6# @n  6'#X'  @n ?  ( x -#x  @n ?  ( x -#  @nט ? ( x -א#؁Sending on Socket/%s%s%s/㿘{ /c`& 4 !耢 """ send_fallback: %msend_fallback: please consult README file %sregarding broadcast address.㿘 4 @U0 ? " ( x 3"bЁfallback_discard: %mx   4&'ܒ @.܀ #X㿐@ͧ 㿐@͟  g( 3f+gf# g( 3f+gSf#㿐'@̀ 㿐'@x 3f g2`* *#3f g2`* *#㿈  @[   @   @O  @͵ (7@@C  &㿈@@9 @5   .. eoption-endoption-254option-253option-252option-251option-250option-249option-248option-247option-246option-245option-244option-243option-242option-241option-240option-239option-238option-237option-236option-235option-234option-233option-232option-231option-230option-229option-228option-227option-226option-225option-224option-223option-222option-221option-220option-219option-218option-217option-216option-215option-214option-213option-212option-211option-210option-209option-208option-207option-206option-205option-204option-203option-202option-201option-200option-199option-198option-197option-196option-195option-194option-193option-192option-191option-190option-189option-188option-187option-186option-185option-184option-183option-182option-181option-180option-179option-178option-177option-176option-175option-174option-173option-172option-171option-170option-169option-168option-167option-166option-165option-164option-163option-162option-161option-160option-159option-158option-157option-156option-155option-154option-153option-152option-151option-150option-149option-148option-147option-146option-145option-144option-143option-142option-141option-140option-139option-138option-137option-136option-135option-134option-133option-132option-131option-130option-129option-128option-127option-126option-125option-124option-123option-122option-121option-120option-119option-118option-117option-116option-115option-114option-113option-112option-111option-110option-109option-108option-107option-106option-105option-104option-103option-102option-101option-100option-99option-98option-97option-96option-95option-94option-93option-92option-91option-90option-89option-88nds-contextnds-tree-namends-serversoption-84option-83option-82option-81option-80option-79option-78user-classstreettalk-directory-assistance-serverstreettalk-serverirc-serverfinger-serverwww-servernntp-serverpop-serversmtp-servermobile-ip-home-agentbootfile-nametftp-server-namenisplus-serversnisplus-domainoption-63option-62dhcp-client-identifierdhcp-class-identifierdhcp-rebinding-timedhcp-renewal-timedhcp-max-message-sizedhcp-messageBAdhcp-parameter-request-listdhcp-server-identifierdhcp-message-typedhcp-option-overloaddhcp-lease-timedhcp-requested-addressx-display-managerfont-serversnetbios-scopenetbios-node-typenetbios-dd-servernetbios-name-serversvendor-encapsulated-optionsntp-serversnis-serversnis-domaintcp-keepalive-garbagetcp-keepalive-intervaldefault-tcp-ttlieee802-3-encapsulationarp-cache-timeouttrailer-encapsulationstatic-routesrouter-solicitation-addressrouter-discoverymask-supplierperform-mask-discoverybroadcast-addressall-subnets-localinterface-mtuSApath-mtu-plateau-tableLpath-mtu-aging-timeoutBdefault-ip-ttlmax-dgram-reassemblyIIApolicy-filternon-local-source-routingfip-forwardingextensions-pathroot-pathswap-serverdomain-nametmerit-dumpSboot-sizeXhost-nameresource-location-serversimpress-serverslpr-serverscookie-serverslog-serversdomain-name-serversien116-name-serverstime-serversIAroutersltime-offsetIsubnet-maskpadunknown-255unknown-254unknown-253unknown-252unknown-251unknown-250unknown-249unknown-248unknown-247unknown-246unknown-245unknown-244unknown-243unknown-242unknown-241unknown-240unknown-239unknown-238unknown-237unknown-236unknown-235unknown-234unknown-233unknown-232unknown-231unknown-230unknown-229unknown-228unknown-227unknown-226unknown-225unknown-224unknown-223unknown-222unknown-221unknown-220unknown-219unknown-218unknown-217unknown-216unknown-215unknown-214unknown-213unknown-212unknown-211unknown-210unknown-209unknown-208unknown-207unknown-206unknown-205unknown-204unknown-203unknown-202unknown-201unknown-200unknown-199unknown-198unknown-197unknown-196unknown-195unknown-194unknown-193unknown-192unknown-191unknown-190unknown-189unknown-188unknown-187unknown-186unknown-185unknown-184unknown-183unknown-182unknown-181unknown-180unknown-179unknown-178unknown-177unknown-176unknown-175unknown-174unknown-173unknown-172unknown-171unknown-170unknown-169unknown-168unknown-167unknown-166unknown-165unknown-164unknown-163unknown-162unknown-161unknown-160unknown-159unknown-158unknown-157unknown-156unknown-155unknown-154unknown-153unknown-152unknown-151unknown-150unknown-149unknown-148unknown-147unknown-146unknown-145unknown-144unknown-143unknown-142unknown-141unknown-140unknown-139unknown-138unknown-137unknown-136unknown-135unknown-134unknown-133unknown-132unknown-131unknown-130unknown-129unknown-128unknown-127unknown-126unknown-125unknown-124unknown-123unknown-122unknown-121unknown-120unknown-119unknown-118unknown-117unknown-116unknown-115unknown-114unknown-113unknown-112unknown-111unknown-110unknown-109unknown-108unknown-107unknown-106unknown-105unknown-104unknown-103unknown-102unknown-101unknown-100unknown-99unknown-98unknown-97unknown-96unknown-95unknown-94unknown-93unknown-92unknown-91unknown-90unknown-89unknown-88unknown-87unknown-86unknown-85unknown-84unknown-83unknown-82unknown-81unknown-80unknown-79unknown-78unknown-77unknown-76unknown-75unknown-74unknown-73unknown-72unknown-71unknown-70unknown-69unknown-68unknown-67unknown-66unknown-65unknown-64unknown-63unknown-62unknown-61unknown-60unknown-59unknown-58unknown-57unknown-56unknown-55unknown-54unknown-53unknown-52unknown-51unknown-50unknown-49unknown-48unknown-47unknown-46unknown-45unknown-44unknown-43unknown-42unknown-41unknown-40unknown-39unknown-38unknown-37unknown-36unknown-35unknown-34unknown-33unknown-32unknown-31unknown-30unknown-29unknown-28unknown-27unknown-26unknown-25unknown-24unknown-23unknown-22unknown-21unknown-20unknown-19unknown-18unknown-17unknown-16unknown-15unknown-14unknown-13unknown-12unknown-11unknown-10unknown-9fddiunknown-7token-ringunknown-5unknown-4unknown-3unknown-2ethernetunknown-0dhcpCan't allocate dhcp option hash table.㿘#`% /%$ "`^#h ř, c , `" @  `D   1 a" 0 09 㿐 텒 } {`V0 ; ` ` D0@?ޠsemicolon expected.㿐1 ;  Ɛ filename must be a stringno memory for string %s.㿐! Ӑ!0 @@T  ڐ!P @̐ @l, 2expecting an identifier in hostnamecan't allocate temp space for hostname.can't allocate space for hostname.㿐  ǒ !!? ! "TH @ć@  "8`@{ @kې隐@q@쿒 .쓒 ."Ȧ@ 2g"`,@@U$@@å@@@ .,@ 2㿘 &@` . @ @ expecting a network hardware typehardware address too longexpecting semicolon.㿐A!$" !K!0 0   .@ .@ .@ Hǐ01'  : @|  & ( `@ݐ p` `.`@7` `" @@Ù @{ ;Ð Expecting numeric lease time㿐!!0 @) can't allocate space for numeric aggregatetoo few numbers.unexpected end of fileexpecting numeric value.no temp space for number.can't allocate space for numeric aggregate.㿐  `  "@ & @:   l"` Q"b !릒 R } {"p5" ;"q m c`?Ӏ! ! "W  @``: @@  "@  @ji(  )@s & @n:  @#@``: "@&@T`&`:`@z$ @x2Bogus number: %s.Bogus number: %s: digit %d not in base %d value %s%o exceeds max (%d) for precision.-value %s%x exceeds max (%d) for precision.value %s%u exceeds max (%d) for precision.Unexpected integer size: %d 㿘L@ -  `2(L@L@ 02# L` x ` ` "@   `!朗"! L@ `` ? @ /??Ѐ@ŒL@` *  *@ & "( "h"X"` c ""X"` W "  "Ȑ %. 0!Ғ 0;0, "  " .ē2`00!numeric day of week expected.numeric year expected.expected slash seperating year from month.numeric month expected.expected slash seperating month from day.numeric day of month expected.numeric hour expected.expected colon seperating hour from minute.numeric minute expected.`Đ鲒! u! ;" E  @>'韒! b!Ѐ ;" 2 @>Ā'l'ܐ8'ܐ鈒 / K!耤 ;"  x! ;" ;"԰  а @>Đ?'ؐd / '"0 ;"  T! "` ;"  @>g'ԐA! " ;" Ԑ @>T'А. : " ;"  ! "Ȁ ;"z v @>1'̐  : ΐ" ;"g c ! "Ȁ ;"W S @>'Ȑ'' ; }B ܐ* @*`@*`@,ؑ: `  `?Ԁ`Ȓ˓*`    ?* @*`@ *`" * * "@*`@ @ *` *  * "@*`@*`" * 㿘@             @  x p h `softdepforcereloadupdatesyncasyncunionrdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotao:ffsmount table fullspecified device does not match mounted devicefilesystem not supported by kernel%s on %s: %s @}' (  &" "b' % #-è / ( ox@e@O@za? ?b* & @ @@@?'`' ''@  x "  -  (0  (0  !!0!`@Z2`xØa@ @ usage: mount_ffs [-o options] special node 㿘Òc@) @ ,-o %s: option not supported㿘@g  @ 1'À n L  o  @d" = 2*`"@> 2   @2    &*@&ch@  @` 2L@Ɛ㿘@Qhaltdlnpq%sreboot???halted (with powerdown) by %shalted by %srebooted by %s~shutdownSIGTSTP init/etc/rc/dev/consolerevokesetsidopen/bin/shshSIGTERM processesWARNING: some process(es) wouldn't die(can't restart init): h'D@|'H 8J`-" @oV`         %!95;71 (3Ā 2* `@€a   ` @  @!D @JH??@  `!Ġ @Y+ @ސ  @>Ē`@ +@  @@ Đ` @Dڔ " Ē!@CT  Đ В @Dʔ "a@CJ Ħa(Đa @ɟ8 @Ŷ @ ?2 Ēa@@Ȑ @  @ Ĥ!P@Q ?J?@#?D @ Ġ!X@?@ِ!h@?2@ѐ!p@ ?2 @ǐ!x @f @c@`  $@Ȓ@) ̔`'̒ @̐ Ė !a@P@2 @ ?@9 ?  x @a" @ @D@  @,  ?@ ?  x  0@a@z @  ?8Ē!@  usage: %s [-dlnpq] 㿘 8c0@% @ 㿘@ cannot seek temp fileout of memorycannot read temp file㿘 2  1{ " " 1  "a  @"   1="X @@t 6 @` S#'  >%#c\   $c\" @ؐ 2c\@_ @ #c\? $c\!#h  @L #h 3 @ / $?$ $c\!#h  @7 #h  1@j  1"X  @ӡ  "@_ǐ Ő#@ Ұ 0 >  B ="+ line too longcannot write temp file㿘@<  @_ 7#N 2 #&@+!+ 1a ' 1X @?  6X@_ #@! 1: <"%aX @  ! 1?? 1:"@_n Ɛ!@ y 0 "<@ $" <`B<" 㿘! 1@5"  1&"`" "& `"$" invalid address㿘 2 @  @ @  @@@ @@ 6#?㿘c\"  )"c\ 1b :  2A!˖"`"@#"7c\ " /#"" "@#"%c\:!˖" "@#"c\ 2ː  "b  #"  `@""c\? #c\1#h  @" #h "@U "/tmp/ed.XXXXXXXXXXw+cannot open temp file㿘ˠ"  1 1"!"ǒaД @c@? @|a 1 "bX?@@^@ !? cannot close temp file㿘1 1"X " 1@~  @^r" @ ~" ?&"X@Ő"  1 1  :""a 㿘 1"X @~@" @㿘 1a̐ H@|   2  2  1" "`*  $*˄"4 1"4((  #"4    * 㿘 2ː"b"** * * * * * * @c[ @&  1"0@2 ,@  㿘#!b"@ 2 @*$b$"" b 2 `$b?㿘#b ! 2 @ $"$b"  b 2 *@`$b ?㿘#b  ! 2  @$"$b"  b 2 @z  ?Enter key: 㿐@"N  @  @p@2  ? 㿘  (@UJ`x@ ?Ѐ6QȄ(K I `F?D `A?? `<?: `7?5 `2?0 `-?+ `(?& ` #?! ` ? ` ? ` ? ` ?  ` ? `? ?"""""# # #4#H#\########p################################p#####bad hex digit in keybad binary digit in key㾘N@ 0{N` x X24N@` @`' 1%ɑ*` R: , ?$@ BР N@ @ *`  `,   "@` *  ` .  A  0@N` b B2:` @`' 1%ɑ*` : , ?$@  N@ @ *` ? `,   ?"@` ,     *` . ,  $,@8Ȕ des_setkey㿘 1",`ˆ"x     ` 2``$  . `$ @_ #des_cipher㿘`0 ! 2    .``$` ?@ # ,  ( (  (  ( ( ( %( 1 "@qb0. ! 2   .``$` ?@Ӕ ]#  @decryption failed (block corrupted)decryption failed (incomplete block)cannot read file㿐  @ϙ J  / / / / /  / ?//@ # 2   . $ ** * * * * * * @2  N  !(?@!P ? ?ސ!x?invalid pattern delimiter㿘# 1b@J  @g#9?@K b@J@`$b@@! 1&" 1"b8# ) 1 !؀ `    @t `?b8@ b8@  p unexpected end-of-file& no previous commandout of memory㿐   1b@@h`H @Z ? Xː x@?0˦ P@!^/ 1+ 1`""  @   H# 1 ?4 @M'c@J?` 2 &?΀ @hh`H | @h^`p bP 1@ )"Ȕ  >%#c\ Ġ $c\" @e 2c\@Z @ c\? $c\!#h  @ِ #h C?@  ??%"Ȑ?$Ā $c\!#h  @Đ #h "@ b@ǔb 1"b@L  @, & @  &   @{ "@  "@J`@ T 㿘 1a% 1   9# 11#\`&#\a@,  2#\@Z @) #\? &#\!#h  @k #h  ?@ ?$?$aЀ &#\!#h  @V #h @ ԰ aГ* "  $ԁ㿘. 1 1Ը 6%3 1; 1b  1b е. a b aԆ  ! aԸ !ԁ 1 1<Ԁ  1Ї(!Ԕ  "< ""<(@"<!<@  1Ї*``"<㿘!#\# 1` 1 1 1 1a$#\" "<#!@8#a#\$aА? $#\!#h  @ΐ #h @ rcannot open input filecannot close input file%lu 㿘N !̒c@ @#@8c 2@YB# @; 6N(? ! @{  #d@y  @Y'̐#8@2?0#d򀢠`#P̒#X @ 1b &newline inserted newline appended 㿘ސ 1b 1 1˔@ !`?خ cT  `  #!" 1"" Rc\ 1`T4&c\ c\? K&c\1#h  @- #h z?@` v?`$`b  @2 \c\? +&c\1#h  @  #h Z?@@ V?\? $\3ch  @ ch "@, @N 3 :?    @,`  ؀    @,`؀   "    %"%cT`&ؒ  " out of memorycannot read input file㿘 + 1O-ia  ?/ 1#c\  $c\T" @ 2c\@X( @4#xc\? $c\!#h  @v #h ?@ ?%a?%T $c\!#h  @a #h T@ T,*` 1 "aT " ? & @{  &  @ a  ? 1#c\ bT $c\ " @ 2c\@W @͐#xc\? 4$c\!#h  @ #h B?@B >?%a?%T $c\!#h  @ #h  @-  2  1"T*@ @ @W @#? / 1T *@ 1 " T 1*؀` 1!` ?wcannot open output filecannot close output file㿘N !Βc@ @(@6!`2@WH#@2 6N+? ! @ր  #d@w  @W,ΐ#0@7?0#d򀢠`#P̒#X @&  㿘cT  `'@&T- 1+ 1) 1  @ `a؀ ! *@ @ 6@?`@T   " cannot write file㿘"  !##T  N@ڲ`  N@@` @V @ax?#T unexpected end-of-file㿘 1"@J @"@[ &@?& c ?+#c\  $c\c" @L 2c\@Vr @~#xc\? I$c\!#h  @ #h Ӱ @ ϰ % ?%c $c\!#h  @ #h @@ސ @c@c @`* 5Ϧ?@ `*?@ &   1#@ J  @2   ?%\  $\c"" @ 2\@V  @#x\? $\!#h  @X #h k @ g % ?%c $\!#h  @C #h "c@v c@F`c@ c   = #c\ c$c\" @ 2c\@U @Ȑ#xc\? $c\!#h  @  #h  @=  % ?%c $c\!#h  @ #h c@( c*&cstdincannot read stdin㿘) H  3 1/ 1? %@y H  % HX' 1 >+ 1!#\  c$#\" @/ 2#\@UU @a#x#\? G$#\1#h  @ #h K?@֐ G?$?%c $#\1#h  @ #h c@ c,`*` 1 "a؀` 2b( c&b(*@c H @ ?@U"@" %@ ?6 ?6 + 1c*c%@%ld \  \abfnrtv\㿘 @⡐  !Ѩ!'р  `@ @(    ^*`: \ `?"``  @(O  ` \?"`` * $ @(; \N``Ѵ @V  "@?M "`   ]* @( ^ 2  0`"@   * $  @(   82  0`"@   * $  @'    0`"@   * $  @'Ւ ``N?"``  * $ @' J  `?"`  * $ @'  @(#) Copyright (c) 1993 Andrew Moore, Talke Studio. All rights reserved. *usage: %s [-] [-sx] [-p string] [name] 㿘̐ @Xg!'HOMEp:sx ? interrupt? invalid filename%s warning: file modifiedscript, line %d: %s unexpected end-of-file8'H@n'D@! 1"cH @@HJ?`r `?"#`/- 1) ('ˢ !+%"$d x pH `H `  %$#T|@|Y@̐ D@xUH?• sH*  D'H@'DJ`-D˒ "#d"HD 'H'D@ !ˀ $#p @   <      @ @ $#p@ @ @p cT@ ah@  @ a@  1@}9#а  ! @'A`4!(GDː &"clHJ@ !D@ݐ H@  H#p`2 %J@ !ː#x@Ws D`@'!8HJ@ 2!@#p`  ?%#!7 15-+') 1;Ҁ   1X ҒX`@{  1!܀ @&ْ@!: ?' 1D #d``@&Ő8a`p 2 X axᐐ "(@{k ;  ?&D5  1# J  ! ? ?5  1@["!Ȱ ?@ & ?  1b @  1?`??p+(` `&D@&v8ja`p!  X` axᐐ "(@{ 0 `Xᐐ @{  `@&T8p`h X axᐐ "(@z ̐ Z 㿘 1  2 1 1"b" "8    1"8 "@& $$"8J`,`;  `;#"@$b @"   4  & "8 "8$ ?number out of rangeinvalid address㿘 1"  # 1$b@b@"  ` b@J?`UՐ 0*` €b@`$b@"b@ `$b@"@ @  ` 2   @2F  <# - ( x`" -v  ^2v t&  `2 - ^2i g?^b@b@@2  <#  ( x`" L Gb@ . 4$b@G ?@^ / @ `? 9b@J@ `$b@+b@`$b@J``@$b@ { (? 2b@ ;` $b@" 1  "b8 1"b@ ? 1"@ Ԑ!8?S QSSSSSSSSSSSSSSSSSSSSSSQSSSRSSSXSSSQSQRS RRRRRRRRRRSSSSSS SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSQinvalid command suffixunexpected addressunexpected command suffixno current filenameinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioninvalid pattern delimiteraw%ld ! unknown command㿘   ! 1$"@"@"  ` *: `p $"@ݐ#*` €  1@J`n" `p`l   2  $"@ $"@ $"@ @"@J ` $"@! 1!Ȁ` 1@ 1@ b8Ѐ  1b  @Q ڔ  1@J`n" `p`l   2  $"@ $"@ $"@ @"@J ` $"@! 1!Ȁ`2 1@p 1b 1@ 8 &?@ A ? 1b  @   1@J`n" `p`l   2  $"@ $"@ $"@ @"@J ` $"@r! 1!Ȁ`2 1@. 1b 1@ 8 e  1b   2\$ 0Z 1"D`#d`"R? 2 `H!"@" @ `>!@ ; @J`n" `p`l   2  $"@ $"@ $"@ @"@J ` $"@! 1"@ =  &?@ & ? 6L@?  !ː#x@S L@  @J#x`!؀ː#xے &?@? 1"""D"b 2 `А!"@" @ `Ɛ!@ "İ?L@ ! !@J`n" `p`l   2  $"@ $"@ $"@ @"@J ` $"@!L@ !˒#x@SU @ #x@ħ0 1!Ȁ`" 1"@  |g G ] qG V` `&  1@J`n" `p`l   2  $"@ $"@ $"@ @"@J ` $"@B!Ȑ`%*  2 `3!  1@J`n" `p`l   2  $"@ $"@ $"@ @"@J ` 8$"@! 2 `!  1@J`n" `p`l   2  $"@ $"@ $"@ @"@J ` $"@!X " "XJ` ٔ`Ґ @vaX0 1"8`Ȑ!  1@J`n" `p`l   2  $"@ $"@ $"@ @"@J ` $"@! 1!Ȁ`b8@_b8@ 7?  1b @     1@J`n" `p`l   2  $"@ $"@ $"@ @"@J ` $"@l! 1!Ȁ` 1@( 1 1"b8 a@ J "@ 1J b8 $"@N! @J`n" `p`l   2  $"@ $"@ $"@ @"@J ` $"@)!Rb8@ ْ  1b @   1@J`n" `p`l   2  $"@ $"@ $"@ @"@J ` $"@! 1b 18@ s   ? 1b @_  1) 1""8  2 `b8` 1"@6%"ϐ! %b8 Ő"@  1@J`n" `p`l   2  $"@ $"@ $"@ @"@J ` $"@! 1!Ȁ`@\@   1b @   1@J`n" `p`l   2  $"@ $"@ $"@ @"@J ` $"@j! 1b 18@   d b? 1b @ђ Z  1@J`n" `p`l   2  $"@ $"@ $"@ @"@J ` $"@4! 1b 18@   . ,? 2 `"!  1@J`n" `p`l   2  $"@ $"@ $"@ @"@J ` $"@! 1a܀  a ( 2" x " 2 `!  1@J`n"  `p`l 2 $"@@"@J ` $"@Ȑ! 1"D`ư?#d`q0"@" @ `2 2! ` 1" 1"b8@  @J`n" `p`l   2  $"@ $"@ $"@ @"@J ` $"@! 1!Ȁ`@>J#x#x` L@ ! @P5 L@  @L#x c!؀#x 1"8R &[?Y 1" U 1 R"bD#) 1'J` @"@J`g" `p` "2-`9,`0("@"@`r 0!$"@! $"@ $"@@, # @$`@ ( x`"  ?$Հ"@  `2"X" "@J@  J` 2"x#\̒` "#\ @ $  \? $\!#h  @ { #h а?@  ̰?@ @l@ ̐ "`% \? $\#ch  @ Z ch @   #̒`@ ` &? 1!Ȁ`` ` ?$`` $``  ?$`% 1 1@J@ n" p l `2 `` ` ` "$"@`@ @ޒ g  1@J`n" `p`l   2  $"@ $"@ $"@ @"@J ` $"@A!Ȁ @ `@ $  1b @ /) 1# 1"Ob8 ( 2 ` b8` 1"@6%"!$b8  1@J`n" `p`l   2  $"@ $"@ $"@ @"@J ` $"@! 1!Ȁ`@@ր  2 `ߐ!  1@J`n" `p`l   2  $"@ $"@ $"@ @"@J ` $"@!@ "@J`q`Q"@ $"@?"@" @ `!@|  2 ` % 1  1 1""8"b@  &?  1@J`n" `p`l   2  $"@ $"@ $"@ @"@J ` $"@e!J#x#x` L@ ! @N L@  @L#x M!؀#xW"" 1" 1 b8. : 16""D"D`2#d`.`q,*? 2 ` !  1@J`n" `p`l   2  $"@ $"@ $"@ @"@J ` $"@!"cT 1"  1 "@e` "@ ?ϐ "@ @)Ɣ # @$`<#@   ( x`" , $`  1@J`n" `p`l   2  $"@ $"@ $"@ @"@J ` $"@! 1"8` 1" @4 @  ?  1@J`n" `p`l   2  $"@ $"@ $"@ @"@J ` $"@r! 2 Հb 1"8 1"@o 0f 2 `]!@ Z  1@J`n" `p`l   2  $"@ $"@ $"@ @"@J ` $"@4!! 1"Ґ!X@6`"@  cd '@,"0# 1"  1 "@`  1b8 @ ? "d $`!Ր"(\?wwPwPwPwPwPwPwPwPwPwPwPwPwPwPwPwPwPwPwPwPwPwPuwPwPwPwPwPwPwPwPwPwPwPwPwPwPwPwPwPwPwPwPwPwPwPwPwPwPwPu,wPwPwPwPwPwPwPZLwP]d_PwPwPwPwPwPwPwPfgwPwPwPwP]dpwPwPwPwPwPwPwPwPwPWDwPXYZ(\,]d^`Ha,b bce4wPf ghjLno]dprwPs㿘 2 ` 1 1"""b8"b8 4 Ԁ  1"  А!?no match㿘 1" 3?1?% 1) 1`  ?, b za !؀ ` Y   @И  b ڀ`!Ȱ?filename too longout of memory㿐 1"@J@ 6$b@b@"  `   !@ $b@J@ !`@}$b@ ' ! 1"Ґ!X@`c" ސ"I[ ' 9%1#\"`&#\@ 2#\@G& 2"#\? &#\!#h  @t #h 6 @ 2 $?$ &#\!#h  @_ #h b@@ b@'J@ "@ @``* '#"@J@ "@*@@  shell access restrictedno previous command㿐#``'!H ' 1 `"b@ ?̪ `  >-%\  $\" @~ 2\@F "\? $\!#h  @ #h ?@% ܰ?%`?% $\!#h  @ݐ #h @  !*@@J@ i /ި 5 17 1@J@ !T %` < !#\ $#\" @+ #\@FQ ^#\? $#\1#h  @ #h ?@Ӑ ?%`?% $#\1#h  @ #h "@@ "@ *@"@J \%"@ *@'"@@ J` >!#\  $#\" @֒ #\@E  #\? 7$#\1#h  @K #h 9?@~ 5?%`?% $#\1#h  @6 #h "@@i "@  *%"@ 3 1J  2!`` =% 1!#\  $#\" @ #\@E #\? $#\1#h  @ #h ?@+ ?%`?% $#\1#h  @ #h @   @:i"@ @ࠢ`*b@@ \"@Jcx cx@= @y` ='!#\  $#\" @& #\@EL Y#\? $#\1#h  @ #h ?@ΐ ?%`?% $#\1#h  @ #h @ ?? ' @ࠢ`*@??'"@`%"@@J` @) 1"$ C3 1%\  b$\" @̐ 2 \@D "\? ,$\!#h  @@ #h .?@s *?Ր!?0$%"$?&b $\!#h  @& #h @Y @*b 1b"!*@L@ ! % 㿘 1  H"b  / 1- 1'Ȁ  1 ?" `  J?`  ` ?5` u s?b@N   @J ` "@@" \N .\N  \X   $\! #\? $#\1#h  @ #h ??@ ;?" ." $ @  #\? $#\1#h  @ #h ?@̐ ?\ 1? "D $\!#h  @ #h {@ wȁ 㿘 1"    @T% 13ɐ ) 1`!@ =/%\  ਀$\" @ \@C b\? ~$\!#h  @6 #h ?@i ?%!?%਀ $\!#h  @! #h "@T ਒`@$`@@@ % 1` >/#c\  ਀$c\" @v 2c\@C 塚"c\? 2$c\!#h  @ #h c?@ _?$?%਀ $c\!#h  @Ր #h @  XਔX* * @F !<?#\?`# 1$b $#\ b  @ǔ #\#\? $#\!#h  @ #h ?@Ր ? 1? "D $#\!#h  @ #h  @  㿘 1"8 1b    1" ˔ c\   "c\8 1"b S @m     @a c\? %c\!#h  @< #h N?@o J?㳐 㬐㩐㥐㢐 1@" $@" "@ $$$8" " 1!Ȁ`c\@轒c\ 1? "D %c\!#h  @ #h  @&  㿘! 1"f  1" 1b8 " ` U" S`& "N  E1) 1#\`@ &#\ #\  $ @є #\? &#\!#h  @ #h )?@ %?#\ ?%"D &#\!#h  @ #h @ʐ      ` 㿘%\ $\ @ ) 1\? $\!#h  @h #h 9?@ 5?"`@  ٦?֐ 1!Ȁ`""&@\?$" $` 1 1 %"" #"D`$\!#h  @4 #h  @g  㿘  1֐!$?"`@  ☐@" # 1z `$b   &?@@ invalid mark character㿘b` `힐"8? 1* b` 2" 1bL "bL" 㿘b  ` ? 1b`*/@ z"8? 1"L  1`  "LL "L"L``$ 㿘@ܐ     ":@A? K" 㿘"  N \2 `?㿘'త 9)!#\"`$#\ @ 2#\@A ""#\? $#\!#h  @d #h . @ * $ఐ?% $#\!#h  @O #h @ N`\  `*  *  㿘#\ (`x  ˔?h * @"h@$`x㿘#\ (`x  ˔?h * @"h@B$`xed.hup/ed.hup㾘#l`> h? # 1b* * &"hհ"" 0  ! 1#Ȁ @  #Ȕ @Db  @ǐb  @ϐ 㿘#l`@ǐ ?h *@*  1"h#@jz?㿐h? **@! ("h x`h @  `" `" $ x..㿘#``" N ! c@Mِ @B /  /!H invalid pattern delimiterno previous patternout of memory㿘 1@J@  2 H `"@J`   !" :" h5"@C . "  `@9 @k   $"@?Ӑ  ް 0"`"@ " "̔@!'"@v $"unbalanced brackets ([])trailing backslash (\)㿘 1"@L@! ` "b@#* :  [ \  L@q   `aL Z L@ ` * b@)̤$"  >'#c\  $c\" @D 2c\@?j v c\? 5$c\!#h   #h 2  . %" ?$ $c\#ch   ch b@֐ b@@ 1*@!؀ %b@!>   J^" J]! 2 J `.`:`=2  J ]   J]2J 2J J] [J] number out of range㿘&@&# 1b@J b@ 1"!; @J b@6?J` @ .&b@ $b@b@ @ϐ  @Y  @&@<#@  ( x`"  &@ ?*:  g2 `$b@ & no previous substitutionout of memory㿘 1b@ "b@J % J*: @b@! 1"`%b@ꊐ"8"%b@b@*J :` % 1y) 1"H` 7 !#\ $#\" @0 2#\@>V b"X#\? $#\1#h |  w#h%"H?$ $#\1#h   #h @Ȑ @ * *:`$@` `J `\'b@ **@: $@ ` 1!Ȁ`b@ H! 1 ?6  " #J?` 2 &M b@=J@ "H"H` =!#\  $#\" @ 2#\@= "X#\? $#\!#h  . #h  a  %"H?$ $#\!#h   #h  1L  1"!*@no match㿘 1" 1 1 b8   "  u +" ` r&" @ &{?]"  f g 1c\"P`%c\#ѐ c\? W$c\!#h  ʐ #h X? T?" ?" $ @ϔ c\? 7$c\!#h   #h 8?ݐ 4?c\? %c\!#h   #h " ǐ " "8b"@ "  %" ``." ?`" K ? infinite substitution loop 㽰ʐ   /  1a؀  ` ޻ `'  @. 1- 1+ 1`  @   [$ >#c\  bP$c\" @ 2c\@< 运"Xc\? $c\!#h   #h ?4 ?%?%bP $c\!#h   #h  ؀ $ J bP@ @ʒ S$ð? = #c\ bP$c\" @6 2c\@<\ h"Xc\? $c\!#h   #h ?ݐ ?%?%bP $c\!#h   #h Ȑ ؀   bP@$ L >"  = #c\ bP$c\" @ߐ 2c\@< "Xc\? 0$c\!#h  S #h C? ??%?%bP $c\!#h  > #h q   $@2 ؀`ސ x?؀  ݎ bP@+bP @*@ @*`  㿘 1 1!b - 1+ 1/M &A \` `" , %\ bP$\" @`  \@; 瓐X\?$\%?%bP $\!#h  А #h @ @  1P`*@"N M 0I 94H?Ѐ4D* @  "@@ , %\ bPb$\" @  \@;8 EX\?w$\%?%bP $\!#h   #h @ @=  1P`*@4" *#c\  $c\bP" @Ւ c\@: 9X%?%bP $c\!#h  I #h bP| bP  *@" a% &:M ? #c\ bP$c\" @ c\@:Đ "Xc\?$c\ 2'?!#h   #h ?C ?%?%bP $c\!#h   #h bP. bP*out of memory㿘%#b!  "d*@  *`@T$b $"*` * "R*"@ *` "I*"@ *` &  $@:_ k"p@а @"$"$bnothing to undo㿈 1 1⨨ b  ? b? J#p?b   1 "bD  c\ " "c\H̓("@*`@  "   2 4.   `"  @ "`"  " @?" ?@" ?`" ?`"   "@  ?" #`?„"2  : *"2(@*`8: @@('`'`*'  #@ #` #`# # #  1!Ȁ`\\"?% %"%b$⬀ $\1#h   #h  %  㿘b ??!"b)b* @*`"@ ⤒@ ``@  @@(@⤒??$ 1"  1"$"b""㿘@2HLPRfiprthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s@T cx@ː  r"`@'4  /# r! r+' r; r%9 r'0+8 *&* @€ '4   '4  '4   %@ $`X$ L`H@R`$ L $`X $D '`H@@]?Ґ?* & @ @`H  @  c@<  쀦c4 c@0  @  2 @ް? r"`T@^ * 2  P' P@X`. @@#`@  \@)ݐ@$ .*\`$,`0%`&@@qK?  (`x ?`(@ <  -  ?@5?% `H 2 @@  @ @q@@@q @<  2  @  `H " @@(((((((((((((((((((((((((((((((((((㿘@K / 2N  2  N /"?* N /2? %s: %s%s: directory causes a cycle..%s%s: name too long (not copied)utimes: %s%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).fts_read(@(   @K 1- ( " ` `0``!`@/P!@ݓ `@ݍ! ;)T`6 2``"`$m``" @E#a0 "``J`$`/X"L? / /, ̤c\$#  ,!8@Y   @;$,#\@p?`8 `@X  2&`@ r D`<  #`@'`@@'`@# '`@@$'@ !`@0 @2`!p@ `@<`  @ 0<      `!@#\x  < @@ r @[@O0`@K(@[@iZ  @` r H` `@Ő!В@a I #\a@ow  r`(@S <  "  r  ("x`(\@C  D` `@@ 2! #\`@@0 r @` @z  r @` @I @5 2 @ِ 2`8x a@ 8  " @8  `??%soverwrite %s? 8` @n 2`@`@ # ` - r X``@\`2G r X`2B r L`9 c@^\?P`? "`@Z! ?P  $?P ? y#`H`? &`@Z `H  $`H` 2` y Y\@r \$ \ &@n?2 2#@۩\' 0 )@@ @ @##@ۑ\ ` `@ۉ#   r@ݐ@ڰ 06 D`@ʒ 2#  ,  r T @ @ @ r R o*@ @ #@V\ @@ #@K\ readlink: %sunlink: %ssymlink: %s㻘  @a#?` ",@ 3̠c\@ # c\@W #@ 0  r D` @ @mkfifo: %s㿘` 3̠c\@  #c\ @fQ #@   r D` @9 mknod: %s㿘` 3̠c\@`  #c\ @\   @ʒ   r D` @ utimes: %schown: %schflags: %s㿘 ! r  /6 $ 0  0@_#$  #$  $@X#̒ "`c\@<  ! @ڑ `  @    (# (  @# (  ( x`!0@u\  <! @6 `  @   $`x@Ð\ !0@]\ $`x` D@^  `x0@\  `x - D !@@C\ lchown: %s㿘̠#\ @İ   ( x`#@,  usage: %s [-R [-H | -L | -P]] [-fip] src target %s [-R [-H | -L | -P]] [-fip] src1 ... srcN directory 㿘#! `8cx@\`8@\c@g 㿘@b:c:d:f:snr%sstdin㿘@N'D`P@  t *` 1/! (# r+ t-% t) t'; 9 4* "T@€ @ᰐ $``   %`x . @ $| % p@D@XX?ݐ?b|* ` @`` "@@@`` `x  p "@@@ !@@ h 2@@ p@R @T`@ 0`Hx@ސ LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL(LLLLLLLTLLLL@, [-cf] list: illegal list value[-cf] list: values may not include zero[-cf] list: %d too large (max %d)㿐'D) r' rDi+J@ -  `'    @    h4% hJ -b @ `@ J@ - d`'􀢀 $dJ` c0@q  (cP@i  tcx  @a(`t &"`t r l@    *  c(@ 'd` tt 4"t h r m@ 1㿘+ r) t t`m  ` "@ , :   * $ࠒ @;`  ? & @V  &?W 2L B' r d`, ?`? "`` , :  * $@ ? & @Vz  &? ܒ`? & @Vg  &? 2 ` ?"`* $@Ԑ | t㿐 t  ҴJ?`  @  @ʒ @ .@  .L@= "  2`  t p`ࠐ@U2  t t r`mP'M ?=   `= ?"`` * $@y L@ ,`=  '  ?`$@ * $ࠐ@\L@ `2 L@ `2L@   > r d`6 `= ?"`` * $@* L@ ! ?`$@ * $ࠐ@`L@ 2L@ 2`` ?"`* $@ @ޒ ,`@usage: cut -c list [file1 ...] cut -f list [-s] [-d delim] [file ...] cut -b list [-n] [file ...] 㿘cp@Z @u 㿘@ʔ Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA. along with this program; if not, write to the Free Software You should have received a copy of the GNU General Public License GNU General Public License for more details. MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the but WITHOUT ANY WARRANTY; without even the implied warranty of This program is distributed in the hope that it will be useful, any later version. the Free Software Foundation; either version 2, or (at your option) it under the terms of the GNU General Public License as published by This program is free software; you can redistribute it and/or modify Copyright (C) 1992-1993 Jean-loup Gaillybitslzwbestfastversionverboseno-timetestsuffixrecursivesilentquietnameno-namelicenselisthelpforceuncompressdecompressstdoutto-stdoutasciiusage: %s [-%scdfhlLnN%stvV19] [-S suffix] [file ...] r㿘   c@X  file... files to (de)compress. If none given, use standard input. -9 --best compress better -1 --fast compress faster -V --version display version number -v --verbose verbose mode -t --test test compressed file integrity -S .suf --suffix .suf use suffix .suf on compressed files -r --recursive operate recursively on directories -q --quiet suppress all warnings -N --name save or restore the original name and time stamp -n --no-name do not save or restore the original name and time stamp -L --license display software license -l --list list compressed file contents -h --help give this help -f --force force overwrite of output file and compress links -d --decompress decompress -c --stdout write on standard output, keep original files unchanged%s %s (%s) 1.2.418 Aug 93%s 㿘  ` @W "P` "P#@Wڒ`(  2㿘  ` @WƐ `@  `@#@W`(  2Compilation options: %s %s DIRENTUTIMESTDC_HEADERS HAVE_UNISTD_H DYN_ALLOC 㿘  !  `@WHPa(@WaX@Wah@W~ax@Wz@Wva.exeGZIPunguncatgzcat.gzab:cdfhH?lLmMnNqrS:tvVZ123456789%s: -S suffix too long %s: -Z not supported in this version %s: option --ascii ignored on this system %s: incorrect suffix '%s' insufficient memory㿘'H@IS'DH! @@!@n$   `?@;b( `*?H0@!D "aH"  @  @  `" a0@  @  a0@  @  a0@ `b8@>F   `b@@>?  `ΐ "` @;bH `@;bP #  "`"# a bX @ K@! $!D#/%1+)59; 7΀`Ez!*` € v$`|@5bp"`ΐ l"`ΐ h"`` c"` "`"Z% U$S$ & O$$L& Β " F"ΐ B"`!@"  $D`b@Vd o@ n "  @ +,  ""`#" Β`" "@ T D`b@V> I@ H  D" ?@ > D Hb`@*9 y   $ `| & `|D  "  ` D` @VbD   ` $  b` @Ub@      `2  "bL @ @ '`@ T#@ "`@@ K#@@ "`x@ B#@@ "`t@ 9#@ "`@ 0#`  ` ` D@6"* H $"@@ "D@"@   ``?@'?@ ก((((((((((((((((((((8(((((((((((\h((((((((((%s: compressed data not %s a terminal. Use -f to force %scompression. read fromwritten todeFor help, type: %s -h stdinfstat(stdin) OK 㿘 /΀`3- 0` H X@_R  $   #`#H#X "#h! @T` @Tޒcp@  `    #c#   x + c+` `*` (x * *` *` *` *`***** %`X `2   R`V@ @# %`X ?@"`\ΐ  " "` @{`8΀ "`@ `  `8@0A# !@f`8΀ 9"` " |`HRf"LR /    h`  `  `  @TQc0  `| @ ! " "@@@T=a-%s: %s is a directory -- ignored %s: %s is not a directory or a regular file - ignored %s: %s has %d other link%c -- unchanged %s: %s: %s compressed to %s %s: %s OK -- replaced with %s8'Dc@8Ր  ! $  D@p < @ 4  ` X? (08@HP ?D?????????@ ?D@ے0| `B    c@S7΀@ `0    c@@S% '1 $ ` `  ` #x`?  s@Sz` 5 3"`   4   X"\ `   #@ ` `# # `x `*x `*  `*  `*  `* * * @3    @c!  ?"`8  c@S, @*[ΐ "`@|  "`@ 8΀  "` ` @8@}m80  R  "aL ! "5@ ' ! 5 d   d `  d    c x@R` d  `?$ d ` c@  @ ##!@R!#   h`  `@8  $  " |bL8€L ?$ @|8 `  @|L  @Y ?  G @ x0C < `   !c@Rw `   ` @!|" "@@D `  `| @!ਐ" "@@7 `      cx@RL  @RHa @ %s: %s: warning, name truncated 8' 3-+) /5@ 8@| 0L  x &`Ȑ*@b!# ? $aL@)J8@|v :%@g  @R `@):8@|f @|daL@&%@   ` ` `@Q`     "`@|AaL@k@0㿘  ( "`x `@a0@aĒ_z-z-gz.tgz.taz.zzp ! @6a "@  А@ $&@@@i@ސ@@ $@?M`/" @6f$ "@  .Z㿘΢"@#(  ( ?"`x @ : `  ( x`  @( ΐ '"`@ bX@6&! "`'Π @@ c `@ .! @@(`$  %s: %s: unknown suffix -- ignored .tar%s: %s already has %s suffix -- unchanged 㿘 !  x @P `K -`    `2h  `2c  `  2Z  `2U  `B   cX@P֖ 8@`@5 a@5 26. ##. .  .  .  ). ! `   ` `    c@P`     "`  " d@^a  %s: %s: unknown method %d -- get newer version of gzip %s: %s is encrypted -- get newer version of gzip %s: %s is a a multi-part gzip file -- get newer version of gzip %s: %s has flags 0x%x -- get newer version of gzip %s: %s: part number %u %s: %s: extra field of %u bytes ignored corrupted input -- file name too largePK %s: %s: not in gzip format %s: %s: decompression OK, trailing garbage ignored 㿐 ` `        @ $@\ /   0        @ $@E /     @ $@7/ `Ζ?   "  #`a @ h@]   aȐ@]      @ $@  $     aА @Oऐ# ΀ "bL    @ $@     b @O|ΐ "`ܰ?   b@ @Ok`ΐ "`    b @OX `ΐ "`    @ $@      @ * $@ *      @ * $@ *      @ * $@z *   ` " X @`$@f  @`$@] `, ऀ    @ $@O      @ * $@@ *  `     b@N͘ ?      @ $@       @ * $@ *  `     bؖ@N? ?  @`$@ ??ऀ`K `2!  ` `!  !    $@А *  *` @I x #  x @ѐ#    @ $@ *`,  ` `2$``!    $@  2h ऐ c&a@#0@\   ऀ 2c8 ` @[ #"bL$@D 2l? B$hc8@[   "Δ "bL4& c@@[ݔ    !"bL$h%& cH@[Δ   `"Ζ  "L$h&  ` `2   (Δ "bL$h$&  %    cP @M:"` `     cp@M` ? "`deflalzh pack comprstoremethod crc date time compressed uncompr. ratio uncompressed_name %9lu %9lu %9ld %9ld (totals) %5s %08lx %11s %s 㿐Ԁ ` `"@C! `23 @;!. ,   Ā `"@%    ` "0@  a@` Đ" @"@@"@0~ \  ? " `0"`|  h`, ??@ws  "$`$`@w  "@* *+`(+  @  *@ $| @8 X *  ` .`ΐ" "P@Ĕ|`@"0`  "  "a@$|$``   "`|" "@$|$`Ā &` "`@|" @"@ "`@`x `/ @* `% `   ` 0`0 4`4 `  `  (`(`? 8@` @?` ?`?` ?`(?`0?`8?`@?`H?`P?`X??@\E, 2,@ ,name too shortcan't recover suffix .internal error in shorten_name㿘@n  `  @#a*?^ 2,@#,  "`dc@0?   ,? ,? ,? ,? ?,@c /  L `%@(?L 2 L ```  `* ,@``@7 . 2L`@8#0L` " @3a %s: %s: cannot %scompress onto itself %s: %s and %s are the same file n%s: %s already exists; do you wish to overwrite (y or n)? not overwritten  (" x%  ?2 Wx@[w `x`     C@[d    Ò '  x@08   `! #h!  @KE[  aH@K;Q `<x!p `  7Hax@K'x ` ?P@~T`  a@K@uH@Z O"H ` Yxy a@K`   x@    c@J @"ΐ "` 㿐` `''@w  <`  1 2    @Jɒc`   "`  @! x%s: time stamp restored 㿘 `%   Xx   ` &  a@Jxx @ o #` 2    @Jc` ` "`` 2 @! x@x  ΢`" @ ! 2    @J_c`   "` @!%s: %s unreadable ..%s: %s/%s: pathname too long 㻘@*u 3  b @J2ΐ :"`/-+.)@/( (@/Ѐ #@~c@~` # @  /,@ @@ 0  "ؘ`@I &`@, Ѥ @+㿘 ! @|a! `"@{А $!! "! @{$ !  "! @{$ !  @ "! @{$ @!  x "! @{$ x!  t "! @{$ t!  @{$ @|'㿘 Ȁ` @t aL @3 x 㿐  " 8 @ ΄  #`H"aL"77 ( @ #`H *   @ #`H* `d  @ `  #`H  *@ X  @ $`H+  @$`H2` * $`H#@  X`@`*  X$`H@2 *@ $`H@` X1* @$`H@ X`H2 @* `@$`H@ @  t"`@ <  @`@`H1 @*@ $`H@`H @*@ $`H@`d) +  @  H @*@ & H@L  `H@%a@`H# @*@$`H2 *@ $`H @1*@$`H@z `H2 @* `@$`H@o`H#@ `@`* $`H@2 *@ $`H@`!* @$`H@T`H2 @* `@$`H@I`H# @*@$`H2 *@ $`H @1*@$`H@, `H2 @* `@$`H@!`H#@  `@`*  $`H@2 *@ $`H@` !* @$`H@ `H2 @* `@$`H@a@  @%a@㿘 `8@rߒ?  @ ` t""`bad pack level㿘? @" `@ t"` @|> Βc. ```! t@   $ `#` "@   @ 6@     "`t@"T t`"  t t "` $ a"  # t@ !   tc$`  *  "㿘  Tt  bL & `@ a0`  c!] X @S  `M ` &~ @6'@` @/'@` @('@` @!'@` @@'@` @'@` @ '@` @"ɲ`'@"@   D ( 2㿘# t  T"@"@  ?@) t?";) t `t! @zڔ  D T"@`""# D @#`$T +  @ 2@2@  #   +   2 2    @  `t T `€ ? %  $㿘 t   "`L ) 5 #' t/ ; 9@`Tt @@ `*  ` * $@ @*2  `T*  2 T" b  ڐ ` 8 C  D? T@"  t`" (% #T? t  @T? t T` `*  * #`@ @ *2 `*  2`T  Tt@% T  $@ `*  $t `T@O `T %$`T``t  `T @Ò" `T&`! t`   `! ` f`T  t@   T @" 㿘 t  ` 8 t ) `5 7 t3 ;@+ 9  T#`t @ @ `*   ` * &@ @*2    T*  2%`L D  t `L@  T" b `L  @ 8 ` `L T D" 8 `LL@ J T "@@ `L " T t#  1@ $%`LT`t T` `*  `* #`@ @ *2 ``*`@2@L? #L T  $ T 7 ``t   T @"  T(%`t  T @h ``t   T @"  T% T $ T $ T `?$ T$! t`   !  < T  t T  @,   t@   T @" 㿘 w#    "`P""# "΄#X z {"      +  #@ #(+@ ?` Δ#̒*  {"    { * +  $ @ **@ ?  *"; ΄# {" * { + "?,  `@ ?(!*@?  $ x $ 2? 62 v x"`$  .   3 2 ! x $ v`b .  2@  3`!! x $ v`b .  2@! 3`! v x $ v`b .  2@! 3` v"@&! w#  6`@ђ 6@  `@ t t060 vt060 wH060  (} 2$      x t   p(|㿘 xD z8.`.`5 z@ +.(`@./`@/ *  .  .. D.  `D.`  .`.` '`D.` 㿐  x  $ '   ' 2? 62 z!< x`D*@ * @"<;2  x $9 7  x- `D@,`@* @ `$22@ 4 . @   @7@ $@* @@@z}#@ '# @zs@ㄒ@&ㄨ "< xH x $-. ` $?. `"?.   ?2 *   2  2 & x $/ x. @`?D% ?-  `* @  " @ @z.&@$4 `2?. x x  $  ** 0  ` ` ` *` *4 @2 6 㿘` z@ z` "=   "a<?"85 x z!@D @ "2`*#+@  ` 8!8 *2 - +  x z Dca@ 8  * @  8 "@ "@ ?* 4@ ,  " 8 8%c%!82  :   &`? 4 x z Da@/ z- z8* %8$ <, * $*$ @ +`@ %< ,4@ @ @ @` -@+`@, 2 @ 2`$h !8 Ӥ<D*`"&<>㿘 ?      .`<`;0 w ``@"-@.6 .6@ 6@` 4HD6D6H        Ͱ 㿘 ?      @P w#`*`  @@` ` w#,`@32$ `@ ,` @%@ `@@"`B@  4 `H`D@`F@  @`J@      @    @*`㿘  tR   vM! ϖ   w # *`   ?  # * `"?# *@   ##㿘>@Ȓ @Œ @’   t w c  *@ @ &  t X? v!Tblock vanished㿘  cx { | `P#p* ?#@2@[ϨJ ϦF   c  【 # 2 2@ ##`@   @k ! #,` ? $#@ 0' @Y  v w"@c c @M  `  {` t v @a c c  "c#@# $##6 㿘   cp *   "cp t .`  `92  z#  ta*` ? 2  { v!  *`> ! @* a > ! *`@  ct` x0 *2   #| }#ct +#| c}#p* `+c}  x { #|#p* ` "x+c}+#| `$#p/2"#p  T  vΤa" #̳+   @wo`@? #p ct2 6`4@  #p#@  #t  㿘 #p `  N  zκc#X { {b  {c̮"􀌠  {#p     @ ,`  @r* @* @j`" @c$@  x-` * 2 `` 2 ! * @ @P@`" @I$@ cp §4$@A$-l used on binary file t   *   @   t*     2 t*   @ P`?2    0㔀?"cp ଁ㿘 c "=  !  H. @ # 2 `@*@$ H@2 *@ $ H# ``@%*@$ H@ [ H2 `@* `@$ H@ P# " . 2`:@4 %# 㔓.  2#c 0`* 2 㿘 # 2!  H#   `@*@$ H`@2 *@ $ H.   # `@%* $ H@  H2 `@* `@$ H@4㔀 '   @ `H *  #`H@4%#㿘M `H#@  @`* @$ H6`* `$ H   @`*@ #$ H@ H6`@*@ $ H@ H# @8*  @$ H2`*  $ H@8 *@ #$ H@ H6@* $ H@5 # !H`@ *@ &H@H %s: %s: not a valid zip file %s: %s: first entry not deflated or stored -- use unzip %s: %s: encrypted file -- use unzip 㿘  `  "`8 **@  `   #`**  @ * @#P@ "    %`P΀` " `   `p   "aϑ2  ϒ ""    ` @>tΐ "` out of memoryinvalid compressed data--format violatedlen %ld, siz %ld invalid compressed data--length mismatchinternal error, invalid methodinvalid compressed data--crc errorinvalid compressed data--length error%s: %s has more than one entry--rest ignored %s: %s has more than one entry -- unchanged 㿈  " 8"aL @O a   5   ` `*  `@ `( `( `+  ` ` +`*   `@  @Y"@q7 7 o9 @Q"Pk b`a `  *` @ ( ( *  @ +`*@      ` `( `+  ` *  b@=@" ?7 9 3 ' ! % # `  &`@  Ht* `@$ H@ ?@@"7 9  & ! % #  ` $ @ .@   * +`(*@ (쀢 ,@ ! % #  ` $ @ .@   * +`(*@  + *`  @@W @@" |@# D   ` =  Ґ@ #P * * @@  *` 2-% ` `     c8@<ߖ` 2% "`   ch @<Ζΐ "`%& %&    'H\'L'P'T'X????????'*`  " H  X "4"@ `   , `" *`@   ,``"8 " *,  @   /`,`@ @  @  '' "@`  ,  *`#`" H`@*  '?'h ɬ / '@H.*`'].  ?!` '+@` " @" `@*8 +@''?@m*   @h  < X# <" 'X h""  //'&4@, ""4'/  c/L    /7LT" * @ /" P* 74@ *  ?, * ""   *@ @" @4 @2@ *@? @  $*.? @ L 0-"p'#\.ϐИ"  Қ   @7c #!0&    0 㿘   l`p  % ) '  @` *@@ $@ *@  `?& 4`% ) '  @` *@@ $@ *@   `4`?%`p %l    㿐    " p"H"`l 1 & < " <8 "& <l   ऒ? ""`l@ 㿘   ( "`x ' ) ?`% @ `|   @a[$`| $ ?`? |x |@v|%  φ?x`ϖ| 0(#"x8     " H "` |"㿘  ( #"`x"' # %  `$ 8@a@ `   $   ?@+      `# #` @㿘!  H  aL @$@ | H "|$ H㿘!  H`# `t`   aL H@ `t  | H@ " |$ H㿘@@&@`Đ?J ✄@`  *J2 㿘@ / 2 㿘 .@  @"` _J@ ."*@@ out of memoryargc<=0㿘@@ij  _ @j3@ @c )@N .N  #@LN 2@@g9  $@@:ؐ  2@@5 @&@ @, @$` %@LӒ$ N `" $@$` $ %s: %s: %s 㿘   a࠘@5 %s: %s: warning: %s%s 㿘 `     b@5d`  "` %s: %s: unexpected end of file 㿘 ` b@5J (`x  @ t 0 b@5<㿘  b@50  @ ^ x{%2ld.%1ld%%㿘`1  @4 . "* * @[Ғ#@[ ?`&@& - -* &@Œ ?`&@&  * &@߳!#X @[ @O@4۔㿘@f I output in compress .Z format not supported 㿘   " @4`"   %s: %s: warning, unknown flags 0x%x %s: %s: compressed with %d bits, can only handle %d bits corrupt input.corrupt input. Use zcat to recover some data.㿀 `  Π 'D 'H   @ $`Ր $` `А "b `     a8@4\` ΐ "`  , '耣 "   a` @4B "`] ` ' * !'`''?' !! `!@h-    `t*?`t <"      *   " ?  D@ @^ ?'   "@  " ` @j "@*` `!@g !*?@N$!? ''' `*  " 쀥 * ?@Ne$`?'䀢' *@ ?' * ?' <   * *` :  a @*' ! ∀   x?#"@` ΀   @H* `|"`| `!,     t , ,  t `t ?',`x " @ ,?5+ ## `&4 `@@fŔ 2  H`@`|$`| `x"@ &  @@f耥6  ` -2 t*2`      @H `|"`| 㿘 ! ȓ*@ 2! %! !% 3 /  İ& *@` 4 $ &!Ā?"$!$aȀ !!Ĕ"a2@  5a%!ȁ㿘  "@> 㿘   2!"a" Bad table В  *2@   @ *`   2  7    # * @3@`  ؐ!  "   & :2 ( 3@  ,`  *#@ +2 ,`:@  *  * 6 "  *@@?@5`*     :*1* 6#1 3*  @  +`2@ 22`* * @+ 21@*@㿘B  =   #* &* #!2? 620>,' - 㨨 * 2 ` 2   2`@`` -@  ? #*    #* &* 㨖 㿘     `@*`a`@  ,`x`o2 0R@@'  #) !2 * @    ! `@ ,   @ 2cv @ @        ?  `@?*`@?*@`@!a   `@*`a`@ x!@ 㿘 c  t  $#-!  (   "? ! #*`3 ?x$#*` !  3   @@ ,   !2`@ @㿘 ! *2c* @    2 @ .    3 c @ ? *@@㿘! "#㿘  "!"aЁ㿘 ̤?  "# @.@   :"̐? "r!   ,"a8?.@ 0#$a̖̐&c? ! $#"̔ @.@    "̐? "0΁㿘  " 8"aL aЀ  1 ! t aЀ taЀ  t invalid compressed data -- Huffman code > 32 bitstoo many leaves in Huffman tree㿘 "!) 1 / 9 '  ء*   @` %  r %@     @ % a $܀ o#ܠ   #H '    % F ܠ $@ aN#8ܖ#H*   " $  " 3 ,  `&a+    ` %  `-ܠ, ܔ#H* `" ܈     H* :` " " @?!܀ 4  `@(      H* @ *????*@  *`@*@`@@invalid compressed data--length error㿐  " 8&"aL !  #H *`  ' *   ?# "  @ % # ) ' ! * ` @` $`   %@   $    " 2@  @ @ `#@33 # 5  , `@ - % ) ' # *  @` $ K ` %@ $`   .`"2@ @    a܀@.` t  !   `H*  "`H^  "" W ! `|"" J J  J(8  J   `0( (@   @"@"`@ *@`4b 0"* (@  # 0@"@"`@ *@b 0* (@  #`4@"@"`@ *@POSIXLY_CORRECT--%s: option `%s' is ambiguous %s: option `--%s' doesn't allow an argument %s: option `%c%s' doesn't allow an argument %s: option `%s' requires an argument %s: unrecognized option `--%s' %s: unrecognized option `%c%s' %s: illegal option -- %c %s: option requires an argument -- %c 㿘"Ш'D"b -    " 4"`0%(%"N - +  "`,  " , @aM"Ȁ  " ," ,(  J  `, -   4 0@   " 4( 4" 2#`0DD "─  *@J`-2J  $ 4"D@%*`@  @nb؀ ""   `4 0  %" `0 D`0 4@D"#`0D$ 4%""D *  0 `42%"e?@J`-`,J `, V?"b%"Q A   -`?`%("* @J`-2(J  -`(( L@   L@  =2`  (@}$@ 2(q$@Ȁ2   "` "*`@   @@,b(P ("@%(%"d"%"L@ ) `G"b"`*?J`-  @ @,ϒc ( @ Jc0@,( (@%( #D Б*@""%""` *@ @ @,c`((@%(N :  :(( @%('`  "@ `"* @J`-(J %("`"* @J`-  @ (@,jc " @ Jc@,a(" #Ȓ`%(%"\ ( @`. :%((J `" %" :2J`"` @ c@,8""7 :23. J` :J "'"" "А "b%""D*"` @ c@,""N`:   :@""%"%(. > 㿘   㿘 㿘@2HLPRXfghorstuwxthe -R and -h options may not be specified together.invalid flags: %sinvalid flag: %sinvalid file mode: %s%s: %s%sfts_read`@Ԭ #`x@ `8 J  o`?#a\J  g`?"TJ  m`?#!XJ? f'Ѐ`??"P''''ܢ   )%%'#; (?'59# 00*  4@€ +  (  %  "'ܒ 'ؔ 'X @*?J`-JJ  $@@'G?ǐ?&*  @@܀  Ԁ``#`@YӐ 2 P P 2X@' @?А   @'`x`x`#`@ J`"'#`@Y ^ @1Ȁ #`@Y  8O'耢 2 @ ?А  '`x@⫐ `x "'`x`x #`@ J`"'#`@Ys ( @ '#`@Yg  \ @@Ԓ : `@@Β . `@*@'@@'@@'̒`@SB   @s * ? ;%* @€܀ X@U] X +P0w # @la @PX hP #  @Y @0ZP WX TԀ QP   @D "D @D "D @ D@X 83 X    @@* 2 4@ ؀`" X P Ԁ  @̀  0 @Xd̀  ؀  @! @S 2q 8`x #a @ؐ @\s 88dd$0<HlTl`lllllll%s: invalid user name㿐L ?@ " @⁔ ?#a@y J`%`@X? %s: invalid group name㿐L ?@ " @W ?#a@O J`%a@X usage: %s [-R [-H | -L | -P]] %s file ... modeflagsusage: %s [-R [-H | -L | -P]] [-f] [-h] %s file ... [owner][:group]group㿘 !X !P` 8`%"H%"x%"@)/ 0 !\`8% b%"%"А @) @[ 㿘@usage: chroot newroot [command] .%sSHELL/bin/sh-i㿘@  % @(c@[h @n` %%@0#؀ %`c@ ` " %@0`%`c@ @\N#谒 %%#@̖ %c@ 㿘@ lost+found㿘@  !   "  (*  :`J "   2 wrong type to dirscan %d 㽘L0`"$&@!   B 6+ B+ 3` @; 2* @ * <  `4@_-@   = b<8 $ @= "(  @[$(@  @   @[֐", - @ 2  4      DIRECTORY CORRUPTED㿘  4@^  @a a8  4  4  (/  6+ @}@ 2$  `&cp@. @=" `@6 "@. . .  ,  ~B?< W$   4  Q   M I @ $   @ b !=< 9   3  /@/ *  ! # ""   <b$ `<  &cp@- @ܒ`@ 6  ,`   8@"". `*41 2. 2 `)  `` 4  `   `J@/`  &J@J@`?㿘@%s NAME=%s %s=%s DIRFILE㻐'@#(@ ?'@ #0@,`  8@ '#8@Ò0@ڐ@' < 'cH'#P'#X @0'#8@UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED) ADJUST㿘 @.`T >`   @ M(`H@b 0G ( `P<  2''#P#X (@l @ ,`T : ("@@ ` c䀢   J#`c䀦 6 c'@}#0(@D xc䀢 (@t c䀢 2  (@'  "@ 4 㾐 (@Z , /`  `   ?   " 67 4   $ !`4  # , ,  ,  ,@Y 㿘 (   ,@4'   ! `$ # , ,  UNREF %s (RECONNECTED) RECONNECTNO lost+found DIRECTORYCREATE (CREATED) SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. CANNOT CREATE lost+found DIRECTORY SORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORY..DIR I=%u CONNECTED. PARENT WAS I=%u `  ???????@<  `?(`#X'#P'#X@n @Ȑ c䀢   J#`#    #䀢 2 ((@&ʐ#x   @z#h `Ȁ G @W !0c (  ''/'@ (-$@5##䀢 2(@&# ! , @   $Ȓ (@ɐ   #䀢 (@B# @m #䀢 $'@6#0Ȁ (T#@< @@ 3(@#)@&k   , @Ր  $)(  (@v  ) @# @b`4 /'ġ,'`*`::``42@ !J ) P@ 0N@&Ȕ@b   ) x@ (@ِ#0; 4.  `?32 ) Ȑ@0 @A@Ƞ  @_4 )`4*  `2 @ )@ `4.`  2 #䀢  '@#0 `  ? (??Ȓb?/'Đ'''???@k'@ X H  8D`B@@  (????  ???/'''''@H`  B*2 @2 2* @ * @>`@Ԓ  @)Ґ@'@ @  NO SPACE LEFT IN %s (EXPANDED) EXPAND㽘  `@ P ` 4հ -`(@     @ɰ @( 8 2° `+`$$` 0 ; B<``  0h: @$h`` P*@ :`   @А  `0  <D @L@ @ @6  2r.` "@Wy`@'0  c.` @Wk"` `0 #ѐ`0@W]  "`0    , .``   `P*@:`   А  `0  <D @L@ @ @   2.` `0@W& *"@J #䀢`"**@l" @$#  @,  .` $$   0 :`@ c <0h:` " $h@(8㿘 @ !`" H `&` &@@ ``4@ ( 3@VҔ ``4@ #ѐ`0@VĔ b`4 @  . @4   3   4  @ 2+ a @? @a  @@Xa" "  *aJ@    4.  ,2  4@  2@ @  @x4 㿘@ @k2 @2㿘  8` @X  ?$, @Y͐ 0?,@Xђ  #,㿘! #Ȁ ?"@$$#ȁDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS @ 2&@&`$ <>` ('7  e( :`Ӗ ` ̀`x h ư @3` ,b> @G! @"`  x @U`0?  ;`; @O@Ъ @ Y p 9,5,/,2  <@ :@L@ B 8T @Q @ &`  8&`@`&N`0 20``&-``@' !h@Œ@#B 2 `@` 0@Xđ<: > @ @"` ` &``@ ] &`@   8 &` p 05,*` * :  @ :`c /,@  &`@6 "&N`0 2Ѐ`@'4 h@n@"ᐨ O  `t @;  d Ѫ` PARTIALLY TRUNCATED INODE I=%u㷐M`0  &`@ 2`0!`@`  !    0@#` 0` : t@A<`?   `t @5; 8 2   `t@"  ,b: @7a @"` qF@B@I `9 d@**  `t6%* @@ 1-  " `!@Ґ@'? " $- * `@#:49, `%`@e "M`0 2`@&b ,ah@@"!`"`f *  ?%blk %d < cgdmin %d; blk + cnt %d > cgsbase %d blk %d >= cgdmin %d; blk + cnt %d > sblock.fs_fpg %d 㿘 #q@n   `@Gc@Wd``@W_, ` 8@WV@WP, @K !$`E#.`@WA@W<, ` @_ #.``@W/ @W),  `! @W!@  !$`#. ``@W @W,  `@2  .`!@,  bad inode number %d to ginode 㿘   8  .#@!d )  А  `x 3%   @V&@V @V * @V  @@ @W @V x  ` a* @ ?"@!0$`x@U@V%ad  x@V * bad inode number %d to nextinode 㿘 # ` "#  8 ) / @7 , E # ``'  @U$ㄒ@Vt `@U ,* @Vj@V ,@Ux` * dㄣ, @:7!   #  ,#  , % , a ! #@#;# "!`a` "a`Cannot allocate space for inode buffer 㿘  8e< `H `    4 "!d"`,# " "㘒##@F $c+ @9%a ! * " $# %a$#"! #܀  @Pc $#/@"0耢 Z##耢`㿘! #܀ "$#@Q$#܁cannot allocate memory for inode cachecannot increase directory list㿘  0 ;  @ C@8 ` 8 `,` $ (@P 2 /@^# @@U cБ* `$"$ $ $ $ $  ,`$  ( $ $ $ @Rh $ # @ # `d"`@Pœ*` $`/@0##`* "  &#ԁcannot find inode %d 㿘  @@U cБ*   0   2 0!8@㿘 cЀ   # *`   @Ph`?@Pa@P_`$`$Ё  * %s %sDIRFILECLEAR (CLEARED) 㿘. < 0bP0"X0"` @ @g 3 c䀢 0@w"h c䀢  0@%"p ?" `H @Qǐ a  *㿘 (  2   ,@Q 㿘 ( "  ,@  2    8 8 &    I=%u OWNER=%s %u MODE=%o %s: SIZE=%llu MTIME=%12.12s %4.4s 㿐1 @˒ 9  8 51@ @8 p "11@  p@ (1@ 0 c䀢 "  !1@' @@ 1  @ H @'1` X@`%d %s I=%u BAD STATE %d TO BLKERR㿘1!x@E1@x! aJ@ "     !4   0   *@*@!1J@!CG %d: BAD MAGIC NUMBER 㿐 #X    !J@     8  !J`" 8 8J@ 28   X`@SJ`@S``@S. ` ` @n @"U@  `#Ԁ "`1"P@Β` @T2  @"U@" \ ` @T   *@ , < @ ?@ % (@ 0C@  0?  *   %   *@ X * @!  $ ( #*4@D$ d`$ $ $ ` 4 :< `4#: $ h`E## !` #6` `*`  @???Ȗ???? /''g  `H@P) ! * ㈐?"㈁dfpnNyYb:c:l:m:numberAlternate super block location: %d conversion levelmodebad mode to -m: %o ** lost+found creation mode %o usage: %s -p [-f] [-m mode] %s [-f] [-b block#] [-c level] [-y] [-n] [-m mode] [filesystem] ... 㿐@a+ @W% (  *#';29 ) 725/2# ! K-2 +B3* L@€c ?%c2",㠐 b@  "x2@1,㠐 cb8@ ('#!$ $%!$",P m@ p&,2@n"X@p `,#  ,` #,`̐ ,# 82"@Z @??"*@  & @N|  T@Nv c䀢 T#@No U\@Nk    ?@@`  @1 ? c  '@N ,TTTTTTTTTT@TTTTTTTTx˴TTTTTTT,ThTTTTTTTT@-%c flag requires a %s 㿐@9"3J 3"@ܔufsffsrwro㿘3 @5bp " 33 @.bx 2 3 @'b "  3 @ b 2     starting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups %d files, %d used, %d free (%d frags, %d blocks, %d.%d%% fragmentation) %d files missing %d blocks missing The following duplicate blocks remain: %d, The following zero link count inodes remain: %u, ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** / ***** REBOOT NOW ***** 㽀 #䀢`U`@M# c@ a$  c䀢 3@1# @?s  cc䀢 m3@#0j  Ғ  " *-  3`@=#P@ "33@5#h3@2#@h c؀  c䀢 3 J#`"33@#3@#@ c䀢 3@#@/c䀢 4@  @ c䀢 4@ 8@ #c䀢 4@~ `@ R!4`̠ `# `8) @PŒc#@. * (!4 @@* . ("2`*@ *:@@ @4 @~ʔa$` 8 #"@" `%#4@~ a$) 3 ; P5  # ,@P"  @4@ &@@o 8@Pm&c"@" `&4@~ ؀ 4@~!؀  %4#4 @~~a( 2 @~x0# 4@~r!8#  %4#4 @~jah 2 @~d0%#%&a(`0  @  ,  &L  #   `,6 % @P```@P. ``d , @ `,& ` 2/#@>O# @K"c @Ka @K`4`0 8c䀢  4@~!p ` 4O# 4@~ !@ "4!@2!P cP`@@ 3"x'''@G   c䀢 4@}!@T 0 phase 1, inode %d/%d㿘   !6ap (,@O@(`  `, - :1Ҫ ``@O``@O, `  @O`  @Oz,  @@ @  ``:c*$@ +@`@* ``,&` 4?@?P @@   ``:c*$@ +@`@*   9??d /'  ?????""㈖6`, @ &  %p    @ `Ѐ %p@o` @   `,&  & PARTIALLY ALLOCATED INODE I=%uCLEARbad size %llu:HOLD BAD BLOCKbad size %llu ndb %d:cannot read symlinkconvert symlink %d(%s) of size %llu bad direct addr: %d bad indirect addr: %d LINK COUNT TABLE OVERFLOWCONTINUE%sINCORRECT BLOCK COUNT I=%u (%d should be %d) (CORRECTED) CORRECTUNKNOWN FILE TYPE I=%u㿘@< 1  p`(@% 0 6 0`X@%  6@ 6` ` 6#@t6@#    `H@KL @ ! *   0` ;  B`B #c ` c !$`w7 `6#( @|u p7c䀢  <6@#8 2G` 4  ;`a<`4@`0`? ;`@  E@ j;  `- !$`?7 6#H @|=87 2`@@((o7  #`>`` 8 872`h`;2`h - #|` ?d# `(`a * @ڒ " 6@#`!$` ` 6, `#x@{ؐ` @J`($`h e(`:` `` `7 `h `B*2@  7      `t@M?   4`( 6, ` $ "7@{#7  , 􀤠    `t@=p   `X 6, ` $ "7@{#7  , @ ~   `4"`. 3T``@HJ  2 6@8#6@# 2@| 77 @ `#""#"`` @  *@[  *@ #5 * #`" `?" <c``$`p$`t4`4`  "!l"ah&`` 4`$@L:` &`$`h /7 @ 䀢 77@{ @0@X P `$" h07 X@ ̒ 6*@E#  *@ `H@I BADEXCESSIVE BAD BLKS I=%u (SKIPPING) DUPEXCESSIVE DUP BLKS I=%uDUP TABLE OVERFLOW.㿘   . '9 `F ah  "ah 9@   #䀢`69@z  @#  @ 77 @ .` `$) ' +6-7/75979    r    #:`K *$:@ `2  #  %# * @ +  Y0l ` $l @ @8 #䀢`9@c K @t @ @G/  2 9@  P@c 9 @b @ Ғ!(`" ("#ؖ"@ ""@ؘ(@ `  !(@@ (`2@(@2 $`2 ( $  & $` phase 1b, inode %d/%d㿘   !9a|#`,@K@%`  :? ? 'Ą/ ?????9`,Ґ#x   "ax" +  `@6+ ) Ѐ %a|  !'J@  H ` @  `,&& DUP㿘  3 3   2 ax- ) +:  !( `x $ " $x!(!( 2 !( x@ Ң`phase 2, directory %d/%d㿘  !:a@$yphase 2, parent directory %d/%d㿘  !:a@$d0ROOT INODE UNALLOCATEDALLOCATE%sCANNOT ALLOCATE ROOT INODE DUPS/BAD IN ROOT INODEREALLOCATECONTINUEROOT INODE NOT DIRECTORYFIXBAD STATE %d FOR ROOT INODEDIRECTORY TOO SHORT%s %s: LENGTH %ld NOT MULTIPLE of %dDIRECTORY%s %s: LENGTH %ld NOT MULTIPLE OF %d (ADJUSTED) ADJUSTMISSING '..'..BAD INODE NUMBER FOR '..'  `?* : `m <"d*` €:@ ":@"   @ ::"@ Nb }!퀢 X!:@ E":@ ":@" :   h!퀢 C!:@ 0"@# ;!@ ::"@ $b:@ b#:@ސ" :   G!퀢 "!:@ "@͐#0  @ ::"@ b\  o@ 2 ! !:J@ #8! * a ! * c *# ! `?#Ԗ@ #Ԑ ` *=:# ?`:?   "/' ?????耤q$a+:@5:3:1:  ``%`a X":$ @c#0 >     : 5 28 @  J#`  cpc@ Ș"#  #c@ ͘"# c䀢 :@w# c! >`$ :@/#       :   @F7@  $  ?H @F|h ' M'̤* :"P&K%ᄬ+:):# 1:/;  :%  "7  2?0   #$ @c0 %#   `4*` ?2  {@Ԑc0 # `4*  3  `4* ?3    $ *c& * @  `"   " ɐ $  $ " *鬐 \DD.BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' BAD TYPE VALUE FOR '..'CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '..' EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYUNALLOCATEDDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORY (REMOVED) BAD TYPE VALUEBAD STATE %d FOR INODE I=%d㶀 # ` (   8  #  @ , $   (!<"@ 2#    < ob :$@ڐ#0 "  !`"` $  [< [b :O, <Sb ! `' // /"7  :c@T <"@ '2 $ 6,`<@ #( $ 7 @D:7 @D $ `& $  4*  ?2 @EL:4@x#0 "  $ 4  !`' //:# ` #/ $7 /   ?  w "74 $  & $  4* ?2 @E4 @ސ 2a U$  Q< 鷒c8 :,@"#0 "F E <b@  : 鴔<#P@?  : 馔<@#?$ :$ 陔7 @DS:@#0 "  $ & $`  4*` ?2  "  `  $L .2`2L  <cU:$@#0 "   .2 <cȐ& $ `8  < > !`!  2    2  <5  :$,@#0 "   ! @ * : ` ?!*` € $ =  <@g# $ aJ `2 =  #䀢`~  J#`y= (  <@J# o  <! @ @  *   4 *`2 O  & $ $  @f @a== @P@ #䀢`<=@tŐ x4 @ # /  $ a $a # c J @ =  薔c:#0 @, "   4*` ?2 *= @:`  $ @@@$$"@phase 3, directory %d/%ld㿘  !?cԐ@㿘 # *` ?Ґ!ܘ  V"-  % H? ) !J `@!J@ :?  J@ 2  `@@  ` `  !J `@@$  m    `4*$ $  ?3 ~ $  $ " !  *a& phase 4, inode %d/%d㿘  !?cĐ@UNREFZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%d` Đ   @??#?   /'#`@????V? ! "a' * : `?@!*` €`  4,`R ` 5`#`02#`"  @@##?cI ?cq  @ 2@?c@`5 `*@ :`@Ģ@ $ht㿘  `B ' +    4    c:  J* $:@`$ ؀  2 & @@7$؀ `  :#* $  * *+ c%c`Ġphase 5, cg %d/%d㿘  !@a@)(DELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATEXPANDCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS UNKNOWN ROTATIONAL TABLE FORMAT %d CG %d: BAD MAGIC NUMBER BAD STATE %d FOR INODE I=%ldFREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %ld MARKED FREE ALLOCATED FRAG %ld MARKED FREE BLK(S) MISSING IN BIT MAPS?b  #X ` ` ?*cH ࠒ @A ?c#0"຀5`X $ ! #䀢 @@R#p#䀢 2 %$@@# "X%$  ,`"cX $  @ #  @# $ %$P@D$*  ณ, @,: ତ@@D|@4 , $:`0@D*`@3, , :`@!  #䀤! @#@H%$#䀢 @@\#Ѐ ?#䀢 @#@P@Cܐ*  ณ,@: ଢ@ @C͒|@3Œ , $:`@*@C`@3, , :`@@L %   * "L? ". A?༘#<? Tc8@#""@ ?:`#4a#@"U%c?P#0?("?" #,%P![#%`Tഡ,  %`XP@Co഑* %`\ฐ`,`: %``?ଐ#,$@"@C]@3V| , :`@%`d?$("@ " %`h$ * @%`l@CB|`@39* , `l:` %`d@`\"U`d?`T%`#4?"@ c8?#" @#<#@ "L@ѐ   @@]@?$" #?c@#@  p  *@"@  8?`8  ??$8   6,    :c*% +@ * , @"!c<"   @ N"a @B" X@Bɒ/@  ࠒ @I @"U@ " #Ԁ A (@༒@B$@4 %` %`,?@2@&5`5`&%`$ $%`8@2 %`p%`%`$%`%`  (`@6%`(%`( ,`@6%`,%`,U` 0@6%`0%`0`@"U@%`4%`8%`<%`@%`D%`H%`L%`P`T`T@?#8 ?#4@?@ L2@"U%cฒ@BW?c?`@c  #@`@/`@"@  @* : `)F!*` €` %`` ? %`  `@"U@:@`\@   ? % *@  *( ณ*A H:`@”ศ Ĭ`%@"U    ` :`b@`\@   ? %*@*`  ? %` @ɨ @"U8 3 @"U  @ :`J *`" : 28 `:`c@``@   ? "+@@* 8ז@8e ``%`@A|@1`@-T@`T@ `"|@A@%j@1@A@A@%_@%]@Az@%XP@At@1m* `- Ԑ@ `X@@Ad*  2$`$>88@1R &``l:`@8@1I &` ?"@  *@ &,$`$ %`$ `:`c@``@  8 " ?% ::@ `4@ 8@@=$ 4 `l `p@`h @@  @  $4*   #  (  `p 瀋@" ?$4*  # ?#`$@ '` @ '` @ '` 'P@@ A`h@%@   `$@``$ `  $ `$$ * c @= X?<@̒ A`@"U@`T`T@ @"U@ T T?#8 @ (A`@ "?c<@@@=U @"U@ T T`@"U@`T`T@?8 @=? #X *` J#` ?c,@@ F?@"U`"@`\@ " \ $ @"U  "3A- ."   \ : 2  @@#@`   ?#,&`?c(@@ 6F`@"U# `` #@``@ $ @"U  "3A- ."   \ : 2  @?ؐ@Ԑ`Р   ?( €`@"U@b`\@@"U" \?4 @ !A`@ x @ "U@" \`@"U@b`\@?#4 @5' cX *`?c @,@@&LҀ?"?0%P??#$c@@@  A@@ϒ`h   = =--+ ,   ,  с с㿘'H'L'P'T'X @ H@: %s: %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. 㿘  #`# F@mO"@6v #` F@mC" 8F @m<"@: 㿘'H'L'P'T'X ԔH㿘'H'L'P'T'X ȔH%s (%s)㿘 (`x!F@#0ޒ㿘 'H'L'P'T'XH@: 8@q / @  <  L  r @{ /r㿘@qi / 1 !,@k /G`,@ַ @ִ0 /Can't stat root Can't stat %s %s is not a character device xG p"c @  G@l x0M8@  @G @l>'< @@#L@# %#@؀  fG@l~ !  G@lt @ `gâ @ `2 malloc failed㿘 GbH@9 @9# GbH@1 realloc failed㿘`Gb@" @9N Gb@ strdup failed㿘@㦐 Gb@  RAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedadoscd9660lfsmsdosffsCan't stat %s: %s %s is not a character deviceCONTINUECan't open %s: %s ** %sNO WRITE ACCESS (NO WRITE) cannot allocate space for superblock LOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO FSCK_FFS TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ffs(8).USING ALTERNATE SUPERBLOCK AT %d clean = %d %sile system is clean; not checking f** F** File system is already clean UNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED) IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=%x IN SUPERBLOCKFIXINCORRECT FMASK=%x IN SUPERBLOCKINCORRECT MAXFILESIZE=%llu IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%lx IN SUPERBLOCKINCORRECT QFMASK=%lx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for cylinder group summary area BAD SUMMARY INFORMATION%scannot alloc %u bytes for blockmap cannot alloc %u bytes for statemap cannot alloc %u bytes for typemap cannot alloc %lu bytes for lncntp cannot alloc %lu bytes for inphead  J#  ?* $" @Y   (`x!H@D @j?° <   H H@z "  @!   "a  (`x!H@" Ȕ@j  c䀢  H @j J ̀` @   &`?`&`Hɐ H@i 䀢 # H@i!#  !  "`" 0`? $`$ , $ ,`$`@6$ @6  $``a H]!@ "" (  "`<"|@  I  cx D 䀢 2A a @0 ": H@!8 3 \@@;LH@;z,@ 8 ,$x@d "`\@H HHHHHH#\!XapḘ!@ib  xH"@U  !$` HJ@iu"h  `рH`"xH"H"8 ?䀢 2H/"   $1  ,5 "c @;$  0 *@ *` t  :` :"8  @&<` @ E   `H"H@s#`2 " ,   <`cH#H@a#  "`<, ` `$H @Hڐ#8 ` "`H@h#`䀢 2 H@=# 2А* ,`   @ H*@H#p  "H@hؐ#`䀢   H@# 2В * ,  `0`H H # `0 "`HH@h#`䀢   H@# 2В * ,  `4`L H r# `4 "`LH@h#`䀢   H@Ԑ# 2В * ,  , $H0204"0H# F  `:%0H@hh#`䀢   H@# 2В * ,  %(`<I(  < `"(H@hI#`䀢   H@# 2В * ,   H8%8: @ %< "!%<I P  H8  :;%8H@h#`䀢   H@`# 2В * ,   L8%@: @ %D "! %DIՐ x  L8  :;%@H@g#`䀢   H@5#   * ,   &!8  ::8 L8  ::@&! 2 e,.䀢 2 II@  G   㸚` "㸒 ",` <:%0` "(`H8  ; 88` L8: ;%@*`+` ] eLY䀢 2 II@ܐ!   b  ` " "L` "P`#\"eT`%`"X`P@9L*  , @,: @@9?`@)7 | , %$:` *@90  ` |@)'*@ , :`@ L%@  $ * (L`  #x` А `@5`h`@  @T  "cP cP 2`I`@g"!80 4 3I/H5I7H ``0"4cP`8@8 ``da @ӕ* 2 Ɛap@C฀  @  {x  0  ժ` #`,`:   ? @ "cI!@fؒ0X 8 @  "a 8I ! 8 @  "c 8I!@f`0> 8 @   "`4 8I`"@f*`0/    # "c"Ԓ @$`@! $ `@@Ē   `"#Ѐ`@I"0@f*`0@\ Ӏ`  *c *# @  MAGIC NUMBER WRONGNCG OUT OF RANGECPG OUT OF RANGENCYL LESS THAN NCG*CPGSIZE PREPOSTEROUSLY LARGEsuperblock mismatches offset %d, original %ld, alternate %ld VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATE㿘- x    < :` @    a @ 2 !$$ \F!T@Ma, 4Ma`Ma@7  `,`@7А?` &`hMb! Mޒb( <@7`d`4 @'-@ $ <@'x`$   , @7 ,  @7*@  @ h@"@  2  t@"e "% ` " # # # # ""b *` *` *` *` X"`X <"`< "` @"`@ \"`\"@4,b"cL"#LcP"#PcT"#Td"$d"$ @4` P$\@4 d\ l$@4d`d" d`" `" eP"%PeH"%H8:8@;%@H"%H0:0@- h $ !$`+MM@e&"H h ?%M@ `$ @e:`  `b@  * $ %s: BAD SUPER BLOCK: %s 㿘  #䀢`" N!Nv#@dN#%s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A BSD FILE SYSTEM (%s) 㿘 @?"  ? #    O  @ b ``*: :@ ``O 8ѐ#*` G#_ e %h@3  &4 &8 &&$`0&`,&`8&@5`(&|``4@58? @5 @6E8?&`&?<``* &@"* &|?@&&8?@&!@6$&@6@&&$@&?@&&,`&d <`` &d`(  " <ioctl (GCINFO): %s %s: can't read disk label 㿘 !e`e@3 6  (  `x!O@"O#bad file type 0%o 㿘< @@"%  (@" 4 0@" 0 @ !$@   !$`" O@cՐ# INTERNAL ERROR: GOT TO reply()CONTINUE %s? no %s? yes %s? [yn] 㿘 #䀢`PPz hP`@㝐P`?@c   J ̀`P  `  P@c  W*cJ#쀢`2 P   J ̀`P@c F  'P@cz@)``$`@ǐ  $ *`H  ` "H` # <  H`? "`@ 2` <  y Y n N̒@cD <  y Y *# cannot allocate buffer pool 㿘  ` 0 "c@/" 2`P" #X ?" " " * c$ "c 0@$($  /P ?Ȣ`$ $ $" $ $, $ @6#@/ΐ @/`0  `#" deadlocked buffer pool 㿘 ## %   `d.  " 2 c` c  2 cQF @̘c  $" "$ c$c"`$c  $ 㿘  `d .@  `@! ( `"(  @`& & & WRITING %sZERO'ED BLOCK %d TO DISK PARTIALLY 㿘N` B`   <Q` @$>QQ!!`-``.`` @&`  Ѐ@# `  ' `#P@@4! 8   0"@ d * @` 0  CANNOT %s: BLK %dProgram terminated 㿘 #䀢`2QP@b  Q"Pa Q"UPDATE STANDARD SUPERBLOCKPanic: lost %d buffers MARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEANcache missed %ld of %ld (%d%%) 㿘  `  @'Ta 0  ж b J $`&)  < :`:  @ @ ! #䀢`! Q #p   <: @  $ ,9! #X4 @.5  # + `) 3 @"!`@.`@.  @"%#Q"@#  %a  `рa$ #䀢`QQJ# #Ȁ " ` * *`a$   ( ,`c̑* !Q#@#%* @aO@& @&SEEKREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %ld (%ld), %ld,㿘  < >:`@ @& 6R" R@&RW "@& 6R"ؒ @0R@`" : ) 9R/R#|@&#| * <` D @ :C  @&W <#| `@2#|@"<@"@`ɐ" @"@` #|@@Ͳ@P@` WRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN:㿘 _  < >:`@ @& 6R"g S@&'S  <"`0X ؐ@% 6SR"LS@`p  $P' +R<@&< @ < D @ :C  @%Ж  <@"$@`Pb <@P@`H CG %d: BAD MAGIC NUMBER 㿘 #X    `8 4  c "   ``8    ! -@  #: * J& : 2` 6` @ : * H" : @6`e`@!Ò@1Đ``@1, ` ` ?XU " `Ԁ S"`@ .# U%  ` `:*"@ +@ * `; c` ` ` ? #@+*@*`c 8@ $c?$$"$$` `8"o ` 8 "@ &^` `?/?..`@ Ҁ2`|T !!`|    !  ``  T !А!. M.   ?? $|/'?????#@ .#'̠0̐#l''Ȑ ''׿ "@.$@@-ݒ / @ ,@Ȁ0#Ta'''נ 0$| ?,@|@-" 㿘 #` @, returning to single-user after filesystem check 㿘T@^#  "c @, 㿘@  @,  @, %s (SALVAGED) SALVAGEUNKNOWN INODESC FIX MODE %d 㿘 '   !U#N 0 UҒ   @ #䀢` UU@^ H &  X   & &% `/dev/tty: x (  *`x€$ "$$xU!H@ x  &$x '@-Ӑ 'ܐ UaX'''@-ʐ'P` '' @-ǒ@#א$x㿘8҄Ї/  (-.`Ҕ଀  ': ) @@2 8&/@/8 /`/ 8܀ ffs_isblock㿘 8>U0#  U@ `?>@ *  @ *  *@  `?>@ *` @ `?#ffs_clrblock㿘 8 >  U0 U.@>@ *` @ *` * * .@ >@+ * .@#ffs_setblock㿘 8 >  V0 V .@>@ * @ * * @ .@ >@+  .@ ffs_isfreeblock㿘 8 ">  V0 V@`?>@*` @*` *   `?>@>   W!X㿘@㿘 `  aLӀ D D`` ` ! #D.``L`2`" L @@IL`@@?    ?  @ "?`^L (&: `@*` @"'@`@*@'@ @@vS@:C@?`@*@940 )&: `@*`  @"'@`@*@'@ @@v%@:@?`@*@   *L k&: `@*` @"'@`@*@'@ @@u@U@?`@*@0K0GL A@"`; ` @2#`@@?    ?  @ "?`"`*0" *㿐@ '@ @!Ӏ 2'@'@ !Lfwrite@P?# #W @s ch@s  @B 㿘aP @ `c ?   G+ !H` @ +  * `@:6!H` `2  " @ 퀠#@``  `2  " G#`ő+ P $ +  @ *`@  "`"@ ` `@@`" ` ` @%  $  2!L` !C("& ` @ &` @@*  0#` x!P `* * ' ' '''' #    `2  8 ܀  " ؀@ # "  `2 8 ؚ `  @;@ 0.  "  ` ` `.    ` @* @ . "   * @.   exponent out of bounds㿘  ?    !x "p #  `2 - 0   0* .   0*  ϐ   * ` / 9 "7` @ /  9@*`"7` ``~ @Y.@r  `=4 = `` " `@"  `<*# `     #@ `*  ,#p ) А   @ " @7* 02 0"    ` .  * 0  #p @   @ 0+  *@ ӂ@   ҆ R t*  .   Є?*t"`"#p    * * ``  a@ @6a@  px " (* `@" a@`  px `" + `*㿘#@`y'T 6.`)ғ.`@ "*`@@@&`` ?"#%#$?*  b ` )Һ *c9#h@* @ *`"@ ! $!0㰐 @?] c #@* @*`@   ,%@    # @ *` * @@!0!0 @?; 㰀 @!0㰔 @!0!0 @?' #'#㰐 `%T?! !0 @? '  @@a0?%#?!0@> "@`$㰑.` b*    @u!0 r%sfcloseline too long: ignoring %100s...㿘#Į@`'L !4 % 8 @ ' 8%Ġ.  * b'Ҩ5[;[   $Ȁ %L@*`z?@ @h $`p* @@po  $%`? "`@̐ @  "@ ,`,@:  .  Ȁ G ?%Đ"  "4?"a8![ Ӑ!@  ?,"&1&@Ȁ? [`x@p) $%?"&&  @pz!"&`? "`@| @  "@!@@&&?line too long: ignoring %.100s...㿘#Ԧ` @ aD'$Ԁ F?%Ҁ  .  b* @$W?Ѐ # !#̀@6N?*`@ [@`h  $#[* @`p@o #̐ $## aD В@B< `"!L? "@ '̖$԰? " 0aD@PЀ? [`x@o $Г. @ "*`" [*`<aD@o#X realloc of linebuf to %lu bytes failed㿘J؀  )   bx*%!P&@!P-'Ӥ +\*`@:  0 2 # bx * @$$bx $ bxaX@oK Pbx$$P &@ ? & @  &2,!P ?!P !C ,!P $&`fwrite㿘@쟒  \b@o 㿘 `" @쎒  \b@o 㿘.  * b?@  @= 2@颐$@?'   N@>? @#I?8 *  ? ''' @Đ  @ k2! @ѐ !k!pl a @4p#[@n @60 䀊   :  2p  p",  @g??#  ( x "$`@> ? @6 ?"`a`  ( x ? ( x    $pp.# @1k"܁ 㿘  ` l`  "` `(`2` lpk" b@"x q!.  @??!  ( x ""1k$ @ ? @5Ĕ ?"   ( x ? ( x   $qp# 1k"܁㿘@ (   @*`2 ,-o %s: option not supported㿘@  @Y 1'q n L  o  @4 = 2*`"@ 2  q @2    &*@&c @   @" 2L@ؐupdateasyncunionrdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotamfsinsane maxpartitions value %dNT:a:b:c:d:e:f:i:m:o:s:NOS:T:a:b:c:d:e:f:g:h:i:k:l:m:n:o:p:qr:s:t:u:x:z:%s: bad sector size%s: bad maximum contiguous blocks %s: bad block size%s: bad cylinders/group%s: bad rotational delay %s: bad blocks per file in a cylinder group %s: bad fragment size%s: bad average file size%s: bad average files per dir%s: bad bytes per inode %s: bad track skew%s: bad interleave%s: bad free space %% %s: bad rotational layout count spacetime%s: unknown optimization preference: use `space' or `time'.%s: bad spare sectors per track%s: bad revolutions/minute %s: bad file system size%s: bad total tracksffs%s: bad sectors/track%s: bad spare sectors per cylindernewfs_%s%s/newfs_%s/sbin/usr/sbin%s not foundswap%sr%s/dev/%s%s%s: %s%s: getmntinfo: %s%s is mounted on %s%s: unknown disk type%s: %s: not a character-special device %s: can't figure out file system partition%s: `%c' partition is unavailable%s: `%c' partition overlaps boot program%s: maximum file system size on the `%c' partition is %d%s: no default #tracks%s: no default #sectors/track%s: no default sector sizeWarning: changing optimization to space because minfree is less than %d%% %s (%d) %s (%lu) Warning: calculated sectors per cylinderdisagrees with disk labelmfs:%dh@kr8@ے`؀ ?'    "`|"`"@@ r @ْ b@ r!r!` `''''ВP! (; 9% 7/ - ''''ܐ@ ?A? ;9x* l@€  2"`  ."bd@ )'bTr @P$`  "t@y Ԁ "`\r @h`@m /' Hr @~ `@b Ԁ "`Lr @r $@T Ԁ "`r @d`@H  "r @X〤`@< &Dr @M؀`@1 Ԁ "`hr @A(̀`@% Ԁ "lr @5H`@  "r @)h`@  Ԁ "@r @`@  "|r @`@ Ԁ "P c`r @`@ Ԁ "dr @` @  Ӓ xu`r @ r "Xg"`T @  r"T\" X@ΐcY`@ Ԁ R"8r @HM` H"`|@  B"r @h=`@ 7%r @2`@  +"\r @&` r@ǐ 2 `@u %lr @`@j Ԁ  "<r @z`@x`"`*`@ &  @&  @f b@ 4@ @ ,r@ ' s$@颐!s s($&@闐@0s0$@鍐@0s`@@VY  @ %s`P@X  Ȓ @ y! $ " @. ''77''/7?''''7@Bǒ /   "Ps `sX$@L@A?2 sh@?$ b` O?@    (xs@p@Ғ@ߒ  2 s (`x@ !s x@Òs`@q   &  rs `@b  ,  @ے  s`@Ր  s`T@줄!' @  t "@& s "ts@ l@贒  ' (s`x@p@p@ 耢   (sx@`p@a<    @ 2 @s8 @=@@ ?"sJ?`` ?Ѐ@b `s@@7 @ @✐ `*: :@ 2 ` s@!@M@ ` s@!@@M@  @%@    b@  sM@!p@@    H "." \  l0 "\s@@!l  bT, %ls@@ܐ!bT  ( 'bTs@@А!`@? L"`@|  DJ "| "|D   H` &D($*$&D H  ` @`  ' HD*  4 ' H\    H@@? & "`\  D* "P `T X?sb@̐sb8@ǔ  " T`8?@"`88l<@ ""XB"< \@rl<8"   ""x`sssb`x@ם"  2@ H2 "@ 'P`'T`'X` bT'\!!"P@D""l'bT@>%l bX@9 "X x@3 "bx@.%@@ #$@" `&a:` "l'bT@! %lX@ "X bx@ "x@%@@ $@@2 Pa b@"@ @ $@`&a@@ G:` $@ b`   ̐@  @ ` @y@w @`/@ s@b xܐ?'`' '' "hbT'\@ '`xr``@؀   (s`p@x@@ X  L\Ќи P|Ѭ <lҨxӨӸDlԘioctl (GDINFO)㿘  e`e@  6 3 bt    `@$9" sbt@4 0 x@S!`Ԑ @, ioctl (WDINFO)%s: can't rewrite disk label㿘 # `6!6 e`g@  x@Sb"x"@㿘'H'L'P'T'XH @V   `8 @ @ @@S@ -z tracks/cylinder-x spare sectors per cylinder-u sectors/track-t file system type-s file system size (sectors)-r revolutions/minute-p spare sectors per track-o optimization preference (`space' or `time')-n number of distinguished rotational positions-m minimum free space %%-l hardware sector interleave-k sector 0 skew, per track-i number of bytes per inode-h average files per directory-g average file size-f frag size-e maximum blocks per file in a cylinder group-d rotational delay between contiguous blocks-c cylinders/group-b block size-a maximum contiguous blocks-T disktype-S sector size-O create a 4.3BSD format filesystem-N do not create file system, just print out parametersusage: %s [ -fsoptions ] special-device mount-point usage: %s [ -fsoptions ] special-device where fsoptions are: %s 㿘 b@    8!yb @G   8!ybX@> yb@9``` %y@ "  " `@'  @@ buffer malloc failed mfspreposterous size %d preposterous ntrak %d preposterous nsect %d illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size (%d) cannot be smaller than fragment size (%d) fragment size %d is too small, minimum with block size %d is %d There is no block size that can support this disk With a block size of %ld %s %ld minimum bytes per inode isMinimum bytes per inode is %ld With %d bytes per inode, minimum cylinders per group is %ld With %d sectors per cylinder, %s to be changed from %d to %d This requires the block size %s to be changed from %d to %d and the fragment size%s groups must have a multiple of %ld cylinders CylinderWarning: cylinderpanic (fs_cpg * fs_spc) %% NSPF != 0cylinder groups must have at least %ld cylinders Warning: Block size and bytes per inode restrictBlock size restrictsBytes per inode restrict cylinders per group to %d. file systems must have at least one cylinder %s %s %d %s %d.%sWarning: insufficient space in super block for rotational layout tables with nsectand ntrak File system performance may be impaired. inode blocks/cyl group (%ld) >= data blocks (%d) number of cylinders per cylinder group (%d) %s. must be increasedFilesystem must have at least %d sectors Warning: inode blocks/cyl group (%ld) >= data blocks (%ld) in last cylinder group. This implies %ld sector(s) cannot be allocated. Warning: %d sector(s) in last cylinder unallocated cg summary malloc failed %s: %d sectors in %d %s of %d tracks, %d sectors cylinders %.1fMB in %d cyl groups (%d c/g, %.2fMB/g, %d i/g) super-block backups (for fsck -b #) at: %ld, %s/'D'H@  ? ''"b@ @ "bH@ @ "b@ @ "bDy@7ސ#x@c @j b@ "B @}'b@ @  ?2y@#@I @+) ? @>: @< @ x   Tb@  bp ?@@Β "  ! @ s"T@ ` $"h@  "d  "c("#$?"e,"e(  <"%("%,  y#@7{ @ T@   \`"l  y@7i#@ y#@7` @  hl`  y@7T#@ِ 4z @7K @А  H`D 0  4z @@7=@  " z p@73 @ "T   z @7( @  z В@7@  z!@7@  ; ;`8 8 H L888@  P =   "`P 4  " T =   "`T0"`T:   "8  =   "`` 8  z 0 4!@ @6ח:@\ `d  0T22 4$%P$ t@$ x$ |`| "`d =   "`dt`p4?@8?@~@&@v?@r@u|&@f& ?@b@e?&  &?=  * "`@* "  0 *` * ?: ;%0 `t:`@P<  e0@B?#@k 0 *  "0= X-`*`"X@d@g"`8`*` "``"8 4 02  8z@5|!z@5y!@ * `: |* # |# 8# `# 4 %P@>*   ,`@,: @ @1@) | , :`%$ 0 *@!  ` |@*@ , :`@ "T@@  @"?`x @@$`)z `8  @"`0=` @* ?`x@ݐ@x@אz @5! ` 0 8::$ `$ 0$ 8@Ò@ƒ$ P@,`*  @`,`: @@@ | , %$:` 0@ *@  ` |@*@ , :`@ @`0* ""`0`@ @~"`x?@y@|$` `0@p,`x?@k@nr` 8 0@_* ?`x@Y@[x!z"@T"`0 @I* ?`x@C@Ex@= @4i``  z@4`"(z"H@4\` z@4U"pz"H@4Q ! `" 0`H zz"@4@b" 4`D zz"@45b@  L @"   z#` z#Hz#X @4 ?@@b`$  L`@ݤ @Ԑ"`x?@ϐ@Ғ$`0 @ȑ* x?@Ð@ƒ "" @$@"x?@@ $ %P@*   ,`@,: @ @@ | , :`%$ 0 *@  ` |@*@ , :`@ @ bx "\ 22 : :` x#"\ eP␀C`" @W$`@O"`x?@J@M$` `@G*  `, @,: @`@:@2 | , %$:` 0Ф *@*  ` |@!*@ , :`8`  @ |@$ @ `@, z@31#p@ z#@3)@ `L0 "`z@3# `` `@  z@3 # `"{{@3 @3 {@2 @b`@| P@Ɛ*  , @,: @@@ | , %$:`@ *@  ` |@*@ , :`@L@  $ d|<$$@@@$ఠ@ $ఖ ' 4 {@2 `@% "| D @ehL @ "X L  h XX@]P* #X @W | `@N* %P  eh`#\%`$%X$%T%``"%X"%T |`਑* * {  {{{{`#\ @2O!"cXD LX "h *" %P .#\?"L?, TP@* 2%P cXܠ@8 |@@ܒ@ݐ@缒@Ӓ@@Ґ@籒@篒@@窐P@ƒ@`,L?= .#\ T@* R?eL?2eXe`@@* ,eL?2eXe`@@L?,.#\ TP@*  ",L?2T.#\ P@t* 2`8@`@A$, $, x ` @Q:  @ $  ,8 ? 4  @I``@B- `` @;$&)`,#{a@@2@,-  @%@8$8@@1C{!x{@1<@ ?@ `$`"@ e @``@, @ $Q2`!{8!ȓ* @|@ @1@ %{@ݐ`'`@ג, ` @ѐ`8$@Ȓ@Đ@0!{|"@@@0 ,$ , @  "@$ `@`@| $`$`d`$* #" @  %{"`d`|@:@?`$"@@0 ,# p%D*  0  L2  # #  # l  =   "`p @ "c{@0"@  ` PF\ " T <$%\$ @$ <$ X@J$ \`T, $ D$ $"$ $ $ $ *  *`@" @`0"|!{$@1"{#H#\@0P`$!`4`{`#(`,` &#`&$" HH?'#\@02`| {@0+#`@  , 7 1{5{3{/@| 2%`@@. ``d , @Ȓ#@/ @/c@`,| 2 {@/# "`` "@ @b @f  T@$ t@F `T`=``0"`d *  c @0 0   `,D@|```@w. ` t`d@,`,D *  4" ;* "@ `2@2 @@ @ @ {@#Panic: cylinder group too big 㿘 " @7 $4@..@& ༒@$@ $4?@  @ #! .@ࠒ "H@G@"H"U$ $ $ ,?2@4 4 &H4 $ $`@8$ p H$T`,  $XeP@`* $\``,`: $`e$``@`@| , `:` '$d@`@ | , `:`H ?$h`h` $`h%$ * @$`l @ `|@*@ , :`$`dHdࠐ" $@.!@> %  '" @"U  H: ` "`\@@  ? $+@*H ?"  ')  0'   @⌓,  "l0 2  "@L```@G. ` `d`0,@" 8 " x ` @0: Ԁ @"U@"`8H`"``cؒ@@~%$`H   l;  +  $  * * H``$`@ |@ * `"`T`T@@ `" |@ @ʒ @@ @@㿒@㽒@ @㸐@%P@ H* "X@ʐ@* H Ԓ@@@@ @%P* @@@ 2@`8`("`(H (" 8 @~$ ( 1$@*4  "  8@ "@@'@"U ``H: ` "``@@ `` ? %@+@*H`$@ "$`8@"U@X`8H`"``cؒ@@%$`H   l;  +  $  * * H``$`@6 |@/ * `"`T`T@@ `" |@" @ @@ @@@@ @@ %P@ H* "X@@* H Ԓ@@@@ @%P* @@@ 2@"`86/H&*`4 @ U"    "H: ` "``@@   ? %(@*"H $  "$%$`9 H l  p  h  `!     %$4+    "  ( @ `H`p怊  %$4+   " H` $`$`̐ $``Đ $` `Ȕ$`'@'` '`$'` @Y```@T. `  `d`0@,㿘  "@ b"` "`"`#!4b "db `4 Ԓ #Ԓ !@$b: < ! "b@`4"$(`Le@ :`B *2   $hbD`d`4@* @y 㿘  "D "  `` `6` @˒`?$ @ a, @*` `2` @"cg 0: bad magic number first cylinder group ran out of space internal error: can't find block in cyl 0 㿘 " ! d*"H@"H@`"U+#` 2`$#  bH`"c``@"@8@ "bH 8` &`#@+ 0"@bH"U `> ` @"%$`bH   l: * $  * +* bH ` "?#` # @ ? "` #` `#  ""@@ |@9 bH* @"U@"TT "" |@) @ @@! @@@@ @@%P@  bH* @"U@"X@@* bH Ԓ@@@"@`@eP* @?2@"`0E`4@ "`8 "@ " `8`̘#bH@ #`$4 "$`8"@*`   `8 '"@"U , H: `"``@@   ?" +@@*" 8 " d*@AbHfsinit: inode value out of range (%d). 㿘@~@@M) "! & l d*@"H"H@"U@" @*#@' 6`\?"  ` * @* b d"H@*b #"?",@X@ " @*{@  @@H @ * @@  @@ @@ x ` d* @,@  0@"@tx*  @"0@Ĕ@i㿘@ getrlimitsetrlimit㿈 "8`%% @h @>? * "@`$8 @ @d"?@B  6@Y""$p8p*@ 8 " $p@: 㿘    @@㿘@ @ seek error: %lld rdfsread error: %lld 㿘 "@`   "T@ h@@q00T>  ; @!  #(  @- 6#(  @) 0@ H@+ !@7 >   @) P@ؐ H@ "wtfswrite error: %lld 㿘 "@`  "T@V bh@(05 "``1 T>  ; @W!  #$  @ߖ 6#$  @)[ 0@!p@ݐ #@ >   @)J!x@!p@̐ $isblock bad fs_frag %d 㿘 8>># 8 2 8@  `?>@ *  @ *  *@ `?@ *` @ `? @b clrblock bad fs_frag %d 㿘 8 >   .@>@ *` @ *` * *.@ >@+ * .@ 8 @csetblock bad fs_frag %d 㿘 8 >    .@>@ * @ * * @.@ >@+  .@ 8 @î`pCOLUMNS㿐`h @&?   @!H  @u* " P㿘@ -%c %s -%c -- %s 㿘@  ""% (#!-)/  @(Va`@(R!`@b? ?@(I@ "!*@(?@ "`@$"@(8@㿘@icall completed call aborted call abortedinterruptunknown ACU type,call failedr%s: can't open phone number file , missing phone number㾈  R d'`L'     @:@ a lb@ 0!!@ @  @#4 & @  @ @'Đ#נa4b  @ Ζ "d  $!L#0`" @֐ 11ð#0 @`Հ "bd1#@J@ @3 ר!4'1 % #X'@z@ 'J * '@쀢 !"d`€ d$0"dc`@   'J@ U !  P@xycp 2  P@'\#x1t#)9'#@}L  ', 'ע!4`@5 2%@{@'@d#*@쀢 1"d   "c0"d``@ 5 '!@vs @ #0`     @[@4"da@  0 "d` 1 #`"da1#b@ call terminated disconnecting...㿘 #0`  alb@ ߖ 0#2!#bd!!4 b@ і T!N @& 0 "d"dab@ "d`㿘 @] #4@ 㿘b  b@   2 v831vadict3000courierhayesventelhourminutesecondLocal file name? %s: cannot creat List command for remote system? 㾘`. ?> "`` * "@l( "P!В@,$ @8@B!# $b\!@&60"@! @Ȑ0b\@[p[take] usage: from [to] %s: cannot create cat %s;echo 㻘 "P#(@$ *% `@[   @%#00`$ @ @B! 6 @%#P0 `h$@@x %d write error lines transferred in 㻐! ' 'H'L@@ bP  @k" a  @Ibh  /@ڔ ! @= "` O ` ` 2  @ΐ  @#`@K @  b P ״!4 '% ` @    "``O " 2/3*`L@:  -O & #*O`  'VN P`@%Q"@"H@"'@%AX &"'"    H@є@%. XR"`  ! h@ "@  @S  `D  @굒bh@ΐ @HLocal command? can't establish pipe can't fork! can't execl! 㾈#p@ ޔ! M@: @$#0D@> @$#0<("@ Ŕ!  @K@I@ 0+@C`@ ap @ @  0@s @( @&  @@$#@0 㿘  "b @Z r%s: cannot open 㿘`. ?> "`` * "@j\  8!В@ `$ @l@ua8 2!!@@$j0 !4 L@ T!~  @!` timed out at eol chars transferred in 㿐 bP'H@   a"@   @s  a  @͒bh)9 ; N% *`@<: N !4R!~`@鵔 0@!@վ @ ע!4  3  ? & @`  & u' q``Taހ +`'`  Taހ   '2Taޒ!4Raހ Ra> @   @    @ "!4Taހ " !4T!N `P@#T!~ " !! @I$"H%   @? "H`  `@#"@@0 `  "``L` @# ~ ` !4R!ހ`H@ H  *`@: N @ @@( !4RaN " @Raހ $@"X @$@ h @` h@ b @ [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo 㻘 "P"p@ $ 8! #`@   @##"x0)#`$`@#`@t/a8 !@@#0R"` `@$ `@$b timeout error (%s) 㿐   /@ צ!4R!~`" 4a! @q$"H@o @k "H`!#@ o@"͐` `c`@  4㿘`@u   "bHcan't find `%s' away for 㾐@: ` "@ . :  * "ࠐ@hn #p@ t! g bP@9  @>  @;   @  a   @ bh@ @"n##' ,)  @ #' ) @ӧ a4R!N` @ @Đ   @  @ @ @"B@ǐ a4R!N`" @! @ǐ "@@` @͒bh" @a  @  @ߒ 㾐@ ` "@ . :  * "ࠐ@g #p@ ! j bP@﯒  @ﴐ  @ﱐ   @(  a   @灒bh@= @!##' /)  @l #' ) @ !a4R!N` @  @ @7   @y  @v @ @!@: a4R!N`" @! @: "@4@` @@bh" @Ԑ  @U  @R [sh] ! can't execl! 㿐@!!X @@  @= @ ^@ @@ J@!r!` @)  @& 0 @"  @ עa4a\@% /  a\@ &b @@!R!h@א  can't create %s 㿐 bP% @ צa4T.  @  @ @ђ@` @˒bx a @澒O`n @!!"[cd] %s: bad directory ! 㻘#8@ $   <`"@B 6#@@ @ #X %s [EOT] 㿘 bP@  "#@ @ #@  @Gb@ @` 㿘"`   @)@j@n א 㿘@    "b#@ -c㿘פ!4a\@%7 /  a\@ z4a\@h  J "  " J"@J  2 J`"J* J &J %s%d %s%c 㿈ը#T  @@"$@@8`@ _!ըcd # `22쀢 2 2 aЀ`  s@ C?@ =!`[set] onoff㾘"Ȓ@ ! G@bנ!4  bP , @ϒ !%  ?,!% !  ?,!a4   ?R.`*a4  ?R`*@"a4@"ؖa4   2`*   ?*@ I v %s %ld %s falsetrue㻘@ a4 da4%)-+@f"  ``">T ``"  K 0`"?L E `$@l (@ ?`$@ * $@ev` ?"`* $@eh   @`0  ! 8 @ H@{    @O  8@r  h!  @@RbЀ  Ȱ d$Ȱ  { ;'" @ " @ 㿘! # `{@Ԕ @  `z@Δ 㿘@. >   @@ߒ @~{[*?$`'"\pipeecho %s/bin/shfork"Echo" failed read"%s": No match Buffer overflow expanding "%s" 㻈'Dc@ D@G @<# }DD(@$@O ?" #0@V@T @H@P@N @ @@w ? @#8@: @80J@5 c`@T$@-@쀢  '쀢  @c@0 @#P) $D  cX  D ch@ 0#`*N   ( 1  J  81 *#`㿘 N@ "N    send breakget this summarylist variablesset variablesuspend tip (local only)suspend tip (local+remote)exit from tipchange directoryconnect program to remote hostpipe local command to remote hostpipe remote fileput file to remote UNIXtake file from remote UNIXsend file to remote hostreceive file from remote hostshella:l:s:htoe0123456789%s: cannot specificy multiple -l options /dev/%s%s: unsupported speed %s oddevencu%ldall ports busy link down noneConnect failed 㿐  @L !   ""l"`   )/ -579 x;`Ds <*` € ( l$l  l 8 @c@+ ! ( @Β /  V$l @cP (` @phJ`2  #@ 28%` ( 8` @c@ !4 "! '2  ?2`d!5@Ɛ @  "l@ *?l " @l *?@@W??*  @  @" L@8@ @ @ @ߐ #`` @5@ ?@ @꜐ 2 @ 0 @ wb@꒐ `@L @Y@@ @b`@!4"!LUఀ`@`@ " U@ H@ @ Rb@m  @`@Z@Z@Z@Z@Z@Z@Z@Z@Z@Z@ZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZXZZZZ,ZZYZZZXZZZZZZY`Zusage: cu [-ehot] [-a acu] [-l line] [-s speed] [-#] [phone-number] 㿘aP@ @ 㿘   "c#@ْ `'Da@* c' "#@  / "bĐ "b @ Mb P R `Q @# @  R`א!4* R `  @8 "`@Ґ !   @z  "c #耢`"  @뷒 R`א!4* R `  ' @O  ` @먔  @˒ @ wb@D '@鿐  c耢 ?āflock???%s (%s) <%s, %s, %s> %s 㿈֢!@ 0R @  @##0&@͗  @4L@-R 2#@_ '@|2* a@cИc#\@#`@da@a@ @Racan't open log file %s. 㿘נ!4 @l`ր "a@  @`؁parercfoexesdiprpnoeieelcucmdvat/etc/remoteREMOTE%s: unknown host %s %s: can't open host description file %s: possible reference loop in host description file brfsdu%s: missing device spec %s: missing phone number %s: missing acu type hdraecbenbsctbvbnvtantrwdctip.record  dlclet㿐@霐!Д !J /@ #0#0!"`"`#0@ 6G# `l  N /?$`l@~  ? `l     # "t2ఀ2`d !  $}"`p?? 80 8 a@ٖ0  8 @Ғa0 @̒b@? ֢"`- + % ' ) /3 5 7 9 ; @ 2 @S  `  @ `bP? !$bX@ U p?Td$% pTd  4db`@5 :@ 4dl2 Td bh@}@  Td ` ""`Td   L`2 Td b@e@ؐ Td   `2  b@U@Ȑ @ :U`@  2 `  `  Td " 4@@l 24@ 4@ "`tb@۔ : א "b b@є : א "bb@ǔ : א "a@b@ : "!@b@ : א "b`b@ : א "bpb@ : א "bc@ : ""c@ : א "bc@ : ""c@z : א "c@q : א "c c @g :   R גa4*`  "@ `\ #(&`\  #8&  x`@ !h  `@ !X  H`@ x!x  X`@ q!Pc@@?਀?"&cH@7 ?"' cP@/`h? '`hHOST%s: no host specified 㿘#<`1 @͐"H   8 @MbP@ " #< l` $#<"##  @U , 2*# "`l&# # &#" l lcuusage: tip [-v] [-speed] [system-name] %s: must be interactive %s: %s, unknown option %s: phone number too long (max = %d bytes) tip%ldall ports busy link down PHONES/etc/phonesnone%s: bad baud rate %ld %s [EOT] fcntlConnected connected 㿈@ @ @"bl @13"`8 @1("bX "bd8 @cX   ! $" ג9 ; @c`@' @  8 @c@ /) -5 7 9 );% ! `J@ -  J 0 9 n v8 $"T  $"T@e% 8@y? ݲ``,b @ `2&!@簐 (  8 c@^ @ѐ @f `J@ 2*@ "`L @M !"8@ @ @ @  ?@ #@奐 2 @  @b@囐  @G b@@擐  &P &P@@b 0ע!4@"`   8`@ 8@ @Wb@r R` @א  % @ݐ P@ @Bb@] T  @ @ ? @ ``@i ?@ݒ ?2 @``@^ "p@A  % "`  "p%   *`  *`!     : ( $ % $ $"` """ """"`"`"`"` "`"`"`$"`"`(" "( *`"$*`*`*`*`@T*` @ Đ`@% @  @/ %  ``h%x@j@ "bP@@@ 㿘@ @b b b `@ @Ԑ 㿘!   @bX $ 㿘!   @wbd$ 㿘 @bl @mbX㿘  @] 㿘 p @U %s㿈 'H" <''L`@ː ' @ǐ '#@@ @Q! !H3 `H:  H*L'L 'H ? & @B`H  &`H2*`H*@䗐 @䔐  `<  H@  㿘 @䁐   "<@  !@  %c㿐נ!4T!.` @U j#`H+ ) /? $@`H  $`Hb`  `//OL o@-  "T`2H \@f* `/@ \ b  !4*J:  OR`?"O` "  @ T!  @`  2 \L @2 \`H`? "`@ `H  $`Hb` " ` / \@wOT `" ` a* / @Y T! "O@$|㿐 H a?/ "@k  H  # H "``" Jc* c>  %*L@ 2  "X 2  @:`@@ @ L 2L*>  ` @ 䀠  `" J@ @* 8(8`  `" J@ @   J  n r t fEb㿘N 2  ^ ? \K  /`  `? HH? .@ `@2 .@.@.@ `.@.@`Nְ.@* 8``   ^(` @ ?*(((%c %2s%-2s %c %s 㿘. :`@:"Jc %cר!4' %#  "M oX 2 M oĠb@"N    * @ N 2 h# `@䖒@1@h R`ט!4? * @ Rc ' @'Ȕ  >/Ԓ S! :w''Ԁ'/'`@ Lost carrier.write㿘 "``  !( ?  @*@\   ( x`2Ð H@ Xoddzerooneeven%s: unknown parity value 㿘א!4" `""" " `0@    ;"b`""``@x    ! a@m  a@e  a@]  ! a@u@ ֖!(a @  * $ @ 㿘 a! "h@  `@ @ْ !@ a㾐 @  @ʔ O%׀` ) +1 3 ,@@ٺ O ` $ (,4R!.`,!쀢 @4"!, y/@eb %! n/ y/4 "a,!` @ٔa@V 㿘R"b` !쀢 @@l 㿘ה4R`?"  !@= 㻐 @ᐐ  @ፐ b@ቐ !#@ᄐ bp@တ @} `@y  @ !  @ᰔ+/ג @ᨐ  `$@A h` ( x`2' @ᔐ ' @ዔ  `L  `,  ` @4Ra. "ǒ 쀢"’R` @ے :   *` ``^: | " L?  "   ` * "@Y * /var/spool/lock/LCK..%sCan't open lock file. Can't read lock file. Stale lock on %s PID=%d... overriding. Can't seek lock file. %10d lock write(Ȓ!@!*@! M @  @> @b\?@؆ P 4 ,@.@[ @bJ?@H@  ( x`@F:? c@ݐ  @@  @@1@͒c8!?@acP@vv@@G@  @@<@ސ#X?㾀Ȓ!@@,Home directory path too long: %s %s/.tiprcrset %s㻘!4`!4   @ 2$  "  $   2 !4@!l $ !l @da+!4!l$@_@c[a !4' % @9@ 2*@j#@a @Ȑ!4 `u ?*`uaccess denied out of core 㿘N @r  2 @#(0A  "1N@  "  5 " "+N@/  " @ )  P @ @l & @#80  ?.   &  !V @ N  &   . all 㿘`@ #!4`!4L @  " @y  2L `@; 2 @ ` @ $`record%s: unknown variable 㿘@ =  ,@ ; `  @^#b03@faP hT0%@ ? "N,@Ӑ L`@  @0 ! @ 40!X@G%s%s=%s=%-5ld㿘  !``"$`%  ?`$  @ * $@V `"$g`@$`   "V   "([`; "BU`  `?$`􀢠"   !* # @VŐ !@"7`@"`  `-$` 9 &`@$`@Β `` "@$``@"` `  $`WN `@$`@` "$`@ 㿘.`2 .`.`   @) `?㿘a4 a4@y   " @p    n r t bf (: [ *`8"W) :\ ^2D+J? +<  Є (8Haa  (8J"J+  J/ 74?(JЄ /  74?( ?+ + +  (:  \) (+ ?㿘t 2    @\ߐ @aP ђ parparitylelocalechohdxhalfduplexrawrawftpetetimeoutcdelaychardelayldelaylinedelaytatandemdidisconnectecechocheckHOME/bin/shSHELLverbverbosetabtabexpandscscriptremoterecrecordrcraisecharraraiseprpromptphones/var/log/aculogloghohostfrframesizefoforceexexceptionsesescapeeoleofweofwriteeofreofreaddialdialtimeoutbabaudratebebeautify starting call...K can't initialize bizcomp.... can't set dialing mode...D%s 7 can't get dial tone...ringing...1 %ld second dial timeoutbiz1022 פ!4TN`@"@" "$""Ȣ@'/@t "Ж (@  `@H@ԉ@" 2TN#@ 0! "@ڐ#@{#(#c ,c0@rHٖc @W㿘`V㿘`؁㿘!  `@D @H  @ 㿘 ` @4a8㿘ה  "c!@ 㿐  @@!a`@9 ' @Ȑ!Ѐ @ a` ` @@ @&  `` @ /Ȱ @ 㿐'Da`@ '"#@a` ` @@ߐ DJ `@/'D DJ@   @!Ѐ @ c`?Using "%s" can't synchronize with courier couriercan't synch upAT E0 AT C1 E0 H0 Q0 X6 V1 OK AT D %ld second dial timeoutcourר!4R!N`#@ ! x @~@' @  @g @ #!4`8@S ` @cP@v `@K `cX@ @t#p @h `cx@ N`' %ג ,J ="*J  =`@@x`c@s @؀`$ܠ!4 ,c@qZ ؀ @܁㿘! # `x@ @   `y@  @@ 㿘 ` @=ctimeout waiting for reply 㿘@ ["ג  "@!㿐'Db4@  '"#DJ@  @   @! 2@a` ` @˒@ǐ DJ `@/'D   @ް  9600/ARQ 9600 2400 1200 RINGINGCONNECT%s #X | `@܋ @) @]`@+ x@ڬ i b4@ڧ 'x@Y @"#ؐ ?;' ` 0/#` LO ch@Ð TaN cp@8  6#`0#@ #   %* |?''||$ @! 2ע!4@0`, ` @-@( 4@ #xx@D   AT Z +++h'  )Ъ%- @   @E! (@Y,@  b@̀`@ ('̐@ 0 2+ @ O  @ K  @  @ @  x@Ք @  y@ϔ ``!@  㿘@ @ @” @ @`㿐 ''@Œ 㿘@ 㿘@ connection timed out dialing...X  Ȓ''D'L@w/@'@  "H@,' @ ڐ#@l 0hR"`"@ ϐ#@r L "Ȑ '@O@m$'$@(W$@ @ `k@C `l@<bD@^ @D* @@2` @ c@4 @8 c@- @DD@'@ L $ Ȓ@(@ܐ@ OÐ A`?㿘!  c@ @   @ޒ 㿘㿘 "H@  starting call...line busy...acu open error...lost carrier...dialup line open failed...`R"`'D@ 2"X @% "b ( x`@ #"p @ "|  @g"p Ca,@͐ @jD* @ & @1@\ &  @ؼ  @ع  @ض @  b@OD'D@ЏĐ @s@  `l@ޒ  "` ( x`@ ܐ"0@ ِ"@k ` @؄  @Ab0,@` ! "@S@'"@  @v @Ē @@U  @bĀ`  `@ 㿘@2  "p@ 㿘@; !  `x@# @ 㿘@, ` $ @3  " ! @ `x@ @  dialing...ATv0 ATTD01234%ld second dial timeouthayes@  !4R!N`"@ I!@ # `@͒@'`@o `@ `!b @Ͱ"@@`b@Ô L` #ؒ ,J ="*J  =@k@Ϭ "$`@ϥ @c*   @\" * :  1" @  $`  @g$`%Ā !4x ,b(@m @Ā @㿘! # `x@_ @m  `y@Y @㿘 ` @Xbtimeout waiting for reply 㿘@  ؒ  "@"㿈'D`@X '" ' @" @L $ a`@   ` @@  `/OJ@"' @D D쀢   @)  OKCONNECTRINGNO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)㿘@ K"?Б* : `*`#8 €@ ="0@ 9"0@ 5"0@ 1" 0@ -"00 @ )"@0. :`"P@ " @ "ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 㿐 ` @r @E "+ @  @h  cP@΅ B#X* :  0 3@ڐ#`@א#x@y  b@d c@i @m  @B  `x@U @1 AT Cannot synchronize with hayes... 㿐'  +% `@D @H  @3b􀢠 "Ȁ( (@*'@| 0 2 @| O @| K   x@  y@ `΢`@s Ȱ Using "%s" can't synchronize with t3000 t3000can't synch upAT E0 AT E0 H0 Q0 X4 V1 OK AT D %ld second dial timeoutר!4R!N`!@?!  @ƒ@' @h @u @*"!4` 5(S ` @b8@ `@ `b@@ @t"X @Ͱ `b`@ N`' %ؒ ,J ="*J  =`@K@`bh@ @ `$!4x ,bp@k   @㿘! # `x@Z @h  `y@T @@. 㿘 ` @Qbhtimeout waiting for reply 㿘@ ؒ  " @"㿐'Da@Q '"! DJ@  @F   @Ր" 2@a` ` @@ DJ `@/'D   @&  12000 7200 1275 7512 57600 38400 19200 14400 9600 4800 2400 1200 RINGINGCONNECT%s "p | `@Œ @#Ґ @`@e x@ i a@ 'x@Sߒ @"!  ?;' ` 0/|"x LO b@ TaN b@r  6!`0!@ #   %* |?''||$ @*" 2ע!4@j`, ` @g@b 4@ǐ"x@~   AT Z +++h'  )Ъ%- @-   @K  (@Sf@L  b@7̀`̐ '̀ @, ('̐@z 0 2+ @z O  @z K  @#  @ @  x@  @  y@ `` @  㿘@ѐ@ @ @Ɛ@`㿐 ''@ I  READYcan't synchronize with vadic 3451 vadiccan't synch upD NUMBER?Vadic will not accept dial command will not accept dial%s Vadic will not accept phone number will not accept number DIALING:Vadic failed to dial failed to dial dialing...ON LINEcall failed call failed0צ!4d  !"`@@@`"@@"  ) @ɐ"v @J @ "@ @V "@r@#  @#R0H 2@@Y@n   @#P:x@> !#@B@?@S# 2 TN@r# "@e#@=#@   @Ԓ   @T#_ 㿘 @ʸ`㿘 @ʲ`㿘N  !  @Ӕ @א N  ""FAILED CALLX'D'c@  H'Dc@/Ȁ`? '!`'`h@Đ  @T#@ 0 @ , @%Ƞ# `@( " ` @ʂĀ  @  *@`'*D@ Ā@ @i  㿘 #@@0 㿘 N@@ ` N@   2   J@*:`  `? starting call...line busy...acu open error...lost carrier...dialup line open failed...㿐R"'D`'H@!H@x  "` ( x`@v! e @r!0a  @#耢 <ct@  @ӽD* @ & @1@ &"< @  @   @  @ D@H A@͐@  `l@8  "` ( x`@6!H0@3!X@Ő b< @ޒ  @ɛ`0@  @ݒ @i"<@   `@Ƀ 㿘@  #@k h@ %  # @ӑ`x@Ӆ @  @W@% `@ @[㿘@ b< # @я # ` !  `@g @C` `x@^ @: /dev/cua1/dev/cua0Unable to locate dialer (%s) `@N <N  ~ Z"@  @ 2 #  @j K`@)`@ ))`@ Ԕ ~''`@ `@  /` @ /`@   /`@ N `@  N  <2/ǒ /`@  /`@ @ `@ܔ   M/Oǀ Bǀ G /`@Ӕ `@ǔ )/@ȟ`OǁJ h ="@2J`<"  J_"* * J *chcan't synchronize with ventel ventelcan't synch up dialing...#k$ $ $D$I$A$L$:$ %ld second dial timeout%s... `@J  @ې#a ׬!4R!N`"@ǐ#@j x@L@'@ @#ؖJ )#ab? ? @B J ba"? 4? @2c@  @  !@@ "` 4 ,c@fB 扖" `@C`>" :4R!N`6@v 2* @v *J 2#JJ " K   ``(*@ `*J 2  @2 㿘 @ǝ`㿘!  c@Ǿ @ǐ 㿐 * /' ! *:  # $ @Ǟ  /  @ǝ  @ǘ  @nj  * / timeout waiting for reply 㿘@ ؒ  "@> 㿈`@ϐ '/'""*`: #  @   @{   *@Oa` ` @L@H  `*   ' @a * :` `?*@tip: ioctlP! # `x@& @4  `y@   %)@" ab`@ @ b@ @s!@"` <4 <@  $<   <" '@ ``$Ő 㿘@ dfiPRrW㿘@m b@$  "b +) # ! ' %57 9 "* `@€ %" $b$" $" $b  %  $@"@?ߐ?* & @ b @@@  @_ &@10@@l"`ˀlˀˀˀˀtˀˀˀˀˀˀˀˀˀˀˀˀ4ˀ@ˀˀPˀˀˀˀˀˀˀˀl%s: %s%sfts_read㿘 "`   "`  " @    "`2 @Q 1 ( @ ?` K#*` € ``z`! @j @ǒm `!`@jy @+  2 ``\`! @jf @O  M``@`@ F@9  @$` `   2 `8``@`@ 2`8     "  "@W` @` ``@ @ӿ`  "` x  `@+   "b@Ĺ 2u`8 x `@ 4΄΄t΄xͼ΄΄%s: is a directory8 m 9 7 5 (3%  +<;/-8@ޒ  " 8!7Fⴀ " @iѐ @`E$   "`#@4$  ' @ "( @   @ǐ "`@@3 "ⴀ x "@`$  malloc㽐`  @t  `<   @_ ? @g?*$@1 a@>  @j`02@    @ߒu@ <d <`耤@P g   @Ĥ @_  @<`02@    @ıG@ <d <`耤@" 9   @v @1  @`02@    @ă@ <d <`耤@   @C  @ɐ0   `"b@ @ؒremove %s? override %s%s%s/%s for %s? 㿀 "` !`@ 3  "` < ( @a  2Q @c @^ @ O Ȅ`  "  #\@ @?P`? "`@ ?P  $?P ` 1 H ? $ @ H  & H` 2 `y `Y "." and ".." may not be removed㿘 @ % #@ ? (J /"*@ / J .2 J  .2 J 2    @Nb $ `&   &  usage: %s [-dfiPRrW] file ... 㿘 8c@ @g 㿘@6-0123456789an:m:oft:%07lo %07ld %07lx strings: length less than 1 strings: max length less than min strings: %s stdinrstrings: %s: %s %s:%sx@'D`P@ 7'7 ??-! (/197; )J%* :  GC* @€>D* ?J`- J  *`J  *`@    $7 !7 @J @J  J o"p x d" x0"  0p@D@D@XX* @    @C`@ʶ  @  @7`@ʪ @  2. (`x!# @g`Д@!@ʔ ?**9@#`''-?@  H`@  ( x@f' @(@ܐ?  ""b'bHR`  b@i?'b "'bȀ k  Ѐ@ @!  a  ! !     G 2D  " ! & ! ! @ ̀   ̀  @    "@@   "@ "H@O ?2  "'b 'bȐ  "b"2 " @J` 2 ",@ `80,@`@" @J`   ",@@  " @J`  @ȒHO ,@؀ a@  @"@@*0`; ?"`` * $@AĐ @v*  " @J`ߒ "`` ?"`* $@A  @Td@ 2@@Aڈڈ٘٘٘٘٘٘٘٘٘٘ڈڈڈڈڈڈڈڈڈڈڈڈڈڈڈڈڈڈڈڈڈڈڈڈڈڈڈڈڈڈڈڈڈڈڈڈڈڈڈڈڈڈڈڈڈڈڈڈڈ(pڈڈڈڈ8㿘 b "Ȑ  "b Ā@ 6#" " `" ̀`"H`? "`@ H  "H?usage: strings [-afo] [-n length] [-t {o,d,x}] [file ... ] 㿘b@? @Ȳ 㿘@Lshutdown: NOT super-user -dfhknprshutdown: incompatible switches -f and -n. shutdown: incompatible switches -h and -r. shutdown: switch -p must be used with -h. Shutdown at %.24s. Shutdown NOW! ???forkshutdown: [pid %d] shutdown㿘@@B    @c(@S .. 7/+ # - ' % 5 ) !"9 E* @€  %` $` %  $  $ &  % @@#H?ې?b* & @ @`   X@@    @@   2 @#@|@~@@%`@  ($ "@. @@`@ "  @ɦ$@`퀦 .. ` (# #N? * j @IH 2N@Ƀ (  ` " @Zc@0@@ "`  ` @@  $ ?@! @U``@ @ @z @Q8 @O @H44444444444444444444444444444444444444444444444444444444444444(㿘 c!, @U ٦    @4" 0  @& @  @P @@p@@l!,@& @ `2 @ PATH=/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bin%s -n/usr/bin/wallwshutdown: can't find %s: %m*** %sSystem shutdown message from %s@%s *** FINAL System going down at %5.5s System going down in %d minute%s sSystem going down in 30 seconds System going down IMMEDIATELY 㻈 b  "b "@F!"ph$@ٔ (" p@b 'b@M> 0W """   @""X ! "@Y7# @ߒ" ;#@ < <#0"@˒ @Òc8 @c`    (@  @ ( at@T @, @!@(  @K 㿘  (@ %s by %s: %shaltreboot System shutdown time has arrived but you'll have to do it yourself /sbin/reboot-l-d-nshutdown: can't exec %s: %m./sbin/halt-p/etc/rc/dev/consolerevokesetsidopen/bin/shsh`  a  `! # 8!#!' !     (@Lz @Ɛ @! ` " @!@  `@ /   "a a  `" "%   b#\@Қ ! b @L8@< % 4   b@" !  "  b"P "  b b #\@#`b@ b @K@"X@Z ?K @?E A "`@?@iА"p@?2@iȐ"x@x ?2 @i" @2 @/@,  $@ߐȒ@ ̔`'̒ @ "b8@ @ @꿔  @ @> nowTZshutdown: that time is already past. 㿐bp@F  "#@nŤN +  b `@)@Cʐ* "@*`   "#""#L b@ `2 : @a   ,, , @ L 2L@"x@V%@I "9N "DN0s  o dNБ* N * ?` $` @`?@6 d`d$` d@`$@$`N?Г* N @*`@ ϰ `$`` $N@NБ*` N * ?А ?`$`  @N?Г* @N *`В@`$` @N?Г* @N *`В@ `;$`@@Y&$@! ?$#@# "  " @b@ @w/fastbootfastboot file for fsck 㿘!&@X! a@ @̐/etc/nologin NO LOGINS: System going down at 㿘#bP@!#`@ @ @ @ &@(! b`@ʔ " @V#  @Ðb @!  (@u@@㿘  ` @ɩ"P @Í @ê bad time format.㿘c@ usage: shutdown [-dfhknpr] shutdowntime [ message ] 㿘c@ @k 㿘@EweofretensionstatusrewofflrewindofflinefsrfsferaseeomeofdensitybsrbsfblocksizeejectTAPE/dev/rst0f:t:%s: unknown command%s%s: illegal count%s: %sioctl MTIOCGETP@@@ / `" X`@"XX@uy`Ȁ ِ "b   @ Т ; % (!+'95٬  t@@u 耢? fbb*@`&  @ `  `@ `? `@`@@ij : $@id :,@@` b@³ b "8@ '@{`%`@А @w 2    "⨀ @j@A  6  ( x` "a@ @v  4 @`7 @G ' J` @a@  '⨀  W@q  '  a@W a(@   @<@I⨐a@A a0@  @;⨀ @@$ 76543210WriteProtectMountedSCSI%d: unknown tape drive type %s tape drive, residual=%d ds erblocksize: %d (%d, %d, %d, %d) density: %d (%d, %d, %d, %d) 㿘R""T`"V@2 V  @Z!V  @1! V @,!`? "`ࠒ * "V@@!p0@:   !  @5 $ 4!  ( ,@- 0%s=%o%s=%x㿘  N  #@#@u`sN o ``?"``  <* H$ @9Ӑ <EN * @:` ` ,?"`` * $ @9 ,* : %   :?`&  @   * $  @9* : 4 NN 4N` `?"``  >* $ @9y >usage: %s [-f] device usage: %s [-f device] command [ count ] 㿘"`   X @aH0 X @a`@ 㿘@ʐ@E ! $ T@V$ Tbh@ @)  P86 Lost connection to remote host.㿘bH@ shelltcpshell/tcp: unknown servicewho are you?/etc/rmt㿐"Ԩ`'"@Bb %"b@ސ @ @ $b@Ӑ  `T @gD @  T,@J 2 @ $T"ؖ T@"@   ?"`P@} ,'<'$ `P?c@b>  `P?c@b3 $'`P  @b+ invalid user name: %s㿘N *`:  b @ `2  _ - x@    N  O%s %d 㾘!(@ِ "bА@HcloseC 㿘!"Ѐ !x@8a$"ЁstatusS 㿘"Ѐ` a@'!   ``@w`,`7  `I%d %d ioctl㾘`(!@j"0@?㿘  P@@@@%s: %sProtocol to remote tape server botched (code "%s").xؠ@M O؀ E F Aؐ@C$"ؒ@ [O؀ F?""@a@J@ "*@"@ D@>ٰ㿐 `P @ OOProtocol to remote tape server botched.(rmtgets got "%s").㿘`* :`` ,, `  @ ,’@  @l㿘@m:pinvalid file mode: %s%s㿘@~ڪ ’`@呐 @ 8 ! % ('-) p @w 2`@= @ !@}@@?• m* @@`2@@@,` -6 @@ @?` @`J /"*` 4`@@%4  4`@@L  !( @@?2@@ P! @ @/%s: %s8¦"+-@_@IL `?,@$  (`x  `..`2 @ x  /@ a?<    /@Z @ 8? /`, usage: %s [-p] [-m mode] dirname ... 㿘 8`@ @Y 㿘@X$OpenBSD: compile.c,v 1.9 1998/09/24 03:00:59 millert Exp $㿘! @#T"#T@; @#  #@*` @ j*  H$cD`*`@ c! $#\unexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandfilename expectedw command%s: %s read commandbranchlabelempty labelsubstitute pattern can not be delimited by newline or backslashunterminated substitute patternextra text at the end of a transform command㿘 - @<(   Òa0@  0`` @ ~"@ ` `` @ ~@ `2`` L@ #"Ր Ґ@  &*  *@$L@!P@d b @   @$ `+ @ ~" @ ~8L@@ `2`L@ ,2B$` @ ~"@ `  ` @ ~@ `2`@ P  @$   @ ~"@ ` "L@` @ ~ @ `2`L@$$+L@ 2 @Òa`@ n  @,Mc`cL@@" L L  2 L 2 L@ax@ S   L@a @ J ` -Ɛ"8*` €` @ ~"@ ` 2` @ ~@ `2`2   * * @$` @ ~"@ ` "$` @ ~@ `2`$L@   $Òa@ "`"L@ @ ~"@ ` "L@` @ ~@ `2`L@ ;_ La@ʐ `"L@ @ ~"@ ` "L@` @ ~@ `2`L@ \Lb@ `"L@ @ ~"@ ` "L@` @ ~@ `2`L@ Lb0@ @<f$ !â`' @ ~" @ ~8L@@ `2`L@ "Òbh@a "@<`$ ?=$& @@!?6$ (`x!@XC"@F +`"L@ @ ~"@ ` "L@` @ ~@ `2`L@ 2bh$b`"L@ @ ~"@ ` "L@` @ ~@ `2`L@ $ b@N$ ` @ ~8" @ ~8Ⱀ@ `2`@2$ @- Òb@א @`L@  \Òb@Ȑ @| @\$ 2Òc@ @@. "L@ @ ~"@ ` "L@` @ ~@ `2`L@ ;~$`@ "L@ @ ~"@ ` "L@` @ ~@ `2`L@ ; d`VÒc(@k P`dT\ can not be used as a string delimiternewline can not be used as a string delimiterunbalanced brackets ([])㿘'D @. `:  h'D \ ƒbh@-  DD] Dƒb@" DJ Q . : !J [ @JD @D @ ";D \2 JJ [2J.@# \2 JJ2J 'D \2 JJ n2 J .@D``'D \ J \2J.@'D`J".@D @`.@'D`DJ    *@J`^ *@`J] *@`J@ ]=*@ J[(\J . : = \ `*@J` ]*@ "J& `(8]*@ 2J 2Jn*@J` ]*@J]2 "` RE error: %s㷐&  @ &@@   &@@”  !@@("(@F @ `H *"H123456789\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expression㿘   l ,@`$@ @Ѱ c&` #L`&`&`@ N =/ : 75/Ǒ*`:  \$ N@` "N,@N``   @ے`&&` & \2 ,@ ` 2 @ƒ ,@N` $@%h - @k  @Ғ( 2Nǒc@@ more than one number or 'g' in substitute flagsno wfile specifiedbad flag in substitute command: '%c'㷐'D ?&@&` &`&` !%#DD  ~"@ ` D'D  ~@ `DJ@ g"  p 9 ; 1 j h jJ@dDe  w`^D @>!@ [&@ X&` @4!@DD@> &@M 'D ! ` ~ "'D  ~8D@ `DJ*'DJ  2 *Ȓap@ @bq#<`&`& @!? &`  (@T`x@  D J@@aD c'Dtransform pattern can not be delimited by newline or backslashunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthN  \ɒ`h@ ` 2?1`c? T 2%`А ~?"@ ` ?  ~?@ `2 ?#@@@ɒ`@e  @  +@  (+@?O#@`  +@J &@㷐 @ @  ~"@ ` "J  ~@ `2J `\2 J " J "  +J   # +$(, @@!( @ ,@@unterminated regular expressionexpected context address㿐N 9 \ 06  $ /` ʰ l` 2&@ʒ`@ʐ &@ &@ &@@= &`` @  whitespace after %s㿘L@  "  N  ` 2`.ʒa@ & @E@undefined label '%s'㿘. ?* : `#ʐ"*` € c@ "c@ & @k &  a@^ @P  2 ***x*x*x*x*x*x*x*x*x*x*x*x*x*x*x**x**x*x*x*x*x*x*lduplicate label '%s'㿘    `,` ` *` @ @' 2  @h 2  @  2 @ $$ $ $ $㿘 ` ,`  `,` `  *` "   2  @h 2 $ 2  unused label '%s'㿘   *` `'   @ @`2 `*`$OpenBSD: main.c,v 1.5 1998/06/23 22:40:42 millert Exp $ae:f:nusage: sed script [-an] [file ...] sed [-an] [-e script] ... [-f script_file] ... [file ...] stdout: %s㿘@u +) # ! (' %/5 7;#9 ( /8* cx@€ %#<  @$c`  @    $Xː @[ah@ΐ @W`?ڐ?c`* ` @ @`@ɐ `u@  @@`@ 0@Đ @jT@C @zࠀ  x@RaȔ@ @ .x.x.x.x.x.x.x.x.x.x.x.x.x.x.x.x.x.x.x.x.x.x.x.x.x.x.x.x.x.x.x.x.x.x.0.x.x.x.<.T.x.x.x.x.x.x.x.lr%s: %s"%s" ..."㿘'` V!  r 0#"% Ԁ`2`  "#L! @"`@8˒`8 "b ( !`x@Q @@    "8$` `"̔H@   P P ` ,  `* `* `* `**    "8"b$`"@6В  cL  "cLN #2Q N  nM  "#XI  b"@y"b$`cL   "J`# J  n  "cX *cL "J  " @ "$``h@#"*cL #cL**"cL` #"#cL`*#"Քstdin㿐 "Ф`?) ' @y`$؀ ";  ! ̔HcH "#8$̐ `8@8 $#8  $#8 (`x!@P @@ `? "`@}5 @  "@@· #P  & c %#P`  \%#P@7 `@ ( x c8 @ @P @ @ L`̮H#H"L# + 31' (@y;b` $b`! $%c8 $#8@7`8  $#8@Px @ @`? "`@|ΐ @  "@@   㿘@& X" " ""@"X㿘@ \" "@" "\$OpenBSD: misc.c,v 1.3 1997/07/25 21:05:41 mickey Exp $%s㿘@   (`x!@P:"@> 㿘  @A   (`x!@P#"@' 㿘# b @͒@@@ ʠ @7$bbsed: %lu: %s: 㿘'L 'P'T'XcL@ 4 `    #L#8@c`@w͐@cȀ @X $OpenBSD: process.c,v 1.5 1999/06/06 15:42:24 deraadt Exp $%s %s: %s %lu 㿀 "#L'  $`/ + T@ " ?Ƒ* : `C~ϐ#*` €x#  @c$  ! **@ #D"@W*`$#Dc$*`#D * $ " " `I #(`UE  S"`` N `@  `?$ " @$`;T ""@Y 2! "耢 "Β` @L "`@G       @:" @-  @ cX  ` `@z @k  2$ @ @a 2 #X`    @zj @ ` 2`@z] ` 2` @ `?$$``@zD  2$` #X`  b b@z0 @@C #  @c$  ! **@ #D"@}*`$#Dc$ *`#D * $ $ @ c$$ `}$c$@ ,@v", c, "ro"c, `2j? & @v!? $ (`x! @Nx Ȗ{ @    J (`x! @Ne Ȗh ?# b耢 bΒ` @Y `'`'` '`''b $b $ "` "`"`$ "` $ $ $ ` 2`  @, L@! vcX  ` `@y @a  2\$ ?,?,?,??,?,?,?,?,?,9?,?,:p:?,?,?,?,?,;p?,<?,?,?,?,?,?,?,?,?,?,?,?,?,?,?,?,9X9P99?,?,:L::?,?,;?,;?,;<>?,9P?,?,\%d not defined in the RE㿀  `" #0    "LВ`   @   #"   @  c- P? -   @x = \\@\   \# @n  `@ޒ\@`` `   @ #@V \# @P \ ` $@.#@A )#\\`  $ @  @& ?2\\# $@  @% `@\  $ @@ #   ' " $  '' #%# $  $ " $ " %"  ''` @x]  `"4   20 ` ?2 & @Ҕ! ?"`   ( !`x@LҠ ȖՐ  `  @d    (  !`x@L Ȗ  rstdout: %s?c #$  6)+?1 /ё, #D* @  #$@  @w $@`@3࢒ $ @w  @ȑ @u$ґ,   `@ ( xр ` @Lei  "#,%$COLUMNS\ \ \abfnrtv%03o㿐!t@̐"H @.$t`h @̔  < 2$t <$tN g!Ѫ"h)t@!"P N" J` \ `?"``  * $ @'ݐ 7 є?bX \"&  * $ @'ǐ \N@V  "@?M@ " `   * $  @' @ː"x N t `?"``  $* $ @' $ `?"`  * $ @'   `@ ( xр ` @K first RE may not be emptyRE error: %s㿘,  s@: & \ ?" ` *: ?? $' , :  \2  N \ &2    @   &  &  &,  4& \* ? "*?2 ?""  "  "?@* \  &  &  &\@ @| @& ,   @   &  &  &,㿘     & && "&  @L @& * %s: %s㿘?'% (?N  w"!  { s" /"* + ?" @1    @Jx @ " ?"& @ "&  @Jx @& 2N 㿘  `"#(  2 y  `"]  2  "( @  `  `@n  2 _    #L` "  U #P`"Q  * $  &#(@  `  `@H  2 9    #L` "  / #P`"+  @2   #L` * &#( $     `@     #L@ `?#P 2  `?㿘   #0` Ғah  "#0 J?` "? #\#0   ; ; #H`\ @f  #0!   !Ր 㿘@iڄx"㿘 ڢ!x @ax&allocate bad sizecannot allocate㿘   Ԑ@na 2   @ ``   :8  2@  `Ȁ`*,`@J  2@Ԑ@na ڐ!x@2@#`#@ &@#@@@" @"@@#` @#` `  #`""`  #` @  allocated object too small㿘Ԑ@nb4 / &`& ""& 2&&`allocation resizing free pointercannot re-allocate㿘  ?`Ԑ@nUa2 < : ?  @ Ԑ@nCc, @  @@2&`ڐ!x&$"&Ԑ@n,c@@2&`"`"@$"&` $ $ "`S"` "  ?$` ?` (  2         `$, ?$?$$S??`@ $?` * 8@-@freeing null pointerfreeing memory outside of block (corrupted?)freeing free object㿘 2?Ր@ma?  @M0I   *Ր@ma耢  * +`Ր@mb 2&`@&?& 2?"?* 2#?@#?#   *   @㿘@2  !x"` "@@&@@LPrestricted shell - can't cdPWDOLDPWDHOMEno home directory (HOME not set)-no OLDPWDdon't know current directorybad substitutiontoo many argumentsCDPATH%s: bad directory%s - %s%s 㿀 cJ   ! #"   P ?# #@sWc? L#J`* l#@א @Ӑ `@̐ (@ڪa@ 2[ S 0  2 ֒`X@]Z L @ڪa@ C < ` 8 chJ  0 p@@ h'  @"@@ h@@@  `h@ݔ @@ؐh@@@@Ҕ  @Lt   $' 'v$' '@\ @/ ' `h@u@@u@/  ֐ @L{<  (`x!@F @Lp1 @> hJ@ @֔ J@ /  @u 쀤  @u@ `@u!쀦`ր   @L can't get current directory - %s㿘 J## %"   P ?c c@rH? Lc* `@L .  #hJ` @u @?  & ֐ @t'   (`x!@FZ!@K  @L Rnprsu,ne-p: %s-u: %s: %s㿀 J`e3     L - L    L  n e  E`2L  k   f L -b L   \ צ"x6% `63ِ 4*` €`צ") '`%  @M{䨒  @K"  ` L`  @Lߔ䨒 6 "@Kk @q?ƒ?  `*   @[`X   ?$ *  '  ' '' {`h ?" @k`Z \2Y*L f0  r a"O  b 0".  \ A \B*A \>* c \8*"7  t n \/* v \)*( ( $ "     А  *`: ?Д  А  *`. : @Р? \*L    * 2` *` *! ` "`@I7  # 쀣 "@â`쀦  `' (@ 6&`x@ːx 2 @` @ ` @ _`\`\`\`\`\`\`\`\`\`\`\`\`\`\`\`\`\`\_`\`\`\`\`\`\`\`\`\`\`\`\`\`\`\`\`\`\_`\`\`\`\`\`\`\`\_`\_`\_``\`pvpvV%s is a reserved word is an %salias for exported alias %s= is an exported traced undefined (autoload from %s) function is a%s shell builtin special is a tracked %salias for not found%s is *GOK*㿘 J@  w`?  !٢!! "  v ? V #    #@o?耢 p# *  `2 ?`2Ϯ ΀   ` ! ! @@#  ` ! #@@  " @:ߒ   `ِ! @J' ?`ڐ"*` €~@J!(z ـ`!@!Xڒ!@J ِ!h@I@pd _\@I!x @I! @I! 2 @I! `@Iݐ!@Iڐ!<9ـ a!ڒ!@Iɐ + @I!  ـ`"!Xڒ!@I  @I!  @I" ِ"(@Iڀ@I!22`- iHhjihPh4i㿘L#R#UZ#fi#lprtuxponly -t, -u and -x options may be used with -ffunction %s %T %s() %T %s: not identifiertypeset -i -x -r -t -L%d -R%d -Z -l -u -U %s exportreadonly%s[%d]=㿐Jb      r7  s e  # t   #ڬ" ڬ"$  #  `"  5`9' ݐ *` €# %# % %# %@ # " %  $ % # ` +,- -#@nT?Ȓ?`'@k " `'@k " # ``#* `J`-`+ `J  ` $# ?#@@G"s #* `, ,P @  - "*#* `C `"#* `64`"%@@@Ɛ@8 ` ! "*" h #ڔ#  @@  `@ "=`@ Ѐ` `8  @@ "`- +1)ր-- (c#   @ @@H  @ `Lװ 0@GT#(԰  ϰ @f@ Ģ`"  `` @ "`    "@0"+-5  " U`R`@G#@"@G#P @G#X$@G#` @G#h@ @G#p @ @G#x@@@G#@@G#@@G~#@@Gw#֐ @Gs ? 07 ڀ##ڒ#@Gb   @GY - @GT - "@@GG# "@G@ @m@G9! "@  2i@ BL5 n4m m m m m m m m m m m m lm m m m m lm m lm m m m lm m m m m m m m m m m lm m lm m lm m m lm mm m mm m mdprtUxuu-taunaliasalias: -r flag can only be used with -t and without arguments alias %s alias not found 㿈 `   "` ' ''   #݀  - +`9ސ"t*` € !  '     ' @l`2  * ` " J`-`+2  J       `?` @Fq! @kӒ @ ڰ 8@Ґ`/`;9  =5@ 2"쀢 ' aX@t8 `@t4+ `2 @s =0$ * $ @l` @F3`ڤ "5 ) 97  =@J $@@eʔ`@z`<`2:`27@ޒ ) $쀢 ' !X@s @s+`2`@s =0$` =*@`$`@lN @E!P ݐ!`@Eޒ H'@ؒ`  `$ `" `2(`$ 2"`` $  `  # @7  `" @eJ $ `$ ?$+ $8 @@`$`  2lvv(v(v(v(v(v(v(v(v(v(v(v(v(v(v(v(v(v(v(v(v(vv(v(v(v(v(v(v(v(v(v(v(v(v(v(uv(v(v(v(v(v(v(v(v(v(v(uv(vv(v v(v(v(v$adt㿐 #  ! %"  t ? a# #  !  F #@j`?〢 d#* ` % @~@~ 2  `" $ q ?$  2@N    $Y` ?$@D 2no arguments㿐   @D4!0  `? @:є   lpnz㿘   % '"  p ? l  z   ?% @j'x?• n* `2 @K 2 @K 2   bgjob control not enabled%%㿘@T)b  cJ` `? # @C"( ڔ@ic ?c * ` @J^ ` "@JT  J `" %*d %*s %s%*d %*d %s㿐چ"``+  ߐ #\#`@r0  #`#\@rbad signal `%s'--ls:Usage: kill [ -s signame | -signum | -signame ] {pid|job}... kill -l [exit_status] %d %s%s%s: arguments must be jobs or process ids%s: %s㿈  ) L -&#  !8*   " ` 2%@  2  P$ @Sn`` ) ' # %"  s ?c" c@  2 c  P@Bް c@ih?ဢ lc   ,`    `p@q H@BӐ!    *ڰ"d '%@f0  '?  *`" @CX  @CSР    J#ـ`ڨ"da '%,`@C:آ``@C3!u  ' `'@  ڐ"`  ' ? @2@4'@+@4 ?  ߘ  Ė  @i >   6+'L % @H 2& %`@e쀢 @B4` ?  @%   (`@C 6 ` (`x@< @B`,` 2L㿘   J## ``  @h$`$ missing options argumentmissing name argument%s: is not an identifierc_getopts: no argvarguments changed since last callOPTARG㿐! ڔ@g# ?# * ` I" B" L  @cJ` "8@A  `L`2bX@Aݐ v  2``?@&  ' *`2܀@    *`@@G @"p@Az 0N$ @g  `? `   +// /` ?///`?ܐ" "@ {b& " @  `@ 0@ @@  JcĠ`?    @ ` lm㿘   ! #"  m ? # + #@g:aX?쀢 l#* `2  @  @E = "*@`@ 2   2utXj^ky xp}h`}X^P]4@k0k {df4~~\bind+fg+bgwhence+unalias=typeset*=readonlypwdprintlet+kill+jobs+getopts+fc*=exportecho+command+cd+aliasHf`?%s: bad numbernothing to shift㿐  # `ڔ@fc ?") c*  @7   6 @@_#   +   "   @ " $ $ @@L# Sugorwx%s %#3.3o bad numberaugo=+-rwxugoXsbad mask㿀 ! # S" #@fM`? ?#*  2;@{ * 2 @w, `8  =  , *.  .   < " . . .? @@ !@@  !8* А   * - ВБ:  @N "- !@$ * 2 @ N8`y +〢 g  o a" I N u"@NN`@D5! 2N" Ia *`@D*<` P  ?* : `  !D*` €  < <I"N N`@D!( 2 @<``- `=`+"  N,N-"-N`,  @Ca "NN 2+N 8!8@?7 - @ϖ2  4DDDDDDDDDDDDDD DDDDDDD,DDDDD @%s: %snot found㿐! ڔ@e-# ?G#* ` A # @1t  #䀢`!+ +!Л* @    `#@   `@       @[Ж   (`x!!@9+@> 㿐! ڔ@dے# ?#  * `  @D  @D `2  " prsu,-p: %s-u: %s: %sREPLY%s%s is read onlyp  'д    # 2+"0' s ?) p c) u" "c @@MԨ c# L   @?Ԩ 6 cԐ#@>A' c@dec؀?ʀ rc* `#?&@>  @h@B ?  ,@  @> !  '   ' ''ܶ  '   '' '  !89 쀤}? #a8#` ``$`  $`@k"` @(`$  @z @ $@ ؐ?$@^#ئ,?$@^  M" 2 @ - @T2  `@T & # ,Ѐ \    * @` 쀤2 `   2  ,  2`   2,쀤 " , ?* @  2?,@$ O#@i @=R 08    @ @   @i&  K @h  ,! ` "`@< 7䀤 @>ݐ 8`?㿘! ڔ@c<# ?    @Q`# * " Jـ`    "a, @Z trap -- %s bad signal %s㿘! ڔ@c# ?#C *   ڠ"`%1 " @=x0@c  @=s"@ ) @yO    @<"H `"L@ -2L` "    @y4  "?@z 2 㿐! ڔ@b# ? = #*  @_֒    "!,c@-eq-ne-gt-ge-lt -le!-ef"-nt#-ot$[]missing ]-tx  \`<l'''' 'ؤ,`2@Ixa ,, @Ioa @9 !h f ,  ''܀Zؤ V  #+€  ꀤ#  €   @ ؀`ʀ0ܐ?'܀  M `@I a "'  @ `?`?€  "'ܤ'@3㿘`# N  N@ *`: N`2`@H 2 `@  `?怢 `N@ 2N` internal error: unknown opȀ  `#"Г*` €-N%NN !`? 2@Yr '4'4 #J '4`?@  @ @ @@s@ T <  D @w H < 8 @k < < , @_ 0 <   @S $ <  @sW  < ( @;   < 0 @/   (@&   $@   "@ @  Ȁ 4߰ ̀ ذ  @[4 '4 $ 4@t'44@     @ @  @<@ `? @Z @Gϒ: @Z 1@G’3@G2 @G  $ 00@-  ,@-    r$`-"*` €0, d`?0, ^@ 0,@Y W 0 ,̀@0,@M K 0,@F D @r > @r8 X@44 @r{8 , @ru X@  @rg  @ra8 8@<  `? (  (\@p(<P@pTX @t@㿘@r8`  `@r  <   I  ?  ` @*0@*unexpected operator/operand㿘@   €  2     `?㿘@ 2   €     㿘@ "   €     @ 㿘   €  `?@%missing closing parenmissing argumentexpression expectedmissing second argumentmissing expression operator㿘 2m  €   2_  €  2X P  €    2  </   2  + €    2  (  2     @@? XPH@8)(!-a-o㿘   ``? `    $*` @E`?   $ 1 ` "㿘%s: %s%s㿘 .`   ` &@5!`0!h@5 XtHf0c dslmnpprocessesnofiles(descriptors)memory(kbytes)lockedmem(kbytes)stack(kbytes)data(kbytes)coredump(blocks)file(blocks)time(cpu-seconds)ulimit: %ctoo many argumentsunlimitedinvalid limit: %s%-20s unlimited %ld exceeds allowable limitbad limit: %s㿀 J##`    /  H-c S*Ж a*`  * * f"  a ?' H" " @Zsc?퀢 S!Ъ!` "L2  cp@4i  *  @ 4  #@4 0 @Dsc 2!#?@*  䀢  !8*` 2 @3# @6 : 5aЀ va#-+' 2 @耍  2@42 2@4xc : @Q @4mؤ 2G  *@ 2?耍 2? @v;  ( x !#@. #@3"  2 #2 2@4-#  : @Q: @4"#ذ 㿘۠!? #P##P """ ""`@q ! <c "c  @"c@0  *c   COLUMNSLINES㿐 㔀 4 ! c."b@6`h %   "a В   @}~ "@{   ؒ   @}o @{㿘 #`@r  cJ` J` @֒ J` @?@Y 㿐 #p`  @N @p' @J   @Zڒ  ( x` ?㿘 @^ H㿘  H`2@a 0"* "㿘N   H   ?*:  @` N$  *@`$  N P #~ v"# `x`# '`(cP`! '`'`'`'`'` '`$'' cP' ' ' ' ''`x` ۖ w$cP #'ݚ & & & ܔ & & '///@wF/L#cP 2 ?$cPL#  L#?& L# L#?& L#  L#?& L#  L#?& L#  ?& @k   @S0b  @w `xJ   J 2JJ- + 8`(8  J            `?J `2"@ 㿘@ƶ / 2 C#bȢ ,`,  @%А  @S{ 0``,`2JD #    " J# * `J `? 񀠠"'   J "  &J ?  #J 2 * *  #*  "㿈g @  a  @@A  @ ,`@  @8$`@M,`` % @  J?`/2 `*`'' @' $< , u, @''',`@@"`@' $< , Z, @'''" '4 2 @&  `fileglob: substitute error( @?1  @   5 N@ \@ 2.@  .@   N@  \.@  !@E`"" &!@>Ԑ !&!bh@0 U  r` ''' `$ @  $< , , @'''"@`'"@ ה    . `2  @@˒ @k J`2@5 f` "&&㿘 @@`@@  `"@FPATH㿈`ذ @# @J `;`` ` '''  @: @5 @0<`    @& L   #@M@v @wڐ!@?":   &`` A`. * ୒`    $@@ $`2 @B "$`$`` ?ഐ@=   `,  &@  `ᴒ`*I$@U??  @?  .&@`ᗒ` ,`@.. &@ @' `$< , ʔ, @'''"@`'`"@ ດ&;|&()`㿘 &' !8@ \  *`*:  ' " ` = :24J !8&" : \2   6 J ` "   *` *:  ' " ` = 5$ " @ `    `2  N @3 ` `N / N /2`?'&㿐\`i '    !"@  `$  $@$'@*+?@!㿘` A   `@N.N '%L \2LL  "L `*`[`?`$"LL  (2L@3  L /"  L  \L  N ~ *`.@*`㿘 $ @@ @*` @`@K@J    K@ K @" @*`㿘 # , @ " `+` , `#`㿘`@Ӑ" (NN / ?N /"?N /2?N /2& *&㿐@hې @QZ @` ``$< , (, @&`&`&@`@N`@"@`&@@h # 㿀@w   `  ' u'' '耦r@27 : @@]@ `-" @M @ 2 @,  @`,@   /,  " @M֐@ $@ < ": 6%,",'@ @䀢 6@䀢 `@,  $@ @@G`?`,&M@`:IFS\$(){}*&;|<>"'\㿘 @t!X@u  ) ' ƀp ƀ &@? @`N@1!` N@1 ƀ 〦`?`ƀx`dP4@(\x@߸߰LߨxߘTߐ߀Pp`P@0| L`t@<$xްޠސހPxh0PH8 (tݸhݨPݘ8ݐxp`P@ 0   ( commentset-argupcase-worddowncase-wordcapitalize-wordexpand-filecomplete-listyankexchange-point-and-markversiontranspose-charsstuff-resetstuffset-mark-commandsearch-historysearch-character-backwardsearch-character-forwardprev-hist-wordup-historyno-opnewline-and-nextdown-historynewlineforward-wordforward-charend-of-linebackward-wordbeginning-of-linebackward-charyank-popprefix-2prefix-1quotelist-filelist-commandkill-regionkill-to-eolauto-insertmacro-stringgoto-historyerroreot-or-deletelisteotend-of-historyredrawkill-linedelete-word-forwarddelete-char-forwarddelete-word-backwarddelete-char-backwardcompletecomplete-filecomplete-commandbeginning-of-historyaborthb fd'(! ! %"#)< >g  0y7#-1 1= ?2*?* /.&.&_606162636465666768695U5u4L4l3C3c[O%A"BCD㿐      ""c"#c##"#.1 !!Ԕ%     !     "c # Ȓ(###c $c$ c̖ Ȕ"  "@    "##cԬ## Ȑ@AՒ ! #耣` ! !a#" :  *@s#?$#"H)  ' @ j @  #*`@  @  `* @*`@` c 6 "#%#ؑ* * ฤbH* @$฀ "  0 0 `".c0"@gj  @I% 㿐 2/@ > 0/1 #ؐ?? &#@C#ؒ&#؁ 㿘 ༀ  @ % 0c>  *  *` "J ""༁ 㿘# c #@ ! # "@#@#c@$#$c@ ?㿘 #' @֐  ?@ "#1 c # `?"@Ȁ  #@tLc8? %#İ 㿘  㿘 # c! @   #؀ 4$##ذ @$"#@ 㿘  㴒@ @ 0؀ 4"@  㿘 a 쀢 %  @ """쀦 ` @{ c?" "c  ) L@-@ 㸒"@q@0%# # ̒`" `4@J   @@   "c@ %# ?@L?㿘@  㿘@ 㿘@T  c@㿘@K  㿘  #  @ 09 ؐ??2#"   c  ` *:  _ $2c"    `2*:  _" $"ؐ??#@G 㿘  #  @ 07 ؐ??2#"   c  ` *:  _ $2c"    `2*:  _" $"ؐ??#؁㿘 #  cԐ   @9"#0c  #$#@J# #0  #J@`@X$###㿘@??@T ??㿘N  * @ : N`  ✄    㿘 #@N` c   @: N  cȀ* 㿘 @; 0b  `  @ ^  ? @@@㿘 # c @   c؀ 4"ccذ Z"㿘  c  @Ґ   ؀ 4"ذ D@㿘 # c @*# cؐ??$c% 㸀 @,   c@,} c@ 0??$c 㿘 @s# #ؐ??##   c2J@{ 0 #ذ ??## 㿘@j @h ܰ  # *@`"# 㿘 a@6 㿘 a@/ 㿘 c * @%"@ 㿘 c * @@ 㿘 #܀` @a0  ! c !*@ * @"@ 㿘 !  ! ! @ 0  #"c% #@D# # "#@ # @$c$@"@v 0@ 㿘   ! a#`" :"@ `z 㿘 # c  #܀`y01 I-search: 㾐?/B )3  J??..?# %*.@ #` `.! #@f  #&O`^ B?` @"@f ``@!@@\   #  `@? 㿘 #`? a  % @# @T 1@RL@`^ ĐD?0 a?:@@  !?$㿘J@ ^`@5@9I   ?@| ?"㿘% # *c'  ɠ$ c@$c    ""$##+@ "#@ 㿘 cv 㿘 co 㿘@? 㿘 ?"#@ 0@ U%  # c    !  Ȓ @<   $ Т ̐ "@  "@") c@2 c ##  c̀ 8/  ##@  㼐"& / @  cА?@#@  c@  > *c@8 <@?" #@} ??#L㴀8? &cā㿘1  ##  @c 03#  J#ʀ`" J#J#CJ#@J# ? ?*?#*J#4J@#1J# ?*?#*#J@#   ? ก    ก    ก 㿘  # c # ܖ" #@   #؀@ @ "##ذ@ < ~ r  㿘 # c@E1   ``* @ " 5  * $@ @kE &  nothing to yank㿘     "`"    ?``* @  #  # "cΐ 0@!ϐ? yank something first㿘 # 0  ' @ې"(?& ' % *``@@  c"  ഀ ?$$഑* @`ഔ`*`         "#"c""##( 㿘@i  㿘Y #      ""###c *@j?  㿘  @Dђ`N *:  ^2*@ N>  ?`  +*@`?` N *@ ✄  ` 㠆 ^*#@ ?*@*#(#%s%s = %s '%s' 㿘  a!Ԡ @$ސ 2 !a!ɠ @$Ӑ! @$̐ c.  ` *` "H * @$ 0  c.  .` @$ cannot bind, not a tty%s: no such function㿘 #` @#!ð #"H  *` *   `2 @$` :   ,  @     2{    ,  @     ` 2N@Xl . %"L  : . *  "@3ܒ 2 ; . bH*   "@#lB ې @Cc , @ 1 ` .#@  `c@*#@ "@@   :*"  * *+ @   :*"  * +  㿘# cϐ ?"c#   "c ! #* #    + c@* c      ` *  ` @ G* `cӽ,$# +   c*" +  *   8("8 ( 㿘`     ` ܔ  ` ֔  ` Д  ` ʔ $   㿘 #쀢`@V 0 #@"@"  Ɛ $c 㿘 쀢 #  "0@6  㿘# % ' ) + c#@cc!۠"" %c$c$@"$%#/@$$$c%#%c@?! @  㿘 @`  㿘 @Z  㿘 @T  㿘 @N  㿘 @H  㿘 @B  㿘 @<  㿀  ## #c#\#`" "  7 c@ 0  7@ )"?%.  뀦6    㿀  #' #㬘#\#`" "   @ 0E` _ 08" c @ ݐ@@# ` J /`d! ` * \ Y㿘 # 2`@ # :`#Ȕ"   ##Ȁ "c"c  c>"ځ 㿘`?"  ` `J@"J``""a 4 㿘  !  "# ##̀ m "# #   # ? $# #Ā` #Ѐ`c̐?@㿘N `#Ȣ*` : N cȀ*`㿘    % # " `   , * ?  ✒ @ `,     $c$h$$c܁ 㿐1 #5% # " 㰐 '"@  #   $* ##c~##    _  㿘 !@` S 0#܀`:@P?@(L@(N "? "? ""? '"? , :    " '2?, :    " ' &0K  N )   " '!N    " '2  N  "  "  ""  '" ؒ?`"NN     " '2 , < .. 㿘@ U㿘@  L㿘@ C㿘 # c  0s#ؐ??m!#ؠ #b #  `*:  _ $2# L b ` `(b `a+  * 4 b ` U#+  U b  ` *  `(*@ `*b  ` *:  _ހ U $ۀ U#ؐ??!#  㿘 #`'  c #   #Ԁ  N  cԀ$ %#substitute㿘' # ఐ a@4@`$ $$a@-h !"`@y ఐ`F$a `@L㿈 C!   ``'''@ ` t '''" '`"  @|  `$< , U, @'''"@`'`"@ E 㿈!   ϳ` '''@L":  ! ܒ`㿈!   ϕ` '''@." :   0!@ƒ з`expand(NULL)%S%s: bad substitution%s: %sparameter null or not set(  'c`@Đ   @j   #J`2J 2J 2@!    ''5  '' (@  ' ''Ԧ?$@@>"(. €N  !-  €ب Nհ N Ѱ   ڸ ظ   $,@` (,@N ``?$@@> ,@N `4 )@’2@"  ' #  $,@` (,@`,@N``?$@@>O ,@N ` ),@`,@`" ?/  @@"d  @eL n?$@@>"  ,@L `\  @"E ؒ@  @a9  @p,@_Ð ,@[#x2D  2     O`" " $ 4$@ 444 $` ` %"  = #    ?  ,@` ,@a `b"( @` ,@T T    %"  = #  E ?/?,@` ),@,` T@e T@2' T@@|֐  ڒ`@ @ew@d'؀`2T#@ @ @ݒ#@ N '   '~ | 'z ) 쀤@~ J  l'd   J  b'؀ W䀢 2  '܀`N'!Ѐ  W䀢 X FW䀢 D  A ` % '`  ?"` `  "`@J]  뀥   ? @Jv '? @G'W䀢` @"# "` 2耥  2,  !8*`   !8*` n 2,@i ,@`͑$@`@$@ @ @ @ ?(`@7(@``  ``$< , i, @&`&`&@@" &@`  ``$< , S, @&`&`&@@ݒ@"@`&@(@  '   ''̭  ''쀥 w !8*` x v  R,?߀`]O *` €G [`@ ,@?`< `,@ 6`@3 {`@0 ,@`*`( % '  " ('@  @ 2  #? ,@` ' 2,@,@``,@`   $ $ $ $ $ $ $ $0 $T $ $ $ $ $ $ $ $ $ $ $ $ $ $ $0 $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $T $T$L4D@Xpx%s: parameter not set㿈N@ $`N@ #cNN` _ } `@o [ % *O  * @ *O  ] *@iE@a  @2 ' $+  2 2c @   `+ @a]@b' ڸa @z^@ + cJ `   2&"@@U &@:ర @:ɒ`$$@    N :   N   N  * a8@  @2?N  J  2&?&'N@ * @'  %%=#  `` 2 `ڐ!$@ @ +   @`$`` ``?$@$`4`  @ [ t O  * @n O  ]j  %%=#!   В` '''@h{@`  +   ఠ$< , @, @'''@aː"@`'2" :  ڐ!$@O `@  ఐ Ԓ`6!8 ఓ,  ,   '''" '$`@ `$`$@O  @`?4` = @!8* @ B? ?@`S@a$`$@ + !8. @2 "@@J`ڐ!@ += -?cJ cİ cJ `@!@!8. @2 +"@@)funny $() command: %s%R%s: cannot open $() input㿐  ! `@.9 !"`@Q"@ $!O V@ .``)``$`    " !    @[J @-   @C7 0 2!6   @֒@@ @Cp  @  @ @n 2@ @ @ 6 &  㿘@ %2#0Q@0L@8J.@ &.@U7@2|  2   2Z @S  "  @  L / '< %@(@ @S8  ? @   2. @ (*L /%< @ (@2   @S^8  ? @ @<  2 /,@`,@ % $< , , @&&& $@@8"@`&@ /,@`N /?$@@8 ,@N /`@1 /  ,@wS @;9 2,@$ @" @7@b@w;@&@=P @ !0@# D  9@ ` . L 1 .2LL +L .N .#@:  @w @"@@7@vK@&@ @$ 2J`@$32,*+?@! 㿘@  -$@@v'L@`" @%  (2 @`L@  @ `@ 2 @ @ ,  ",, , `L@  @,@ ڐ㿈   ' 'ǡ ' 'L@?"@$ `@7- ``*@L@` 2 *@L` /"耢 :*@ @   @.ȳ N "&@?$@6 2,  ,N  &HOMEPWDOLDPWD㿘N  + @]1#@^^2 NN  2 N @]$#@^Q - N   @] @^D@ ڐ!" 㿘! !@PU@P 2 @̐ 2    @6~`$ `$ 㿘  @Ò  +N {2( N   `N { }   ,?2 "N  逢` # k$0e    `$< , =, @& & &ǒ"@`L& 0B> "& 4 N { },  ,? ,% 2# `&  `w@t@t@@t,g  2㿘 @O %sPS4%s%scoprocess already exists%s: %sX'D'H'D   H H DR` H?D@ {@48  #p`@R DR`YD D"`D  `  *`#` :`'H$ Dڨ J#倢`4`/  H!  #@[ݐ#@] ͒ @D3@   %#ڠ  ` a@D @  @@ H` @FH ;'HD` 2 ! DR`"! DR` !   @ũ`  @"` @t[ D `%D `#  %'@ 6 '`R$a,` N@J@~ D@?* : `< ȓ*` €HD@'0.DH`H  'HH 'H@!    2   @mR @{  ` 2DR`!! @ @[ DH@` @Q @H 'HD`'DDR@ !   ` @lR  ` 2 HD@`@H`ܠH "'0DR`DHŒ aD`'DDR@ HD a `Д@r  ` 2 @@    @r| @3@2# `   @Ԑ @   @ !    # 2@   c2`@, @ܔ @i$  쀢`$   @Д @ $c@Ɣ  $ `$ $  @r4  H ` ?2'HD H@b0VDH %`D!E'D `D R@  `? DH H!'H03D!(`?D '` aT'''''0 'D` " D G `   ' 2@ `?  @2Z@2 ` @?ΐ   'DR` * `D@Z` '@[DHʒ a'`0'D@Y`@[ DH a'@) '0   2 `?  @2@1 ` @?|   '0DH a'D!DR@@  `? 0D `~D!r DE D Hf a0=D D`'DD`aDR`\D '`  @6/  '@ D 'DD 8DR`01DH a$D`D@HD׈ 0D @^@'@PY@1DD`@( (`x !D@@ ޠ (@9' @1`"a,H @1  H!  J#ɀ`@0 @O2 ;|;;<??????BBLAABLDPC>CCC=T_builtin: %s: not a builtin:pcommand -p: restricted%s: restricted%s: can't find function definition file - %s%s: can't find function definition file%s: can't open function definition file %s - %s%s: function not defined by %sCFUNC %d%s: cannot execute - %s%s: not found㿈 #J  'H'P`'J     2 ( ! "@\& ?@Z: HL  ^" @ 'HH A!(@H a   JP 'P*H b < #@7  # c@7aH p?+   J#ۀ`æ = #*`   @Ғ 'HH H `H b8  `'H ! H Ha @VH H ` Hh   JĀ 2  @ "B7  + )   DM!`(`2  @Wߐ#@Y ϒ H@@5c  `H!ږ!  @@$  ` @<ƐH  @[W   @ Ȣ`` c H  J#ۀ` @ /  ah@ɔP @/'HH    0A逢 0<H@8'H`H H `H `H!`۠!x a@ H  @- H ( !`x@ !И@~  '@J@g @  H b @g 'H 'Hh"&"   `" `` !  H`"`( `` ܐ "` ܐ `"( ", "0 "4 "8 "< 3"@ #K ! 'H H2 + ! "'H "2@<   H P  a "a,  H*H" }H@ #@ &$H` HH@H ?"@ @TH"`#*` € d!,@.@.@.b @" 0XH`" H `H!`"0@ C@  ~A' bH@: aP@  4'#L `  (! "@Z H @X# P @kP "!L  !ڠ"@N4  @N1 H  `2`"  P""@Д?'P  "!,@.& N,N8N,N8N8NHNHN8EXECSHELL/bin/sh%s: %s: %s㿘@V* @WW L  # @ L 2    "?& " @@ ( !`x@  (@shcomexec: %s㿘# c<@ID@I `@g @㿘  `    @I  L @I& && 㿘 @I ה  2 " ?$$, ` $ @S `2 @Iِ`?@Q`$ $V``$ 㿘 !  N = *a +@2#<@@Hǐ@Ia` " "" FPATH㿘@H J#ޒ /@>   q`  #<@I ` @2 /`]   @U3#@@V`ڔa  & &  @ &   ` @2  ` 2 % `0 !   @HŔ #`   @’      &?` ?&  `  T P`N `      @H &    &  &   #   @   耦  @.>`& &  &`@T#@@Uڔa   @_  ` & "`& 㿐 `@HƐ   J`/  ` $ ?$@H 28@I'  '?@) ` ( x <   I  ?    "&㿈2&@ / Ő 2X 0VÒ"@Q@m-    ' ', ' '耦`:@ : @m@$" @-@lX /, "@@-@lFy N@ ɲ`Dz  (㿘' @% !  $$ @7ސ  #  #@3$cH @@8Ð$cH$$㤁%s%s %Rcannot %s %s: %sopencreatedupcould not finish (dup) redirection %s: %s ?      / J "`     ' ' ' ''''J`!!'! "@Sj#@TZ    @NӖ@ /?`P#(*` €I G" J `B&  @?@H <  30.."   @ߒ `'L -  L 2 #     @ ̔| ! (  @N |@ 9 ?J ` bah@ * ?@G! ! 2~?  "(  "@"H"P (@`x@  c?  *`R   ?@   ` *2 "@a@ =@    !  "X@N  (@V`x@ ͐  +?@a'?`@a` ` !@   @ @   H @6  [[\\[\4here document missingcan't %s temporary file %s: %sherein: yylexerror writing %s: %s㿈?''D 'Hc@@ v ?!    @@  ' '쀢`  `@Fܒ '  `#X"H"@ ( @`x @ I쀢 T?@6<! '@*8  @7Ő   H @*A"!@6?@a!䀢`  ! `@ 0 D" "$!@X !cx@ j  `$!@ @9 @9D@*@6w?0@`? ( !`x@|#@  baaREPLY-rreadPS3㿘 + )'% , `2 #` @Qa@RJ`@;@Q"@R@ hc *  @Qa@RJ@ ۲ @֐ 4ڑ* ?ڰ!%*d) %s㿘.`@ (`@9Ր㿈   @ja@&     @\˒   ' H0 ''@1 㿘.` @9㿘   @j,@&     H`@1 㿐   `A`?K  K " K`? ) K  : +@  +@K `@* +@~`   \"\*`  @n`?   $ 㿘`   "`1 !耢    㿘wdbteste_error: %s (offset %d)㿘 &bx@  ++--==!== *= /= %= += -= <<= >>= &= ^= |= <<>><=>=<>&& || */%+-&^|? , ~!():x"'ؒ'@&@x'ܐ 'D'L'''@(&' ` @5  􀢠 *@"@(*  L 1 @!@'Ő@l` (2ܐ '@N"`"@ @Vܒ ("D  @C "@RS 0@P L@QmD@' end of expression%s: unexpected `%s'%s: bad number `%s'%s: expression recurses on parameter `%s'%s: %s requires lvalue%s: %s applied to read only variable%s: %s㿐`C .` €  ''&"  *( )"  * @P  "  @//@ *`"Ȗ@b8 bP bhbb@m 0b@g @' kkkkkkmissing )zero divisormissing :㿘 `Y ߀ ```#@ @`! 86& `"` `?.& 2- (& `@ ϐ`$(i  @t@  @g S `:@ @X02  ),`@"ȓ*`  @A`@5  @  ` ` ` s@耢 ``    $ 8 `"*` € @i  @Y  @M   @  "@  *@  :@  @    @    @    @     ~`?   x@   t @  p@  l@ 2  $ @ `  @ `U   "  $ ْ@ `  "   8  ?3$  @   $   ?$  %HM @Z   $   ?$ "  `$ @"@PB@O2&   ,`ȑ* `@pp r oo0oDoXohoxop8pHpXoxooooophpoo0oDoXohp8pHpXqLr missing ]㿘`"L  `2 &` (  a8* @ 4  [ L * `2 [2 ` @T 2 `  ! @&`@@ "` $@&Δ@M/ &`|`[ & 6 _'   _  * !8@2L #"Lఐ $@&@&` }"`" `"` `@O ఐx H`' '&` "Ȯ @* :  ` 2  @  M ` 2&` )&`&`㿘@@K` ` & "@OI @NÐ"& 㿘N 2@@2 .`* Ȕ  $ .`* Ȕ   㿘!   ` """ " " * 㿘N`  @@" @b @N  @ "$ `ݒ @@ @M&@O @ *@&@$ e:glnrs0,1,2,3,4,5,6,7,8,9,- $_-%c%stoo many argumentscan't use -e, -l, -n, -r with -s (-e -)can't use -l, -n with -e-16 %d %.*s %s cannot create temp file %s - %serror writing temporary file - %s_${FCEDIT:-/bin/ed} $_cannot open temp file %serror reading temp file %s - %s(        % ?3`C<  *` € c@{ ,`@dܐ ` @%i@Xc`  @4G#耤  @# @+c`* Q   `2 2"@Ґ  `J@ `@ a =    @%`$ @ ,@    2   @#V  @< @  G@–B `@ 06  2  2 2  @s#  ` P @ @W  @Q    @ @  @ `@5  `?`= X ` ,) )7 5 3+ ":@31# $ @3*`h@ 2  @3`p" ? @/   ` @ @# `  (`!`x@U x@  !@2 p" ? (@/#?   (`x!@/ @l J#܀` #  @K3 `@L# # a @!D $aT`  @-Ɩ 2 `@ F @ci    !'`$ U' '' "  $" @#ې"@@0 & `@.,@+'$@U # $@Ǣa@V@. yyyyyyyyyyzDzDzDzDzDzDzDzDzDzDzDzDzDzDzDzDzDzDzDzDzDzDzDzDzDzDzDzDzDzDzDzDzDzDzDzDzDzDzDzDzDzDypzDyzDzDzDzDyzDyzDzDzDyy㿘@" )+ ) ' @  @, L " @!@    @"@vp ,? ߐa@ w%asubstitution failed㿈`  @#`0V@b@b    ' '  ''$@"  @#@a@a@  〦$  @" @bP "@$@"@aΒ$j%s: not in history%s: invalid range㿐@% /  ! ` "* @ *@  ! `+!@P/! `!!@.%"  ! PL ?    1 a! " : ?@u '! 8@ !* @no history (yet)㿘 ! a  2   !@! ?㿘  a!!@! 㿘!  !a # a%  " `a!`?$!$     `"8@*`     "!  㿘 a   " : `? @ae aa. @@ #@!?- @@f  a a@@ a&@ > a@@ @怦?㿘 )  ' % "@ : .  "@@Y/ ,  % $$㿘 !`! !   @  !  G`$! @oa㿘! !    " `"? "a$!㿘%  #  a* a  ' a @Xߕ*a*` @!K@`$@ (%!J "*%!㿘 !@`@@` @J?` "` 4`"@ , @_,HISTFILEr㻐 J#̀`L   "" "@Gv"@H  J   8"!`@   ""@)bب -   ,@5   a "k @$@``? $@w ݰ @#w%s%c㿘 a  5"a   ! `" :  *`"  ! !#@ג`( a )#  0@+ a`@   2@#D㿘   "a,"HN'H'L'P'T'X  3 @ `HH@/@.j @+ސ`H@ 㿘'L'P'T'X@m!  HL@/y @.V@+ʐ%s: 㿘   "a,"HN'H'L'P'T'X 3 @L  ##a@/`H`H@/QH@.. @+`H `   J#ـ` "#@o internal error: 㿘'L'P'T'X@ !  H#b@.ӐL@/#@. @+t @L %s[%d]: 㿘 !  !     "  @    J#- b H@.a ! !     # HcX @.!"`㿘 !$'H'L'P'T` 'X!  H@.ДH@+$shl_stdout not valid㿘 #H'H'L'P'T`'X$`   @.H8@_   <   ` `㿘!   @)   0@)  ?@)   "a$too many files open in shell㿘@'h   ( x` $Ӑ!㿘  @8  ` ( x` $ ?!@Tʐ`㿘 ` #@* ``@T0Ô @Tcan't create pipe - try again㿘@{ 6$" &  & 㿘@T@T bad file descriptorfd not open for readingfd not open for writingillegal file descriptor name㿘" ` ",NN  2(N*: ?А @8  `+$(#@(  %` `  2$$#X#p p N  @K$#&?? #"#   㿘! #`  @@T#?$#㿘 c   c` @T?$ 㿘 # `  @S?$ no coprocess   `%"@?㿘  1 # `# 6## #@S?&#  #@S?$   @S?& /tmp%s/shXXXXXXXX㿘  ؀`%"@] @ ,%$ $$@,@7R  @( $ !$$&ixargument must be %job or process idambiguousno such job㿘  P "aDԔ "@[  "- b@;Ĕ ) ' J`  *`   @'ڐ J  "aLJ ڢ"`%`# .  * $ @; ?. J` "J`@ @Br 㿘 !, ' ) <%  24  2.  2 #J` "%J` 2!2   @   @   2  @  @  2 `@?  @m@2#!!b@V !@)? #J` @.*` j_init: getpgrp() failed: %sj_init: tcgetpgrp() failed: %sj_init: setpgid() failed: %sj_init: tcsetpgrp() failed: %swarning: won't have full job control㿘  cJ` "J`@Aِ " `'  #x @ $P@z  "aT (`x!&@"x $PP  ې!@:ϔ ! @Z @k`" &0 (!T@2 %ڤ#b` ,   *  @:?, P 9   cT 0 @( " (`x!&@ ":  $P`x!&@"0 $P@Vc  T (`x!&@"  $P"!c$TP "&c " 5 @A`x01 `"!P%ڤ#b` ,   *  @:[?, #ڢ"`%`# , *`` 2` `@:E ?, #J `@Aexchild: XPIPEI and no last_job - pid %d%Tfork failedcannot fork - try again/dev/nullchildexchild: execute() returned[%d] %djw:last proc㿐` IaH  `@Z @ <$@$`$``$` ! !0    !'b@ڐ  a(!0"#"a(@ ` `2$$ $ ! @$ $ $$$ $"@$$($0  "!0"a(@ Z 'p` 0@= ) `@=|,@l)   ( x`# !0`  @ _'@bx @Y '"`?"$` @Y[ "a$` #J ``   `  $@'`  aP  `b@T `@`hb@Pcb  @Yo @\`#J `` 2J %ڤ#b` ,   *  @9??, #J ``@# `'#J `'!ڠ"  @9%  @9! b2 '' @63"  @P'@kb   "P#"a<* @@N* @8ra`F' b@R @GK`8@b  # $0 " `" `#'@x#J `! 'b@) H(` %'`  H@)@`2`  H @(Β@&B@Ӓ  @Xؔ 㿐 `Д@Xΐ  a0 `@" @X waitlast: no last jobwaitlast: not startedjw:waitlast㿐 `А @X a0``  `))` `j  @X   })@  @X %s: %sjw:waitfor㿐  `@Xv   &@ !, !  !@2 2')@{   !   @XI "? @XC `%#`*` )!Ԓ?)@'  @X,   &@㿐  `@X @@   @X %#`*`  )!0) `2 @ 2  ``2  @  @ 6  (`x!)@!  @W job not job-controlled[%d] %s%s| 1st tcsetpgrp(%d, %d) failed: %sfg: 2nd tcsetpgrp(%d, %d) failed: %scannot continue job %s: %sjw:resume㿐  `@W @ϒ   @W %#`*` )ː!`  ` @W ** հ "`(*`̐ 0`(  +*)*'  2$ $  `8   @  2 ! @$Đ 2$` @ݒ `"` @ҐK` 2?` !P` ` b @=ޒ`4!P -۠`h"```@R !`  "`x@=Ɣ  @W, `*"h H``` (`x@( 0a` 4  ?@ $`"4` A``@  ;` ( x)` P $``  b  @=`x!P !# "@RZaT "aT!* x@ p`  @Vא !* @ܐj 0 !P`*` 7$`@  @V You have %s%s%s jobs stopped and running㿘 !,'  ! c  " J` "J` 2  2  2 " 2 +  + + ؀ ++  ؀ + +    jobs㿐  `@VS     @o ` @VB %#`*` )Ր!B  !,``    ! %  !`  @ @6 ?   "$   2  !, 3+ "@?b 2  @U  notify㿐 `Ш @U  a, '  #L` "    @ @H ? 8 "$  2L` ,  %+ "@`2 @#H @U 㿐 `А @U a4`"` "` @U  a8asyncj_async: job not startedj_async: bad nzombie (%d)zombie㿘 !4  !!2 , @a  2 ,,a J 0B   a< D  "!8 7$a4) +,%,!, 4 "! " @6   a4 a!< !<a@  &!<@v`!<D@!,㿘   (& `  2H & , a"H@TҒ j_waitj: tcsetpgrp(%d, %d) failed: %s㿘``$`$ #J `"` @;[  c8  " ? @3$$`" @3 2^ " `   `}$ $#J` 51 !P`1" .  ! @e;" $`($! "@P%!T 6 !T (`x!,"@#8*   "4" @;+$"&',   2 $  @;`x,  ?R$   ` "`x@;  `2, ;$,#J `  2$   ڐ"` * "$@2א $   `""a4#J `!  "#Ġ H @^@!  #J ``@sp  (!,`x   !    2  2S"H 2 @*XD@*T!,  (`" `  @`2`  2 (  '''"' $" @# $ " @# '''' `$` `  $`@ ?@y>  %`xcheck_job: job started (flags 0x%x)checkjob㿘 2 (.`x 0`  `  4@`2` ,&  ``"  &  : &   &  ? # c 2 0 $  0`"  @2   ? $ c   @c& L : 8c 2L @ L  -c   '  !   `"R``2 2 !L@ !L@] @ !L ` c +c@tcJ `   !4  . <?& & `"<@U`%d RunningDoneDone (%d)[%d] %c %s%5d %s%s (core dumped)%-20s %s%s%s|%s%5d %-20s %s%s %s%s@ `' .#H ,  @#0   ?` ' .#P.#`' !,2 +" - ( ֗*';     `0C( `0>.h:? ڕ:*h @11``"./ :  ..#p `#p/!' @@#O#x`  2 `2  `2     2  /ڔ *h @`` ( ..# @#; `c@# ``. c@#`2O %`.# '.#a@"  .'#` .#Иa`.#a@"ې   ; 7  3 ).'ڶ#а/.-+.``  #\#\@"2 c  #Ж@"     ڀ` 21  ڐ@"a㿘  !8* &*@~ a,  , "  2 ,, |`   z 2 p`:  %`m k&@L`?F0"*` € !, !, V` R`0T@; a, I  J 2 @` !, 7  ( "  @$  `"`2.&@-    2 (`@R !,    (`@Ȕ 2`` 2 (`` &@    ,TTTTTTTTTT㿘 aX "aX `W d  ,`" & ` 2@`"& 㿘 a\ "a\ `8 @remove_job: job not found (%s)㿘 !,!,`@2 @1`h 0* " ( `   \ @"`"\ !  ! @ aX a<?"a<aX!0& #aX#!04" 4 ,,2`"`,0,"",,"" """㿘 (   "@P  &? 2 no closing quote x'X7 / 3 - ?'xX'|'p't @'h 'l Hh '`'d%`&adH   , @% , 7  J@  \` `"@   " #ad &adadJ@  \` `"@  퀦 ad?&ad@ ]`  ?"`  Jcـ "''`  `  !8*` `?$@`` 7"4-` € [> *`; *,d@=B  @֐\ # ,,\L  `?$@`, , L \%` @$\" 8" " "P% @ + ? ! 'J` `\` " @  ( ,Q,@ΐ '"  \ "+ \098 \J@  \` `"@ = ,,ad`&ad t@ p %*  , t@ p %  \  ` $9 ,/ ,J@  \` `"@ $͐  \ "` ? `` ?$@ڐ`  , \,,J@  \` `"@k (: {J@  \` `"@X (t  @p %  % d $ % @ t2 @}p %  % % | U  ,,@`J@   \` `"@ : # ,,J@   \` `"@ # %@̐ t @3p %L @ t @$p %=  a8* @ 0  , X,`?$@`,J@   \` `"@ * `2`, ," X `?$@` , X,,, ,, , $,@Wt  @p %  ,%  J#ـ`Φp @ @ 2% @ ``~ ' p?2@p ,ad&ad " \p?2@p   ?7" * € ("  ) " 'ad.  \  (  $%  ? % %  %  % `&ad%  " \% 2    %  '2 ad% ?&ad  2',$p ( )  % 2, ? % J` `\` " @ )p?2@p,"@d   $ @Fv , (,  % %%  } *p?2@pϐ  } |p?2@p Հ (0׀ ` \,2,J@  \` `"@r $", \ " 0  ` ,  2,  \, ) (  ?Z% J` `\` " @@ )y @C 'A '  =%  \ 'J@  \` `"@   P, "t  @Up %  ,ad`h&ad8  % , _ " \ , %U % J@  \` `"@ $  \ " `  , \, ,,+ ) | ,?p@ p ( , * , , t@p % J@  \` `"@ ``?$@ ڐ`` 1@="p" d < >` L@ } ` a8* @uఐ ` L`?$ >`?$J` `\` " @A <- & >* &  >  $ 28$J` `\` " @ - $@$ > <  $$   > $ | @$@͐$$ $d!l " 2h,`2e,l )"ذ ) ; & ( 206 0 |J` `\` " @ | ; | &!,!!!& &$!@? J#܀`J` `\` " @ (~!@\0zdlŒ$  o"`@N c `@@ J@  ` @,@`@ `J@ ` @Kϔ$ 2,?L? J? H!@&J ! @&   !  } 4`- ) #@& #! !8 "  @$ """ "8% `)?!Ѡ,8,`h<Ӥx(ҔՀX(㿘  #c   @c  $chere document `%s' unclosed 㿀 ݒ  '`  ad "ad  !' '! ''+ -   $ ` a L@!?$@ , aJ` `\` " @`ڀL  `` 6@Z% '7@<⸐?$@ ː, aJ` `\` " @b` ߀`?$@ , , $ `&  ad?"ad㿘 !'H'L'P'T'X`?  H `8`? (`8"!ڠ!"o  @| Hِ㿘א <ڐ!?$`$ $ $ $ $ $ $ 8 $ $!$ 0$ 4! 0$ , $ ($ ($ ,$ 0$ 4㿘 a @J  $@``n$@9 *` €m!@b@`   $`$` $`X$@` `ڐ!$`$@M$`! $`$`G$@`  `8 $@ P" `  J`"`8@; ?@ `"`8`8` $ :$` `  `$ "  `` ,`,` $` $`$`8$@%$$@``@  ` ``8$@`2 ` ڐ!$`$`$@  !  H@@@J  x$@DD0㿘 #J  ` ,  `?   @  (<$@  (,&` &   ̀ڐ "a@ `J`  J` J`  $ & ,F+ "  `@ ? & ?#+ %  ( @~"@  `$  `p `"@')  ("  J "   ,$ (" $٠?@ 3 (Ҡ? `@ ` %a  ̀`"!@  , && @w$ ,    21&@ -&+ #t` J!8` * J  *`  2J #t 2  ,葒    [&   @  PS1%dPS2㿐 "#t P:0S:@0 0@1K@I$'*   B@~ J@  !1:J`` ! 'J@' ` 8`  @TJ@ 倢 !@!  '`'@   @   #l  "`Β @ e "`@@/Ґ @@0! $ ȁ㿘!  H@@͐missing ] 㿐 ' J  \  !``" @`k; P.` €, :  # ^  a8* @ V  S  P N  !8*` G`, :  [A @[ 2.:! L # ?&@   .L  ``J  \  !``" @  !8*` ` `2, .: @b 0 ?&@ڐ.p l㿈    ' ') ('  '') J@  @ \!` `" @U?$@,`: , [  ]":`  , v$&`?㿘 a` ?"a` !a `!@` "@`$ * * ! " " 8"$!!㿘 !d`  !@J  7"@ a`   ! $a`J  '"#$a`! !@J  "@ \!J` "  ! $a`㿘  `r!" !$ $ 㿘` ~&``& !tMAIL8@  !| "#!|!| a" 9 !h #!| ;@.0#    !l %%<#   "$ @"ݒ 2$  2$ ̀@   @$  2   8 !l` ! E `  ?  @w$` $`@"  l<  l$` l" 㿘# @>ah `@V$ah 4 #Ĥ@럒 : , @똒 % N? \ @F ?@>Œ  L  @뀒 ? . @h "$h㿘 %  #  ؒՒ` 8 ` $ $$ @"1 2 $ <  2$ $ _%s you have mail in $_㿘< @.#` @/  <`#h<#p ; @2 j`XH8(pXh`XPH@80( whovishsedrmprmvmakemaillsgrepemacseddatecpchmodcccat-tUlogin=exec loginr=fc -e -local=typesetnohup=nohup integer=typeset -ihistory=fc -lfunctions=typeset -fautoload=typeset -fususpend=kill -STOP $$stop=kill -STOPtype=whence -vhash=alias -taliastypeset -i RANDOM MAILCHECK="${MAILCHECK-600}" SECONDS="${SECONDS-0}" TMOUT="${TMOUT-0}"evalOPTIND=1PPID-i-rHOMEPATHSHELL-xtypesetpdksh/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bin/sh-shPWD.RANDOM$ # PS1-c requires an argument%s: %sCannot determine current working directory/etc/profile$HOME/.profile/etc/suid_profileENV0(@ @ 2@ڲ"  @!   "   ????????'7  @*"`' @+) @89 @!a5 ;<  @\  #@W  !@R @'1  #<@K @'"@`"  H  2"``   8  2=# $ഐ  @   Ð @$=@+"@-Z `#Ē *@D*`?@=@:c` =`@4`耢 =`@.ch  #Đ *`  @  ( p#Đ *`   #`  @/   `@B "a'#ڔ    @.!ڒ O!=@+X#p@,L /@ P =#x@   P@2 T@ @ hJ@ @ w hJ@ ڐ!@,۔ @H=@+"@-1=@+#@X @F#@F@-$@+ "ےb@, c`c `    @ l & =#=#"@=@*#     @, @蹒 #  #l @,@#   @Q@QȠ   ,#,  @- 6L @A  ఐ `. @ $@$` =㸐#. @ R%`N '#L  #ఐ Β`. @  $`  @  0  $`  (`  x!=",@0#㋒`&%` `, =c$`p   @ $` @C @C   ,,"` `  $` `"$`@Ci <   #Đ#J `"L @  #L  @ , L  ఑. `?`@%""&@\ L , hL , J@ 2 #L  =cE #L = # @[ L `2 #>    @O #J ` >  @E 0>@) 0@+  J@    @4 @@ 2  =@)ސ#@+ @  >ڐ 4#Đ *`#Đ *`#J`  @@p*`@  include: %d㿈'D'H'L'P'  @  0 'y?L    `''0''@  ` @I  4L @#` @    " "?`A @*` € A !/P` !,`7 @E@bې L 3   "`H" ` `'D`" @ђ` "@6@ ` @u `" " 0d0d<lld㿘   W`"`"@@ shell: %dUse `exit' to leave ksh 㿈'D'HD `  J̐ ''` H@  !' '@쀢   " ` @  :?`.*`B X €쀢  2 ⨐! J#ˀ`D `  D "`DDa""  @"!@ @"aA`-  #Ģ %A #p`@0 D 8`L  D`  D` ?"` 쀢  DBD^ D@ BV .  L  ?'`?D"  3 `  a  D&`"`H '@6   L   D `  "a, V  쀢  ` 2"`@ @i  "a,xxx㿘  #J `   "l` "`J `  ! ې"`@ !  R`B!l*` € `@    ` 2`@  D 0 0 0 \ 0 0㿘# ` D`44  ``$ $ $ $ @$`㿘  ` " `  `@"` @&`  ` , R@`"   $` ` R ` H @  @c` 'T@ !  J#̀```  !,  2  ڐ"`, @ @ @>א  @>a,$`㿘   "    ,`R@ `@6y`$  $   2 " 㿘  @ @  㿘!  @`@ `%"`@㿘  !  !@2@Dr  2 㿘@uM / 2@ r  =@i`耠@ alloc: %s㿘C `!` !8    0 !83!8J  8( 2J  0123456789 |&;<>()*@#!$-? =-+?#% "#$&'()*;<>?[\`|㿘 8 – @  2@ ` !8  @  2@ `8C`2! C! C! C! C! C! @C!!0123456789ABCDEF㿘 !?C",@BP @?,@AT 㿘   @?w} @Ӧ㿘` r`@* 㿘 @    $  &@ $$ haXPcH@e8(iklXmCnfbupxrphsXhPvH@0 xxtracevi-esccompletevi-tabcompletevi-show8virawviverbosetrackallstdinshrestrictedprivilegedposixphysicalnounsetnotifynolognohupnoglobnoexecnoclobbermonitormarkdirsloginkeywordinteractiveignoreeofgmacserrexitemacsbgnicebraceexpandallexport㿘C# . @ " @4   ". ?%-*s %sonoff㿘 .`@ #J  D"Ѐ`D"D"@ ܐCurrent option settings set -o %sx "+DDE#HCب#'ؤ  ,` "`@>R$?$ؠ @'آ``",` D  @ۚ 0#h C#Ĥc !DN " `,``"` #p``"(N!pCc #Ą ` J@  @K@ " *  "`  *`㿘 #J  *`6 5 w1     &c* * * !* ` @! @K$ @K @K@K@K@K   c*       ac* "o:A:o;s%s: bad optionparse_args: `%c'%s: is not an identifierx J!!`   -E"P"P 4@=, EbXbX "4 @=}Cc J`  ``  ,@`" *  "`,@*`  J#Ā`-   @r / ",` J  -2,`  ,` !Ȑ@  C#ĴcS7E`A2  `o`?`0* `0'? ? Đ8  O.  , R @#i`C`s# # `  " #J`@2`R`@ #PE@T耊 !`ؑ*  `J`-`+`J  ``-  #J `2* * !ؐ '؀`   耊 2  ؑ* `"'@ '@ M  @(J`E",?bp &?ؑ, `2 I*`$$ @j ؐ*@+Q ؑ*`" ؔ*`2'؁㿐 @N J`2   <#$&@  %s: bad number㿘ސ F#܉X `+ @?@ "*`` /Qcؐ @( (`$" x*?6`  ( x`@ "` (&`$&@` @'  퀢 0 2 `x ?" ?``?&`*@`&`㿘 " ?@1*@shf_write: flags %xshf_write: nbytes %d㿘R`ф `6R` | `@@`4 @0H$@@"&&`9" ?23?@ #`@8&@ &@% ( @' 6$x`  (&&$&? 4 ` @0 @"&&㿘'L'P'T'X@MLshf_snprintf: buf %lx, bsize %dh'P'T 'X` Rb Ȓ P@*DhȖ'H'L'P'T'X  BА H@00123456789ABCDEF0123456789abcdef(null %s)P `  @, `:  %"N@ `2 ̒`& * & ``   U`* : `L#U H*` €CA?"<@;N@7 261N@ -+ ) !8*` &,@: , ?Ѐ`  ,@.,* :`@  ?Ѐ` "N@`  & , 8 ۦ ۑ* : `ST"*` € Ϧ * : ``\T"*` €   ,` @2p 0,@@1t 2 =` u> -9 +42 /`   04  ,@# 0""R#pR#`   4  ,@  x X,@ 0,@%$@`R#@/O ` // `d`% @"@@ L@`+ @`-` `0  )?"*3 0  ? 0 ?&   @*@`& ?` ` @` x 0  ?*`:  `&   @*@`& `?`@  0 '@, `2 < o& * & ,    @?  ?L@T &   @*@`&  `?$@@, `2 < ;& * & 4 @, W(?N@OOOON@OOOOONOOOOONTOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMOOOOMOOOOOMMOOOOMOOMLLLLtLLLLLLLL|LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL㿘 !! ` `?@}$!!   "a $!/  "b "` ` a ` @ $a`@3 㿘@" * # % @   @! 2   @g  @` $ a $a | |$ސ $a㿘ϐ "# % Ȑ  !@   @9 a $aȐ $!瀤! $a㿘  ) + !`b%!ۭ %b  ` @a `瀦 0`* &! ; &   @ 2 2  @  @ޖ $ %!too many <<'s 㿘 !`  $!_ ! "b #  "a# % `$! ! `` `?@, ` & J`   &  #@ `V "@"& 㿘   "@ "0   "b@5 㿐@U  @ @n too many redirections %s: bad identifier forselectP!   }`   @}` @'''  @}` @'''ز  !` "%a͐ ,  "baaa tЀa!a `{ a`(   ,  oa  00"  aaa  %àa  %a`~|  ~w` ~s`0 @ %a a #$ T耠 ` " `@:  a`$a  %ai%a"a`(c!V0jaV",% צ%aؐ" :  " :  2  @# "4" :   N #  `@   $< , }U, @'''`" '  $< , }>, @'''`" ' }`" : ؐ" :   ؐ" :  " )@  %a %a  ( )٤ { }Ԥ@Q  a$%a  $< , |, @''' ڒ`@""@`'!   $< , |Ӕ, @'''  "@`'@  \]]]p!aȒ'%a'''''!V" @ @G! `@N    Va "V"V"  `끐#$@Ȑ@I@$0$@a   @ @$ $@Ð !   $@! @$@@ m @$$! @,!V   @3   @{    @q    ؐ! ` @!V$,ߦ"% , |Ӓ` $ % ,|$ T  ;   $< , |, @'''"@`' "@ {$  $< , {, @'''"@`' "@ {֔ $|` |`㿘 a  ""a؋  "b! {! }@  N 㿘 H!@   & @ @& 㿘 a   "&!X , "b!!  &!  @c @ʐ  & &  㿘 a   "$/   "b! {!  }@=     @`2$`&  $  $ڒ 㿈!   @z` @'''@z  !` "$a   "b( $a% !  ఠ$< , {, @'''" 'a`"$a׾ %"|ݐ! $a $< , z, @'''"@`'ఒ"@zВ &  m )ڐ a` & $a׏ %"0"!Y %s: invalid function name 㿘@ 5L #  !8Z *a`=`J 2 @  !`& 6 `&  {%   "a` ` U2` /& @Ő `& `y  `"`y   ` :"  @* `* `* `"`yɒ`  "`  "@ "  `` ?2`㿈!   @y` @''' a   "$a   "b;: 8$a%   $< , z, @'''"@`'a $a̐ $߀ ;@ܐ " :    z`  ,  y ,   '''"@`' "@ yє㿘@" " " mmmmmm m Z Z m mmmmmxmpmh{m`}mXmPmHm@m8m0m(m newline|&((;;||&&[[!}{timefunctionindonedountilwhileesaccasefielifelsethenif㿘  `! @# [ D` D T` "`@@@ " `"T`" `@ 2T`unexpectedunmatchedsyntax error: unexpected EOF %S%R?%dsyntax error: `%s' %s 㿐  ["  ""a  [ [" "aDDDa " [m"[   [ @ D @ "@R` 2`@  [//А ["@ " " " "   㿘   x#`22 " " " " " " 㿘   c "!""!#  !aliasexportreadonlytypeset㿘 J#ـ`* :   a)   \a@z "  e r\a @p  r t\a(@g  t2 \@^a8   2 8   "  "  j j(j0j8j@㿘 !` $!` @ A  "b "   J# @ ``H`D `A `\9d`7(3) (`  ` ` "Pڔ"X   @ `       `ڒbH@`? .`,$!2 `  \\.` @ ``@`*`` `$< , w`, "``"`@"``@" "@㿘 !`  $!a @ "b "!"$!$  @`* ` `$< , w} , "` " @"`  `" "1ڰ! 㿘` &  ` @ " !" ?#a .`  "4J@  @`*J@(8 @ ( * "* * 㿘"" 2 `2 @㿘.` vV  @*``@$.`6 @ 6 5&  @6/*``%`@ "`V  * ` 2V *  " ?6 w@ב*`w㿘T  ?%  * @ @N N@@2   @˒ 2   2T *  2N  㿘T ? T?* @`@L`N@@2 `@՛ /2T* `2L`T TX*`T@$ u $@$`$`$`$`@$-`4$"R`"`"      㿘 @F`㿘 T`  `u* T``  "@ 2`T` &"@: ^L_, &Error handlerERRUser defined signal 2USR2User defined signal 1USR1Information requestINFOWindow size changeWINCHProfiling timer expiredPROFVirtual timer expiredVTALRMFile size limit exceededXFSZCPU time limit exceededXCPUI/O possibleIOStopped (tty output)TTOUStopped (tty input)TTINChild exitedCHLDContinuedCONTStoppedTSTPStopped (signal)STOPUrgent I/O conditionURGTerminatedTERMAlarm clockALRMBroken pipePIPEBad system callSYSMemory faultSEGVBus errorBUSKilledKILLFloating point exceptionFPEEMT trapEMTAbortABRTTrace trapTRAPIllegal instructionILLQuitQUITInterruptINTHangupHUPSignal 0EXIT㿘!ڒ"`И"`    2 *"J 2"@` b #b "`  Tb t#`!a| 4"`#"`"` b @$ T$ t$!$ 4$" $@ @ @ ` @! @ 㿘ڐ"`!_"!Ԑ!c@Ք )㿘#à  @   $a"a00@ySIG㿐  a8* @渒 D A 4@ 1ڑ* "`;ڰ"` %`  /`@ ,@# #( @  2 @o  @Ә @" ( @   2  @Ӈ  ΰ  㿘ڐ"`. @ " ( `x "#p`@ "!0b"  2 "#8 "a0`"$`x@$`x㿘 !0`@<"@ڐ`  "  @   ڐ`  " " H2 @  timed out waiting for input㿘̀  ` c—"L " "#p @ "!0" "#8ڠ"`      "  2@ 㿘  & 2L " @ "!, ) "!,  " !  & ~&  a! !,$!,  ! ta` &  & 㿘 "#p "a0 "#8b`  $  "   J@ 㿘ڠ"`  2 ` 0 @i< 㿘 ! t!  Y & a` & N@ `!|    "@& 2 `!|  J#̀` π&   &  &  @( 㿘۠  `    @   `  @    @  㿘 ې  @ 㿈< ";      b@ 耢 `` & &      J#̀` @! "&  `& !|  '& ''@Ɣ  setexecsig: unset signal %d(%s)㿘  2  b`(   ` π` & ` `  0 `  &  & %S #no-vars# #no-args# ( %T) %T| %T%;%T%s %T||&&! [[ %S ]] select %s for %s in %;do%N%T%;done case %S in%N(%S%c%;%T%N;;%Nesac if %Tthen%N%Telif %Telse%;%T%;fi %s %Twhileuntil%;do%;%T{%;%T%;} %T|& %T& function %s %T%s() %Ttime %T%s㿘 ?* : `ld!8*` €   #b@`Р  2 bؐ@   K#b@Ԕ`Р  2@ b b @’`3  b b@ *:`b `!b!b!  @ b(@ b0@  @ #b , @a8@  , `2 bȔ@b H@yV 2  b X@o ` %b)bb`@d   #b@Z`Р  2bh@P p@K!xb @C `'-b`+b)b@8` "`!  )  |@(  2 `@a``b`b @`!b bh@ b А@`    bh@b @` `bR@ ߀` h@b ؐ@`'!b*: a `b!b" @ϐb@ʐb `@Đb xb `@b @' b (b 0V  b"8b"H  @ b P@ bX@ `6@   @@Y`@ 2@ @  'b@   `  햐  ݒ Z @b` @ 2@큐 p$l44<h< <<- << >> >| > <> <&>&%s 㿘 `       4`  @ @ `  @ `03?`.d#*` €d` "ddd`@"dd  d`dȐ@ dА@ڒ 2  b@ϔ0  !d!b А@㿘 `    ^ $ג  @Ӓ0 2   ^ $ɒƐ ?0Ò㿘 %eN  , X@€NҰ NN`   " ` $ \졒N왐 $얐 (N`&* : N  )섐 $쁐 (~ (N` * : N n ) )k  + " ( "` $N`{  {YN  sN  NN }   }NB  ( | );~NP`x4<㿘'P'T'X@P h'P'T'X   B @PI`N% Nŀ`:~f!h*` €zL s *`:  L  iNbdd 2 `2 ݳ `? -,L K *`뾑:  L  AN9! ;  ;맒 뤒+ 럒`  똒?  $N 뎒?  N/  ~zNrt000000000000000000t000X00000000000000X00000000000000p0Н㿘 g m 4 4V  @\$$ ` $  $ ?m$  " $@@?$@  `$@  $   $ ?ms$  " $@@$@  `$@ " @$ $  $ $ $㿘@ "mD@wdscan: unknown char 0x%x (carrying on)㿘 #gN + * aL@€N  N N  N`  ?N  N?@? ` 2Nՠ?gN?`@l NDtthȠ   > B#gN  * c<@€瘐[NU NP $ (*  : GN`? )> $; ( (*  : 2N`+ )' )& $N`{  {N  N  NN }   }N   ( | )N0 㿘  &li ? `- l_ $@$`$ `$ ` $ `$ ` "` $ ` "`$ ` "۹$  ب - &㿘 7  " mj  " mb   mZ  " mR   mJ " @  ϒ ̒m;㿘  " m0 " m*  "m$m!  㿘@㿘@楒 /dev/ttyNo controlling tty (open /dev/tty: %s)Can't find tty file descriptorj_ttyinit: dup of tty fd failed: %sj_ttyinit: can't set close-on-exec flag: %s㿘ۦ"  @?$% h"$x @%   (`x!h"@($x `@    @   hb8 00 @'  $ (`x!h@"X|     (`x!h@"l @_‒?$ m`x @R㿘!" @H?$"i㿘!   Pk-`k$`  ` i h$`$` $```$`` $`Dk$`H`g `$`L"`㿘  ```L"`T`?,` `@!"?@`@ @1 ?@ ?<`  `(" `, " `0" `4" `8" `<" `@" jఐl `@ 80(    LINENOTMOUTSECONDSRANDOMMAILPATHMAILCHECKMAILVISUALEDITORHISTSIZEHISTFILETMPDIRPOSIXLY_CORRECTPATHOPTINDIFSCOLUMNS㿘  `"hʔ i"`  @@bh"`@`" %s: subscript out of range㿐&@@- @0L@ [,@ِ ' &@3 `Đ` `kq``$@ٷ #(&i#`k[`bad substitution㿐!  `IL@ `!8*` h  " j   "HH $ $ ,  $H @ + `+ ` @+` + * :`  ?Ѐ@4 +`@t $[$"HL``U߀` "Hj#t*` € #E$  @$  !,:$ 7$  =ڀ$1$ - =@* D  0L 2b`@`@L$ !$\Lx㿐!     !8*`    $H"H $ ;$ `#    L  є " L" @ $""$ $  @``@$ !$0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789abcdefghijklmnopqrstuvwxyz㿘! @Ґ T! M k!Pk!x bE  & `" ?.@r ?.@v `  #?. @ ?` . @  ?.@ 0 0? -.0@@2%s: bad number㿐@?2 !k#0n%s: is read onlysetstr: %s=%s: assigning to self㿘$`"kc l M I!"7 " @ @6 @@ kc   iq &  ?` &@@Ґ @u ה &   & 2   !&@G 㿘"2&    "H"H"`"`   "`  !&@&㿘! @ΐ L `"P?" &@J @2L@ڢ!L@   :` "a8 - #- & # $4+?   *@`    ? ??ɠ?  6? @ ?L@ ΢`2 &@㿐2 b  & h  `& & "!&@%0*s%.*s%*s%.*s%-*.*s㿐@I0@ "$   `gA0@V @0@"( "  `2"@ #@ @ @@  @a8* @l#l##\" !j*" @ ` `@ `2`@ lN@N@ 0"`lؚG `@/@N . b `!*@ `*J 2 0@N  b ` (*@ `*J 2 㿘    @@ &f@& @ޔ =,  $& @Ӕ  gENVSHELL%s: restricted㿘@P " L [ =@  @  6  !8 * @` &  L =   $А@   J#ۀ`ic(@Ő mc@@ſ mcH@Ź hm#P!h6` `͐ .@ @$ k2##  g5`@y  p   b@ b2   bb "       ?$"2` ?$$ `* $ p$ p@2$ " B  `"  ? " f $  ?$`"  fŐ  2z!""   4&    b    `  !㿘 " f @` `"&  ` fz fw `& `! @ a&!@6㿘  a8* `  N* `2 ` [@ 2J1 8(*  J ` (2 `J [ H(8[`]2H2H㿘ɒ J`?㿘 @  J@ J` =`?㿈!  !d`!'''  PT? H? ?  ; ͤL  6 " L@ ?"@ L "   y& $< , d, @''' " ' 6L2T $< , dД, @'''"@`'"@ d㿘@ '㿘! i"h֐  @ 2`㿘! "hWĒ 8㿘ݐ ?`9p"*` € ~`,&@)  bt" $ >@ &?*   >& >&  ` x >& !&0h8 ?`q!(*` €# c ! d Ɛ" $c 0ґ L"! ~&pe  Ԉ 0# `؀  dŒ`$`L /z@2  u@# p<  j `e$` ~&'3zBXiF"`Qo,Ӑ!ڀ G$!Ԑ D$!b6^] ~&(  ~&@ +!(& ~@U&$ ""t" `&  "  ~& ` " ?"xa&l¨Ĉ(8\Ôøļ 㿘 ?`/q"L*` €! # 1 d  `T $#7 0q!pĒ ڐ "a1  ؀  d` & ʵ 0ݐ 0 Ť<D$0<<DDDDDD<<㿘 @`$2$   &     @|b !@` ~$@$`$`$`$`$$`J@ `]"?["J  ][["  㿘 [@   "@ϔ㿘,$`k#4ޒ    ʔ   㿘d8$@@ ~~# cH  ` $cH `$cH@~O5 #D( #P @  @2 @Đ~X @   ~ ϶ @   "` cH@ ?@) ~8cH~: ~8 ~0! ?" @" @"ܒ  ."ܐ "  /?㿘 #D` Тt#`*` €! #0+  $cD ^@j "cD ?cD cD @$cD  #0 " @ L"cD@ G@ cD    ?π #""ⴐ?В "$cD "*  #"@ $cD@  "܀ /"` "`r"xr" @ R а?@  cD k @ ! "ܠ""` "`@.@ < 0ې"   "`@ h @ b*@ "@  C$cDb  `  *` * ?3"  "* `L" ?π "?В "$cD " * J` f#"ې"  1 $cDb  `  *` * ?"! " "$""@> $" " * J` 7#"ې"   @k$cD$cD  $cD "* ` "$cD   @ "􀢠   J#`  @$cDb *@ @# $cDcPcP 2 􀢠 b @  @4" b "@"" @ ? 0@$cD@ 9 cD2  " "b "" ?  " '  ""  ?  `2  "?b ?  `" ?  "@ @ܠ? "@" $  @ " 􀢠' @  0""* '  J#•`ܘ M  - * ܒ`"  *@ "  ܘ ^  @* ܒ`"  *@ "   * `" ܐ  @ "c cD     W 0X  0Ub$cD @Ȓb "   ?5 0G? ? 0B#0` "" @ @ 9  "$cD ! $## #@c " ߀   0%#0`Lc`s`c`C @   @@# @|@ S   @ O  @r$cD ʴ0ͤppΨψ㿘 "#DҐ?# b         ##8"c@#c<#4" 0 @T$b@ۄ    .       㿘 #P #P 2< #0`   "b` @ 0" ?#""` &` ?"  * "``  ?"` `?#   #`@#` ۀ2! "  "b" @ "` `" "` "`$  "`@  "   "  @ǐ"  "@" " "# ""~" b耢   ""쀦 Cv |.  €o ۀ`"#D  " " "  a  *" J# s c C  c?@uI@  E  b@  ?  J#〢`!  @ @ 5 ! "  ?@ +? "* # c0`"  ` "  @N"`  "` "*@c0  ""` ` "` "#D ררררhהרר׀ָררָררררררררררXרר^y$%s %d%sfc -e ${VISUAL:-${EDITOR:-vi}} --㿘  %@  @@" @  @ @] o " 2"  2@ #H`2@! "# b"@` @"   b## # #c@Ĕ @?* : `yz!*` €@ e  `!۠#H, # cQN` $?  #H JN`@ @V J @ x HH ``""@    ]p @ `H,@H`  @@ ^,@ ,@ H$H" 9"   " c<   "#4`"@  #  ("#0 #<   "#4"c@ @y  " ` "`"0v` @  bܔ @g" v N@N``c v` @  "ܦ;`  ` `@x  &?N@ c' N` w W " @  ` ܖ ?  `2?     N` %  N@ c@@N@ y@ " N@ c    b #<  "@"c4   % # b@ ܰ? b` "? #` #<   "@"c4 % # b@  ? 4   "` ?"` a o?  "ܠ c<    "4"@! " @" @"` D?B"`  #<`   ! `<""! ?#@@y  "#4'$#@ #<    "#4"c0##@ #<   "#4"@v` @  b " "0! #4# c@@Q@ #4$c@$#4! #4# c@@D"@ #4$c@"$#4 " ` #<   "@"c4N` `@    *  #<     ##@"4"0 " `j   #<  "#4@ "@#@  @ "#0 " R  #@` * a  ܐ #  a  <4 " ?"܀   v!v!v ܰ @  $ ! "    #<  @"@"c4  @"`@’e ! "   #<   "@"c4  @#"`@""`"H"`  """A"# c@ ! @#8 #8 "#43$c@  #<4@  ?"4 ""N@"#@ #@  ?N@`?`N% `?'  @4@   ?@~@ 0"#8$@$4? & ?{ GJ" J   `2 "* ?&"J  ` 2J✀ J   `2 " ?2J Z '    ##ڠ L '    #"  `2     "  J 2 ܐ  @ <#4 ""JJ   ` a @ 2 ?@  ?   ` ?#` Z"c0 " ` Q)#    '%b  "  <$c@#4  " b$c@#4(*  (b` `??"`b# ! " w *"("  b@ђ   J# J#䀢`"?@  @  #0`  "` @" pppD$pڀ0T߄X<ht<ܨܰܰ0<8ܰd㿘@?* :  `t  {#H*` € "`?@T  "`?@%   b   ?@   b   ԰?@@  "` &ɰ 0N@"#Nx dX @ oW#T.x %#T#T@㿘 #T + "@o> @  #X.$cTN@o2`#T @$#T#$cT$cTo$ cT?@&cT$cT #X" @  $cTN@o`#T @$#T$cT㿀  ) !#D  ""  b  %"\$#D" " %" "ܚ    #\#`r՚ @d?0AѢ ے %""D"`5 / + -  3 @ ڐ! Z 2?@,`@@>}tS8 `?"  " ``"`c< %4%0&@&c 㿀 ) !#D  "  @  $#D "!#D  ""  bܰ  %"$#D `%"`   "ܺ    #`#\rO `@ް?0G@@ְ?orߐ 0s ',`@ r @+}9 7 / 5 -  . @r֒ @@   ,`@+}9 7 / 5 - @ @ry+} ے "D`?9 7 / 5 - b%"a8bܐ"s 2쀤`  "#DJ?`/ ڐ!v rr< &4&0'#@%3 㿀   #\#` q  o rS 0@>?    H†     ` M-㿘 J#•`  m x   m ^ @m㿘   #`  #\- 㿘@ms mk㿘! #H  #H `R5`$#H$`$`㿘@㿐@!!@$p `@5   %@@Dž!?* & @ @t@@ ` ! ." @%@ `,`@c,`@* ?Р @ M`@ `  .@ .3`.@`@}x!% `2@@;@@?Ц@ `@@``!"@ ``@@`"`''  @ᶒ  ( x  usage: %s seconds 㿘 8c@ @r 㿘@ 㿘@if%s: destination pathname too long8@# ! %+- / i  $ ,$`( $`($ ,@@͔0? fb* & @ @@ . @%0?@ڴ  <   $`@`@@@@?#(?@`8@A @@ސM / /-`?< @ /@3 2L ?`? ` L /"?* L /2? @ #@@G8  @@3 2  Ȳ@Đoverwrite %s? override %s%s%s/%s for %s? rename %s to %s%scannot resolve %s: %scannot rename a mount pointcan't remove %s  (`{@# u  ,` @    b@ 2`  0`+@  &@ 2" @Ѷ(@8 @8ޒ O1`) "" @#\` `/ `H`? "`@ H  $H `  H ? $ @H  $H` 2 `y`Y2o @ʅ  (g  x`#@F] 8 @~ A#@<   @㨒  #@F> @⃒  @NԀ @F#0. @Q @<   @o   @@ސ #P@FQ 0@<  @,@%s: remove%s: set owner/group; not setting setuid/setgid%s: set owner/group%s: set mode%s: set flags%s: set times㿈 @  #&@! 6  #@F@] @!` " ( x ?Ò* @ `  ) @ @$  % $@E  #@Eߒ0+ @_`$@P  $#@Eʒ@N #@E’@@Y @! ( ,  $ x#(@E 3 6  (`2#X@E@ #p@ED@^$ x   x -D #@E ''''@!"耢 #@Ex@А # @  #@Ee /bin/cpmv-PRp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status/bin/rm-rf㿐'D@ 'H 2!"DHb @ِ#@E+@ @ y ? "@EbH "@Eb? :"5b@ Q 2!#Db @#@D@ @ G ? "@Dc "@Dc  : "Вc@Dװ usage: %s [-fi] source target %s [-fi] source ... directory 㿘#! `8`@dz`8@Ǯ`@! 㿘@֔㿘@e  2"  @Ds "㿘@X   @ &  @Da  &㿘 @i @g2   '"@% J-`?` J  +  (*J?Ї8 `2 "@ 㿐  ɒ 2  @% $$ %d㿘 @   @C   (@% & &㿘 2  `?J@   Đ "   |&=<>+-*/%:()㿘 `8    8"`@ ."`8L`*L   =#@ " #" @L  `<"  `>`!  0  0  "`@  "`@  "`@,   "`<"@syntax error㿘a@W 㿘!  @     < @ @  0%sh `@ M+) JH`@ޔ "  @ޏ!a@  @ܘ Ȁ ؀  *@ "   ! @͐@ non-numeric argumentdivision by zero㿘  @/' Ր А  c@ 2` @`& ` c0@ @ & @ & v@ Ҁ Ѐ 㿘  @     c@z  ` `" & G@ ဤ 㿐Ң  `@ s : -5 (?` X#H*` € -@@J H @D B  /@1 3 QO?` -#*` €  @' $! 0 @'82  @'2   @' 4 0  @'`? @'@ ̐ʐ@      &&T&&&&&&&&&&&h&<%%%p&&&&&&&&%%%㿘[ `@  Q   ^ y`@ 㿘 `@  ̐ ^Z`@ %d %s 㿘@`a@  " 8̐   @`"@  `@) 0`@) @$㿘@"_msgbufpM:N:sysctl: KERN_MSGBUFSIZEcouldn't allocate space for buffer datasysctl: KERN_MSGBUF%sh@    (`N" 0 @p@v`M`?䀤=  & в?'Ȑ ̖ @' ax@A- ` @'̠ a@  @N̐ 0''Ȑ  @ a@A  @Δ  쀢@6'  C  @"N@`>5 2 `<`* `'` ؤ`? @Ζ Oـ  `Oؔ?"``  *  # @n !@(֒`@ ``?"`ࠒ * "@n  usage: dmesg [-M core] [-N system] 㿘`@ @4 㿘@ssethostnamegethostname%s 㾘@̤ #') @?@a ? s* & @ @0@`" @ϐ@Ր a(@@W @uk! a8@@N  !H@ . 2*!H@(Y@ސ usage: %s [-s] [name-of-host] 㿘 8bX@X @ː $Id: logout.c,v 1.4 1998/07/13 02:11:13 millert Exp $/var/run/utmph"ؒ @! )  Ȁ @  2@tՒ @tҒ!@ >Ԓ?@퉐@!, @휔!,!,O@sRAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedadoscd9660lfsmsdosffs%s%sr%s/dev/%s: not a device node%s: couldn't read disklabel%s: bad filesystem type in label㹠@ҙ  `m!@? < @ @ `0#$@v/@Ɛ  $@x@? @@@? a ,@`:!@?P @@   ( x``@?,@1 `!@?J3 !@?C, e`e@  `!0@?4@쌐 @숐. :`@ z` `!P@?R  ܐ"*` J@   $Id: login_tty.c,v 1.3 1996/06/17 07:46:02 downsj Exp $㿘@K`a@z ??@ @ @  $ @F r%s%s%s%c/dev/%s%s%s㿐& (  "`x? p x@ޒ / @ѡ `@<  a`H#\$@ѭ# @ш& ?$x`?x   H@я$# @j& ?$x㿈   ?'  @: ?/etc/fbtabr /dev/%o%s: bad entry: %s(null):㻐"Xbh@wP aW@a # 2,"p@m Ibx@  ! @` L 0b@H ` a  @H "" @zO@   b@+ b@& $@u5 @x/*%s: chmod(%s): %m%s: chown(%s): %m%s: opendir(%s): %m...㻘@@ X@ .2`@#(   ( x``` @y@ : ( x`6`x$@t/, @ؐ  `@yې 0 -+#@n @i`  %@t@ 2 @ $Id: logwtmp.c,v 1.4 1999/08/17 09:13:13 millert Exp $/var/log/wtmp"` @@ "@h Ȓ @sې@sה @sӔ!@Đ@Δ!,!, @ @Ꙑ㿈   ?'  @ ?܄  㠝㿐#V`@q?N#`%#c`  "R`""ސ "bc "`c "`,"ac "`(c "`L"ac "ac "0c R` ހ   "?@Fb? Rb%ߘ S @E"? $ c R` `x@<V"V"@m[VcȔ `4 ##`, `?""d`b  b 2 aĀ  ca c`Ԁ c `2   2 X 2 @"c& , `   ``" @Q ".%D .%DcȰ  `  ``" @? 2 @gp,%E@f@nc`d`X`X ?`\ ? "`d"`X@C/"`\@DI 㿘#Ȁ`"!?` 6?ä! + , `""@$`* @@  2``J  쀤 +?㿘#Ȁ "(?  @ 6#?Ĥ#T`& ,` $"@ "$@  * @ 2   ,`R   ?`@ 値`&?㿘#Ȁ "&?  @ 6!?Ƥ a ,` &" "$@ $@   * @ 2  ,`@`@ 瀤a?㿘 B b= @Q۔ ?V @    @QА%  b b,  @ `@Q ?@J F  1@J 1@J@J ' "R` ڀ 㿘 b  =  @Æ  #"4?" "" @" "` +R "` c   c2 R b@c   4 "c R` "` c   "`2" @ @`4``!̒@<+<   .*@: :`"@  @B 㿘 ?` VV @< @a@+ ncurses %s.%d5.2㿘1  XLUahx@zH㿘#J `@'@Cސ0!Rc@#ܒ@C @;c@  "!c?@L# cc"@@ 㿘 "  @㿐 `  e  /`R@Ҕ 0 "  `? "`` . :  @* "@@[ 㿘@ 㿘? ?#Ȁ 2 ' ` `#Ȫ #J `  R ` "  @*Rc#` R  "  -܀`0/ +  ,` *  `?Е: ,` .*   `*Б: @  `2 N *2%@x %N '*`:  $  N <"  ƀ $N x`ƀkN `.@ > 2ƀ $ƀ <[N ` ✕+  +` *  `?Е: +`N `.*   `*Б: @  ` ✰  `2 N  *2  @  N *"N /"N` `  "N@ N ` N }` ` "@ܒ % 㿘#cȀ $c @h!c4#`!  *#㿘 " ?@eϐ@cȀ""cȰ 22KKnn,,XX ` `%%KK ?  8 2` `  8*` 2`#`  8   8``  8*` 2`  㿘#c!@" X* 4#:`cȀ`2"`㿘  " @B  @_㿘 "O? 8 "K? 0 4B$`" V   T  @41? `V   T  @4"?0?@%.`.* & 0& 4     (@"  ` V  & (  2* ?  5 81R @'8 (S `&R4 ( ((0R @S  $R 2 R 6R2 R`@ނ` 882R㿘 7 8 3V  ,  4 * @ (*` R&V R 0 ("   V  4 R@ $R2R@6V 2V  ؚ` 㿘  V 4@ V  0@A  8  8 㿘 V T`T` T``@5T` 2`J  6 @6`6 `*`6 ``6 ` 6 `H6 H` ?6 `& `&  `.  `.  `.  ` . `$& $ `.  `. & 0& 4& 8`,6 ,`.6 .T` *   (@`(@`( (@`2 `( (@`2 V        xph`XPH@80(  !"#$    x ph`.XPH@80(  D  I x p h`XPH@80(  !"#$%&'()*+x,p-h.`/X0P1;H2L@38405(6 789b:;<=>?@ABCDEFG=HIJKxLpMhN`OXPPQHR@S8T70Ui(V WQXYZ[\]^!_`abc^defghijkxlpmhn`oXpPqHr@s38t0u(v wxyz{|~}~xph`XPH@80( 6Fxph`XPH@80P( e Hxph`XPH@80( + !"#$%&(x)p*h+`,X-P.H/@0802(3 456789:<=>?@ABCD F G Hx Ip h`OXLPH@80%(  !"#$%&'()*+x,p-h.E`/X0P1H2@38405(6 789:;<N=>?@ABCDpEFGHIJK5xLpM/hN`OXPPQHR@S8T0U(V WXYZ[X\]^|_`ab[cdefWghijkxlpmhnm`oXpPqHr@s8t0u(v wxytz{|}R~xp!h%`&X'P"H#@8 0(() $%&*+<ybox1memumemlOTGCOTGVOTGHOTGDOTGUOTGLOTGROTG4OTG1OTG3OTG2OTxrOTptOTmaOTkoOTknOTdTOTdBOTNLOTMTOTbcOTnlOTdNOTdCOTncOTnsOTbsOTugOTrsOTi2slengthsgr1evhlmethlmerhlmelohlmelhlmehhlmscesascescpctrmrmscsmscrmpchsmpchdispcslinessetcolorendbidefbicolornmbicrbinelbirepsmgtbsmglrs3dss2dss1dss0dscsindevtpfxlsetabsetafgetmreqmpminfokmouscsnmzeromdocrsupcssubcsrcsdrbimscsdsbimsmgtpsmgtsmgrpsmglpsmgbpsmgbscsmcuumcufmcubmcudpordermcuu1mvpamcuf1mcub1mcud1mhparumrsupmrsubmrshmrmicmrlmritmrwidmsumssupmssubmsshmsnrmqsnlqsmicmslmsitmsdrfqswidmdefccvrchrlpicpisetbsetfscpinitpinitcocopu9u8u7u6u5u4u3u2u1u0waitpausehookpulsetoneqdialdialhupwingocwinrmclkdclksclkflnsmgrsmglmgcel1kf63kf62kf61kf60kf59kf58kf57kf56kf55kf54kf53kf52kf51kf50kf49kf48kf47kf46kf45kf44kf43kf42kf41kf40kf39kf38kf37kf36kf35kf34kf33kf32kf31kf30kf29kf28kf27kf26kf25kf24kf23kf22kf21kf20kf19kf18kf17kf16kf15kf14kf13kf12kf11rfikUNDkSPDkSAVkRESkRITkRPLkRDOkPRTkPRVkOPTkNXTkMOVkMSGkLFTkICkHOMkHLPkFNDkEXTkEOLkENDksltkDLkDCkCRTkCPYkCMDkCANkBEGkundkspdksavkreskrstkrplkrfrkrefkrdokprtkprvkoptkopnknxtkmovkmsgkmrkkhlpkfndkextkentkendkcrtkcpykcmdkclokcankbegrmlnsmlnenacsxoffcxoncrmamsmamrmxonsmxonkcbtplnacscrmpmc5pkc3kc1kb2ka3ka1iproghuuctslhtwindhtssgrriindscvparcrfrs3rs2rs1repmc5mc4mc0pfxpflocpfkeycuurincufcubilindnichcuddldchpadnelsmmrmmlf9lf8lf7lf6lf5lf4lf3lf2lf10lf1lf0smkxrmkxkcuu1khtskrikindkcuf1kppknpkllkcub1kil1kich1khomekf9kf8kf7kf6kf5kf4kf3kf2kf10kf1kf0kedkelkrmirkcud1kdl1kdch1kctabkclrktbckbsipil1ich1ifis3is2is1fslffflashrmulrmsormirrmdcrmcupsgr0rmacsechsmulsmsorevprotinvissmirdimsmdcsmcupboldblinksmacshddsldl1dch1cvviscuu1llcuf1cnormmrcupcub1civishomecud1cupcmdchhpaedelcleartbccsrcrbelcbtbitypebitwinbtnswidcscpsorviorhiorlorcnpinsmlsmcsmjumpmaddrspinhspinvbufszncvpairscolorswnummalwlhnlabwslvtpbxmclmlinesitcolslpixcpixsamxvpadaisycrxmxhpahlsbcecccndscrnpcnrrmcchtsmc5inxonxonulhzxteslokosmsgrmirdbdainhskmhcgneoxenlxhpxsbambwlPPXxd|4X$0<TL x $pHP(t `0DtTh\,<|\t88X @` l8`,@@8|h<d \(LHD($\L4@hTp|D(0lhH84d4lL`htT$`TDd\L0@p,xp| \(H<d(4L@<l,D(,P ,X0 8P,T 8|\h0     ޸xpްިޠޘސވހxph`XP H!@"8#0$(      ݸݰݨݠݘݐ݈݀xph` XPH@80(      Hܸܰܨܠܘܐ܈܀x p!h"`#X$P%H&@'8()0*(+ ,-h./0f12@345(6789:;۸<۰=ۨ>۠?ۘ@ېAۈBۀCxDpEhF`GXHPIHJ@K8L0M(N OPQRSTUVWXYZ[ڸ\#ڰ]ڨ^ڠ_ژ`ڐaڈbڀcxdpehfx`gXhPiHj@k8l0m(n opoqrstuvwxyz{ٸ|}~ٰ٨٠ِ٘وـxph`XPH@8%0( u~ظذبؠؘؐ؈t؀xapmh`XdP H@v8`0(W ׸װרנטא׈׀xph`XPH@80( z.'X(ָ/ְ֨֠֘֐5ֈ6ր7x8p9h:`;X<P=H>@?8@0A(B DEոհ^ըՠ՘ՐՈՀx p h ` X PH@80(  !"#$%&'()*+,Ը-԰.Ԩ/Ԡ0Ԙ1Ԑ2Ԉ3Ԁ4x50p6h7`8X9P:H;@<8=0>(? @ABCDgEFhGHIJKLӸMӰNӨOӠPӘQӐRӈSӀTxUpVhW`XXYPZH[@\8]0^(_ `abcdefghijklҸmCҰnҨoHpUҠqҘrҐs҈tҀuxvpwhx`yXzP{H|@}e8~f0g(h i!%Ѹ&Ѱ'Ѩ"Ѡ#јѐҠ(ш)р$x%p&h{`*X+PH@80( bxmumlGCGVGHGDGUGLGRG4G1G3G2xrptkokndTdBNLbcnldNdCncnsbsugrsi2sLsAXvXtXrXoXlXhS8S7S6S5S4S3S2S1YZYzYyYxYwYvZzXyMTs3s2s1s0cidvxlABAFGmRQMiKmZyZxZwZvZuZtZsZrZqZpZoZnZmZlZkZjZiZhZgZfZeZdZcZbZaZZZYZXZWZVZUZTZSZRZQZPZOZNZMZLZKZJZIZHZGZFZEZDZCZBZASbSfspIpIcWAPAfhPUTOQDDIHUWGCWRCDKSCLfMRMLMCcbFrFqFpFoFnFmFlFkFjFiFhFgFfFeFdFcFbFaFZFYFXFWFVFUFTFSFRFQFPFOFNFMFLFKFJFIFHFGFFFEFDFCFBFAF9F8F7F6F5F4F3F2F1RF!3!2!1%j%i%h%g%f%e%d%c%b%a#4#3#2#1*0*9*8*7*6*5*4*3*2*1&0&9&8&7&6&5&4&3&2&1%0%9%8%7%6%5%4%3%2%1@0@9@8@7@6@5@4@3@2@1LFLOeAXFXNRASARXSXkBpnacrPpOK5K4K2K3K1iPtstawistsasrsfcvr3r2r1rppopfpspxplpkUPSRRILEALSFICDODLDCpcnwmmmol9l8l7l6l5l4l3l2lal1l0kskekukTkRkFkrkPkNkHklkAkIkhk9k8k7k6k5k4k3k2k;k1k0kSkEkMkdkLkDktkCkakbalici3isi1fsvbueseeitemeaeecussomrmpmkimmhdmtimdmbasdsdcvsupndveCMlevihodocmCCchcdceclctcsblbtYpYoBTYnYmYlYkYjYiYhYgYfYeYdYcYbYaNCpaCoMWNlwssglicoYGYFYEYDYCYBYAhlutccNDNPNRHC5inxxoesmsmixnxsxbt|Τ,\͜ĄX<ϸP|¤\Є$hlŒʜ(Ȍ<`@$dhlx\Ȥƈ ,ʹǨX<Ƹ0(̈(@ˌP̸͐`4ͨ Hŀp0|Ϭΰ8lɠX<ĐdTHH°hШLxʨȘHLΌ8txLDŽдɈɸȰƔ8ϠǴd|(tHhɬ̔ĴDL˘\t0l@$`ŌÈμDàĜpT(t$(X0ʴ4PT΀DpǐА ȼƠ$DМø(tϔŰ@x HThdpΘ LxL0ŘDÔ˜PìdĨp `4€ʐȀ0 |, 4ψdhd4\`l<|H $ǜ@Ƭ0P|4 4ˀDż̬|@0(p <٠h܈֘`x܈Hܰxؠp8h۸`XPHؘ@80(  ؀܈ۀԨ֨԰BCKFKEKDKCKBTekKAIRISHSIBMkqGGGcGvGhGdGuGrG8G5G7G6RTPSPNPDLDHMENCOCFGSGEXENIXEEXSDSCVCIAT&TBOBSDsbhx`pXhP`H8@kselkbtabfont3font2font1font0 0  Out of memory㿘1 !  !@"a&!! 2*@U"!㿘! !&@w@  @ *`!@," $!@U"@Z@astring too complex to convert㿘 ` @U3#0    `+  "@#`I'm confused㿘 ` 2 ? ` 2"`@U     +   "#` a "a%'%{㿘N \ ^": ; N 3 06 % ' $6 * \#%  \  "@ `  ' )   ` *` Т@  `    ' ) `b @ `   , ' \ : H` $ B- . ' ;` c $  d@ǀ  0-  / $  @t @g   0-    $  @]  0-    }-  $ $ string may not be optimal%Pa%ga%p%{96}%^%{127}%^㿘 !`   " !   `F@T@#! ! ܒc ;$! #! Ԓc($! 01$ ! ' 0# ! 0$! ,``$!  !`   ! ! c8$!   ` ! ! c@$! saw %%r twice in %ssaw %%m twice in %ssaw %%n twice in %s%i%{10}%/%{16}%*%{10}%m%+%{2}%*%-%?%>%t%+%;%+%-%*%/%+%c%s%-%c%c%2d%3d%d%\unknown %% code %s (%#x) in %s$</>㿘       "    " #`#!)"  "a `  @) 9 " `  `@" `2`*:  * ."` `A*`: %21- `a -- @?ۑ* : `N` ԓ*` € %- a a  %a   %     % @S<N@a aߒ a Вa$a ג a a В a a0ɒ a a@$a @a aH$a @a ђaPN@ = + - * /YN` p cSN` ON@ = N` p N` ?@  ?$א` @?֑* : `( *` €a  aXa  a`a aha apZ@$a a     " $$@rN@P @a eaXF @a 4ax< a -a@2 a #a+ a aN@ 3 22) % a a a a a a<$a 'N@ "$?$a a %- a  $a !N@@!"!@@R? N@a ` $a N@ Ē#a Βa$a !%`@" `2  *:  * . a @ a - $a $a a  - !|@hhhhh0hthhhhhhhhhh$hhhhhhhhhhhhhhhhhhhhhhhhhhhXhhhhHhh8hhhhhphhhPX㿐ܐcД@՗  " `  ` " \%03oH`b` J ``:`\ ! !  \,  ,  `@ @ E@Vb@V%>㿘cHʒȒ%%%%?%%{%d}%%>%%t%%{%d}%%+%%;%%?%%{%d}%%>%%t%%'%c'%%+%%;%%?%%'%c'%%>%%t%%{%d}%%+%%;%%?%%'%c'%%>%%t%%'%c'%%+%%;%B%%{%d}%%+%%c%%'%c'%%+%%c%D%n%mdoxX.%.%r㿈//@(@J >    v J /2sN@%? `2?*:  . * <2 ?N $"  # ,`~`  `2*:  ." *"?N@ \@N` ^ , *`@ *``*:  $*N` <*`%`@ `2`*:  . * / >"`:  % *N` %*cx:  %  *``c@s c@j c@a  c@Y  @fK ;  @ ``@>  `@7 @f) + aXҲO`'a0@tV  `(}`c8@tJ     ~`n`0c@@t;  2 ```o`_`8@?ۑ* : `N\"*` €  %*`M`1  %.  b @ #`z @ `2. N@@e`@ ;N@ d8 0E&a"`Ha`N@ 1 2$  22N@2N@I`P  0 a> @ *`6` N@  `N@ @2N@  ! 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8   8 8 8 8  8 8 8 8 8 8  8 8 㿘N  N * :`* N@  @#㿘* @  `*`   o* @@p 2V 㿘#L: 2  @p 2 *  xph`XPH@80(        OTxrOTptOTNLOTMTOTncOTnsOTbslpixcpixsamxvpadaisycrxmxhpahlsbcecccndscrnpcnrrmcchtsmc5inxonxonulhzxteslokosmsgrmirdbdainhskmhcgneoxenlxhpxsbambw@(xhX@(p`H8 hP8 return_does_clr_eolhas_hardware_tabslinefeed_is_newlinegnu_has_meta_keyno_correctly_working_crcrt_no_scrollingbackspaces_with_bslpi_changes_rescpi_changes_ressemi_auto_right_marginrow_addr_glitchhas_print_wheelcr_cancels_micro_modecol_addr_glitchhue_lightness_saturationback_color_erasecan_changenon_dest_scroll_regionno_pad_charnon_rev_rmcuphard_cursorprtr_silentneeds_xon_xoffxon_xofftransparent_underlinetilde_glitchdest_tabs_magic_smsostatus_line_esc_okover_strikemove_standout_modemove_insert_modememory_belowmemory_aboveinsert_null_glitchhas_status_linehas_meta_keyhard_copygeneric_typeerase_overstrikeeat_newline_glitchceol_standout_glitchno_esc_ctlcauto_right_marginauto_left_margin( xph`XPH@80( OTknOTdTOTdBOTdNOTdCOTugbitypebitwinbtnswidcscpsorviorhiorlorcnpinsmlsmcsmjumpmaddrspinhspinvbufszncvpairscolorswnummalwlhnlabwslvtpbxmclmlinesitcolsxhP8 x`H0 x`P8 number_of_function_keyshorizontal_tab_delaybackspace_delaynew_line_delaycarriage_return_delaymagic_cookie_glitch_ulbit_image_typebit_image_entwiningbuttonswide_char_sizeprint_rateoutput_res_vert_inchoutput_res_horz_inchoutput_res_lineoutput_res_charnumber_of_pinsmicro_line_sizemicro_col_sizemax_micro_jumpmax_micro_addressdot_horz_spacingdot_vert_spacingbuffer_capacityno_color_videomax_pairsmax_colorsmaximum_windowsmax_attributeslabel_widthlabel_heightnum_labelswidth_status_linevirtual_terminalpadding_baud_ratemagic_cookie_glitchlines_of_memoryinit_tabscolumns,+++++++++++++++++x+p+h+`+X+P+H+@+8+0+(+ ++++*****************x*p*h*`*X*P*H*@*8*0*(* ****)))))))))))))))))x)p)h)`)X)P)H)@)8)0)() ))))(((((((((((((((((x(p(h(`(X(P(H(@(8(0((( (((('''''''''''''''''x'p'h'`'X'P'H'@'8'0'(' ''''&&&&&&&&&&&&&&&&&x&p&h&`&X&P&H&@&8&0&(& &&&&%%%%%%%%%%%%%%%%%x%p%h%`%X%P%H%@%8%0%(% %%%%$$$$$$$$$$$$$$$$$x$p$h$`$X$P$H$@$8$0$($ $$$$#################x#p#h#`#X#P#H#@#8#0#(# ####"""""""""""""""""x"p"h"`"X"P"H"@"8"0"(" """"!!!!!!!!!!!!!!!!!x!p!h!`!X!P!H!@!8!0!(! !!!!                 x p h ` X P H 8 0 (     xph`XPH@80( box1memumemlOTGCOTGVOTGHOTGDOTGUOTGLOTGROTG4OTG1OTG3OTG2OTmaOTkoOTbcOTnlOTrsOTi2slengthsgr1evhlmethlmerhlmelohlmelhlmehhlmscesascescpctrmrmscsmscrmpchsmpchdispcslinessetcolorendbidefbicolornmbicrbinelbirepsmgtbsmglrs3dss2dss1dss0dscsindevtpfxlsetabsetafgetmreqmpminfokmouscsnmzeromdocrsupcssubcsrcsdrbimscsdsbimsmgtpsmgtsmgrpsmglpsmgbpsmgbscsmcuumcufmcubmcudpordermcuu1mvpamcuf1mcub1mcud1mhparumrsupmrsubmrshmrmicmrlmritmrwidmsumssupmssubmsshmsnrmqsnlqsmicmslmsitmsdrfqswidmdefccvrchrlpicpisetbsetfscpinitpinitcocopu9u8u7u6u5u4u3u2u1u0waitpausehookpulsetoneqdialdialhupwingocwinrmclkdclksclkflnsmgrsmglmgcel1kf63kf62kf61kf60kf59kf58kf57kf56kf55kf54kf53kf52kf51kf50kf49kf48kf47kf46kf45kf44kf43kf42kf41kf40kf39kf38kf37kf36kf35kf34kf33kf32kf31kf30kf29kf28kf27kf26kf25kf24kf23kf22kf21kf20kf19kf18kf17kf16kf15kf14kf13kf12kf11rfikUNDkSPDkSAVkRESkRITkRPLkRDOkPRTkPRVkOPTkNXTkMOVkMSGkLFTkICkHOMkHLPkFNDkEXTkEOLkENDksltkDLkDCkCRTkCPYkCMDkCANkBEGkundkspdksavkreskrstkrplkrfrkrefkrdokprtkprvkoptkopnknxtkmovkmsgkmrkkhlpkfndkextkentkendkcrtkcpykcmdkclokcankbegrmlnsmlnenacsxoffcxoncrmamsmamrmxonsmxonkcbtplnacscrmpmc5pkc3kc1kb2ka3ka1iproghuuctslhtwindhtssgrriindscvparcrfrs3rs2rs1repmc5mc4mc0pfxpflocpfkeycuurincufcubilindnichcuddldchpadnelsmmrmmlf9lf8lf7lf6lf5lf4lf3lf2lf10lf1lf0smkxrmkxkcuu1khtskrikindkcuf1kppknpkllkcub1kil1kich1khomekf9kf8kf7kf6kf5kf4kf3kf2kf10kf1kf0kedkelkrmirkcud1kdl1kdch1kctabkclrktbckbsipil1ich1ifis3is2is1fslffflashrmulrmsormirrmdcrmcupsgr0rmacsechsmulsmsorevprotinvissmirdimsmdcsmcupboldblinksmacshddsldl1dch1cvviscuu1llcuf1cnormmrcupcub1civishomecud1cupcmdchhpaedelcleartbccsrcrbelcbtK8K0K KJJJJJJJJJJhJXJ@J0J JJIIIIIIIxIhIXI@I0IIHHHHHHxH`HPH8H HGGGGGGGGxG`GPG@G0G GGFFFFFFFFFFFFFFFFxFpF`FXFPF@F8F(FFFEEEEEEEEEEEEEExEpEhEXEPEHE8E(EDDDDDDDDpD`DPD@D0D DDCCCCCCCCCxChC`CPCHC8C(CCCBBBBBBBBBBBpB`BPB@B0B(BBBAAAAAAAAAxAhAXAHA8A(AA@@@@@@@@@x@h@X@H@8@(@@@??????????p?`?P?@?0? ??>>>>>>>>>>x>p>h>`>X>P>H>@>8>0>(> >>>>=================x=p=h=`=X=P=H=@=8=0=(= ====<<<<<<<<<` @ !߀ s$  @ܔ ߀i# | ` P"ed"` "`$* | *`!h!ݐ!h$ `@  ` /@   >``R "@ = "` @ / "``2```"2` " $` `ahR`% "ԓ>` @{ ߀`" x` -" (>?     " ?㿘   ?㿘 D? et= 25 `"et"@  %߀ ')V  @  ( "V @V `@ @ (@ɐ|"$|x"$x "%  2 㿘%"  `  R "@ `2  R "@  @ S @5 S  0@  ( $ ! @}.@ (*`"  ( .`    " (@  *"  㿘-  * (`&$T @47 T @41 `"2 ?" 2 T T @4 2& 4 & 0 `&  & ./ *   ( (@"   & 8㿘V V & ' * 8 4 㿘  "   @}   @} L  @} $ (@m  ?4  4 44 4 4    4 H4 $  $ R R@`?, , ? , 4 .4 F, , , , $ $, , $ 0$ 4$ 84 ,4 <4 >4 @4 D 4 B  (@ 2` ( 2   ``R@`   4 R``4 `R  `  4 `et$`$@"et㿘3ܰ cȐ + # - < > | ~ _ : ' o v ^ * ! f&!&!&!&!&!&!&!& & & &!&!&!&!&!&!&!&!&!&!&!&!&!&!&!&!&!& & &!&!&!"l "c(c bH .@  (cȆ "HJ@ a ~ `6  + . 0"   4  f&   "H J `*     * NCURSES_NO_SETBUF㿘@# $@! ` "` "@Ē`j4*  ` @  " `?@ Җ㿘 *x RR" RS  S @`&%t ; RR  `.R``&2`R "@ 2`` &R @ ` 2`R   @ 2 @5 "-? 2 ` 2`2 `2@2 ``"2@q `"%`% "&@h`"%&"b"ذ 㿘  ~,°?V @V "   8 4R 4? 0R 4?( @;`@ ,,`*  (`@*@@ ,@ (@:*` F& ( @,`*  ("@  ( 2  (@ 2` "` 4* @*`  0 (* "@ `@ @k @G  ( 26`  @:V. ("@ (`F?  4* @ 0*` * " (R @&2  (2 , ?"`2  (@2``@ V ,.`: @6 6 6 ,V .V @ @2V 6 .V V @ 6 VV @ 6   ` ?? @ ???@?@@㿘@2V ` 8 V @|L 2\V V `  ?# ? @  ?# ? @ ?#@? @@@ V* @ (*` R?2 26R242*" V   *V .`@:  . 6  6 6 6 @$ 6 6  V `L  " L!"@" "@@ V ."V V @`V  @ ??#`* ` : @   @ @ ? @@ @V* @ (*` R?2 26R242*" V   *V .`@:  . 6  6 66   ?@$w 6 6  ?"?V  6@ V .`@ 6   V @$Y { @V . $    n@$I   j ?d6 c ??#`*:  V   @   @ @ ? @ V* @ (*` R?2 26R242*" V   *V .`@:  . 6  6 66   ?@# 6 6  ?" ?L   ?66  㿘 ?@2V ` 8 V @L 2]V V `  ?# ? @  ?# ? @ ?#@? @@@ V* @ (*` R?2 26R242*" V   *V .`@:  . 6  6 66  ?@#o 6 6  V `L  " L!"@&" "@@ V ."V V @`V  @ ??#`* ` : @   @ @ ? @@ @V* @ (*` R?2 26R242*" V   *V .`@:  . 6  6 66   ?@" 6 6  ??V  6 @# V .`@ 6   V @"ڒ z @V . $    q?@"ɒ   h ?b6 a ??#`*:  V   @   @ @ ? @ V* @ (*` R?2 26R242*" V   *V .`@:  . 6  6 66   ?@"m 6 6  ? ?L   6 6 ? 㿘 ?@2V ` 8 V @zL 2]V V `  ?# ? @  ?# ? @ ?#@? @@@ V* @ (*` R?2 26R242*" V   *V .`@:  . 6  6 66  ?@! 6 6  V `L  " L!"@" "@@ V ."V V @`V  @ ??#`* ` : @   @ @ ? @@ @V* @ (*` R?2 26R242*" V   *V .`@:  . 6  6 66   ?@!t 6 6  ??V  6 @ V .`@ 6   V @!V z @V . $    q?@!E   h ?b6 a ??#`*:  V   @   @ @ ? @ V* @ (*` R?2 26R242*" V   *V .`@:  . 6  6 66   ?@  6 6  ? ?L   6 6 ?  . .  xph`XPH@80( xph`XPH@80( xph`XPH@80( xph`XPH@80( xph`XPH@80( ~~~~~~~~~~~~~~~~~x~p~h~`~X~P~H~@~8~0~(~ ~~~~}}}}}}}}}}}}}}}}}x}p}h}`}X}P}H}@}8}0}(} }}}}|||||||||||||||||x|p|h|`|X|P|H|@|8|0|(| |~_~^~]~\~[~Z~Y~X~W~V~U~T~S~R~Q~P~O~N~M~L~K~J~I~H~G~F~E~D~C~B~A~@^?~}|{zyxwvutsrqponmlkjihgfedcba`_^]\[ZYXWVUTSRQPONMLKJIHGFEDCBA@?>=<;:9876543210/.-,+*)('&%$#"! ^_^^^]^\^[^Z^Y^X^W^V^U^T^S^R^Q^P^O^N^M^L^K^J^I^H^G^F^E^D^C^B^A^@ ބ* 㿘 C? @  *V :  6 6  @23?*V :  4-?,V :`@ %?',  (* @R?$ 2 <2V * @@ "  ("2 㿐@e#'@G#* "*"@ *`@*`'@7  㿘#`` ?d'0 ` [Ȁ?H?Ȁ?HA㿘#Ȁ ?R (@e͒ ``?2b\2b`2b^  ""|   | ""   㿘 ?` @| @`?`?㿘  >?  ,@ `@ *: <" 4"% *: *  (@*`  ,`@.T ?$T 4 T <?@?4 e  &?R 4?`&?R @4 ? 2  2 2 ?㿘 |  @. 0@      *@. 㿘 ? !?  ""  ?H4 @ T *\  *`R :`@ 4V  ?(: * @(*`+` :* T`* (`@?-`T`=`4 $+`: +@(:`  @"" P?0 06P040*`:  `4`4`(`T:   ) R :`@ (   , *`   H  @2  2  *`㿐 Rbb  ``  '7 @IJ 4    2bb 㿘#ȦJ` <J`  ~ߐ ? ` ?bh @'  % €  `?"`` @* "@@ xȐ "xbD b\ Mb` "I`J  ~ߐ ? ` ?bh @'  % €  `?"`` @* "@@A xȐ "xbD  E xȐ?"x=b\0 |`"  Ѐ   bhR` R` ?   J` @'_  "x@"t "bx"btJ ` ~ ? ` ?bh  @'B  % €  `?"`` @* "@@ΐ xȐ "xbD   bhR`R` ?   J`@'  "x@+"t R`"bt *"bx  (*R`*  @ ?H?""tH"t""x""t"x""x㿘#Ȯ`` `a䀢 `u5߀`f @a`7Rt?@ Rx?@ ? J` ~ ? ` ?bh @& % €  `?"`` @* "@@  xȐ "xbD "$"xR  z`  @`WRt?@ 7Rx?@5? J` ~  ` ?bh @&4 % € `?"`` @* "@@xȐ "xbD ""xR   ب  2   `@"  `Y S7J `?l ?# 0  4   8  ?  `? 1 bh"@%Ȓ @&o6h "h"x "t @  J`@% "x"t@ƭ- &@"bx"bt a䀢~`y xR   ?h @@%xȠ  - @%ǔ&x"x&@Rt?@ R?D; J` ~"`` ?bh @%G % € `?"`` @* "@@ӐxȐ "xbD "&@"xR  e- ,c &@@\- 7,`Rt  Rx?@ > J` ~ ? ` ?bh @$ % €  `?"`` @* "@@t xȐ "xbD "x"xR  `@``b  @6^ 7 ,`Rt   Rx?@ ?Ƞ  J` ~ ? ` ?bh @$ % €  `?"`` @* "@@ xȐ "xbD ""xR  `h@߰ 㿘='`   52 +)ܤ.@@@## .$ "@[@bh   # J`@$ "x@@"t"bx"bt  ֢`'.@9`㿘  Rbb bb2bb`bd  ex `@`"d`@@`%X@`""d | ` - ` @ |* Q*`  ``R`R 4 @+h@ 7?  v ~  (@R`? | (@R`?@VR`4  |`(2 `(@2` |R` `(2 `(@2`Р R`4 |.  * ?(  2 (@ 2`R  |R`.  * ?(  2 (@ 2`R  ` %`` |*`2@:`2bh* @  : ` #`J `@#1 `"x@V"t`"bx"bt`"h`@#!    |"㿘#` J `x ?# @`  `RR @4@` @ @ 㿘| 'bt "R`bx` + "t|*` (*  @"   R`쀣 ` ` s?"h  @"`R "x"ܖ" ]``Rt?@ Rx?@>`#ȤJ `` ~"``bh `@" `%`€ ` `?"`` @* "@@ `xȐ "xbD "``"xR  l ?0#`㿘 bh?bt bx@"> #`R "@R``,`* ߚ|,  ( @ " `R`| R`@ R   ,`* `|,  ( @ " R``| R`@㿘  `RR #ȈJ  `x ?# @`  `  `  bl ?#@ c0   4   8  ` @ {? 7  `|  +` (* @*@ `? &*  +` (* @*@ `? &* " 6Ҕ  ?#  `:$4 6"h   # J`@!h "x @"t"bx"bte e R`+`儚`@ " R`@㿘 | `.(*  ( e@e .  bl :9R` @66#? )?'ߤ @##  @   @@2` 2   2  6`+ c(*  @ `  @ ``R @ ֆ#J `  ` R      ?@2  4  "h   # J` @   "x @"t #"bx"btJ `  `x?# @`    R ?S   R   @2R   @" R#$4`" J `l ?# 0  4   8  ?  `?   R       *@"  R  2 b  , @"  b $\ R`) b܀ % bh@ ` # J` @   "x @>"t ?"h""t@ ""x@  # `)"h  ?  # J` @  "x@"t ?"h""x@ ""t@ # d4%, R  8 #R`* J`?l ?# 0  4   8  ?  `? > R @,`  @ @@@"@ "h   # J` @  "x@"t "x"t1,$@@*0R ,@" R @,`@"@w@ $܀ q@h@ ` # J` @I  "x@n"t ,"bt"bxR`? #R`?# >   J` ~ ? ` ?bh  @  % €   `?"`` @* "@@   x#Ȑ "xbD "  "xR  73G,`,    %G` @ 8 "h   # J` @ǐ  "x@ "t $b"bt"bxj  "h`@&Y ,`,   `@ "h   # J`2 @|  "x@ "t "bx"bt#]@& `bh@ ` # J` @V  "x"t@ z&@# "x"t`a "`| #`  @ڠ "-`# `Ѐ  @" -`А"? -`͒n  $@@ݐh e `bh@ ` # J` @  "x@ ""t# "x"t`ᤐ`" T  @" , "?(   "h`   # J` @  "x@ "t "bx"btʒ   ?bh @ @r$ R @"@,@*㿘#Ȩ``   ` 2 ` ߠ ߤ `bl  c0  bh*   @F|# J`" x# ` ?bh #@e # `"bt"bx` (?"h""t  ""x"  J `@H  "x @ m"t?"h""t@ ""x@9 # `ۚ` ?"h?""t@ ""x@&  R`'"h  `# J`@ `"x @ 5"t#`"bt"bx  `R`?"h  @ R`}"h   # J`@ސ "x "t@   R`"bt@Z"bxRt?@ #Rx?@#< J` ~"`` ?bh @ % €  `?"`` @* "@@ : x#Ȑ "xbD ">"xR  `R`@R`"h   # J`@d  "x @ "t"bx"bt` R`  R @  , *  |,` (`@ " `R`@ |`R`㿘#Ȣ`a "L`|@`c J` ~ߐ ? ` ?bh @ % €  `?"`` @* "@@  xcȐ "xbD "° 0X`` T` `Kcc J` ~ߐ ? ` ?bh @ % €  `?"`` @* "@@ N xcȐ "xbD "cRc `؀ "J c C`0ON' <``J  ~ߐ ? ` ?bh @o % €  `?"`` @* "@@  xcȐ "xbD "cc `؀ " 㿘#Ƞ`!  @0 # `T?#ȁ㿘Ր㿘 5%b .@- *  bh@  `  J `@  "x @ "t bh"bt"bx@ 2b 3 X`/2.! bh@  `  J `@Ȑ  "x @ "t bh"bt  "bx@ `Xq  !`.@2-Ȁ2* bh@  `  J `@  "x @ "t bh"bt"bx@Ȕ  0!`221 bh@  `  J `@e  "x @ "t bh"bt  "bx@UȔ  @ x "`7@26Ȁ23 bh@  `  J `@,  "x @ Q"t bh"bt"bx@ H7Ȓ  =  X`42ð? bh@  `  J `@  "x @ "t bh"bt  "bx@ 7Ȓ  X ? bl " c0 2  J`2  @6~  "h  &   J`@ "x "t@Ӹ `R`"btZ"bx Rt?@ Rx?@}<  J`` ~" ` bh  @  %`€   `?"`` @* "@@   xȐ "xbD "  "xR   e  R` @  㿘 5%b .@- *  bh@  `  J `@"  "x @G"t bh"bt"bx@ 2b 3 Ԁ`/2.! bh@  `  J `@  "x @"t bh"bt"bx@ `  !Ā`.@2-Ȁ2* bh@  `  J `@  "x @"t bh"bt"bx@Ȕ  0!`221 bh@  `  J `@  "x @"t bh"bt"bx@~Ȕ  @3x "`7@26Ȁ23 bh@  `  J `@U  "x @z"t bh"bt"bx@E H7Ȓ  =  Ԁ`42ð? bh@  `  J `@  "x @B"t bh"bt"bx@  7Ȓ  Դ ? bl " c0 2  J`2  6~  "h  @   J`@ؐ "x "t@ R`"btZ"bx Rt?@ Rx?@戀<  J` ~" ` bh  @  %€   `?"`` @* "@@4  xȐ "xbD " 8 "xR     R`   㿘#Ƞ`a 2a`X "?a `Ԁ ? bh   # J`@D "x @i"tbh"bt"bx@4  # `X  # a   @vے $7#Ȓ  X#"h   # J`@ "x @!"tbh"bt"bx@  # `Ԁ   # a   @0 $ 1#Ȓ  "Բ2#Ȱ 㿘#Ȧ`J  `x ?# @` ˢ  X  `R 2 +߀ / bt@@/ "` /!  =  Ȓ  @̠⠒ 2` Ȕ  *`?"bt"bxFȤ` @  `?"bt"bx eF&ؖ񀤿`J  J 怦値$ ` ` bh@  &` `J @ `"x @>"t` "bt"bx#)`"h &   J``@ `"x "t@` "bt"bx `  L  `F`+/`"t@@` /    Ȓ  @⠒ t`" `Ȕ  k?"bt"bx_Ȥ` @  U`?"bt"bx eF`2 J `  J )`( $#+`"h    J``@_ `"x "t@` "bt"bxg ``|.`.::@|@  ?㿘 "bh *bl  !# d "## ` "`#Ȁ "## ` "## ` "## ` ##`"\ "`  `J` 2  㿘㿘! "h` @ސ  bl  c0  *c0? @=В   *#0 S "x@"t  R"x"tҒ A 㿐 'H1f"@N[a`$RN  <N'@1 > F Na >4"!b ` *: ?')":  * .H" N> ` ' ƅ#D° N > "`2  !"" b# N ('㿘аb@   @~ِ?㿘#`    R` @㿘#`p  ?bp"bx?"bt@\"bp㿘#`` W@~#   $b 4cȐ "bcȒ  <cȒ  #"50cȒ  #".HcȒ  #"'8cȒ  #" DcȒ  #",cȒ  #"LcȒ  #" |cȒ  ## c "c"c ؀ "c  "cc `(  `<" @  cȒ  #"@ cȒ  #"@ؒ cȒ  #"@ϒ cȒ  #"@ƒ cȒ  #"@  cȒ  #"@ cȒ  #"cȒ  #"cȒ  #" 4cȒ  #"TcȒ  #"cȒ  #"@ cȒ  #"@ cȒ  #"@   c#"`@{ ْ   "bc@s ђ cȒ  ##@j Ȓ cȒ  #"@a  "@ 4 c" "` p  @h c "bc "a㿘! ?R` ?@ bp?@  #` T x@@   b@   @ @6  bԀK a& Ȁ@@Ƞ`@@ " `,t@" 6mВ@Ȱ  `,@@` W'А`V@ M@ aȀ&@ @@ΒȠ`@@͐ " `L+@٦ 6$В@Ȱ  `L@M@ǐ` 'А` @ @а"@А"@7 ' '.' b@  @xȠ` @K@w  bЀ a' Ā@@XȠ`@+@W " `Dؠ@."`@` `  '߀`@`  O耢 `.`$(* .@ `✐ 2 ` ߑ. `* . ``$ (@ bh ? "  ` !`.* .ߖ  $`( * 'ܐ*@"'@ ȴ  `D@z@ %А` @Β @д"@@^А@@ 2TS a&#`"@6Ȑ@Ƞ`@t@ `" `80"@w`  8b@'@ %А` @{ @д"@ А@e@k 2А"@@㽈߀@` ` R   @{cR@oDT @ P@{V`T   & "@ C)##`  cb?` ?"`* "@: ?`# `  Gb ` ?"``* "@  R  4 4 Т"@@ ˔"c@@   ?"?R ? ?, , @ Ѐ?@ "g Дb@ ?  ?)# ` @ " L Дb@  "@ 6#Ȣ # `0@ t"  1 Дb@  "@ 6#Ȣ # `H"@ YR  Дb@  "@ ` `" #J@ 'J` #   8`"@ *R`? Дb@  b  @ "`E#x*` €!#Ȑ`@ %#Ȑ`@ 0  #Ȑ`@ HR  Ѐ`#`@ #Ȑ`@ 8?R А"@@  ?H`㿘 ߒ` ` @Q 2  #` ".  . ,%F ?㿘  `` @ @ . ,%G㿘? 8 ?@` "   `?" $" $ ? 2* ?  2" $㿘 ?. @ 㿘 `` "#` "` 0`   #` q㿘  +bp 1  `0"!`#`P  ?#`@ "?H`#`4  ?;`""p?   㿘`2`  2@   `  㿘 ,㿘 #`d "     #``    !  4`@  "`4 㿘ݐ" `%# cȗ*   @  ,   2㿘`{@ w bȀ s . o 6@       2   0`  `@ "H6  "#@ڴ@V &@  @V & ,,b@ .`.6 @ " 6   @V & 2 @ ,b@d 20  .`.6 @  6 㿘 `#Ȁ "b"bd*xX #Ȓ }"d"X* y#2 X?㿘#Ȗ  #bd*xX ~#Ȑ >`"X"d*y# X㿘# dX* "d㿘c "" d X 8 X d  # d# X㿘c #"dXXa"d"X㿘# dX@ "d㿘`` d *@c d  "d#Ȑ XܒȀ Ѐcᰀ c|਀ cT2 2 Ȁ Ԁ2XḀ X2 ᨀ2 㿘V  * `7..:":`  * .@ *`* (@%?>&,V  .*  (*"@ V $ ( &V ,`4-`<"> 4<* .@ *`* (@`  <&>V  .*  (*"@ V $ ( 4V ><" @T 㿘 "?  `" V .V ,$@@ 4?   ?nh  " R @4 `*`   ((R 8@  " R  4  (R      `&,?R @@ &?@ 6# @4  *` (?  ( 00 (  00` @ ` R @$ (  ށ LINESCOLUMNS㿐"Ѐ`2&@Ȧ  )R`&` Rb&@!h@& 4&@!p 4&@ '@ ))#ȦR`(@)ހ   (" x%ȒhR(@  x 2 " 4@&@ 4&@ 4@ R`&@ 4 R@&@  @ Ȑ & P&@ ` 2 `` 2 R` & %"܁㿐 %d€㻘@(+ / . @X @   `6` `J@ &*@ `&``   `* ?"" ` &`TERMTERM environment variable not set. TERM environment must be <= %d characters. Not enough memory to create terminal structure. terminals database is inaccessible '%s': unknown terminal type. CC'%s': I need something more specific. '%s': I can't handle hardcopy terminals. 㿘 @ N  Ð? @N{`@ @" ? `@Nl"@ߐ  @S| 2 ? @N\`@ϐ F`@ΐ  $$ $  $ $ $ $ $  $ $$ $`?& @N-a@  ܀2Y& a@@N @ #ȀR(,$ ,0$ 04$ 48$ 8<$ <@$ @D$ DH$ HL$ LP$ PT$ Tc` $ @m!` "c@Ac"@)!`c@D  " c2(">b؀ &c J `&? ah@MȔ@; J   & ? a@M@*  㿘@%!`Ȗ  $  @*`ȕ* @ J@  @8*:  "*@`J@  @Ȗ ` ȁ 㿐@' @B  "?J ?/usr/share/terminfoTERMINFO㿘#! cဢ 2#䀦  #`2#@ #@Ő"X  c *c$##㿘ݐސ *c??   2 2  2 2 (2  㿘 @E?/`/` 2/`&@(/`&@/`&@@`N  N2 8&@@‡/`!?#&@&`&`&` &`&`&`&`&` &`$@w@ 2 #*` 2 @#### # #*`*  *+`+ @  R OM`K -`/4s @~I &`l  ?#""@v/@ @Q  +&@@" > ;   @vȖ , ,@Qo  &`@vה @vΔ ' '@QY  &` .@v2% ` a!@QC  &``-`@v2  `@v2 `` , '!6`6`6` ?c @v  #耢`#?c@v 2ưcc cc*` c **   cc   *`*  4° /4  ,+ '`6`6` 2`@6`&``` @*`&` ` `@*`, &`` 6`"``,@v12 ?c @v& , 6`$?#,@v2 ` `NU? , c @v2j ,@}= 5&`@u\ , #6`&`-`?#@ `K * `. @ "fx`x? "?@?@P[  &`- ?#,`@  +4 `*  +$` &4 ?. `   &2 !4  . ` !"  㿘@  @  @Z   1 @̐@uV%s/%s㿘@6# `(@Ғ 㿘@'I 0 ' L``:2 ` ,@Җ 뀤` @|%c/%.*sTERMINFO_DIRSp@ 9Na@W  c  9  2 @~ 2'@~"X  $  @    @}! "@㿘@ϒ /  .㻘@Y 6" ` ( x`2?@~#@ "@*"7@9 ?㿘  "@| " @|   " @| " @|  " @{  " @{  "& $@{& $&& & & & & & & & (HOMEOut of memory%s/.terminfo㿘@}c & c   @}Q 0 "#N "#@~ $8#@~@{ $#@ ) 8`H@s#TERMINFOHOME%s/.terminfo/usr/share/misc/terminfo㷈@}&耢 @}!  @%G$#'@} 2@}! J@    @Y$#$ !0$$ 耢 @. 2 @%$  2 㻘$@%@ɒ / .@Ò /   *@ 㿈''@ E'@ @ V @}{@z  7@"I : 2& @|” ,.@@` *@ N`   ,:2\"*@*@` N  *@*`   @}  2  &&& & &&&& & $&$@"쀢 `@z`@z@`? "@ KA \ K ;`J   #  2 : `" *!"@  ✄  (8\J̀ ``2  J@\2J@  @ "J@` @ 2` J@2*  J@`TERMCAP/usr/share/misc/termcap /etc/termcapTERMPATHHOME%s/.termcap /usr/share/misc/termcap /etc/termcap?#d x'@{"a @{" h@"`@ܒb:$M@ /2@{" @-$"@{}/h L@ @! hЖ@W"!@b@@c$+@$ L ! *:   :2 , L  "  :"   `$ ۠ L  `$M@ /2 !?@3 !?d?J?!?#d@z A% #`#\' '  ,   *@KJ 2JK @2 !??#p@,`& "@"  ɢ` :..!?#\   #` 2˒#p?#d "@yD  @y>  $. @#@ $'|:@z 2?"@z ?L /@y  ?#@"@ +??## ! a! !a@ "`\?c    @ `  -? &@ &` &` &`  &` &` &` &` &`  $&`$$ @  #@-b 2! 2@  * 8Ḁ(Ḁ| `a8 ! (8*@|2`!* "A J< K@ 2 J`K@ J"`J   J + 8J`J2 `  J  "JK@2JĐ   " "`" *@㿘 @ ` ` 㿘`@z` ` "`@Ē`@$`` "$` 㿘`@z` @ "`@@@$`` "$` 㿈ߴ   "l  `  bl  c0`?  /"h%@  #` R ?#<.?#܀`@#` R` ` a*  `?@2@ *`@~ @ . @ ?# `2 .?` +.    ` 2     0   @*ϖ e@@#`  }@*@%@@ 7#Ȩ`` " k'@ " %E   `  Y,  "@ %D  @ # `  E@? @%@r@`n?# @2  2S `N @E0F#`b `I`6  !6 6 6   6 6 6 6 6 #\  `;`#h `  @ @? @%@/@`+?# @2  2 `  @ 0 @* `  Д,  " %E  # `  ,  "@ %D @ # `  @, # `   @? @@%@"@`?# @2  2 `  @ @ @)@ # `d  g@ # `h  \@ # `l  Q@ # `x  F@ # `  ;@@ # `  0@@ # `  % @ # `  @ # `  @ # f  @ # f  @ # f  @ # f  @ # f  ؔ@ # f ͒  "%@""h 㿘bdh` @l@x@@@@@@ @@l ?@ Out of memory㿘! .  !<@"@ $!< @!%d0 'P'H'L'T'XH`"!D@w  ! `#@" $#    ?? ???'3 / K@`%2K@ #'`* K        L* : `X'"*` €  *5 *   ) "* *   `"  *" @ ` (* +`?Е:  c 4 *  K    %* *    "*$ @?ߑ* : `]9!,*` €1?`ߕ*`P" 'K ?Ѐ "     ? ?А  ` @?А (` K@?`? K@ 2`#@&DK@ 4  * " # @`&a8    *8* *`#@&a8*N . :  % " D @  DD<*  #'`*K@ @       L* : `X'#ȓ*` € @ *5 @`*`  ) @"* @*`  "  @*" @ ` (* + ?Е:  c 4 *` K@  @   %* @*   `"*$ @?ߑ* : `]W"P*` €D @`@ %1 D<* `C$Da8    * ` &a8 `cĒ D`@ a@ <<DNa8߀ H  * ` &a8 2@uԐ D @   <D*a8߀ H  * ` &a8 2@ucĒ 4D`@ a@ <<D@ <D@u@D@$DK`?πƢ`* a84L@ *` * "@ &a8a8K ` `*`a8: ?    * ` &a8@   0 *`a8: ?    * ` &a8@  #ȓ*|" `  `*`:  `0a8 @ i*`: | ca8@a8 K` *`  *"@ &a8S` ` А `*`( @@*`: В@ a8a8   * ` &a8 a8    * ` &a8 a8 a8   * ` &a8 a8    * ` &a8 a8#@a8   * ` &a8 a8    * ` &a8  @w$a8xa8   * ` &a8 a8    * ` &a8  @f Ra8a8   * ` &a8 a8    * ` &a8  @Z ,a8a8     * ` &a8 `)a8a8a8     * ` &a8 `2 a8    * ` &a8 `a8 a84VL@ *`  *"@ K&a8a8   * ` &a8 a8    * ` &a8 a8ǚ a8   * ` &a8 a8    * ` &a8 a8 a8   * ` &a8 a8    * ` &a8 a8 a8   * ` &a8 a8    * ` &a8 @a8h`?a8   * ` &a8 a8    * ` &a8 @  Fa8a8   * ` &a8 a8    * ` &a8 @  $a8a8    * ` &a8 a8`?a8    * ` &a8 a88 4eL@ *`  *"@ Z&a8Ѐ  'Ԁ 2PL@ K'a8    * ` &a8 2;L@`  2L@`3L@ 2`L@ , % `L@ ? ;`뀢 e`L@` L@ 2`L@  % `L@ ? ;`2L@`L@ D`L@  @D @  DD<* <?AAA4<8pAA99A9A:AAAAAAAAAAAA>>@?LAA;AAAAAAAAAAAAA<78AAAAAAA4AAAAA=AAAA44AA8A@AA5t;A46AA6@AAA4AA8=HA@3x333l33333333333<333333333333333333333333333333333333333333(33333333333(3(33333333333(3333(33333(1L1h1h1h1h1L11h1h1L1L1h1L1h1L1h1h1h1h1h1h1h1h1h1h1h1h1L1L1L1h1h1L1h1h1h1h1h1h1h1h1h1h1h1h1h1L01h1h1h1h1h1h1h01h1h1h1h1h1L1h1h1h1h001h1h01h1X1h1h01L1h001h1h01h1h1h1h01h1h11L1h1L/h///\///////////,////////////t//////////////////////////////////////////////////////////////  H㿘 !P`*!P @Ȕ"㿘 @caP"%s", line %d, col %d, terminal '%s' 㿘 X'H'L'P'T`1'X aH ``@<Ő`\`h@< ``x@< JaP aP`@<@k# :@k  @M-H@<`㿘 aH ``'H'L'P'T'X@<`\`h@< ``x@<~ JaP aP`@@j :@j H@L@<0`@n 㿘 #R``l  ! h@*` y$ hR`$`l@ R`67?'`R h  , ?" $  "h,  " R   h, @?" " `?R    I`R``R`? 8 6 h, @?"?6? & h,  "? , ?"  ? , @?" "?8 R $    㿘 @m  @m ( "`x@mV|P  @ `4 Ȓ H  x?  |P   @`? 4@ 㿀  R` ' h ߖ   - " `R  /`h-  `"R    - ?"" `?R  ' h ߑ- " `'R   ' h- @&''耦 #@' l *`- @* *`-``- %'%@ M@F6`h"#`|% (,`(H`|, ( (@>  (K@ `| (`(-2 (9@  |@*` ( (   `h?" "@'쀥6r' *`- @* *`-``- %'%@ Q  @G `h"#`|% (,`(`|, ( (@  (@ `| (`(2 (@  |@*` ( (   "'`h  "  ``' R`߁㿘 #R``t  p`@k  R `*` @k*   $p % "f$`t@k "%`$`t R $`t e 4e . R`@'%#߄+` `(*  R`?``|+`R  `  +  %"@R`@[ e 2 R`@>  "e e 2 R`@>  "e e e   R`@:'%#߂+``|`( R* ` +` `+  ` %*"@`| R  (`   ( ? `e"`R`@  R * p@mS*  R`@Mp p+`%`  "   2"  ""S @ p  R`@)p ߢ?+` p `   "   2"`h """R`@p  2 2   h* "@ 2 R`@S R @ 6R  h+` ? R `@ +`"`R @ 6h+`  "  `@  +`?" "`#@ `` `:  4 @ 6 6 ߔ?* h " R @ 1倀|* R`(`( *   @*? ` 㿘! %Y&  ?"@ ** .`. @d &@@F|.`R(* @  .`+  %@"@ 0'.` . @d}"@&@@|.`R(* @`  .`+  %@"@ Out of memory㿘@ 2]# "" `""a㿘   "!@i!@i̐`""``""` 2 |㿘@ | @r :  .   *`㻈"ߔ"$2  @E   @ | $@ |  terminal names must start with letter or digit㽐߶ X ,`X@3 ✐  А!  b "@kc@?2`` b "bb 2b",`XName collision between %s %sresolution of use=%s failed` /'Ȁ`A  ' '-+@(!@g "! @> @7耤$ !5@7c! ဤ@` ?"`* "@Ẑ a`2߀ C `?"```y'`( 6qa  `0@,, `4`, @պ `3`0 ` "!$ ! `3`?????Ѐ '`@hh" c$ԗ*$ ت $ $ $ $ $ $ $ $ $$!'$ (& `2`(" \* &Đ '`(&@a`2`(Ā`x 0π `Z `($Sa  Д`0 (`H   @Ւ`( Р`0`(*` *@W `(? $`(@O` "` @h` "`@h` @h А$@Ԓ $`$`$` $`$`$`$`$` @3$`$ a`2`(  `8 ` 6` `J@ ?"*@ `&`` 6` ?` *R ?"2 `&` `  6a`* ?"" ` &`a`2` `  `?߀`"`!a@$ \@a`2a exit_standout_mode but no enter_standout_modeenter_standout_mode but no exit_standout_modeexit_underline_mode but no enter_underline_modeenter_underline_mode but no exit_underline_modeexit_alt_charset_mode but no enter_alt_charset_modeenter_alt_charset_mode but no exit_alt_charset_modeenter_alt_charset_mode but no acs_charsexit_alt_charset_mode but no acs_charsenter_blink_mode but no exit_attribute_modeenter_bold_mode but no exit_attribute_modeenter_ca_mode but no exit_ca_modeexit_ca_mode but no enter_ca_modeexit_delete_mode but no enter_delete_modeenter_delete_mode but no exit_delete_modeenter_dim_mode but no exit_attribute_modeexit_insert_mode but no enter_insert_modeenter_insert_mode but no exit_insert_modeenter_secure_mode but no exit_attribute_modeenter_protected_mode but no exit_attribute_modeenter_reverse_mode but no exit_attribute_modeto_status_line but no from_status_linefrom_status_line but no to_status_linemeta_on but no meta_offmeta_off but no meta_onprtr_off but no prtr_onprtr_on but no prtr_offrestore_cursor but no save_cursorsave_cursor but no restore_cursorexit_xon_mode but no enter_xon_modeenter_xon_mode but no exit_xon_modeexit_am_mode but no enter_am_modeenter_am_mode but no exit_am_modelabel_off but no label_onremove_clock but no display_clockdisplay_clock but no remove_clockset_color_pair but no initialize_pair㿘 ` ?2C``  ?"  ` ?2 @!` `  ?"  ` ?2 0! `  ?"  ` ?2  ! `  ?"  ` ?2 ! `  ?"  `d ?2 "  `d  ?"  ` ?2 "X `d  ?"  bH ?2 " `  ?"  bH ?2 А" `h  ?"  ` ?2 " `l  ?"  ` ?2 # `p  ?"  ` ?2 #@ `  ?"  `p ?2 #h `  ?"  `t ?2 # `t  ?"  ` ?2 p# `x  ?"  ` ?2 `# `  ?"  `| ?2 P  `|  ?"  ` ?2 @ P `  ?"  ` ?2 0  `  ?"  ` ?2    `  ?"  ` ?2   b  ?"  ` ?2 ! `  ?"  b ?2 !8 a  ?"  a ?2 !` a  ?"  a ?2 А!x a܀  ?"  a ?2 ! a  ?"  a܀ ?2 ! a  ?"  b ?2 ! b  ?"  a ?2 ! bX  ?"  bT ?2 " bT  ?"  bX ?2 p"8 b`  ?"  b\ ?2 `"` b\  ?"  b` ?2 P" bt  ?"  bp ?2 @" dP  ?"  dL ?2 0" dL  ?"  dP ?2  " $  ? $ ?# 㿘 "  "Ӱ " "Ͱ   , " $ & " $ &   $ &    ,`@f 2 ` " $@@@ɴ@ @* Ĵ  @#-  ,` @L "   %`0`0  ,'`@* `n- "% " M $"4 I $ "* 2`6 "6  :&   *?8 1 $ $* 2`6 $}6  "&  ,  ??2  $ &* 2`6 &e6   &  ,  ??"  $ " &   P, ? &  ,  ??" @  "@ ?X%X& 6 6 Entry does not start with terminal names in column one%s `%.*s' may be too longprimary namealiasusetc%s (%s termcap extension) ignored%s (%s termcap extension) aliased to %s%s (%s terminfo extension) ignored%s (%s terminfo extension) aliased to %sextended capability '%s'unknown capability '%s'maMTbooleanstringnumericunknownwrong type used for %s capability '%s'unknown token type㿘@ ư? @  `&!&!&! L  | *  @ R&h& C @   ! S @@ | $& (@ސTR Բ`p`@a `@a @  ( ,*@ *`"  (`\* * 4"@  ( && ( ``""  P %"p`G"p')@`Ԁ 2   "䢒 64!@  /` 耤`0)!쀢`!')@`Ԁ 2   "  !  ` ``@`Ԣ`` #耢``Ԑٔ   o`!` `!0S`N!`@J  @  "`@8  @  {'`  s` "   "  " """`R"(0W"*T` 0B'?` " T`  "T`0@" T`0= ? * 72@? * 2"@T`  -*  * (2  T`* V@i`Ԡ@ T` *`"  ! !h0 2"P  , :@ @@( ` @Ӓ +    ( @ ,@Œ + "  (`@ @Z@F@ Ò   `O`2JT J $ @J<* b2+ 8.􀠠*򀠠/>"*8$+ J`<+ `` @b2`*8.􀠠*򀠠/>+ + *+   8*8 `㿐///Ӓ㿘 @aj NPH@80( xph`XPH@80kcuu1uptakhtsstkentnlkcuf1ndkcub1lekICimkich1ickhomehokrmireikcud1dokdl1dlkdch1dctbcctkclrclkelcekedcdkcbtbtkil1al%s$<%d>hardware tabs with a width other than 8: %dhardware tabs with a non-^I tab string %sunknown capability `%.*s' in ko stringko translation table is invalid, I give upno value for ko capability %s%s (%s) already has an explicit value %s, ignoring koacsc string synthesized from XENIX capabilities``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~x` ; `Ȁ 2 af( "a@ G "` a쀢 2  f, " @ : "a  `2  R D "ߒaX@ʐߐ @ " "` 8 2!  R H "ߒaX@  J %`2 4ߐ @  "`8 ?2"8 `, 2! f0 ?2"`, J )`"  R F "ߒaX@ߐ @ "`,  2(  J &`"# 0 ?" ", J )`"  R F "ߒaX@Zߐ @ "b  Y` J )`2 R F "ߒaX@=B? ?"  ?آ!   +  ` #?"``, ?آ!    , @W "a` : J`+ " J`'  "  "`2  R J "ߒaX@ِߐ @1 "b R?2   J *`2  2  `2 "@!` "` J *`2.  R `"$!h#  " ^`  !" b@!  "`2 @  "b  2` &8 ?`@ i  J` m`?  &8 #"@ "`@_2`@@ 2``  ?"!Ȓєda@b`b `2T "! * @2T`"@" E* @` @] :!"T` *` "@@@'`화,?J" @ $2 J <2 J  >J*@`J  ?"*@@Y@T` *`" @[ , |! ` a4  `c `"a4 "# `2%  J `   ܀`2 !<@0  "` !<`2 @&  "a<  `2 @  "` &@ ?2>#?fD ?28#?fH ?22#?fL ?2,#?fP ?2&#?fT ?2 #?fX ?2#?f\ ?2#?f` ?2#?fd ?2#?fh S?Q#?bئ#J `H fL j fH k f@ l fD} m fhx n f`s q fPn t fTi u fXd v f\_ w fdZ xL @ ""bH졐x0bH `d  ` "@y" "bHacsc string synthesized from AIX capabilities㻈 &t \?Z#א H ftJ  l ftJ q ftJ k ftJ x ftJ j ftJ m ftJ w ftJ u ftJݒ v ftJ ג t ftJ ђ nO  @ %"bH#p "&t㿘?2 . #$ !0 @ " @  2 p  2 V   2 V 2 0 `ȤIllegal character (expected alphanumeric or %s) - %spremature EOFempty longname fieldolder tic versions may treat the description field as an aliaswhitespace in name or alias fieldslashes aren't allowed in names or aliases$[]!*?dubious character `%c' in name or alias fieldSeparator inconsistent with syntaxMissing separator after `%s', have %sno value given for `%s'Missing separatorIllegal character - %s@% t  ! A#x?$t,#xհ@Z ϰ?@@@` ` `  \ @   ? Jcq : `:`.@l`. `  @``.` ` b `  `2! `. `2 ߤ ,`:`@   !&!(ܐ@Mcq0 #pch *ch `\ߒ?# """ 5߀`,$-cq \ @    ,@` `:&!``,@ ,ڐ $-cq,?   :$-cqhL " " ,",h@ | 2L@[Ll,,@В |  L 2&}!p @j  &s! hh@[h1&+&#&'&*: `/ "h]ah@Jb  2hLQ(h:h b ` h@!Ȥh& !ߤ@ob `@ `2, `;`_2,,",,`:`=`#"5 `,z z  v \`@ p Mcq@h&<"X" n @3Mcq@   h!&"͐hh" W  5ߤ@b `@ `",,  N,@j 2J&"ÒhJ`&Mcq@&鸐"h&"`#  ch@Z*  `: Mcq@&飐"ߒh " "   ?  !&"r鑐! Premature EOFIllegal ^ character - %sAllow ^? as synonym for \177Non-octal digit `%c' in \ sequenceIllegal character %s in \ sequenceVery long string found. Missing separator?㿘'H    ; ^2 \ %/ \@}?(y"  b  J ` ?!("- ?2  ,@` `( "`" y,@o @N? (J". @: & ?Ѐ ' `/(-+(@7?4‐?Ѐ   @ `b, ?Ѐ " ,@A?`j+)"*` € 4,@ 1,@ .,@ +,@ (,@ %,@ ",@ ,@ \,@ ^,@ ,,@ :,@!("譐 ,@2,@ 2,@ ``XX (蕐#  @Ocq ? H@ ` 7 5 ^. ,@> TDPtD\\h㿘  "ct#x㿘. > @:?㿘9 ?;   5 7'#t /cx#&| & \ `㿘1 @X!|?"!|  `. > 2   㿘 a   !|J@  ?y3  \ߒ`" \r"` !|`J@ i3 ! 3 % )ߦ/*&a l! d ch $l %ch #h@"`#hl@ء"@  #h  &a \ߐ % \"`` "a@xa $a|@Xa|J@`$|J` | `@X|a|a|a| J?` 2 a|J? a| *?a|*@ a|J?` l#hJ`#"&aa|a   ` `? +cp# `J$a|Can't backspace off beginning of line㿘  |a2*玐#"|*㿘 ! " @ !|  !&   "  0 | H`?(null)(cancelled)\%03o㿘`1+i ! 1+d . !@W* `$ ".N@ P` \%'+",  @ ` 2,  ,3   ,  n,   r,  b,  e,   `  @,  ^, , @@WN@` ",, 㿘 㿘  , '!6 6 6 6 "6 $6 &@T ,&  2 @T N&   2 @T&x&   6   *   &   6  ? *2   &      *"   &  "!㿘 @(" @V"@㿘! !@W1! @/ 1 !@@[!@$!!Out of memory?c` % /)  $ @ & ,` ?"  "@ `@&  ( @ , 2 ( $ (`@ @T ! " `?#   ??  ?"@""@"@` (?#?  a? , " "" @T- & ,ɐ @U!   @@&? ?    " 2  "   "@  `@`2D ( " $ & < @ ? @  @@Vo` @@"&@`@S & ,~  @ ? @   "@ `@@~@ @VG@@` ( @?#@ ,,`@2 " " (`@ 㿘@ؒ` 6``J ` * 2` * `&`` 6` ?` *R  2 "` 2 `&` `  `* ` " "`  " ` &`㿘  @q  @. $`  . $   @. $ `? 4@ ?@. $ `    . $  ?㿘`@-     㿘 " $  &'  & * 2`6 &  "  ", @  @  @*  @*@?, 6 " $ .&  * 2`g6 &  $  "* .@,  *?  "  @2@2??6 $ & ,'  * 2`66 &  &?  "*  *.@q  "  @"@"?6 &`" "` `" $  " `"  $4  "`2 "  " " $ &㿘ڐ:? , @] 2 * ?  4 $2 $ "    $ "     & "   㿘Ô c " $ &  ?   +     " ǔ!" E "- A ? 6  "  `*   &  " ?6 *6 " ? 6  $ +     2  $ ?6 6 $? 6  & +     "  & ?6 6 &  㿘4A " $ &    ,  @ X6  ), &  +  ??"  "H%" S": O "* 2`6 "6  @&   * ?8 7  $* 2`6 $6  '&  +  ??2  &* 2`6 &6   &  +  ??" 㿘 " $ &  @I,`  &"" @ *  ;@      &G  *@   А͔   Ɣ   + * ?2`㿘 "`" $`$@ & `&  `@  $`$@   , `  @ "  `l@P*  & " `&`"`$ u`& "   " $ " h ``"& "`"`* "  *`  $,`$ "`"* + `  $@ `$,`*`* &`& @ M  "& @Ps& @;-``֒&`@R㿘@&`& `& ` & `& `& `& `& ` & `$ @P& $ & @P*` & @P*`   & `  *@  &`  6 ` ,    2   &`   6 `"`,    "  &``"`$`&  , @O& `@Q0& x2d2d2dJ2d<2d,2d2d 4 8   1@* 㿘#`e "dEl 0 <l 㿘#`e "d-l 0 Ґ$l 㿘#`d d  lr 㿘  1!"Β1#` R -! "#,` "R`@"   "c(u{` c( , 2# R```*`"$!ߐ $  "l@O* ` "c Y?# J`0#0#  J ߤ `cȢ d#  # @@ 2@ `2`-2  ? * @*`  2 ` 2`2J` "  2 R@ 22@ #  R `22 #  R `22  ƚ` 㿘. .`: :`@ .*@: @ *`:  &**`: :` @C 76H7@* :  1 &@&@*` *  *  * * 'А "@"@* @Cw7@- : <` 2,,,: :`"@*`" < " @Ce*  x:   ",:`"@ *`" < " @CV*   *`" < " @CN* !h* : @7/!h6㿐. >  ' 6Ű? c0.` & . & ߓ,  :`@ `2?,`:   ?.`: ` @ 6?.:   6? ?+ : (.   *  ` D+܀A| R  :. |(R( * @ @ "?#+` 2|" S ?@3  3 6S 3 @43  |`R`@$y|R`|= c(*2?h#* @ cȐ@ "hc$`"* J `0#0#c d, : * *,` P :` *`S` S`(PS= #\S3#`j 㿘#Ȩ$`. :   6F?.`0#.: ` c4;?.:  #$2?J ``.  *   8# .  *2@   2  @ 2`# d  , ,`,,:`::ؙ; j7 J @ ` P P`一"伀2 圀"堀2 䴀2 * :   `"? + # (@3@ + # (2 + # (2 * :   ?*#( 03*#( 2 㿐 7`7 @ |`#` "Bi 0m `.`:  =` 9 . : W`WW  `W .WW )` #1` W  `W 4 p` #1`W  W 4 x ig WW #W Wx7W y7 77W "WW $OpenBSD: kvm_file.c,v 1.4 2001/06/27 09:11:51 deraadt Exp $can't read fileheadcan't read kfpinconsistant nfiles`(0((  @ H  4(((?Ģ`"@Ā` 0 @ 2 0 0?Т`0@` 0  44@ kvm_getfiles_filehead_nfiles%s: no such symbolcan't read nfiles`( N  '' 'Ē   @E ?$((`2(0@ &((Ā :((@&((((Đ&(0  @E ?Ā`8 ((5@Ɣj   a'@ _@ 'X`0@ U&55 `0'''@  ` ` ` 2` @ 5@q87 А@   5@cP) ` *` ((*  `'Ē @ &(((0 :((@&(((( Ēܔ&(0 '&(($OpenBSD: kvm_proc.c,v 1.8 2001/06/27 06:16:45 art Exp $($ 2 ` ( @x h&($`  ( @"i @ 3 H HX @耢`@ " ( (2Q ( &@O ;@O * @<@   29 <x@   21 `@@ 8 82' t(  ($ ( ( (($@O ; @( "(   @Oƒ$&($can't read proc at %xnprocs corruptcan't read pgrp at %xcan't read session at %xcan't read tty at %xcan't read tpgrp at &x㻈 @6̰"ɰ/6+6-6'6)6@!8!80@n?p@  `p@ P` ``@0`@0  t"@6@@H?P'h@Z  aX5`f'\7 'l @I 0 0p$\ ),`& @8!!,' '@&  !@?0C`'?'?'($@ 'Đ`'p`@ @ 7'7`7`   @@O!8!8h@O!"Ȣ`@Ccannot read allproccannot read zombproc㿐(@Ö  7  @  7 @?0. + #+ +  '@ & kvm_getprocsproc size mismatch (%d total, %d chunks)_nprocs_allproc_zombproc%s: no such symbolcan't read nprocsP( "(@I5&(( ;  ?'''   @C ?@ &(  @B ? 7@= ^ "@N)  70@ "P @M%"H'77"`bh7x''''ܐ@g  ` ` ` 2` @ 7@) @  7@ؔ *` *" * * @"' &(̒ؔ'&(㿘( @H&(out of memory㿘@H 8@ 㿘D?=#8 (4`2 (8 & * &(8@ސ  *  & * &(8ϐ "&(4(( 2 (,( @Ɛ &((( &(0(, 2 .( @  &(,.(4@o (4 ((`(  (,@֔( @ ?(, @ #'4 @J˔ $@ (0 *`((&(0r &(((4 " "*  @I`$ $  @`2$,$  (4:$ $(4"@ " "@ "`@!8!8 4@ O 2 N1 " p! !    ?'ؒ ܖؘ @A $!N`1 !@:   ԟЀ   h a8 " 㿘9L㿘9`invalid address (%lx)㿐 %9<  @[   @M&$OpenBSD: kvm.c,v 1.23 2001/06/27 09:11:51 deraadt Exp $ pread㿘! (@$ x? x 9@Bpwrite㿘! (@,b$ x? x 9@(h%s: 㿘'P'T'XP! 9c@@%@Cm 0 @ݹ(: %s : %s㿘'P'T'XP#`9c@ؐ@%_ (`x!:@㾠 P@˒0 (@ݐ@I  (`x(#:$  @㨢`X@$%s㿘@Fq   (`x!:@㔠!0exec file name too longbad flags arg/dev/mem/dev/drum%s: not physical memory device/dev/kmem/bsd/dev/ksyms8?&(&(&( &(&(@l&(  &( >(H&($&((&(,&(4&(P&(T&(<&(@` &(D@H#:?:N`:!:!@$) &( :0z@H :0p<  N`:a@  :Ȗj`:!@# &(:0O@# &(:0C`:!@ؐ?O` @#ے ?-&(`D:"@#Ғ ?>&(:!@#ʒ ?6&(:@# ?&(`:"@# ?&(:!@# ? &(:0ߐ `@ @  ` @='@  x(   k 2u??### cʀ@2l?2 # 2g? 2c?ޒ M&(<##  #  ( B 2=(<c @@27(<2` 23(<  &(@ (&(D(  $䀢@2(< ( ؖ   2(<   2 2(< >(H (< "(D@E$&(<(D "?@E&(@&(D?already has a dump headerdon't use on live kernelinvalid magic in cpu_hdrinvalid size in cpu_hdrinvalid dump offset - lseek㿐(<  ;H?( ;h?(   2w??c# #ʀ@2;2 # ;ϒ c? &(@ K&(D @ (  D  ;(@  @ >`D ( >(H! (  @=$ x(H (L   x ; (<  &(< 2`(< 2`(< "(<"#"@@U 2(<(< "(D@Dg&(<(D "?@D`&(@&(D?clear_gap㿘  <~8 ? @@ג?  no valid dump header(s)kvm_dump_wrtheader㿐(<`(D   <5V?  @  I(<`”??F#(@ c ?''  @ | 2(<` ?"/?(D (@@ k !(@ "@ ?##''  @ W  (<`? ?2 0<?㿘@C(`  ^   (`x@ @X'%s: %s 㿘@C(`   (`x!#= @ਢ`Ж@  "2 㿘(  @<( &(@;( &(@;( &(@;( "(P @(P "(D@9(D &(@@Cb(< "(@C\( "($@CV($ "((@CP(( "(,@CJ(, "(4@CD(4 @C>@C<%skvm_%s.db/var/db/file %s is incorrectly formattedinvalid argument to dbopen()unknown dbopen() errorVERSION_version@?c ==В$@!   @ #$( ( x " O ==X?=R?=(L?=#@ ?   2:( 5􀢨2@H(=cH ''   2"(` 2( @Hw ?#@і2 (@r 2( ( @?$(bad namelistsymbol too large㿐 2@@ ?N>p 0H>|B? 2J .1@D$ ' '  2 ` 2  ` @H   @H   $J $*` . .  .  > &clearing dump on live kernel_dumpmagcannot invalidate dumpx( >*># ''?>p@ ( '@    > 0 ?invalid address (%lx)short readno valid dump header㿐`   ? ̒ >?<?Ĕ806< D ?H(?Ғ "$@@ ۀ8 @X d &:"$@@@$@short writekvm_write not implemented for dead kernels㿘(` X  ? i ? ?a0?[?$OpenBSD: kvm_sparc.c,v 1.5 2001/05/18 09:08:38 art Exp $_kvm_freevtop: internal error㿘(P ?7&(PUnsupported CPU type㿘(D  "a &(   "a  &(    "a??( @5 "a 㿘! Ӑ !?! @@Xinvalid address (%x)㿘=#@8(D6`?6` `?*  *    *  ?$ !@E a? >`  ?>` *  @(  a?+@ *  &(  & @8  cannot read pte for %x㿐=#@A(D6`?6` `?*  *   ` 4a?  >`  >` |@ @.? % ( 5  @h `  @( ?@* &(  "@@8 K 㿘(D       2 8 B   2 D @(H@F@F @  f8 ??㿘 `  !  $! ?@! ` 㿘!(!( %@   `` ߢ!(, @@?, @㿘 a  "a 2@ : :*:   㿘    b`  ?   b`  8 `R  $D`  $$` $:  @C  @ @ $@D@`@ @  $@$@@`@ $@:`  $D`  $$` $:u @?n #@a@? ?#@  ߐ!83@   2 "  S Q 664+@,   @ "@ B@ `@  "@ "@ @ ` "@ :. >  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@ .        b`㿐?@  @  ?@ `㿐?"H ߰ Z "P B"X7ąB' B'@    @q @> . 6`  `6 @3 @߅?"H ߅$%"X7ąB' B'@@ f "X  D'…B'@@ F #dd߁#dd`` B BhBD# 2@  2*2   㿐    b`  ?   b`  `V  $D`  $$`$: 7 @B  @ $@D@`@  $@$@@`$@:   @ $D` @  $$`@ $:` @??#@a@? ?#@  ߐ"p4@   "  d`]664,@ ,    "B `  ""€ `": .  >  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@.  @@b  d ,6 @4 =   b ?㿘>@ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@@A@A㿘 `R  $D`  $$` $:  @@  @ @ $@D@`@ @  $@$@@`@ $@:`  $D`  $$` $:u @?n #@a@? ?#@  ߐ#p3@   2 "  S Q 664+@,   @ "@ B@ `@  "@ "@ @ ` "@ :. >  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@ .         @    x  'ܰ''ܘ @5Ԛ  ?8   *'*`F <@㿈 2 ( ''   @5 ?`@;찒   @5 ? ! ( x@;$ x ?@f@;  "`x " $ 㿘'L'P'T'X@PߔL : xxswufsswap ,rwrqro㻐- 5E3E !$ @Ő! E ax@ _EE!@% + J #" @ & @ & @8   a @0& E!E!& a @u @ 􀢀J `#@a$`@\ @ 􀢀J `@ $` !@C %J #" @8 $`@4 $` @0 t$` $`$` @( +@ 􀢀eJ a`_#@Z$`@ " @ 􀢀LJ H`F@D$` $@s!E@!  !@훒 )E!Ȑ@픒 "a@펒 @툒 "%  @Ӓa @<  E!@t E%    @ O 㿘 !`@@    1  !㿘@0 " ! @E ! ! 㿘@  !  @/  ! /etc/fstabr8! ! "F@i 0#"@.  (̀@<  F ( O "`x@!b $!  (`x@ 㿘! ! @$!fstab: : pF#FFb   ''''''@ސ@<3''Fc '' @<0 $OpenBSD: strtok.c,v 1.3 1999/11/09 11:19:46 art Exp $㿘 @Ё   2H( HJ  " H?" J  H  2*? " 2HJ㿐` `` (  (' "`x? `@<$OpenBSD: sigcompat.c,v 1.2 1996/08/19 08:19:39 tholo Exp $㿈`"  `` @'''` @:+  &㿐'D D@:3 㿐'D D@:' 㿘'D@ D%02x:%02x:%02x:%02x:%02x:%02x㿐 !"@ G c(#`  #\@ѐ㿐"   `2   @ϒ J: `✐@ `2.@".@ .@``ݠ 㿘 !ؐƒ  %x:%x:%x:%x:%x:%x/etc/ethersr+ ethers.byaddrX``H````@#`#\@k@:HH @` R\?@8 @40V@1S  J?` '< @:/ , H, `Ȑ@$ @̀ 'H̒`Д@ Ā Ȓ@ @8W@  @J  @  @ ( "`x?ethers.byname㺀@:HH @E` Q[?@8% @Ɛ0U@ÐR  J?` '; @9 , H, `Ȑ@y$ @3쀢 &Hb@ϟ䀢 @& @7@  @ѐ @ @u ( "`x? 㿘’ ( (N  2! ("@ ` " N  `2 N I`x@YՐ@`  ( "`x?$̈́ b|@㿀'@ + 9+ ` @ ` \+0  00+ 0+ ` 0"+` \+  M+ ✄ `   ^+`  ? +`@+ -+ +  +44444444<4$4l34T44 4444444444444444444㿘@N@:`'@*``2`"*㿐@*B " `  *       *: . \  @2`*.?  ` *`N@:`ڔ@*  :  .@*`"&`N@:`Ð@"*`&㿘 N@`N@8N@N@ "*$OpenBSD: bsearch.c,v 1.2 1996/08/19 08:33:26 tholo Exp $㿘@7>@  $>>2 㿐  ?  @,r ?? $' b|@/dev/tty ( ( N!@k   ( "`x    ' @3X  @4 ! ?????'Ԁ  ?'ꀢ  /Ȑ @r ??????'????'@4@*Đ"  /" ` `(* /!*`@ `/, @*  O` ` ՀԀ ,Na@* @  , @  @2Ք `@*J㿘 b( P h`''' ''''' '$'(''Ȁ` `` (  ( `` `@4+ "`x?./㿘 ON O!p@3ڐ?J? / J /"  J /O!x1 6""@" J /2"  1 "@0 ( ?"`x $OpenBSD: atexit.c,v 1.2 1996/08/19 08:33:22 tholo Exp $㿘! ( l2 " $ @1  l ?""$ l* "  " $# b|@$R b|@$ b|@$OpenBSD: sigsetjmp.S,v 1.2 1996/08/19 08:17:45 tholo Exp $`" (0@ (`0P$OpenBSD: _setjmp.S,v 1.3 1996/08/19 08:17:25 tholo Exp $" " " @" `&"`@B6 0`$OpenBSD: setjmp.S,v 1.2 1996/08/19 08:17:44 tholo Exp $  0 " 5H P """  """㿠   @" &  g @longjmp botch. 㿘Pap @)$ 㼘 ? c ت ` $ ( `-  5 @ `8H%H" . !/@ *`  @ *   ` 2?@$ &o @X "j $@2  @' ? @$ @Xo ĒG`$` 8<`8 @" 4&88 @ &8/J@ @ .   N . 0  b`  @٤@’ ے @ 8"` 8`  "` ( "`| bf0.0.0.%u.in-addr.arpa0.0.%u.%u.in-addr.arpa0.%u.%u.%u.in-addr.arpa%u.%u.%u.%u.in-addr.arpap '"h` @P?ؐ@ߒ (  @5h O؀  Q`@0   "w /Q-Q+Q)QL f"a4e b2b`2_    *2#" ( # $@ t $@ l $@ d`  #\$ @ Y  @[$ &    "" 2```22`" @a 2 4 L  f 㷈 '"h` @?@`B (  @4ϔ O耢  Q`@   "/ L f4 ` b2`$@ؤ  @a$ &`X   `@) Ȣ``4 L ـ f 㿘 (`d @?@_  `d  `d @A㿘! ( d@& @g d  @:  d@W 2 d @/etc/networksr㿘! # RR!@a$#@ (`d"`d㿘! # " (@$# (" d 㿐 c   RR!@la $@ y J?` 2'#! #@/, L@ #@_ # 2, "#@0 #* R @Ӓb( , L% L "  " @( ,@`@7# " ""`  "'$L " *`:    $@0B , @( " $,  "$L  $#㿈N 0   N x X2  N $"  @2, ?:` D , :  *??  N + :  . @  $@` " ` 2$@?$@`$@:   **   x" '" "  @b؀ ?  '㿐 @?.@ .  ?#@.   ?#. ` '@.  㿘  `   @L  $`  ` % @@ $`8 $ 5 `* @*`@*`@ *` ' "`@-` * @*`@*`@*` @,$ $ @ $`*` *  *   * @&`% b|@$OpenBSD: pmap_prot2.c,v 1.4 2001/09/15 13:51:01 deraadt Exp $㿐 `?'#@ @ '@ٮ    @  @   2@ @"?'L'P7'T'X7L@,d '' ''@ ?  *@, "& "&@,m'& ( "`x?ShSXSPS@S8S(SSRRRRRRnoopaquenodumpnouimmutablenouchangenouchgnouappendnouappndnosimmutablenoschangenoschgnoarchivednoarchnosappendnosappnd㿘@+ T. "``  ,+  *    * @ `J@  @`*J@  * .  ߑ+ * ,㿐`2&@2&'5+UL@ 1T" @޲  2  `@ާ 2  `@ &@  & ڤ   @w `P 2& $OpenBSD: swab.c,v 1.3 1998/02/10 02:19:48 deraadt Exp $2":J  *@`*@ `: DJ  *@`*@ J`  *@`*@ J`  *@`*@ J`  *@`*@ J`  *@`*@ J`  *@`*@ J`  *@`*@ J`  *@`*@ `㿘  @ޒ `   А *`: ?А *`: ? *`: ?ɀ`2    V 8,  €,@` ,  ,@ ` ,@`@* $@*WWWWX XX    *` . *@  ` :   *`*@` *@` *  *@  $$OpenBSD: xdr_reference.c,v 1.4 2001/09/15 13:51:01 deraadt Exp $xdr_reference: out of memory 㿘@ @   @*_  &@V @a0 @, @ @*n&@㿐@@ '@Z   Ė&@  02  "2 2 $= b|@$OpenBSD: strmode.c,v 1.3 1997/06/13 13:57:20 deraadt Exp $< ( b("" c4" p ?" d ? l0 "  -  ? s8" w ?*@`! - r*@`  - w*@ (@@` 0 @ 0  - x S s*@`  - r*@`  - w*@ $` 0  0  - x S s*@`  - r*@`  - w*@ " `"   *@ "   *@ - x T t*@` *@*`$ b|@$OpenBSD: heapsort.c,v 1.2 1996/08/19 08:33:32 tholo Exp $㿘` ( "`x?@)E 6`? -&   ,,-`@.+  6 @. 4ݢ2ت`k@.  @,` @- @,`  # @-   @--  @,`  (5 : @-ʐ@-ƒ  6  @,`   @,` ڨ@(ː " $" ( H @K D% * @,`@@,`@*` ,  &, @{& @/? (* @,`@@k,`@*` ,  & , @`& @x 2?* . @O. ?$u b|@㿐1!`7   5 ;  3  &Ȕ0&c&T"!P'c#Ķ  .( > @?*   ᠖P (@ (   (. @?*? (  и x  .@/@.?$ 0  h  .@/@.7$ h ./$P  ͅ, P' P ݆P Փ,P  , "''@#  # @4("(' @4(@'@(#ײ`` ʐ    PP    PP  ) ! "@  @  ##ȇ(@'@('$"   " %@Рh  @  cċ(@'@('` 􀤠O  0 .$ ɖ P㠔P ( ( . '   (@&@$ . $(  ؁ Ā       2*`0"㿐'L`'P   P' '  І'' 7 նP7  ͞P@7 7 .# /  @4. 954 @@  ;@ 4#@  @. @   @ @c@  P  ŪcPP)>' ~!~      6 . ( 0 .`@.  @6  / 00@@ @@/ 6 P?1 !P6` (o  ʵ.P. ˆP3 ̱. aP@ `?   ݆P3 3  c 3  +  , 4 * 4  #4c %/ L P  @   @P  㿈!؀`h֐ / / / / / / //''.@.`.`.`.`.`.`.`㿘!؀`2 2  3 aP  T@  P!P6  a" 6  $6  *@ .  a &0`@ * ( 0` a*  0` !,@ (`!P   !P .  P   `д  &aP  a"!T     <b @3 @&5 -22 5 -@ !cP@2@ 3 @   PaP@ 3 *cP @ !P3`3  @aP@ P 3 aP@3`  !P  P 3`3 aP@ @ @!P  ` +` P P @ @$@ $$$   㿐!Ж *        * $ $*  㿐!؀`L !P  #  + @ @ @   $` ?!P (( +  @ @   ,@ ($OpenBSD: rcmd.c,v 1.39 2001/09/04 23:35:58 millert Exp $㿐 #\.`2`@dRSHshelltcp%urcmd: socket: All ports in use rcmd: socket: %s (invalid)connect to address %s: Trying %s... %s: %s %drcmd: write (setting up stderr): %s rcmd: select (setting up stderr): %s select: protocol failure in circuit setup rcmd: accept: %s socket: protocol failure in circuit setup. rcmd: %s: %s 0\'L'D'P@%'T  \@%y"8 L \\bH@"@  .``2 @D@oE,` \\"@@bH  4`@  DLP@T@$kظ\P4` @ϐ  D??@ ??Ș '''@w а? `! !X@Y!D" '@$ #''  c@ (`x 0 ?X' =" ` 7/`` !#\! @_ \7? \b@q @ȟ%x`/`!` #\@C \7?\b@W`  ` @-` # !\x`@1"Ȗ@=!`@ "  ( x # !\ @+bX `#\ @bx@!`  @# @?0-@`@^` q`@`2 \bА@ '@P!'@ 2 `* @"  @\ؒ @@%' @h@%  @/ (x!#\ .b@u6 *   +6`& *``+ &%x@   @œ x: x  !#\ c@@0\ @c0@ @`   #\  @]  @  @Ԑ@А x!#\ @Vc`@cn' '@  #\  @1   @#@ܐ! \ @@cxF@$LL @Đ@$}PP @@$wT T@ @  D (@#`x!\`@ #@O @   @ O`   @" @!0 @U@@!ې@N @"Д ?0p  ? ???'_``'ܔ@uԀ ?0@ 0Ԁ   @P   2 @?㿈  ?  ?//'@4 /etc/hosts.equivr/.rhosts.rhosts lstat failed.rhosts not regular file.rhosts fstat failedbad .rhosts owner.rhosts writeable by other than owner8  __!`@qax `@v @[ @`2V?!䀢`"O?@d] I @_a@@l@1i_ax@=@1b`2@  _#!<  _!T`@#t _!Ȁ` @_!  _!  &" @摐?㿈  ?  ?//'@ 㾐@!? # * ( &# ✖ J ` `(*   *J   * ŐJ  2 *J      J   "  J `J    * *J  @" L + -L   @ 56 @ɒ -   @jі& L   @ ?@    @j @N @IL@ + -L`  @`0 # ` @jL`  @ `` @j @  ?@`?  ?   @ 2L?h !#\ /ؐ! @ 29    ? ???'_'ܐ``'Ԕ@sԀ  0#@ 0 Ԁ Բش !/  !#\ @ 2  @Ҋ   2/@ rcmd: address %s not listed for host %sh  bX#\*bX /! @d 2Q  !#\ ! @W 2D    ?? ??'_'ؐ``''Ԕ@rԀ  0-@;X0*Ԁ Բ !/  !#\ @, 2  @&   2/a aX @z@ $ b|@udptcp%d㻘 \۰?2װ?! @   @  *`@ İ? @" ?  /`,   a#Xa#`@  `" @!-@ 8?@@Z ,`ah2"@ڐ@! p@I   0: < @ 8 22` 2`*`        ?#@2  2   2     ? ?  IG  2D? /@" 7?@  @- @I  @ @ (@?@ِ "?  @  0@Ȗ ? 㼘 @" )?@ {`@@ ` !@   ? @ %@.*` %u㿘 ? ?  ? ? b  @6 " @ : b@  ?㿘 (`` @@ `` ``` @Э `` @p  `' #X  @ j  `"#,`' @ X?'0a$'@ ? J?`6   //`+/Ѐ`7@ݔ   ??ؐ@      2  @?$@`٠OАВ@ OЀ @ ?@ @-$j b|@$OpenBSD: rcmdsh.c,v 1.5 1998/04/25 16:23:58 millert Exp $/usr/bin/rshrcmdsh: unknown user: %s localhostrcmdsh: socketpairrcmdsh: fork failedrcmdsh: dup2 failedrcmdsh: fork to lose parent failedrcmdsh: setuid(%u): %s /bin/sh-c-lrcmdsh: execlp %s failed: %s 㿈`c#X@_  cc ch@ؔ?@ϲc   @G 2@?0&   @ c#@/ c#@?0ys@@AT c @AN  c@Ґ#@3 @/ c@ɐ#@* @& @,  "c  (`x#!d`@t @ꀔ@ @Zc  /@T 2 / J  d  /@Sِ  d(@A]  (@Sː  d0#\@AM (`x!#d @6`8@B@Ԑ @@r No address associated with nameUnknown server errorHost name lookup failureUnknown hostResolver Error 0 (no error): x؀ N   (@N'$ dc '' (@!`|@A$$  d# $:$$ @; Resolver internal errorUnknown resolver error e  Pe h* 㿘? @L4 $OpenBSD: rresvport.c,v 1.5 2000/01/26 03:43:20 deraadt Exp $㿘@ 㾘@R!`` ( .  /("`x,  @~ &!?4@c44@ @  ( x`0 4@, @>?@$@Ӑ?㿈 ''@ $ b|@㿘 ch ! @#x@ ! ( "`xN  "`x 㿘 ' #p@%t ! #h@,  @ ( x$t,` #h@j @ @@#p  "㿘#p@w@ "#t@q$1 b|@$2 b|@$` b|@$Ä b|@$OpenBSD: strspn.c,v 1.2 1996/08/19 08:34:26 tholo Exp $ ` (  *88 " (" $ b|@㿐#\#`  @̚  *** unknown regexp error code ***invalid argument to regex routineREG_INVARG"can't happen" -- you found a bugREG_ASSERTempty (sub)expressionREG_EMPTYrepetition-operator operand invalidREG_BADRPTout of memoryREG_ESPACEinvalid character rangeREG_ERANGEinvalid repetition count(s)REG_BADBRbraces not balancedREG_EBRACEparentheses not balancedREG_EPARENbrackets ([ ]) not balancedREG_EBRACKinvalid backreference numberREG_ESUBREGtrailing backslash (\)REG_EESCAPEinvalid character classREG_ECTYPEinvalid collating elementREG_ECOLLATEinvalid regular expressionREG_BADPATregexec() failed to matchREG_NOMATCHREG_0x%x`> @5$ !   ` @  2` "`@ `@9g`h@l@ @X0%d㿘  "  @|  2 gaX@G1g!P$OpenBSD: strlcat.c,v 1.8 2001/05/13 15:40:15 deraadt Exp $㿘 `"@ J@ "@ 2N@@  @ *@`N &*@$OpenBSD: system.c,v 1.4 2001/09/04 23:35:58 millert Exp $sh-c/bin/shxgg"b?' '> ''@ @?v? "   @ '? @  (`pg"@?@@ @  @ ܐ@?]  @ @ @ ??܁% b|@$ b|@㿘 '"` ` @p?  !$ 㿘 'b`` >@{"`$OpenBSD: sigsuspend.S,v 1.3 1999/01/22 06:07:56 marc Exp $ o b|@no errorinvalid value for ai_flagsname or service is not knowntemporary failure in name resolutionnon-recoverable failure in name resolutionno address associated with nameai_family not supportedai_socktype not supportedservice not supported for ai_socktypeaddress family for name not supportedmemory allocation failuresystem errorinvalid value for hintsresolved protocol is unknownunknown/invalid error 1h܇(h+!0h(!@h%!`h"!h!h!h!h"h"0h"Xh "h "h"h"h"xl`TH<0$$7 b|@$OpenBSD: realpath.c,v 1.5 2001/06/27 00:58:56 lebel Exp $./8!i x@  x .@ `.`@s$ /@O6 @`i  @(*`J@ /"*`@*ݐ c0@ #< (@ 2  ( >M"`x@Ĕ# G! (.@@ @* <i @@@$ "2! (N@ / N``?O @@ $ ( ?"`x i`@)@&@g  ( x @ ! ( x@Y@$ x /   `  ( "`x@# #  /,&@@@0Đ "#.@##`' .i-@"@ -`d ' (" x' ''@ @"ʠ?! * .* '@ @ ' .- - -@ |`@+ u /-   @Ґ b x@.$?#5 @Đ T xL` .2 `L` `  ``@a@ " x' x$` `   `c/`@ "&@&@@2 2 `? /, ``$ @&@-f' `' x ' x``@E`@@ @ `   ` $  @@ @@: <  "  >(` :`@?? D8 >` > >> `` "`@6`  @0㿘#/.   > @@" @ @  #$, , 2 > @" @"ܰ  @"װ Ӏ@@"ж @0ʀ@@J@n@"@@@$@ @&@ @@?@ kby@@?@ژ 2 8@Ę@? c3> ?'"`. @ . "@2 &  : +   ; &   + : :&㿘  b#% .> @8 @"A @!@ @C @!@  @"@" &@D(@"f  , N@: @` ~`* @w@@@ @  `s @2   " @:h N @  "s@ :[ N@ 2W  hQ  @    @ N @  @ @ (:  `24 _"1 @ :. %@@  " @ :" N@ @  2 @ : @ `2 _"  @(   `_` . c`$ .  `-.`2@ `.> @P@"Z @>0@"W 0@>@" 0@^0 ,,  @ `?, ` ?,   "@ &@ @ @ 2 .` @ @.@ 2 2>, /` " `/` @>, " &  2`# ?#$!" D/  > > /   @ /  "?>&@ ,   :, :[ 2"  :@, ,  &@  ::B "   : 㿘 @ N * @@   + @ N@" `   `2  `      ,  `        `0 "  @?  `b `@ ```_` b @ `2 _` `b ` ``_{   `{_  {  @2  @ @r`& ` `㿘  0@ N * @  + @ N@ `   `2  `      ,  `        `0 "  @X?  `b `@ ```_` b @ `2 _` `b ` ``_{   `{_  {  @2 2 @ @s`㿘 ك( >+@ @( "m M(NR?~@ Y @o@@_@耦 $@  Z"q &( v82rm   2kf e b( 2a\ 2]X 4YT  ( Q J G((@ @0@@0>@@;  7((@@ 0((@@ *(@((@   >(@/(@@.  @@(@(@0(``   ` $  @@ @]@: <    >(` :`@?? D8 >` > >> `` "`@` "`$@`$@ 㿘#/.   > @@" @ @  #$, , 2 > @" @"ܰ  @"װ Ӏ@@"ж @0ʀ@@J@n@"@@@$@ @&@ @/@(?@ kby@ @?@ 2 8@@ݘ? c3> ?'"`. @ . "@2 &  : +   ; &   + : :&㿘  b#% .> @8 @"A @!@ @C @!@  @"@" &@D(@"f  , N@: @` ~`* @w@@@ @  `s @2   " @:h N @  "s@ :[ N@ 2W  hQ  @    @ N @  @ @ (:  `24 _"1 @ :. %@@  " @ :" N@ @  2 @ : @ `2 _"  @(   `_` . c`$ .  `-.`2@ `.> @P@"Z @>0@"W 0@>@" 0@^0 ,,  @ `?, ` ?,   "@ &@ @ @蔔 2 .` @ @.@ 2 2>, /` " `/` @>, " &  2`# ?#$!" D/  > > /   @ /  "?>&@ ,   :, :[ 2"  :@, ,  &@  ::B "   : 㿘  ,@ 0 ( N` @  ,@ @n `@ / @ N@`@˒ "   `2        ,  `        `0 "  @# ?   ✒ @ `_ ✒ @ `2 _ ✐  ` _?{    `?{_  ?{  @ L@ @ `@ `@ @Șa& L@  `㿘  4@ 0 ( N` @ 9  , @ / @ N@ `  ` 2 `,`    `, `         `0 "  @i ?   `✒ `@ ```_` ✒ @ `2 _` `✐ ` ` `_?{    `?{_  ?{  @& L 2`@拒 @ `@ 2`@ -@c㿘>!`+@ @( "v`M) PV~ОDŽ@ d Ş@"x@@n@耠5$@  h"@&("`8@2@ ``2@{ z@u `2u@n 2o@h 4i@b `(`_ ` X@S   @ @. @@O@ H/@(D A@ `@.`@@6/@O@2@(@  5> (@  @@/@@ `.``(  @@@/@@@(`㿘<"e @ @4"E@ `( "`    "  " @.㿘 ( "`x@  ( `&& & & & & & & & & $`& $@$$@ @ gw bh@ ]?46 `-  @ n J@s`D&`6`6&` $@ * 2``6`86`8`&` &`%   ئ@h@D &"  2 8 $w"p @ǔ &  $ & $ ( "`x@L@@ @ 㿘`(`D&`$ @@@4 / @2`L`  `@ @  &`( `0&`&`& 㿘  ` @ T 6 6 @  " @  @w@u  $ `@   ( x @  $  `@_ (" x?@Y ..㿘 $@3 < `4<@ &48`&8* 2   @ * 2``848$ w"p @ $  ( x 48&$: "4:*2  X`"  :$ @ 0 @" : "@u  " @$ 4 8ް` *$$@u $  @Ԕ? "" : (`x 4 :$ "[$ $2@   $$@ C$S@T6 2<$  @ $ $ 〢 2#@H * 2``48$  w"p @僔 $  ( x $48: 4: 4< $  J / @  /*@(`@ԒDO$@e T6?2 @_ (" x$C $* T62 :$ 22@s&  $ @h  ! ( x @ $$ x@$$$@ 2xP@? $ $$$   48$ 2`< (  x 㿘`@ ( E"`x $ (@>"x 8  9 27   "@w@2  $& $ T 6   J`/ $ @& w"p @ǔ @& @ 2 @6  㿈  $ 'H @   HH Y  ( x % S5 82 $ `  ?`  4 ''쀥 H2'@@z  (H 2 :x%  :x`@"5 :'  ' $ J?`/  $B  / *U 6 `'"'    2 `L` .2 `L` ?` ` `@` "% ( `@ '@ `@ː  % (x@.@@Ր 5 8 $ & $$xϰ   "   $  '@ "4 6$  ` $ $ ` ` : 4 :  4 8$ 4 8 6$  쀢" $ `  "  $ $  D $ #4 8 $    ($ @H D D$ @  4 8* 2  *`2  $ &```@Ր 2` $`@[耢 @c $   2--􀢠$H 29 U 6  x $ @     P@s?  5 8 $@W& $2 H  5 8@l@@ 5 8 $ & $ ( ?="`x @8 $``@`:    > 86 > X>> > > > (> 0> 8> @> H> Pf ``@= #! ( x@&` 2 &`$ xQ @  ( x&`  > X>> > > > > (> 0> 8> @> H> P:  < @ ((&`0 &`, N`D`.6`4N`E  ?`Dc  2`  `2``0"&@`R`6 6`,  @  @    㿘 ( *@$  2 $   "$ @$ $   "    @E  `"`" 㿘`$ H@k   @`$ ``6 <& & ( M ?& @@+ D㿘@s  㿘 a   "& @a&  ( ?"`x  @s&  2 &   "& @O&     D" "  2 D""  P66㿘   @v8   8 $ ,   @  ?@f ?`0@ (`,@ ( "`x ?@ 7 (x@U&x$  b|@㿘 @o㿘@w@}$OpenBSD: rand.c,v 1.6 1998/12/07 21:47:22 millert Exp $㿘q@bm `9 1 *$㿘" $ b|@㿐 '`v@'㿘 @? @f㿘  @fx $" b|@㿘` ` 2 `@_  ( "`x?`?` &``@ , :   @ * &@@|*㿘'L'P'T'X@8L$ b|@0123456789ABCDEFabcdefxdigitABCDEFGHIJKLMNOPQRSTUVWXYZupper space!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~punctABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ printabcdefghijklmnopqrstuvwxyzlowerABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~graph0123456789digit cntrl blankABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzalphaABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789alnumDELtilderight-curly-bracketright-bracevertical-lineleft-curly-bracketleft-bracegrave-accentlow-lineunderscorecircumflex-accentcircumflexright-square-bracketreverse-solidusbackslashleft-square-bracketcommercial-atquestion-markgreater-than-signequals-signless-than-signsemicoloncolonnineeightsevensixfivefourthreetwoonezerosolidusslashfull-stopperiodhyphen-minushyphencommaplus-signasteriskright-parenthesisleft-parenthesisapostropheampersandpercent-signdollar-signnumber-signquotation-markexclamation-markUSIS1RSIS2GSIS3FSIS4ESCSUBEMCANETBSYNNAKDC4DC3DC2DC1DLESISOcarriage-returnCRform-feedFFvertical-tabVTnewlineLFtabHTbackspaceBSalertBELACKENQEOTETXSTXSOHNUL(    " @ϐ@I!S 4x * @`*`@>$` $` $`@_j @$`$`$@$`$` И P` `H  " "  ! $ $ 4$ 8  !$ $ $ $ $ ($ ,$ 0$ <$ @@T$ D$ H@  `?$ @:   "@j  @z  @ `$ $@ \@ @ @ 4 (< DbE$ L$e& & & @ߒ ` "`@ `㿘   @J @:  J@ | 2@  @&J@ |!` & "@ h  "@ G  " @  "@ <   " @ z "@ .$㿘 @?ܑ* : ` X&#P* € @ @m   D`" D D  ,  " @  @J@ )} )  ,  H" @ J`)a&@: ]@ڔ   ( "( `, N"`,@̔  `( "`( 0 A"0@ =@ 8  `@P/ @ *@E& @ @  , &@:` @  @ @ , :`@ @  @?֐ , :  ? {Ր`  ` ` &@ , :  +"(  ? *"  , {J"@c "@D "@W "@8{"@J "@+n "@< "@  @_" "@  @V $@  N@r @J@ ,2`& `  !@\@@E @ @:  J@ }2 `&@ :J@ }"   @ &J  }  @ @ @  @  @?֐ , :  ? {`   ` @ `,Pp㿘 @ @ &@ *J㿘   @ J@ ^2 `&@  `( "`( , ", @-  @  ` :J@2J`` & @  `( "`( 0 "0 @B 㿘J@ ``\ & @ @2   a&a)xa{`." `[`*`0 a(&0 a}a9a1 ~a?Z0} `@Jy @ t@?p@ l  D`" D D  ,  " @ @ `  J@ \J` ) \K )  ,  H" @n @ ` J@ \ J` )`)&@ %,  H @M `@1@C @    "`H@ @ ~  @"J *  &"@; "@ "@/ "@w p n`$J \j`$J {f`$&@g @ J@ ,` & ` !@P @9 !@ @ ` : J@ \2  J` }2 `*&   : J` &` :J` \2J }2 @ @  `$  㿘  " @ ` `. J* ?а  `  ` . ` @ƒ [:<:]][:>:]]㿘@ǐ    ` @B  2&   `(@3  2 (@A  & @: J@ ^2`&  @:J@ ]2 `&@ ` ] *] ``] @:"J@ -2`&@ ` - *- ``-,` ` : J@ -2J` ]"@ @ :J@ ]逢@  @:J@ -2 `&@ ` - *- ``-,` J`]&@-   s ` ,`?,"` %@ `@  `"?@* :  @ `@* ` ,`?<@` @-- `?, @ `@" * * `" * ` ?,`  `" ` @ ` * * `?,`` @@  @@ߐ@20@P@^ 㿘 @ J@ - [    * @ 0*:  : ="40e   &@ J - ]@ @ @ @y  @  `  J@ :J` ]3`@f 0m   &@] J - ]@S @ @ @I  @ ` J@ = J` ]`?&@3 0:@ @ J@ -2` :J` ]"&J` -`& -@, *`: :`@@  @ ` * `@   .`㿘  "  @  &   ` `\"` @  @f 2` @J`2`@ǒ 0!L  @ `@* ` .`L `  `@@% L 㿘 =@L@ ` + `@.`㿘 @ @   ` :J@J@ [2 J@J` .2J@`$J@`$ .@ @ ` J@ . J` ]`$@Z . > 㿘 @  ` : L@2L` ] ` &` :J`2J ]2  `" `@@ 2`@J`"N``@   @ 0L@✆ (* : (H㿐 &  ]&///+& &㿘 ` `8b` ` ː* : ڒ0@o`   `4, "`4㿐 &  ^  ]&////& &㿘     .  `y"ؓ*` € $" r&  "@A`Ԕ  "@  @_" "@  @V $@  0M "@ "@  "@@"@  @7 $@ ` @Ґ 0% "@ "@0@~0@t0@ @t ""  " " 㿘   "    I `& 4 @ߒ   @ב,  @,  "`   @ʐ "`@  "` , `  :`@` @$ ` "  ``%@ @    -    < @ , @% $*,`,`$`$` `  (  @ (*@   *` 㿘   *`   7` 2. * @% @  @ ` @  @ @@`@ ` @ @ `@ @ @ "`@ *   &@>    `@ @" * :       `@ @2  㿘`@p`  @&`@ @#  ` "&` @&` ݒ 0 ?@&` ` ` *? ,8    ` "     ,8   `  "     㿘  '`8? @  Œ `4 &`4,@ @ 2  ʔ 2,@  $ @ $ @㿘  @c@ .` *  @/. @$ 㿘      `2`@:`*` @E @ *`"`& 㿘  ' ߐ ,   H.    @ "@ @  "@ ` ` "@@@* "@    (@> "@㿘   @8.` 2&  0& 㿘 &`  @'*` &`  &`㿘  w `  >1-+)'%#@ `:0`@ "3 / &`@" !`@""c>$""`@ * @@  2`(  `@$ &`@ 2@`@ $@  &`<&`@ &`(`@`>@ `@ `*`*  ! `>   4  2`("`(㿘<"e@& "4"E@&  $@H  " @B  " <@< < @6@4$$ b|@%x.0.%x%02x㿐!   #77c  @ڐ@C  ` @ @*`@2 @, %@’c c@`@,'L`  @ L 2  @@*L@6 c@@ cJ@ @ υ(85 ( @*@  `J@ @ H*@`*@ ,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,%8xH.%02x:%02x:%02x:%02x:%02x:%02x.%u㿈 ! +   *` *    *     @ #\ a#d#`#h@㷘`&`&&~@  & && ,` ( 2 :$2  2 `   \2 2   \? 2 :2  2` @0@㿐 {  }   @ " @’ { @㷘@ @`2@ 2  " [ {  ] 2  "   }`2 `   〢 [` @P&@L@ [ { ,`>` }`8``@ ] 2`@ "+ *`'``#`," ` 2   * 2` * 2`Z&``@(@& HOME㿘 ~6 (2.?  *@`@  /2*@N @ @" @?@8 "%  @75 2 *: 2`J@  @: 2* 2`2㷐'$@`a  `? *`]`?"D` `[`*C `M4J ``!"   [@ ] 2   [4`!8 6`[4`! `!4 `- `4`-  `] `4 4 `]` 4!&` 4!&` ` !&` ?"44 `4@- "@` 2 #"?@  `- `*`  #X@  㿘@C@㷐  #\#`@  (\`  : /6@ܔ " a "$  /;< 9@(@2 @۔ 2  2  @ /? 62@ `$ @4  2 `3@  /22#\  / 8  6 /  #d#h@#`㻐\`dhe 6' ($x@I 2  @$ Q?x€ J? "F 0DC @ /41 1)  .` ." @4 ` @ ? 6#\#`1 2  2J` @@0@㿘`@`` *  @e@` ` N?@=J&`  `` *`@,&`?$@&`  @ `"@: @@& @ "@@?` * $@`&@@` * $@` @   #@ (" x ?㿘@:a `?`]@ @``[`*@ @I@"D"K  "B   =  ,  * 2  @`! `?`2`@`* - ]@ @ 2`@( `" @`* @  ˰ @*@`?㿘 ` * ?? @@ ?@x?`@s & .㻘  @O$  0!7` @2` @@㻘@5$ ? @2$@B€㻘@$ ? @2(@:€    (*@ ` 2  㿐@b  '@ "P`2V @V   6  ?`" @饐 V  @ 6 􀦠" @ @Δ! # (`x?逢    @ @μ!`x@"  @  " 0@  0& & && & ` &  @@"& 0@ & 0 D & 4@& D`& H6 $`x&  @ @K @yyyy H`X6 6 & $& ,& (& &   @Ė $OpenBSD: setenv.c,v 1.4 2001/07/09 06:57:45 deraadt Exp $㿐N@ ="`@@ "w @*7@* ,`` i  ( p `  `Ȁ  `p@I*` *,`$p `"@*   ,`p@$p (`p" 'L% (L  =2 $@  p*`" (?`*`p* : , *`: ,   =2 =,@ *`,   @* ,``  㿐 ( p*`  "  "@ $ b|@$ b|@$+ b|@$/ b|@$ b|@$ b|@$OpenBSD: getrpcent.c,v 1.11 2001/09/15 13:51:00 deraadt Exp $㿘1 '"T  @¢$&"T㿘  @/ @W  @;㿘@ 0@M  @F    @4 2@r㿘  !h@sKb$@su $ 㿘  `   @ $㿘 "  2 !h@s b &# @qZ "  @V@  # 㿘l `Z @$ ,L` #c@t   .@@tc貒 2.@>$``N@` `N@ "` "`@nc$`$`@tk貒 "&$.@``"!$N@ @`*`:    $ @tQ貒 " $.@``"$N@ @$㿐`w@ ? ? ? @  gc" "" " `@ 2@&@ #  # .@@ :  *  . : .  . #ܒ#`% ` 4`4 `4 ` 4 4 4 @9 @] `*@ @-  @) 4@ 4` 4` 4` 4` 4` %d-%d-%d-%d-%d%x.%x.%x.%x.%x.%x%x:%x:%x:%x:%x:%x%x,%x,%x%3x%3o%3dxN -   cX#\@7#ch#\#`@#!#\#`c@!c@ @@!0aN  ӑ* : `K`"*` €   0,@  ,@L@  @`#+ 0#"##耢 L@ `" 4  @1 ,? @,@?@@P!MMMMMMMMMMMMdMdMMMMMMMMxMxMxMxMxMxMMMMMMMMMMMMMMMMMMlMMMMMMMMMxMxMxMxMxMxMMMMMMMMMMMMMMMMMMl㿘`&    @ `   @ᯐ$@Ց? /`4 / &/$  b|@$OpenBSD: fork.S,v 1.2 1996/08/19 08:18:06 tholo Exp $  b|@"` $ b|@$) b|@`@ 2@H@ #  # .@@ :  *  . : .  .  cc % , ,  ,  ,  ,  ,  ,  ,  ,   , , , @E @s `*@ @9  @5  ,@ ,` ,` ,` ,` ,` ,` ,` ,` ,` ,` ,` %d-%d-%d-%d-%d%x.%x.%x.%x.%x.%x%x:%x:%x:%x:%x:%x%x,%x,%x%3x%3o%3dxN -   c0#\@%7#c@#\#`@#!#\#`cX@!cp@ @@!0aN  ӑ* : `K`"*` €   0,@  ,@L@  @`#+ 0#"##耢 L@ `" 4  @; ,? @,@?@@P!UdU\U\UdUdUdUdUdUdUdUdU<U<U\U\U\U\U\U\U\UPUPUPUPUPUPU\UXU\U\U\U\U\U\U\U\U\U\U\U\U\U\U\UDU\U\U\U\U\U\U\U\UPUPUPUPUPUPU\UXU\U\U\U\U\U\U\U\U\U\U\U\U\U\U\UD㿘`&    @Ȓ `   @߹$@ӛ? /`4 / &/ @ 7'''L'P'T@'X`x'''''@L     @ `" `  % ?& &   4@  2@ @ `2 @2   @ xe`!<,  €  4@ 2B @A` ?& & ޤ@ l2ڤ`פ,* Ѧ? Р > # 8 3##/ - @@& @# #   2@w2s"? ` Р    @@ ـ@  ? & &@o 2ɰ @ `2  8B@!(,  €"   @@M& @$`%@$& &@ @ٖ "?/ J #  ?& &   4 @  "n0 L`  ?& &  a@  4 @ @J@0 L`  ?&  ,@&`@"=,@"?  @ ` ?&  &  4@ " @ ` ?&  ,@& `  4@ "$@v,@8!H ?Հ`MB#*` €` ""  "-`R  "-`R `` %   @  ,@ `? &  &@M 2 @( @  x X@s$@,@   x: p2l"8!1 ?Հ`:+#*` € "   $ !,@ `? &  &@ 2 @(7 @@@. @ e E@ @@$@,@@̒ 2":"$@ "?0ab aab a|a|a|a|a|a|a|a|a|a|b b b b b b b b b b b ab b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b a_``_````_t_________``````````````______``````````````````````````````````_````````````````______``````````````````````````````````_\\^_$a,[0[8[8[8[8[8[8[8[8[8[8[8[8[8[8[8[8[8[8[8[8[8[8[8[8[8[8[8[8[8[8[8[8[8[8[8[8Y[8[8[8[8Z[8[8[8[8[8ZHZHZHZHZHZHZHZHZHZH[8[8[8[8[8[8[8[8[8[8[PZ[8Z[8[8[8[8Z[8[8Zt[8[8[8[8[8[8[8[8Z[8[8Z[8[8[8[8[8[8[8Z[TZZZZ$Z`[8[8Z,[8ZZxZZ@[8Z[8Z[8[8Z @^` @ `  ( 6( " * @- `]** @]6` -* @ 㿘@뾒 2 * $@ % &&@@联@@A&$@ @8@p"@&&㿘;'Db'H  `-+L  L0 L x XL )0  ) #?)  >` Ɩ   $ `%E    7 (G "T @ 4?@  @  ?1  *&x.<@  b 41@ @  1?#? &x<@ B   b     H  DH"@㿘/✺  `-+M  M0 M x XM 0  >?? ?@聒?   ( 5 ! (@ @   ( ""`x?? ?<@ B   ✐    Ӧ ̦ ``` '@㿘 0 @2 4@H$ $& 0& 4c  @,@< @& ,@v  @@& 4&& 0 ?㿘?, '"P`2` @d` 2`0  " ` @ E?` &` ?6` &``  6` `0  ``4@& @ "@-?&@*` %&`` ` ?߀6` @@ (` 2 `` &`&@``@@ `B &`&`<&`8&`0&`4&@.`B x@Ecؔ  '''''' '@耢  ?RAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedadoscd9660lfsmsdosffs/etc/disktabb0b1tyremovablesimulatedsfsentnsncdtscsurmilskcshstsbssbpxbxfxoxtxdxa  ''@#  @c!''T?X'`'d'hl'   * ` *J`|`:2 *@@Ē@  @ޒaЀ 2X    @Ғa 2X $X@ : X $XĒ@?"Ē@$(Ē@$0"@$,$4Ē@` @` 4Ē@m?  4Ē @cT?20@e,$8(@VX?24@X8$<Ē0@I?. 4H8@?? 4JĒ@@5?  4LH@+? `4NĒP@!\? $PX@`? $TĒ`@ d?$h@h?p‖"x$"  `p/7"x  a7/ '/7 `/7" `7/ʠ /////@̔?8$$@”||$ @x? x $ Ē@t 2 t@ , , pĒ@?    , @~ @3, `*`:  p  .  : ?4  \7/ 0Ĕ/@w? l`*`$:  4   aW$@$㿘@  @@dP "&@`@ 2@b ` > @b 㿘 1 ! " @_ &!"! @䴐! `@,$! ` "! !"! @ ?J:   JJ2JJ@:  :2J0 2J J@ 㿈#\?@ %s.dbtc㷀'X'D'H` 'T?X  # a @T ! !@ǐ$ !a@㘔!' dȦ`@Ḑ$ }      @M A'$@#x#/!`+   @F #T@C ` @@ᬐ@@ D@R @ H"D"" @ h '`9 (.M@  `(;,L \27, , %$@ጒ $@i耢  @ؐ ' x?@*M@@$ 4̨耢 @ ̶? , L " #"T@ 2ݦ\  @> 2Ԧ ` P` @ `??x  ?L: ,?#\$ ? 耣 @n@0" ?2 :,??L %L  : $ " ''L?`: :, '"@ #@%$@$&@ '@࿐耢 @.@ැ3 (@$ @@@࣐?^ = X耣 $@ $H"@ਐ 2 (@ ( ""`x@|?0D#@ 㿈@''`?''  ? J ? ?  &@J `?  JJ|:? ?J:|?  㿘@@㿘1 ! " @&!   "!"a" r|:㷈 !`$a a   a@dc` r$% `   ᤐ "P @c ᤀ`` @W@ a$ᤐ`$a`  0@cc` $0C*? "!"  `   *:  : #!  J?`\2#! #!J?`\2" "9,@ $LJ  : \2$@"%@ 'h?0; @2 ޢ@ @cA ᤀ` ` @@ $ᤐ*?ch@'@, #\?N    -㿘 = ?@ d 2N? dmS*2Q* N :s "q*А  ?  *`* Б: @  N/7$*`*1* : `2$ !*` € * ? *? *? *? *? * ? :*???*?  2N"@`d 2  ,?@ѐ(? dN :  ^ \ N`:`2 *" @ϐ 2  ?@ެ?&㿘/ = ;?@C d 2L4? d  `"@@t d 2 `"?@Q?@ dL : 2*@*@`"@@Y 2 `?@6?&㿘 # 2N@2? 0  `N@ x X `    @`@А *`: ?А *`: ? *`: ?& 㿘N@ :`N@ :2``@.`.`$OpenBSD: strcspn.c,v 1.2 1996/08/19 08:34:15 tholo Exp $   (8 J2J " $| b|@㿘  @ $9 b|@$OpenBSD: random.c,v 1.9 2000/04/04 14:27:00 millert Exp $㿐"`"O"@""@Ġ - #)|b,  ##@@l+ @ +` *`" *" *  ** " b"@ "@   Ġ b"ȗ*` *  *""  "b@ đ*` * /dev/arandom㿐b   "ģ*`" @& ? "@ռ @Փ@ @  z?@Ղ0  "*` """㿘"b  """@ :`*`  "C ""Ȕ $"#"bĀ?        """ $"  ? $""b#"Ĕ `* "b̐ $b"b "?"b"@ :`*`  "㿘 @W @mb " """@ :`*`  "`4. `,`"  b @  """    $bȕ( "@* @""* @"̰㿘"`"q@!bm `9  * $! b@ ""̐ 2` bb   #bb  #b"#b$OpenBSD: ldiv.c,v 1.2 1996/08/19 08:33:35 tholo Exp $㿐@@'@ ' "`?$$  /bin/shsh-c㿈'HN@ r'D w (HJ`  ( "`xl @۷ 'e @" @Ұ 0\@1?  H܀  %!`7@L &l 쀢  e  % !L@%@`?U @ب @"'K'ఠ@X쀢  ఐ %!`@]@ @2  @؇% "@''  " aQ '!   @ ' #@Ք"'@ ''䀥 "  ? 쀧 3 '"` !d%@` "   @ఀ @2 @  @l^@"%''"`  @ (" |  ("`| 㿘@l+! '"` ` "`@QQ?"`@(   @  @  @l abf㻈 '"` ` `@Q,?`@` (?      ( /"|"x  ( "`|   " " @| . @2ʐ 2 " ` C/N? ."> !T@U ! !P!@~``  !#$"`''& ` & #`@ (" | " `.2 J 2 J . "  `D`@|0 : 2NN :2CN &N? .; !T@U ! !P!@~  !#$" ''`&  #`&  (# |^  "  `D`2 *:  : . J 2 J .  (  @ځ O  ap@VI   1 L f"  y b 2`2@ @1$  @`2L Հ f%u.%u.%u.%u.in-addr.arpa%x.%x.ip6.int㷈!@jؤ '"` `@O? @א)`&    ?#@"           (?   ( /  (? ( "|"x@j - (,  a  @j- (! +1 2b@j "" , ,  ,  ,  ,  ,  , , @٢ O耢  ap@Uj   Q - M f"= y b ;`29`26`@1  @/ɘ$ '/   !T& & @f%%"`  @L  & &  (" |@*`` M  f@i/etc/hostsr㿘!!T !@W{a$!T@W"!X㿘!!T !X`@ $!T 㿈!T` + (!@WWa %!T ?!T@V  %`| J?` 2'#!T! !P@ϐ, N #ߐ@zF # 2, @XÒbx  !T, @S   @S  '"h @ '  '  `   !T T"  """ "L) '  L "  " Ē "`&  @Xzx &"`,  !L  `*`:    @$@`@X`x  "`,  "`L  "`   $@P$'' @f%`| 㿘 '"h @   @ 㿘  0 @T;   "   @T' 2 㿘  " "      @  㿘  ``Ė   " " "  #`   " / a @W֒bx Z ,%@R7 L  L "  " b@W  `L " , `  %`@  !L@$@`ð $`L   !L*`:    @$@`@Wx  `,  `L  ` `$@% %u.%u.%u.%uhosts.byaddr㿀   `  @S 2 *   ` @hc'  @є #`$@@i1䀢  H  ( "`|hosts.byname㿐@ΐ     `  @Sq % ! %  @[ #a@ӱ$@h   ( "`|㿐@   .@?` .@`.@`@ 㿘  , (   & &    @ &@ $&@" &@@$@ `&@?&`2@㿘P  @ '  'Ȗ`~ /   d .@2` 2 ?(R& `@  `.. V?V 6?6@?`&@&`@ 鶇$OpenBSD: bcmp.c,v 1.4 1996/08/19 08:33:57 tholo Exp $2J  J@ `2J 㿘 (  ( "`x?6?@; @2 P (    ? 2 0    : @  0f  < :@ f  "  :@ F㿘 $OpenBSD: strsignal.c,v 1.2 1996/08/19 08:34:25 tholo Exp $㿘 @5ah$OpenBSD: __strsignal.c,v 1.6 2001/06/27 00:58:56 lebel Exp $㿘 "l@ϒ  0?,@  @’  0,libcUnknown signal: 㿘#@v3 А".   @uϐ@y 0?㠔 @uÐ @y@3 "@y@u$OpenBSD: strcoll.c,v 1.2 1996/08/19 08:34:13 tholo Exp $㿘@ 0? (?#$OpenBSD: atol.c,v 1.2 1996/08/19 08:33:26 tholo Exp $㿘 @Un 㿘`^@  $ b|@$ b|@I @ Jg" 8o-"H XJ+"FG* ?`C*  u2?*  !00  `  `+ *`+ *`` *``*`*`"   *"* 2 㿐L V?'@ @ -@2  @ @֐ 8 ? "  `8` @Tǔ  ,02+L*  ` 2 А L   @ 0 2 0-3  =@'/@λ  L g  o a *`:  u*` : -)$8 :  + - =ڐ`=*` =  ?* : ` u *` €$ ?" ?"" II -@} &`0 ? ?@ -3 =`@ =` ="  +` -@X ݐ& ? ?@ -3  X@  -@@ Ő& ? ?@ -L3 @{=`G =` =!``=` ="  -@ & ? ?@ -=`3 @V`" -@  &`# @ߐ ? ?@ -3  X@6AL  ,**` .@vTTTTTTTTTTTTTTTTTTTTTTTɜɤT`g"*`o`= -`X`+`-0?0<`u07*2 -2   +* )2  &2 *2 <c* 2  * 2 +-  =  *   - +  X2`2 `: J@+-X2@   `J@-+`8  X`8  `( 2 **   2 **  "J@2 ** ʐ $< b|@㿘'H'L'P'T'X @H$OpenBSD: authunix_prot.c,v 1.4 2001/09/15 13:51:00 deraadt Exp $㿘@xϒ `@z @xl` @xg`  ,`b` @     $OpenBSD: xdr_array.c,v 1.4 2001/09/15 13:51:01 deraadt Exp $xdr_array: out of memory 㿘@@xZ ' @ 28 @i @   % @W  &@ @` @Ό  @ @ @^@&@㿘 :     @ $OpenBSD: ffs.S,v 1.2 1996/08/19 08:17:58 tholo Exp $ "2 J "2 J   "2 J  J x   ?''D'''   @Ű      @ˠܮ   @Ş ܚq  h   2c  ^ T`  T ` ?@` ` L`D/ 2 ` @>  : `   * @"   ?     + "    ? 2@`2@@+ * @ ,`D "@=0ɐ"* @ @2? @Hܢ @    2  1 2  ) T %` %` @̾ \ . %`  T@̴ T   ?@`` ?%` @̤ D`%@ h`Df / 2 ` @8"Y  T`` %`` %`%`  *  @"   ?    .  @"'   ? "%` "%`" %`  @̲@@A@Ց.%@ܨ *a @䀥@ D%@""@u 㿘@o$ b|@$S b|@%s: 㿘`8 b0@f`@@\b8@ϐ㿘@@ @}. @offonsecurelocalrtsctssoftcarmdmbufwindow㿘 c\  @o 1 "c\@Lm Ȁ N@q> c\c\`? "`@X @  "@ ဢ0" @ ` " L   `2 L "Π" #"ˠ"  bx"bx  @*X$`L $`$`@ɐ$`L $` @"x"` "`L M#X '@%     ` ?|$` b@     `  j$` b@     `  X$` b@~     `  F$` b@~ݔ     `  4$` c@~˔     `  "$` c@~     `  $` c@~  M#XL  =2 M#X@n$`@%L pM#X #" L #2 "x L "  " "x& L "& @p: 2,J A "62 J\2 J ""  *@'`# *X&*  2 *X* J "   "   J "  "  " 0 Jŀ"*㿘@o =   /etc/ttysr㿘1 #\   @L`耠&#\@ @L 㿘1 #\  @58&#\@ $OpenBSD: rindex.c,v 1.2 1996/08/19 08:34:08 tholo Exp $*`:` J " 㿘 @  @$@ 㿘  c`!@^Ӗ  !  (" x /dev//var/run/dev.db@̒h  @ʢ  (P x< @ H D " ∖.@ .` ".`  .`  .` .` @} '  ?PP 'T'X'\7P X` 2 d` @ "@ɡ` @  @@8@v*" & (+ x@w' "@w|# `@ @u@Ғ  @@`@@wѐ 2@wZ BLOCKSIZEGKM%s: unknown blocksizemaximum blocksize is %dG%s: minimum blocksize is 512%ld%s-blocks㿐@ !_ L [@MP Q" J``MJ  1`M*`k`G`K`(#!(!(`m`g!(!(! !!% $! $!!(@"% @!@@v @ ! !`@j`""!  h@-  &&  &&@ h$8 b|@?ch?# @  @ Ժ ?@ ?# @!?4#a/?#?  ?# !?$#?#?  ?# ! ?# ?#? ?#  ̀??#`  ?`?``?# ! ?#?  ?#  ?Q#M??#?   ?# ! 2 ?7@! 2?#?  ?c@  ̀@2 ?"@ ̀@?#?  ?c@ ! @" @! @2 #? G #?   ?# !  ?8 @! 2?#?  ?c@  ̀@ ?$ @ ̀@?#?  ?c@ ! @"  ` @! @2` @   ?#?    ?# ! ?#?  ?#  ?Q#M??#?   ?# ! 2 ?7@! 2?#?  ?c@  ̀@2 ?"@ ̀@?#?  ?c@ ! @" @! @2 #? G #?   ?# !  ?8 @! 2?#?  ?c@  ̀@ ?$ @ ̀@?#?  ?c@ ! @"   @! @2    ?#Ԑ#  @ ?`?D '#\   @J2@   (z? " x@ d? M J J`, , 4 $   @ J 2, ;`@ :E4&@ @? ?`)` ` % _ J _"@w̐ 2 `?$  ` , `4  ` ,  "J 2L Т`  8 & @` `?@Ħ0#@ސSF ӄF @   "  ?b!?#Ȣ@ 4 @% 4    n ΐ i#h ?@ϐ &?`0@7`.`    #\   @w??@% J `  @ 0:*` *   ?#Ȓ 0   @ `( ( @ @R  @   @@?#\  @??@ ,`4`$`` @  `J 2,``e0P %L@?`C@ "?L "; @v " L _2  @v 2!` $` ``"   ``  ,` ,` 2  ? ,`4`  ,`` @ "L ̐  8 "   @0" @w0@ű㿘 ?  , @€? 㿘 @U ?@ɐ㿐#\#`  @z  㿘`? "`@  "@@ %u㿘 ?*`  * `N  2! # a @  $a@ 2$` 1 !@ 0 @l  㿘 ?*`  * aN  2! # b @  $b@ 2$` 1 "@ 0 @l  㿘 aԔ  @YB! b'  @Y:!@Y1! !Ѐ`@     @  @Ya㿘@Y!@    @ a䀢@@Y!  㿘 aԔ  @X! b'  @X!Β㿘  "7 (x'  `x&x㿘@Xː!@J    @ a䀢@j@X!  㿘 aԔ  @X! b'  @X!Β㿘  "7 (x'  `x&x/etc/groupr㿘1 !Ѐ "@FE1 ! `"!@ &!  #x@F c&!а@ 㿘@ 㿘!@X]!   "! @XT!㿘! !Ѐ  @p# a $!Ѐ`"!@Ő $a㿘!!@X8@X6group.byname%ugroup.bygid: `  # ) !耢 p !` !@Cΐ `%!@ !耢  4V'# a쀣`aИ#`% #\ !`Ș@Y̚ؠ@ua쀤 $a$a$,! `Ȗ@ Ѐ @\%!!耥` !#`@ï@XР@H%!耤  @C!Ԓ@ @;%!', !Р@C$ 2' @hW 2L!{!`? "`@q @  "@ k0 +L :h  d@C  x !  S%!! !@C$ K!耦 #!`@C`@W!!@3 @XzР 2*!Ԓ@Ƙ@!̠ ,'̒@ L&@ H&@ D "!耦@G ȔJ@ !耢@ P&N&@B `@ %̀  " @s ! %!@k  ̠ @ `  &" @sl 2! @ &@  "!@GS Ȁ@J@ 2!耢8!耦 &̀!̀  c@%& J ,  *"@`    ""@*"@ `" ̀@  '"@ 㿘N  @  " @j $" ""$ @  㿘" " @r 2   2 㿘"` @@`@ 2@$㿘%  bX "!  `(L ` ?@) @Ř"@!  @"  L ` ?@ @ŀ" @   @"  ` " "  ""  L ` ?@ @^" @  @"   L ` ?@א @F" @  @"  L ` ?@ @." @  "  b@  $# $"T: 㿐N@ ' +J@` :'J@ 2`bp'@ &@ & @  ] @FUJ 2 N& @  H @EAJ 2} : :& @ & @  . @DӐ'J 2c #@4^ ' @$Z & @ p  @D J 2H @4E @4 & $@  & & & $bp@ Q& @ M& @ Ia (& !`"  2&  T   & T  &   2&   2&  `2&  master.passwd.bynamepasswd.byname` "4`@ 1b? @2%""  bD æ  "L` "L@@i D$DD y   !  "G! bH , @- "!x!ؘ#`% #\ "LbH@VP@/bH  $bH $D@%'! $bHh$P@"L !x’! bHP@ ˚؀ TJ$D@̀ @ $D ""J "@"L !x!@G@U؀ #*! b  @"L "!x!"@+ܚ@Ur"@$D  &"܀ "Q"@M"! @Ã"X@' ذb "X*@` ;"0a 8 2`/8"8@j  ''@Ȑ N" I1 " J + -J  @"     "bD  "bD@0 "D@g "b"2)" J  @@԰ ̀` J@ 7 @Ҕ @["*""  __YP!+XÒb  1''Ò/"@ 1 "4 ''   "4 ؟   㿈@% @" ? ) `!)`2#$ "L` "L@? "L$%!"L’ax@耢 2 $@  $%!$ %!$  ` "4`@ A    ""8?7 9" J`+`-"J b # bLbL @> 8" J   @" _"H! "H @$"HbL !x¢!@! "H@T4"P _ "H`@ %"H2b @ ̒@Ĭ @|?8 " J  M"L !x!# @"H@SbP "2! "H "%"H@J%"H`@C %"Hb L %'Ȁ !x!# @"H@S՚bP  ! "H "O%"H@"K%"H"X"H@bPbP,̐b < b $05` `@@H ̢ Ā` J@ ؐ @s @b ː b @nݒ b < 4 @&4J'!S 8 %88 8 2/А В@  ''@ ! < 4 @&4ư %'! 1/@ `  В@w`''@Ր "<` 4 @&4  "  %umaster.passwd.byuidpasswd.byuid` "4`@ B 7 Œah@R6  "b8? 7 9" J`+`-b  # bLbL @=\ 8o" J   @" _"H! "H @=$"H"bL !pŢ!@! "H@RӚ"P _ "H`@ %"H2b @Z ̒@Ĭ @?8 " J  "L !x!# @U"H@RbP "2! "H "%"H@%"H`@ %"Hb L 'Ȁ !x!# @-"H@RtbP  ! "H "N%"H@J%"H"X"H@bPbP,kb ;b %04J ` `@@ ̢ Ā` J@ v @ @b  i b  < b4 @&b4D'!T 8 %88 8 2/ @8  ''@ ! < b4 @&b4f  '! 3/'@  ''@z "<` b4 @&b4  "  㿘! "H   "b<""8"D@( 5$"H"! 㿘 㿘! "4 ""8@ $"4! "H `""D@  $"H"!/etc/pwd.db/etc/spwd.db%s: %m㿘 ?"b@a"D #ư#   @op   "b4 ! "  ƒc@A.  $" 㿐 b4  v  ! @a"@" 2 $"" "$"@$"_ " "" '  @* .``  "  @* .`` ! "@b ` @] ` @X $ ` @* .``  "  @* .``  "  @* .``  " @* .``  b0@/ `$@@@@%   $@ $OpenBSD: getnetgrent.c,v 1.10 2000/12/09 23:04:16 deraadt Exp $㿘@ 2 b @! & & @  P &b @ 㿘  @2 *@6&  2 & @&b @  * "  & 㿘`  @ .`@ @` @*@@㿘  @: ,`@@k֒ 2 `@* 㿘L@ @"@ L@ @ `2` "`"L@ @K   ` 2  L" L    `2  " *: #&   `&@a b @n @/@* & 㿘@K  2b @X `$ ,  ,   )    "@P @J@H netgroup: db getnetgroupnetgroup.byusernetgroup.byhost㿀) "X / @ @ ,@Ґ"X''  ?0@@b耢 &b @ & @"@ 2" 310 0"""@G@O䀢   netgroup: Syntax error `%s'㿘J`"V #%J`#N  `&J` ` " `2 "(2< &@`0.?, &J  b@ `  # @h &@ @v @7@  *L 2 netgroup: Cycle in group `%s'㿈  @hɐ!@03<+ 1 *'5|  ? @>0 4"` &4Ē㿘  ` `@j  `  @j      @j   㿈  @ɐ!@EY ђ 1 M ' " ?:( @Ұ 01 "@  "@  @@  Ð@ 0@ %s.%s㿘@s b @  !(N "`N@ "@(%s,%s,%s)㿘ʔ!ʖ! ʘ!Ȁ`ʚ!@z㿐` @" @ @E   ,㿘ؖ   і  ǖ    $ @t7"NN? ,2 N`@]9⨀  @  @L 逦@ 㿘"0!`$"4% "4 $b0@ "4  ""4@"4  @@"4b0 $"4X  @$X/etc/netgroup.db+㿐"0`'! "X  ː    @k4 $"X"X  ˒` n 1 @7͐0@@` b @{ "4$0 4  4"@4"4 "4 㿐! "X'  'ː    @j $"X"X @7 ` " 1 @7 `@H`  `  3`  2  2 @_  㿘'L'P'T'X@L%s: : %s 㿘 ( x` 8˒cx@` @˒c@!ˠ#@Q@@q㿘'H'L'P'T'X@ H%s: : %s 㿘 ( x` 8̒`8@  @e̒`@@֐!̠ H@Q@Β㿘'H'L'P'T'X@H%s: 㿘`8 ̒`@ @9̐@a$ b|@$ b|@$OpenBSD: strsep.c,v 1.3 1997/08/20 04:28:14 millert Exp $  J H 2* #2HJ$OpenBSD: yp_first.c,v 1.5 1996/12/03 08:20:03 deraadt Exp $yp_first: clnt_callX  N "q @ @ `"j N@ "f @ @('_ &'@&Đ@M0 S !,  ?''?'?'' ` +#\ ͦ  ؟#    `@OpbĐ?"`h@bఒ !`@& & @*@`@'@ ' @@@*@@_`@NEā$OpenBSD: xdr_ypreq_nokey.c,v 1.3 1996/08/19 08:35:03 tholo Exp $㿘@^ @^` $OpenBSD: radixsort.c,v 1.3 1996/08/19 08:33:44 tholo Exp $㾘    +@  ( 4 * $*        ("`x?@H  㾘2  `* @ `* ``4  * ``$*     ( "`x?` @  @.`  ?@Ӗ @- ?"@@ & &   8#?c#"?#") ? `   @? "`+` /!  $"d"`   *    "@d&$"d`  `*b`*` *   f?  "` *  $?c@@"c b`"db`* ` ! "`` "  & &&  "*  $"`%$$@ ` ` #@#`#`"`" *@  #@ * *  ?# V??"@@ & &  ͦ ?8c#?#"?c) @"@?    @? "h! `1* ? $"lh  *`    "@l@&$"lbh #bh?:h*` *   r?`  "h?* $  %"h?c@@ "ch""l h* h`" ! ?#"h`h "` @& & &  *`""# $"h@%$$@ ` ` #@#` #`?#@? ??c   *@ #@ ?"? I?㿘`.  %? @ @ @`@@"`@  &&?? 8 `ք 㿘 &`Ȣ @@7 ` `Ȁ @/etc/protocolsr㿘! 0 ϐ"@5Ab$ 0@5k &`Ȑ"`ȁ㿘! 0 " &@v$ 0 &" ȁ 㿐`0   ϐ"@5b؀ % 0 0@4ƒ y J?` 2'# 0! "p@, L@ #@X # 2,   "t@6c` Ҥ, LL "  " @6z`  ,@`@6" 0J  0# 0 ""t"`"``!L  *`:    $@6G` " $,  "$L  $"t$OpenBSD: killpg.c,v 1.3 1997/07/25 20:29:58 mickey Exp $㿘 @!  ( "`x?" ( $OpenBSD: creat.c,v 1.3 1997/07/25 20:29:57 mickey Exp $㿘.`2@C&E`EXEHE@E(EEDDDDDDDDxDhDPD8D(DDCCCCCCChCPC8C CUser defined signal 2User defined signal 1Information requestWindow size changesProfiling timer expiredVirtual timer expiredFilesize limit exceededCputime limit exceededI/O possibleStopped (tty output)Stopped (tty input)Child exitedContinuedSuspendedSuspended (signal)Urgent I/O conditionTerminatedAlarm clockBroken pipeBad system callSegmentation faultBus errorKilledFloating point exceptionEMT trapAbort trapTrace/BPT trapIllegal instructionQuitInterruptHangupSignal 0$OpenBSD: clnt_udp.c,v 1.17 2001/09/15 13:51:00 deraadt Exp $clntudp_create: out of memory X\@J   `` ? `d@@@ ``ђa@}t  (`x & "h"`$ X @C `2@Qǖ *` V 6 ! $$$   $  ?$  $ $  8$ $ \$ T$ $ (@$ $ ''''' X@P- @O +  <`€$ P 6$  '  @R    ' ( x & `"`"@Pϒ  b~@$ @N$ $ @ @ 㿈`'' #\b'D ('H? \'L'P'T'X'D`@'T'P$'P('T`!ؐ` 2 * @ U@Ȓ  '$$$ $$$$H'|'x8'@$8`€PX@3€ D € PL€ 2  @w $, `€'<'HH X@7q<H   ( x$0@\ $, P  (T F (  X'7 (' T''' @1p?/b@!b?'8 2`* `*  $ 8  @Q  ?% X`x '` | 'd?``d'xP '|TH @ $, x Mh@ hp"@l'`t"`'d@?`x`@|'Xd@'\@?XX\'xP '|T& @Ґ $,r ȠL ) ( \'L@  x "x #"$0@$,Q (uX`@ 2o @N @M .@Nc,, DD `€   $,$0  %@Mu D@  @  D'D @M''$,",@_, ,"@0"`4"`㿘  " 8 8@% ӄ0("$"($"(""" "  "" """   NNNNN㿘   " <@ < `@ 8@@0H(@PPPPPPtcpudp㿐N '@3   J   8  ????' $ $ $ $ $ $ $ `?"V  2y? 2u? 2q? 2m??g? "   "\?$$  $ $ $ $ $ $$ !#쀢`# 2`"    ".? ꀢ    2/' ' ' ' ' ' ' '   $ @ $$ $ $ $ $ $ $ '  ' ' ' ' ' ' 쀢`n'$$ $ $ $ $ $ $  U"   O2N @ "   D`2A @ "   7`24  2 $   2  2$   2$ @`@` `" `` `   m 2l?g? V$$ $ $ $ $ $ $  =  5 22  @ "   (`2$   2 2$   2$ @.`` `` `     2 `?&   "&@*&fbf㿐@  q  '"h`@&? Ւc@,  ( @ O Ւc@,x `+ J@ &`J@ f" y b  2 @  @N@b  `J@ ဢ f`@B `  &  ( |` ֐!*` €???`@*{YlYdY\YlYdx& ' @Mx   ( x`1 @@ 2) @J  "$  " ``@  $  @ $  ?@  & @*3h&'ؐ@̒ 2= @  6 @*ܔ & @`2"?@ $?@   ` `  & @)㿘@ 2B @  2 ; @Q %  ,@TZ $%?@ѐ!?,@   2 @?&`2@㿘  @@~  &`?@@. 㿘`@p &  $  $ $  $  $   $ `$  @$ `  *`@$  $ *  ` `@"0 㿘@ 㿘`"E    2?         3?1?/?  "(?@(?c ?     Ԓ @+ ߀ 2     2  2         㿐N ?`@? ?@?@  ?@/Y "@/ؔ J@ ?gethostby*.getanswer: asked for "%s %s %s", got type "%s"?cH'D  'L????؀  D0M2L D? c  ?D# 5`  ( 8"`|D@( |€  ( %"`|@@  ( "`|&'L ?#" ?@?D@ Bb|@ "=@@ * 2 `@ * `4 @ * 2 ` @ ?2&D@Ę$ |€ " @@ 4?@>&? _@耢 (Z@@ @@ؒL@/] %H@]@)  aX %@/K6@20@?2*@?# 2  @6 & ' ' ' ' ' ' ''  ' @(? %@ ?     2 @ ??"  @D?#  L (Δ ("`|  ("| 8`  ????'???'???耢 L H $ ''''' '?' $''̢ ' 'Ȑ  $?'̢ 'Ȑ@g ! TĀ   $ `    > 2$ /etc/hostsr㿘!! ِ#@+c$!@+=㿘!! @l$!# ?cp!`ِ#@*c %a| c@& ?#@a@)% "o L #?ڒ`@,u ڨ ,@,m` ?,  L  *`:    "@,S  , @(]  ? ?L  ?#` `` '`'`'`'`''''ؐ Җ ? #@$@` ?  2@?#x  ????M  $ ` ` \  IP  ? ???+ڒ @M\ `*@ `@+ؐ 2*@_] `J@*:    "  @+` " `*@``"`J@  @` `'` '`'`'`'` '''E 2' @&@`+  2@   $` `  hosts.bynameipnodes.bynameP #  #?`??? @'  _  #`#@ ` %# 1%!۠ @@=- !%` @'` '`'`'`'`#?8'   $` ` @@=# 2#   $`` 㻈 '"` `   @ ` (" |\?`=?#`$ $`` ` ` #d#\@ #`  `  $@ 3@v   2   2   &`@`2` `ܐ `-` € (   (  (  ( "`|? ( "`|p,p8p pp8p8㿘 '"`  ``   @ h ( (" | ( ( "x"`|N    J .Jd?`2J J .`?  b`@  b`Rgad2  ? @c 4[|  b` `  ' 87b` b1 'b ,b@@C 4;x =4| "   "  2     2 `"" `@  "@ @   $| `? $|?%s.%s㻐 '"h` @` (" |2?`@k$  ?N .2@M @W@T $ ( "`| ?@$㻈 ' ? &b``  @~ (" |H?$#d#` #\  @  b`  $@<  ( ("`|@ 6 ( "`| ` `ݐ!*` € (   (  (  ( "`|?upu|uduXu|u|㿘 '"`  `   @ ( (" | ( ( "x"`|N    J .Jd?`2J J .`? b`@ dqb`ad2  ? @j 4a|  b` `  ' ;:b` b4 'b /b@@G 4>`x =7| "   "  2     2 `"" `@  "@ @   $| `? $|?%.*s.%.*s㷐 '"h` @m` (" |'?`@?"N .2h@w ,@ `h$@9f$HOSTALIASESr㻐 '"h 2x @!X@ 2p lސ@&ah "g @d YJ?` '#N@, O "@ ` 2 L@`L@  @@ `"`L@ 4 ,@@$  )"` @ `2`!`L` `  1 "J  @ `"#*$@Kݐ@g0 @%ޒ @g H '"` `` d@` (" |?`  @!@E` "`2@4@@ *` * $@ >*` a ?$@?'D'?Z?2X?? Ժ@ ˑ. $ 2 @.2  @  ;4` 8?@  @  @ @  @ 4`  ` .` ,` @Ց2 .`@ё2 `@Ґ /`2 @ʒ```@N4`&㿘& @%?.@ @ ). @2  . . '"h    @ @ `   &6`  㿘.`  .2 .   ,,`6 @2 @6 , 4 @ @6` ,`6 㿘@~%?' )!$0@@ #c4    2"@~2c 0$0  @~2c$$0  2 ! 4#(!  2c& 5 3- 7 14#(#( @*  `@~#$0@ c4 $0` ߨ"p ,,`2   , @4*  2` , 2  @` ,2`x 6* 6b@~4" @4 ` ? &,6"㿘!  @~#4b!/  #4#, ! t! #0 @~.$#0#0b 2 @/@ $#0a -   #&c()`# @S@1!?4# ` b #$ *@ 5b c" . 6  h l '`*@ @ &* 㿘  8 Q '"` L ?# ߐ @ @2  @2      ) @|  "$   0 # 'b` ?c 2 `"  @2  㻐 )@e$ @?@ * `4 @* 2  ` @!   ܤ 㻐  & $?  @.$ @@ؐ* `4 @Ӑ* 2  ` ` '"` 'H'Ԁ`'D@,?"I?"` `'H" 'Ĕ`  <''̀  !'Ȑ`  @  ' @  `   @? ` *"h`"  DHh`"*` €   )4?`hĀ"`"X`'Ȥ  !"``"d @ "%bX @   @B$"d $bX ( *`x! ($ x@A^  * x "b`J@0D H''''bX@D H`  ( *`x 7ްbX@jޠ  ް"@*` 7ހ  (@ x6(̀ % @'j @* 2 ' 77"7ހbX@; ހ  ( x@nB"`"b* &7ޑ* 2 ""bX@蠒 ޒ"@*` 7 @ "X` !`  "d @ "`` @2   @AU$"d $bX ( *B`x""\"``$ !`  Ȁ"\` !"\  DbX@@䀢 # $"\D bX@',HH"\   /'7bX@@  ($"\"`xD bXH@'H Ȑ *t"`"`* '@` '耢 4' ''bX  @q!2  \bX 2 * +  &   @@ݐ @  ( x`bX0B! >'' ("`xbX @؀ 0'Ԑ '@bX"` $ (u bX (2 DH bX     "` *@r"`!``"D  `  " @c'< Ā "` ` `"` a@P"l`  DblH`/"̓*` €   )4%?`D  `@ ` Ȑ  '@Ā  (Ѐ  ( ="`x <"`x" x? <( <D㿘!"X  @?$"X""\"`"d$ b|@㿘 @? @$㿐 U?@`0`  `@@"$`0@ $`0T` $` $`@` 3\@F `@  ?@`2  `C  $`4` $`$`$@2(" $`4` $@  $`  $`$`$`y  &"`rjeechodiscardsystatdaytimenetstatqotdchargenftp-dataftptelnetsmtptimerlpnamewhoisdomainaptsapfsbootpsbootpctftpfingerlinksupdupnewaccthostnamesiso-tsapx400x400-sndcsnet-nspop-2sunrpcauthsftpuucp-pathnntperpcntpstatsrvprofileNeWSsnmpsnmp-trapprint-srv%d㿘`! *` €1!1!1! 1!(1!01~!81{!@1x!H1u!X1r!`1o!h1l!p1i!x1f!1c!1`!1]!1Z!1W!1T!1Q!1N!1K!1H!1E!1B!1?!1<!19"16"13"10"(1-"01*"81'"@1$"H1!"X1"`1"h1"p1"x1"1"1 "1 "1 #@b @2l(4@LXdp| $0<HT`lxicmpigmpggpsttcpuclegpigpnvp-IIpupchaosudp㿘`+ *` €1*#1'#1$#1!#1#1#1#1#1#1 1  1  1 #Xb @1w@LXdp|%s㿘 '"`!` G   !\a8@h  '"``  @ @  @* 2  &<`b`!`  !`?` '`@ * '@ @* 㿘@`;; res options: %s㿘b@hL   '"`# " @ V@h<b2 `?`&`@ * &@@ ;; ->>HEADER<<- opcode: %s, status: %s, id: %d; flags: qr aa tc rd ra UNUSED-BIT-ON ad cd; Ques: %d, Ans: %d, Auth: %d, Addit: %d;; QUESTIONS: ;; , type = %s, class = %s ;; ANSWERS: ;; AUTHORITY RECORDS: ;; ADDITIONAL RECORDS: ;; ...truncated ;; ...malformed 㻈 '"` `@Y?k!`  ( ``" ` `2`  `< +`  cX@g`& * & @a`!` (`?`&@ ; ;* &@I`!` "@`c@gt2``c@gl$c@ge"c@g^!c@gW c@gP @c@gI c@gB c@g;`!` !` c@g/ !?#c @g' `@g"  `@g`!` +" ?`& * & @ђ  t`!`  "?` @f? g '"`-+)`  @@f0@8`   @ @D$ @ `s@m`  " `@* @2 @f`8`@8Z`   @ϐ* @2 @f H` ` "? ?`&* & @^?<`@/  X?c#\  ՚ %@  h#\ @ǚ @  #\    0 @f]`0@fX`㿘"㻐@$ O ?`&@ .* &@ .@t㿘Ԕ".㿘@ & @X J?`."  ##.  *`㻐 ؘ$ @80  %lu %s %s ; proto %d, port %d " "\"?" ;; *** Warning *** OS-type missing ( %lu ; serial %lu ; refresh (%s) %lu ; retry (%s) %lu ; expire (%s) %lu ) ; minimum (%s) %d %u %u "%.*s" %u %u %u %u %s %s ( 0x%04x %u %u ( ) ; BAD BASE64 %d ; LABELS WRONG (%d should be %d) ( %s %u ?%d?;; packet size error (found %ld, dlen was %d) ?c '"` ` @ (" |   =$ @@p*  2 @k*  2 @k @b"`a`*  2 `d"``P@e3"`!`   !@! X@e%@ X@e`eC! *` €``2?%?@Ŕ   T"@ @q@  X2,T"@ @f@   @* 2 `` ` @d?`&@   x@9 6:5%@=  \?`&@ \* &@~?` &@  * & @i`*?`&@ " "* &@RM H `x@Ȓ6:5%@=  \?`&@ \* &@,?` &@  * & @`*?`&@ "| " 2g@~ `@d0]?`&@  * &@  "[ ?`&@  * &@ϒ @E @ @c`@! @| ؖ@c@! @p @cڒ@ ! @d!@cΐ@ !! @X @c!@ ۠!8* 2 @cx !@ Р!8* 2 @c  " ?`Z&@6WZ  x@ߒ9 6:5%@<  \?`&@ \* &@??` &@  * & @*`*?`&@ " "?`&@  * &@g "?`&@ "* &@ 9 6:5%@<8  \?`&@ \* &@ Ӓ?` &@  * & @ `* "?`&@ "* &@  ?`&@ * &@  ? @l X?   .@6 ޒ X?`  @Ւ X@ ǐ * @ ¡4 * 2  @ba@! !H@b @b @bC@  * @ 4` * @ 4 * 2  aP@bk,?`&@  * &@ "[ " ?`&@  * &@ C 2h| ?`&@  * &@ @ mO 2M!@ >!`@bB  ?!? @Ɣ !T#"@ @@rah @a  * ' ``x@ 4 @ / ?`&@ * &@ ,`*?`&@ ) )* &@ ?`&@&  * &@ r@ Ő* 2  @aa a@aa @a?aX ✒$@Ô @+1逌`?2@a{!L?`&@  * & @ 1`@倌`?}a@ ~*  b@92 @aU a@aO@D a@aB@ da@a8 !@ W!@R @a-@ O@J @a%!@ @!* 2 @a ?aX ✒$@G @"+1逌`?2@`!L?`&@  * & @ `@倌`?a@`a@`ސ@pa@`Ր?`& * & @ &b@` ``@````TTt$,PttANYHESIODHSCHAOSINh`XP8 0    ph`X@8 ph@8(  !p"hH@ depfhP#H0("any"URN Naming AuthorityNAPTRgroup ID (nonstandard)GIDuser ID (nonstandard)UIDuser information (nonstandard)UINFOmail agent (deprecated)MAILAmailbox-related data (deprecated)MAILBzone transferAXFRincremental zone transferIXFRATM address (unimplemented)ATMAserver selectionSRVNIMROD locator (unimplemented)NIMLOCendpoint identifier (unimplemented)EIDnext valid name (unimplemented)NXTlocationLOCIPv6 addressAAAAgeographical position (withdrawn)GPOSmapping informationPXkeyKEYsignatureSIGNSAP_PTRnsap addressNSAProuterRTISDN addressISDNX25 addressX25DCE or AFS serverAFSDBresponsible personRPtextTXTmail exchangerMXmailbox informationMINFOhost informationHINFOdomain name pointerPTRwell-known service (deprecated)WKSnullNULLmail renameMRmail group memberMGmailboxMBstart of authoritySOAcanonical nameCNAMEmail forwarder (deprecated)MFmail destination (deprecated)MDname serverNSaddressA㿘    @" 2 2 &   2 2&㿘   2 2&   2 #pb@&2&㿘   2 2&   2 #b@&ې2&㿘# 㿘" initdebugaaonly(unimpl)usevcprimry(unimpl)igntcrecursdefnamstyopndnsrchinsecure1insecure2inet6edns0?0x%lx?㿘@"K1"?1671O1 8121F1 11A1 61.1(141 '1/1 '1!1%1 "11 1!########        0 8#`@@&=0 secs%d day%ss%d hour%s%d min%s%d sec%s㿘  !!  c"c6 . @m <@s <@f <@l <@_ @e  `#`!!"@% L 2 ` , 񀤠"!"@%ؔ L 2 ` ", "!"@% L 2   `2 #Ȁ2#Ȁ2#Ȁ` 2,",  "(!"@%#ȁ%ld.%.2ld㿘  @2   @ߒ 0* @1 !# @ے d d@͐@%o㿘"    `1 +   +` *  `?Е: L .+`  ✐ `*  :`Д *` * + Б: @ +` *  #0*   ```@:`#0,`@ 4 * $ 㿘    .(`(б> `b2bi.) (б> `b2bK.+(б> `.2*b!. 8(( `(/ 8а( (`/ ?Ѕ8b"b2(82)((` (( (( (1 ((` (( (( (1 &(& (82 (( " ""b"b2"ͼͼͼͼ͌͌͌͌͌͌͌͌͌͌͌͌H͌͌͌H͌͌͌͌͌͌͌͌͌͌͌͌͌͌͌͌͌͌͌͌͌͌͌͌͌H͌͌͌H㿀''@O'@@  / /    /逢`  2 쀢 2   J@ - +`'?J@ +`'"4' 4' 4`5 5 5  K ' , @ *  `?Ѐ K .,  ' b ` '* :`Д@ *` * +`Б:  ', @*`@*`@@F&%b  @ `   ' @ `  4  4 b4 ' @ `  :X.`/b  `' @ `  b  `' @ `  :/.`r/b  `' @ `  b  `' @ `  :.`I/.`.@.` .`.`.`.`.`.`.`.` .` .` .` .` .`?; error: unknown LOC RR version%d %.2d %.2d.%.3d %c %d %.2d %.2d.%.3d %c %d.%.2dm %sm %sm %smH '&%`h@"v0 ` ``*`  `* `*`     `*``+ @ +`**@ *  @`   / /ސ†"??ڐ!  N S/ /@t'#'@=#@t  <@6 <@t <@/ <` W/  E/@t #@#@t <@ <@s <@ < d@s d@ @ l @5+ꨒ "cXe@5 "cX^@5 "cX#\`#p#`#d#h#l#t#x#|##@!ѐcX cX@cXcX@cX@㿘@L   L ." `@ &L L * 2?J?`.2 %04d%02d%02d%02d%02d%02d㿈'@3 1  l  "  " #\ #``X@!=㿈`B #`   `2`*3  *2  `? /// ///ꀢ`?/@??@@`?@T` . . . .Ğ`? ///@ * `@    2`*  2+ 2  //逢`?/@ ?@?@@#` `. . = . =..?㿘N  ^ b   Q`#` @1D _ "`   `9N +`3N@L"@* .@*  `C"@@: .@@**`  ` `3"@@: .@@**`   @%"@@ .@` N  ✒ @ `2N=ꀢ=@ N    #9 64?" @ `  =N   `2N=2?N  "  `"?N ` @ ?0?㿘?   @`G  .&`)?0C@ @??(@`@.` , \ . \2 (@@:)?(@`(@`<   !`?( `@ &  ? ` (@!㿘@    @ 2`  `B ?@n  ;:,*`" 7*  ?@$@`$@ .񀦠\  ,  $ ??"? >*@*,2$? $     ? " ?   @(*`P㿘D`4 ` "' 8?, ., \" Ґ  < ` "&`."  `?*  @ `Ц &*?J .( J.  .`.`Ѐ   Ѐ -2 `2J 㿘N * N  .   㿘N  % ߀ ] `.`\ " N`  ߀ ] `.`. J߀](J    ( ( (*`  2 *`*@2 2 2 *`*@*`*`  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~2((P㿘`` &`` 2 @@~   ( "`x&?@``"  @ ? `@?&`*@``&@`  @ ?ZONEREFZONEINITUPDATEMAUPDATEMUPDATEDAUPDATEDUPDATEA8765NOTIFYCQUERYUCQUERYMIQUERYQUERYNOCHANGE14131211109REFUSEDNOTIMPNXDOMAINSERVFAILFORMERRNOERROR㿀@' ?''@|?Ѐ 8?Ʌ(8㿘 B :@'뀢.3+1// #4 b `*   ` D "$ Ӑ   *  b ` D "  ,  .@`   ǀ.   4  6%* . @ 0 07( @ ` 07(*& @*   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~2(P%d.%d.%d.%d㿈'1 ##\@c 㿘    (@  @" /"`x 㿈 bx @ @֐ ( "`x %x8  ???? Ț 4`@ :`*`$@*`#@ * * ``# ?''  ?,`` ?'' ' ?Ā@$''''``,` ?Ā@''?Ā ??'?#  : .+@  Đ@@ `@ 2,`,( ``, ,` ,`Ā  ,`,`$%  ] ( @ b@n`` Đ@ 2, :, , $@ ( "`x fLOCALDOMAIN/etc/resolv.confrbf;#domain lookupsearchnameserver%dsortlistoptionsconfRES_OPTIONSenv  '"`"`'`''   '"b` 2 $  "$ 5 ,4 & ,$@ d<*@  $da$  $`@Ɛ@) =-@! 7`!@-אL` '$DH \  .  $@` ' N" N@ 2NNN    2 .$@!@ '! (aȐ @z /e'#a@, a@  .O Pa@91  )O  $a 2@N "  " N 2 0! '"!@-\@ Naఒ 2."'a@9  2AO  ; ( @@   N   `L@ y @ b f,  ,``L@ y @ b f , "Ӱ a@8  UO  Pa`2N "  " N  ! '"!@,@*V 2.&?L"?耢  ?@N  . " $@`  N @   N   2 .$@ 'a@8c 2O  2 N "  " N d a " `  .J  "@ `"*  ??  ??''b  5@`' 6` 1`  & +  `@@   *  @!   ' p+  @+   '"p*@" " "" ' "@Yb@7Ԕ  O  ֐`  ' &`"`lcc-7N "  " N π ̀ ;@ `2N N`"N@)^Ȁ 2 NN ; N.@= B '"`ah-`$@@)C %`. N   ;  `" *: @. %h@{'%@@u'%`h*`c"  ' S'@  @ N` -`@*` '@ @@"#"#"#"# . `N   ;  `" *: & ./ @Q @U  ?    4,, *,`` ` =.b @6   O  b(@@7 ` '`"  '"`d `**` "d@F '"`L`` @U  @(} . `` @+!`- '"`""` $@N   ! '*:   .Nd`"?@$$@@(R . $@`@$@@  '` @  " @"0 @b@ '"`` "` ndots:debuginet6insecure1insecure2edns0㿐N s '"`c+-)'%*:  N "  " c@6C    @ C@b  2` ``7* ad+  < -$adc@6  '@6  `#@6 2`$@6 2` (@5  2N` $`N   2 N  0 ???$OpenBSD: atoi.c,v 1.2 1996/08/19 08:33:24 tholo Exp $㿘 @0 $OpenBSD: bzero.S,v 1.2 1996/08/19 08:17:56 tholo Exp $ `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*㿘  ` @@ 㿈  ?'  @yӚ ?? 㿐@ ?㿈)" `y 0   N x X   "*:   `  @ ?;   D` +`ɚ@ ;  . = $" $5" `0$:  `2"T*` €?#@!耢 * #@?#@耢 쀢`* *` ` 耢 쀢`*   *` * @`2&@  <㿘    (@  @G /"`x?㿐N  / ( #@&[ " @* @*`@ $2,@  ,@ .2 `,@ N ް   .@.`.`.` 㿈 @ N :   N :"Nt K N  `D ?##@& #@%  ",R (N`:`.`GNN A >4, ,   6  @2l  0+N`°   !4, , `$   ? % **   @(   $OpenBSD: strncpy.c,v 1.2 1996/08/19 08:34:22 tholo Exp $ @(*`  *02 @$OpenBSD: strcasecmp.c,v 1.3 1997/08/20 04:13:57 millert Exp $        @ ` " @ @ @`  @ # 2 @ $OpenBSD: _yp_check.c,v 1.3 1996/08/19 08:34:57 tholo Exp $㿐 'J!P` @#    !P&@h!P`?$OpenBSD: yp_get_default_domain.c,v 1.3 1996/08/19 08:35:09 tholo Exp $㿘 '&J!P` !P @ ! !P !P& 㿈  ?'  @w ?? 㿘`6 "@"&&@I+, @9 `"&&@/&@`", 値@F ހ" ,㿘#@a! (@M ` @0R `  @0G   20 ``` @09 ``@N 2`` @5@ἁ㿘 !c(@  / /etc/servicesr㿘!" #0@'c@$"@Q (``"``㿘!" " (@B$" (" ` ,/㿐b   #0@c@ $@  J?` 2'#! #(@~~, L@ #@# # 2,  ", @ocȢ ,@`L@L@ "` "`c@^ ,@}  J ?#* #,<2"` "`"` @;Ƞ "&$@,  "!$@L  `*`:    @$@`@!Ƞ " $@,  "$@L  $@#,$OpenBSD: fgetln.c,v 1.2 1996/08/19 08:32:29 tholo Exp $㿘 H* D  @|^ "?& H& D 㿘 4@E 2F&@ @~  $&@ @ "$4 4$  @~  $@Ò D@}$"@$@`P $@D@}@Ei ئ&@D&@ 㿐@JE & @s  @YҔ! y6  yyy H`X6 6 & $& ,& (& &    @t 㿘 @R   ( 6 " x8 '"P`@s(` (K  ? (B ; (> @tN @2P  @ ? 2 ?  : @ 0d < :@  d  " : @ DE      "`x2 @r h €dy 耦@2 T & @} 2  <   (4 ؐ$$L4 2T @} Ȫ@B 2#0 @" P  @ ? : @ 0d "< :@ d0 " :@ D8<" @d  "@@d   @2'L4$L@@@D 4%@2L@%@&0$  $@"$0@z $0  ?T4 L  :  @ @?2"$0` $@@"$0@z $0 @ ?04 @D   @ "@$"$@sF ?@?20?0`@@"$0@zp $0 $ ?4 $ 㿘 ;   $OpenBSD: strpbrk.c,v 1.2 1996/08/19 08:34:23 tholo Exp $J H ? 2H  J  $OpenBSD: strtol.c,v 1.4 1996/08/19 08:33:51 tholo Exp $㿘7✢ @ `` - +L@  L@` 0 L@ x XL` ` 0  ) #@b@n$ $    - () "6"&? ? %x@~"  #?%x @~  @`✐    Ҡ? ??ˠ`2&@ 㿀'  @  `c   "%,' @y P'0a$'@|? B`6   /,/0@.Д   @,J "@{  @.     2   $ؠ@,* @q @y'$OpenBSD: strtoul.c,v 1.4 1996/08/19 08:33:52 tholo Exp $㿘% @ `` - +L@  L@` 0 L@ x XL` ` 0  @}?@~?  / ( "#@8? ??%x@}  @`    ? ??ޠ 4 `&@ 㿘'L'P'T'X@ Lsyslog: unknown facility/priority: %x<%d>%h %e %T %s[%d] /dev/console p<a0Ґ ###< :@ ` (# x#8 @"X@Vz((  (6'$@!!`@  @   6$@#0` c4   8%c4c4p@VF  6$@0 !@xˠ!x@V2  6$@c4   :,@` ,@`@*`$ $7):  % N` m `@@V!p6?&$`, ?`@*` : ,@  6@0 $@'$a '''' @z  #̀`c4 @0@D,@ )@)@8,@ 0 ! @U  >@ $@$a ''''ؐ@y@o㿘!#,?" @o?$#, "#ȁ/dev/log(#c,?   @b ?3$c, @S| c,?,% Ȁ (  ? j ?/??????????? /a7@  hc,@ j? @oc,$c,$ȁ㿘 "#4"#0c0"#8c0    "ć㿘!@o#,? $#,"#ȁ쀢 < <㿘 @ $ b|@$OpenBSD: strftime.c,v 1.7 2000/09/06 23:05:11 millert Exp $***x*p*h*`*X*P*H*@*8*0*(****h*))))))))))))))x)p)h)X)H)@)0) ))(((%a %b %e %H:%M:%S %Z %YPMAM%a %b %e %T %Y%m/%d/%y%H:%M:%SSaturdayFridayThursdayWednesdayTuesdayMondaySundaySatFriThuWedTueMonSunDecemberNovemberOctoberSeptemberAugustJulyJuneAprilMarchFebruaryJanuaryDecNovOctSepAugJulJunMayAprMarFebJan%c㿐@' "@2"`2*? *?%02d%2d%Y-%m-%d%03d %H:%M%I:%M:%S %p%ld%lu %d%04d%e-%b-%Y-+PLF`%<L`z6  ē*` €/``  (*` |  "@``  (*` `  "@ ``   (*` 0  "@``   (*`  "@` d@j'l c@o `Ȕ @ ޠ' ː! ` c@TȰ ` c@L # `c@@` @^/@^+ "  c@-`  c @$ `c@` @^ @^ "  c@ } `c@u`  c@l #(@e`     ̒@X O#0 K#8 @c@ԖH`@'`'` '`'`'`'`'` '`$'`('@ ' cH@ @$ !  #X@` `?@i" c@ ` "  c`@@i > ``'l` $2m@]k d 2 n@]e! 2mn!m@][ d  !n@]U! !m!n? @]M$?@]I $@?& Ζ 4` -`` -` 5-`:  V g  c2   ' d@]! cch@# #p``` " @i$   @i  c@  `c`@w n` `Ė ',` '@hf' '` d@\א'l c@ݖQ` 'lch@ԖH`( @ؔ@` D` ` @ @ɔ9` 5`$`6  # #@@h <@h <* , ,  <@\ ch@  `ԔĘ  . L  +4444444444444444444444444444444444444444444h444444444444444444444+,\,-@+-0--444.4+44/0/P00,02D23L3p444444,,--P-p40,4. .0.P..4.4/@/p00`242233̝㿈@ @@ `@  (*@  J ? * `` К  `"  'L  ( " c  @  'L% (( ` (@  @../etc/localtime/usr/share/zoneinfo/?` #@t_  N : /@ / 2 ` @ i 2  N /@ .   2N ( " ?N :" N /`?" 8`"?@t@t #@ `P@h@e@ . 2 @  2?@Pj ?? @ @j@j֐ 2ذ?;`8`5`&@2` &`/`$&`,`(@`, 2&` ` 4?` !r4?``24? 2? 2?* + * @ @` ?@@  *@ $@@$@ r 6``, & ` `` 6`e @*` Y`` & @` 6` gLΐ`& @` E&  @``@& ` @4Y?`  `   #L@ @*`   `#L@*@ 6`!L@&`& @ ` ` gL" "` L@` "` ?` `  gL" "`L@` "`?` ` mnJJ Ѐ ,-+2  " JЀ   ((+ Ї8   JЀ  & "@ 㿐 ۖ $* "@*`@*`&@N :  ʖ ; *@" * @&@N :   < 2@  &@㿘N -   +    @ &@㿘N J M &@`* !?В &@ `   "0 N .  ` v  "$ N . `      &@` !m` 2N  / u` &`㿘 ` @YY d 2  @YS! 2  "  ""   * * "@*`" *{ ;xT!u* * "@*`" *k ?- @!*`@ ?* @*`" *" *  @Y    &@ d@e d@X,`@*`@*`@e   ``:```: .`" @Xޒ  & @,` +`- @* *`   `& +` * "*"@ *` posixrules,M4.1.0,M10.5.0X '@rJ!'{$>?L :ԒĠ 5?# 2&@L '_$ (!?L  , ;  2L?Đ1'L 2L`#L , ;j  ࠒ "?L , Ȑ "?L 2?Đ     &`&`&gL&gP&g` &gT&gd&gh`eب '9 Ĕ̐Ɣ$ $@$@,`$@ ,,`$@ ,` !쀌 @X d 2  @X! . .*@ *`" *" * Ȩ&` 2?  `@e gP* *  ``gL   eؔgP@gL * @*` ` @6  * * ``  @1 eĄgPg\gXgL` * *  `(  `2*" %% #* * ` ``@ۘ Ė   &gL&g`&gd&`&gP&gT &gh  &`&gL &`&gP&gT&` &` ` "8?#L@@l @@e  㿘#ʒ  㿘 #  ?#"  o㿘!#@@TZ㿘@o!ؠ # #מb  #!@!V 2@p!@ $b #!@L   " "T#c"@"L0#Аn L :C 㿘!#@@㿐 #``'`  %gP@ *`` eؘ%``   *@ 6* , 'L@ @@m &  #L@@ *" &(㿘!#@Re @L㿘 #b  ,@D " 㿘 @3 #b !  "b"@*"@,`# "!&(㿘 ޔ㿘 #b  ,@ " 㿘! #"Ŕ㿘  ? D+!L!P +  2.   4  ?*      ?+    @2   @     @??ɑ+ %T@b@U&@ T T!  ?"  `@a.&@U˒.@a <& <@UĐ&`@U  & &0'@aϒ!m`&* @*`@*`@ <  d@a$@a! <  d@a$@a!$$@`Ѧa쀌 @U d 2  @U{! ,  , @ , @!*`@&&&@`*``*`&$@ @ 6`&$& & 㿘ː@h@ɒ "  2`㿘@ &8@aM@aI8@qJ@"&@`` ` ` `@ ('D'P&@`'H'L'Ȑ  '̒`'Д 'Ԗ 'ؐ  ' ' $'('' ' < G?В < ??  8?ܨ 0?z'l *?Ԁ )!n'o? ؤ  ܤ  쀌 @T d 2  @T! ,  , @@ `'Ԁ!n(+ؤ  ܤ  a쀌 @T} d 2  @Tw! ,  , $@ 'Ԑ*  Ԁ!nݢ'"@ 'Ԁ  ''ؐ  Ȱ?ؤܣ*   @TM d 2  @TG! ,  , * @Ԁ@ؒȶ 8 ?ܐ'l'Ȑ?ŀ ?Ȑ ;''x''' 'IH#@  #Ь"? |,* 'P@P@耢@2-?? (/ * 'L@L耢@@ " L'HÒ 2耢@츇???줄ϪC?LH  4? `?' *"@' *@'耢`   @' 2?'LHD P"@?㿘  { 㿐  &  `" K && #@  #Ь"? :- * P@P@ @2-? (,* @  L`?"@  && `2 "@  " `?&& ޢ쨅?Ϫ?㿘!#@ِ c@ѐ㿘?" 㿘& ` 㿘& `} В L*` 㿘'DDD&㿐'DސDD@ 'א D"@@ `'D&@ &􀢀 ?0'D&@ 4􀢀  $! b|@SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec???%.3s %.3s%3d %02d:%02d:%02d %d 㿈  h*@  (@  * h@  =@  'l p#h #\ #`#d@G  㿘 #b  @ " Ȑ $OpenBSD: strcpy.c,v 1.4 1996/08/19 08:34:14 tholo Exp $ @( *` @ (* $OpenBSD: strstr.c,v 1.2 1996/08/19 08:34:27 tholo Exp $㿘N@ `@kN    2N@ 2N?@#?"77'''''L'P'T'X@GƔL*@8`#`? "77''''@G*@$OpenBSD: ypmatch_cache.c,v 1.7 1998/01/20 18:40:27 deraadt Exp $㿐@ #b        6 2 @h  Db$$ $ $ $ $  $ $$b  " @h$  @h$ @h &$ @h $  @h $$  $ @j\$  @jX    @  @h @ $  !$  $ 㿐! #"  (  & #'@" "  2 @g 2 @Dl 2 @$  2  yp_match: clnt_callX  L " @j @`" N@ " @j @$' '@Đ@@  'z !P@  쀢 `@g'@ '@ 0_ @i@@*@@0U!, Ė ?''''''''' ` ,#\ + h П    `@Yb0Đ?"`h@谒 !`@g'@ ' @i~@!P@@*  @ʔ " @I@.āyp_next: clnt_callP\ `N "w @i @`"p N@ "l @i @$$a '$@'@@ U !,  ?''?'?'''' ` +#\ + h П#    `@Ғ`?"`h@xఒ !#`@g''@ ' @h@@*@`@g$@ $ @h@@*@#@’@$OpenBSD: yp_bind.c,v 1.11 2001/06/27 00:58:57 lebel Exp $/var/run/ypbind.lock%s/%s.%d/var/yp/bindingclnttcp_createYP server for domain %s not responding, still trying clntudp_createfcntl: F_SETFDH'D#0@D  ? ^ @  ? (`x # @_QP @_M@g!0? '!H  ` " @@f 2 `%aH`$0&@D ( @i  # '!H D@  2 2 h@fw l   @h l?& \& h  h 2> hDHX$ @D@Dz ?"- h@  x #  '''̒ '@p̒@ @^֐& h@^Ґl@^ΐ"̰ @fTȰ     ?А   ?؄?//'a'bД  @] 2 @#h" @f/ #   @" @f !,'''' #\@++  D耢  "  D @4cx `€ ?f& h @ `* @7 `/# 2 & H"W @eߐS   & L. H. I& P& T ` . J ` . K A. L `. M `. N ` J. O6 X& h@D!,'2`@:`' ` ? @& \a''Ēb H Ř \ & `@#& h \ @A ?@ ې#aH&%aH`2&@ 㿘 ` @?& \& `㿘 㿘 '!H  @c  2 ` @`$@$H@e_0 $OpenBSD: clnt_perror.c,v 1.13 2001/09/15 13:51:00 deraadt Exp $㿘1 #"耢 2"@e!&""%s: %s; errno = %s ; low version = %u, high version = %u ; why = %s (unknown authentication error - %d) ; s1 = %u, s2 = %u ... 㿈Ƞ !j  `€!@ "!@C" ! @L$@ 耢`;!0*` €!@"Ȗ@B3@B" @ @+$@ @얒 @Bݔ@BՔ@B̔ @BÔ@cX. @0` @B pppppppp<pppppppppp㿘!# cv@2ssssssxsPs0srrrrrprPr0rqRPC: Unknown protocolRPC: Failed (unspecified error)RPC: Program not registeredRPC: Port mapper failureRPC: Unknown hostRPC: Remote system errorRPC: Server can't decode argumentsRPC: Procedure unavailableRPC: Program/version mismatchRPC: Program unavailableRPC: Authentication errorRPC: Incompatible versions of RPCRPC: Timed outRPC: Unable to receiveRPC: Unable to sendRPC: Can't decode resultRPC: Can't encode argumentsRPC: SuccessRPC: (unknown error code)  * 㿘!# c@1ߒ%s: %s - %s %s: %s 㿘z  &/  Ѐ`  Ѐ`!! А  ! ǐ @@A!    @A! ,,%s㿘!# a@1vvvhvPv0vuuFailed (unspecified error)Invalid server verifierClient credential too weakServer rejected verifierInvalid client verifierServer rejected credentialInvalid client credentialAuthentication OK  * $OpenBSD: strcat.c,v 1.4 1996/08/19 08:34:10 tholo Exp $J" @ J2  @(*`  $OpenBSD: strerror.c,v 1.2 1996/08/19 08:34:17 tholo Exp $㿘 #@b$OpenBSD: clnt_tcp.c,v 1.18 2001/09/15 13:51:00 deraadt Exp $clnttcp_create: out of memory `@b  @b d 2 `@0  (`x & ""` 2@= *` 26 @b@by  6#$   @ &@z  @    ( x & "`Д`"?O @[K $ $$ $  $   L$  $  @@p$ @@' ''''Đ 0 @ @ 2  P  # @Z `€ P$ H``@ "ܚaP@o!T$@$$  @bC @b> h 'H'P\ L 0'L'T  @$ `$ T   @ 2 `   0&@$ $%`  H ``€H " $ € PL€   $  $ $@ q $@  $ $h 2@d   ` % ( $ $Y % (,"&@'`'`''@'耢 F@  $ "'0<Ȁ2' @ $ $ 2&  T  $ $$ (€   $ ؐ $ $؀  &@@ $"  $  @ 2g&@ $ $"@("`,"`㿘  " L L@` `"  `"  " " "  "  "" " " "  㿘   " P@Y P `@ L@a6@a4P2 `!ؐ` 2 * @` ?@c7  '$ $ $ $ $ $ $  @>  Ȩb@''+ ( 2`* `*  $   @ `x@> Ȗ"@'̒"`'Đ@? "@ '"`'@?' '`  ` & $@`)?`x " & (& $@`?"@`@YA 2  6 & $& (?`x & $& (㿘# ( @Y+?&`x?$ $$ ( @$OpenBSD: auth_none.c,v 1.7 2001/09/15 13:51:00 deraadt Exp $㿀! ## 2  < @3 @ 2$#+  < ' (  &  at&  && &  &  & @T (@< @9 @& <  `@㿘 ##  ` (<   $OpenBSD: rpc_prot.c,v 1.7 2001/09/15 13:51:01 deraadt Exp $㿘@ "  ``@ Z!㿘@  㿘 @ ` " `    ``€ @ `  @ `㿘@  " @   @ `  @ ߒ`@ Β` 㿘@ Ғ @ ` " ` 2  ` ጒ`@ 5  㿘 &`&` 2 @  @ ` @ `  @ ` @ `  !p*  "@ "@ "@  "@ "@"@ "`"@"`P ,8D     "@ "@"`"@"`㿘    &@  "&@ @ ڒ@ &`@ "  " 0 " 0 &` &`&` &`$OpenBSD: xdr_mem.c,v 1.8 2001/09/17 18:34:51 jason Exp $`"" " " "  "  "@ "   "@   "   " ? @dd(*#d ` * `* `*d# "  #"@d 0#d*@  *` *` *` "  #㿘 "  $  @`-  @$  㿘 "  $  @`  @$    "    @4 " "       " "   $OpenBSD: bindresvport.c,v 1.13 2000/01/26 03:43:21 deraadt Exp $㿘@㾈`!'@l?2`\?@`2  `   '`  ' ( ."`xE? '` ' ) .` *`.@ '@A찒 +@A  #@" ! (   x@-   $ x@ @ &$ x $h b|@$  b|@$v b|@$i b|@$b b|@$OpenBSD: pmap_getport.c,v 1.7 2001/09/15 13:51:01 deraadt Exp $p o6 a?a!'''#\ab7ڐ ! /"'"`-''''' ##\!T ڀ   & "` ``  ڀ 2  & "` @܀?"6 @U6 ځ$OpenBSD: pmap_prot.c,v 1.3 1996/08/19 08:31:39 tholo Exp $㿘@  @ `  @ ` @ `  $] b|@$a b|@$OpenBSD: xdr_rec.c,v 1.8 2001/09/15 13:51:01 deraadt Exp $xdrrec_create: out of memory 㿘@\ D # @*c05@ @$ <@ @\$ @  $ # @*ڒc@\Ð0 $   2 $   $ 8b& & $$ $ $ $ ,$ ($ $ $ $ $$ 0$ 4㿐 4 ,0"  @&@4, ", "4@%   &@ 㿘    &  & & @- 2  & @ "㿘   4   8 2 @a 󀦠 8@9 & 4"$ 4@㿘!    " 8 @] & @@$  @$ @  2  㿘`   @T  ?@  "  , ?  "  0" &㿘 ?&"   0  "    $  , 4 "  0   ( "@ $ 4$ ,    " 40 @  @  ,0 # , 4㿘 @[ @[㿘 @ "  8  & 4@ 2 4   4 4 4 8 " 4& 8 㿘 @ "  8  & 4@ 2 4  4 4 4 8 " 4 0 , `?㿘`       * "@   # ? " `""㿘 ` "@ @?* "   "     `$ $ 㿘 0 (  $ "  ?" & ,& 0 㿘$  0 ,     4@\ ,&@& ,@㿐    2 & 8& 4  㿘`$  0 ,  @ ` 4 & ,&@  c(/  ?$ b|@: x؀ N "  (@] '$ &` '' (`x@Dؒ@\$$  &  $:$$ @\ $OpenBSD: __strerror.c,v 1.7 2001/06/27 00:58:56 lebel Exp $㿘 # #@C5  0?,@OI  @C(  0,libcUnknown error: 㿘& @"#L . (   @4@  0&? @( @@\ "@%@㿘?  ( "`x ?" @\b @Z# 㿘?  ( = x @ @7   @.@08/`(@ @ @?@4@08/`(@р 6`6`@؆@NLSPATH/usr/share/nls/%L/%N.cat:/usr/share/nls/%N/%LLANGC㻘 "?N @ / @w@[F 2 ''@[9 H 2'' P'@[1 ' J B  ?* : `(3'"*` € J@  4 @ 1 *`J@ ) @ **% J@   @  *`J@  @ **    * * L  :`%*@9?2 L 2 L ?hHHH0@7  ?,@[v @Q{$?#\   @[" @Qo?2???#@ @XƐ  & ... . .. tmp @ ;Jx   @@;Jx i@@`@@<@`bT U;JT@@(A;JyN;JyN;Jy߀k3A;JyW;J8;J8 ;J8;J8;J8/tmpBa;J߀;J߀;Jܓ16!;J;J;Jܓ 1a;JC;JC;Jܓ2`!;Ju*;Ju*;Jܓ 2 a;Jp;Jp;Jܓ3!;JG;JG;Jܓ 3*rea;J;J;Jܓ4Z;!;Je;Je;Jܓ 4a;J /;J /;Jܓ5L)!;J!`;J!`;Jܓ 5cea;J#F;J#F;Jܓ6!;J% ;J% ;Jܓ 6~a;J'c;J'c;Jܓ7 ~!;J) ;J) ;Jܓ 7샚a;J+;J+;Jܓ8G !;J-L;J-L;Jܓ 8ɏa;J/;J/;Jܓ9I!;J05;J05;Jܓ 91Ea;J3%;J3%;Jܓ:@bI!;J6;J6;Jܓ :Pna;J9;J9;Jܓ;ۓ!;J;3;J;3;Jܓ ;3a;JÀ;JÀ;Jܓ<ޑX!;J;J;Jܓ <T$a;J;J;Jܓ=%6!;J';J';Jܓ =%Ra;J h;J h;Jܓ>~a;J ;J ;Jܓ?!;J沀;J沀;Jܓ ?a;J U;J U;J6= m!;J!;J!;J6=:-a;J$s;J$s;J6=>!;J&%;J&%;J6=:Ma;J) ;J) ;J6=Q!;J*T;J*T;J6=:ha;J-D;J-D;J6=;J>;J6=: )a;J9;J9;J6= x!;J;J;J6=: E̎a;J;J;J6= #z!;J U;J U;J6=: a;J#F;J#F;J6= !;J% ;J% ;J6=: $B)a;J(;J(;J6=!;J*T;J*T;J6=: Na;J-D;J-D;J6=`#!;J0G;J0G;J6=:a;Jv;Jv;J4΀2.!;Jf;Jf;J4΀6087!;JW;JW;J4΀614!;JG;JG;J4΀625ua;J'c;J'c;J:i@2a;J*T;J*T;J:iAa;J-D;J-D;J:iB=!;J05;J05;J:i6@$!;J3%;J3%;J:i6A!;J6;J6;J:i6Bua;Jр;Jр;Jk Pya;J ;J ;Jk QVNa;J沀;J沀;Jk R[!;J;J;Jk 6PiT!;Jܓ;Jܓ;Jk 6QR!;Jׄ;Jׄ;Jk 6Ra;J&%;J&%;J8ـ`a;J) ;J) ;J8ـa&Da;J,;J,;J8ـbZcl!;J/q;J/q;J8ـ6`[e!;J2b;J2b;J8ـ6asp!;J5 R;J5 R;J8ـ6bya;J;J;Jtpga;J S+;J S+;Jtqda;JN;JN;Jtr 8!;JI ;JI ;Jt6p4n%4!;JC;JC;Jt6qT[!;J>;J>;Jt6r$Ҩ!;J% ;J% ;J(x!;J-L;J-L;J05xݭ"! ;J;J;Jy-Ȝ;J;J;Jss0h! ;J S+;J S+;JNyb;JI ;J;Jss1IT!;J;J;J|~!;J*T;J*T;J*T.Z!;J-L;J-L;J-L)!;J3%;J3%;J3%i!;J6=;J6=;J6=`!;J;J;JeM!;J;J;JF|$!;J h;J h;J h7޾!;J ;J ;J i^!;J;J;Jh!;JC;JC;JChґ]!;J9;J9;J9QrV!;J8;J8;J8D!;J";J";J"=/t!;J$s;J$s;J$s ڮ!;J+;J+;J+ RK!;J-D;J-D;J-DMn!;J3%;J3%;J3%No{!;J6=;J6=;J6=C!;J;J;J =s/!;J;J;J 4!;Jр;Jр;Jр 4@!;J S+;J S+;J S+ i!;J;J;J 7^!;JC;JC;JC !;J9;J9;J9 7v!;J4΀;J4΀;J4΀ S!;J#*;J#*;J#* ,!;J% ;J% ;J%  ~y!;J,;J,;J,!;J.};J.};J.}!;J4s;J4s;J4sTL!;J8ـ;J8ـ;J8ـ a;J]J;J]J;J 3!;Jw;Jw;J n?#$a;J h;J h;J t!;J ;J ;J nDa;J ;J ;J dm!;J沀;J沀;J nKba;JI ;JI ;J O!;Jz9;Jz9;J n̓a;Jܓ;Jܓ;J b5!;JW;JW;J n<>`a;J;J;J M!;J9;J9;J n9a;J8;J8;J b!;Je;Je;J na;J U;J U;J |T!;J!;J!;J nחa;J$s;J$s;J !;J&%;J&%;J n0a;J(;J(;J  6;z!;J*Q;J*Q;J n va;J,;J,;J  !;J-D;J-D;J n Ua;J05;J05;J  KD!;J2b;J2b;J n Na;J4s;J4s;J  .!;J6=;J6=;J n 糢wa;J8ـ;J8ـ;J  }!;J9;J9;J n Bxya;J1-;J1-;J d壴!;JbZ;JbZ;J nEa;JĴ;JĴ;J [/!;J;J;J nUa;JI ;JI ;Jׄ-!;Jz9;Jz9;Jׄn{a;Jܓ;Jܓ;JׄQ‘!;JW;JW;JׄnIa;J;J;JׄW!;J9;J9;Jׄn؂a;J4΀;J4΀;Jׄה!;Je;Je;Jׄn/"a;J U;J U;Jׄ)` f!;J";J";JׄniWa;J$s;J$s;Jׄ_!;J&%;J&%;Jׄnqca;J(;J(;JׄR3!;J*Q;J*Q;Jׄn^a;J,;J,;Jׄوu!;J-D;J-D;JׄnHa;J0G;J0G;JׄBe!;J2b;J2b;Jׄn a;J4s;J4s;Jׄ'!;J6=;J6=;Jׄna;J8ـ;J8ـ;Jׄ!;J9;J9;Jׄnqn'a;J1-;J1-;Jׄp!;JbZ;JbZ;JׄnN)Ea;JĴ;JĴ;JׄK_!;Jw;Jw;Jׄn a;Jр;Jр;Jׄ?n%!;J !;J !;Jׄn\a;J ;J ;Jׄf!;JN;JN;Jׄne a;Jv;Jv;Jׄ@d!;Jz9;Jz9;Jׄn*a;J(;J(;J&%d!;J U;J U;J&%n~a;J#*;J#*;J&%Ck!;J$s;J$s;J&%n8a;J'V;J'V;J&%%E~!;J(;J(;J&%n"{a;J+;J+;J&%䡺!;J,;J,;J&%ng\a;J/q;J/q;J&%Xz!;J05;J05;J&%n!Ea;J3B;J3B;J&%H!;J4s;J4s;J&%nba;J6;J6;J&%X!;J8ـ;J8ـ;J&%nw a;J;3;J;3;J&%e\!;J;J;J&%nVNa;J;J;J&%??X!;JĴ;JĴ;J&%nioa;J';J';J&%6!;Jр;Jр;J&%n=z& ̐@[ ?$OpenBSD: index.c,v 1.2 1996/08/19 08:34:02 tholo Exp $*`:`J   $OpenBSD: errlist.c,v 1.3 1996/09/15 09:30:59 tholo Exp $H0pX8 p`H(pH0pP8 `P8pH pXH0pX8Inappropriate file type or formatFunction not implementedNo locks availableBad procedure for programProgram version wrongRPC prog. not availRPC version wrongRPC struct is badToo many levels of remote in pathStale NFS file handleDisc quota exceededToo many usersToo many processesDirectory not emptyNo route to hostHost is downFile name too longToo many levels of symbolic linksConnection refusedOperation timed outToo many references: can't spliceCan't send after socket shutdownSocket is not connectedSocket is already connectedNo buffer space availableConnection reset by peerSoftware caused connection abortNetwork dropped connection on resetNetwork is unreachableNetwork is downCan't assign requested addressAddress already in useAddress family not supported by protocol familyProtocol family not supportedOperation not supportedSocket type not supportedProtocol not supportedProtocol not availableProtocol wrong type for socketMessage too longDestination address requiredSocket operation on non-socketOperation already in progressOperation now in progressResource temporarily unavailableResult too largeNumerical argument out of domainBroken pipeToo many linksRead-only file systemIllegal seekNo space left on deviceFile too largeText file busyInappropriate ioctl for deviceToo many open filesToo many open files in systemInvalid argumentIs a directoryNot a directoryOperation not supported by deviceCross-device linkFile existsDevice busyBlock device requiredBad addressPermission deniedCannot allocate memoryResource deadlock avoidedNo child processesBad file descriptorExec format errorArgument list too longDevice not configuredInput/output errorInterrupted system callNo such processNo such file or directoryOperation not permittedUndefined error: 0$OpenBSD: strlcpy.c,v 1.5 2001/05/13 15:40:16 deraadt Exp $   (+  2 2 " 2+J " ?$OpenBSD: strncat.c,v 1.2 1996/08/19 08:34:21 tholo Exp $JJ2 @(*`*$x b|@$OpenBSD: xdr_ypbind_resp.c,v 1.3 1996/08/19 08:35:01 tholo Exp $㿘@K " @  2  @`@`$OpenBSD: xdr_ypbind_binding.c,v 1.3 1996/08/19 08:35:00 tholo Exp $㿘@Ք  `@ϔ  $OpenBSD: xdr_ypbind_resptype.c,v 1.3 1996/08/19 08:35:01 tholo Exp $㿘@$OpenBSD: strdup.c,v 1.3 1997/08/20 04:18:52 millert Exp $㿘@Wؐ @UR @W%0 㿐@3\  ?&$OpenBSD: xdr_ypreq_key.c,v 1.3 1996/08/19 08:35:03 tholo Exp $㿘@#  @5` @n` $OpenBSD: xdr_domainname.c,v 1.3 1996/08/19 08:34:58 tholo Exp $㿘@ @$OpenBSD: xdr_mapname.c,v 1.3 1996/08/19 08:34:59 tholo Exp $㿘@ؔ @$OpenBSD: xdr_ypresp_key_val.c,v 1.3 1996/08/19 08:35:04 tholo Exp $㿘@r  @U` @` $OpenBSD: xdr_keydat.c,v 1.4 1996/08/19 08:34:58 tholo Exp $㿘`@-$$OpenBSD: xdr_ypresp_val.c,v 1.3 1996/08/19 08:35:06 tholo Exp $㿘@5 @` $OpenBSD: xdr_valdat.c,v 1.4 1996/08/19 08:35:00 tholo Exp $㿘`@$$OpenBSD: xdr_ypstat.c,v 1.4 1996/12/14 06:49:45 tholo Exp $㿘@$OpenBSD: xdr.c,v 1.6 2001/09/15 13:51:01 deraadt Exp $㿀 ' 㿐`"  ` 0 @ €'@€  &@  㿐`"  ` 0 @ €'@€  &@  㿘`"   `  0  `@€ 㿘`"   `  0  `@€ 㿐`"  ` 0 @ €'@€  &@  㿐`"  ` 0 @ €'@€  &@  㿐 "    0 V@ €'€   6@  㿐 "    0 @ €'€   6@  㿐 "    0 V@ €'€   6@  㿐 "    0 @ €'€   6@  㿐N@'   .@ 㿐@'В   .@ 㿐 "    0@  @ '€@€    @ &@  㿘㿘$ "       $  `2      2    ``?xdr_bytes: out of memory 㿘@[ "2  2+ "   0"   @R^&@  . @ `    @Rn&@㿘`–$㿘{ "   @ "  2    €xdr_string: out of memory 㿐 @   "7 @T' -8+ `  ` 0!  2@Q&@  . @ b ,#@Q&@  㿘?$OpenBSD: ypprot_err.c,v 1.4 1996/12/14 06:49:47 tholo Exp $  /(             |tldTL\㿘@ union㽐@/  @T    (<   ( "`x @- ?@Qc @$#"`@ /`4@           c@Qz @@QW0%@Ӗ  $@䀤c``@I@/7  @Q8@Q6r $@&  50"   ` , %   `$@@$ '(@= , %   @ @ "$  2``2$`@ 퀤@P   @P*  2 & $& @P&  & @PА@IC  & && & @& 8  F@S# @Ȕ   @P, 7 0:" ƀ 4   ?@Px  ' $@ `,`  4`  @V^,` . @R Ȕ ؖ  @P, 2 ?@Pw?. "?@ Ā@ @ &@㿘@ @M`㿘@ @Rؔ `@@?` $@@PE$`@PC@H@RȒ 㿘@㿘@P    $ $ *`    #" # # #?㿘` $*` @@  2 "  @  " : @Hu  & &   @6@  2 @O$@㿘  @&   22 &   2   2    @R  &   @ 2   "   & @ `"   2   2  㿘  % @R' # ($`x  `x  @R `x  @Q8@R  "&& $Ą b|@$OpenBSD: qsort.c,v 1.5 1997/06/20 11:19:38 deraadt Exp $㿘  `@ `= @T.3%``@$@#6 $"    ,*  @$@ ֘ Т06`@S`@S`(q@S6`-    4  $  &  4  -% %    4      4  ``&$6? "" ? **@S1-`)@` @$$@`6? ""  ? ** @3 π@0,)$` $$$`6"? "" " ? ** @ @ @-` `@@$$@ $6"? """ ? ** =@R%``@$@#6 $"    ,*  @$@ ֘ Т0a@RW$@$ @  $`%`$@ 2`? ""#@  ? **#@@8``% 2`? ""  ? **@  @QYĖ@QO%$OpenBSD: strcmp.c,v 1.3 1996/08/19 08:34:12 tholo Exp $J@   J@J`  % b|@㿈 $ `    '?   @F ? ? $OpenBSD: merge.c,v 1.3 1996/09/15 09:31:50 tholo Exp $㿀'D'H 'P ( "`xB? 'D ``?'H@Q@L  D0?H'P@,H@Q{` @@'耢' H@Qo'` ?' @  ?&@  ?&@P€ ?  2" MP€F'€464'- P%@€$@($@PY%@@Q2 P€4@P€4=" "  $@ `$@`/  ,@ ` ,@`!`" $@ `$@ ` ,@ ` ,@ ` VP ` $@ `   ,@ `䀤` " $@ `  ,@ `"  ''` ?@ @ 'D H@P^@E@K~ 㿐.@` ?@PE@$ &@P<@@@P4@  ?@P-@$   @P'     "``"@ "@   @,*@`$ P*$   $@ "@   @,*@`"@ * *ܢ$$  @,*@`"@ * $ $@ " "`?  㿘  ,*  @ `$@ `$OpenBSD: strncmp.c,v 1.3 1996/08/19 08:34:21 tholo Exp $2J@ "J`  2J@ 㿘!ɔ@8  ( @ @n6@ @n6 @ @n6 ( "`x ?6h" " " " " " r @(4 а  ? (' ' ''''''!  ! @   "  "& `& . ``& i& &`D9 (' x  @Bp ?#` ` x 2``o (  & 6b@ f&  @"& G `G!&  (S   & @L-x 2K5 (@6 !& EI7FHJE!b(`!b& & & & & & &  @F "'5 (`  2   "` @є @͔ !  )€??5 (0 ( "`x5 ( x@`"&x@A&x 㿘  `"" @ & " ( (" "`x?@C: '|'d 'h'`'l't'x'p ?"@ (  t  'lt  |Ex @`'tE 'x| "'||EE @` 't'l'x'd'`'|'p| ဢ@d[ (@Hא"$ \ @K"$?$a| $$a$at$ax$b@H$a J$`&& & & & & & & & aFb  $b F=99<AF ctȘ"cH& & & & & & & && ` " (   (  ( b  $b @& $aaА`  (@i?$ab  $b aВ @$ ?`a@J `̀@wa@A  •  (L!b@b ?F$b \ $b X'\ T/ P/ L/\'X/ H/ / /X'T/ `/ `/ `T//'P///P'L////L'H/ / / H//L!b@ (  O?"@~ (_2z ('pb  $b $a$bp `؀!'p"'pp@ 8'p` b  $b b $aԐ $b $bp$ad p?*  'dpd* @ *'ddaؐ@L ?l@L??* 2``4aܐ 4aaЖa@ې +$@b :; `@@3?b  $b  b  $b @b  $b  (  ( O"`x` ` "a@GaЀ?@@@G 㿐 @1  (  2 2   @ ( "`x, `x 2,?"`x@  "@  `2? $4 $ $ !ڒ 4 $ !ؒ @Ij@  @ 0?TMPDIR%s/bt.XXXXXX/tmp㻐@Hɰ 9@H"9"9"$@%=?'@H @#N?@M @H   㿘  `"" @D & "  (!А "`x?㿈  `@/ $  ( "`x'?@  ?  @@ 0#\  @ 2!Ȱ" @ @@0@$ P" `2@0' ` ` `.' .. . .' . .  .. '... . .. 7...7  `?2 .O.* 2   ܄ؚԘБ.`2 7 **  '. ***'**** ' `* `* `**' * * **`*`2  ² 0ki* 2  e ΰȞĆ.`2 @7 **@  '  . * **' * * ** 1'****'****' `* `* `**' * * **`*`2   P" `2@0 ? ``U2 * 2  Ģ+ 2 @  '``. +``+`+``@' +@ +` +`+`` @ `@' +@ +` +`+``@'+@+`+`+`@ 7 + 2`*@ *t`Ģk* 2  f ܰ؞ԆЄ̪ʑ+ 2   '``. +``+`+``@'`+@`+``+`+`` @1`@' +@ +` +`+``@' +@ +` +`+``@'+@+`+`+``@'+@+`+`+`2  7 `+ ʒ@2*` *`' . . .'. `. `. `.'. . .  . . ' . . .7. .7. ..t#tp * d * #p* l t`*  * (` (` ph(`  #l  * (` (` l(`  #h * (` (` h(`  #d  * (` (` d(`  #` ` `* (` `(` `(`#h ``"b @@ $`b  ( "`(   ( `   ( "`x?`aܐ < (`Ԑ@2? '' @> `@> `aܐ Ԑ@?Ӑ '' @>} @>y `aܐ ̠Ԁ2 a@ @` "?)`  Ж@ 2 @ ?  Ѐ @@  Ѐ "`b "`@m?2 `@@ ?`    ?  "@ @ #\@Jn c0m,* 2 2`   , "*@>  ,  6 "@6  2  ` &  $ ,@ `@=`@=`(@ @@ 2 a`@2a`  4`a䀢 2@  2  5`?2 ?@2@ $a 4a쀢 2 @`2@ $a4a$a@@  2b @ b   $b 㿘 @!袒 2!I&!& 6 ` ` ` ?"@  @*7!䀢 2`` 2/*2 2`?@2' @ &  6!6 6!쀢 2* 2 @ 46!쀠 `?&&!@/  㿐  `"" @# $ "  (I   (B @L@   6 " =  @k /'`?2  2  @/ 2*?  @N`?2     @  ?`?@  ( "`x? "  $" 㿐@ @ @ " @@`"g@ ,@   @ "ް ` ?2 ? =@ !?&! 2"- 2 `@@  ! "!2! @y&!@ܔ  @k @Δ 2 @! "!2`! &!@@`2@ y@H @ "y @ i`e ,@3   @ "c   A@$ !?&! 2""- 2 `@@  @  @m `!"!2`2!  &!@ @T 2@  ?@ !"!2`! &!@"`2@є  @4&@`?㿐 @ 2z x? 2  @n`?  @Q 2&` @ 2M" `?2  2 @S <?0L@ H ? 2 @ ئ ` ?2  @" ?#@Ӕ?"%    4 @  " `?2  @X  @P  ?@K ?@ ?㿘?r# @  ` - @  @  ?"u`?2  2@@   4`!ڐ 4`H$` @ 2q?@ 1 "D!i?`` @$ @;.`?@4`*2  ?#  2*`2  `?2 "?* `+ 2  *2*` `?4`@ ϔ @! ,@&! 2@  @   @  ?@6  @ ʒ  㿘 (@   @  .@r 2m?.@  `` @ n` ?"^?` " @@` @ b@ ?2@P?`@ ` &@ @:@6*?#2@   3*`2   ?2 "?* `+`2   *3*`  @?6 ( @ @2    2  ?6  㿈  ` ,`" `  `  #\'7 @) 2 7'@ 2 ` W,`?2 ?7'@  ` C,`2`"@ : %' 2`7@o 2 `" @  ?2 ?2('`"$'@  /?'7@N 2 ` ,`@   $@4`@  '7 `#\  @  `  ,`㿘``"`@ ۔  `"@ l ``" @ ̔ 2`? "@ [  㿈 ``"@@ O $``B d*` € `( @@/ ( "`x? @t#\a@Cab  @ @ 0$`㿐`]B"*` €  (  ( "`xL?@F    @ @ F "7??2  "  "&@)6` @ ̔ %   * @  @  @ " "??2 `" &@?2 ?6`       㿐  `  @WS @   D "" `D6` ` ` *?2`2 @5  @ p  @ є " &6`   `,`&@` 6`` ? @ R 2 @  2??2 ?6`&@ 㿐@ 2~ "[" 2s' '@   @  ' ' 7  2&  +@ @   @ i 2$@2D? @  >??2 4  4 @ @ @ ܔ  !& ?2 @2 @ ʔ `2 @ ) 2$?4  & &㿘  " (@=m& &  (&   . (6 㿘 ,&! @  2& l  2`*`    , 2 @6 @-   "@!&P, `?, 2   +" 2$&-`    @Y 20 4 ?2 @2&  @# 2 &6  , 2!,2"!2`! &!   @ /㿐 @ ` ' 7@Ĕ  @  0 @   & & & 㿐 @ i` '  ?2 ?7@  @  0 @   & & & 㿘@`* @\7    @A 2n?$`2" @@ @R 3b /$b. * 2`2   .  "*@1  .   4 "@4  2    $  * @1b b$b @$b@ 㿘  `@ $  ($ @`" ("@@% (  " 2 $ @  $?$ $ "`x ? "  @$" 㿘@ 2@?`@ @L  @G 㿘`. @   " @( ?2I?`` @& @1U. ``@ " @: ?6`?* c2  @ 3@*`2  ``? ? @" : ?* `+ 2 ` *3@*` `` 6`b?$b㿘@  ? ?$  @`$㿘  @/N㿘 '"P`@.  $ 2 0  ( " x@4 G?"  @/. @? $  ?4 $   4 ` @@" <@6[  <$ 0 $  8 &$  2 @- J@/+!@  $  $  ?Ȑ*@$  4 2 @ 4 4 $  㿘  `"@c $ `.K ȓ*` €@% ((" ( #  $    ( " "  $?2"G " )2"!€??<?" ( "`x5?" " )2 "!€ $" ـ8 @\   ( , ($ $@"   @@0@$ +D++|++++`++㿘'L!Ā ! @5y @5 `; &!&!!L@/  &!& "@ @`* @   !@3!̀ 2.?&!" @"#!̲ @ !Ȁ @5@@5~`2&!? &!!Ȓ@/' !'''  㿐@/ ` @/& :! @5 @5L`$?&'!?@' @ 8@/~@P "@`' 㿐` !@?@@k %? $$ $ $ 4 @4  @/R $@  &ۦ@  㿐@/7 `@/3  @l 2` ? "!@   ? @Z "'`'@ @ 㿘&`!Ԓ&`"  @&!@&" 㿘!Ԁ`@2   !&@" `$" $!@ 㿘 ,&!  @ J ( $@& 6 m   ?2  !*`2 @`*+@   @( !2 !&! В*2 ?@    ?*2 ?@    # @j @e  x' ,` *`  ? *`   #  @K !?&! ` @@ ߀$x 8@6\ # <   ( "`x  @ $(  &&   ""  %&$ &$&$&$"$$"$"$ mpool_new: page allocation overflow. 㿘$?M`@ɐ @4 @3 , $ &$@"&@" &$   *   * "" 2 "" "" " @2 &" & 㿘  *  䀢@ ""`@ "@@ & "`  @"@"`@3\  㿘@R ?   *    "`"  ,"@$ $` 2@"`" "@ @ & "`  @ "`$  $ @2 &" &    Y, &"@@ "P $@7 $@+ 2C @2@ $$@+ $   ( "`x2  @5  $  ,     `*  ,   $$ ` 2 "`" "@$  $ @2 &" & $" $$    `*` *` 㿘 @ & "`  @ &"`@2 2@2 㿘   @f?2  ? 2 @$  ?㿘dd @*;d@"7d  2/  @A?<    *  @@  ""` @ "@ @ $`"`  @ "`, $@"2 d@2    d@4S $ , d $d 㿘$ `$$`` @6$$@* 2?@2?`$@*$$ ?` .``("   2 2  㿘'L'P'T'X@L$_ b|@㿐@6  @   ``  @ ( "`x @) " 3  `y!3 yyyy H`X3 # $# ,# (#  # Jr  wa (  (        &  " x J+b  J +    "@ %$sniglet^&8`   ( "`x@!ܢ  ?$a$a@Q?$a ( x @ m a@3   ̀@`@  ` @ N ( "$a !H$a a@)!?! ( xp! (2 O@!a@2 O`?  Oa  €!`@ "` OX! (`(@%֐ $a@ 2V ` `D* a8` `*@ :@ *`$a@3   `@<А$a0@<@$a0  a @ ?$a$$a4@0 $ P! ( x@֐"$ xQPQQRQ!c$<p"b` & & & & & & & &  &`@) a@0$ x 㿘 ?@ @0 " ? ? (  x?8!H` ! @$ $ $ $ $ $ 4$! $ 8$  D @2  Ē @2 @` @} :  @ w$ $ - " @ m *@@@ $ $  2$ 4 2$!  2  ဢ@ d"$  ( "`x  $ @  㿘 4@$  & @ 6  *  D# *#  * ,& $& `@ږ " ?!.`2 ? & ,& < & 0@$& (@  , @4& @㿘!4@;    ( x!؀ !!ؐ?* &! @/!??&!@/!@K 2! ( x! 6!!8, @ "!@/! , !?@(+@/ ( " x?㿘` ( "`x? "? !4  @;  2 ?@  2?&!0 㿘!4 9aa!  &O&  !!& @  @' ?"$?@(!?! O (" x&!,? !8 đ, ` , @ @  2?  ,  㿘  @=   (" x#!,?㿘  !   (" x#!,?  @ 㿘      @    (" x",?㿐 @ @9 ?P ` ` -` G`   % 2  `@ @ ݔ G`   @9 "s ``݀@ +2 `'@* 2 `@9 "W ``  T?` ` @ F?F ` `C `! ``+00 `6 `,@  @Ș  & "@&@ђ 2 `@k  `?@  ?0 @.?? ` ?-`㿘     (" x$!,?!$   $!($!$$!  ! 2!$ $!( ( @9 "m?$! @ "  ($!$?$!$_ !(*  `2@ *@ @8 $! $!(`  @ `!$$!  $!$"! @ "! !**`     @   *?0)! ` @ @ &@@ ? " &`! ( 2  @& *@ 2" &@  !$ $!($!$$! $!( 㿘 (  4  0& (!@   @  *`*`!@0 "+?&  @Ȓ !ؓ,` "  ?!! `&!&! (@     D*` + "&  ,  & ,& 0@+㿘@-L  @'ؔ&@/ @-g$㿘! € , (  0㿘 @z   &!  @s.@   ! ( xN$ x?6  + +* !ؐ@" ! `&! `7 ``20S(* * * * * * * * ؔ O4OOOOOpO\OH$OpenBSD: calloc.c,v 1.5 1999/11/10 20:12:31 millert Exp $㿘@1@, @. 㿘,` ``$, @2 `@'(,`2`6 $, 2 @'`,`2`,``2 6**`@6$ 2`2`㿘`. `@C"?. "  ,"* *`@`2 `" @ @&@4.`22@22*   @4 248?$8``.`㿈  @78   @70 2 j?- .`3 3`@c Y  - `  -`@<`` , @ '2$'2%* "@ , 2 $ @ @&o@ "@44 @ '" ('`@ʴ@ "* 2``**`4@@% 2`@* 2   - ` ?-`p?*2`@   ?* 2   #\@6 2?܀؀*,`2 ` 2%`# + 2**4' 2*`* 2 2`@6w c  @h   l  i,`,`2  ' %@ '`' `# '`2#  * @  `@  @͐ "w #. * @  `@ c@ 2"?U .`* 2`@  *` `8,`,`2  *F @ 㿘`' *2  "- * @ ?*2  `  ^ ?@5ʖ "\?``"  Ք*``ё* *  @  `@ `@= 7 `  *  @  `@  ؔ `@W 2?`  .` 8` & 8 (@`` 4 $  А@ڔ ?㿘 4@@ `2  & 4 & 4``@r.`,`2 `@5P  &` ` *`*2*  2224`㿐!  6@  ?6` 6`  <@A ?*  D@  3 *  <  '@0 ?*  D @ @> @" ?P?@"?  ( O"`xB?6@`2  @ 2  6@ ?6` 26` ဢ@-`"@ :  &@?'  .@ .`.`.`` 7.@.`@  `@?7 .@.`` 㿐!? @Ր 2o?  ဢ@,! "@ :  $'++ + +   `@`7 **  <@ ?*  D@  4 *  <  '@u ?*  D @ @> @!Ζ ??@!? (  O"`x?㿘@) !!<   , &! @+H " @+B?* $ ĕ.2 !8.`" $      (HASH: Out of overflow pages. Increase page size 㿘 D, `$* : ?: 1 8. @ @c €2 * ?  $* ? @  :  ? ?k` *` Ց. ,D@  %$@   "@ * $@ g$  Wc @!= 1 % *` ,$   ?$   * ?2%``W, F  2e ` g $W% * ,$  , ?$  :** %  * @% , ;C  :**$   * @%  @-*` $ ?%$  D D .  4  ?* D@$@ g4 . . 6  㿘`2 ` '*  D@  $&& $ !8 : +`*`   @|  :**$   * *# @4TMPDIR%s/_hash.XXXXXX/tmp㻐@)k Y@)^ Y Y 0$@ߐ?'@( @?&!@.Y! @Ӕ  @( ! ?㿘,``$4, @2 `@"`$ 6, 2 @!64`4`` *`$ @2`* 2 㿘!@6 @'O .`!8$ .`        2@'^  ?*@    2@* *@ 㿘`*  d* 2 *`*  4`$ , 2 @!  +  +  42*`4$ 2+ * 2 4 `s%'+ @ @- $@,`4 2 4 @!] 4%@*"@2* 2  4` `.`*`@`?`*  H* 2 @ @"**  4 $@ ,`2 @!  +  +  42*`4$@ 2@*  2 +  4 ! 2`?+  4 `` .`*`@`? 㿘`  * 2  ( `*  ` * ?`*` .`2`@1S H`   +  ?  `22`$`&?$`?2  + *`2 "  2 ` *`@ 2` ` ,`  8 ?$ 8㿘`,  " * 2`@( `$*, 2 @ & @0 $@``" *2   **2  ?,  @ ??㿘 @+  ? @0 "    +  @  `+ &@  㿘`.  `2.*  ? @0 "s?`  .  `*  ? @0 ]` ?* @   2  "?@0i -,`D?  &" !&  * !$  &!(&!$&!  ?@0L (&!  &!(`@ 2" !$&!  &!$ ,`2 @?&   (!@ ! & "`x?㿘`   "@(`! @%"@$ @&!, &!( * ?@/ /&!  `,!$&!  &!$* @/ Ĕ $?,` 2 @  (! `@M@ 0 "`x?㿘@  ?&! &?㿘```? * 2 "@ ` ! @$@$ /$!  ,%?@* @/ ΐ ,` 2 @  (!``@@ 0 "`x?㿈\'P 2d?@ P* 2`` 4 P@/Q $ L?$  `"`` *``/`` *` 2`6 *2 *62`6@2`* 2 P$$  `` *` *  *` 262*`@2`P  ?6P"$ $ $OpenBSD: memcmp.c,v 1.2 1996/08/19 08:34:05 tholo Exp $" @ ` ?  2    (  $\ b|@㿐@3 ?㿐 @' ?㿘  @  㿘  @   㿘8` ( "`xL 2 $? ( "`x@$8 L@ A  0,@V ?L`XL X`?#@  @( 4GA,?L X` ``%<'+ ( L/2?,@a X, `Q%`x8L`*@6!  &@D , A, a, ( x`5 " @-!  ( x`' @  (`x `? aL Z2b" ,  @ `ʀzŀ  /dev/arandomx @ۨ]#@ߒ ?@y x@S   %?p    , 'l p l @ ?2 ?. ` `.   @ q @.  ` , , . 㿘 '"\`  $ਐ *@? #"\**ਁ㿘 '"\` $ $ ``? *` ` `,  @ 2@, ` - - ,㿘 '"\` $ $ਞਐ (ਖ   ` + *  *ਔ  (਄ ,   ` + *  *ਔ  (ਢ +` +  *  *ਘ (ਔ ( + *  * $t b|@$ b|@$ b|@$ b|@$ b|@@'P'T`'X#?"77'P`''''@o`*$OpenBSD: vfprintf.c,v 1.13 2001/08/13 19:16:34 millert Exp $㿘` @&`&`&` @   ? ,$ 7''7'''''@1 @5 2? @  @4 InfNaN0123456789abcdef(null)0123456789ABCDEFbug in vfprintf: bad base0.㼐@'H'` ` 2 ` @I  ( "`x*?`   HW` HH<'$'8 ''''' '$ @'$  $< %'$'$$ $$@ '耢 '[ ޤ ' $  '$''?/+$J@`'$?`Xe# *` €O+ $ /+ $ L ?Ѐ 8, L** ?Г:`  L $ 8  '8H8@8 .' '$.' $ '  +/+$J  *>'$L ? 8, L** ?Г:`  L $ 8  '8H8@8 .'$.?&i?h$?Ѐ  , * $?РJ@`?Ѐ '$ $?&U?T?M  , * $?РJ?Ѐ '$ $2A'8 9'8H8@k2$/ - @$J l2( '$$ 8`@.@/@   ''8 @ `.@*  : `.@:  6q  -/+`k ? g   G  "  8`.@''ȴ?`".@''ȴ?@% # _ -/+_! @% _! ,#`!#\7@ƚ0 g G00?@$ g g E e e f'0@' , @ ,`  O7 @  O7`  " O7 C  -@/+  8`.@ :`:  `.@ " @ 8`.@ 2`.@ "   '' 8 @ `.@  `.@  8`.@_a '  q x8`.@_!Ѐ   @! "$/+@!3   'x'|x 8 @ `.@  `.@ / _!_!  ''X'\X  8 @ `.@  `.@   2 /+ '?`S "  7_F!  4`,  `4 0 , 806 03,  @! `0, i  ` `0, , 4`  ` 4  ,'@  ' ? @/@ /+ ''O+ `' '`4O+" . 3b $$` '耢 ': ? b$$@ '耢 '$ O+  + $$`  0/8/98 $$` '耢 ' `4" . +b $$` '耢 ' e? 4$b$$@ '耢 '̒ O" - +b $$` '耢 ' 5? 4$b$$@ '耢 ' ! e$$@ F BV0_" $$` '耢 'u 0,@  $$` '耢 '\ ߤ,?  +b $$` '耢 'B Ť? 4$b$$@^ ``,_" $$` '耢 ' $$` '耢 '  0  - +b $$` '耢 ' u? 4$b$$@ '耢 'ܒ _$,$,@R$,$, @ '耢 ' B0,"@ - +b $$` '耢 ' '? 4$b$$@ '耢 '  _" $$` 0$0 @ '耢 'o 0 _" $$` '耢 'Y ܤ$0," $,0" @ t , 4 R   ./8/98 $$` '耢 ',  B,$,?$, .@ ? 4 +b $$` '耢 ' ? 4$b$$@$$` '耢 ' f$ $  @ '耢 'ϒ R 1" , 3b $$` '耢 ' 5? 4$b$$`'耢`' !8 &  ' 耢  8' 耢  8'8`@"` @( ` @? pxxxxxxxxxHPLL@T ?`/*`d * d *`d * d*`d*d* N%2   N `Xh"\*` €N ?` %L* @ L*`ДЀ @LN*6 N ?`  L* @ L*`ДЀ @L $@  @ d@r`d *@`@4 d@d`d *@`@4NЀ NЀ   +  * ?И NЀ  $ @ `@d@2`d *@`@4qpN `@d@ `d *@`@4_^N@d@`d *@`@4ONN@`@d@`d *@`@4>=N@d@`d *@`@40/N`@d@`d *@`@4N@d@Ғ`d *@`@4N `@d@`d *@`@4N@d@`d *@`@4N@`@d@`d *@`@4ߦN@d@`d *@`@4ѦN `@d@`d *@`@4N@d@p`d *@`@4N@`@d@_`d *@`@4N@d@Q`d *@`@4N`@d@B`d *@`@4N`@d@3`d *@`@4rqN `@d@!`d *@`@4`_N@d@`d *@`@4PON@`@d@`d *@`@4?>N@d@`d *@`@410N `@d@`d *@`@4 N@d@ђ`d *@`@4N@`@d@`d *@`@4N@d@`d *@`@4N2N@q* & )d+ " d `h"*` €`@?``@? ``@?``@?x`` $d @e$$$$$$$$,$|$$$$$$$$$$$$($($$$$$$$$$$$ $$$$$$$$$$$$$((((($$$$$$$$$㿘@  * @ʐ&@@@& @  @$ &@㿀?"\ f#   e E  # 9/ -/?#\  ?@W耤 g G f# fJ 02 @c B  '@@# B3'@   0`*@@ '`" "@ ``, -,   +,  ` @-  0.@ A ` `0..   & 0. `0. &@(#)divrem.m4 8.1 (Berkeley) 6/4/93@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   & &  $OpenBSD: strtod.c,v 1.14 2001/07/09 06:57:45 deraadt Exp $㿘 $!.  ` @ " ,, @X "`"`"`"`   $`ḅ("@ 㿘? #  @< @@84`4  *  $ 2  ,   * @ ː, " & 㿘 @   *`   "`"``   N      &N    ?  * ?<* 0*  *   @, 0"@& 0"@" ?  0 0 0 02 "@0  "@㿘&  " " 㿀 `@6  `  ` . ' , `,`% *%@  ''@ L@ @`'?c '? c@J @  @C4`4 444 4  $@? #@* 4 4@"4 @   4 $@  $'  "' 㿘` #*  >``#! $!```"q$! $@ 2^$@"`" >`U>``2@㿘>` @ *@  Z `  " * ` " * " 2@ ` "`" & C`(` " ?8 㿘     H     ` * `@ (? # @  "  22: "  33 ` :`@  ?# @  : 2`@ 33  :`  ? 2 ?   ?0  8 4?8      ( ;``"##㿐  * ? " &@ " 4  ? "@ ,2   ? " 3 ,  ? " 4+ @ ?"#㿐T ?. . 6  `''`'   " *@ $ 2 '$   $   $ ΐ $ $   ` 5͐@& "@ Γ. @&. "@&㿐v? o ?` " *`"  * #??ā`@ 'Hb @@ `  0  ' ` @ `2`M@ - + '2M@`M@` @`0 *  `M@`0 @`O* : *'     -*   ?4`+  *  ?Ъ`M@ /9뀥 :E` =M@0Ϫ`M@0`π 6e ' `(``   -*  4+  *   -*    +  *    M@Ѐ Ӓ`e EI 2 `2"ڪ`M@+ -І `M@Ѐ .0Ϫ`M@0"`π !Ъ`M@ *  `M@?Ѐ/9*`%@ "@" 2     `H &@  ' 8B?  ?c(* @ $'%H  8BD? >'@ 2:%`"_H%`  #(.` ?$%% B"@ $%c(*@?$&@ .`% B@?$% B #(*` ?$% ?*%@P #(* ?$% B?4$ :!P ( ""`x䀢 H   + @?$% B?: + ?,$ ?%( B?  $(#a?_]  #(* ?$% ?K:4 ` + ?$% B?: + `@?"# 0 D(?)F!?()BD F? 0 ( ""`x䀢`|H 2?@?r  2'''m  0[5 # @  I ?   ? ?2@ :?8 ?񁠈 ? 0! B0&  @!+' `H&1'? 񀤠" H!`P H`X XB'`XB &'??@n?Ѐ B- %?,??? @'cD?   #"D? H `XB B?d?? @D?   F#' €? ` `h 0 p ``` *@` ܒ `       $@  ?3 6" @   4`% & $@    2`&  u & V  ?H 2"?"쀢 #㿘 t -    `@ `1?#  @ @@4`4    "@ @2 @:`"44 3`: ('  "'  0?#`  - @4   4` " 2 @:`"44 3`:  ('  "' InfinityNaN0h $!'L'P'T ? $! *@  "" $"!Ȁ`6'@ '@ * '  T#"@̀ q?qq""\ N    \"x B T "\qְb "  +ȓ2g Ⱥ| ?* &' $2`   @Ȓ"@̐$* 2@ ̐"*@'  B?{͔ ? '?  ' F`xJHBH ' B# '#(, $ȇ%)'#?    '% 'L 8'LL` 'L L "'u"* €?'? 'P'P`P 'PP' 'P '쀧`  $ ` "!  ,  `"ᴪ $"! ` Ⱥ  '  c(* @<"  #Ƞ    ?Ȁ # /`@ &' B<  `ȅ!?Ȳ`c(* @>`$Ȁ %B?#  /`@ $ȇ%B?ȡ<  `耢 ` 9' 쀢 ` B ?'ȀF ?0D'@'&   '$% ?ȅ)  P?䀢 Ic(* @`$% ȉ ȑȍB'`0-@ȍ…&' Z?ȉ" #ā) 0 @6T? ȑ DDB?ȅ'`0.Ȱ …&' 8?ȅƁ)} 0`@4?Ȑ* c(@ $% B Ȁ@B'`0.Ȱ ? ȅD-Y 0ȉ&' 9?Ȱ?N 0"? Ⱥ`D??Ȥ  ZX#(, "P #    ` Bȁ  1-@ Ȁ@ȍB'`0 H.Ȱ  ?ȉ"#B  ?ȅ$%H` 0?N 92?-@ .  B? xD`'Ԁ ! L ؀d3 6" &$' %  ` @4%%&@䀢`` 4 y p L̀ 2'?@2 '   ''  *`p  "@ `  ` "```@h b耢`  ݒ  Ԕ 쀥L  Ɣ x  1Pɤ8 1-@`Ĥ``'܀'  Ը* @      Ԁ   ' 'Ԑ  `Ԣ 01G  %a` L` ̀ `9+ 4`f.& ``L`̀ `  4`2N.`"K.``:  9E. `9` 9., ;..@   # ` 0.@  ɒ 4 ??`N  1?N 9  .-@`N 0"?   Ԁ`@ސ ܐڐ2. 0-@` .T"\2"ɜɜɴɸ@(#)divrem.m4 8.1 (Berkeley) 6/4/93@@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"&  +ddv0ᘅ(#$OpenBSD: localeconv.c,v 1.3 1997/07/23 21:14:40 kstailey Exp $$ $"       $((()(*(+ (,!(-"(.#(/" <" "` "`"800.㿘` ` ` 2 @@  ( "`x?@`  ` `, $$ ڤ`" $&`ְ `s "` `@  @2` :` ``#. ` *. @ ے` ``&@$`$`$@$`` "`*@@ [`@"@$`$@.@` @ I@@@<$@ 2` `` `,` $u` ` @ -`@"@$`$@`" $&`b   `  ` @  "@  `@ ` `@ @ @ @@@$@ +0@ `,` 0   @ ٔ`@"@$`$@2`@Ɛ   `" $&` ` ? @4` 㿘 '"P`2 @& 2   +?"  0` @@"& 0@ & 0 &   ?6 &  6   2 @   &  &   &  㿐  C & & (&@&@  y  C  & 6 & &  &"`& &  &@ V  2  6 8T  &&@   &<  ؐ`?`&$&@( "&@$ L ( (y 耢@"$㿀. * "* @>  * ?  ? #  $"0"0? P? ?    ( 0 8 @ H?88888 8(80888@8H8PX㿘 '"P`@Q!P   R X 2 &  ?2 2 """""""0"4"D"H㿘@P " `P  ` "@` 2`} $㿘y@Ɛ"y & ' " "bP㿘T @j  P > B< P ?Đ*@4 㿘 ! V  @6  ?Ē* 6 V @R㿘T   @#?  2  ?Đ*@4   4 < P㿘@V $ b|@㿐 @   ??#\  ǔ@   @  $ b|@$ b|@㿘 2 y@7"    (@  "`x?㿘T` `  ` `@" $@`$`` ? @4`  $`` &  4`, 㿘!P ? T` "??`X2$OpenBSD: getdtablesize.c,v 1.2 1996/08/19 08:19:20 tholo Exp $㿘@ x? `}'z"D*` € G  @耢 ~?|z d W  7  @耢 n?l ,  )  C  #     : !              '9'    '1'                    $? ܖؘ @R ? ܀ ? ( "`x ? ܖؘ @> ??܁(4Tht\ $4@T`lx$„ b|@/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bin㿘 @lU  N (`2J (   < ; <"zb@f <9    1 ",  ?`#{ *` €#?###    (",&  & ( "`x?(4@LT\dppppppppx쀂$ʄ b|@$OpenBSD: bcopy.c,v 1.2 1996/08/19 08:33:58 tholo Exp $Y V+ 2     " @*`2 @"`2 @*`0*@    "2 2  " @*2 @" @* error: x 8!{'ؠ"@  &`''@ ''@'@~''ؔ @  & @p"` warning: x & {c@א & ` 8'@^  &`'ܐ @X'''@T'@P'' @R 㿘@! / 0. @  &  d6  & p"@  & &" @ "h@  㿐% &p. 6  * #\  .  @?! &p l@d*.  l$p$ l@  /etc/malloc.confMALLOC_OPTIONSunknown char in MALLOC_OPTIONS mmap(2) failed, check limits. P ( x )- &1 &|!@ ? j , @  2a|@!  ( hTOLđ* : `>>} 4*` €# * <%# # 2 8%#  &5"  & 1"` &."  & *"` &'"  & #"` & "  & "` &"  & "` &"  & "` %  %! & |!0$ $ L    & "``#\   @$? &?"`l|!P@- /2  `? &# "`d$ &" p & ` %# #  *` @Q%#  &"`&`x\(L((x(((((((((((((((((((((((((l(((((((((((((((((((㿘 &/ t0   * `""` "@""" 6  4  &`d"  &*  l   "@   l"  ` & `. @v Ѐ`  &` "`@㿘 ( ?>   ' &>  `l,` o  c 2 2 *   *@, @ @ @O 2* 2`*26 2 2 2"  ?3  *  `"6 3 *  @(   #@ &   (3 *`@ (*#@  $?2 2   &`d l#* "@l"" l5 l `  "   `* @ " *` 6 l"@& &`#: *  ,    @ allocation failed. 㿘 & `` & `$0@  (0ܐ & ` 2 &~6!H & ` @~ malloc() has never been called. junk pointer, too low to make sense. junk pointer, too high to make sense. modified (page-) pointer. modified (chunk-) pointer. chunk is already free. pointer to wrong page. 㿘 & `@t & ``2 &~\"( d4` "@ ~T"P & h ~M"x & l*  o~A"`@ !`@ $0 & `5@30@00>(~* 3`?@~ " o2 2*  2@ `~" & ` @ 3`@ 0" 0&  @`0@[@page is already free. freelist is destroyed. 㿘 ] & `` &~z"(0T `Q & d6 "@ ~l"P0F &`h ~c"x0= & l* ̨  T!0. /~M"0' ~G"0!#   l* @ ' &! &  `l" `l@   & `+  @V & `@͔ ଢ  $" " "  t` t" "A$ t  :  2 @ " " $  "@0$ @ $ `%$ `2" ` $ `$ @ $" 2 $ $   " "$$!( .`%  @'# & `@#`@ `@`  $ @ @$  d2 " ?$` %h &l+ " h  l`p0l /  2 ~"0a2`*  @ `2 ~{"0U & ` @ @ *@$@    l* *`24    `"@`"`  : " $ "  *$ "  2"  d2 "  l* "  in malloc():recursive call. out of memory. 㿘! &  b &"  $ "  ?$   &`?$ ѐ" in free():㿘! &  c &" $ " Y ?$  in realloc():㿘 &# &"`  ""  ?$ <   &`?$ "$OpenBSD: abort.c,v 1.7 2001/08/12 12:03:01 heko Exp $㿐?ߒ'  @ ,   & ` @",@A@G  @L  @ @6@< @ $OpenBSD: exit.c,v 1.4 2000/01/06 08:45:50 d Exp $㿘 ( l` &`?, @`, @?, @`2` & @$ $ b|@$% b|@x  ??''쀢'  ("`x ? (  *@ @  '@؀ ?؁$. b|@$OpenBSD: sigprocmask.S,v 1.3 1999/01/22 06:07:56 marc Exp $@2@  0 b|@2"$OpenBSD: brk.S,v 1.2 1996/08/19 08:18:02 tholo Exp $cx@4   :b|@ c$OpenBSD: sbrk.S,v 1.2 1996/08/19 08:18:10 tholo Exp $   : b|@"$OpenBSD: getenv.c,v 1.4 1998/07/16 18:02:33 deraadt Exp $ 4 (p /  p#8*"@ J=2 p"  J JJ 2 J=ې    㿐ƒ$ b|@$K b|@$OpenBSD: bcopy.c,v 1.2 1996/08/19 08:33:58 tholo Exp $Y V+ 2     " @*`2 @"`2 @*`0*@    "2 2  " @*2 @" @*$OpenBSD: memset.c,v 1.2 1996/08/19 08:34:07 tholo Exp $(㿈'XX#d#h#\#` @ Ł$Ƅ b|@$I b|@$: b|@$OpenBSD: strlen.S,v 1.2 1996/08/19 08:17:59 tholo Exp $ J " $y b|@$ b|@h @   @8@ @   㿘 `@$6 b|@$OpenBSD: memchr.c,v 1.4 2001/09/07 08:09:31 espie Exp $"  `  ?2  㿐@H 'T @] T 31?T2 7耦(7耢 2: % 4`44`44`4`ؤ45 5 ȕ4'5 5  B'? 8' `@%`@`*  @@ `*  @@`*  @T  -`@T :-`-2 ,`- ͓2`   ` `" `` 8   đ. ?2@ Đ" * c'Ā@ '.` @ '  @ @ @?   '/ @   7@', @@ '@H. 2, @ ( ?#   ?#*`/@.  ?@+'$$66`% @"6``4@  * . ?  @26`@4@Ā2T`#@  " . @?* :@ @2. 4@*  *`T@ :̑* Τ Г*`@  +    ?( 8 2 + ( 2@(#)divrem.m4 8.1 (Berkeley) 6/4/93@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &" $OpenBSD: umul.S,v 1.2 1996/08/19 08:17:46 tholo Exp $ /)# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@&@# # # # # # # # # # # # #@+ 3`@@(#)divrem.m4 8.1 (Berkeley) 6/4/93@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  $OpenBSD: bcopy.c,v 1.2 1996/08/19 08:33:58 tholo Exp $X@V+  2     " *@ `2 "@ `2 *@ `0* @  "2 2  "? *@2 ?"@? *@;`` (` `?#;```0  ?2 `2 #$OpenBSD: multibyte.c,v 1.2 1996/08/19 08:33:39 tholo Exp $ "  J` ? `   ?J@"J@@  " *   J@"`   `(*`  $  b|@$OpenBSD: cerror.S,v 1.2 1996/08/19 08:18:02 tholo Exp $ ( `x??x@\ 7ޤޠ@+ ޠ@ ?  ޒ"@6 * 2     & , y@ & $ , kf@ Y,  @ ?+ V@:?`,Bἔ ł W  7  "  "  0= 9 ; 07   5 ?   `( ?  *   2`*`2  (" ` ? ? @ @ ` '' '@'` ?:      "   @q @   * ޓ2   * "@ *ʐ    6   "  "  0 @ e0 ޔ"6 *`3 ޒ*  }$  ޔ"6 *`2 ހ`*  & &  $   ,   `[` @ؐ?`0Sހ ? * @      @` @Ӑ$@$  ޔ"6 *6 ޓ*`@ &,$  ? * @      @` `?2 $@$  ޔ"6 *`6  * 2`&  $ `"@ 2 @Ӓ?@?  ἀ?$ἠ  Ѱ  0Ȕ Ĕ  Ŀ? Ļ-㿐 a  4`$@4``$`@$`` $` ```?2 @  &`4`7&&C%ؠ 2Ć 8  \` @`$` @ ``$ $ 4 4 $  Ԕ 2@' & a @Ɩؐ"&&㿐w r   $@$@$`$ $ $`4 4`!ڒ4 4``  $ $` @&&㿘!ڐ?6`6`*  2 `@?2 @$$ `6`6`*` 2` @ ?2 @$ $ ` 6` `&`   㿘!ڐ?* 6`6`2`&@ @ &.`  ' 6  ` " 6`6` * 2 &@@&.   `"`  @>?2`  ? ` ?" *2 @ 6`6`Ґ&`   ? 6`&` Ù  x`!ڐ?2 7'T*`* 2`'X2`     -'7  ''`'-`2 2` X6  "-  -0*  -0$2 @ @ `  2 @ @ ` `  ? `-2  @   2  @ @   ?Q-`2 7   /`2   :/*`2 -2`@ $* "6 2  'ܐ?ܒ`@*`2     -`-2  `-` 2  @6    - @@-`  22@:# # "2-`2 T @"2@ *F`-2  ` `  "*`  *`0  *`0@ @ `  @ @ `   ?*`  @ @ @ ` -`"2`64 ﻔ*` `-`2 4 6 6㿘      " q  ?` (0 `*`0`@*`0  㿘   "   "     6@ !ؐ?*@ ,  ?!0    2@$   `?ʖ  ,$ ! " "@!&& $! "㿘! ! ` "`     ͐ $`   ! |?z&!@"``@"` 2` ` "n$` `@ *  ? ` И 2m ` "``  !ؑ2*  !0  * * " *"` "=$` $`  27$`  23$`  @ *  ?     ʔ 21 $  , "` "!`$ !$!"  "@ `" $` $  `  `" $` $`&,` ,`!Ē!$`$@&!`" @ :@`! "!""!㿘! 4 !/   `   6 2?`"  "     " "!2  @"``"` *` @`"!"`!"@! ` $OpenBSD: crt0.c,v 1.3 1999/08/20 14:11:36 niklas Exp $...U.U.Z.r(. .+.,8.,8.0.x.h.`u.Xu.Pu.Hp.@0.0H.( 9. _ . . . X. X- - - - - - - - - J- V- [-x a-p v-h -X ސ-H X-@ X-8-0-(p- X-0---,X,X,X,X,,,,Z ,x,Ƹ,Ƹ,-,.,ʘ,x0,h,` ,X,P h,HP,@P,8P,0 x,(, H,)@,-**$OpenBSD: args.c,v 1.11 2001/10/06 22:31:54 millert Exp $$OpenBSD: conv.c,v 1.8 2001/08/07 14:39:27 hugh Exp $$OpenBSD: conv_tab.c,v 1.3 1996/06/23 14:19:46 deraadt Exp $    [.<(+!&]$*);^-/|,%_>?`:#@'="abcdefghijklmnopqr~stuvwxyz{ABCDEFGHI}JKLMNOPQR\STUVWXYZ01234567897-./% <=2&?'@O{[lP}M]\Nk`Kaz^L~no|JZ_myjС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx7-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|_myOС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx    .<(+|&!$*);~-/,%_>?`:#@'="abcdefghijklmnopqr^stuvwxyz[]{ABCDEFGHI}JKLMNOPQR\STUVWXYZ01234567897-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|ཚmyO_ !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwxjJ7-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|_myOС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx@(#) Copyright (c) 1991, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: dd.c,v 1.11 2001/10/06 22:31:54 millert Exp $$OpenBSD: misc.c,v 1.10 2001/08/07 14:39:27 hugh Exp $A.$OpenBSD: position.c,v 1.4 2001/08/07 14:39:27 hugh Exp $@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount_cd9660.c,v 1.11 2000/07/31 01:57:06 pjanzen Exp $$OpenBSD: getmntopts.c,v 1.2 1996/06/23 14:31:10 deraadt Exp $@(#) Copyright (c) 1980, 1990, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: df.c,v 1.30 2001/09/06 13:29:08 mpech Exp $@A0?PA>Bp>C=p<@$AA@Y@Y@(#) Copyright (c) 1980, 1990, 1993, 1994 The Regents of the University of California. All rights reserved. rHXP@0 `XP8(x`@(xph`XPH@80( xph`XPH@0xph`XPH@80( xph`XPH@80( xph`XPH@80( xph`XPH@80( Pxph`XPH@80( ߸߰ߨߠߘߐ߈߀xph`XPH@80( xp`XPH@8x( ph`XPph`XPHH@8(ph`XPH@80( ( xph`XPH@80(       h P @ (  xph`XPH@80( xph`XPH@80( Pxph`XPH@80( ߸߰ߨߠߘߐ߈߀xph`XPH@80( 9:@:8:0:(: V8jjjjA0123456789abcdef@(#) Copyright (c) 1983, 1988, 1993 Regents of the University of California. All rights reserved. ~p`P@0 p`P@0(p`PH8( ` h``XPPH$D@%88&\0)(5 |h|`*+\x.3p !;T ";D|  ]eL]\ZW('< Y@YZPZZ[Pph`XPxh`0``@UGHRBD M@dmCXLS1@2 3xp`P@0 pXH0xph`P$OpenBSD: atalk.c,v 1.4 2001/08/18 22:14:03 brian Exp $@(#) Copyright (c) 1980, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount.c,v 1.22 2001/06/24 17:03:16 csapuntz Exp $@   x h P 8 0 (      @    $OpenBSD: getmntopts.c,v 1.2 1996/06/23 14:31:10 deraadt Exp $@(#) Copyright (c) 1987, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: sync.c,v 1.3 2001/05/18 07:32:36 mickey Exp $@(#)cl_bsd.c 8.29 (Berkeley) 7/1/96@(#)cl_funcs.c 10.50 (Berkeley) 9/24/96@(#)cl_main.c 10.36 (Berkeley) 10/14/96@(#)cl_read.c 10.15 (Berkeley) 9/24/96@(#)cl_screen.c 10.49 (Berkeley) 9/24/96@(#)cl_term.c 10.22 (Berkeley) 9/15/96@(#)cut.c 10.10 (Berkeley) 9/15/96@(#)delete.c 10.12 (Berkeley) 10/23/96@(#)ex.c 10.57 (Berkeley) 10/10/96@(#)ex_abbrev.c 10.7 (Berkeley) 3/6/96@(#)ex_append.c 10.30 (Berkeley) 10/23/96@(#)ex_args.c 10.16 (Berkeley) 7/13/96@(#)ex_argv.c 10.26 (Berkeley) 9/20/96@(#)ex_at.c 10.12 (Berkeley) 9/15/96@(#)ex_bang.c 10.33 (Berkeley) 9/23/96@(#)ex_cd.c 10.10 (Berkeley) 8/12/96@(#)ex_cmd.c 10.20 (Berkeley) 10/10/96@(#)ex_cscope.c 10.13 (Berkeley) 9/15/96@(#)ex_delete.c 10.9 (Berkeley) 10/23/96@(#)ex_display.c 10.12 (Berkeley) 4/10/96@(#)ex_edit.c 10.10 (Berkeley) 4/27/96@(#)ex_equal.c 10.10 (Berkeley) 3/6/96@(#)ex_file.c 10.12 (Berkeley) 7/12/96@(#)ex_filter.c 10.34 (Berkeley) 10/23/96@(#)ex_global.c 10.22 (Berkeley) 10/10/96@(#)ex_init.c 10.26 (Berkeley) 8/12/96@(#)ex_join.c 10.10 (Berkeley) 9/15/96@(#)ex_map.c 10.9 (Berkeley) 3/6/96@(#)ex_mark.c 10.8 (Berkeley) 3/6/96@(#)ex_mkexrc.c 10.11 (Berkeley) 3/6/96@(#)ex_move.c 10.10 (Berkeley) 9/15/96@(#)ex_open.c 10.7 (Berkeley) 3/6/96@(#)ex_perl.c 8.10 (Berkeley) 9/15/96@(#)ex_preserve.c 10.12 (Berkeley) 4/27/96@(#)ex_print.c 10.18 (Berkeley) 5/12/96@(#)ex_put.c 10.7 (Berkeley) 3/6/96@(#)ex_quit.c 10.7 (Berkeley) 4/27/96@(#)ex_read.c 10.38 (Berkeley) 8/12/96@(#)ex_screen.c 10.11 (Berkeley) 6/29/96@(#)ex_script.c 10.30 (Berkeley) 9/24/96/dev/ptyXX@(#)ex_set.c 10.7 (Berkeley) 3/6/96@(#)ex_shell.c 10.38 (Berkeley) 8/19/96@(#)ex_shift.c 10.11 (Berkeley) 9/15/96@(#)ex_source.c 10.12 (Berkeley) 8/10/96@(#)ex_stop.c 10.10 (Berkeley) 3/6/96@(#)ex_subst.c 10.37 (Berkeley) 9/15/96@(#)ex_tag.c 10.36 (Berkeley) 9/15/96@(#)ex_tcl.c 8.10 (Berkeley) 9/15/96@(#)ex_txt.c 10.17 (Berkeley) 10/10/96@(#)ex_undo.c 10.6 (Berkeley) 3/6/96@(#)ex_usage.c 10.13 (Berkeley) 5/3/96@(#)ex_util.c 10.23 (Berkeley) 6/19/96@(#)ex_version.c 10.31 (Berkeley) 8/22/96@(#)ex_visual.c 10.13 (Berkeley) 6/28/96@(#)ex_write.c 10.30 (Berkeley) 7/12/96@(#)ex_yank.c 10.7 (Berkeley) 3/6/96@(#)ex_z.c 10.10 (Berkeley) 3/6/96@(#)exf.c 10.49 (Berkeley) 10/10/96@(#)getc.c 10.10 (Berkeley) 3/6/96@(#)key.c 10.33 (Berkeley) 9/24/96\^:   }) 00123456789abcdef01234567@(#)line.c 10.21 (Berkeley) 9/15/96@(#)log.c 10.8 (Berkeley) 3/6/96@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. @(#) Copyright (c) 1992, 1993, 1994, 1995, 1996 Keith Bostic. All rights reserved. @(#)main.c 10.48 (Berkeley) 10/11/96@(#)mark.c 10.13 (Berkeley) 7/19/96@(#)msg.c 10.48 (Berkeley) 9/15/96@(#)options.c 10.51 (Berkeley) 10/14/96@(#)options_f.c 10.25 (Berkeley) 7/12/96@(#)put.c 10.11 (Berkeley) 9/23/96@(#)recover.c 10.21 (Berkeley) 9/15/96@(#)screen.c 10.15 (Berkeley) 9/15/96@(#)search.c 10.25 (Berkeley) 6/30/96@(#)seq.c 10.10 (Berkeley) 3/30/96@(#)util.c 10.11 (Berkeley) 9/15/96@(#)v_at.c 10.8 (Berkeley) 4/27/96@(#)v_ch.c 10.8 (Berkeley) 3/6/96@(#)v_cmd.c 10.9 (Berkeley) 3/28/96@(#)v_delete.c 10.9 (Berkeley) 10/23/96@(#)v_ex.c 10.42 (Berkeley) 6/28/96@(#)v_increment.c 10.12 (Berkeley) 3/19/96@(#)v_init.c 10.8 (Berkeley) 3/30/96@(#)v_itxt.c 10.16 (Berkeley) 10/23/96@(#)v_left.c 10.7 (Berkeley) 3/6/96@(#)v_mark.c 10.8 (Berkeley) 9/20/96@(#)v_match.c 10.8 (Berkeley) 3/6/96@(#)v_paragraph.c 10.7 (Berkeley) 3/6/96@(#)v_put.c 10.5 (Berkeley) 3/6/96@(#)v_redraw.c 10.6 (Berkeley) 3/6/96@(#)v_replace.c 10.17 (Berkeley) 6/30/96@(#)v_right.c 10.7 (Berkeley) 3/6/96@(#)v_screen.c 10.10 (Berkeley) 4/27/96@(#)v_scroll.c 10.9 (Berkeley) 4/27/96@(#)v_search.c 10.18 (Berkeley) 9/19/96p@(#)v_section.c 10.7 (Berkeley) 3/6/96@(#)v_sentence.c 10.7 (Berkeley) 3/6/96@(#)v_status.c 10.9 (Berkeley) 5/15/96@(#)v_txt.c 10.87 (Berkeley) 10/13/96@(#)v_ulcase.c 10.7 (Berkeley) 3/6/96@(#)v_undo.c 10.5 (Berkeley) 3/6/96@(#)v_util.c 10.11 (Berkeley) 6/30/96@(#)v_word.c 10.5 (Berkeley) 3/6/96@(#)v_xchar.c 10.9 (Berkeley) 10/23/96@(#)v_yank.c 10.9 (Berkeley) 5/19/96@(#)v_z.c 10.10 (Berkeley) 5/16/96@(#)v_zexit.c 10.6 (Berkeley) 4/27/96@(#)vi.c 10.57 (Berkeley) 10/13/96@(#)vs_line.c 10.19 (Berkeley) 9/26/96@(#)vs_msg.c 10.77 (Berkeley) 10/13/96|/-\@(#)vs_refresh.c 10.44 (Berkeley) 10/13/96@(#)vs_relative.c 10.11 (Berkeley) 5/13/96@(#)vs_smap.c 10.25 (Berkeley) 7/12/96@(#)vs_split.c 10.31 (Berkeley) 10/13/96$OpenBSD: cchar.c,v 1.8 1998/11/18 23:26:13 deraadt Exp $$OpenBSD: gfmt.c,v 1.4 1997/09/01 18:30:33 deraadt Exp $$OpenBSD: key.c,v 1.9 2001/06/25 03:40:25 millert Exp $ddxp`XPXH@80(< h8\$OpenBSD: modes.c,v 1.5 1999/10/26 22:53:52 deraadt Exp $$OpenBSD: print.c,v 1.8 1999/10/26 22:53:52 deraadt Exp $@(#) Copyright (c) 1989, 1991, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: stty.c,v 1.9 2001/09/06 13:29:08 mpech Exp $@(#) Copyright (c) 1987, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: ln.c,v 1.6 2001/08/09 03:33:17 millert Exp $@(#) Copyright (c) 1987, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: disklabel.c,v 1.71 2001/09/03 16:14:27 millert Exp $xph`XPH@80( 0(8 ```````XPH``@`8````/tmp/EdDk.aXXXXXXXXXX!A$OpenBSD: dkcksum.c,v 1.2 1996/06/23 14:30:05 deraadt Exp $$OpenBSD: editor.c,v 1.77 2001/07/07 18:26:10 deraadt Exp $xph`XPH@80@8(H0ppppppph`XppPpHppppAA?DISKLABEL(8) OpenBSD System Manager's Manual DISKLABEL(8) NNAAMMEE ddiisskkllaabbeell - read and write disk pack label SSYYNNOOPPSSIISS ddiisskkllaabbeell [--nn] [--ccdd | --rr] [--tt] [--vv] _d_i_s_k ddiisskkllaabbeell --ww [--nn] [--ccdd | --rr] [--vv] _d_i_s_k _d_i_s_k_t_y_p_e [_p_a_c_k_i_d] ddiisskkllaabbeell --ee [--nn] [--ccdd | --rr] [--vv] _d_i_s_k ddiisskkllaabbeell --EE [--ff _t_e_m_p_f_i_l_e] [--nn] [--ccdd | --rr] [--vv] _d_i_s_k ddiisskkllaabbeell --RR [--rr] [--nn] [--vv] _d_i_s_k _p_r_o_t_o_f_i_l_e ddiisskkllaabbeell [--NNWW] [--nn] [--vv] _d_i_s_k ddiisskkllaabbeell --BB [--nn] [--vv] [--bb _b_o_o_t_1 [--ss _b_o_o_t_2]] _d_i_s_k [_d_i_s_k_t_y_p_e] ddiisskkllaabbeell --ww --BB [--nn] [--vv] [--bb _b_o_o_t_1 [--ss _b_o_o_t_2]] _d_i_s_k _d_i_s_k_t_y_p_e [_p_a_c_k_i_d] ddiisskkllaabbeell --RR --BB [--nn] [--vv] [--bb _b_o_o_t_1 [--ss _b_o_o_t_2]] _d_i_s_k _p_r_o_t_o_f_i_l_e [_d_i_s_k_t_y_p_e] DDEESSCCRRIIPPTTIIOONN The ddiisskkllaabbeell utility can be used to install, examine, or modify the la- bel on a disk drive or pack. The disk label contains information about disk characteristics (size, type, etc.) and the partition layout, stored on the disk itself. It is used by the operating system to optimize disk I/O and locate the filesystems resident on the disk. The options are as follows: --nn Make no permanent changes to the disklabel (useful for debugging purposes). --vv Print additional information during operation (verbose mode). --rr Causes the label to be read from or written to the disk directly, rather than going through the system's in-core copy of the label. This option may allow a label to be installed on a disk without kernel support for a label, such as when labels are first in- stalled on a system. This flag does not work on a number of ar- chitectures, thus it is not considered the right way to put a new label on a disk. Its use is discouraged. --BB Install bootstrap code. The --rr flag is implied by --BB and never needs to be specified. --bb Specify the single level boot program, or the primary boot pro- gram, depending on the system boot architecture (single or two- level). --ss On machines with a two-level bootstrap (such as i386-based sys- tems), specify the secondary boot program. --dd Use the _d_e_f_a_u_l_t label. This ignores any existing OpenBSD parti- tions on the disk. Note that this option will only work for disks that are capable of reporting their geometry, such as SCSI, IDE, and ESDI. May not be used in conjunction with the --rr flag. --cc Clear the system's in-core copy of the label and update it based on the on-disk label. May not be used in conjunction with the --rr flag. --ff _t_e_m_p_f_i_l_e Write entries to _t_e_m_p_f_i_l_e in fstab(5) format for any partitions for which mount point information has been specified. The --ff flag is only valid when used in conjunction with the --EE flag. If _t_e_m_p_f_i_l_e already exists, it will be overwritten. --tt Format the label as a disktab(5) entry. --ww Write a standard label on the designated drive. --ee Edit an existing disk label using the editor specified in the EDITOR environment variable, or vi(1) if none is specified. --EE Use a simple initial label editor, using the command-driven built-in editor described below. --RR Restore a disk label that was formatted in a prior operation and saved in an ASCII file. --NN Disallow writing of the pack label area on the selected disk. --WW Allow writing of the pack label area on the selected disk. The first form of the command (read) is used to examine the label on the named disk drive (e.g., sd0 or _/_d_e_v_/_r_s_d_0_c). It will display all of the parameters associated with the drive and its partition layout. Unless the --rr flag is given, the kernel's in-core copy of the label is dis- played; if the disk has no label, or the partition types on the disk are incorrect, the kernel may have constructed or modified the label. The second form of the command (write) is used to write a standard label on the designated drive. The drive parameters and partitions are taken from that file. If different disks of the same physical type are to have different partitions, it will be necessary to have separate disktab en- tries describing each, or to edit the label after installation as de- scribed below. The optional argument is a pack identification string, up to 16 characters long. The pack ID must be quoted if it contains blanks. If the --rr flag is given, the disk sectors containing the label and boot- strap will be written directly. A side-effect of this is that any exist- ing bootstrap code will be overwritten and the disk rendered unbootable. If --rr is not specified, the existing label will be updated via the in- core copy and any bootstrap code will be unaffected. If the disk does not already have a label, the --rr flag must be used. In either case, the kernel's in-core label is replaced. In the third form of the command (edit), the label is read from the in- core kernel copy, or directly from the disk if the --rr flag is also given. The label is formatted and then supplied to an editor for changes. If no editor is specified in an EDITOR environment variable, vi(1) is used. When the editor terminates, the formatted label is reread and used to rewrite the disk label. Existing bootstrap code is unchanged regardless of whether --rr was specified. The initial label editor mode is only intended for new disks as it will move partitions around as necessary to maintain a contiguous pool of free blocks. Some commands or prompts take an optional unit. Available units are `b' for bytes, `c' for cylinders, `k' for kilobytes, `m' for megabytes, and `g' for gigabytes. Quantities will be rounded to the nearest cylinder when units are specified for sizes (or offsets). Com- mands may be aborted by entering `^D' (Control-D). Entering `^D' at the main `>' prompt will exit the editor. At prompts that request a size, `*' may be entered to indicate the rest of the available space. The edi- tor commands are as follows: ? [command] Display help message with all available commands. You may specify a _c_o_m_m_a_n_d for which to get more detailed help. There is also (simple) context-sensitive help available at most prompts. M Display this manual page. u Undo (or redo) last change. Entering _u once will undo your last change. Entering it again will restore the change. p [unit] Print the current disk label. If a _u_n_i_t is given, the size and offsets are displayed in terms of the specified unit. e Edit drive parameters. This option is used to set the follow- ing parameters: sectors/track, tracks/cylinder, sectors/cylin- der, number of cylinders on the disk, total sectors on the disk, rpm, interleave, disk type, and a descriptive label string. b Set OpenBSD disk boundaries. This option tells ddiisskkllaabbeell which parts of the disk it is allowed to modify. This option is probably only useful for ports with fdisk partition tables where the ending sector in the MBR is incorrect. The user may enter `*' at the ``Size'' prompt to indicate the entire size of the disk (minus the starting sector). This is useful for disks larger than 8 gigabytes where the fdisk partition table is incapable of storing the real size. r Recalculate free space. This option should really not be nec- essary under normal circumstances. a [part] Add new partition. This option adds a new BSD partition. If no partition letter is specified (a-p), the user will be prompted for one. c [part] Change the size of an existing partition. If no partition is specified, the user will be prompted for one. The new size may be in terms of the aforementioned units and may also be prefixed with `+' or `-' to change the size by a relative amount. d [part] Delete an existing partition (or `*' to delete all parti- tions). If no partition is specified, the user will be prompted for one. You may not delete the `c' partition. g [d|b|u] Set disk geometry based on what the _d_i_s_k, _B_I_O_S, or _u_s_e_r thinks (the _u_s_e_r geometry is simply what the label said before ddiisskkllaabbeell made any changes). D Sets the disk label to the default values as reported by the kernel. This similates the case where there is no disk label. m [part] Modify parameters for an existing partition. If no partition is specified, the user will be prompted for one. This option allows the user to change the filesystem type, starting off- set, partition size, block fragment size, block size, and cylinders per group for the specified partition (not all pa- rameters are configurable for non-BSD partitions). n [part] Name the mount point for an existing partition. If no parti- tion is specified, the user will be prompted for one. This option is only valid if ddiisskkllaabbeell was invoked with the --ff flag. s [path] Save the label to a file in ASCII format (suitable for loading via the --RR option). If no path is specified, the user will be prompted for one. w Write the label to disk. This option will commit any changes to the on-disk label. q Quit the editor. If any changes have been made, the user will be asked whether or not to save the changes to the on-disk la- bel. x Exit the editor without saving any changes to the label. X Toggle ``expert mode''. By default, some settings are reserved for experts only (such as the block and fragment size on ffs partitions). z Zeroes out the existing partition table, leaving only the ``c'' partition. The drive parameters are not changed. In the restore form of the command, the prototype file used to create the label should be in the same format as that produced when reading or edit- ing a label. Comments are delimited by _# and newline. As with --ww, any existing bootstrap code will be clobbered if --rr is specified and will be unaffected otherwise. The final three forms of ddiisskkllaabbeell are used to install bootstrap code on machines where the bootstrap is part of the label. The bootstrap code is comprised of one or two boot programs depending on the machine. When installing bootstrap code with the --BB flag, if the names are not ex- plicitly given, standard boot programs will be used. The boot programs are located in _/_u_s_r_/_m_d_e_c. The names of the programs are taken from the ``b0'' and ``b1'' parameters of the disktab(5) entry for the disk if _d_i_s_k_t_y_p_e was given and its disktab entry exists and includes those param- eters. Otherwise, boot program names are derived from the name of the disk. These names are of the form _b_a_s_e_n_a_m_eboot for the primary (or only) bootstrap, and boot_b_a_s_e_n_a_m_e for the secondary bootstrap; for example, _/_u_s_r_/_m_d_e_c_/_s_d_b_o_o_t and _/_u_s_r_/_m_d_e_c_/_b_o_o_t_s_d if the disk device is _s_d_0. The first of the three boot-installation forms is used to install boot- strap code without changing the existing label. It is essentially a read command with respect to the disk label itself and all options are related to the specification of the boot program as described previously. The final two forms are analogous to the basic write and restore versions ex- cept that they will install bootstrap code in addition to a new label. Note that when a disk has no real BSD disklabel the kernel creates a de- fault label so that the disk can be used. This default label will in- clude other partitions found on the disk if they are supported on your architechture. For example, on systems that support fdisk(8) partitions the default label will also include DOS and Linux partitions. However, these entries are not dynamic, they are fixed at the time ddiisskkllaabbeell is run. That means that subsequent changes that affect non-OpenBSD parti- tions will not be present in the default label, though you may update them by hand. To see the default label, run ddiisskkllaabbeell with the --dd flag. You can then run ddiisskkllaabbeell with the --ee flag and paste any entries you want from the default label into the real one. EEXXAAMMPPLLEESS disklabel sd0 Display the in-core label for sd0 as obtained via _/_d_e_v_/_r_s_d_0_c. disklabel -w -r /dev/rsd0c sd2212 foo Create a label for sd0 based on information for ``sd2212'' found in _/_e_t_c_/_d_i_s_k_t_a_b. Any existing bootstrap code will be clobbered. (Normally you do not want to use the --rr flag though.) disklabel -e -r sd0 Read the on-disk label for sd0, edit it and reinstall in-core as well as on-disk. (Normally you do not want to use the --rr flag though.) Existing bootstrap code is unaffected. disklabel -R sd0 mylabel Restore the on-disk and in-core label for sd0 from information in _m_y_l_a_b_e_l. Existing bootstrap code is unaffected. disklabel -B sd0 Install a new bootstrap on sd0. The boot code comes from _/_u_s_r_/_m_d_e_c_/_s_d_b_o_o_t and possibly _/_u_s_r_/_m_d_e_c_/_b_o_o_t_s_d. On-disk and in-core la- bels are unchanged, but on some systems other information may be de- stroyed. Use with care. disklabel -w -B /dev/rsd0c -b newboot sd2212 Install a new label and bootstrap. The label is derived from disktab in- formation for ``sd2212'' and installed both in-core and on-disk. The bootstrap code comes from the file _/_u_s_r_/_m_d_e_c_/_n_e_w_b_o_o_t. FFIILLEESS /etc/disktab /usr/mdec/_x_xboot /usr/mdec/boot_x_x SSEEEE AALLSSOO disklabel(5), disktab(5), scan_ffs(5) DDIIAAGGNNOOSSTTIICCSS The kernel device drivers will not allow the size of a disk partition to be decreased or the offset of a partition to be changed while it is open. Some device drivers create a label containing only a single large parti- tion if a disk is unlabeled; thus, the label must be written to the `a' partition of the disk while it is open. This sometimes requires the de- sired label to be set in two steps, the first one creating at least one other partition, and the second setting the label on the new partition while shrinking the `a' partition. On some machines the bootstrap code may not fit entirely in the area al- located for it by some filesystems. As a result, it may not be possible to have filesystems on some partitions of a ``bootable'' disk. When in- stalling bootstrap code, ddiisskkllaabbeell checks for these cases. If the in- stalled boot code would overlap a partition of type FS_UNUSED it is marked as type FS_BOOT. The newfs(8) utility will disallow creation of filesystems on FS_BOOT partitions. Conversely, if a partition has a type other than FS_UNUSED or FS_BOOT, ddiisskkllaabbeell will not install bootstrap code that overlaps it. NNOOTTEESS On i386 machines, installboot(8) is normally used to install boot code. The --BB option to ddiisskkllaabbeell can still be used to install old style boot code, but this usage is deprecated. On some machines, such as the sparc and amiga, partition tables may not exhibit the full functionality that is described above. BBUUGGSS When a disk name is given without a full pathname, the constructed device name uses the `a' partition on the tahoe, the `c' partition on all oth- ers. In --EE mode, ddiisskkllaabbeell is far too quick to shuffle partitions around; it should keep a free block list and only move partitions around with the user's permission. Also, in --EE mode, partitions outside the OpenBSD portion of the disk should be changeable. OpenBSD 3.0 October 27, 1997 5 $OpenBSD: ar_io.c,v 1.24 2001/09/19 10:58:07 mpech Exp $$OpenBSD: ar_subs.c,v 1.16 2001/07/17 18:19:48 millert Exp $$OpenBSD: buf_subs.c,v 1.10 2001/10/06 20:21:55 niklas Exp $ $OpenBSD: cache.c,v 1.9 2001/06/26 14:19:33 lebel Exp $$OpenBSD: cpio.c,v 1.7 2001/05/26 00:32:21 millert Exp $$OpenBSD: file_subs.c,v 1.14 2001/05/16 03:04:56 mickey Exp $$OpenBSD: ftree.c,v 1.16 2001/05/26 00:32:21 millert Exp $$OpenBSD: gen_subs.c,v 1.12 2001/07/17 18:19:49 millert Exp $$OpenBSD: getoldopt.c,v 1.4 2000/01/22 20:24:51 deraadt Exp $$OpenBSD: options.c,v 1.48 2001/05/26 00:32:21 millert Exp $abcdfiklnoprstuvwxBDEGHLPTUXYZ4p$hה > > > > > > >p >h >Pddddxxxx e j   ky JKYdu f   bvz!w"F2R r u'g<<p%{{}}{}(())()[[]][]#$G>>P30123456789=:f/?/*?*n+n,N-N.m'E :e  :n:p:x&-/:ttso_|%v !+ HhVq:q:QZZ  lhbwixX  0 $ k j  is a directory is not a regular filea# X 8b #X ( B# c# ϐ p Hd#x ( e# θf# Π ΀g# ` 0 h# ͰHA# ͘ xi# X @ j#  kH @lH m#L ̰n"#H ̘ ̀ `o PO h @pH P 0q#  r!# ˘ ps!#t X 8S!#| ( t | T P u"#P ʰ ʘV <w!# h @x$#( 0 XA#$ y# ɰ Ɉz# p P? #|P (press RETURN)... (interrupt to abort)?n?f%f .?m(file %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?m(file %i of %m) .?e(END) ?x- Next\: %x.:(?pB%pB\%:byte %bB?s/%s..).%t?f%f .?n?m(file %i of %m) ..?ltline %lt?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(file %i of %m) .?ltline %lt?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tx 290@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. $NetBSD: mount_nfs.c,v 1.12.4.1 1996/05/25 22:48:05 fvdl Exp $ @(#)getmntopts.c 8.3 (Berkeley) 3/29/95          ( p D ` ` P | @  0     0123456789A:B:C::EFGHIUVX:abcd:e:f:hiLlnqrsuvwxyZz lxA lhG lXB lH l8b l0C l(c ld lE lf kl kL kF kF k#P ki kn kxx kp#X k`h kPs kHZ k8z k0q k r ke kv kq ja jU ju jV jH jw? SuccessNo matchInvalid regular expressionInvalid collation characterInvalid character class nameTrailing backslashInvalid back referenceUnmatched [ or [^Unmatched ( or \(Unmatched \{Invalid content of \{\}Invalid range endMemory exhaustedInvalid preceding regular expressionPremature end of regular expressionRegular expression too bigUnmatched ) or \)N 0P 2 6L 0H 2 6L 0@ 4t 6L 08 4t 6L 00 9 :X@(#) Copyright (c) 1991, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: basename.c,v 1.3 1997/08/17 21:25:01 millert Exp $@(#) Copyright (c) 1980, 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: umount.c,v 1.12 2001/05/18 08:07:51 mickey Exp $@(#) Copyright (c) 1983, 1990 The Regents of the University of California. All rights reserved. $OpenBSD: rsh.c,v 1.21 2001/09/27 16:24:45 deraadt Exp $@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mknod.c,v 1.9 2001/07/07 18:26:14 deraadt Exp $@(#) Copyright (c) 1988, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: slattach.c,v 1.9 2001/06/01 21:35:20 mickey Exp $% a a a@(#) Copyright (c) 1983, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: route.c,v 1.43 2001/07/07 18:26:20 deraadt Exp $0123456789abcdef P 0  h H (  ` pksentrttvarrttssthreshsendpiperecvpipeexpirehopcountmtuUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CLONING XRESOLVE LLINFO STATICPROTO2PROTO1UPBROADCASTDEBUGLOOPBACKPTPNOTRAILERSRUNNINGNOARP PPROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD H 8 0 (       Ÿ Ű Ũ Š Ř Ő ň ŀ x h ` X P H @ 0 ( ! " # $ % & ' ( ) * İ+ Ĩ, Ġ- Ę. Ĉ/$OpenBSD: cmds.c,v 1.38 2001/10/01 14:58:49 millert Exp $ (       $ x p$OpenBSD: cmdtab.c,v 1.15 2001/10/04 22:49:55 pjanzen Exp $send account command to remote serverappend to a fileset ascii transfer typebeep when command completedset binary transfer typetoggle mget upper/lower case id mappingchange remote working directorychange remote working directory to parent directorychange file permissions of remote fileconnect to remote ftp servertoggle carriage return stripping on ascii getstoggle/set debugging modedelete remote filelist contents of remote directoryterminate ftp sessionexecute macrotoggle use of EPSV/EPRT on IPv4 ftpset file transfer formattoggle gate-ftp; specify host[:port] to change proxytoggle metacharacter expansion of local file namestoggle printing `#' marks; specify number to set sizeprint local help informationget (set) idle timer on remote sidechange local working directoryprint local working directorylist contents of remote directorydefine a macrodelete multiple fileslist contents of multiple remote directoriesget multiple filesmake directory on the remote machinelist contents of multiple remote directoriesset file transfer modeshow last modification time of remote filesend multiple filesget file if remote file is newer than local file nlist contents of remote directoryset templates for default file name mappingset translation table for default file name mappingview a remote file through your pagertoggle passive transfer modetoggle use of PORT/LPRT cmd for each data connectiontoggle preservation of modification time of retrieved filestoggle transfer progress metertoggle interactive prompting on multiple commandsissue command on alternate connectionprint working directory on remote machineterminate ftp session and exitsend arbitrary ftp commandreceive fileget file restarting at end of local fileget help from remote serverrename fileclear queued command repliesrestart file transfer at bytecountremove directory on the remote machineshow status of remote machinetoggle store unique for local filessend one fileescape to the shellsend site specific command to remote server Try "rhelp site" or "site help" for more informationshow size of remote fileshow current statusset file transfer structuretoggle store unique on remote machineshow remote system typeset tenex file transfer typetoggle packet tracingset file transfer typeget (set) umask on remote sidesend new user informationtoggle verbose mode "H "@ " "8  "0 h "( ͨ "  " ̀ "  "(  "P P !p ` !  !  ! \ ! | !@ !X P !  ! !  ! t ! !   ! !( !x` !p !h  !` ̀ !X !P8  !H !@  P !8H $ !0X P !(p  !  ! H !  !  !( 0 8  X Ѱ X Ѱ p |  P  4   8  ` X     4  P  x  h p x h  `  x X   P  H H @ X @ 8 x p 0 ( X (  h         h   8    \   H          8  X 0  p ʸ       h  S$OpenBSD: domacro.c,v 1.7 1997/07/25 21:56:19 millert Exp $$OpenBSD: fetch.c,v 1.35 2001/10/03 18:49:39 heko Exp $$OpenBSD: ftp.c,v 1.41 2001/06/26 23:44:00 lebel Exp $@(#) Copyright (c) 1985, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: main.c,v 1.48 2001/06/23 22:48:45 millert Exp $$OpenBSD: ruserpass.c,v 1.12 2000/07/27 19:59:13 millert Exp $ X P @ 8 0 ( $OpenBSD: util.c,v 1.26 2001/07/12 05:17:08 deraadt Exp $ KMGTPA.A.>?PQ ް Copyright 1995, 1996, 1997, 1998, 1999 The Internet Software Consortium.All rights reserved.Internet Software Consortium DHCP ClientPlease contribute if you find this software useful.For info, please visit http://www.isc.org/dhcp-contrib.htmlPATH=/usr/bin:/usr/sbin:/bin:/sbin/sbin/dhclient-script( 0(EHC  `X$H@$0($ $$$$$$$ $ x$ h`$ PH$ 80$ 0$@$0$0$$$$H$xp$XP$80$ H$$@$$$$@$ $!h$"PP$#8$$(p$%P$&$'0$($)$*`$+$,x$-`p$.P0$/@$0($1@$2P$3p$4p$5@$6$70$8hH$9PP$:8P$; 0$<`$=`$>`$?0$@$A0$B0$C$Dx$Eh$FX$GH$H8$I($J$K$L0$M`$N`$O`$P`$Q`$Rx`$Sh`$TX$UH`$V8`$W(`$X`$Y`$Z`$[`$\`$]`$^߸`$_ߨ`$`ߘ`$a߈`$bx`$ch`$dX`$eH`$f8`$g(`$h`$i`$j`$k`$l`$m`$n޸`$oި`$pޘ`$qވ`$rx`$sh`$tX`$uH`$v8`$w(`$x`$y`$z`${`$|`$}`$~ݸ`$ݨ`$ݘ`$݈`$x`$h`$X`$H`$8`$(`$`$`$`$`$`$`$ܸ`$ܨ`$ܘ`$܈`$x`$h`$X`$H`$8`$(`$`$`$`$`$`$`$۸`$ۨ`$ۘ`$ۈ`$x`$h`$X`$H`$8`$(`$`$`$`$`$`$`$ڸ`$ڨ`$ژ`$ڈ`$x`$h`$X`$H`$8`$(`$`$`$`$`$`$`$ٸ`$٨`$٘`$و`$x`$h`$X`$H`$8`$(`$`$`$`$`$`$`$ظ`$ب`$ؘ`$؈`$x`$h`$X`$H`$8`$(`$`$`$`$`$`$`$׸`$ר`$ט`$׈`$x`$h`$X`$H`$8`$(`$`$`$`$`$`$`$ָ`$֨`$֘`$ֈ`$x`$h`$X`$H`$8`$(`$`$`$`$`$`$`$ոհ$249:;<=   !"#$%&'()*+,-./017>?@ABCDEFGHIJKLNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~P@0 xhXH8(xhXH8(xhXH8(xhXH8(xhXH8(xhXH8(xhXH8(xhXH8(xhXH8(xhXH8(xhXH8(xhXH8(xhXH8(xhXH8(xhXH8(xh;Zx0N@(#) Copyright (c) 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount_ffs.c,v 1.11 2001/04/04 20:19:01 gluk Exp $$OpenBSD: getmntopts.c,v 1.2 1996/06/23 14:31:10 deraadt Exp $@(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: reboot.c,v 1.21 2001/07/19 17:41:22 millert Exp $$OpenBSD: buf.c,v 1.11 2001/01/16 03:04:45 deraadt Exp $$$OpenBSD: cbc.c,v 1.6 2001/01/16 03:04:45 deraadt Exp $@ $OpenBSD: glbl.c,v 1.8 2001/01/16 03:04:45 deraadt Exp $$OpenBSD: io.c,v 1.8 2001/01/16 03:04:45 deraadt Exp $Hp$OpenBSD: main.c,v 1.22 2001/06/22 23:53:53 deraadt Exp $HHH$OpenBSD: re.c,v 1.8 2001/01/16 03:04:46 deraadt Exp $$OpenBSD: sub.c,v 1.7 2001/01/16 03:04:46 deraadt Exp $$OpenBSD: undo.c,v 1.5 2001/01/16 03:04:46 deraadt Exp $@(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: cp.c,v 1.17 2001/06/25 04:35:31 art Exp $3\x$OpenBSD: utils.c,v 1.17 2001/09/06 13:29:08 mpech Exp $@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: cut.c,v 1.7 2000/06/04 23:52:19 aaron Exp $֘PՠXԘXacc׸dרdנfטhאl׈L׀nxNpqhqXrPSHt@T8v0V(1 9Zbp۰ېH p(وP0ذ`& X& X      %Ш%ڐ;X%ٜ%;%߈zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: chmod.c,v 1.12 2000/07/31 19:02:38 ericj Exp $@(#) Copyright (c) 1988 The Regents of the University of California. All rights reserved. $OpenBSD: chroot.c,v 1.3 2000/08/17 15:28:36 mickey Exp $$OpenBSD: dir.c,v 1.9 2001/05/28 21:22:47 gluk Exp $ ... ...$OpenBSD: inode.c,v 1.17 2001/07/07 18:26:12 deraadt Exp $@(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: main.c,v 1.18 2001/03/02 08:33:55 art Exp $$OpenBSD: pass1.c,v 1.9 2001/07/07 18:26:12 deraadt Exp $$OpenBSD: pass1b.c,v 1.4 1999/03/01 07:45:18 d Exp $$OpenBSD: pass2.c,v 1.10 2001/07/07 18:26:12 deraadt Exp $$OpenBSD: pass3.c,v 1.5 2001/07/07 18:26:12 deraadt Exp $$OpenBSD: pass4.c,v 1.4 1999/03/01 07:45:18 d Exp $$OpenBSD: pass5.c,v 1.12 2001/07/07 18:26:12 deraadt Exp $$NetBSD: fsutil.c,v 1.2 1996/10/03 20:06:31 christos Exp $$OpenBSD: setup.c,v 1.13 2001/07/07 18:26:12 deraadt Exp $xph`XPH@8 H @ 0    P8 x x x x x x x p h ` x x X x P x x x x$OpenBSD: utilities.c,v 1.12 2001/04/13 02:39:05 gluk Exp $Q?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@HHHI$OpenBSD: append.c,v 1.7 2001/03/20 19:36:27 millert Exp $$OpenBSD: fields.c,v 1.5 2001/02/04 21:27:00 ericj Exp $$OpenBSD: files.c,v 1.7 2001/02/04 21:27:00 ericj Exp $$OpenBSD: fsort.c,v 1.8 2001/02/04 21:27:00 ericj Exp $$OpenBSD: init.c,v 1.3 1999/05/24 17:57:18 millert Exp $$OpenBSD: msort.c,v 1.9 2001/02/04 21:27:01 ericj Exp $@(#) Copyright (c) 1993 The Regents of the University of California. All rights reserved. $OpenBSD: sort.c,v 1.16 2001/02/04 21:27:01 ericj Exp $ /dev/stdinH$OpenBSD: tmp.c,v 1.3 2000/06/30 16:00:23 millert Exp $@(#) Copyright (c) 1991, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: init.c,v 1.22 2001/07/09 07:04:45 deraadt Exp $ $OpenBSD: dkcksum.c,v 1.2 1996/06/23 14:30:05 deraadt Exp $$OpenBSD: getmntopts.c,v 1.2 1996/06/23 14:31:10 deraadt Exp $@(#) Copyright (c) 1983, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: newfs.c,v 1.28 2001/07/07 18:26:16 deraadt Exp $ȸȰȨȠȐȈȀxph` X@P@@ @%s: can't read disk label; disk type must be specifiedpX(pP0x`H($OpenBSD: mkfs.c,v 1.19 2001/07/07 18:26:16 deraadt Exp $>......$OpenBSD: getopt.c,v 1.4 2001/07/12 05:17:09 deraadt Exp $$OpenBSD: acu.c,v 1.6 2001/08/11 00:05:53 krw Exp $$OpenBSD: acutab.c,v 1.2 1996/06/26 05:40:41 deraadt Exp $55Hh55|5t5t$OpenBSD: cmds.c,v 1.12 2001/09/26 06:07:28 pvalchev Exp $<<555$OpenBSD: cmdtab.c,v 1.3 2001/09/09 17:58:41 millert Exp $!WI|<Wp6$>WP=TtW07|pWB|W;$VDCVG$cVK\.VLLVLLVpRVPRsV@NvV0PP?Vz#VR$OpenBSD: cu.c,v 1.10 2001/09/26 06:07:28 pvalchev Exp $$OpenBSD: hunt.c,v 1.7 2001/09/17 22:21:09 deraadt Exp $$OpenBSD: log.c,v 1.5 2001/09/09 19:30:49 millert Exp $$OpenBSD: partab.c,v 1.3 1997/04/02 01:47:02 millert Exp $ !"$'(+-.03569: } ${PS3=#? } ${PS4=+ }KSH_VERSIONlet||&&!()]]<>~x~h~`~X~P~@~8~0~(~~}}}}}}} }} }} }x}h }`}P }H}8}0} }}}|||||||||||h|`|H|@|0|(||{{{{{{{{{h{`{H{@{( { {@(#)PD KSH v5.2.14 99/07/13.2 AAA  Q AA A QB& _@(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: sleep.c,v 1.11 2001/09/06 13:29:08 mpech Exp $@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mv.c,v 1.19 2001/09/06 13:29:08 mpech Exp $@(#) Copyright (c) 1991, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: dmesg.c,v 1.13 2001/07/07 18:26:11 deraadt Exp $)`@(#) Copyright (c) 1988, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: hostname.c,v 1.4 2001/09/06 13:29:08 mpech Exp $.0(0 0000/////////00000000x0p0h0(0`0X0P0H0@0800//0000000000000000000003$NetBSD: getrawpartition.c,v 1.1 1996/05/16 07:03:33 thorpej Exp $:($NetBSD: getmaxpartitions.c,v 1.1 1996/05/16 07:03:31 thorpej Exp $v%%p%c%%{10}%%/%%{16}%%*%%p%c%%{10}%%m%%+&h@$\]^7ba_`c8V9Mdefg:U;J<H=>LhW?O@NiAB CD  !"#$%E &'()*+,-./F 0123456789G :;<=>?@ABCH D E F GIJKjkLMKNIOP[lmcnoQRpqRSrZstuvwxSyz{|}~TPUQVTW@$OpenBSD: read_bsd_terminfo.c,v 1.9 2000/10/08 22:47:02 millert Exp $kH  @%&*!#Ҡ}4~8=A@A$OpenBSD: getloadavg.c,v 1.2 1996/08/19 08:23:39 tholo Exp $A$OpenBSD: confstr.c,v 1.4 2001/06/27 00:58:54 lebel Exp $$OpenBSD: cfsetispeed.c,v 1.2 1996/08/19 08:34:36 tholo Exp $$OpenBSD: fscanf.c,v 1.4 2001/07/09 06:57:44 deraadt Exp $$OpenBSD: fstab.c,v 1.9 2001/06/27 00:58:54 lebel Exp $x$OpenBSD: tcflush.c,v 1.2 1996/08/19 08:34:39 tholo Exp $$OpenBSD: ethers.c,v 1.12 2001/06/27 00:58:54 lebel Exp $xx:xx:xx:xx:xx:xx$OpenBSD: _vwarnx.c,v 1.3 1996/08/19 08:21:35 tholo Exp $$OpenBSD: fwrite.c,v 1.2 1996/08/19 08:32:50 tholo Exp $%(D(L(t)(*0+h+$OpenBSD: cfgetospeed.c,v 1.2 1996/08/19 08:34:35 tholo Exp $$OpenBSD: nice.c,v 1.3 1998/05/06 23:11:43 deraadt Exp $$OpenBSD: devname.c,v 1.2 1996/08/19 08:22:18 tholo Exp $$OpenBSD: linkaddr.c,v 1.2 1996/08/19 08:29:27 tholo Exp $0123456789abcdef$OpenBSD: getprotoname.c,v 1.3 1997/07/09 01:08:32 millert Exp $$OpenBSD: vis.c,v 1.7 2001/08/13 15:30:23 millert Exp $$OpenBSD: _warn.c,v 1.3 1996/08/19 08:21:36 tholo Exp $8$OpenBSD: sethostname.c,v 1.4 1998/05/13 08:51:00 deraadt Exp $$OpenBSD: readpassphrase.c,v 1.7 2001/08/07 19:34:11 millert Exp $$OpenBSD: tcsetattr.c,v 1.2 1996/08/19 08:34:42 tholo Exp $$OpenBSD: basename.c,v 1.6 2001/06/28 04:27:19 pjanzen Exp $>x$OpenBSD: setjmperr.c,v 1.2 1996/08/19 08:25:52 tholo Exp $$OpenBSD: getnetnamadr.c,v 1.14 2001/06/27 00:58:55 lebel Exp $$OpenBSD: getnetbyaddr.c,v 1.5 1997/07/09 01:08:28 millert Exp $$OpenBSD: getnetbyname.c,v 1.5 1997/07/09 01:08:29 millert Exp $$OpenBSD: getnetent.c,v 1.8 1998/03/16 05:06:57 millert Exp $$OpenBSD: inet_network.c,v 1.7 1997/07/09 01:08:37 millert Exp $$OpenBSD: alarm.c,v 1.3 1996/09/15 09:30:54 tholo Exp $$OpenBSD: inet_makeaddr.c,v 1.3 1997/04/05 21:13:12 millert Exp $$OpenBSD: getmntinfo.c,v 1.4 1999/06/01 15:31:13 millert Exp $PP$OpenBSD: asprintf.c,v 1.7 2001/09/05 22:32:33 deraadt Exp $$OpenBSD: strtofflags.c,v 1.1 2000/07/19 19:26:04 mickey Exp $Ux$OpenBSD: iso_addr.c,v 1.2 1996/08/19 08:29:23 tholo Exp $0123456789abcdef$OpenBSD: cfgetispeed.c,v 1.2 1996/08/19 08:34:34 tholo Exp $X$OpenBSD: inet_netof.c,v 1.3 1997/04/05 21:13:13 millert Exp $Z]$OpenBSD: cfsetspeed.c,v 1.2 1996/08/19 08:34:37 tholo Exp $$OpenBSD: times.c,v 1.2 1996/08/19 08:26:43 tholo Exp $$OpenBSD: morecrypt.c,v 1.9 1998/03/22 19:01:20 niklas Exp $:2*" <4,$ >6.&@80( 91)! ;3+# =5-% ?7/'91)! :2*" ;3+# <4,$?7/'>6.&=5-%      )4%/7(3-!0,1'8"5.*2$                                                                                                                                  @ @ @ @ @ q$OpenBSD: getservbyport.c,v 1.3 1997/07/09 01:08:35 millert Exp $$OpenBSD: herror.c,v 1.4 1997/03/13 19:07:28 downsj Exp $pP8$OpenBSD: wait.c,v 1.2 1996/08/19 08:27:41 tholo Exp $$OpenBSD: sleep.c,v 1.7 1997/04/25 04:20:41 tholo Exp $$OpenBSD: getlogin.c,v 1.5 2000/01/06 08:24:16 d Exp $`$OpenBSD: pwrite.c,v 1.2 2001/05/05 22:58:30 millert Exp $$OpenBSD: regerror.c,v 1.6 2001/06/27 00:58:55 lebel Exp $X8(xXH(   x hX H X$OpenBSD: _warnx.c,v 1.3 1996/08/19 08:21:38 tholo Exp $$OpenBSD: sethostent.c,v 1.4 1997/03/15 21:53:50 pefo Exp $8$OpenBSD: getcwd.c,v 1.6 2000/07/19 15:25:13 deraadt Exp $$OpenBSD: regexec.c,v 1.7 1997/04/30 05:51:10 tholo Exp $$OpenBSD: engine.c,v 1.4 1997/04/28 20:44:57 millert Exp $$OpenBSD: fts.c,v 1.29 2001/08/27 21:42:06 millert Exp $$OpenBSD: vprintf.c,v 1.3 2001/07/09 06:57:45 deraadt Exp $$OpenBSD: raise.c,v 1.2 1996/08/19 08:25:33 tholo Exp $$OpenBSD: tcsetpgrp.c,v 1.3 1997/07/25 20:30:15 mickey Exp $$OpenBSD: setbuffer.c,v 1.2 1996/08/19 08:33:05 tholo Exp $$OpenBSD: fputc.c,v 1.4 2001/07/09 06:57:44 deraadt Exp $$OpenBSD: _errx.c,v 1.4 1996/08/19 08:21:21 tholo Exp $$OpenBSD: errx.c,v 1.3 1997/07/25 20:30:02 mickey Exp $$OpenBSD: regcomp.c,v 1.6 1998/08/14 21:39:35 deraadt Exp $0h`PHXP( xph`XPH80 (         xph`XPH@80(  !"#$%&'(x)h*X+P,H-8-0. .//0123456789:;<=p>`?P@8[(\\]^^__`{{p|`}H}@~8$OpenBSD: regfree.c,v 1.3 1997/04/28 20:45:01 millert Exp $$OpenBSD: ns_ntoa.c,v 1.7 1997/08/24 21:25:48 millert Exp $$OpenBSD: ipx_ntoa.c,v 1.2 1996/08/19 08:29:20 tholo Exp $xxxx.xx:xx:xx:xx:xx:xx.uuuuu$OpenBSD: glob.c,v 1.16 2001/04/05 18:36:12 deraadt Exp $$OpenBSD: freopen.c,v 1.4 1998/11/10 22:10:21 deraadt Exp $AE`/etc/rpc$OpenBSD: tcgetpgrp.c,v 1.2 1996/08/19 08:34:40 tholo Exp $$OpenBSD: cfmakeraw.c,v 1.3 1998/08/20 19:45:57 deraadt Exp $$OpenBSD: ns_addr.c,v 1.6 2001/06/27 00:58:55 lebel Exp $$OpenBSD: ipx_addr.c,v 1.5 2001/06/27 00:58:55 lebel Exp $$OpenBSD: sscanf.c,v 1.4 2001/07/09 06:57:44 deraadt Exp $$OpenBSD: vfscanf.c,v 1.7 2001/07/09 06:57:45 deraadt Exp $  $OpenBSD: fread.c,v 1.3 2001/07/09 06:57:44 deraadt Exp $$OpenBSD: strtoq.c,v 1.4 1996/08/19 08:33:52 tholo Exp $$OpenBSD: strtouq.c,v 1.4 1996/08/19 08:33:53 tholo Exp $$OpenBSD: ungetc.c,v 1.3 2001/07/09 06:57:45 deraadt Exp $$OpenBSD: puts.c,v 1.3 1999/08/07 17:35:58 millert Exp $$OpenBSD: disklabel.c,v 1.5 2000/07/19 15:25:13 deraadt Exp $ppppppppppppxppphp`qpqhqXqHq@q8q(q qqpqqppppppxp`qqqqqqqqqqqqqqqxqqpqq$OpenBSD: getcap.c,v 1.19 2001/09/22 18:36:40 millert Exp $$OpenBSD: truncate.c,v 1.6 1997/04/26 08:50:13 tholo Exp $?9gt>QNPaPkqj,jH6T7YqϑI 7RǤq)>Oq9NNL(Kɲ@KCS[kAD88($OpenBSD: popen.c,v 1.10 2001/07/09 07:04:39 deraadt Exp $$OpenBSD: exec.c,v 1.11 2000/08/22 18:46:04 deraadt Exp $$OpenBSD: waitpid.c,v 1.3 1997/07/25 20:30:06 mickey Exp $$OpenBSD: utime.c,v 1.2 1996/08/19 08:27:24 tholo Exp $$OpenBSD: setlocale.c,v 1.7 2001/06/27 00:58:54 lebel Exp $0 CCCCCCC$OpenBSD: gethostnamadr.c,v 1.43 2001/06/27 00:58:55 lebel Exp $gethostby*.getanswer: asked for "%s", got "%s"$OpenBSD: ftell.c,v 1.3 2000/02/21 22:11:22 millert Exp $˜p$OpenBSD: inet_lnaof.c,v 1.3 1997/04/05 21:13:11 millert Exp $$OpenBSD: tcdrain.c,v 1.2 1996/08/19 08:34:38 tholo Exp $$OpenBSD: setmode.c,v 1.9 1998/11/18 23:28:34 deraadt Exp $$OpenBSD: printf.c,v 1.3 1997/07/25 20:30:10 mickey Exp $и$OpenBSD: _err.c,v 1.4 1996/08/19 08:21:19 tholo Exp $$OpenBSD: verrx.c,v 1.2 1996/08/19 08:27:32 tholo Exp $$OpenBSD: getttyent.c,v 1.4 1997/07/09 00:28:22 millert Exp $x$OpenBSD: ttyname.c,v 1.7 2000/01/06 08:24:16 d Exp $$OpenBSD: getbsize.c,v 1.7 2001/08/18 22:56:22 deraadt Exp $$OpenBSD: nlist.c,v 1.40 2001/07/09 06:57:43 deraadt Exp $$OpenBSD: pread.c,v 1.2 2001/05/05 22:58:29 millert Exp $$OpenBSD: fgetc.c,v 1.2 1996/08/19 08:32:27 tholo Exp $$OpenBSD: pwcache.c,v 1.5 2001/06/27 00:58:54 lebel Exp $$OpenBSD: getgrent.c,v 1.14 2001/09/11 04:52:50 pvalchev Exp $$OpenBSD: getpwent.c,v 1.22 2001/07/10 16:46:25 deraadt Exp $h*netgroup: %m$OpenBSD: err.c,v 1.4 1997/07/25 20:30:01 mickey Exp $$OpenBSD: verr.c,v 1.2 1996/08/19 08:27:30 tholo Exp $$OpenBSD: warn.c,v 1.3 1997/07/25 20:30:06 mickey Exp $$OpenBSD: vwarn.c,v 1.2 1996/08/19 08:27:38 tholo Exp $$OpenBSD: warnx.c,v 1.2 1996/08/19 08:27:50 tholo Exp $$OpenBSD: vwarnx.c,v 1.2 1996/08/19 08:27:39 tholo Exp $12@4x4$OpenBSD: getproto.c,v 1.3 1997/07/09 01:08:31 millert Exp $$OpenBSD: getprotoent.c,v 1.4 1999/09/03 16:23:18 millert Exp $A$OpenBSD: cfsetospeed.c,v 1.2 1996/08/19 08:34:37 tholo Exp $B($OpenBSD: _sys_siglist.c,v 1.2 1996/08/19 08:21:27 tholo Exp $$OpenBSD: siglist.c,v 1.2 1996/08/19 08:26:05 tholo Exp $EpHXNxN4NTODNgethostby*.getanswer: asked for "%s", got "%s"$OpenBSD: res_query.c,v 1.16 2001/07/31 22:02:18 jakob Exp $$OpenBSD: res_mkquery.c,v 1.10 2001/07/31 22:02:18 jakob Exp $$OpenBSD: res_send.c,v 1.10 2001/09/14 23:49:29 itojun Exp $$OpenBSD: setbuf.c,v 1.2 1996/08/19 08:33:04 tholo Exp $$OpenBSD: setvbuf.c,v 1.3 2001/07/09 06:57:44 deraadt Exp $$OpenBSD: res_debug.c,v 1.11 2001/06/11 10:05:59 itojun Exp $ d'B@;`ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/$OpenBSD: res_comp.c,v 1.8 1997/07/09 01:08:49 millert Exp $$OpenBSD: tolower_.c,v 1.3 2001/06/27 07:17:08 pjanzen Exp $$OpenBSD: wbuf.c,v 1.5 2001/07/09 06:57:45 deraadt Exp $$OpenBSD: res_data.c,v 1.1 1997/03/13 19:07:36 downsj Exp $xph`XPH@0(`XP$OpenBSD: fputs.c,v 1.3 1999/08/07 17:35:58 millert Exp $$OpenBSD: nsap_addr.c,v 1.4 1997/07/09 01:08:45 millert Exp $$OpenBSD: toupper_.c,v 1.3 2001/06/27 07:17:09 pjanzen Exp $h$OpenBSD: inet_ntoa.c,v 1.2 1996/08/19 08:29:16 tholo Exp $$OpenBSD: inet_ntop.c,v 1.1 1997/03/13 19:07:32 downsj Exp $%u.%u.%u.%u$OpenBSD: res_init.c,v 1.24 2001/09/14 23:49:29 itojun Exp $/&$OpenBSD: gethostname.c,v 1.3 1998/05/13 08:50:58 deraadt Exp $$OpenBSD: inet_addr.c,v 1.6 1999/05/03 22:31:14 yanick Exp $$OpenBSD: inet_pton.c,v 1.3 1999/12/08 09:31:15 itojun Exp $01234567890123456789abcdef0123456789ABCDEF  x  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  $OpenBSD: getdomainname.c,v 1.3 1998/05/13 08:50:55 deraadt Exp $$OpenBSD: fgets.c,v 1.3 2001/07/09 06:57:44 deraadt Exp $$OpenBSD: getservbyname.c,v 1.5 2000/01/06 08:24:17 d Exp $$OpenBSD: getservent.c,v 1.5 1999/09/03 16:23:19 millert Exp $8$OpenBSD: fopen.c,v 1.2 1996/08/19 08:32:41 tholo Exp $$OpenBSD: rewind.c,v 1.2 1996/08/19 08:33:02 tholo Exp $$OpenBSD: fseek.c,v 1.3 2000/02/21 22:11:22 millert Exp $8$OpenBSD: syslog.c,v 1.11 2001/08/18 22:56:22 deraadt Exp $$OpenBSD: send.c,v 1.2 1996/08/19 08:29:52 tholo Exp $@(#)strftime.c 7.62'@(#)localtime.c 7.70$OpenBSD: localtime.c,v 1.20 2001/06/27 00:58:57 lebel Exp $WILDABBRGMT@(#)asctime.c 7.9$OpenBSD: asctime.c,v 1.7 2000/01/06 08:24:17 d Exp $]^$OpenBSD: sprintf.c,v 1.4 1998/01/12 06:14:31 millert Exp $$OpenBSD: vsnprintf.c,v 1.5 1998/07/27 02:28:28 millert Exp $_f nHvwpwz}}}~~$,4@tT 0h 0P<0`$OpenBSD: perror.c,v 1.3 1998/09/10 06:44:53 deraadt Exp $X$OpenBSD: catclose.c,v 1.4 1997/07/09 01:08:57 millert Exp $$OpenBSD: catgets.c,v 1.5 1996/09/15 09:31:22 tholo Exp $$OpenBSD: catopen.c,v 1.9 2001/05/11 15:30:14 art Exp $(P`h$OpenBSD: time.c,v 1.2 1996/08/19 08:26:39 tholo Exp $(xpP$OpenBSD: opendir.c,v 1.6 1998/08/15 08:10:14 deraadt Exp $$OpenBSD: scandir.c,v 1.4 1998/08/14 21:39:32 deraadt Exp $$OpenBSD: closedir.c,v 1.3 1998/11/20 11:18:37 d Exp $$OpenBSD: seekdir.c,v 1.3 1997/09/22 05:09:39 millert Exp $$OpenBSD: telldir.c,v 1.2 1996/08/19 08:26:35 tholo Exp $$OpenBSD: readdir.c,v 1.5 2001/05/17 20:20:36 rees Exp $0$OpenBSD: getpagesize.c,v 1.2 1996/08/19 08:23:54 tholo Exp $H0$OpenBSD: db.c,v 1.3 1999/02/15 05:11:23 millert Exp $$OpenBSD: rec_open.c,v 1.6 2001/05/11 15:30:13 art Exp $$OpenBSD: bt_open.c,v 1.7 2000/10/03 18:16:48 mickey Exp $$OpenBSD: bt_get.c,v 1.4 1999/02/15 05:11:22 millert Exp $$OpenBSD: bt_conv.c,v 1.4 1999/02/15 05:11:22 millert Exp $$OpenBSD: bt_put.c,v 1.6 1999/02/15 05:11:23 millert Exp $$OpenBSD: bt_delete.c,v 1.5 1999/02/15 05:11:22 millert Exp $$OpenBSD: bt_seq.c,v 1.5 2001/09/16 13:08:55 art Exp $$OpenBSD: bt_search.c,v 1.4 1999/02/15 05:11:23 millert Exp $$OpenBSD: bt_utils.c,v 1.4 1999/02/15 05:11:23 millert Exp $$OpenBSD: rec_close.c,v 1.6 1999/02/15 05:11:25 millert Exp $$OpenBSD: bt_close.c,v 1.4 1999/02/15 05:11:22 millert Exp $$OpenBSD: fclose.c,v 1.2 1996/08/19 08:32:19 tholo Exp $$OpenBSD: ftruncate.c,v 1.7 1998/11/20 11:18:52 d Exp $$OpenBSD: rec_get.c,v 1.6 2000/11/21 02:11:02 deraadt Exp $$OpenBSD: rec_put.c,v 1.5 1999/02/15 05:11:25 millert Exp $$OpenBSD: rec_delete.c,v 1.4 1999/02/15 05:11:25 millert Exp $$OpenBSD: rget.c,v 1.3 2001/07/09 06:57:44 deraadt Exp $$OpenBSD: refill.c,v 1.5 2001/07/09 06:57:44 deraadt Exp $$OpenBSD: rec_seq.c,v 1.4 1999/02/15 05:11:25 millert Exp $$OpenBSD: rec_utils.c,v 1.3 1996/08/19 08:21:12 tholo Exp $$OpenBSD: bt_overflow.c,v 1.5 1999/02/15 05:11:23 millert Exp $$OpenBSD: bt_page.c,v 1.5 1999/02/15 05:11:23 millert Exp $$OpenBSD: rec_search.c,v 1.5 1999/02/15 05:11:25 millert Exp $$OpenBSD: mpool.c,v 1.6 1999/02/15 05:11:25 millert Exp $$OpenBSD: fprintf.c,v 1.3 1997/07/25 20:30:09 mickey Exp $$OpenBSD: fdopen.c,v 1.2 1996/08/19 08:32:20 tholo Exp $$OpenBSD: flags.c,v 1.3 1996/08/19 08:32:37 tholo Exp $$OpenBSD: hash.c,v 1.10 2001/08/04 21:11:10 millert Exp $$OpenBSD: hash_func.c,v 1.5 1999/02/15 05:11:24 millert Exp $NP$OpenBSD: hash_page.c,v 1.7 1999/02/15 05:11:24 millert Exp $$OpenBSD: ashldi3.c,v 1.2 1996/08/19 08:30:16 tholo Exp $$OpenBSD: hash_bigkey.c,v 1.7 2000/10/03 18:16:48 mickey Exp $s`$OpenBSD: hash_log2.c,v 1.4 1999/02/15 05:11:24 millert Exp $$OpenBSD: mktemp.c,v 1.13 1998/06/30 23:03:13 deraadt Exp $$OpenBSD: snprintf.c,v 1.6 1998/01/12 06:20:56 millert Exp $| 00000000000000000}?@$@Y@@@È@jA.AcAׄAeB_ B7HvBmB0@BּC k&4CAy7Cv4WؠCmgNCX`=Dx@DKPDMՒCAy7FnM8O?ZwH02uOs<<Ҳ؉9I#ը32D=%[ό (doCA@???5?55?5A??҇coCa?Ɗ(`ȳ?DPy?@$@@?$OpenBSD: flt_rounds.c,v 1.3 1997/08/01 21:36:33 deraadt Exp $$OpenBSD: infinity.c,v 1.2 1996/08/19 08:17:37 tholo Exp $$OpenBSD: ctype_.c,v 1.5 2001/01/06 20:34:48 naddy Exp $ ((((( AAAAAABBBBBB ((((( Ř$OpenBSD: _def_monetary.c,v 1.3 1997/07/23 21:14:38 kstailey Exp $$OpenBSD: _def_numeric.c,v 1.3 1997/07/23 21:14:39 kstailey Exp $ $OpenBSD: fvwrite.c,v 1.11 2001/07/09 06:57:44 deraadt Exp $$OpenBSD: wsetup.c,v 1.3 2001/07/09 06:57:45 deraadt Exp $$OpenBSD: makebuf.c,v 1.3 1998/11/25 05:18:49 millert Exp $$OpenBSD: findfp.c,v 1.2 1996/08/19 08:32:36 tholo Exp $(HXHȠXH XH<H$OpenBSD: stdio.c,v 1.4 2001/07/09 06:57:44 deraadt Exp $$OpenBSD: lseek.c,v 1.6 1998/11/20 11:18:53 d Exp $$OpenBSD: fflush.c,v 1.2 1996/08/19 08:32:26 tholo Exp $$OpenBSD: fwalk.c,v 1.3 2001/07/09 06:57:44 deraadt Exp $$OpenBSD: sysconf.c,v 1.4 1998/06/02 06:10:26 deraadt Exp $$OpenBSD: sysctl.c,v 1.3 1997/08/24 21:25:46 millert Exp $$OpenBSD: malloc.c,v 1.42 2001/05/11 15:30:14 art Exp $$OpenBSD: signal.c,v 1.4 1998/06/26 02:12:49 deraadt Exp $(( ( $OpenBSD: mmap.c,v 1.8 1998/01/02 05:32:50 deraadt Exp $$OpenBSD: isatty.c,v 1.3 1998/11/20 11:18:39 d Exp $$OpenBSD: tcgetattr.c,v 1.2 1996/08/19 08:34:39 tholo Exp $$OpenBSD: umoddi3.c,v 1.2 1996/08/19 08:30:48 tholo Exp $$OpenBSD: qdivrem.c,v 1.2 1996/08/19 08:30:42 tholo Exp $$OpenBSD: isinf.c,v 1.4 2001/09/10 22:38:11 millert Exp $$OpenBSD: isnan.c,v 1.4 2001/09/10 22:38:11 millert Exp $@(#)bt_split.c 8.10 (Berkeley) 1/9/95$OpenBSD: hash_buf.c,v 1.8 2000/10/03 18:16:48 mickey Exp $a  !n}n`npopa3d*POP3 server/var/empty/sbin/nologin2popa3d*POP3 server/var/empty/sbin/nologin1popa3dJEuucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2nobody*Unprivileged user/nonexistent/sbin/nologin3named*FFBIND Name Service Daemon/var/named/sbin/nologin3Fsmmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin1smmspe`""www*CCHTTP server/var/www/sbin/nologin2proxy*GGProxy Services/nonexistent/sbin/nologin3Gbin*Binaries Commands and Source,,,//sbin/nologin1binsn3.named*FFBIND Name Service Daemon/var/named/sbin/nologin2 rootdaemonCharlie &/root/bin/csh/2rootdaemonCharlie &/root/bin/csh/3proxy*GGProxy Services/nonexistent/sbin/nologin1proxy e`oUoproxy*GGProxy Services/nonexistent/sbin/nologin2 daemon*The devil himself/root/sbin/nologin2smmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin3daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user/nonexistent/sbin/nologin1nobodyul+&;6  nobody*Unprivileged user/nonexistent/sbin/nologin2 operator*System &/operator/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Bpopa3d*POP3 server/var/empty/sbin/nologin3operator*System &/operator/sbin/nologin3operator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/csh1root \Vto$$bin*Binaries Commands and Source,,,//sbin/nologin2www*CCHTTP server/var/www/sbin/nologin3Cbin*Binaries Commands and Source,,,//sbin/nologin3named*FFBIND Name Service Daemon/var/named/sbin/nologin1namedwww*CCHTTP server/var/www/sbin/nologin1wwwuucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucpsmmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin2a  !n}n`npopa3d*POP3 server/var/empty/sbin/nologin2popa3d*POP3 server/var/empty/sbin/nologin1popa3dJEuucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2nobody*Unprivileged user/nonexistent/sbin/nologin3named*FFBIND Name Service Daemon/var/named/sbin/nologin3Fsmmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin1smmspe`""www*CCHTTP server/var/www/sbin/nologin2proxy*GGProxy Services/nonexistent/sbin/nologin3Gbin*Binaries Commands and Source,,,//sbin/nologin1binto50named*FFBIND Name Service Daemon/var/named/sbin/nologin2 rootdaemonCharlie &/root/bin/csh2rootdaemonCharlie &/root/bin/csh3proxy*GGProxy Services/nonexistent/sbin/nologin1proxy e`oUoproxy*GGProxy Services/nonexistent/sbin/nologin2 daemon*The devil himself/root/sbin/nologin2smmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin3daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user/nonexistent/sbin/nologin1nobodyvm,'<7 nobody*Unprivileged user/nonexistent/sbin/nologin2 operator*System &/operator/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Bpopa3d*POP3 server/var/empty/sbin/nologin3operator*System &/operator/sbin/nologin3operator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/csh1root \Vto$$bin*Binaries Commands and Source,,,//sbin/nologin2www*CCHTTP server/var/www/sbin/nologin3Cbin*Binaries Commands and Source,,,//sbin/nologin3named*FFBIND Name Service Daemon/var/named/sbin/nologin1namedwww*CCHTTP server/var/www/sbin/nologin1wwwuucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucpsmmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin2 ... . .. binmdecdsbindshared . ..bootRbootxxbinstall" installboot . .. chroot installboot sysctliled_c_filestore.9_bootstore.10_prom0_fake_saveecho_pv_putchar_sun4_idprom.65_dtab_stringbuf.75_promdev_inuse_prom_mapin_prom_mapinfo_prom_mapinfo_cnt_prom_devmap_promvecstore.88version.ogcc2_compiled.___gnu_compiled_cufs.ostrncpy.obootparam.ocd9660.ogets.onfs.orpc.ostrerror.orarp.onet.oin_cksum.oether.oglobals.omemcmp.oexit.ocloseall.ocread.oalloc.omemcpy.omemset.oclose.olseek.oopen.oread.oprintf.oarp.osdiv.oashrdi3.ostrcmp.o__main.ostrlen.oudiv.oumul.ourem.obzero.orem.oinflate.oadler32.oinfblock.oinfcodes.oinffast.oinfutil.oinftrees.ocrc32.or4X}4X4X4`4`4`44444 4 |4"4.4 =4 I4LW4i4v44 4 4 X54p4484@$4_4_dvma_mapin_block_count.urem_devopen_obp_close.udiv_pgofset__udiv_sprintf_netif_debug_freelist__urem_printf_putchar_obp_strategystart_prom0_iclose_io_twiddle_prom_ioctl_promvec_prom0_close_closeall_vprintf_block_size_prom0_strategy__rtt_dvma_init_dvma_free_prom_boothow_prom_si_prom_bootdevice_memset_memcpy_cputyp_pgshift_prom0_iopen_panic_progname_prom_open_etext_donottwiddle_bzero_prom_init_block_table_ndevs_dvma_mapout_loadboot_nbpg_exit_main_free_debug_alloc_edata_end_dvma_alloc___main_prom_bootfile_devswsrt0.obootxx.ogcc2_compiled.___gnu_compiled_ccloseall.ogcc2_compiled.___gnu_compiled_cdvma.ogcc2_compiled.___gnu_compiled_cpromdev.ogcc2_compiled.___gnu_compiled_c_filestore.9_bootstore.10_prom0_fake_saveecho_pv_putchar_promdev_inuse_prom_mapin_prom_mapinfo_prom_mapinfo_cnt_prom_devmap_promvecstore.47/usr/src/sys/arch/sparc/stand/bootxx/../libsa/obj/alloc.o/usr/src/sys/arch/sparc/stand/bootxx/../libsa/obj/exit.o/usr/src/sys/arch/sparc/stand/bootxx/../libsa/obj/printf.o/usr/src/sys/arch/sparc/stand/bootxx/../libsa/obj/memcpy.o/usr/src/sys/arch/sparc/stand/bootxx/../libsa/obj/memset.o/usr/src/sys/arch/sparc/stand/bootxx/../libkern/obj/__main.o/usr/src/sys/arch/sparc/stand/bootxx/../libkern/obj/bzero.o/usr/src/sys/arch/sparc/stand/bootxx/../libkern/obj/urem.o/usr/src/sys/arch/sparc/stand/bootxx/../libkern/obj/udiv.o\4 `@# ` "" $@` `T@   b@w"@H*/+  "bH  0  "  "  * " !` " @ %s: can't open device㿐@K#@  b("b( @ "   @`@)  @   "H@@%s: alloc failed%s: block table corrupt%s: read failure%s: short read㿐 `@    !@`  @ D ? c' / - + ,`2 @      @@ @`a@@?@2 @a aa @` @Ȳ@  ? Ċ`Ī@` Ē`IJ@` @ dvma_mapin㿘? #@(1? @@#1?dvma_mapout㿘 #@(1 @. 1㿘@ " ْ㿘 @  promprom0㿘  ` @ "H `  "  ` ""J  *@J` )*@Can't open device `%s' 㿘@   ` @ "H `  €b  $€b 2$   " @!X0   $   $`$` 㿘# bH`   ``*  `bH   '@`2`0`,6 * '@ 㿘  2& `& $& (   €5 " '@ 㿘 "H  @@ 0(@  㿘  @ $ ? `$ *㿐 "H/  0T@㿘  㿘 "H`t€Invalid controller number prom_iopen: "%s" error=%d 㿘) " ?N  @  "bPbP$` $`$`$`$`$`$` $`$$`($`,$`0$`4$` $`  $` $`  @ `+  " * @F $`0 "$`4 " @$` @ 2" &  %"   @  㿘# b  @ 4 "$b  & 4$b prom_mapin: length=%dprom_mapin: invalid maptype %d㿘  *`@   "H@ Ę    L         "`@{` `  @   8 <?*  Ș آ&@  `   Ȱ@㿘?( ,1 \&"H H L` T ` X P d l$ p  t @  .@ ДЖ ? * `:```?  `Ԕ "`"     А?"  㿘 b'H'L'P'T 'X "b@0H @  exit㿘 !@ ( 㿘!  !X'L'P'T'X$"@L"*㿘 'H'L'P'T'X @ H㿘  @8N@`N@`%` N@`|`  `*` € @L` L   ?,@` < ,L L  LL 4 L  ` >0 `L` L` N@ ` - @L N@ @C N@ @: N@ 0 x  @, N@ % w ls4l404x444444444444444d44444444444@444444440123456789abcdef㿈  @ @,@"  ?L?|/-\㿘  ؀`  "  a8J@ #" @ @   @ *0   @ *`( `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &" bootxx4444444H44\4   4444#4p,4\74=4F4M4 pV 4 c4m4t4 |4 4H44 4(4@4 4H44X4 444H 4`4t! 4L/ 4P8 4I4Q4Y4a4 j4w4 ~44444@44 4H4 444 H44  44  4 44H#48+ 4:4 A4H4Q4`4 X ` h p x  (08@HPX`hpx (08@HPX`hpxX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpxhpx (08@HPX`hpx (08@HPX`hpx (08@# $OpenBSD: dot.profile,v 1.17 2001/09/17 14:52:18 millert Exp $ # $NetBSD: dot.profile,v 1.1 1995/12/18 22:54:43 pk Exp $ # # Copyright (c) 1995 Jason R. Thorpe # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by Christopher G. Demetriou. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # export PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export HISTFILE=/.sh_history umask 022 set -o emacs # emacs-style command line editing # XXX # the TERM/EDITOR stuff is really well enough parameterized to be moved # into install.sub where it could use the routines there and be invoked # from the various (semi) MI install and upgrade scripts # terminals believed to be in termcap, default TERM TERMS="sun vt* pcvt* pc3 dumb" TERM=sun if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES mount -u /dev/rd0a / # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C, status ^T' stty newcrt werase ^W intr ^C kill ^U erase ^? status ^T 9600 # get the terminal type _forceloop="" while [ "X$_forceloop" = X"" ]; do echo "Supported terminals are: $TERMS" eval `tset -s -m ":?$TERM"` if [ "X$TERM" != X"unknown" ]; then _forceloop="done" fi done export TERM # Installing or upgrading? _forceloop="" while [ "X$_forceloop" = X"" ]; do echo -n '(I)nstall, (U)pgrade, or (S)hell? ' read _forceloop case "$_forceloop" in i*|I*) /install ;; u*|U*) /upgrade ;; s*|S*) ;; *) _forceloop="" ;; esac done fi # # # # # # # # MDSETS="kernel xbin xman xinc xcon" ARCH=sparc md_set_term() { test -n "$TERM" && return echo -n "Specify terminal type [sun]: " getresp sun TERM=$resp export TERM } md_get_msgbuf() { # Only want to see one boot's worth of info dmesg > /tmp/msgbuf sed -n -f /dev/stdin /tmp/msgbuf <<- OOF /^OpenBSD /h /^OpenBSD /!H \${ g p } OOF } md_get_diskdevs() { # return available disk devices md_get_msgbuf | sed -n -e '/^sd[0-9] /{s/ .*//;p;}' \ -e '/^x[dy][0-9] /{s/ .*//;p;}' } md_get_cddevs() { # return available CDROM devices md_get_msgbuf | sed -n -e '/^cd[0-9] /{s/ .*//;p;}' } md_get_partition_range() { # return range of valid partition letters echo [a-p] } md_questions() { : } md_installboot() { local _rawdev _prefix if [ -z "$1" ]; then echo No disk device specified, you must run installboot manually. return fi _rawdev=/dev/r${1}c # use extracted mdec if it exists (may be newer) if [ -e /mnt/usr/mdec/boot ]; then _prefix=/mnt/usr/mdec elif [ -e /usr/mdec/boot ]; then _prefix=/usr/mdec else echo No boot block prototypes found, you must run installboot manually. return fi echo Installing boot block... cp ${_prefix}/boot /mnt/boot sync; sync; sync installboot -v /mnt/boot ${_prefix}/bootxx ${_rawdev} } md_native_fstype() { : } md_native_fsopts() { : } md_checkfordisklabel() { # $1 is the disk to check local rval disklabel $1 > /dev/null 2> /tmp/checkfordisklabel if grep "no disk label" /tmp/checkfordisklabel; then rval=1 elif grep "disk label corrupted" /tmp/checkfordisklabel; then rval=2 else rval=0 fi rm -f /tmp/checkfordisklabel return $rval } md_prep_disklabel() { local _disk=$1 md_checkfordisklabel $_disk case $? in 0) ;; 1) echo WARNING: Label on disk $_disk has no label. You will be creating a new one. echo ;; 2) echo WARNING: Label on disk $_disk is corrupted. You will be repairing. echo ;; esac # display example cat << __EOT If you are unsure of how to use multiple partitions properly (ie. separating /, /usr, /tmp, /var, /usr/local, and other things) just split the space into a root and swap partition for now. __EOT disklabel -W ${_disk} disklabel -f /tmp/fstab.${_disk} -E ${_disk} } md_welcome_banner() { { if [ "$MODE" = install ]; then cat << __EOT Welcome to the OpenBSD/sparc ${VERSION_MAJOR}.${VERSION_MINOR} installation program. This program is designed to help you put OpenBSD on your disk in a simple and rational way. __EOT else cat << __EOT echo Welcome to the OpenBSD/sparc ${VERSION} upgrade program. This program is designed to help you upgrade your OpenBSD system in a simple and rational way. As a reminder, installing the 'etc' binary set is NOT recommended. Once the rest of your system has been upgraded, you should manually merge any changes to files in the 'etc' set into those files which already exist on your system. __EOT fi cat << __EOT As with anything which modifies your disk's contents, this program can cause SIGNIFICANT data loss, and you are advised to make sure your data is backed up before beginning the installation process. Default answers are displayed in brackets after the questions. You can hit Control-C at any time to quit, but if you do so at a prompt, you may have to hit return. Also, quitting in the middle of installation may leave your system in an inconsistent state. __EOT } | more } md_not_going_to_install() { cat << __EOT OK, then. Enter 'halt' at the prompt to halt the machine. Once the machine has halted, power-cycle the system to load new boot code. __EOT } md_congrats() { local what; if [ "$MODE" = install ]; then what=installed else what=upgraded fi cat << __EOT CONGRATULATIONS! You have successfully $what OpenBSD! To boot the installed system, enter halt at the command prompt. Once the system has halted, reset the machine and boot from the disk. __EOT }  @ ;Jx   @@;Jx i@@`@@<@`bT U;J (!xA;Jyv;Jyv;Jy 1/A;JyC;Jy ;Jy MA;J;J&6;J&6 tdA;Jy ;J;J > ;Jܓ;Jܓ;Jܓ../../instbinS ;Ju*;Ju*;Ju*../../instbin{ ;J;J;J../../instbina;J沀;J沀;J [m!;Jv;Jv;J da;J4΀;J4΀;J$[܀ @{!;Je;Je;J$[܀ /7a;J U;J U;J$[܀ !&!;J";J";J$[܀!1a;J$s;J$s;J$[܀ "u!;J&%;J&%;J$[܀"1a;J) ;J) ;J$[܀ #2_/!;J*Q;J*Q;J$[܀#ga;J,;J,;J$[܀ $E !;J.};J.};J$[܀$Rqa;J05;J05;J$[܀ %$!;J2b;J2b;J$[܀%;a;J5 R;J5 R;J$[܀ &!;J6=;J6=;J$[܀&)a;J98p;J98p;J$[܀ 'Cɏz!;J:i;J:i;J$[܀'7Gb[a;J1-;J1-;J$[܀ (<!;J;J;J$[܀(翿a;J]J;J]J;J$[܀ );!;Jw;Jw;J$[܀)Ya;J h;J h;J$[܀ *?xo!;J ;J ;J$[܀*ea;J ;J ;J$[܀ +J9!;J沀;J沀;J$[܀+`<a;JI ;JI ;J$[܀ ,)K!;Jz9;Jz9;J$[܀,a;Ju*;Ju*;J$[܀ -Q(!;JW;JW;J$[܀-g"a;J;J;J$[܀ .}u!;Jt;Jt;J$[܀.wa;J4΀;J4΀;J$[܀ /=$!;Je;Je;J$[܀/OZqa;J*T;J*T;J 0c!;J,;J,;J0a;J/q;J/q;J 1]x!;J0G;J0G;J1Xa;J3B;J3B;J 2V!;J4s;J4s;J2a;J6;J6;J 3U\O!;J8ـ;J8ـ;J3;?a;J;3;J;3;J 4,!;J1-;J1-;J4786a;J;J;J 5-!;JĴ;JĴ;J56:a;J;J;J 6Q!;J h;J h;J6-a;J X;J X;J 7!;JN;JN;J74a;JI ;JI ;J 8G=G!;J;J;J8'a;J ;J ;J 9F!;Jp;Jp;J9:a;Jk ;Jk ;J :N9!;J4΀;J4΀;J:wa;J /;J /;J ;!;J";J";J;")>a;J% ;J% ;J <^"!;J'V;J'V;J<aa;J*Q;J*Q;J =i=X!;J,;J,;J=BI/a;J/;J/;J >!;J1xˀ;J1xˀ;J>׊a;J4s;J4s;J ?{z;!;J6=;J6=;J?&a;J ;J ;J#*l!;J沀;J沀;J#*{ڏ%a;J;J;J#*\si!;JC;JC;J#*{>a;J>;J>;J#*s.!;J;J;J#*{9a;J;J;J#* !;Je;Je;J#*{Xa;J U;J U;J#*n]!;J#*;J#*;J#*{x+%a;J&%;J&%;J#*`H!;J'c;J'c;J#*{Ea;J*Q;J*Q;J#*!;J,;J,;J#*{a;J/q;J/q;J#* !;J1xˀ;J1xˀ;J#*{*"a;J4s;J4s;J#*@)!;J6=;J6=;J#*{)a;J98p;J98p;J#* !;J;3;J;3;J#*{ a;JbZ;JbZ;J#* ì m!;JĴ;JĴ;J#*{ a;J';J';J#* J!;J h;J h;J#*{ $l;a;J X;J X;J#* ;`!;JN;JN;J#*{ |a;JI ;JI ;J#* Ӳ3!;J;J;J#*{ Ewa;J ;J ;J#*z 1!;Jp;Jp;J#*{ԏfa;Jk ;Jk ;J#*H0Z!;J4΀;J4΀;J#*{N2a;J*Q;J*Q;J8C!;J,;J,;J8C{C5a;J/;J/;J8C !;J1xˀ;J1xˀ;J8C{ìia;J4s;J4s;J8CH&p!;J6=;J6=;J8C{fga;J98p;J98p;J8Cz+!;J;J;J8C{߉a;J;J;J8C{!;JĴ;JĴ;J8C{ka;J;J;J8CR3!;Jр;Jр;J8C{:&(a;J ;J ;J8C!;J ;J ;J8C{Oa;J߀;J߀;J8C;,!;JI ;JI ;J8C{Za;Jf;Jf;J8C(3Ŝ!;Ju*;Ju*;J8C{#a;Jׄ;Jׄ;J8C]!;J;J;J8C{LI"a;J;J;J8Cd!;J4΀;J4΀;J8C{t!a;J(;J(;J8C!;J!;J!;J8C{Kq!@a;J$[܀;J$[܀;J8C!;J&%;J&%;J8C{ҁxa;J(;J(;J8CO!;J*Q;J*Q;J8C{Ea;J,;J,;J8Cq플!;J.};J.};J8C{);J>;J81S21!;Jp;Jp;J8{1Ja;Jk ;Jk ;J82HD!;J8;J8;J8{2ea;J(;J(;J833S!;J U;J U;J8{3G9ha;J#*;J#*;J84"TV!;J$s;J$s;J8{4MGna;J'V;J'V;J854 !;J) ;J) ;J8{5IuUa;J+;J+;J86!;J-L;J-L;J8{6RJ-a;J/;J/;J87{$!;J1xˀ;J1xˀ;J8{7za;J3%;J3%;J88t6T!;J5;J5;J8{8a;J8C;J8C;J89!;J9;J9;J8{9[`R.a;J;J;J8:<_1!;JÀ;JÀ;J8{:ra;JĴ;JĴ;J8;[!;J;J;J8{;a;Jр;Jр;J8<--!;J !;J !;J8{<Dxa;J ;J ;J8=p&!;JN;JN;J8{=͋a;JI ;JI ;J8>0mk!;Jz9;Jz9;J8{>]Ha;Ju*;Ju*;J8?do!;JW;JW;J8{?4>.!;J&%;J&%;J'ci!;J-L;J-L;J/qi!;J;J;JbZi!;J;J;J hi(?!;JI;JI;JviI!;JW;JW;Jׄi v{!;Je;Je;Ji!;J$s;J$s;J&6i)!;J,;J,;J-Di !;J3%;J3%;J5 Ri B=!;JĴ;JĴ;J١!;J !;J !;J cG!;J߀;J߀;JI 7M'!;J ;J ;J>'K[!;Jk ;Jk ;J8Cr9!;J&6;J&6;J'c@XH!;J,;J,;J-Dcٞ!;J2b;J2b;J3%mi!;JÀ;JÀ;JĴp!;J h;J h;Jz9wfĀ!;J ;J ;Jz9wW!;J X;J X;Jz9wc!;J ;J ;Jz9wb.m!;JI;JI;Jz9w-!;J(;J(;J!`3;&A;J% ;J&%;J&% !|PV!;J*T;J*T;J,}A!;J0G;J0G;J1xˀ}Ap!;J5 R;J5 R;J6=}ը!;J9;J9;J}.!;J;J;JĴ}z}!;JX;;JX;;J h}!;J ;J ;J沀}_!;J;J;Jf}}1d!;J>;J>;Jp} sU!;J;J;J4΀} !;J U;J U;J"} c!;J&%;J&%;J'V} mc;J6;06;J rZD+m&;J8;07;J /  mT A&};J;J-L;J-L   8 @ H P PI ;J߀;JI ;JI  ^;JG;Je;Je # "$_b" ]] ; then _l="$_a $_l"; _a=$_b else _l="$_b $_l" fi fi shift done echo -n "$_a "; bsort $_l } dir_has_sets() { # return true when the directory $1 contains a set for $2...$n local _dir=$1 _file shift for _file in $* do if [ -f $_dir/${_file}${VERSION}.tar.gz ]; then return 0 fi # Try for stupid msdos convention if [ -f $_dir/${_file}${VERSION}.tgz ]; then return 0 fi # Special check for kernel if [ $_file = "kernel" -a -f $_dir/bsd ]; then return 0 fi done return 1 } list_has_sets(#!/bin/sh # $OpenBSD: install.sub,v 1.170 2001/10/15 22:58:59 krw Exp $ # $NetBSD: install.sub,v 1.5.2.8 1996/09/02 23:25:02 pk Exp $ # # Copyright (c) 1997,1998 Todd Miller, Theo de Raadt # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by Todd Miller and # Theo de Raadt # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # Copyright (c) 1996 The NetBSD Foundation, Inc. # All rights reserved. # # This code is derived from software contributed to The NetBSD Foundation # by Jason R. Thorpe. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by the NetBSD # Foundation, Inc. and its contributors. # 4. Neither the name of The NetBSD Foundation nor the names of its # contributors may be used to endorse or promote products derived # from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE NETBSD FOUNDATION, INC. AND CONTRIBUTORS # ``AS IS'' AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED # TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR # PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE REGENTS OR CONTRIBUTORS BE # LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR # CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF # SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS # INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN # CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) # ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE # POSSIBILITY OF SUCH DAMAGE. # # OpenBSD installation/upgrade script - common subroutines. ROOTDISK= # filled in below VERSION=30 VERSION_MAJOR=$(( $VERSION / 10 )) VERSION_MINOR=$(( $VERSION % 10 )) export VERSION VERSION_MAJOR VERSION_MINOR # extra "site" set can be provided by person doing install ALLSETS="base etc misc comp man game xbase xshare xfont xserv site" # install UPGRSETS="base misc comp man game xbase xshare xfont xserv site" # upgrade SNAPSETS="bin dev etc games man misc sbin \ usr.bin usr.binutils usr.games usr.include \ usr.lib usr.libexec usr.misc usr.sbin usr.share var" THESETS= # one of the above # Path searched for sets by install_sets on the local filesystems local_sets_dir= # decide upon an editor if [ "X$EDITOR" = X ]; then if [ -x /usr/bin/vi ]; then EDITOR=vi else EDITOR=ed fi export EDITOR fi # Please don't use the 1 of n form below, good idea, wrong implementation! # get a reponse with default[s] getresp() { local _shell_aware=0 local _no_shell=0 # -s option means exit after a shell (caller is shell-aware) if [ "$1" = "-s" ]; then _shell_aware=1 shift fi # -n option means don't try to run shell commands if [ "$1" = "-n" ]; then _no_shell=1 shift fi set -o noglob valid="false" while [ "X$valid" = "Xfalse" ]; do read resp if [ ${_no_shell} -eq 1 ]; then test -z "$resp" && resp=$1 else case "$resp" in "") resp=$1 ;; !) echo "Type 'exit' to return to install." sh test $_shell_aware -eq 0 && continue ;; !*) eval ${resp#?} test $_shell_aware -eq 0 && continue ;; esac fi if [ $# -gt 1 ]; then for i in $@; do if [ "X$resp" = "X$i" ]; then valid="true" fi done else valid="true" fi if [ "X$valid" = "Xfalse" ]; then echo "Try again: Enter one of [$@]" fi done set +o noglob } isin() { # test the first argument against the remaining ones, return succes on a match local _a=$1 shift while [ $# != 0 ]; do if [ "$_a" = "$1" ]; then return 0; fi shift done return 1 } addel() { # add first argument to list formed by the remaining arguments # adds to the tail if the element does not already exist local _a=$1 _seen= shift while [ $# != 0 ]; do echo "$1" if [ "$_a" = "$1" ]; then _seen="yes" fi shift done if [ "X$_seen" = "X" ]; then echo "$_a" fi } rmel() { # remove first argument from list formed by the remaining arguments local _a=$1 shift while [ $# != 0 ]; do if [ "$_a" != "$1" ]; then echo "$1" fi shift done } cutword () { # read lines on stdin, return Nth element of each line, like cut(1) local _a _n _oifs="$IFS" # optional field separator case "$1" in -t?*) IFS=${1#-t}; shift;; esac _n=$1 while read _a; do set -- $_a test "$1" = "" && break eval echo \$$_n done IFS="$_oifs" } cutlast () { # read a line of data, return last element. Equiv. of awk '{print $NF}'. local _a _oifs="$IFS" # optional field separator case "$1" in -t?*) IFS=${1#-t}; shift;; esac read _a; set -- $_a IFS="$_oifs" if [ "$1" = "" ]; then return; fi while [ "$#" -gt 10 ]; do shift 10; done eval echo \$$# } firstchar () { # return first character of argument local _a=$1 while [ ${#_a} != 1 ]; do _a=${_a%?} done echo $_a } basename () { local _oifs if [ "$1" = "" ]; then return; fi _oifs="$IFS" IFS="/" set -- $1 IFS="$_oifs" while [ "$#" -gt 10 ]; do shift 10; done eval echo \$$# } isnumeric() { local _a=$1 while [ ${#_a} != 0 ]; do case $_a in [0-9]*) ;; *) echo 0; return;; esac _a=${_a#?} done echo 1; return } get_ifdevs() { # return available network devices /sbin/ifconfig -a | egrep -v '^([[:space:]]|(lo|enc|gre|ppp|sl|tun|bridge)[[:digit:]])' | cutword -t: 1 } bsort() { local _l _a=$1 if [ $# == 0 ]; then return fi if [ $# == 1 ]; then echo $1; return fi shift while [ $# != 0 ]; do local _b=$1 if [[ "$_a" != "$_b" ]] ; then if [[ "$_a" > "$_b" ]] ; then _l="$_a $_l"; _a=$_b else _l="$_b $_l" fi fi shift done echo -n "$_a "; bsort $_l } dir_has_sets() { # return true when the directory $1 contains a set for $2...$n local _dir=$1 _file shift for _file in $* do if [ -f $_dir/${_file}${VERSION}.tar.gz ]; then return 0 fi # Try for stupid msdos convention if [ -f $_dir/${_file}${VERSION}.tgz ]; then return 0 fi # Special check for kernel if [ $_file = "kernel" -a -f $_dir/bsd ]; then return 0 fi done return 1 } list_has_sets() { # return true when the list $1 contains a set, given dir $2 for $3...$n local _list=$1 _file shift for _file in $* do if isin ${_file}${VERSION}.tar.gz $_list; then return 0 fi # Try for stupid msdos convention if isin ${_file}${VERSION}.tgz $_list; then return 0 fi # Special check for kernel if test $_file = "kernel" && isin bsd $_list; then return 0 fi done return 1 } ftp_list_files() { # log in via ftp to host $1 as user $2 with password $3 # and return a list of all files in the directory $4 on stdout local _host=$1 _user=$2 _pass=$3 _dir=$4 shift; shift; shift; shift ftp ${_ftp_active} -V -n $_host << __ptf user $_user $_pass cd $_dir ls quit __ptf } get_localdir() { # $1 is relative mountpoint local _mp=$1 _dir= while : ; do echo -n "Enter the pathname where the sets are stored [$_dir] " getresp "$_dir" _dir=$resp # Allow break-out with empty response if [ -z "$_dir" ]; then echo -n "Are you sure you don't want to set the pathname? [n] " getresp "n" case "$resp" in y*|Y*) break ;; *) continue ;; esac fi if dir_has_sets "$_mp/$_dir" $THESETS then local_sets_dir="$_mp/$_dir" break else cat << __EOT The directory \"$local_sets_dir\" does not exist, or does not hold any of the upgrade sets. __EOT echo -n "Re-enter pathname? [y] " getresp "y" case "$resp" in y*|Y*) ;; *) local_sets_dir= break ;; esac fi done } getanotherdisk() { cat << __EOT Now you can select another disk to initialize. (Do not re-select a disk you have already entered information for). Available disks are: __EOT _DKDEVS=`md_get_diskdevs` echo "$_DKDEVS" echo echo -n "Which one? [done] " getresp "" if [ "X${resp}" = "X" ]; then DISK=done elif [ "X${resp}" = "Xdone" ]; then DISK=done elif isin $resp $_DKDEVS ; then DISK="$resp" else echo echo "The disk $resp does not exist." DISK= fi } getrootdisk() { cat << __EOT The installation program needs to know which disk to consider the root disk. Note the unit number may be different than the unit number you used in the boot program (especially on a PC with multiple disk controllers). Available disks are: __EOT local _defdsk; _DKDEVS=`md_get_diskdevs` _defdsk=`echo $_DKDEVS | cutlast` if [ "${_defdsk}" != "${_DKDEVS}" ]; then _defdsk= fi echo "$_DKDEVS" echo echo -n "Which disk is the root disk? [${_defdsk}] " getresp "${_defdsk}" if isin $resp $_DKDEVS ; then ROOTDISK="$resp" else echo echo "The disk $resp does not exist." ROOTDISK= fi } addhostent() { # $1 - IP address # $2 - symbolic name # Create an entry in the hosts table. If no host table # exists, create one. If the symbolic name already exists, # replace its entry. if [ ! -f /tmp/hosts ]; then echo "127.0.0.1 localhost" > /tmp/hosts fi sed "/ $2.$FQDN $2\$/d" < /tmp/hosts > /tmp/hosts.new mv /tmp/hosts.new /tmp/hosts echo "$1 $2.$FQDN $2" >> /tmp/hosts } addifconfig() { # $1 - interface name # $2 - interface symbolic name # $3 - interface IP address # $4 - interface netmask # $5 - (optional) interface media directives # Create a hostname.* file for the interface. if [ "$3" = "dhcp" ]; then echo "dhcp NONE NONE NONE $5" > /tmp/hostname.$1 addhostent 127.0.0.1 $2 else echo "inet $3 $4 NONE $5" > /tmp/hostname.$1 addhostent $3 $2 fi } configurenetwork() { local _ifsdone= _ifs _ouranswer= _reprompt=1 _IFS=`get_ifdevs` resp= # force at least one iteration while [ "X${resp}" != X"done" ]; do if [ $_reprompt = 1 ]; then cat << __EOT You may configure the following network interfaces (the interfaces marked with [X] have been successfully configured): __EOT for _ifs in $_IFS; do if [ "X${_ouranswer}" = "X" ]; then _ouranswer=$_ifs fi if isin $_ifs $_ifsdone ; then echo -n " [X] " else echo -n " [ ] " fi echo $_ifs done echo fi echo -n "Configure which interface? (or, enter 'done') [$_ouranswer] " getresp "$_ouranswer" case "$resp" in "done") ;; "") _reprompt=0 ;; *) _ifs=$resp _ouranswer="done" if isin $_ifs $_IFS ; then if configure_ifs $_ifs ; then _ifsdone="$_ifs $_ifsdone" else _ouranswer= fi else echo "Invalid response: \"$resp\" is not in list" fi _reprompt=1 ;; esac done } configure_ifs() { local _up _if_name=$1 _if_ip _if_mask local _if_symname _if_extra _hostname local _dhcp_prompt set -- `ifconfig $_if_name | sed -n ' 1s/.**$/DOWN/p /media:/s/^.*$// /status:/s/^.*$// /inet/s/--> [0-9.][0-9.]*// /inet/s/netmask// /inet/s/broadcast// /inet/s/inet// p'` _up=$1 _if_ip=$2 _if_mask=$3 if [ $_up = "UP" ]; then ifconfig $_if_name delete down fi if [ ! -x /sbin/dhclient ]; then echo "DHCP install not supported" echo else _dhcp_prompt=" (or 'dhcp')" fi # Get IP address resp= # force one iteration while [ "X${resp}" = X"" ]; do echo -n "IP address${_dhcp_prompt} ? [$_if_ip] " getresp "$_if_ip" if [ ! -x /sbin/dhclient -a "X$resp" == "Xdhcp" ]; then resp= fi _if_ip=$resp done # Get symbolic name _hostname=`hostname` resp= # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Symbolic (host) name? [$_hostname] " getresp "$_hostname" _if_symname=$resp done # Get netmask if [ "$_if_ip" != "dhcp" ]; then resp= if [ "X${_if_mask}" = X"" ]; then _if_mask=255.255.255.0 fi while [ "X${resp}" = X"" ]; do echo -n "Netmask ? [$_if_mask] " getresp "$_if_mask" _if_mask=$resp done fi if [ -n "`ifconfig -m ${_if_name} | sed -n '/media/p'`" ]; then echo "Your use of the network interface may require non-default" echo "media directives. The default media is:" ifconfig -m ${_if_name} | sed -n ' /supported/D /media:/p' echo "This is a list of supported media:" ifconfig -m ${_if_name} | sed -n ' /media:/D s/^ // /media/p' echo "If the default is not satisfactory, and you wish to use another" echo "media, copy that line from above (e.g. \"media 100baseTX\")" echo -n "Media directives? [$_if_extra] " getresp "$_if_extra" if [ "X${resp}" != X"" ]; then _if_extra=$resp fi fi # Configure the interface. If it # succeeds, add it to the permanent # network configuration info. if [ "$_if_ip" = "dhcp" ]; then ifconfig ${_if_name} down ${_if_extra} cat > /etc/dhclient.conf << __EOT initial-interval 1; send host-name "$_hostname"; request subnet-mask, broadcast-address, routers, domain-name, domain-name-servers, host-name; __EOT dhclient -1 ${_if_name} set -- `ifconfig $_if_name | sed -n ' 1s/.**$/DOWN/p /media:/s/^.*$// /status:/s/^.*$// /inet/s/--> [0-9.][0-9.]*// /inet/s/netmask// /inet/s/broadcast// /inet/s/inet// p'` if [ $1 = "UP" -a $2 = "0.0.0.0" ]; then echo "hostname-associated DHCP attempt for $_if_name failed..." ifconfig $_if_name delete down cat > /etc/dhclient.conf << __EOT initial-interval 1; request subnet-mask, broadcast-address, routers, domain-name, domain-name-servers, host-name; __EOT dhclient -1 ${_if_name} set -- `ifconfig $_if_name | sed -n ' 1s/.**$/DOWN/p /media:/s/^.*$// /status:/s/^.*$// /inet/s/--> [0-9.][0-9.]*// /inet/s/netmask// /inet/s/broadcast// /inet/s/inet// p'` if [ $1 = "UP" -a $2 = "0.0.0.0" ]; then echo "free-roaming DHCP attempt for $_if_name failed." ifconfig $_if_name delete down return 1 else echo "DHCP attempt for $_if_name successful." addifconfig ${_if_name} ${_if_symname} ${_if_ip} return 0 fi else echo "DHCP configuration of $_if_name successful." addifconfig ${_if_name} ${_if_symname} ${_if_ip} return 0 fi else ifconfig ${_if_name} down if ifconfig ${_if_name} inet \ ${_if_ip} \ netmask ${_if_mask} ${_if_extra} up ; then addifconfig ${_if_name} ${_if_symname} ${_if_ip} ${_if_mask} "${_if_extra}" return 0 fi fi return 1 } # Returns true if $1 contains only alphanumerics isalphanumeric() { local _n _n=$1 while [ ${#_n} != 0 ]; do case $_n in [A-Za-z0-9]*) ;; *) return 1;; esac _n=${_n#?} done return 0 } # Much of this is gratuitously stolen from /etc/netstart. enable_network() { # Check for required network related files for _netfile in hosts myname; do if [ ! -f /mnt/etc/${_netfile} ]; then echo "ERROR: no /mnt/etc/${_netfile}!" return 1 fi done # Copy any required or optional files found for _netfile in hosts myname dhclient.conf resolv.conf resolv.conf.tail; do if [ -f /mnt/etc/${_netfile} ]; then cp /mnt/etc/${_netfile} /etc/${_netfile} fi done hostname=`cat /etc/myname` hostname $hostname _didnet=1 # set the address for the loopback interface ifconfig lo0 inet localhost # use loopback, not the wire route -n add -host $hostname localhost > /dev/null route -n add -net 127 127.0.0.1 -reject > /dev/null # configure all of the non-loopback interfaces which we know about. # refer to hostname.if(5) for hn in /mnt/etc/hostname.*; do # Strip off /mnt/etc/hostname. prefix if=${hn#/mnt/etc/hostname.} # Interface names must be alphanumeric only. We check to avoid # configuring backup or temp files, and to catch the "*" case. if ! isalphanumeric "$if"; then continue fi ifconfig $if > /dev/null 2>&1 if [ "$?" != "0" ]; then continue fi # Now parse the hostname.* file while :; do if [ "$cmd2" ]; then # we are carrying over from the 'read dt dtaddr' last time set -- $cmd2 af="$1" name="$2" mask="$3" bcaddr="$4" ext1="$5" cmd2= # make sure and get any remaining args in ext2, like the read below i=1; while [ i -lt 6 -a -n "$1" ]; do shift; let i=i+1; done ext2="$@" else # read the next line or exit the while loop read af name mask bcaddr ext1 ext2 || break fi # $af can be "dhcp", "up", "rtsol", an address family, commands, or # a comment. case "$af" in "#"*|"!"*|"bridge"|""|"rtsol") # skip comments, user commands, bridges, # IPv6 rtsol and empty lines continue ;; "dhcp") [ "$name" = "NONE" ] && name= [ "$mask" = "NONE" ] && mask= [ "$bcaddr" = "NONE" ] && bcaddr= ifconfig $if $name $mask $bcaddr $ext1 $ext2 down cmd="dhclient $if" ;; "up") # The only one of these guaranteed to be set is $if # the remaining ones exist so that media controls work cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" ;; *) read dt dtaddr if [ "$name" = "alias" ]; then # perform a 'shift' of sorts alias=$name name=$mask mask=$bcaddr bcaddr=$ext1 ext1=$ext2 ext2= else alias= fi cmd="ifconfig $if $af $alias $name " case "$dt" in dest) cmd="$cmd $dtaddr" ;; [a-z!]*) cmd2="$dt $dtaddr" ;; esac if [ ! -n "$name" ]; then echo "/mnt/etc/hostname.$if: invalid network configuration file" return fi case $af in inet) [ "$mask" ] && cmd="$cmd netmask $mask" if [ "$bcaddr" -a "X$bcaddr" != "XNONE" ]; then cmd="$cmd broadcast $bcaddr" fi [ "$alias" ] && rtcmd="; route -n add -host $name 127.0.0.1" ;; inet6) # Ignore IPv6 setup continue ;; *) cmd="$cmd $mask $bcaddr" esac cmd="$cmd $ext1 $ext2$rtcmd" rtcmd= ;; esac eval "$cmd" done < /mnt/etc/hostname.$if done # /mnt/etc/mygate, if it exists, contains the name of my gateway host # that name must be in /etc/hosts. if [ -f /mnt/etc/mygate ]; then route delete default > /dev/null 2>&1 route -n add -host default `cat /mnt/etc/mygate` fi # Get FQDN after any DHCP manipulation of resolv.conf is done get_fqdn /etc/resolv.conf # Display results... echo "Network interface configuration:" ifconfig -am # enable the resolver if resolv.conf is available if [ -f /etc/resolv.conf ]; then route show echo "\nResolver enabled." else route -n show echo "\nResolver not enabled." fi return 0 } # Print the selector and get a response # The list of sets is passed in as $1, sets $resp get_selection() { local _next= _f _sets=$1 for _f in $_sets ; do if isin $_f $_setsdone ; then echo -n " [X] " _next= else echo -n " [ ] " if [ -z "$_next" ]; then _next=$_f fi fi echo $_f done # Get the name of the file. echo -n "File name? [$_next] " getresp "$_next" } # Do globbing on the selection and parse +/-, sets _get_files and _setsdone # (which must exist in the local namespace) as side effects. glob_selection() { local _selection="$1" _parent_dir="$2" _sets="$3" local _action _matched _tfile _f if [ "X${_selection}" = X"" ]; then return fi # Change +/- into add/remove _action=add case "$_selection" in +*) _selection="${_selection#?}" ;; -*) _selection="${_selection#?}" _action=remove ;; esac # Major hack to allow the user to select globbing patterns set -o noglob if [ X"$_selection" = X"all" ]; then _selection=* fi _tfile=/tmp/install_case.$$ # safe in single user mode cat >$_tfile << OOF case \$_f in $_selection) # Add/remove file to extraction list if [ "\$_action" = "add" ]; then _get_files=\`addel \${_f} \${_get_files}\` _setsdone=\`addel \${_f} \${_setsdone}\` elif [ "\$_action" = "remove" ]; then _get_files=\`rmel \${_f} \${_get_files}\` _setsdone=\`rmel \${_f} \${_setsdone}\` else echo "Unknown action: \$_action" fi _matched=\$(( \$_matched + 1 )) ;; esac OOF set +o noglob # Eww. _matched=0 for _f in $_sets; do . $_tfile done rm -f $_tfile if [ $_matched -eq 0 ]; then echo "File $_parent_dir/$_selection does not exist. Check to make" echo "sure you entered the information properly or enter 'list' for a file list." fi } install_url() { # Get several parameters from the user, and xfer # files from the server. # Note: _ftp_server_ip, _ftp_server_dir, _ftp_server_login, # _ftp_server_password, and _ftp_active must be global. local _sets _kernel _f _file_list _get_files _failed_files _osetsdone local _url_type _url_base _reuse _minpat # Parse arguments, shell style while test $# != 0; do case "$1" in -ftp) _url_type=ftp ;; -http) _url_type=http ;; -reuse) _reuse=1 ;; -minpat) shift; _minpat="$1" ;; esac shift done if [ X"${_minpat}" = X ]; then _minpat='base*.tar.gz|base*.tgz|man*.tar.gz|man*.tgz|etc*.tar.gz|etc*.tgz|bsd' fi echo echo "This is an automated ${_url_type}-based installation process. You will be asked" echo "questions and then the files will be retrieved iteratively via ${_url_type}." echo # Reuse old values w/o prompting for anything? if [ X"$_reuse" = X"1" ]; then _reuse= if eval test X"\$_installed_via_${_url_type}" = X"1"; then echo -n "Use values from previous ${_url_type} install? [y] " getresp y case "$resp" in y*|Y*) _reuse=1;; esac fi fi if [ X"$_reuse" = X ]; then # Proxy the connections? if [ "X${_proxy_host}" = X"" ]; then _proxy_host=none fi echo -n "HTTP/FTP proxy URL? (e.g. \"http://proxy:8080\", or \"none\") [${_proxy_host}] " getresp "${_proxy_host}" if [ "X${resp}" = X"none" ]; then unset _proxy_host ftp_proxy http_proxy else _proxy_host=$resp export ftp_proxy=${_proxy_host} export http_proxy=${_proxy_host} fi if [ "${_url_type}" = "ftp" -a "X$ftp_proxy" = "X" ]; then # Use active mode ftp? (irrelevant if using a proxy) case "${_ftp_active}" in -A) resp=y ;; *) resp=n ;; esac echo "By default, ftp will attempt a passive connection and fall back to a normal" echo "(active) connection if that doesn't work. However, there are some very" echo "old ftp servers that claim to support passive mode, but really do not." echo "In this case, you should explicitly request an active session." echo -n "Do you want to use active ftp? [${resp}] " getresp "${resp}" case "$resp" in y*|Y*) _ftp_active=-A ;; *) unset _ftp_active ;; esac fi # Provide a list of possible servers test -z "$_ftp_getlist" && _ftp_getlist=y echo -n "Do you want a list of potential ${_url_type} servers? [${_ftp_getlist}] " getresp $_ftp_getlist case "$resp" in n*|N*) _ftp_getlist=n ;; *) _ftp_getlist=y ftphost=129.128.5.191 if [ "X${_resolver_enabled}" = X"TRUE" ]; then ftphost=ftp.openbsd.org fi ftp ${_ftp_active} -V -a -o /tmp/ftplist ftp://${ftphost}/pub/OpenBSD/${VERSION_MAJOR}.${VERSION_MINOR}/ftplist > /dev/null cat /tmp/ftplist | grep "^${_url_type}:" | cat -n | less -XE ;; esac # Get server IP address resp= # force one iteration while [ "X${resp}" = X"" ]; do if [ -f /tmp/ftplist ]; then eval echo -n "Server IP address, hostname, or list#? [\$_${_url_type}_server_ip]\ " else eval echo -n "Server IP address, or hostname? [\$_${_url_type}_server_ip]\ " fi eval getresp "\$_${_url_type}_server_ip" if [ "X$resp" = "X?" -a -f /tmp/ftplist ]; then cat /tmp/ftplist | grep "^${_url_type}:" | cat -n | less -XE resp= elif [ -n "$resp" -a `isnumeric $resp` -eq 1 -a ${resp:-0} -ge 1 \ -a -f /tmp/ftplist ]; then maxlines=`grep "^${_url_type}:" /tmp/ftplist | cat -n | sed -n -e '$p' | cutword 1` if [ $maxlines -lt $resp ]; then echo "There is no ${resp}th line in the list." resp= continue fi tline=`grep "^${_url_type}:" /tmp/ftplist | sed -n -e "${resp}p"` url=`echo $tline | sed -e "s/^${_url_type}:\/\///" | cutword -t' ' 1 | cutword -t' ' 1` host=`echo $url | cutword -t/ 1` path=`echo $url | sed -e "s/^${host}\///"` path="${path}/${VERSION_MAJOR}.${VERSION_MINOR}/${ARCH}" eval _${_url_type}_server_ip=$host eval _${_url_type}_server_dir=$path resp= # do it again, just to double check echo "Using $tline" else eval _${_url_type}_server_ip="$resp" fi done # Get server directory if [ "${_url_type}" = "ftp" -a "X${_ftp_server_dir}" = X"" ]; then # Default ftp dir _ftp_server_dir="pub/OpenBSD/${VERSION_MAJOR}.${VERSION_MINOR}/${ARCH}" fi resp= # force one iteration while [ "X${resp}" = X"" ]; do eval echo -n "Server directory? [\$_${_url_type}_server_dir]\ " eval getresp "\$_${_url_type}_server_dir" eval _${_url_type}_server_dir=$resp done if [ "${_url_type}" = "ftp" ]; then # Need default values even if we proxy ftp... if [ "X${_ftp_server_login}" = X"" ]; then _ftp_server_login=anonymous fi if [ "X${_ftp_server_password}" = X"" ]; then _ftp_server_password=root@`hostname`.${FQDN} fi # Get login name resp= # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Login? [${_ftp_server_login}] " getresp "${_ftp_server_login}" _ftp_server_login=$resp done # Get password unless anonymous if [ ${_ftp_server_login} != "anonymous" ]; then resp= # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Password (will not echo): " stty -echo getresp -n "${_ftp_server_password}" stty echo echo _ftp_server_password=$resp done else # only used by ftp_list_files() _ftp_server_password=root@`hostname`.${FQDN} fi fi fi # Build up the base url since it is so nasty... if [ "${_url_type}" = "ftp" -a "${_ftp_server_login}" != "anonymous" ]; then _url_base=ftp://${_ftp_server_login}:${_ftp_server_password}@${_ftp_server_ip}/${_ftp_server_dir} else eval _url_base=${_url_type}://\$_${_url_type}_server_ip/\$_${_url_type}_server_dir fi # Get list of files from the server. # XXX - check for nil $_file_list and deal if [ "${_url_type}" = "ftp" -a "X${ftp_proxy}" = X"" ]; then _file_list=`ftp_list_files "$_ftp_server_ip" "$_ftp_server_login" "$_ftp_server_password" "$_ftp_server_dir"` else # Assumes index file is "index.txt" for http (or proxy) # We can't use index.html since the format is server-dependent _file_list=`ftp -o - -V ${_url_base}/index.txt | sed 's/ //'` fi _sets= if list_has_sets "$_file_list" $THESETS; then for _f in $THESETS ; do if [ "X${_f}" = "Xkernel" ]; then if isin bsd $_file_list; then _kernel=bsd fi elif isin ${_f}${VERSION}.tar.gz $_file_list; then _sets="$_sets ${_f}${VERSION}.tar.gz" elif isin ${_f}${VERSION}.tgz $_file_list; then _sets="$_sets ${_f}${VERSION}.tgz" fi done else eval echo "There are no OpenBSD install sets available in \"\$_${_url_type}_server_dir\"." echo -n "Search for *.tar.gz and *.tgz files? [y] " getresp "y" case "$resp" in n*|N*) return ;; *) ;; esac # *.tar.gz and *.tgz are possible sets _sets= _kernel= for _f in ${_file_list} ; do case "$_f" in *.tar.gz|*.tgz) _sets="$_sets ${_f}" esac done if [ "X${_sets}" = X"" ]; then echo "There are no *.tar.gz or *.tgz files in that dir." echo -n "See a directory listing? [y] " getresp "y" case "$resp" in n*|N*) return ;; *) ;; esac echo echo "${_file_list}" echo return else echo "Adding *.tar.gz and *.tgz files to selector." fi fi # Yes, all those blackslashes really are necesary... eval echo "\\\\n"\ "You will now be asked for files to extract. In addition to the files listed,\\\\n"\ "you may select any file located at\\\\n"\ " \$_${_url_type}_server_ip:\$_${_url_type}_server_dir\\\\n"\ "You can also enter \'all\' to install all the standard sets, or \'list\' to list\\\\n"\ "the files available. When you are done selecting files, enter \'done\'. Some of\\\\n"\ "these sets are required for your ${MODE} and some are optional -- you will want\\\\n"\ "at least the base and bsd sets. Consult the installation notes if you are not\\\\n"\ "sure which sets are required!" _osetsdone="$_setsdone" # Set the minimal default for _f in $_sets $_kernel; do eval "case $_f in \ ${_minpat}) \ if ! isin \${_f} \${_setsdone}; then \ _get_files=\`addel \${_f} \${_get_files}\` ; \ _setsdone=\`addel \${_f} \${_setsdone}\` ; \ fi ;; \ esac" done # Allow the user to select/de-select additional sets while : ; do echo echo "The following sets are available for extraction." echo "Enter filename, \`list', \`all', or \`done'." echo "You may de-select a set by prepending a '-' to its name." echo get_selection "$_sets $_kernel" if [ "X${resp}" = X"done" ]; then break elif [ "X${resp}" = X"list" ]; then echo eval echo "\$_${_url_type}_server_dir:" echo "${_file_list}" continue fi eval glob_selection \"$resp\" \$_${_url_type}_server_dir \"$_sets $_kernel\" done # User may have said "done" without selecting any files if [ "X${_get_files}" = X"" ]; then return fi # Stash the fact that we configured and downloaded via this url method eval _installed_via_${_url_type}=1 echo echo "Fetching files via ${_url_type} may take a long time, especially over a slow network" echo -n "connection. Ready to download files? [y] " getresp "y" case "$resp" in y*|Y*) ;; *) _setsdone="$_osetsdone" return ;; esac # Download the files one at a time and keep track of which ones failed while test -n "${_get_files}" ; do _failed_files= echo for _f in $_get_files ; do echo "Getting ${_f} ..." if [ "X${_f}" = "X${_kernel}" ]; then ( cd /mnt ; ftp ${_ftp_active} -V -m ${_url_base}/${_f} ) else ( cd /mnt ; ftp ${_ftp_active} -o - -V -m ${_url_base}/${_f} | tar zxpf - ) fi if [ $? -ne 0 ]; then # Mark xfer as having failed,. _setsdone=`rmel $_f $_setsdone` _failed_files="${_failed_files} ${_f}" fi done # Give them the option of refetching failed files. _get_files= while test -n "${_failed_files}" ; do echo echo "The following files failed to transfer and extract correctly:" echo "Choose which one(s) to refetch or 'done' to exit selector." echo "You may de-select a file by prepending a '-' to its name." echo get_selection "$_failed_files" if [ "X${resp}" = X"done" ]; then break elif [ "X${resp}" = X"list" ]; then echo eval echo "\$_${_url_type}_server_dir:" echo "${_file_list}" echo continue fi eval glob_selection \"$resp\" \$_${_url_type}_server_dir \"$_failed_files\" done done } install_from_mounted_fs() { # $1 - directory containing installation sets local _sets= _kernel _f _get_files _failed_files _osetsdone if [ ! -d $1 ]; then echo "No such directory: $1" return fi if dir_has_sets $1 $THESETS; then for _f in $THESETS ; do if [ "X${_f}" = "Xkernel" ]; then if [ -f $1/bsd ]; then _kernel=bsd fi elif [ -f $1/${_f}${VERSION}.tar.gz ]; then _sets="$_sets ${_f}${VERSION}.tar.gz" elif [ -f $1/${_f}${VERSION}.tgz ]; then _sets="$_sets ${_f}${VERSION}.tgz" fi done else echo "There are no OpenBSD install sets available in \"$1\"." echo -n "Search for *.tar.gz and *.tgz files? [y] " getresp "y" case "$resp" in n*|N*) return ;; *) ;; esac # *.tar.gz and *.tgz are possible sets _sets= _kernel= _sets=`cd $1 ; echo *.tar.gz *.tgz` if [ "X${_sets}" = X'*.tar.gz *.tgz' ]; then echo "There are no *.tar.gz or *.tgz files in that dir." echo -n "See a directory listing? [y] " getresp "y" case "$resp" in n*|N*) return ;; *) ;; esac echo ( cd $1 && ls ) echo return else echo "Adding *.tar.gz and *.tgz files to selector." fi fi echo "\n"\ "You will now be asked for files to extract. In addition to the\n"\ "files listed in the selector you may enter any file located in\n"\ "$1. You can also enter 'all' to install all the standard\n"\ "sets, or 'list' to list the files avilable in $1.\n"\ "When you are done selecting files, enter 'done'.\n"\ "Some of these sets are required for your ${MODE} and some are optional --\n"\ "You will want at least the base and bsd sets.\n"\ "Consult the installation notes if you are not sure which sets are required!" _osetsdone="$_setsdone" # Set a minimal default for _f in $_sets $_kernel; do case "$_f" in base*.tar.gz|base*.tgz|man*.tar.gz|man*.tgz|etc*.tar.gz|etc*.tgz|bsd) if ! isin ${_f} ${_setsdone}; then _get_files=`addel ${_f} ${_get_files}` _setsdone=`addel ${_f} ${_setsdone}` fi ;; esac done # Allow the user to select/de-select additional sets while : ; do echo echo "The following sets are available for extraction." echo "Enter filename, \`list', \`all', or \`done'." echo "You may de-select a set by prepending a '-' to its name." echo get_selection "$_sets $_kernel" if [ "X${resp}" = X"done" ]; then break elif [ "X${resp}" = X"list" ]; then echo echo "${1}:" ( cd $1 && ls ) continue fi glob_selection "$resp" "$1" "$_sets $_kernel" done # User may have said "done" without selecting any files if [ "X${_get_files}" = X"" ]; then return fi echo echo -n "Ready to extract selected file sets? [y] " getresp "y" case "$resp" in y*|Y*) ;; *) _setsdone="$_osetsdone" return ;; esac # Extract the files one at a time and keep track of which ones failed while test -n "${_get_files}" ; do _failed_files= echo for _f in $_get_files ; do echo "$1/${_f}:" if [ "X${_f}" = "X${_kernel}" ]; then ftp -V -m -o /mnt/$_f file:$1/$_f else ftp -V -m -o - file:$1/$_f | (cd /mnt; tar -zxpf -) fi if [ $? -ne 0 ]; then # Mark xfer as having failed,. _setsdone=`rmel $_f $_setsdone` _failed_files="${_failed_files} ${_f}" fi done # Give them the option of retrying failed files. _get_files= while test -n "${_failed_files}" ; do echo echo "The following files failed to extract correctly:" echo "Choose which one(s) to retry or 'done' to exit selector." echo "You may de-select a file by prepending a '-' to its name." echo get_selection "$_failed_files" if [ "X${resp}" = X"done" ]; then break elif [ "X${resp}" = X"list" ]; then echo echo "${1}:" ( cd $1 && ls ) echo continue fi glob_selection "$resp" "$1" "$_failed_files" done done } install_cdrom() { local _drive _range _part _fstype _directory _n # Get the cdrom device info _CDDEVS=`md_get_cddevs` if [ "X${_CDDEVS}" = X"" ]; then echo "No CD-ROM devices were found. Aborting." return fi cat << __EOT The following CD-ROM devices are installed on your system. Please make sure the CD is in the CD-ROM drive and select the device containing the CD with the installation sets: $_CDDEVS __EOT _drive=`echo $_CDDEVS | cutword 1` echo -n "Which CD-ROM contains the installation media? [$_drive] " getresp "$_drive" case "$resp" in abort) echo "Aborting." return ;; *) if isin $resp $_CDDEVS ; then _drive=$resp else echo echo "The CD-ROM $resp does not exist." echo "Aborting." return fi ;; esac # If it is an ISO9660 CD-ROM, we don't need to ask any other questions _n=0 until disklabel $_drive >/tmp/label.$_drive 2>&1; do # Try up to 6 times to access the CD if egrep -q '(Input/output error)|(sector size 0)' /tmp/label.$_drive; then _n=$(( $_n + 1 )) if [ _n -le 5 ]; then echo "I/O error accessing $_drive; retrying" sleep 10 else echo "Cannot access $_drive. Aborting." return fi else break fi done echo if grep -q '^ *c: .*ISO9660' /tmp/label.$_drive; then _fstype=cd9660 _part=c else # Get partition from user _range=`md_get_partition_range` resp= # force one iteration while [ "X${resp}" = X"" ]; do echo -n 'CD-ROM partition to mount (normally "c")? [c] ' getresp c case "$resp" in $_range) _part=$resp ;; *) echo "Invalid response: $resp" resp= # force loop to repeat ;; esac done # Ask for filesystem type cat << __EOT There are two CD-ROM filesystem types currently supported by this program: cd9660 ISO-9660 ffs Berkeley Fast Filesystem __EOT resp= # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Which filesystem type? [cd9660] " getresp "cd9660" case "$resp" in cd9660|ffs) _fstype=$resp ;; *) echo "Invalid response: $resp" resp= # force loop to repeat ;; esac done fi rm -f /tmp/label.$_drive # Mount the CD-ROM if ! mount -t ${_fstype} -o ro \ /dev/${_drive}${_part} /mnt2 ; then echo "Cannot mount CD-ROM drive. Aborting." return fi # Get the directory where the file lives if [ "X${_directory}" = X"" ]; then _directory="/${VERSION_MAJOR}.${VERSION_MINOR}/${ARCH}" fi resp= # force one iteration while [ "X${resp}" = X"" ]; do echo "Enter the directory relative to the mount point that" echo -n "contains the file. [${_directory}] " getresp "${_directory}" done _directory=$resp install_from_mounted_fs /mnt2/${_directory} umount -f /mnt2 > /dev/null 2>&1 } mount_a_disk() { # Mount a disk on /mnt2. The set of disk devices to choose from # is $_DKDEVS. # returns 0 on failure. local _drive _def_partition _partition_range _partition _fstype local _fsopts _directory _md_fstype _md_fsopts getresp "abort" case "$resp" in abort) echo "Aborting." return 0 ;; *) if isin $resp $_DKDEVS ; then _drive=$resp else echo echo "The disk $resp does not exist." echo "Aborting." return 0 fi ;; esac # Get partition cat << __EOT The following partitions have been found on $_drive: __EOT disklabel $_drive 2>/dev/null | grep '^ .:' echo _likely_partition_range=`disklabel $_drive 2>/dev/null | \ sed -n -e '/swap/s/.*//' -e '/unused/s/.*//' \ -e '/^ .:/{s/^ \(.\).*/\1/;H;}' \ -e '${g;s/\n//g;s/^/[/;s/$/]/p;}'` _partition_range=`disklabel $_drive 2>/dev/null | \ sed -n -e '/^ .:/{s/^ \(.\).*/\1/;H;}' \ -e '${g;s/\n//g;s/^/[/;s/$/]/p;}'` _def_partition=`echo $_likely_partition_range | \ sed -n 's/^\[\(.\).*\]/\1/p'` if [ -z "$_def_partition" ]; then _def_partition=`echo $_partition_range | \ sed -n 's/^\[\(.\).*\]/\1/p'` if [ -z "$_def_partition" ]; then echo "There are no usable partitions on that disk" return 0 fi fi resp= # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Partition? [$_def_partition] " getresp "$_def_partition" case "$resp" in $_partition_range) _partition=$resp ;; *) echo "Invalid response: $resp" resp= # force loop to repeat ;; esac done # Ask for filesystem type cat << __EOT The following filesystem types are supported: default (deduced from the disklabel) ffs __EOT _md_fstype=`md_native_fstype` _md_fsopts=`md_native_fsopts` if [ ! -z "$_md_fstype" ]; then echo " $_md_fstype" else _md_fstype="_undefined_" fi resp= # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Which filesystem type? [default] " getresp "default" case "$resp" in default) _fstype= _fsopts="ro" ;; ffs) _fstype="-t $resp" _fsopts="async,ro" ;; $_md_fstype) _fstype="-t $resp" _fsopts=$_md_fsopts ;; *) echo "Invalid response: $resp" resp= # force loop to repeat ;; esac done # Mount the disk if ! mount $_fstype -o $_fsopts /dev/${_drive}${_partition} /mnt2; then echo "Cannot mount disk. Aborting." return 0 fi return 1 } install_disk() { local _directory cat << __EOT The following disk devices are installed on your system; please select the disk device containing the partition with the installation sets: __EOT _DKDEVS=`md_get_diskdevs` echo "$_DKDEVS" echo echo -n "Which is the disk with the installation sets? [abort] " if mount_a_disk ; then return fi # Get the directory where the file lives resp= # force one iteration while [ "X${resp}" = X"" ]; do echo "Enter the directory relative to the mount point that" echo -n "contains the file. [${_directory}] " getresp "${_directory}" done _directory=$resp install_from_mounted_fs /mnt2/${_directory} umount -f /mnt2 > /dev/null 2>&1 } install_nfs() { # Get the IP address of the server resp= # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Server IP address or hostname? [${_nfs_server_ip}] " getresp "${_nfs_server_ip}" done _nfs_server_ip=$resp # Get server path to mount resp= # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Filesystem on server to mount? [${_nfs_server_path}] " getresp "${_nfs_server_path}" done _nfs_server_path=$resp # Determine use of TCP echo -n "Use TCP transport (only works with capable NFS server)? [n] " getresp "n" case "$resp" in y*|Y*) _nfs_tcp="-T" ;; *) _nfs_tcp= ;; esac # Mount the server mkdir /mnt2 > /dev/null 2>&1 if ! mount_nfs $_nfs_tcp ${_nfs_server_ip}:${_nfs_server_path} \ /mnt2 ; then echo "Cannot mount NFS server. Aborting." return fi # Get the directory where the file lives resp= # force one iteration while [ "X${resp}" = X"" ]; do echo "Enter the directory relative to the mount point that" echo -n "contains the file. [${_nfs_directory}] " getresp "${_nfs_directory}" done _nfs_directory=$resp install_from_mounted_fs /mnt2/${_nfs_directory} umount -f /mnt2 > /dev/null 2>&1 } install_tape() { local _xcmd # Get the name of the tape from the user. cat << __EOT The installation program needs to know which tape device to use. Make sure you use a "no rewind on close" device. __EOT _tape=`basename $TAPE` resp= # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Name of tape device? [${_tape}]" getresp "${_tape}" done _tape=`basename $resp` TAPE="/dev/${_tape}" if [ ! -c $TAPE ]; then echo "$TAPE does not exist or is not a character special file." echo "Aborting." return fi export TAPE # Rewind the tape device echo -n "Rewinding tape..." if ! mt rewind ; then echo "$TAPE may not be attached to the system or may not be" echo "a tape device. Aborting." return fi echo "done." # Get the file number resp= # force one iteration while [ "X${resp}" = X"" ]; do echo -n "File number? " getresp "" case "$resp" in [1-9]*) _nskip=$(( $resp - 1 )) ;; *) echo "Invalid file number ${resp}." resp= # force loop to repeat ;; esac done # Skip to correct file. echo -n "Skipping to source file..." if [ "X${_nskip}" != X"0" ]; then if ! mt fsf $_nskip ; then echo "Could not skip $_nskip files. Aborting." return fi fi echo "done." cat << __EOT There are 2 different ways the file can be stored on tape: 1) an image of a gzipped tar file 2) a standard tar image __EOT resp= # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Which way is it? [1] " getresp "1" case "$resp" in 1) _xcmd="tar -zxvpf -" ;; 2) _xcmd="tar -xvpf -" ;; *) echo "Invalid response: $resp." resp= # force loop to repeat ;; esac ( cd /mnt; dd if=$TAPE | $_xcmd ) done echo "Extraction complete." } get_timezone() { local _a _zonepath # # If the zoneinfo is not on the installation medium or on the # installed filesystem, set TZ to GMT and return immediatly. # if [ ! -e /usr/share/zoneinfo -a ! -e /mnt/usr/share/zoneinfo ]; then TZ=GMT return fi if [ ! -d /usr/share/zoneinfo ]; then _zonepath=/mnt else _zonepath= fi cat << __EOT Select a time zone for your location. Timezones are represented on the system by a directory structure rooted in "/usr/share/timezone". Most timezones can be selected by entering a token like "CET" or "GMT-6". Other zones are grouped by continent or country, with detailed zone information separated by a slash ("/"), e.g. "US/Pacific" or "Canada/Mountain". To get a listing of what's available in /usr/share/zoneinfo, enter "?" at the prompts below. __EOT if [ X$TZ = X ]; then TZ=`ls -l /mnt/etc/localtime 2>/dev/null | cutlast` TZ=${TZ#/usr/share/zoneinfo/} fi while : ; do echo -n "What timezone are you in? [\`?' for list] [$TZ] " getresp "$TZ" case "$resp" in "") echo "Timezone defaults to GMT" TZ="GMT" break; ;; "?") ls -F ${_zonepath}/usr/share/zoneinfo ;; *) _a=$resp while [ -d ${_zonepath}/usr/share/zoneinfo/$_a ]; do echo -n "There are several timezones available" echo " within zone '$_a'" echo -n "Select a sub-timezone [\`?' for list]: " getresp "" case "$resp" in "?") ls -F ${_zonepath}/usr/share/zoneinfo/$_a ;; *) _a=${_a}/${resp} if [ -f ${_zonepath}/usr/share/zoneinfo/$_a ]; then break; fi ;; esac done if [ -f ${_zonepath}/usr/share/zoneinfo/$_a ]; then TZ="$_a" echo "You have selected timezone \"$_a\"". return fi echo "'/usr/share/zoneinfo/$_a' is not a valid timezone on this system." ;; esac done } sane_install() { if [ ! -s /mnt/bsd ]; then cat << __EOT Warning, no kernel (/mnt/bsd) installed! You did not unpack a file set containing a kernel--this is needed to boot. Please note that the install kernel is *not* suitable for general use. __EOT elif [ ! -f /mnt/bin/cat ]; then cat << __EOT You still do not have a /bin/cat in your filesystem (i.e. a sample random file which you probably want). This seems to indicate that you are still missing important distribution files. __EOT elif [ ! -d /mnt/etc -o ! -d /mnt/usr/share/zoneinfo -o ! -d /mnt/dev ]; then cat << __EOT Something needed to complete the installation seems to be missing, did you forget to extract a required set? __EOT else return 0; fi cat << __EOT You will now be given the chance to install the missing set(s). You can enter '!' at the prompt to escape to a shell and fix things by hand if you wish. __EOT return 1 } install_sets() { local _yup="FALSE" _have_nfs # Can we do an NFS install? test -f /sbin/mount_nfs && _have_nfs=true # Ask the user which media to load the distribution from. cat << __EOT It is now time to extract the installation sets onto the hard disk. Make sure the sets are either on a local device (i.e. tape, CD-ROM) or on a network server. You will have the chance to repeat this step or to extract sets from several places, so you don't have to try to load all the sets in one try and can recover from some errors. __EOT if [ "X$local_sets_dir" != "X" ]; then install_from_mounted_fs ${local_sets_dir} if [ X"$_setsdone" != X ]; then _yup="TRUE" fi fi # Go on prodding for alternate locations resp= # force at least one iteration while [ X"${resp}" = X ]; do # If _yup is not FALSE, it means that we extracted sets above. # If that's the case, bypass the menu the first time. if [ X"$_yup" = X"FALSE" ]; then echo -n "Install from (f)tp, (h)ttp, (t)ape, (C)D-ROM" test -n "$_have_nfs" && echo -n ", (N)FS" echo -n " or local (d)isk? " getresp "" case "$resp" in d*|D*) install_disk resp=d ;; f*|F*) test -n "$_didnet" || donetconfig install_url -ftp resp=f ;; h*|H*) test -n "$_didnet" || donetconfig install_url -http resp=h ;; t*|T*) install_tape resp=t ;; c*|C*) install_cdrom resp=c ;; n*|N*) test -n "$_didnet" || donetconfig if [ -n "$_have_nfs" ]; then install_nfs resp=n else echo "Invalid response: $resp" resp= fi ;; *) echo "Invalid response: $resp" resp= ;; esac else _yup="FALSE" # So we'll ask next time fi # Perform sanity checks... if sane_install; then # Give the user the opportunity to extract more sets. They # don't necessarily have to come from the same media. echo echo -n "Extract more sets? [n] " getresp "n" case "$resp" in y*|Y*) # Force loop to repeat resp= ;; *) ;; esac else # Not sane, don't exit loop. resp= fi done } munge_fstab() { local _fstab _fstab_shadow _dev _mp _fstype _dev _options # Create a 'shadow' fstab to use for mounting and unmounting all # of the target filesystems relative to /mnt. _fstab=$1 _fstab_shadow=$2 ( while read _dev _mp _fstype _options _rest; do # Skip comment lines, non-ffs filesystems and # 'noauto' filesystems. case "$_dev" in \#*) continue;; *) ;; esac case "$_fstype" in ffs) ;; *) continue;; esac case "$_options" in *noauto*) continue;; *) ;; esac # Don't use soft updates _options="$(echo ${_options} | sed 's/,softdep,/,/; s/,softdep//; s/softdep,//')" if [ "$_mp" = "/" ]; then _mp="" fi echo $_dev /mnt$_mp $_fstype $_options $_rest done ) < $_fstab > $_fstab_shadow } mount_fs() { # Must mount filesystems manually, one at a time, so we can make # sure the mount points exist. # $1 is a file in fstab format local _fstab=$1 local _async=$2 ( while read line; do set -- $line _dev=$1 _mp=$2 _fstype=$3 _opt=$4 # If not the root filesystem, make sure the mount # point is present. if [ "X{$_mp}" != X"/mnt" ]; then mkdir -p $_mp fi # Mount the filesystem. If the mount fails, exit # with an error condition to tell the outer # later to bail. if ! mount -v -t $_fstype $_async -o $_opt $_dev $_mp ; then # error message displayed by mount exit 1 fi done ) < $_fstab if [ "X${?}" != X"0" ]; then cat << __EOT FATAL ERROR: Cannot mount filesystems. Double-check your configuration and restart the installation process. __EOT exit fi } unmount_fs() { # Unmount all filesystems and check their integrity. # Usage: [-check] local _check _fstab _pid if [ "$1" = "-check" ]; then _check=1 _fstab=$2 else _check=0 _fstab=$1 fi if [ ! \( -f $_fstab -a -s $_fstab \) ]; then echo "fstab empty" > /dev/tty return fi ( _devs= _mps= # maintain reverse order while read line; do set -- $line _devs="$1 ${_devs}" _mps="$2 ${_mps}" done echo -n "Unmounting filesystems... " for _mp in ${_mps}; do echo -n "${_mp} " umount ${_mp} done echo "... Done." if [ $_check = 1 ]; then echo "Checking filesystem integrity..." for _dev in ${_devs}; do echo "${_dev}" fsck -f ${_dev} done echo "... Done." fi ) < $_fstab } remount_fs() { ( while read line; do set -- $line _dev=$1 _mp=$2 _fstype=$3 _opt=$4 if ! mount -u -o $_opt $_dev $_mp ; then # error message displayed by mount exit 1 fi done ) < $1 } check_fs() { # Check filesystem integrity. # $1 is a file in fstab format local _fstab=$1 ( _devs= _mps= while read line; do set -- $line _devs="$1 ${_devs}" _mps="$2 ${_mps}" done echo "Checking filesystem integrity..." for _dev in ${_devs}; do echo "${_dev}" fsck -f ${_dev} done echo "Done." ) < $_fstab } get_fqdn() { # Find LAST instance of DOMAIN or SEARCH and extract first domain name # on that line as FQDN. Then ask user, just to be sure. if [ -f "$1" ]; then FQDN=`sed -n \ -e '/^domain[[:space:]][[:space:]]*/{s///;s/\([^[:space:]]*\).*$/\1/;h;}' \ -e '/^search[[:space:]][[:space:]]*/{s///;s/\([^[:space:]]*\).*$/\1/;h;}' \ -e '${g;p;}' $1` fi resp= # force at least one iteration while [ "X${resp}" = X"" ]; do echo -n "Enter DNS domain name (e.g. \"bar.com\"): [$FQDN] " getresp "$FQDN" done FQDN=$resp } donetconfig() { _didnet=1 resp= # force at least one iteration _nam= if [ -f /tmp/myname ]; then _nam=`cat /tmp/myname` fi while [ "X${resp}" = X"" ]; do echo -n "Enter system hostname (short form, e.g. \"foo\"): [$_nam] " getresp "$_nam" done hostname $resp echo $resp > /tmp/myname echo echo "If you have any devices being configured by a DHCP server" echo "it is recommended that you do not enter a default route or" echo "any name servers." echo configurenetwork # Get FQDN after possible DHCP invocation if [ -f /tmp/resolv.conf.shadow ]; then get_fqdn /tmp/resolv.conf.shadow else # If install is being re-run, save a few keystrokes get_fqdn /tmp/resolv.conf fi resp=`route -n show | grep '^default' | sed -e 's/^default //' -e 's/ .*//'` if [ "X${resp}" = "X" ]; then resp=none if [ -f /tmp/mygate ]; then resp=`cat /etc/mygate` if [ "X${resp}" = "X" ]; then resp="none"; fi fi fi echo -n "Enter IP address of default route: [$resp] " getresp "$resp" if [ "X${resp}" != X"none" ]; then route delete default > /dev/null 2>&1 if route add default $resp > /dev/null ; then echo $resp > /tmp/mygate fi fi resp="none" if [ -f /etc/resolv.conf ]; then resp= for n in `grep '^nameserver ' /etc/resolv.conf | \ sed -e 's/^nameserver //'`; do if [ "X${resp}" = "X" ]; then resp="$n" else resp="$resp $n" fi done elif [ -f /tmp/resolv.conf ]; then resp= for n in `grep '^nameserver ' /tmp/resolv.conf | \ sed -e 's/^nameserver //'`; do if [ "X${resp}" = "X" ]; then resp="$n" else resp="$resp $n" fi done fi echo -n "Enter IP address of primary nameserver: [$resp] " getresp "$resp" if [ "X${resp}" != X"none" ]; then echo "search $FQDN" > /tmp/resolv.conf for n in `echo ${resp}`; do echo "nameserver $n" >> /tmp/resolv.conf done echo "lookup file bind" >> /tmp/resolv.conf echo -n "Would you like to use the nameserver now? [y] " getresp "y" case "$resp" in y*|Y*) cp /tmp/resolv.conf \ /tmp/resolv.conf.shadow ;; *) ;; esac fi if [ ! -f /tmp/resolv.conf.shadow ]; then echo echo "The host table is as follows:" echo cat /tmp/hosts cat << __hosts_table_1 You may want to edit the host table in the event that you are doing an NFS installation or an FTP installation without a name server and want to refer to the server by name rather than by its numeric ip address. __hosts_table_1 echo -n "Would you like to edit the host table with ${EDITOR}? [n] " getresp "n" case "$resp" in y*|Y*) ${EDITOR} /tmp/hosts ;; *) ;; esac fi cat << \__network_config_2 You will now be given the opportunity to escape to the command shell to do any additional network configuration you may need. This may include adding additional routes, if needed. In addition, you might take this opportunity to redo the default route in the event that it failed above. __network_config_2 echo -n "Escape to shell? [n] " getresp "n" case "$resp" in y*|Y*) echo "Type 'exit' to return to install." sh ;; *) ;; esac } populateusrlocal() { if [ -f /mnt/etc/mtree/BSD.local.dist ]; then /mnt/usr/sbin/chroot /mnt /usr/sbin/mtree -Uedqn -p /usr/local -f /etc/mtree/BSD.local.dist >/dev/null fi }  . ..altq cbq wfq afmfifoq red riolocalqhfsccdnrblueLpriq @h 8`@#`3"Ȥ" $@``T@1#`3b@"@H*/+,2"c  0  "# ,"#, *,"#$!`,"#(@>> OpenBSD BOOT %s bsddevice[%s]: boot: open: %s: %s Booting %s @ 0x%x 㿘@T@- @ 3!`L@ 3!313%3/+3)3-'3 5@a(@ $ `@{!@ M! 2%`@r h@ Lh 2@b  8@a@@gBad format %d+%d+[%d+%d]=0x%x boot: short read x@ ;%?@ ?# @!2?3܀a"0?@ ?# @!2?%܀a""?@ ?# @! 2?܀a "?@ ?# @ 2 ܀`@"0@"?@ ?# @!  a ܤ` ܐ@;܀?@@ ?# @! a "?@ a?# @!"  @ .@`@ 2.@"@@ k@@ 䀤 .@?`耣 C.@ .`".`.`@`@耢@F#2@ b@ٔ  < b.@ .` .` .`b  ?`@Ĕ2'@"@m`? ? @3"X@a"@,c 2#3!X b1  Ā 0@K", ? Ċ`Ī@` Ē`IJ@` @ dvma_mapin㿘? #@(1?@,#(1?dvma_mapout㿘 #@(1@#p1㿘@ " ْ㿘 @㿘1#`` @, "c3  @/ #` $#`㿘1c` ? "c`,@}cboot: client IP address: %s boot: client name: %s rootroot addr=%s path=%s 㿐',@j㈀?73"@!' @@@㈀ )32 @a- 12㈒`#p@ 23#p!' @n@#p'@  3 3  2 3 㿘3` 231"#h"`"`"`"` "`"`" @`  "`? 3  ?3 㿘  ; < 㿘 , @@H   @="&  ?  promprom0㿘,# `2@2c  $  31 cx"3"!JJ`  -2*@3!@ (*`J@ @ *`  1c3" J  *@J` )*@c 3`"!``*J@ -& @33 *:  c` d a  J@ s  J@   $ #a\ @ # J@  @Can't open device `%s' Can't open network device `%s' 㿘@ ,# `  @aܔP$` $`%32# `( $ 3`€  !a\$` $`$@ @Z!02@ $`&` 2!22,ch @ "0P @@!0"0,c0 @,cL @ , "c# ,`# $$ 㿘#2c`   ``*  `c   '@`2`0`,6 * '@ 㿘  ʒ& `& $& (   €͒ " '@ 㿘 ` @ 2# `( ( @0@ 㿘   2  @! $ ?2`$ *㿘2#` `0`4 㿘2#` `?`8 ? xmit: not a network device 㿘  ,`@|!?K@ S`?㿘 ,5`€>㿐2 c` (`P#    #O/O O /O㿘㿐2# `      O ? X/O O /O㿐2#/  0T@㿘  㿘2#`t€㿘@,@㿐2c    #X# p@%x mac-address drop swap 6 cmoveX,# ` #21 ##` 1   Њ@+`  .@ .` .` .` .` .`c` `€0 `@c|@ielefdxyxdstsddevice_typeblocknetworkbyte㿘2#` !,`@@Xa@a ' b@  @b   #`#N@J@2J`N` " 2 node %x property %s length %d > %d 㿘2#` € 0#@ 㿘1#ޖ ??" ,Invalid controller number prom_iopen: "%s" error=%d 㿘)2! ?N  @ 3"``$` $`$`$`$`$`$` $`$$`($`,$`0$`4$` $`  $` $` @ΐ#+  " * @F $`0 "$`4 " @D$` @ 2!&  %! @# 㿘#2a  @ 4 "$a & 4$aprom_mapin: length=%dprom_mapin: invalid maptype %d㿘,#$*`@ -!@| x --         !@e` `,#,@ ,#$8 <?*  | آ&@  ` ,#(|@㿘?(1,12\&# H L` T ` X P d l$ p  t @2 .@2.1㿐``@ 0@ `@`@[ @ * @S   @@ x ` *  d,  0 2 0 0@" x @s*  @`?``"? 6"?%` 0@㿘 `  .` 8@ ^&  @   @`&@``@@6``,`G D& h`?  ,` @@!  @!0$@r     d ,  0 2 0 2 %@` ,`@L@Ԑ,`& 㿐   e<`P @@ܔ 4`0*:  8  2`0 @8e<`0e<eD `L  Ȁ)n 2; @`0$  " @   `d  *  0 @$ $  $&@&    b 8   @   " & 㿐`@  <@`@-5 2& :@ "   2  @l  " *@B<@@` ڐ2 ``@Ӑ 㻀@@ Ц @ &`@9@$`   `  @2 %\F!T@  0@@eg0   @ t,   $@  '` L@  @5<`/2L@`L@ /"`L@"y   נ  / ``4k `L@  /`,@P谒 \,@+ W(  2LL@@ $H  E;@%( 8@"@ 0 K䰒 *@`  d*  0` @O / ' 'ܒ L@  @   0@ @@ Ё㿘 &     . @ "  @0  .  "  @z0 @w@t а 㿐 @j@&B<@@`@@ ``@0 2&     ":?"   ? @ : ` :?  2`"` "`:`0㿐`  8 `@@2.@``@.@+?) @ " " ""@@C <@  @ @ @ B <@   @(*`  bootparamd: 'whoami' call failed bp_whoami: short reply, %d < %d p k3"@1a"'А $  $ $ ''X@ג 2W?-`??"`4` $@!#`"#@ #\ @  !2 @Ő#<?#3!a@!*`4a' @2 6` @##?2'ܢ ܔ"(""(2a@ ?3"`2bp`@w  ?2@a ? ?  P2"(2a''@H 2C?@!@? 2:?-`2?"`6 "&#`a#@b#\ @'   3 H"`''@( 2?@J 2?#'@ ? ?㿘`&"@  &@  㿘`&@   ? & @ Ԕ.@&  @""#d d " e" f" g"#" ?  +d +e +f +gd"@# @ ` J@(8(8    `J/`? `2A ` `!J@(8(8  . ` J J#   J@;..2J`;2 , `J@; @Є 8 <` CD001㿐@ ( ( @V`  -``( (  !@ R     2` * @h * *` * +  *+`  h  @ (g 8@ @`-`  ` ΀ǰ    *` *   *  M `N JL *  2D     !*  *` * @*@  @  @ L  *  "M  !   L  *  2 M  : L  *    g2 @ ``  `-`( U(  gh 8  *   *` * ƒ  @ @@ ˀg@+ @    >>>&`>  * *`   * & +` * +   :>@ 0  @  @ 㿘  @ &  㷐 R@ N`@4 @H``@C@2 *@ `  @ ,  ( )􀢨$ 2@` ' 8'" w@ '@@ @ B <@&hhB <@2&     ":?"   ? @ : ` :?  $2`"`"`  :`0 㿘c  ,  ". /.".+."&  "!".. 0  ? 0 @͠L *L0} 0z 0pؒ  @ S@ 8 'pt@ ( ,  $ #`a#\b` @' ? 3 H "`؀`3@   " ?㽠P  x@   'P $` $` $`  $$` ($` ,$`@ $` 8 t@  $`   h #`ab`$#\ @ ? 3  x 0  &,& &&& D& &(&$@ 㺈 ` ($a b ????#\#`  @ ? 3  `  dh@ d .@  ?nfsread: short packet, %d < %ld 0  '  $  $  (  ,     $$L#`a $b (#\  @b ,? L `" H3" ?@T@ B0  @ y3 H"`?㿘@ -3 "` 2" 6 & 2 ?  " $?!$ "  ?nfs_open: must mount first. 㷈2""` @ :" N  m `/2N N /" N a  0 ] @ x  <$N O  N  /  .ɔ A.0 0 2;@ @  $+  (@;@O`/ @ x@ x  @ x N  &`  @x x@s x㿘  "& @i x&  nfs_read: hit EOF unexpectantly㿘' #3!3%@ {   ݖ? `2  !\ @ P  ; B& > @ 2&     D  "; ?  ?  @ ;   `; ?  -0( 4 2`:2` <"` @"`D :`0 callrpc: error = %d 㿐\@?<6   '?'?@?2 '?` '?`@""?'?Đ #`#` #`#`#\ #`a $  p@X? 3` @``2"@#3 H"`?recvrpc: reject, astat=%d, errno=%d 㿘!3$ @ 2"@ 2?`2 ?`` $  H@’ ??"@?232x( 2  2 2 *?3 Ȁ #  2(x"# " " " getport: %s㾐a"@3 o'?(' "p #\#` ""   6   p'0 #3!`@f!Ȓ@Q H$`?bad adaptor numberbad controller numberbad drive numberbad partitioncan't read disk labelunlabeledDevice not configuredOperation not permittedNo such file or directoryStale NFS file handleInappropriate file type or formatExec format errorInput/output errorInvalid argumentUnknown error: code %d㿘`W1!(*` €10"1-"1*"1'#1$#1!#01#@1#X1#p1#1#1#1 #1  12!` @8D8D8E8E8D8D8E8D8E8E8E8E8E8E8E8E8E8E8E8E8E8D8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8D8E8E8E8E8E8E8E8E8D8E8E8E8D\8Dh8Dt8D8D8Drarp: bad socket. %d No response for RARP request Ӑ @B"J?  .@  7Ɛ(   , 4 , 4 ` 44 `~4 `4 `4 ``4 `4 #\ D .@q @"? 32b@ b@2  b@ @ 0- ? @ -??"aP@ $`㿘- @ 5㿐@3!"   5@2?@ 2?`(2?`&2?` 2 ? `@  ??sendudp: bad write (%d != %d)x&$`$` $`$`$`$`<* @ *@@ &  ,`,` 4` $`  $`@4`  6 4 4 `'`'` '`'&$`,` '@4` 4 쀣?&$`$`$`  $` -!P    2`'!'ܐ@_ܖ@( @?!@Qreadudp: huge packet, udp len %ld x@ް zހ( (  t?@͒o?2m?<@ 2f? 2b?6` <`\@u 2X? &T?``  2L?` &@  "@4  ` 2=?` 5` %@"0? ,  $ $ ' '`'''4 @8  ?$$ $ $ $ $$ $ $ $ ` ??sendrecv: short write! (%d < %d)㿘\   )3 <+`% (?@ @a @,`4 2    $$@Ӧ` l J` Є * (Ж  (8. 53 ".?" 8" ?#  0 `(?`d((  `d(h(*  ?#㿘@㿘2!Y,@  .  @ 0,@@ "@  0,@@  0,@,@6 ` "@(* 8("@ Є (@ 㿐 "= N -N`$* `.! גN*`? @ . Ȓ?N*`# @ .   J `   `&     ,` ` `   ( `߀` ܗ(2 ?# : :* 㿘 3` 3` 3`  .+`+`+`+`3`  +` ??㿘   @,   -`Ȑ@%  "` ?` ?72-` :  0 *@ `  *@`*@`2*!`" @ ` ?  2   㿘2ax'H'L'P'T 'X @"ax@H@ exit㿘 `㿘3"H , @` @ , 㿘@@V㿘@~ 㿘 < " ? 2  @13 D& @[  $   `$ <?$ 8 D$ ?$  @`$㿘אԐ* А* ̐?. ?$`8㿘-!X  , @     & &"   & L`?& & S`?   2?  ?B& 8     `* ??w?2? o  e  "  < Z   <  ?& 81.1.3㿘@\?.`,@ P2!. `"  P @ՐȐ?@/ 8 `@v &`D&@a&`@0 @`@ P@Ő?㿘 3 "`?3"H. @ 2. ! @ D@y@v P@㿘2!.  8?? ?2$  ?$8$ L "88 @P  "@"$ $$$$ @' 43 `$<" $& @$$$<S < D!3$ @ $ $<D$@ #$8 H@" $H H ?$88 @=$$  @ $H8 2  < 2  2L H@" $H&㾘 3 3"H- @2@9!-  `L @?2+$`)'$`" ` 3f c3b @F ` 42$`@   @ ?L @`D P @Ȑ?@ 8$@$`D$`@.` 4@ 1@ /@ f )`' a !ڒ: @3  Yd 4 `0 Y"`??-`` ? * `:```? -ad "ad"    -`?"  `@ @   @ *0   @ *`(㿘3. "H @  @  3 $"`2  " @      @ $3" `3 " ?㿘3. "H@ @  3 "  3  Y :@B: Y"`? ?   ` 㿐3"H @  `  ` 3 D"`$@$`$` ' 83@`` / "`J ,`)$@&$` #@  2"0 € ` `# `" ` @3" $@?㿐3. "H @@  3 ,"`" @% * 2`      3 "` B< ' 3 "`&?2( ᔝ㿘!2#'L'P'T'X$!@L!*㿘'H'L'P'T'X#@ H㿘#@8N@`N@`%` N@`|`"*` € @L` L   ?,@` < ,L L  LL 4 L  ` >0 `L` L` N@ ` - @L N@ @C N@ @: N@ 0 x  @, N@ % w ls8d8eh8e8fl8fl8fl8fl8fl8fl8fl8d8fl8fl8e8f48fl8fl8ex8fl8f8fl8fl8fH0123456789abcdef㿈"@ǒ @,@  ?L?|/-\㿘-!h` 2! cpJ@ #! arpwhohas: overflowed arp_list! arp: no response for %s-!Ф@ -!p@  'h@@C`@ ` Ѐ  $#ƒ  . 7Ɛ(  , 4 , 4  ~4   44  4  4  4 hax4 j4 h!$@#\ .? h!'l#l ` `4` 4`  $4`㿘-2(㿐H3-" (2*?@ 2&?`(2"?`&2?`  @??-!-*@ p*`@ `V  ??㿘@ /`(+`&'` # `:   `6`6`` ` 6``6``6`6` 6` 6`   .6`  `6` (6`@@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"&   ?: :  *2@ : J@   J@J`   J " @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"  /)# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@&@# # # # # # # # # # # # #@+ 3`@@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &   `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   & &  㿘 ?`2"`0"`"`   "` @ߔ 㿘 ? ` $ 2`0 " $@ $  (€ $ 㿘"M?N 12I?8 D?2 @? &  & & ( $ 2  & $   (  )& "  `"   "`  ( ?"  `   "( *@  "` ?㿘 unknown compression methodinvalid window sizeincorrect header checkneed dictionaryincorrect data check㿘 "@?  "<? 7` ?? ` .#*` € %  $ $  @  " `$  "b` 2    "b " `  $ $    $`*   &@ݒb`   &@&@  ސ? `$ $    * "` $" `˒  $ $    *` " $" `  $ $    *` " $"    $ $  @ ` " $ $ 0" "b $ " @?   " F"" s @u `  5"@ "@  a? `$ $    * "` $" `N  $ $   *` " $" `9  $ $   *` " $" `$   $ $   " $@  "b $  " " ??8{D8{8|`8|8}8}T8}8}8~T8~8~8H88ԝ㿘    "#? ? @s 0  ? & 06 * ?$@ @  "@ 㿘 A?`2@0;  "@"` 20?  -!ؚ  @`#@  ?( "$$$ "` $$ "@?㿘 " ?   ?  @i㿘?6  ` W R !6& @`@ `@`@ `@`@ `@`@ `@` @ ` @` @ ` @` @ `@`@ @β` @`@##񀦠,`     㿘" <&? 8`$`(€  2 ( @A (& 8& 0& & & 4   & <&`0㿘`  `( @ 2` *  `(% $ $`(`$€ 0`  `(  $ ($ ,$ 8$  `( `$€ $`(`$€invalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid bit length repeath 0 4@`  "? ,"` '$# *` €̨?  *`` 4  `&  `-`0  `4 $@&إ4@ @5耢 & & & @&``$  &`&@& 4?  &4!&!p&`4& & @&``$  &`&@& 4֔??  *`` ?#4* @! &!&`& & @&``$  &`&@& 4?`&  m p  `& & @&``$  &`&@& 42D  , ` 0 ( @ "?"`22 & 4@! 0 4 "@ ,? ," ` 0 ( @ "?"`2 & & @&``$  &`&@& 4U 8I "@`%%@ &     &?  *``  ?, & 4   ! !&!&`& & @&``$  &`&@& 4? `  `( & & & @&``$  &`&@& 4? &4&   2  @  #?  *``   *@ *`"  & 2  4     #* *`"  &  &   $ @  `$`(€ 2&  && & @&``$  &`&@& 4&&  4   ! @  -!!a @,  ]?  *`@ ,   *`    $@ * "  & T4    @  A?  *`@ + 4$@  4 @ ! @$@ 4 2!  `$€`( &&`& & @&``$  &`&@& 4'?  ( ? + "@ &  4   ! @     4  $ `#\#`&    `''#d@1!`$`(€ ?"&& & @&``$  &`&@& 4@؀ 2& & & @&``$  &`&@& 4ʔ?&& & @&``$  &`&@& 4@   @E 0 4@`  "? ,"   g&&& 4@8 4 0 0 4@& & @&``$  &`&@& 4 && & @&``$  &`&@& 4q & & @&``$  &`&@& 4c?& & @&``$  &`&@& 4U& & @&``$  &`&@& 4G& & @&``$  &`&@& 49& & @&``$  &`&@& 4+& & @&``$  &`&@& 4& & @&``$  &`&@& 4& & @&``$  &`&@& 4?@8h88\8<8,88888@㿘. `( `$€ (`(`$€ $`(`$€㿘 (ٔ (@& 0& 4`?㿘 (    * * " " "invalid literal/length codeinvalid distance code㿘 0 4 @`  "? ,"@` '!(*` €)` '& & @&``$@&@&`& 4 ` ``@.` 0 4@ `  "@? ,": $@ ` `$` $`$@` -`  *  -a+`@ ` * @  @$ 4  $`$@  @ $` $`$@_   $@%$@ &`& & @&``$  &`&@& 4?` -``  *  -!+`  ` ` `$`$ $` $`$@4 ` -`O  *  -a+`@ ` * @  @$  4 $` $` A$@ @ $` * 8$`%$@ (&`& & @&``$  &`&@& 4M?` -`  *  -!+`  `  $` $ $@4  ( `   ," "@` "$@27  ,  0 ( @ "?"2% & 4@% 0 4 "@ ,? ,"  0 ( @ "?""&  ( ,   (`? $`$@2D `  ,  0 ( @ "?"22 ` & 4@ݐ 0 4 "@ ,? ,"  0 ( @ "?"2 ` & & @&``$  &`&@& 4 (k$@ & 4?`@ 4 0 0 4@& & @&``$  &`&@& 4r $@& & @&``$  &`&@& 4b & & @&``$  &`&@& 4T?& & @&``$  &`&@& 4F& & @&``$  &`&@& 48& & @&``$  &`&@& 4*& & @&``$  &`&@& 4& @&``$  &`&@& 4& & @&``$  &`&@& 4?@88`8t888X888`8㿘`(`$€invalid distance codeinvalid literal/length code㿘04@`  , -. .`( ` (@( @ @'!` !h6 . !`  6@(  ` (' @p@!` !96` ( &@(  `. '!@ 6'/ / , @ &@?/ (/ X @2 `. `(. @@@1  3"` @ . `. @(@@ 2```!/6/ 1 ` @8.`!" "@'@`'@"@"`"`"42 ` "`@8.`!" "@'@`'@"@"`"`"4? C `1  @8.`!" "@'@`'@"@"`"`"4 㿘 4 0@`  ,"` " `"&`&` 8 <& <&`0< ,@@ ' 4  (& 4 4`"   " `"&`&` 8 <& <&`0@&` & 0 #+3;CScspp !1Aa  0@` 'H'X\H'L'P'T''''''''''''''''@(@`&@H X&#1 @  .@"@ * 􀠠  (`@"@8 # (.@@  ,`(`@??&@0 '48' - @ `  @ `.@(&@h H`@*@ @ h'H'0?'p  '(+ '$??Hh((+`', M+`$   % ` d#,@   @&@ .`@8, . ``dp&@&#//! $0@8 '.@&@&X& 4#/,@  /@L   `/@`'LT (P/@ P(@`'0@ (?  ?..`& &   (@" @6@2@ .@@? '  .@+`@?2[  H+ ` 2?oversubscribed dynamic bit lengths treeincomplete dynamic bit lengths tree㿀   ( ' #?#d#`#\#h   z ??*"( ' *@ 2 (*"P' ? ( $€oversubscribed literal/length treeincomplete literal/length treeoversubscribed distance treeincomplete distance treeempty distance tree with lengths㿀d !  ( `' R?((Ș#D#\#`#d#h! ?  ,??*#0-$ +*'#X()\#`#d 8#\#h  ? 2 (??*#x $ ?*#*#$ ? ( $€0 ( $€ -X-""\-"@`1"`" w0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-+!`Y G8+ @0(` @(` @0(` @0(` @0(` @0(` @0(` @0(0` + @0(`88! 8$8%$8%8%8&X8-828284L84T848:8=(8=p8>,8>48>8 88 88 8 8X8 8l8 8888888   8@` 0123456789abcdef/8?? inflate 1.1.3 Copyright 1995-1998 Mark Adler `PTsRp0 P ` @ PX S;x8 Qh( H PTUS+t4 Q d$ D P\ TS|< Rl,  L PRUS#r2 Q b" B PZ TCz: Rj*  J PVS3v6 Qf& F P ^ Tc~> Rn. N `QURq1 P a! A PY S;y9 Qi)  I PUPS+u5 Q e% E P] TS}= Rm-  M PSUS#s3 Q c# C P[ TC{; Rk+  K PWS3w7 Qg' G P _ Tc? Ro/ O `PTsRp0 P ` @ PX S;x8 Qh( H PTUS+t4 Q d$ D P\ TS|< Rl,  L PRUS#r2 Q b" B PZ TCz: Rj*  J PVS3v6 Qf& F P ^ Tc~> Rn. N `QURq1 P a! A PY S;y9 Qi)  I PUPS+u5 Q e% E P] TS}= Rm-  M PSUS#s3 Q c# C P[ TC{; Rk+  K PWS3w7 Qg' G P _ Tc? Ro/ O PWS[QYUA]@PXT!\ R ZV`PWS[QYUa]`PXT1\0R Z V`8, 8@8W!84- 8ɘ58u:8(C8r@I8I R8,[8 f86u8kXz8 8 8l8)8 8ɜ 8ɠ8P8q@8n 8ɨ88+08t+8? 88QB8(K 8(X8n_8hj8nXr8|}88N08n88ST8J8 8:8Ot8z 8c 8,!8`+8 88B8=(M8r@T8c\8RXg 80t828` 8h8A|8n89 8p8+l8&88(8j8T&8'/8<86J 8S88@a8=pk 8v8P|8X8>48 88:$84L88l8>8gx8F88" 8p*8 9 8xH8 T8@c8Tl8v88%$ 88%8\8D088h888Tx 88d8&X88-8, @84U8kX[8! e8u8x8P8x088?08808u88 8̀ 8̈8 8'8_x/8>,:8D8-Q8`Y8+l8^t8 88_88( 8 848, 88S888T 828 ,8 &84T38(=8 D8hR 8Z8aHa8th8Lr8R}8 8x8888|8Y$88p8A8%8P 8 8" 8X(8O/8$58<8ThB8LH8^N8MDX8[_ 8\f8Xm8 8`88^(8`8 8h 888858n8 88b 8͸ 8L 8z< $8 0 8ͼ @ 8 F8$ Q8 a84 q 8@ w 8H ~8 8 8 8 8 8 8 8 8 8 8 8 8 8 +8` 78  C8  R8  d8h p8 z8 8 8x 8Lj 8 8 8 8ǘ 8 8Ǹ 8 8 8 %8x 78| D8 U8 _8 n8 8 8' 8' 8,` 85 86 8? 8B 8F 8I 8Q 8RX 8S 8S 8T 8Tx 8T 8^( 8^ !8_x *8_ 28` :8aH A8b H8c Q8g W8kX ^8n h8nX q8n z8n 8n 8q@ 8r@ 8t 8u 8x0 8( 8 8 8p 8 8 8 _getsecs_rpc_fromaddr_open_dvma_mapin_gateip.rem_adler32.urem_sendudp_getprop_netif_put_nfs_getrootfh.div_devopen_socktodesc_obp_close_bp_getfile_inflate_codes_new_bp_server_addr_strtab_inflate_codes_free.umul.udiv_hostname_getchar_xdr_string_encode_inflate_trees_bits_nfs_readdir_in_cksum_pgofset_hostnamelen__udiv_arpwhohas_strcmp_net_close_inflate_trees_dynamic_inet_addr_strlen_inflate_set_dictionary_ether_sprintf_readudp_inflateSetDictionary_nfs_open_inet_ntoa_inflate_sprintf_netif_debug_freelist_netif_close_net_open_nfs_close__urem_printf_sendether_file_system_cd9660_close_inflate_trees_fixed_swapip_rpc_pmap_putcache___ashrdi3_nfs_readdata_domainname_xdr_string_decode_ufs_readdir_putchar_inflate_copyright_arp_reply_zcfree_strncpy_netdev_sock_nfs_lookupfh_rpc_xid_nfs_readlink_nfs_read_strtablen_ip_convertaddr_obp_strategy_nfs_seekstart_nfs_root_node_nfs_mount_cd9660_write_inflateSyncPoint_prom0_iclose_nfs_stat_twiddle_rarp_getipaddress_hz_getdevtype_rootip_net_mountroot_rpc_pmap_list_prom_ioctl_inflate_codes_zcalloc_rpc_port_obp_xmit_ufs_read_promvec_ufs_seek_obp_recv_strerror_prom0_close_file_system_nfs_inflate_flush_arp_num_closeall_bootfile_vprintf_ufs_stat_prom0_strategy_prom_getether_xdr_inaddr_decode_inflate_blocks_free__div_ufs_open_nfs_stat_types_inflateEnd_netmask_inflateReset__rtt_rpc_call_inflate_blocks_sync_point_file_system_ufs__rem_dvma_init_dvma_free_prom_boothow_prom_si_getpropstring_prom_bootdevice_memset_nfs_write_rootpath_cd9660_open_olseek_xdr_inaddr_encode_memcpy_get_crc_table_nameip_oclose_inflate_mask_bp_whoami_cputyp_cd9660_stat_pgshift_rpc_pmap_num_memcmp_prom0_iopen_inflate_fast_panic_cd9660_read_netif_open_prom_open_cd9660_seek_peekchar_etext_donottwiddle_ifname_oopen_bzero_getticks_readether_prom_init_inflateInit2__inflateSync_ndevs_loadfile_dvma_mapout_read_inflate_blocks_reset_arp_list_rpc_pmap_getcache_ufs_write_prom0_recv_errno_sockets_esym_intoa_nbpg_nfsys_exit_main_free_sendrecv_lseek_debug_close_inflate_blocks_new_domainnamelen_crc32_alloc_edata_cngetc_fbuf_end_dvma_alloc_bcea_gets___main_netif_get_version_oread_prom_bootfile_file_system_cd9660_inflateInit__prom0_xmit_bp_server_port_dbuf_ufs_close_inflate_blocks_cd9660_readdir_myip_files_devswsrt0.oboot.ogcc2_compiled.___gnu_compiled_cconf.ogcc2_compiled.___gnu_compiled_cdvma.ogcc2_compiled.___gnu_compiled_cnet.ogcc2_compiled.___gnu_compiled_c_open_countnetif_sun.ogcc2_compiled.___gnu_compiled_c_netif_prompromdev.ogcc2_compiled.___gnu_comp!vhT)@P rHP lHP hHP dHOHiHP XHP LHP RHP LHP HHP DHP @HP |HP ?xHP @tHP ApHP BlHP ChHP DdHP E`HP F\HP GXHP HTHP IPHP JLHP KHHP LDHP M@HP N |HP ? xHP @ tHP A pHP B lHP C hHP D dHP E `HP F \HP G XHP H THP I PHP J LHP K HHP L DHP M @HP N |HP ?xHP @tHP ApHP BlHP ChHP DdHP E`HP F\HP GXHP HTHP IPHP JLHP KHHP LDHP M@HP N;;;;; ;(;0;8H )@`  >! !7 >00+0;"+,+0΁`#@ 0΁1 !>&;8>0)@09`")@)@0΁`# 0΁1"; > 9`9`9`9`9` 9`(9`09`86`@!`xH )@` !!! P -@ @ @"P/> P-> %)> x %"+/> ->+cP> #H`"#H#t@>  8;x ;"`;" @@Ҋ@@2 @ 0P -@ @ @"P/> P-> %)> x %"+/> ->+cP> #H`"#H#t@;x҂@ ;Ԃ@`;"k  ւ@ ؂@ " +?P `* -` @Ft x ``-`ā @: tx  )>!4@! P-> %)> x %"+/> ->+cP> #H`"#H#t@;x;;>!<!@ ;`#h#l;;;;@Ζ``htxs ;`#h#l;;;;@̓``htxZ )>)#D@)>)# P -@ @ @"P/> P-> %)> x %"+/> ->+cP ;`@;h#t;x;;;;;`@;`htx />->+cPۜP -@ @ @"P/> P-> %)> x %"+/> ->+cP ;`@;h#t;x;;;`;;@b;`htx́ -?P -@-P -@ @ @"/>/> />6PP-> %)> x %"/>/> />P;x> #P`"#P@;,/,;@ ;`,)>!;h %)>! #p "`@ x|  +?P`-@-?P- %0P -@ @ @"/>/> />6PP-> %)> x %"/>/> />P;x> #P`"#P@;,/,;@ ;`,)>!;h %)>! #p "`@   @@`x P -@ @ @"/>/> />6PP-> %)> x %"/>/> />P> #P`"#P?P * * ;`@;h09P -@ @ @"/>/> />6PP-> %)> x %"/>/> />P> #P`"#P?P * * ;`@҂@ Ԃ@;h ւ@ ؂@@(`h ?P `*  P -@ @ @"/>/> />6PP-> %)> x %"/>/> />P> #P`"#P?p " ?P "  ;`@;h@ `h ?p " e @/>  @̀-> $)> x %->+cP-> NP @ H ,@`#>`$` (08 @̀=)> 00+0;"+2+0 `# @ 05-" % >&q 8 >0-@0=`"-@-@0 `# @ 05-"U  ->%- +cP ;`@;h #t;x;`;;;;@ȩ;`htx ->& 0! H,@` !`hpx (08@HPX @̀H,@`%> $ (08 @̀@ @̀  H ,@`#>`$` (08@̀2O?@ @̀='>00/0?"/2/0 `# @ 05-"$>& 8>0-@0=`"-@-@0 `# @ 05-"  ?  H,@`#>` $` (08@̀ ->  @yP->"/> 4  ! H,@` ! (08@HPX @̀>x `?* `"" * `@">  * `@&* *  ֊@* "``'1@'0@ )>+>%@#'$(  `   c  mt@ >   >  @@   >  @@ #>%> Ϥ`@%  '`@`@ 7  '`@`@ 0, *H Ѐ(H+ `!Ђ* ր  Ԡ҂2`*`D4`@ D֠ 0 !Ђ* ҂2`*`D4`@ D>%b@>" >" ( *>" ,!`>" 0H(  /  > ==>PH >" 4> "h> ϒa@.H"@!> $"(H``> "b  !>%#!>'"0$ $ >%# 2> " > " > "!> "!(>#"">#"">#"#>#"#,>$"!>$"!>$""D>$""l>*" ,>*" 40>+""@@qd#@+`;h;p;x;;;;;;;;;;;;;@L@P@ `hpx gP   d#@+`;h;p;x;;;;;;;;;;;;;@H@@ `hpx d P    ">> >  ">>@ >  >&c # J@*@`  ?"@ 2"#   "  ?J*@`8  ?"@ 2"> * > >@ *> >&#Ď@" >" >"   >4``6 >` >  !!`> @> !ܒ`"!> #T`"#T >  >> !ਁ`2$j0>'@q >'@q >'@q switch rqswitch wchanswitch SRUN> >: H> " (o!ਁ`j>  > :!>*"2J "2 J    "2 J  J " > `ؑ+  @ #@"   *@ * lH1 > " `!਀"I"j >  @`" @j ` *@  ( !> !@` (08 2㿠@->`` Ъ@@>`€"Т@: H"  h `>   >>'" " " ?" ?> >>'" " > >>'" " > >>'" " > ؀ >>'" "" > >>'" 2" > >>'" 2" > >>'" *" >>'c" `2 `2`2" >>'c" `2*`22`2"" @>'c" Њ@" " @""@" "`""@ 6 :@ 6 `6:   6  J?*@``";" " J `*"J*@ `"" "R2@ `4"R2@ `"" ""@ `""@ `":@ `""@ `R2@J *`2J*@   6 " J"`*@`"(" " " J"`*@"" J"`*@"" "" R"` 2@"" R"`2@"" "`"@"" R"`2@2J?*>`>)` #` 6 J *@`#`  `"<" " J *@`#`  "J *@"`" "R 2@`8"R 2@"`" " "@`" "@"`  :@ ` " "@` R 2@J *`#`  2J#`  *@#`  #`  H@ `*  @ : " : : : : : (: 0: 8: @: H: P: X: `: h: p: x 2@ *  @ 2* H@ `      ( 0 8 @ H P X ` h p x 0000H ?P *H ?P +*?p` "@?p`"@@* ?P` <@ "@$@% #@%"$@% #@%&؃%"@ւ"%ւ"&؃"@  >* "2 J "2 J   "2 J  J  @ @: `  : `z Z@  r R@  /*# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@#  # # # # # # # # # # # # #@+ 3`@;  /)# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@&@# # # # # # # # # # # # #@+ 3`@a>` """"""""""""""""@2?# * 2  `c  @ `> ? @ 3 >!\ c@  Њb@&""""  >a@ @> b ``44: " longjmp botch@" `&"`㿠>+@l"6 0vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapdrivevectoffsetslotluntargetphyleveladdrkbdgifksymsccdvndtbptygrevlanbridgeenctunsppppppslbpfilterlooppflogpfvmmapbsyvm_map_lock: failed to get lockPolled Mailbox Command (0x%x) Timeoutisp_mboxcmdInterrupting Mailbox Command (0x%x) Timeout%s index %d=> %s %02x%s:0x%08x:%s????21002200230012401280108012160LVDDifferentialSingle-Endedunknown mode on bus %d (0x%x)Unknown Chip Type 0x%x10201020A10401040A1040B1040CDifferential ModeUltra Mode Capablechip reset timed outMBOX_BUSY never cleared on resetRegister Test Failed (0x%x 0x%x 0x%x 0x%x 0x%x)F/W download failed at word %dRam Checksum Failureskipping f/w downloadBoard Type %s, Chip Revision 0x%x, %s F/W Revision %d.%d.%dloadedresidentFirmware Attributes = 0x%xInstalled in 64-Bit PCI slotLast F/W revision was %d.%d.%d%d max I/O commands supportedCannot setup DMAx!>, 2``.!`B  !  €* 2 aS 2  ؐ`€ * 2 ` 2  ؐ`€ * 2  "   `@  !7@$ה 耢2  6 6 6   &  ؐ`     6 6!6 6!`@ ` = ` ">, 0 >,    !h !p   >,6 6 6!6!!x ؐ`   ؐ`!  ؐ`   ؐ`(  ؐ`  1 ` ܒ <.   ">, "a  d ܀ . >,!  >,!2>,>,!!  `v€a id+ &>,@2"+ @>>,$!@>>,$ ! @>>,$!Ȑ @7   >,ؙ3  @7     ’   av€a  ̀id+ '>,@#+ @>>,$! @>>,$!  @>>,$!Ȑ >,ؙ3  @6   ؐ` ܟ€  ?`*`>1  €>,@6 >,  (">,  (">,  <" >,  < "(>,  <"0>,  <"8. .   `v€! >, @6z@@ @*@$@  ` € * 2` `2  >, @6\X@  $@ < . @6P  @ *@$@ *`"   @ +.    >!>!`" @   `   d !   "  ؒ B    `   d !     ؒ @   ؐ`  ` ##>, d?<     €bp0     `€  "  0 `€      ؐ`   ؐ`   % @R d ؐ`    5  `( `€ * 2 `  !  `€  * 2 `  ؒ @`€ * 2 ` @  .   0   /(    @  `@   ` @ # d? k>, ؐ`€* 2   7@"U c  @7/b <)!777777@"8 耢G7" @/"?#@! )!@"  >,#`#\@5 0  `$   "    /'(2 $     ) ؑ, 77$@7@! 耢2>, ` 77@!ٔ @>,ڔ   &  * >,& @4 @ 77@!    ?` &  & H 0 +! 2  2 H /d * %    & & H 0     ` ` 477@!u  7@!o @}>, #0>,#p>,#x#\#`#d@4O  >,@4E  ؐ`€  >,@49 6  6 •6  耢   >,  @4%  7@!' @5>,6 *` @42@"l  @ >-!`  .!   @   & @3 0>x@3  & 㿘@#:     2 @#/  @0@$failed to set active negation state (%d,%d), (%d,%d)failed to set tag age limit (%d,%d)Enabled FW features (0x%x)㿀  ܀   2   @2     `. 27 ` 7 `  7 7  @ 7 67@2` `72 7@ o 耤 57@2`2` `@ 722   7@ X 耢 3>1@3`2 23`#\@   `@3<  37 `7 7@ : 耤 >1 ` x@3( 0j 17`7 7@ % 耢]@w     2!J@l !J !H @777777@  = !D6! !F!77777@ 耤@+ J6! !?6! 7耢 7 7 ?  7ꀤ @Ӕ 耢>1@2’ !  .!Initiator ID is %d on Channel %dInitial Settings bus%d tgt%d flags 0x%x off 0x%x per 0x%x㿀.`*  ܐ *  07.`  7 @ @>2`  71@2 9>2,*  2``c  2  `.`,  8@77ꀌ 77  2 * @7 `2`#\#` !@2L@P ' 8@7777@A 耢$*  72    977 7 7@% @2  , *  @2  !2 ! *  `@.!!!  `@.!0` bad frame length (%d) from NVRAM- using %dbad maximum allocation (%d)- using 16bad execution throttle of %d- using 16Setting ICB Node 0x%08x%08x Port 0x%08x%08xNot using any WWNsisp_fibre_init: fwoptions 0x%x'D '@ې@D 0"@`   `@ ' )D ` D  ?# @3DD?  * *`   @ 7@@!D2 `2?# @31 * 2 '@ 1 >3D' @1Y$$1  *`  1  >3D'@1I  1 `  1 `>3D'@1:  1  `)  k ) D1    /.D   D1  ` `" `   1 @`  1 @ 01 @1 @D  /D  ? # @1  @  1 @D  耢 /' 8 77D'77@ ' ) D `/  ` 'Dؐ `  D ؐ `!D  ؐ `!D ?  y?؀vܙ3 'Թ7 /`''غ З*7`''/ ğ+''3 ܸ'2 иԓ*`2'и  * '''|'x @غ'7 Я7`7 ط7`7 'ȓ7`7`ػ7`'غ '7 ;'1 ) ) ) ) ) ) ) ) ) ) ) ) ߚ) ) ג ) ) >3#\ܖ D@0H' D>3 '@0@@? *@1 D! @1 $1 &!F>31 (!DX1 *1 ,1 .D!J1 0!H 1 21 61 4@0#@ ` 7 7@@7 7D7777@ @7!!7!7! !  /!! `` /!㿈 ܒ c7! 7   7` 77@7@ ?  i @@ *  `@.@?? ܔ  ( " ( 㿈 ܒ d7.`! 7   7` 77@7@2 ? 0 V 㿈.` j7耦  7`7 @ @3   3 3 *`*-5,`4      5`-    -4,  -`,  6    F Port (no FLOGI_ACC response)F PortN-Port to N-PortFL PortPrivate LoopFirmware State <%s->%s>usec%d: 0x%lx->0x%lx enano 0x%x%08x`ܨ 'l`;'p-B9>55>5@{d'dd@l 2  @d@ߐ l2`@ِ `d @/#0l `d2 l2   @{='d"@'xd"'|А"@'x'|x*" * "@*`@ |*`@ *`" *  * : D+ "@ +`" *`* " "* * ** **#@ # +`@ +  #\p'd+ +`#` @.H dА"?@pb@@ b?'p ` `?` `` `H 0 'dd` e6` 2@ H /d * % `   ` `H 0 e6@ ?D 8`;ʀ@8`'d@%)#d`  `  `?` `` `H 0  'dd` @p` <pH /d * % `   `) `H 0 "p p#;ʀ('dpe6@ ?D 'p;ʀ@p#'d@$Аpd@'ppΐl2   2? 7'd@ @d?l*``  /l 8 l *  @" ?"l@ ?l " * "`   2      'd ~ d` ~`'tl@ ? "@* *`  *`l "- ,`+`(  5`  t@ 5-  @6`.  -`. -.`l/   (  ?`+`(  ,`5- @ 6`.  @-5`- .`-`    ?`l@ 0* * @"* *`  '`l*l@ @ "l "'d@*td@jdl@ ?"@l@ ?l* ""l> 2`  ` >#\@`*  #`'d@, l3 d p *` l*   ("@@6*` *` * l ( `@2@  2@`@2@@2 @  @2@$$ p@@*@'@lp 'p'd@* dl `/@l'``?`` ?`` "@" @@ @@*@@* * @ '@ '@@@  '@l 'p@*F  Config WaitWaiting for AL_PAWait LoginReadyLoss Of SyncErrorRe-InitNonparticipating????? >8* >8">8">8">8#>8 #>8 # >8#(>8#0>8#Hp|ĝ'D '2     ?2`   2`  @D ?@ 0g` "@ 0("ذ ְ? (( &??#c    2<  '!D '$@)$ @̐$ `*`  !   2     ! ' '*(', @* *` (`( ?'0"@*` *  *  *  : ?'|`f'  @b, '\,2  Ȕ D'$ $, 'T'd'D'l  ?h'L't?Ht?pT'\?Pd'<l?`6 D--`tL?@  6 @ *h H\+?Xd@0D. 0`@* <(@ ?8l@L..`  @* *`X@<+8*`2 d +D + @ \<@ +2@@\@@@@.  @  @ 0  3@6@* *`   2, 2( 2$   @2` 2` @@ ! >|'$Dp@* $*@! /'`Ñ2` 8 D'$ '$ q7  *`D77@70$*`$ *** !*  >D'$:@*y $* ! /'``?0 * *  *  *  : ' ~)'42 \ ` o7D` *`77 7/(D 7D'$4@F  /'`T$?@` 3>< *` €, '0'>&* +  + +    D'$8; @* $ !` )>'$D@* $!' ~ ``~D)'$-  $> D@) $@ /'`  > D'$@@)ג $* *`   > 0*@ * ! +`(,`  5-   6`.   @-5`-   .`-`    9 +`(  ,`5- @  6`. @-5`- .`-`      @$9   @0#* *  *  *  @ !: 'D'$@'. '$D'$@)C $@*@! > D'$@)5 $ q7 *7D747@1  /'`?$, *  (@ ?  0("HHHH$HHgiving up on synchronizing the port databaseRemap Overflow 'D 2        ~U Q pe' ('@ޒ+ '@͖ * * `( '  D''  ?`2   *`` @  D?`2   ``@  ?`'D'Ӕ  2   ?2   @ 'v`><D@@(y ? +`(,`  5-   6`.   @-5`-   .`-`    ?`+`(  ,`5-  6`. @  -5`- .`-`    ?` 0* * @' * *`  '`/  7'  (''$) ?#@ **@ *` `( *"`( *  * ( *  ( @ " ( ' '+`8?#+  * `    @' 8>*` *  ` {(*  @r% @ n (, ,#\#`'D@' @*` ** @ *` "`,(*`(+  * ( "( *` *  @  <"(,* ? c#>+  *  @2   2D `'@'Q* * ( "( ( @$ ( ۨ   @z'6+  *  ,> (8D'@'' g 8+ @ *`     @ 8@ @`@@2`@2 '><D'p@' @'`0*` * * (* ** @ +` : 0* *  : * * `( `(  #`(`,*` *  @ #`(#`,D' @$ '*  (@ :$ؒ"@*` *  *  *   @ 2```@ < 'D @$|@ `@   0&'No LoopFailed to allocate IOCB bufferFailed to allocate XCB buffertimeout or transmit failedno fabric loopremote device not a target%xSNS Failed- %sbroken fabric nameserver...*wheeze*...x @` p$$@  @ p`c!$@ @D   !04@ `4!4 @  a2`4 4 !4 4 4 4 4  n 77@ 7` 77@7 9@2`  2 p"$@@2T?`>?!*` €>>"(>>"0>>"P>>"p>> ">> ">>@[g >>@%ݒ *?2`  2%?2`  4 ? *`* @ @  @# ?# >>@% @ 0$$@`lxRegister FC4 types succeeded㿈 # ` <@` 4  a4 "!2 4 4 4 4 4  !4   n4 4  777 777@~ @>?@%m Adapter not at RUNSTATEunsupported cdb length (%d, CDB[0]=0x%x)Target %d does not have target serviceRequest Queue OverflowRequest Queue Overflow+out of xflist pointersSTART cmd for %d.%d.%d cmd 0x%x datalen %ld㿀*@ $$, `   a2   >?@%   ` ,42  >? @% n  ``m `2   `   } U$, O2`  }J 2`    $,2  h e& $ " o"2`t  h2`  2`  2`  , 2 h /(`, h*  ( 2`  2` 2 >?@$ @ $,k e a "`@`ؒ  `€4aa7a7*a<  7 @  77>? a b `       S a2  : H@W @ .   , , 4 ,`2 2 ` ,  ,, , `2 "` , , `ؐ```4a`€`4aa7a7*a<  7 @  77>? @  @ ,  `   ,  ,,, ,  ` "   $(J`   d`ܔ̑,*  h"   "  4   d, ` "` ,  4   4 ,  9@=#* `4   4  a "`   4 ` a"ꀣ   a8 "   *@`22a8 ?*"@0`쀢" 4a" >?@ $ `ؖ`@ g" ꀢ`5`쀢@1a8* -"@( @#P f %$,$,>? X 2 K $#\#` @@#=`ؐ``4aa 4a a`  g a ,a gUnknown Control Opcode 0x%xdriver initiated bus reset of bus %dTarget %d on Bus %d Reset Succeededcannot find handle for command to abort㿈 >C p* €>A@" ?  7耊`7 `7 7    7 7 ! 2* ! *  `@.!@Δ @2ʰ?>AЖ@" ° ?# :..`@  777@ @2?>A @"! *2! *  `@.!      !8*@ * +  2 >B @"p w?  2 ` `7 .`7777.`  7.* @ 7778 @O  I A "<?8 "3?7/ "*?&   b7 @@?    @  ? h  $ 4 l     LMbox Command Async (0x%x) with no waitersAsync Mbox 0x%xinterrupt (ISR=%x SEMA=%x) when not readyoptr %x soft optr %xResponse Queue Out Pointer Unstable (%x, %x)bogus intr- isr %x (%x) iptr %x optr %xQueue Entrycontinuation segmentinternal queues fullbad header flagbad request packetunknown flags (0x%x) in responsebad request handle %d (type 0x%x, flags 0x%x)cannot find handle 0x%x in xflistasked for %ld got resid %ldunhandled response queue type 0x%xx. L ,.!6!$  !$ <  `€6  ` & @2֐ .! .>C2@!5  4 @>CЖ@!( @`,`2`@  2# !2   2 !2   $.`- >C23 @!   ؐ! €!* 2    `@ ؐ`  0  / `€!! * 2`  7>C! @ ے  ! 7   /(* آ  ؐ`€! ش`€!* 2 .2 `c$ ؀  `@>C(@  0U`€!.2@2 -  2/   /( # d ؐ`€! ش` ` €.2` + .`>C X23 @ r#\!`B >!  `@ ؐ`  5`뀥)>  !@. ?2` 7`   `.`,``.`.`  @@ڔ 5 5>#\@ 1  %>C!>,H@ %  /7>,%>, ` @ @@U  @2` P@  @/@  ` , >C @R ؀ >C@ ` >C@ ` >CА@ `>C@ג  `  2`@Ӓ `>C` @@ ؀  (!8 *  ? *@ `>C @@ ؐ`!+2 ` *2 @!8* "@`  !2  d  !*  .! $ , " ` `"`  6` ` @"@` , X@>C@ , 2  X 2  $ ,  ?`$ (` "` X 2`"` , 2` $ ,``  4 ` "K>C   d ܔ̑* *  @ "  ! d  !  .!.>C`@2 $ (` , "$ (`$ (` @>C X 2 $`"" $ , 2` $ ,``  4 y`  6` >C $h`@ @ $`  (, X$ , , 2 $ $ , $ $ (@В  , 2 $ $ , $ "    ` 2` / , 2` X '` @" X 6   W 0  . ? ( 8 2    $#\ (#` X #d#h ,#l@#! ",!?6!,x" @   5`   `! ؐ`€ 6! 6! @ x,` "`@`@,`Request Queue Transfer ErrorResponse Queue Transfer Errortimeout initiated SCSI bus reset of bus %ddevice reset on bus %dextended message underrunSCAM interruptstalled SCSI Bus after DATA OverrunSCSI Bus reset after DATA OverrunTransition to LVD modeTransition to Differential modeTransition to Single Ended modeTransition to Unknown Mode 0x%xfast post completion of %uFast Posting CTIO doneLIP destroyed %d active commandsPoint-to-Point modePoint-to-Point -> Loop modeLoop -> Point-to-Point modePoint-to-Point -> Loop mode (BAD LIP)FATAL CONNECTION ERRORLooped Back in Point-to-Point modeUnknown connection mode (0x%x)Unknown Async Code 0x%x㿐    2 '  ` €* 2 '?ߐ#@`5>I!*` €! 2*  ! *  `@.! @S,  @M ?>F->F)  ؐ`€ , >F@@R 0x>Fp@K 0q>F@E , >F8>F>F@6 ,   `€* 2 @h!>Gd0>GD`@@>G>G@   *# * "  0" @    " * # * ">G@@   *@"  " * "`@ڒ ! 2* ! *  `@.!,   `€>G, 2@ , >G  `€ 2`  ܐ "  pa"! .! @  @2     쀢  !8*@ " " , &!8>G@| Ʊ, !  ܔ.! "  pa"1 !  ܔ.! "  p"  !  ܔ.! "  pu" ! `` .! g" @ ,  ܐ pbZ" @ t,  @  ?  "@I!   ܔ.!  ?" ܐ @#>G@ Q,   `€* 2 '`$>I!*` €>G>G@  >G 8>G`@ @ )?>Gx@ג   >G@ϒ   @! ` ܒ`.! ?" @ 0!"@>G@ , 6 $$$$$P%X%X$@P`|%X!l"d""#4#x!l%X%X%X%X%X%X%X%X%X!!\%X%X%X%X%X%X%X%X%X%X%X%X%X%X#%X%X%X%X%X$8Ignored Continuation ResponseUnhandled Response Type 0x%x㿘@?`>I#8*` €>Ip@W   @5 2  @>I@H ?&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&Selection Timeout for %d.%d.%dcommand incomplete for %d.%d.%d, state 0x%xDMA error for command on %d.%d.%dstates=> GOT_BUS GOT_TGT SENT_CDB XFRD_DATA GOT_STS GOT_SNS XFR_CMPLT status=> Disconnect Sync_xfr Parity Bus_Reset Device_Reset Aborted Timeout Negotiation%stransport error for %d.%d.%d: %sbus reset destroyed command for %d.%d.%dcommand aborted for %d.%d.%dcommand timed out for %d.%d.%ddata overrun for command on %d.%d.%dcommand overrun for command on %d.%d.%dstatus overrun for command on %d.%d.%dmsg not COMMAND COMPLETE after status %d.%d.%dNo MESSAGE OUT phase after selection on %d.%d.%dEXTENDED IDENTIFY failed %d.%d.%dINITIATOR DETECTED ERROR rejected by %d.%d.%dABORT OPERATION rejected by %d.%d.%dMESSAGE REJECT rejected by %d.%d.%dNOP rejected by %d.%d.%dMESSAGE PARITY ERROR rejected by %d.%d.%dBUS DEVICE RESET rejected by %d.%d.%dIDENTIFY rejected by %d.%d.%d%d.%d.%d had an unexpected bus freeInvalid IOCB entry type detectedinternal queues full for %d.%d.%d status 0x%xAuto Request Sense failed for %d.%d.%dWide Negotiation failed for %d.%d.%dSDTR Message failed for target %d.%d.%dBad LVD condition while talking to %d.%d.%dPort Unavailable for target %dport logout for target %dport changed for target %dport busy for target %dUnknown Completion Status 0x%x` `+>O!H*` €` b2  >I``2 ` @ , ǐ &,*` 2` 2  >I#\v  >J``2 `l >JH  0/H * *` 2 *` !OH>J @` J 2 * *` 2 *` "OH>J P` J 2 * *` 2 *` $OH>J `` J 2 * *` 2 *` (OH>J p` J 2 * *` 2 *` @OH>J ` J 2 * *` 2 *` @OH>J ` J 2 * *` 2 *` @OH>J ` J 2 * *` 2 *OH>J ` J 2 * *` 2 *` OH>J ` J 2 * *` 2 *` OH>J Ѐ` J 2 * *` 2 *` OH>J ` J 2 * *` 2 *` OH>J 耢` J 2 * *` 2 *` OH>J ` J 2 * *` 2 *` OH>J!` J 2 * *` 2 *` @OH>J!` J 2 * *` 2 *` OH>J!(` J 2 * *` 2 *>J8 @ >J``2 `@ #\ >J h 2   @  !2  d  !*  .!,`А &, >J  2   @  !2  d  !*  .!,` >J``2 ` @h ,  &,`>J &(``2 `R  >J``2 `H  >J``2 `(>  >J``2 `P4  >J``2 `*  >J``2 `  >J``2 `  >J``2 `  >J``2 `8  >J``2 ``  >J``2 `  >J``2 ` @  , >J``2 `ז  >J``2 `͖ `,&(` >``2 ``  >``3` ` >``2 ` >K @ , >K``3` `HX `#\@ X , Ӑ &, >``2 `8  >K``2 `xz  >K  3`   `@s   "(, `$ ܘ `?ȑ*` *  *@ 2  `* *  @ "  ! d  !  .!, "&,0 >K  3`   `@:   "q, `$ ܘ `?đ*` *  *@ 2  `* *  @ "  ! d  !  .!J, >K``3` ` `@ =, >K  @ , 6 4&, >K @@ , ) '&, >K `@ ,  &, >K @Ԓ ,   &,>K` @Ȓ ,  &,;$-.d.5666677D7l7778 848\8889==99D9h99::,:T;8<======O2@o 0#2  + 2 !8* "@`$&`(  .`X  2! !?6!@GET NOST DATASET HOST DATAGET DATA OVERRUN RECOVERY MODESET DATA OVERRUN RECOVERY MODEGET TARGET MODE STATEENABLE TARGET MODEEXECUTE IOCB A64INITIALIZE RESPONSE QUEUE A64INITIALIZE REQUEST QUEUE A64DUMP RAM A64LOAD RAM A64GET FIRMWARE FEATURESSET FIRMWARE FEATURESSET SCAM CONFIGURATIONGET SCAM CONFIGURATIONGET SYSTEM PARAMETERSET SYSTEM PARAMETEREXEC BIOS IOCBWRITE FOUR RAM WORDSRETURN BIOS BLOCK ADDRSET RESET DELAY PARAMSSET DEV QUEUE PARAMSSET TARGET PARAMSSET PCI CONTROL PARAMSSET ASYNC DATA SETUP TIMESET ACT NEG STATESET CLOCK RATESET TAG AGE LIMITSET RETRY COUNTSET SELECT TIMEOUTSET INIT SCSI IDGET RESET DELAY PARAMSGET DEV QUEUE PARAMSGET TARGET PARAMSGET PCI PARAMSGET ASYNC DATA SETUP TIMEGET ACT NEG STATEGET CLOCK RATEGET TAG AGE LIMITGET RETRY COUNTGET SELECT TIMEOUTGET INIT SCSI IDGET FIRMWARE STATUSGET DEV QUEUE STATUSABORT QUEUESINGLE STEP QUEUESTART QUEUESTOP QUEUEBUS RESETABORT TARGETABORT DEVICEABORTSTOP FIRMWAREWAKE UPEXECUTE IOCBINIT RESULT QUEUEINIT REQUEST QUEUECHECK FIRMWAREABOUT FIRMWAREVERIFY CHECKSUMMAILBOX REG TESTREAD RAM WORDWRITE RAM WORDDUMP RAMEXEC FIRMWARELOAD RAMNO-OPLun RESETSEND LFAGet ID ListINITIALIZE IP MAILBOXSET VENDOR IDGET PORT/NODE NAME LISTLOGIN LOOP PORTINIT LIP LOGINFABRIC LOGOUTSEND CHANGE REQUESTFABRIC LOGINSEND SNSINIT LIP RESETGET LINK STATUSGET PORT NAMEGET FW STATEABORT TASK SETCLEAR TASK SETTARGET RESETCLEAR ACAGET PORT DATABASEGET FC-AL POSITION MAPINIT LIPINIT FIRMWAREGET PORT DATABASE,, ENHANCEDREQUEST NON PARTICIPATING MODEGET RESOURCE COUNTSLOOP PORT ENABLELOOP PORT BYPASSSET PORT QUEUE PARAMSSET FIRMWARE OPTIONSGET PORT QUEUE PARAMSGET FIRMWARE OPTIONSGET LOOP IDUnknown Command 0x%xno parameters for 0x%xopcode %xINVALID COMMANDHOST INTERFACE ERRORTEST FAILEDCOMMAND ERRORCOMMAND PARAMETER ERRORLOOP ID ALREADY IN USEPORT ID ALREADY IN USEALL LOOP IDS IN USETIMEOUTerror 0x%xMailbox Command '%s' failed (%s)h ># > ܐ ^@  >Q6@&@ -   ``2  ?  `  ? !$  >Q6@X@ 0   +- `@@4@4  `6!4 .! `@  0 ! `  ؐ@̒Οʀ  ΐ!   !!! 2 ! >>,!4@k 8!>?/b?#p&  ->,@^`#p 'Ѐ@'Ԑ @?@Ѐ "  @!  ``# .!>,!4& @4    *" @ 2@  `} { > >!-  `2 @>Qp@G @`@1 4`@ "R ``DE>R@G`@=>R@". ``@`@/>R@` @!'>R)>Q'#$>Q"#>Q#>Q#Ȁ>Q#>Q#  >R  >R (0@G5  >R@@ 㿈  i 7 @ *  @$㿘!    < @,`skipping target %d bus %d updatebus %d set tgt %d flags 0x%x off 0x%x period 0x%xx! !* ` *@  .! .`*   ܑ* ??c#   ->S 2` 2` @ >S$ ` @7l`  2` (7 $ 8'䀊 ^ 87 ?!a @4  @7@7@2 7 2 * @7 ? * (@4  2#\#` @   $ '.`,` 7 䀢  !2 !@ *  `@.!`2,  *@ * .`$ @4 ' @``  *  2` 2`  `!!  `@.!0` Using Node WWN 0x%08x%08x, Port WWN 0x%08x%08xp Z.`* * " ܑ*  B $!    k$, 4 4 , , ,  ! <  4<  !4?* 4 @  @   @& `2  "  >T  #\ @U   & ;   :  :  : .`*   ܑ* @@` @* @ *@*  $@  <*$* $@!   4`,`,` 4`,` ,`   *` `  "` `  @21@@G  @2(@ %7 @@  $@`* @2  *@ * $@ 2  * * @$@@!>3` #\ ` #` `  #d ` 3`#h@>2 #l ` @˜ @>3` #\@3`2` `#``3`#d`#h 0 @ `???ì#c !)> 4  $ , 4 4  ` ? )  # `2  2   ` 2 `  ? : @2       * 0 *   , $ , #\ 2  #` #d  p@U isp_reinit cannot reset cardisp_reinit cannot restart card㿘2!2   >U@2  Q " !2   !  0.!!2   >U0@  6!5 ,`2   (!8 *  ? 2`"  $ 쀢@!8* "@ $ " $ (  2 $$ ( $ ,@ 9`*` 2  Ϣ invalid NVRAM header%x %x %xinvalid NVRAM checksumversion %d NVRAM not understood㾘 ` !       @  `!S@2  P=` 2 2j?>V@ >V@ [?  @T `    @ ` >V@l :?>V @b 0? `   @@ !  @    ` @@   @ @8 㿘 ؒ   Զ  ؐ`  Ԯ  ` 2` 8`?`f a `&&6* 2 <    ؠ  ԋ  ؔ`  ԃ  ؔ  { <<6 *`6 ؒ  k  ؐ`€   6^  ؐ`  V < ؐ`  K  *`2  6㿀`  ܑ2 ` @ ` * * $@`2 * * $@`?,` `,` ` ,` ` * $@   3  4 ` $    $@` @2  * * @$@` 2  *@ * $@` 2  * * @$@` 2 *@ * $@` ,`` * ` *` 4``!>`*@ 4`` * @3`$@ `#\ `  #` ` 3`#d ` >#h@2 #l ` @ 3 @3` #\@3`2` `#``3`#d`>#h0  ` @  %>` 2  * * @$ `, ` `*` 0 $ `,    `  ,  2`   p,2   ($ 4 ` !4  $4 ` h4 `   4 `   4 ` @  4 `2     4  4 #\ 2  #` #d p@   <2*  *  @$ , 4 ``` 㿀.`*   ܑ* 2` `**` $`  * * $` `,  `,  , `  < * * $`  2  * *  `$ 2  * * @$2  *@ * $2  * * @$` ` `* @4  `! 3`* 4 `#\ !>#` #d  #h3`2 #l> ` @ >3` #\3`2` `#`3`#d#h0  `@  ( />  `+  2  * * @$ `) *` `+   *  p@" `* `*`4  " !4  `$4  h4 `   4 `   4 ` @  4 ` 2     4  4 #\ 2  #` #d p@ o <2*  *  @$ , 4 ` ``p 㿀.`*   ܑ* 2` `**` $`  * * $` `,  `,  , `  < * * $`  2  * *  `$ 2  * * @$2  *@ * $2  * * @$` ` `* @4  `! 3`* 4 `#\ !>#` #d  #h3`2 #l> ` @ Ɩ>3` #\3`2` `#`3`#d#h0  `@  ( />  `+  2  * * @$ `) *` `+   *  p@" `* `*`4  " !4  `$4  h4 `   4 `   4 ` @  4 ` 2     4  4 #\ 2  #` #d p@ ) <2*  *  @$ , 4 ` ``p NVRAM Port WWN 0x%08x%08xNVRAM Node WWN 0x%08x%08xfwoptions from nvram are 0x%x㿐` `+``(`,`` ` `5-   @  6. @-5`- .-``    `ܒ >Z '@ 6   @ ? ` `+`` (`",``! `# `$ 5-  @ 6`.   @-5`- .`-``%     >[ '@ }6   @ ?   @   $@2  ?  @2    $@"  ?   @"/`   $@)     2`2  <?#?  ?    2`   2`2` @  ? ` >[` *` 7 ` ` *@ 7 `8/ ` / `/ `/ `@ 7vmmapbsyvm_map_lock: failed to get lockPolled Mailbox Command (0x%x) Timeoutisp_mboxcmdInterrupting Mailbox Command (0x%x) Timeout%s index %d=> %s %02x%s:0x%08x:%sisp㿐!>  0>].!` &  0& &  $`$`$`  ! 4 4`  >]!( ``& !)4` ܒ 4`  4` *@6  2  X """ `  2 2$ `22 ̒  *@6   "B 'H /d * %    & & H 0 p     2    'a ?` &  & H 0 Bސ!f!>ِ !H /d * %    & & H 0  &%"`)' ( 2# @2`  22`    2  2    2`  2 2`  4  ?` &  & H 0 4`!>!@#     `(!@# 㿘 <?#@@& <@T㿘   > `H>] "# B# 2 (`*   ܑ*  @`4 : .> `< ?#  a `;# `?Ȗ*`2 (* @ @ " 2  !  !*  `@+!* 3@added to blocked queueActive Hiwater Mark=%dblocking queueretrying later for %d.%d㿐>_c4@̐h ` ``  $,6 H /d * % `  $`$`H 0  a2   4K``ؐ`  H a2   & `  ``   ``   `?` $``$`H 0  $, e a `  0,a` ``   ``   ` =  $,`   $``$`H 0  2`@` ` "$``"$`$`?` $``$`H 0 >]@   !2` /`$`@` `` *` ? $`w$``$`H 0 0mQ f"0` g e"U T` h"9 N`  h@#>Xo @  $a` 67`a>]$`a@Q -`>] `  @$`@E ` "$``"$`$ >]   @4h>aaT@>!X @Ӑ $`?` $``$`H 0 㿐 f  g e 0 h 0   `, 2  &`,   "`5 "  ` ؐ@  z` 2 i#蠄?2 ؀`2 ` 2  ͔ "`,`,   &`,finished command on borrowed timerestarting blocked queue㿘 @  *&    @ h *@&  @>_ ` P@  * & @z `  $ >_x@ @watchdog found done cmd (handle 0x%x)recursive watchdog (handle 0x%x)watchdog cleanup for handle 0x%xwatchdog timeout on handle %xpossible command timeout on handle %xwatchdog with no command㿀  H /d * % `  $`$`H 0   ` 6 a8*@ * * 2  "`  >_ X@ `?`$``$`H 0 0@ >_ @`?`$``$`H 0 0ڐ & `ؐ@ꀢ l ` >_ @ɖ @*@-& @->_ ὔ $` >_` >_А @ "  `쀢8 a8* "@ *  & ,& `@  @*  & @#>Xʏ @, h  & `ؐ`€`4aa7a7*a<  7@ @  77耢" `?`R$``$`H 0 0H & @S @   , 4 , ` $` , `2 2 ` ,  ,, , `2 "` , , `ؐ``4a `/>_@ `?` $``$`H 0 㿘H /d * %    & & H 0  ؐ`   ?` &  & H 0 restarted command for %d.%dblocked cmd again%s for %d.%dCMD_EAGAINCMD_RQLATER㿘  H /d * % `  $`$`H 0 q f)>a g e"P ,U` h"2 O` >a   @  B h>_c4@ @ #>XɃ '@s ` ` ?` $``"$`$` &>a >a H (@Z h>aaT@˔>!X@  &   & ,`?` $``$`H 0 requeued %d commands㿘H /d * %    & & H 0   `'& $  ?& ` &  & H 0  ="@ "` >ax@ 0 ?` &  & H 0 㿘   &  "@ "` >ax@ , 16 bit wide, Tagged Queueing Enabled, 16 bit wide, Tagged Queueing Enabled Bus %d Target %d at %dMHz Max Offset %d%sBus %d Target %d Async Mode%sSCSI bus %d reset detectedLoop DOWNLoop UPTarget %d (Loop 0x%x) Port ID 0x%x role %s %s Port WWN 0x%08x%08x Node WWN 0x%08x%08xTarget/InitiatorInitiatorTargetNoArrivedDepartedName Server Database Changed N_Port NL_PortF/NL_Port Nx_Port F_port FL_Port E_port?%s @ 0x%x, Node 0x%08x%08x Port %08x%08xno more space for fabric devices8'D` >e .` €D ` s `/n?> @ ,  * D ܓ.* @*` ( `&  "# 2  ` ` 4*`` " P` ` ` *`0  (  ! *`@_#   " >b ( >b ! >b !!X>b!h>b!`.*  >b `#\D#`k>bDd  >bD@ 0D>bਔ( ` ? #UDD ? D@ ` $>aD@c $@ >bD<8D 3 /.>b.@ܓ*``( >2   "<@ #\ >b">b"#`#d#h #l #pD@: 0* >bD@3 0#  * !, !-`  ! /`' -' !' !  ' .' !! 'Ħ ??? '? !"'?ă5 ? 5 @  ȧ+ܟ- ?ğ*`4 @2 , @ ?@̆  * *`؆+*`2  +ܘĘ ܃2@@ + -  @  @+/ D-  @ !#  @    ܤ@   "'>b ">b  >b$#x>b #x">b >b#x>b#x>b##>b #( #8>b#H#X>b#h#`D>b'#\#d @a "B N2      * *  ( (`  2` 2` 2` 2` $!  (* *  (  @22>bD@ 0 $< < $  ,  h%s: 㿘'P'T`'X /@ >e @5% 8@5<P>e@5 @vmmapbsyvm_map_lock: failed to get lockespFAS366/HMEAM53C974FAS216FAS408ESP406NCR53C96NCR53C94ESP200ESP100AESP100    2     2 out of memory %s: unknown variant %d, devices not attached : %s, %dMHz, SCSI ID %d 㿘 H>a@"Ȁ 2"Ԑ  @ &""Ԁ 2"Ȑ  @ &""Ȁ >e"Ԁ 2">e@4!0D >>e!@4 0<"l* ">e"@4!" @  `.  . "*"@ *`"  *  , @ۑ*  . . &  @."" 6 f6 j> `& |& t& @m >aX*"@ @ؓ*`%s: unknown revision code, assuming ESP100 㿘  @!>"P!>e# @4@!  ."`  "P! >e#@40!  ."   ń!"` W>e>f"t*` €     `  "` &"  "` &"   "    &". .     .     `   `   `   `  " @3ː# `   `   `   `  "  `  t$%s: resetting SCSI bus 㿘 @>f"@3 >bP!>e# @3!g  ."`  [NCR_INIT(%d) %d] ncr53c9x_ecb㿈>"P`>f"#(@3f!>"T 2"> >f"hc@#\#`#d#h L  @'  $"T" 2  & & &  @" ""??06 ."6" "`, @O Ȩ  "$?   $ ,  "`, @=    @ $@" ,@0`,   2 ?ڬ@!&"&"  "   :   : `!`*" *** @` ."P!>e# @2!  ."`  0 ."@eregs[intr=%02x,stat=%02x,step=%02x,stat2=%02x] [ncr53c9x_select(t%d,l%d,cmd:%x,tag%x,%x)] SELATNS 㿐` `,  ` >"P` >g`/"`I`J@2 ."`` 2">!X`d `#@#daX`aX@#@`" 2 "P!>e# @2w"\  ."`            * ". @걒 ,`"* "@꩑* &`"  "  2`   `2 "􀌠"?"  "          ` "j`I" Q`/`@&"&"'    `  @2 "  ` "  `  " "P!>e# @1"s  ."`  "P!>e# @1є"v  ."`    "`@@`/"P!>e# A@1"{ A ."`  A0ܠ  " "    `  ` `@`I.`,`,*`J *`@  `..`." q 2p &"&"'    `  @2 "  ` "  `  "P!>e# @1W"  ."   `!" @6".""Pa >e#@1@"  ."`   "P!>e# @1."  ."`   " "@  @0E @ "P >g@1"0"P!>e# C@1"Ɛ C ."`  C0)`!" @6".""Pa>e# F@0"ʐ F ."`  F0"P!>e# B@0ݔ"̐ B ."`  B㿘H /d * % > "h@(&` H 0㿘>  ` `@? `H / * % > @&"hH 0` L@m>~`c@֔`  &`  [ncr53c9x_scsi_cmd] [0x%x, %d]->%d 㿘  ` !>"P `>i@0s""P >i  # @0i``*    @,`  c 4$  @쬔  2@$ >  <$ H /d * % ` $ ` "` $`` $ ,` " H 0d 2$ N  $  $ @ $  $ D  /_  $ @ $ < $$ D, HH /d * % $`$ `"@%`  $ b`@zH 02  @! " @ @  @ [ncr53c9x_poll] [ncr53c9x_poll: rescheduling] 㿘>"P`>j@/!"" !>j @ "`@ B` ""  bP @/"@'#贆2  [ncr53c9x_sched] ncr53c9x_sched: not IDLE (state=%d)ncr53c9x_sched: tag alloc failure %d:%d busy 㿘>"P`>j@/g""`" >j@-"``` `*     ` @  ` "`  @  !H /d* % ,      ; &> $  @넔   H 0@@$  <$  "` $$ , " >  $   "$  `      `  H 0v@=,`I  2 H 0g@ *`  *`2    *`22 >j@-5# ,  , *# ,`JH 0       , @``& `P @``"`& `@"` $` & 0 "@>j`#H@.q`@`2`requesting sense 㿘``/  *  >bP  >k@.V#h@*  .`/  *`,`,``  4   #&`@&`<&`D&` &` $,     ?   2, @ , $  @2 j0 &@ " & &  &`` `&` " [ncr53c9x_done(error:%x)] %s: QFULL -- throttling to %d commands resid=%d sense=0x%02x error=%d 㿘` *  ,      >bP  >l ,@-Ȑ @``H (2  , `>l*`4 !2@-  , 2 `H, X` @  $ , $ ,`H > 2`D`D$ (:0Q$ ( bP `$  (`" ,>l@-!H ,`2>l>l 4@-!X@-!h@U @2  ," &  ." , 2 ` 2  ` 2 4`, " ``"` ` "` ` `"@@뗒  `@l%ncr53c9x_dequeue: lun %qx for ecb %p does not exist ncr53c9x_dequeue: slot %d for lun %qx has %p instead of ecb %p 㿘`  `*  ` 2,``  ,`  2 " >l>l>l#@+2`I*"`I `J*`  "">m @+r ?*`  ?&` @``"`& @`"[flushfifo] 㿘!>"P >m@,ɐ!"P!>e# @,$  ."   "   ncr53c9x_rdfifo: bad flag [rdfifo %s (%d):startcont %02x] 㿘``>m0"&"""@@+"X @€ "` * ,`  '> @€ , &  % `   @€ , @ € "ܠ  '> @€ , & "ܒ@&"P  >m`"x>m">m""@,9 P """ܲ @ >m!>m"Ԑ"@,+ "ܲ`@ *">m@,#""܁[wrfifo(%d):㿘!>"P >n @,"P   >m#>m@@,b &@>m@,"  `@ " 2   `   & %s: reselect with invalid selid %02x; sending DEVICE RESET %s: reselect from target %d lun %d tag %x:%x with no nexus; sending ABORT ncr53c9x_sched_msgout %x %d 㿘b   bb  b* * >n!@+`!> ? `*   `@*``       `` `    ,bݰ `.@  >n!@+k`!>,b$` ````+`b4`@㷒 . "* b@㯑* & bb  ` 2`` "?b  `  `  `    !>"P >n" @+%X"P!>e# @+ %X` ,b`   bbĐ @ ` @"P >n" @*%Z"P!>e# @*%Z` ,b`   bbĐ @` ,b4b< $bD>$b"P >n" @*Ҕ%c"P! >e#@*ʔ%c` ,b`   bbĒ`@ "P >n" @*%g"P!>e# @*%g` ,b`   bbĒ`@ 4b,b [ncr53c9x_msgin(curmsglen:%ld)] %s: msgin: no msg byte available %s: phase change, dropping message, prev %d, state %d gotmsg(%x) state %dcmdcomplete got %ld extra bytes msg reject (msgout=%x) %s: tagged queuing rejected: target %d (rejected sent tag)%s: sync transfer rejected: target %d %s: wide transfer rejected: target %d noop TAG %x:%xdisconnect save datapointer restore datapointer extended(%x) SDTR period %d, offset %d async mode max sync rate %d.%02dMB/s %s: wide mode %d unrecognized MESSAGE EXTENDED; sending REJECT ident unrecognized MESSAGE; sending REJECT %s: TAG reselect without IDENTIFY; MSG %x; sending DEVICE RESET %s: reselect without IDENTIFY; MSG %x; sending DEVICE RESET %s: unexpected MESSAGE IN; sending DEVICE RESET 㿘>"P`>o"@)""܀ 2">o"@) 0"P" >o @)""&"ܒ `.""P >o" @)#0" "P!>e# @)%  ."`  >o"ܐ#H"@)v 0"܀` >n" @)k%"P!>e# @)c%  ."`  ""Đ 6"Ē`A3."" "Ԛ "Ԛ  ` ` `  ( ` ` ` `    `  @`?`"P"P!>e# @)%Ő  ."`  0!">o #`@) " &"  ""2 ` " *  @ "N>t!T* €"P">o@(#x" 6  @jl` ">o#@(ڒ &" ! " $D" ( .""P">o"@(Ő#"€ @"{ "P"L!2">o` #@( "Pb>o@(#"P! >e#@(%  ."`     ,`    *  2    I   J*` ",J" ?*,J,I *W">o` #@(g " `."  ,  "`     `   `  2">p`  @(B  , `&,"P"">p@(7 H""P">p  P@(- ""P">p@(% `  $"`." !$ "P">p@( p"$<"$D"P">p@( <&"D&""P">p" @' " `  " `G"P">p ` `@' " ` O"P `,"   `,," "   `|"@i\` >p@'̐ "`2  , `,"P >n" @'&^"P!Z>e# T&^d @   @!-`@*`@*`" "y@ ,`"* "@* &`,`"* "@* ,@i` >p @'"`21  "@6 ",   ,  `,"P >n" @'i&{"P!>e# &{@'`  ."`  ""Đ @`."6"Đ ," ."  `+ " @ߜ ,`"* "@ߔ* &`""    2  "? "           ">p @'!" ` 2L,  @, +@ " @I ,`"* "@A* &`""    2 `` "? "              ,@h8` >p@&!"P"P"">p@&!H@h)` >p@&!P"P >n" @&&"P!>e# @&&  ."`  ""Đ @c`" 2>p"`2 >p !x U"  >p!@&c "P6"  C"@g` >p"@&S "P >n" @&K&"P!>e# @&C&  ."`  ""Đ @` >n" @&/&"P!>e# @&'&  ."`  ""Đ @` ."6""Ā "P!>e# @&&ϐ  ."`  "P!>e# @%&  ."`  " ."&"܁dȰh|| |||||||||||||||||||||||@@@[ncr53c9x_msgout(priq:%x, prevphase:%x)]%s at line %d: unexpected MESSAGE OUT phase %s at line %d: no nexus 㿐>"P`>t"Đ!@%"" @" "=""P!>e# @%&  ."   6")&"Ѐ ">t"P >n"Ɛ"@%~&"P!>e# @%v&  ."`  ""Đ @"."@ 6"Đ" @%b&"Ѐ 2""Ą "ƒ    * 6"6"6"€&"@"""є ǀ""""s  "” """    " *"ȓ*`* "Ȓ`* "*  "* "`&"  ,  , " @d ,`"* "@\* &`"    2 "  "  `"?`"  `         ]"Ȗ    `"ȑ* *"Ȥ*`"*  "* I&"" >t"@ @$'" ` "Ȑ 9*@ >t"@ @$'+   I"* J"* (&"Д "Ȑ ."*@ ` *    ` , , *@   "Ȑ  *@ *@  "."*@"&"" 2""̐L""P!>e# @$]'l  ."`  0V"@8  '"̔"П@  `   `  @2 "  ` "  `  "P!>e# @$'u  ."`  "P! >e#@$ 'v  ."`    @[ncr53c9x_intr: state %d] %s: SCSI bus reset %s: nexus in reset state%s: illegal command: 0x%x (state %d, phase %x, prevphase %x) %s: DMA error; resetting %s: !TC on MSG OUT [intr %x, stat %x, step %d] prevphase %x, resid %lx %s: !TC on DATA XFER [intr %x, stat %x, step %d] prevphase %x, resid %x %s: SCSI bus parity error sync nego not completed! %s: unexpected disconnect; resetting sending REQUEST SENSE %s: waiting for SCSI Bus Reset to happen %s: target didn't identify <>%s: target didn't send tag: %d bytes in fifo [%d] backoff selector %s: RESELECT: %d bytes in FIFO! [intr %x, stat %x, step %d, prevphase %x] selid=%2x %s: identify failed, state %d, intr %02x ncr53c9x: no nexus%s: step 1 & !NEG %s: !MSGOUT (%s:%d:%d): selection failed; %d left in FIFO [intr %x, stat %x, step %d] (%s:%d:%d): select; %lu left in DMA buffer [intr %x, stat %x, step %d] %s: unexpected status after select: [intr %x, stat %x, step %x] %s: stray interrupt %s: ICCS: : [intr %x, stat %x, step %x] %s: can't get status, only %d bytes %s: STATUS_PHASE: msg %d %s: invalid state: %dncr53c9x no nexusMESSAGE_OUT_PHASE MESSAGE_IN_PHASE %s: MSGIN: unexpected FC bit: [intr %x, stat %x, step %x] %s: MSGIN: weird bits: [intr %x, stat %x, step %x] COMMAND_PHASE 0x%02x (%d) DATA_OUT_PHASE [%ld] DATA_IN_PHASE STATUS_PHASE %s: unexpected bus phase; resetting x>"P`>v"@"[!  @ 2 z  € . @€ " ` .  @€ .  @€  . `$`" @ 2! &"P >g !  @"  <  -& < @€  P! >e#@" '  ."   ] " >v @!!@^   >v!X@ v  0@Y  @( @€  P! >e#@!ה'  ."   * "  2  "`,ے @"-""  ."ݰ ">v" "!x@!" @€   P! >e#@!'  ."    " ` ." € "C  @?2  >v @!}!    @ 2  2* " "& "`2"" >v" ! #\ @!Z  2 >v "   ?D#\@!H B>v @!A"p"`P >n" @!6(@P!>e# @!.(@  ."`  ""Đ @` >n" @!(BP!>e# @!(B  ."`  ""Đ @`."6" ` ""6"P >v " @ ` @€  P!>e# @ (J  ."`  P!>e# D@ ה(Q  D."`  D"?`q>~!*` € ",`  *  ` 2  2 4 `8*`` " `"  "`  "@ @ْ `2" ">v@b` >v@ "` "*  `." ` ,`" 2>v @ r" `>v@ l"ѐ>v@ g#@.  W"`,Z& "?`h>~!ȓ*` €>v @ L# r "  >v@ C#P>v@ >#pX""   € >v @ .# ?#>v  € @ "c ?   "6"ƀ 6"6"."P >v@ #@Ґے $ " & &  $ `$ & " `.">v @#PSQ   $"" "" >v  #"#\@Ւ : ."P >w (@ʒ ` """`."P!>e# @)  ."`   " " "" 2"" ."" >w  @ 8 ) 0  2;>w2>w@ h`   *  `$>~!*` €P!>e# @w)>  ."`   ! ` 2 " I 2">wX >wS ` P >n" @@R)MP!>e# @J)M  ."`  ""Đ @`@."6" ` D ",`,`" ." I`P >n"!@')UP!>e# @)U  ."`  ""Đ @:a >n" @ )WP!>e# @)W  ."`  ""Đ @`P >n"!@)ZP!>e# @)Z  ."`  ""Đ @a."6"Đ t&"" " " @€  f @€   >w    #`#\@ Pa>e# @)z  ."`  P >n" @){P!>e# @){  ."`  ""Ē`@ 6"."P!>e# @)  ."`  !" !"䀠 >w     ` #\#`@c !&"< &"D."u&" !@ @T Pa >e#@L)  ."    " W  `.">w ! @1  "܀>w!@' ""ܐ ?,H""Ԓ@P @ >w !@ >w ! " $D" ( .""@ &"P!>e# @)ː  ."`  0>w"( @ T " 2>w2">w@e"@ P  "2 @z @ >wĐ#XP! >w#X>w#XP @>w@"X &"P @" >w@"p /" P 2"P!>e# @)  ."`  "` ."P! >e#@)  ."`  $ >w" 2 ">w " @r """@ ߀ ."В`?   " @^  `&">w /#@U@ @€  P!>e# @F*  ."`  " X/@ &"&"`'"" @ `   `  @2 "  ` "  `  P!>e# @*#  ."`  P! >e#@*&  ."`    @ @ǒ/P!>e# @ؔ**  ."`   &"P @>w"@Ɛ# P!>e# @*0  ."   ""@8  "'" @*&">w@#8" 2"P!>e# @*9 ."   ""@8 ' "" @ &" >$  `   `  @2 "  ` "  `  P!>e# @O*F  ."`  P! >e`#  @;*P   ."   `   @N  @>w@!#H"`."P!>e# @*V  ."   &"@  o+  ."쑐% @3"@U 2В@@@ '"@  ? @ 2 @2@*@$  `<$TTT㿘` 'А @&`&`  @ <" ">!>"P >n" @*"P!>e# @*  ."`  ""Ē`@ 6".">aX d  c@#d!X!X_@#`@0  DMA active%s: timed out [ecb %p (flags 0x%x, dleft %x, stat %x)], AGAIN sync negotiation disabled p  `` *``@\ɨ   €  @ >~#0>~#@ ">~#\ #H#`#d" #h"#l"#p"#t" #x D#|@ HH /d4 * % @  >~@#А琒 0!>~@#ؒ $,4   " @\u>~@#`  `*  $ H 0㿘>  }H /d * %   H*`  `(6 2  2 4 `8*` " `"  "`  "@ @ڒ  `ґ*`H 0>!X*"@ @*`㿘 @€  . @€ " ` .  @€ .  @€  . `$`" @ 2! &">"P`>g !  @O leam7990_config: weird memory size %d: address %s %s: %d receive buffers, %d transmit buffers am7990_config: can't establish shutdownhook㿘@   Du >>>?"̒`d"& & & 6 d& 0 ܐ & ܠ 0@'1@/͐!p 8&!p!p @!  @ @" !>@ @@@" >@ " >        &!t&!x!p@\#!>!@/z @͐!t>!x @ǐ >>"p @c &!`>@B P!t *&!!x *`&!*  * &!&!&!㿘H o*@ g@ H 0h d! 77! ! +`! *! + ! @ !  77ސ 0@7!l&!|!&!@!t3`7&!&!?* !l@!!x 3`77?* !7! !t 6!x  !, !l!@!3`: /7Ԑ7/7֒П !t f!x  0!, !l!@!3` /ː7/77Βȟ !x f㿘!0  %s: controller failed to initialize 㿘!0  \ d!4`"!d@!d!0 a!!l  !0, 2!04  ? d!0  a" !,€ !"?!,€ !!0 !B d6 b @ ;6 d@0 0!8> @ !8`@㿘 > "'> +>  2G! H /f * ' V* 4@mܒ  ""8@ <"`<<8"`8"($@ $0,@ֱ4&0 ?6@qaؑH 0M@H /f * ' V* 4@m  ""8@ <"`<<8"`8"($@9 $0,@e4&0 ?6@%aؑH 02l ; <!(" <㿐H /f * ' > !@  H 0 #->  4 H /f * ' > p 2H p@  $ $ 4 $$ $ $  @a  2  @b 0 0 $ $ $  '􀦠> "p =ܑH /f * ' @  H 0  4 H /f * ' ` 5`H p@  $ $$ 4  @`R   쀦:H /f * ' > !ؐ@ T $ $@`@ L $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8    ( ' $ 8 $ !$ %&@y㿘% 2 x |  & | X `& x @ 0@+M%s: overflow %s: receive buffer error %s: dropping chained buffer 㿐!|; 2  > @  > @  | & |    >@א! |` & |, !@*`  ! :/77 !t " !,  !  " @&!|%s: transmit buffer error %s: underflow %s: lost carrier %s: excessive collisions, tdr %d 㿐!X#>`@ ;>6 d @>"p@~  @>"@u 0@hȐ0P!<`>@"@` @  &   @Qb `&   & ``  "   &   & !x " !?&!!  , ! ! `" d 0@&!! "6 b%s: memory error %s: receiver disabled %s: transmitter disabled 㿘!,€  ?L !0  !0  @   & ( | & | > @ܐ 4'   > @ѐ  |`&& |  $> @Đ  `&   "Đ"" ( %s: device timeout 㿘>bP @Y  T`& Tmissing buffer, no_td = %d, last_td = %d 㿐 4 $@ @ha+>a,@a  b 4d6 4a@va ̀  @/ے    €  "=$a  & & $  ?& "1$a ( ",@,@a*`    6 20 /77a a0  Hax " a  $a 4$6 4$a㿘H /f * '  0@&   H 00\a2@a1@5a @a@"4G 0!5@70 !6@3 0<4 44 ` ݐ@΍0.@  244 ?#44 2 @Ȑ0@*ג@+ 4  !@ !D@L- H 0㿘㿘 4!9<6`6`6`6@ & @j  *;n # ?  @?`   @2?26 @22*@  * @6@ 2  ؐ 4 = 6 4 4<"6 46@6`6`6`㿐!h'@㿐!h'㿐!h'@vmmapbsyvm_map_lock: failed to get lock/dev/ksyms: Symbol table not valid. ELFfailed to allocate memory for /dev/ksyms 㿘> > ϐa>@ @0N#> >   @`  ` `(@ 2 > "$c\%#X0"cT`h@   )>  >   " 0> !!%#X @; #> $cP>@Ԑ p0@ͨ#XcP"! ""> "@"> "#\##T? 0   ` > T   㿘#`cX `  > @  #T> #PcX@ " #TcX\"  " @8 @U ` > > X \  ` ј ` cX  $ `$[ % `%V"G @K  I?`D 06@?  =?`8  6?`1  /? ` *  (?`#  !?`  ?`  ?`  ? ` "`""  "@0 @ ""`" `" ` " 㿘 `@2)  `@2$  `@2  `@2  `@2  `@ ( 2  <`<@ ( 2 @#@ 㿘 l`l@2  p`p@2  l  `@2 2  `@2  ` @2  $`$@2  (`(@2   ,`,@2   ,`,@2w  0`0@2r  4`4@2m  8`8@2h   <`<@2_   <`<@2W  @`@@2R  D`D@2M  H`H@2H   L`L@2?   L`L@27  P`P@22  T`T@2-  X`X@2(   \`\@2  \`\@2  ```@2  d`d@2   h`h@ @o@ 㿘 \ `@2 2 \ `@2~  ` @2y  $`$@2t  (`(@2o  \  ,`,@2e 2  ,`,@2]  0`0@2X  4`4@2S  8`8@2N   <`<@2E   <`<@2=  @`@@28  D`D@23  H`H@2.   L`L@2% 2 \ L`L@2  P`P@2  T`T@2  X`X@2  \`\  ?@2 @ߒ@ 㿘 l`l@2  p`p@2  t`t@2  r  `@2 2  `@2  ` @2  $`$@2  (`(@2   ,`,@2   ,`,@2w  0`0@2r  4`4@2m  8`8@2h   <`<@2_   <`<@2W  @`@@2R  D`D@2M  H`H@2H   L`L@2?   L`L@27  P`P@22  T`T@2-  X`X@2(   \`\@2  \`\@2  ```@2  d`d@2   h`h@ @&@ `4`,"`,4" ,0"`4 , 0`8"`88 "`88 8`8 8 8`0`,"`,0" ,4"`0 , 4`8"`886 "`88 8`8 8 8㿘` >  @i# &R Ŕ ( "`(" 8"`," 0C" 4  ܐ 4 "7`8 "`88  2,4 84t! 0 "`8?"`88??  2 0 8`V0|㿘` z  &S 4 "l`8?"`88 a?2a0 8`*0PP 4` 0 &" ,> # @ E 0 2  4&"`,> # @ 9  0@ 44` 4@ " (@`( ("`(@ 0 "`8 "`88  24 84ِ 8` x ``2 ?> `  ' ' ' '`'7777'''@ذ  2 ,  ,2 , 0 0 02 0 2 4" "  , 0 0 02 00 0  ," ,4" ,㿘!> $ 4 0 Ò " 0`B :0㿘   (pf: ERROR! insert invalid key already in tree_lan_ext key: proto = %u, lan = , ext = state: pf: ERROR! insert failed key already in tree_ext_gwy key: proto = %u, ext = , gwy = p x y / /Đ  x7 0 @#> 7a@'a@> " `Ԁ4>@ >@  y>@ @E>@!@>>@!@>@!( x a@m '>   Ԁ`" x>@!0 x 0 y //r @  x!> 7k ,#7#M $  Ԁ`1>@j >@g!P y>@c!x@>@\!@>@U!@b>@P!(  ː#   Ԁ`>@=!0 8̒`B ":8pf: ERROR: remove invalid! pf: ERROR: remove failed pf: ERROR: next not found p> c )>  (> "Hl@  x/ ( y'> / ( `x` (7 ( `x`0 ( @!@7 (   Ԁ`>@  H ǐ!@!@   Ԁ`>@ ِ h (@2, x 2,  @2,$@2 ,(@, " ( (,@ y (> @!0P (@'` '`c'` '`'`'`'`'` '`$z'cZ    Ԁ` >@   ch   @̒`B ":@ 2f (%u.%u.%u.%u:%u:%x[%u]㿘.`0V.`> ` #H 3`@ W2`0K     * ` 2 ` " "@ $      *  %>)>    2 @ X  .@ #`8 @ X  倢>#h@ 6`TCP UDP ICMP %u [lo=%lu high=%lu win=%u modulator=%u] %u:%u㿘 y " >  ">>">>@   @ ݐ   @ ِ!  y@ Ԑ!  i x!>!@ ̐ , a x@ Ɛ @ 0[ x!>! D H P@  L T X `@  \> b!@@  RFSRPAU㿘  >@ !  >@ "`  >@ "h  >@ "p  >@ "x  >@ }" >@ x"pftrplpfruleplpfnatplpfbinatplpfrdrplpfstateplpfsport㿈> >#\#`#d#h# c@ <  @ > >#\#`#d#h#xcH   @ > >#\#`#d#h"cX t  @r > >#\#`#d#h"c` `  @e > > Кcp#\#`#d#h x  @X > >!0cx#\#`#d#h |  @K > >#c#\#`#d#h   @> > #8"#8#`> `"#@#>  `" `"> " h > !"!"> "! > #"#"`> `"## > j!> #> %> '> )> +> -> ""$!$c,$l$%"h%`%> "!`> @{"a?  0  ?  0  pf: started pf: stopped   > #`U0@" #@" `@"  `@A`@ ?0 * @" $ @.@0  @" 0 @" !0 @0  0; @"w 00 @ 0 0= @0^ @0d 0 @"H^0` @Y> , @ !> 8` @ "> 8  @> E @@ @> `@> 6 `@e` @> - `!@ > `@"`@g>  `@>  0 @ "8  @"  @0 @A 0 @> -0 @ "J>  0 "@ "&8 # @>  @>  @ ">  @"&ذ @@"N&ϰ 01 $@"800`@q> @P  `@ݐ`@> j 0; @"06 @>  0= @x0^ @" " Ȁ`" @X ؐ !> $Ȑ"H@!$"HԀ`$>@ s"00" Ȁ`2|  y">@ e"@0t!Ȧ@#> !> `""`"`"#x@W 2aĐ $aU&!@ 2P !> ͐#x@- . > aȦ  @`"4`` 4`L@  $`@Ԑ $`##x  <`<`<`$`Ȗ`$`"@ " !Ā H /` * ! > c'> 3> j)> j ("`d 2 (a%"b &b@$ȑH 0#> `"`$ "@cx@ے 20ݑH /` * ! > j"` "&  &> j"&H 00"@ 2 H /` * ! > j"@``  ```` 2``   H 00Ҕ H 00  x `> ͢#x@[ \ L  $ @ $ ]  < < < H /`4* !  > j""@  > j> jb  @"@`2 2``2  H 00/ $`> c!> ͔  )> j(`d""`d 2(``"b`"``"```"@#x@(b b $ $ "b"` 2 `` $ $ `"$``$  "`b "``$`$ )> jb`4```@b" %"H p@0> "l@'> #> `""l"`"`"b@ "l2d $d&"d@ 2 > ͢"@  tL " $ @8 $ > "l $ $ ""l"`"d &H /` * ! > > #,> ld##,"#("lH 0d#> `"`$ "@b@O 20QH /` * ! > #,@` >  &``2> #(&H 00/#(@ 2+  H /` * ! > #,@      *    H 00F tH 00  `> ͠"@В ѐx. tL@ $`@ $`H /`4* !  > #,"@  > > c,  @#,@ ޒ 2  2  H 00   `", "` "`  "> ͐"@'>  ,`$`$`","` 2   `$`$` "$ `$``"`,`"` $ $`> #(`"#(H 0g"h@'> #> `""h"`"`"b@J "h2` $`H&"`@ 2C > "@  } `L " $ @Ґ $ !> "h $ $ ""h!"`"` H /` * ! > > #> h`##"#"hH 0#> `"`$ "@b@ 20H /` * ! > #@` >  &``2> #&H 00#@ 2Ű  H /` * ! > #@      *    H 00 `H 00  `> "@j kdȔ `L@ $`@ m$`H /`4* !  > #"@  > > c  @#@ , 2  2  H 00F   `" "` "`  "> "@+'>  㐖`$`$`""` 2   `$`$` "$ `$``"`㐐`"` $ $`> #`"#H 0!@'> #> `"!"`"`"`@ !2 $&> !@ 2ܰ >  А@  xL " $ @k $ > ! $ $ "!"`!耢 YH /` * ! > >  > # " "H 0#> `"`$ "@`@ 20H /` * ! >  @` >  &``2>  &H 00b @  \ H /` * ! >  @      *    H 004x xH 00+  `>  А@ | ] xL@  $`@ $`@  H /`4* !  >  "@  > > `  @ @ K 2  2  H 00   `" "` "`  ">  @'>  `$`$`""` 2   `$`$` "$ `$``"``"` $ $`>  `" H 0H /` * ! > c  ( "`l 2 (MH 00pH /` * ! > c  ` `2 `( H 00K |H 0!> @8"H"Hl" &lp"H"5&p3&p $ H /` * ! > c  H 0,"* & !> @"HH /`* ! > cu -, {(,"*  |x`(x2 |"H"@ ''" 'j | f|`|`@(`(,"* &H p@0@b > " 8"  0" ː @x $ $ ȠPI J/t`/u@H 7rIB`7pH ` " `2      ` "~ `` n`2B 2B 2 B 2B "e B "a @ "] H /``* !` > c> a@ ` x "  6DH0B6F0  , 6FH@6D H 00#` 8!  >"*` "&` 8 >"*`  &> ""H 0`   `d+@ *`#`  `2 "`d  `2 "`h  `2 "`lJ ` `" 2< `27 `22 `2- ` 2(  $`$2 $`$2 (`(2 ,`,2 0`02  8 `82 "`p  4`42  9 `92 "`t J@ ` <`<" 2<  <`<27  @`@22  D`D2-  H`H2(  L`L2  L`L2  P`P2  T`T2  X`X2  ` ``2  "`x@"  \`\2 @ a `a2@ "`|  -``  * *` *`+ 02 *?0" 0  ( (2 㿈` `@_ȔĒ`6@`0P  *   2 66@ * . *  2 *  2 *  2 *  2 *  2 *  2  * 2 * ,/`2 2`2|6㿘&@64 p?c * 2  h6@㿈S O V@* P2 * J2 * D2 * >2 *  82 *  22 * 2 ,6@x\l @`kؒ `2@, ` 6@/ @24  7@@4  ` 4* @2  4  K *   2 5 *  2 0 *  ϑ2 *  ɑ2 *  Ñ2 *  2 *  2 *  2 *  2 4 4풔  0@d ڑ* 2  d22@ ڑ* 2 ܑ* y2 ޑ* s2 * m2 *  g2 *  a2 * 2 [4㿘" <`  (`   @Uc   @JT  @Uj0@Um> "`$`   $`$`@$`"`'``  - 5  % @%   ,4($$ $ $$$$  $$`4@4`  ` $  2`  $,  c  $  0)@4 @@ /*@@  %- 5 5 5     @ 0 ( @/4 ,    @ 㿘  @T͔   沐 @KQ  @Tѐ0@TԐ 0 ` @˕ 0`@   `0&@@```` ` `  " ``@ `? ?=>(**`03 *0@.@ **`0  *0@#!  (`? (@ **`@ **` `?**`@ **``? kl4lHl\lplll  *`0  2  2  㿘>  @# 22`   "@" &"` 㿘  > !`> ΐ!.`2 > 2`""`"@@ђ 02㿘  > !`Q > ΢!.`.2`2   6 "=>  @r@ܒ&@ @r@Ւ$?&644*2`~6 "2644 *2`j6 " ˀ2 n㿘> #,@ 8  `@ p @"'  p "#  m``@2  l 2  n  ,   < o L "    " 㿈 @c > c S `$`  ` ] ` \ `  r   , ^ <j 2)`2&  2"  ] 2  \ 2   LN   , ^ <F "    `㿘>  @ J / 7  `@ v @"7  v "3  s``@2,  r 2&  t  ,   < u L "  n l  7  l@ @ 8    "  l*` p2` ? 8 (2 x\'D@ ` ` 'L'T` D'7怠> -4   ' 7@`#`#\`j L ј d'@0?cQ k怢 2 `#`#\`H\-4 ` K & w `7 p7`4#`#\``# \D * L2 N    Δ```#`#\`  > j"@  "   `B < "  d `4@"  h  4 l4`` $ `2 8 $ 2 8 ( 2 8 , 2 8 0 " 9 8  $4 2 9 p 9  4 4 6%@ 4 t`` L `2 ` L 2 ` P 2 ` T 2 ` X " a ` < L˙4 2 a x a "  \ ^` 2 { |D 2w ` "n  h q  `B =  ` B= 7>  `B :  4*D(L2 x 2B  9 2 ` D` `4#`.3`#\ 2 ` D2 `4#`.3`#\`` T4  4 2`L  怢`Ӱ ސ ϰ  2 `  2 ` 2` ` > `2`T*`" " !0@ 2 &`d怢`{     2   .`{.`yD.`x *.`z `x@6`,`0r``6`@ ``f&`&` &`6`&&`Y`, 6` `P`6``0J@ 6`@ ``?6`,:`6`,`,2 @ &`H&`D ` 2&`L !> %>@os &`L`D` `  &`L!> %> `  `H &`H ` "``H &`H``*   .`R.`b6`P&`T&`X6``&`\"H&`h"H@ &`l&`p`$&`tLT@  p\ @ `` 'L'T` ''7> -4    Ɣ`#`#\mL ` g'0?cQ 怢  礔`#`#\K\-4  ښ'܀ ' w !7`p7}` 4#\#`"\L2  ۚ   J [ `#\#` > j"@  "   `B < "  d `4@"  h  4 l4`` $ `2 8 $ 2 8 ( 2 8 , 2 8 0 " 9 8  $4 2 9 p 9  4 4 6 4 t`` L `2 ` L 2 ` P 2 ` T 2 ` X " a ` < LW4 2 a x a "  \ ^ 2 { |"v  p b  `B =  ` B= 7>  `B :  43. L2   `24  / 2` 2 `4#\#`.3`܀`2` 2 ` 4#\#`.3`  4 2`L  怢`     >   > 2!0܀`y !0@D 2 &`d怢`s _ o   2   .`{.`y .`z".`x `#6`,`0`6`@``'6` `,!6` `6``06`@܀``6`,`6`, .`R.`b&`D&`H&`L6`P&`T&`X&`\6``> H>&`hH Ȑ@ &`l&`p`&`t LT@ǔ  㿀\   'L'T   : `   / /䀧`=. 4    垔``> jV"<`L `H`L 1 B傔``> j:" \ `,\4   S $c``> j"` > jL2  迚  ``  > j"@  "   `B < "  d `4@"  h `"4 @4 l`` $ `2 8 $ 2 8 ( 2 8 , 2 8 0 4 8  $}4 4 p4`` L `2 ` L 2 ` P 2 ` T 2 ` X " ` < LX4 2  x 2   2 ` @2 ` @"w  ী p#`B < B<7>  `B : ঀ 4E/`L2  ऀ 2y  ਀ > > `e !0@~ 2&`dd  ঑2  .`{ `.`y.`z.`x `f6`,`0a6`@``W 6`R`6` `J6``0E`6`@`>6`,8`6`,.`R.`b&`D&`H&`L6`P&`T&`X&`\6``> H>&`hH Ԑ@ &`l&`pS&`t   L@T 㿐        8``> j3"`L`L )> j   Ԛ ``> j"` r > j2  D `͔ > j"@ w "   `B < "  d "  h `` @` l` $ `2 8 $ 2 8 ( 2 8 , 2 8 0 ` 8  $ ` p`` L `2 ` L 2 ` P 2 ` T 2 ` X " ` <  L 2  x "   "#  `B =   @ B = 7>  `B :  `c. 2 楚   pf: loose state match: seq=%lu ack=%lu len=%u ackskew=%d pkts=%d pf: BAD state: seq=%lu ack=%lu len=%u ackskew=%d pkts=%d dir=%s,%s inoutfwdrevpf: State failure on: %c %c %c %c | %c %c h`    / /`7 7> c> a@&`2 `z @`D`T`D`T@ F  .@j $`  @ "  J  E   `@ `2  ` $@ ,` `    `    $`` 5 84`   ` "@@        `@ `2   2   "  @`@#  @" @ ?"%|A!ۀ4y .p2` "pt "t` @ *4` @$ 4$@ @  $$   `  ,` " `  ,` "    2  ,  ,,` `    >> bH$Đ ` > ` > bH>` > bH>`> > bH>bH> "`l ? ? ` N?"% IA!@@ C> "`>@ ( >`p @@.p2` "pt "t` @ *4` @$ 4$@ @  $$   `  ,` Y ,V,`> "`( >@{ p >p ``"p> > #\ z@ 2>> Ȑ #` @Y`> ؀@  1  @ @  2 ?"% 3 A!ۀ  4 $ @  5 @   6 #\@1X @` x 2,  @`$@ `(@`, !` ,  #`#\(      #`#\ @  ` @ٔ  d" `B :d@ B : h`  `@` / /ཐ`` `77> c> a@䓒&`2 `z~ @`D`T`D`T`p "`p`t "t `2  *  2  +    >  bH> bH>bH> "`l@` x 2,  @`$@ `(@`,  ` ,@ #\ ``#`|  ` #\ ``#`o@6  d" `B :d`@ B : pf: ICMP error message too short (ip) pf: ICMP error message too short (ip6) pf: ICMP error message too short (tcp) pf: BAD ICMP state: seq=%lu pf: ICMP error message too short (udp) pf: ICMP error message too short (icmp) pf: ICMP error message too short (icmp6) pf: ICMP error message for bad proto `   :0 @` `     @` ` 2    `//ߠߜ7`7> c> a@y&`3>`p "`p> t "t"H@"l     2     @ `$@`(@ `    0 `  @A     0͖ ݰ  `ٖ  Ȓ `/ƀ`"(`jǬ`#\  @š  > "`> H?@2  * /''E'#\h ( @  n> "`> pp/''' @ '@ @: ` 3" < +" , "  p  2   / `*` " ǀ   X> P"ƀ :> J"P#\   @J  > "`?>; ( /M/LޏR87HމP`7J> c> a@f&`"!  `z@`T`D`T`D`T "@T` ` >  @" <> "`>@d q> @^    x 2 @`$@ `(@`,@"E``2,#`#d#\#l#h Ɣ#`#d#\#l#hR ƀ   @  @  @  (@h Ɣ #\   @  > "`~>z  //ΐ"7 `7> c> a@ᥒ& _@`x 2 @`$@ `(@`,@:`2, #h#`&#d#\#loƒ #h#`&#d#\#l^"ƀ    @h   @_  (@ZhƔ#\   @  > "`>! //@ܐ7:܀`7> c> a@& ф@`x 2 @`$@ `(@`,@`2, #l#`#d#\#h   #l#`#d#\#hҚ  @  zƔ#\   @  > "`w>s!@ //ǐ7`7> c> a@& X@`x 2 @`$@ `(@`,@3`2, #l#`#d#\#hi   #l#`#d#\#hY  @k  (h@e@`   `>!p@i 㿘\(0@  * 2    2477  7`27@>  `B %: @      @   (   7` 7@>  `B : @ " Ȫ  7֨  'А @D_ "`/ !> >@{ @"H'> j"H>b" * `@"H$` ֐@Ė  7` *     7Ԕ `B <7  '?  // ? "   q@ #\ ' :Ԁ lĤ2`*`"" '#\ @x* 2``7Ԓ#\#`Д |* `+7Ѐ ~> #\  s7Ԓ #\ ' Ԁ /В#\#`Д * `7 {T dЀ Q> #\O F7Ԓ #\ ' ИԀ Ԁ@ N #\#`Д F* `7 d "! { `B =  @ B =  {Ѐ > #\/ 7Ԓۘ7>  8@ ` ਟ. . Ԓ@ B *H; `B ;`  . ՠ<#/|7x'֐20 ԁ㾀> " Ȭ  7 '   @C " Y #> >@6 @bH'> jbH>b" *  ߇@bH$  '  7 `B <7!   ``?/'`  ( ?  `$@ (/  & : ` 3"  < +"  , "    "   7 `B :7 / `*` "  J : m #\ ' ʚ kĤ2`*`"" '#\ @* 2``7#\#`  * `*7耢 }> #\ r7 #\ '  /В#\#` * `7 {T d耢 Q> #\ F7 #\ ' a 쀠@ N #\#` ך* `7 d`"! {``B =```@ B =` {耢 > #\ 7l7>  8@ ` ฟ. @. @ B *x; @`B ;` . <c/7'2 pffrentpffrag㿈#> `>#\#`#d#hc   @ !> !`>c#\#`#d#h   @s $@凒#c @咖 > i!"!"`pf_purge_expired_fragments: expiring %p 㿈@&>""@ '耢'Вb@ ?? #> i"`> h@@Oa `  @  쀢@> "> pf_flush_fragments: trying to free > %d frents 㿘> g!x,  @6> "`>!`@В$x@> i!`  @x@  @ 㿘 %> #> g` "` "@6 @㬐ax ? $ax@9 `  * $* %` "`" `2 "2 pВ> a^ @ `> i "` "  " &" "`"& p >  !/ ' 7'77 `"  "`> i"! "> !`@Ndiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../net/pf_norm.cfrep != NULL || frea != NULLpf_reassemble: overlap -%d pf_reassemble: adjust overlap %d pf_reassemble: missing fragment at %d, next %d, max %d pf_reassemble: %d < %d? frent != NULLpf_reassemble: drop: too big: %d pf_reassemble: complete: %p(%d) p   *  `  "@ & <& > !`@  2 .`@ฒ  ~.`6` &` &`  .` 6`&` > ! ,> ia a&@" "`"&` -` -   2` ` @ `  @ (`` `>>> ``@!/2 2@7 c`" ``` ",2`@`  @7> "`> @S@" 44 >- - 2   @ 5> " 7>1> g  Ԁ"@,`2`@2 ,`2 @ "@5 `"  "` "@> @$ !x?` &!x`4  4 `5@*6```` .`2 @` &` " &` `  & &@" %@&`  ` ``)-> *2`  *`2 @  ` ` @   Ԁ``> ` ?  @ė2 `2`  Ԁ - >`!@鵓4`4 n ` 2 >>> ` @!|? c *  $   Ԁ >!0@锒 ݐN !> @6&@᎐ > gax?"ax  @@ၐ!x?$!x@6ܐ`2 `$ ` $ *  4    "@ &  &   @&   Ԁ` >!X@H0@42 pf_normalize_ip: IP_DF pf_normalize_ip: mff and %d pf_normalize_ip: max packet %d pf_normalize_ip: reass frag %d @ %d pf_normalize_ip: dropping bad fragment 㿘> j"` @ *` 2`*  5* 2- 2)   2# `" $ ` @2  $    8 $` Y  "  L  < ` L`M    2 `- `j`7`@ > " `Ԁ}>@贐 y `*`"4``4`> " `Ԁi*> (@螓2`c `    * 2  U'> >  @| > g@t  > g 6>  (`B ]:(ax>  "ax& & >` h@f5} G&`2D "`4` 4` `6 ` *2,`0  6>   `B :  `Ԁ  >@4 z 6``B <`    .`2|  㿐> j" \ @   2   "  d " z h ` @ p l  $ " 9`2 8 $ 2 8 ( 2 8 , 2 8 0 " 9 8  $? 2 9K p  ` 4 6i `? t` L `2 ` L 2 ` P 2 ` T 2 ` X " a ` < L 2 a x a "  \ ^9 2  |2    "   2t `2 a   E> 2    <> 2  6> ( 2>  2` , 2 @  ,  *`*$ 2` E 4  ` : 44 @   > "   B: '`  `  . `2|  redcbqnoq㿘?2  @ >#؀ >  #+   㿘?2  @ >#؀ >  #+   㿘?2  @?0!@ 0!@!2 @ 2@0!@ !@ 030!@ 0-@]   &&@U  @@L  @h >#؀ >  #*  @vmmapbsyvm_map_lock: failed to get lock㿘@!   ``"`  "  2  " " " " $" (" ,\" 0`" 4   "  "  " " " " $" (" ," 0" 4 㿘   > 2< H /f     ! * '   2 ,@0 ` ` && "` ?& `  0`& & H 0 㿘  6H /f     ! * '   2 ,@0 ` ` && "` ?& `  ?& H p@ altq assertion "%s" failed: file "%s", line %d altq assertion㿘>"P@嚖>@"㿐``8 ( "d`  4``  8P @> #" : 3`+ @+` b 2**@ b 2`* *` B 2**@ ;C3`+  +`   d 4 2   (  @ג   B<    4  2 <   @(<  < <   4 `,   8`0& `(€`@ `  $@$`& `?$`  `2 $ (   @ c < $ (tbr_set: no cpu clock available! 㿐#>` 2 @@` 2@>@!~  2  0 8 2& 8u [ @= k @ 0@2 `   @ؒ <`   <  ?  ? @< ?<  @< > #Ȣ " : 0(@(b2*@ *@ b 2`*  *`@C+ 3`+`@ ;B 2`*  *`< $ ( 8 & 8@ƒ  !>#䀢  ># `>c`@ǹ @ $# 㿘 H /f4> * '> !Ѐ   ̀ "   ` `" @  2 ̑H 0`># `>c`@} @ǭ 0>"#㿘 8 >&`&@  2`* @ *`@&@ &` 㿘``" 0Q. < @@ H 0.. p. . && @=9 &606  .. ?.2 . *@ & &  &$ &( &, & & & $ &" &  )(&  @S  6 6 .. 㿘66 &`?@@A9    @ * @@: 2@(   &@ *  @ ` "  :  2 .   6 .6   @@ " 2 2N @* @:B `"@( @  "@ @:</>(  2 *#2 2* " *   "  `(В  (Ȓ@* \||||||||||||||||||||||||||||||||||||||||\||||||(||||||||\㿘`   l  l @8  @ l`q X`$` %!  2 4$ 4 2 ?$ 4 2 8$ 8 2 ?$ 8  4 @   8$  ~$ 2~   2 4  2 4  2  4 2 4> "0"0 2 $ 8 2 $ < 2 $ @ 2  $> "p"p` $ 4`$ @`$ 8$ < $ 2 D ( 2 D , 2  D 0 2 D> "0"0   H  $ L  D P  > "p"p` $ D`$ P`$ H$ L  $ D  4   *$      *$  `22`!@:  @$` @,@&$`H /f * ' . ` ``   @``2 ` $@"  "` $` $@" "$`H 0 `  &㿘@Ԓ  H /f * ' `"`"H  @  㿘H /f * '  *``` 2 2`"  "` "@@ђ  뀦 2`aݑ*`H 02& h\ɀ`F ` `N$`` ``@Ĕ 2Y`@`2`S 2`$`M ``@ 2F`@`2`@ 2  :  . ```@3 2.`@`2`&!.ɀ 2! ``2`@:   !. ```@ 2 `@`2`!  `8 `2: ` 22  `4`(  `8`   `   @  `< `@   `   `2  `2  `      `    `      `<  `@  㿘`S `2U `2M ` 2D ` 2;  `$ `D !   ``4    `T`   `   *`>`` `*`    #  2` 2`( "    2   " 0[2 2 2  2 2 2 2@ @0>2!2"2$2 $2$ "$$$2((2 (,2(0"(  㿘> #``@P @m 2  *  "  " `2 ` 2 `" 㿘> $#` @2  @2 @2 @26`6` &`   @Z   " J 2  ip4f_init: can't alloc %dth entry! 㿘> #`"#`"`  #>  <@  2 *`@(`  ?  "@ "`"  $  > `@` `"`@  *```"@`  "``"` @> ` `#` `@ *`"@#` "`  " `! ` 22 `     * :  "`  `<@  ` `0 0`S ``L `     * : `3"`$``<) @ !?8  ( 8882 * `@2`*("@altq: emulate %uHz cpu clock 㿘>!X!А>" @ܐ>"`>#@7 㿘>    @*  "  㿐0! @   !2@h  a@! a@/ !@" 0 !@Ԑa@ 00! @ {  ۰  װq  Ѱ  Ͱ@튐  ư  @1 @   @( ' @      @  '  @ @    ' "@  <"   "` >"  >> Ha$#\#` 7  >@4  @Ғ @ϒ 0~`'{"`  u @q &  &D   (:& H> P>  X>( `>0 h&8 l&< p&@ &H &L &P &X&T&\&h&`K&d  2 D H /f * ' @S @& " & @ ' H 0&   &  &  &  " (@U$   >>># ""`red_detach: no state found in red_list! 㿘 `    >`2"`` @2@"@`>@ߐ @}  @ @ invalid weight value %d for red! use %d 㿘 x @% ^ @ x $ 0 $ ("$ $ `2$ > $ 2$ > $ 2$ > $ `$ # $$ 2 @"@ 1!+ @4  $    <>    * $ >!@y$     *  * *`" $ mC$ *  @$ $$ 8@m㿘@ 8@   (:"@ H:` P:` X:` `:`  h"`( l"`, p"`0㿘  @     $  7㿐 0 # (@6& 0 <"@<* "@ *`"  @*  " * @v ?`$ `@ 8l< `  * <  ,"  & ( )& ,` $&& 4 & 4   $  & 4& , $@U: `  @\ "   p& , & p & 4````@6 ``@`"`&"``&@ &```2 h l & l & h X`B > X ` ; @ B > `& ,@&? H`B > H P @ ; B > P 㿘ln&@`$ l@˒@ `"T ``2M `     * : `3"`` 0.+<`@2% `  ` *`<2` `2 2     㿘`         @   ?$ 㿘@`  ` "&@"`` ?&`" 2 "00   "0@< 㿘` @ 㿘 @%ܐ `2`  "$"`  ?$ "`   2& wtab_alloc: malloc failed!㿘>   "  2   @  >@>! $$ @ `  $$ $ ?$` @* $    ?kw: &  2`,$ `` 㿘 ? & >` 2 "` @ 2@"@@  㿘`@ `1`  @,`k9: .@``, cbq_add_class: no parent class! cbq_add_class: borrow class != parent 㿘В  2 * 8'   8#  (@ ,@   4@># >#@ @=㿘  2  @Ȑ "  @ 2   G!$@㿐   @ 8 "  0 #\   @@ $   㿀`$< @@"4`" l @@" d 2b  Ԁ 2^  ? Ѐ 2X ? 2S ? @   *`2 > ?$> ̖#h #\ #d#`@  >#\#p #`#d #l#h@  2&`8  "?" ?"&  & Б, "@ 㿘`@i "&  `0  `0& & .` "@ "  `0 `     *`  㿘  2   ܐ  l 2!$ 㿘  "  +!$㿘   @㿘!$ =    ,``" ``@  "@``$  ؀`"  `@ 2 v&  Ѐ`"  `@ 2 k&  Ԁ` `@ `& Ԁɤ  㿘` @ No Root Class for %s No Default Class for %s No Control Class for %s 㿘"   5 `/`0 Ԁ   Ѐ ` ؀ `2 >"`@v Ѐ 2 >"x@n ؀  >"@f  2 ̰ "$ 0q ̰㿘`> `> `> `> `& (`& ,`& 0`& 4` & `& 8`(& <`,& @`0& D@ & H`& L`& P@ & T`$& X@` & \@` `\ϒ `㾐   > ` 9 5 `"``""  ?'?'?',  4%, `" ' d!  `@ р`%㿐@牐 "C  %,=  @, 5 @%,! @ $ @ $ @ $ @$!$> c0#\#` $ >>>ؘ pb<$  @ 2 > ( " ($@ؒ @Ւ 㿘   :  ؀`" # Ѐ`"  Ԁ`) >`("`("  "`" @`"@ @ @  㿘` 2& ` & ``@6 2    `$ `  $` `C >B> >  7㿘  @j  `  $  @z& 㿘      `    4$@㿘  , @  @ $    2&  %s㿈>`(  #>`( ̒a @B  "`( 2 ́㿘0! @!2 @ W @ A a@+ a@?a@? 0Ba@!a@1 0:0!@ " !  @0! @* 0*@0! @  0" 0 0Y0l040d0}0 m0 0ؐ0Brmc_newclass: RIO not configured for CBQ! 㿘 p`>@O#  ؒ @ @ ؐ @   @ $@x  @  \ $ L沒$ P$ $ "$ @@$ <$ $ $ 8$ "d"` "f$ d & :  $ ,$ ,`f2  $ ($ ( (h$ $fܒ2  $ 0$ 0`$ T`  `2lfʐ@#而`     $ \" H /f * ' . ` @ $ H H H H 2 H& H"@$ H P `@'`<$ D'`@@`  ``` " @ @S"H 0㿘  H /f * ' 沒@/"& & 8& "`f`2  & ,& ,fX2  & ( & ( (& $fM2  & 0 & 0     *  "@ @ # H 0 㿘   ,  `  %@f$ @%@     $ @ $  H 2 ړ, `*`    P"       @2 "  4D2 `"  P 2 @㿘`4 @`H /f * ' @}`P @ `D  "@`P "`<2  @ `D`P"`@"D&`D `D`@`* `" `H@ `H`H`H2`H"`H`*  @2 `H# #   `*` ` "@ # `*@ 9#@ `PH 0`\ @ ` @@ @ rmc_init: root class not allocated 㿀h@@! 4  <4  `&` &`&`&`&`&` &`e1@#* e*&`&%b  & : &` &``ؠ`܆`Ԅ`````@`   "" " " "  &`&`  " " "  \>#``d#d#h$#\#l#p  &`>@#80" 㿐`   @ `? 쀣 + l  p   4  L 4$  L  "  쀣6l& $ p 6L 4L$ @ `, @@  "@   @  @O?㿘  ,`"@ 2 H  , & 㿘 "- @l &( `p@6    2@4   8     ے "  D  㿘 ``ԑ* "@ PK 4  l@ &D ` p@ $= @ & l7& 4. @!  `쀢@ "# |$,@" # |` #  T€  l  & L` p@ $ L ``* "@ _rmc_wrr_dequeue_next㿐@       l  "c&   ԑ* &  "@ @   6  `8  `4 @$  `"$  l g  ` 8`6  * %2$  L 2$  HՀ`2Ϣ Ǧ`"     쀢 6  &  `& 쀥`R   *  L% L & 쀦B@ 2>@  `2 , @@ ?"@  `$ `"@$  @2    H* " * "@  ؑ* "  `*`"  * " "   @~ & `&@& _rmc_prr_dequeue_next㿐@M    K&   ԑ* &  "@ @     `" H l 2 -`2 H L 2 H2ߨ?`"     쀢 6  &  `& 쀥`>   *  L&@ L & 쀦.@p 2>@n#` , @@?"@ H "@  ؑ* "  *`"  * " "   @ & `&@_& 㿘 @&   grm_class: bogus time values 㿘  ؑ* @`$  `` <B`C <`<` ,  ,   bX< <  <     @C 4A  "@  >@_"x А"@@А"@@ @ 6  И"?@@ / ?/!  @ @%& "?@ & @  ?/!  @ @& Ж"?@& @   ?/!  @ @& `z& д"@? `x `t"   >@"x  $``($`$`aҐ<< `$@<@ ; $$ $`$`,6+ $`$+ # : @@ $`l?/!?@@ $`l`$`p $``( @4`4$`$ $`l@`$`4`@" `̐ $` $`t `P$`x  $`h`` <B`C <`<``P`2  *   쀢  @ `l  p  6 & 쀢 4& ʐ  * ' *`%   @ & &㿘 @ڐ ` @ * "㿘   `@@F `2`  "$"`  ?$ "` *`@ ?$@ 㿘 Р &  p  l |@" ` `` >@)"x А"@@А"@@ 4 7 " 0 0 h>"  pВ@ "?@  @ ?/! l @ @& l& p \  ԑ* `@& 4& @i l   >ʒax@1@a㿘 H /f4 4* ' 4  & l& 4@Ѐ`@H 0rmc_root_overlimit㿘>@@"㿘` 2 d `{ \  ` `"`&`"` & &  㿘`2`  "&"`  ?& "`@m 㿘` 2@\ \2  ""@"` ?"`" vmmapbsyvm_map_lock: failed to get lock㿐@-.`? ?*@   .   ` 2 㿐  + >@-vmmapbsyvm_map_lock: failed to get locka.out[ %s symbol table has bad start address %p ] [ %s symbol table has bad string table address %p ] [ %s a.out symbol table not valid ] [ %s has bad a.out string table index (0x%x) ] [ using %ld bytes of %s a.out symbol table ] 㿘@`` >ː Ȓ @ >  "#l>ː @5 @ >    ?  "p>ː!0@ΰ$ @#>paX@Ρ  *  @ ?>˒&!@΍ 㿘``: `" ` `"   2   @7 _  * 㿘 < `24 `"0 ", "'  @ "&@`2 `  2 "  2 `"  *  2&& @ " "`"gcc_compiled.㿘 ? ? A ->   "?`"   " J g2  @< 2 ??   d D ': `    2    ': T  * `` && ???㿘`D ?` $28  4 :/# 2+#@6(#1>` "@  H:2H:"(: # @&# *  㿘  ?`"8   "3  2. >  ch*`  ?`>͐ *` € @*h * *h + *h -*h /*h*h"   h _@ *44<4 4<44<4$4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<40vmmapbsyvm_map_lock: failed to get lockAll breakpoints used. 㿘>`T "> "`T`P>  h>͐ "`P@ѐ!0 >T"  TAlready set. Too many breakpoints. 㿘@< >@̶!0 >>@̭!0 `X""" """"`XNot set. 㿘> X@ @ "  2  $@ >@̆"X0㿘> X " @ϒ "  2  2 㿘@Ґ㿘>`\  > X  #$t@     $   (`   $\㿘>`\  > X "$`\@      $`\㿘B    & & & && & $t  0>@!Ȱ 㿘   9No breakpoints set Map Count Address %s%p %5d * 㿘!> X >>@ 0@  X >Τ!#>@B ">>!! @  @ @Ȑa(  㿘@+!㿘" @!㿘  >@"  `   >vmmapbsyvm_map_lock: failed to get lock㿘@  @ @ "  JK2 ` 2"  `@2@%-12s㿘  !>@S#h@    2? No such command Ambiguous Bad modifier Count missing @  >  't'x'|r/   @j 0>W#`|#> %>!>Βa|  | DB#؀`@} c`| `C|@q@k >&#> a@B0@\ /@ x x> > "a" > " 'x@M @t  |>ΐ#@@J@9 ?'t| `|1|  & xt| a> ``> !P>  >  "bA@!> "> "`㿘N> f`?@ԁMalloc debugging not enabled. 㿘>@{"㿘N> f`?@xԁ㿘@Dcalloutprocsmallocextentsobjectmapwatchesbreaksregistersallhaltdumpcrashsynchangmanhelpbootshowpscalltracematchnextuntilccontinuesstepwatchdwatchbreakddeletewwritesetsearchxexamineprintmachine> 㿘>!t ddb> 㿈> `> b'> > > g"`#!P"[y#`> ga )>'>%>#>!>@  "$@ $@@-cD!t> g!`> " 㿘 @@U> [T`Bad function Too many arguments Argument missing %#n P@ސĀ  >)!@)Ā (@ѐȀ   >@ǐ  `@ ` @ @   >#!>А!@Ʌ@ t`  ȑ,``` "@#\#`#d#h؟Āܒ>@f!㿘@(㿘@)㿘@)㿘@ ( vmmapbsyvm_map_lock: failed to get lockvmmapbsyvm_map_lock: failed to get lock㿘J@ !>@#H" #H@: = 0x%lx %-*lr%-*lx%-*lz%-*ld%-*lu%-*lo%c\%03o㿘 > L@  `@  @ * >@ (> "aP`1`>ѐ#*` €        >ѐ 0@`  >ѐ @@גt`  >ѐ H@ʒg`  >ѐ P@ȽZ`x  >ѐ X@ȰM`k  >ѐ `@ȣ@`^  >ѐ h@Ȗ3` Q  ^ >@Ȉ p%`>@ȃ x ` ` ^8>>@x p@t x 1  0   @+c`@  "L@@ L@O6E> " G8GPGPGPGPGPGPGPGPGPGPGPGPGPGPGPGPGPGPGPGPGPGPGPE<E FEGPGPGPEG,GPGPE$GPGPFXGPE0ETFGPF$GPGPEGPE%*r%*x%*z%*d%*u%*o 㿘N >*# #?* : `6*`>Ґ! €@ # ->> `> h>Ґ p@  >> x>Ґ @ >>Ґ @ޒ >Ғ  ^8>>@Ԑ p>@А x>@͐ HIIlI(IIIIIIIIIIIPIIHIII4IIIII 㿘@ Ԓ >@Ǫ (@*  @(*` Bad modifier bhlAddress missing Value missing Count missing 㿈@ $ @ "> >?"p!>Ғb@ϐ > b@ǐ >  @b > @@ >"@x >"@q ?'@  @f쀢  >Ґ"@6@0@?'@㿘!>   ?> "!Pٔ 2$ vmmapbsyvm_map_lock: failed to get lockSymbol not found Syntax error 㿘@u  > !@ْ < >3  > "0 > " >  !P >   > ! $ @ @ @ > @; >Ӑ  @. 㿘@,   2>Ґ   $ 2>Ð  R $ @Divide by 0 㿐ϐ / 0=  >   >"  @~'@ '@~?W6'@? π ̀ @ $@㿐 % @? !>  U  " @'? @ $@Negative shift amount 㿐̐ , @?  #>!> "`   * 2 @a'? @W $㿘̐vmmapbsyvm_map_lock: failed to get lock㿘 N@  a( "@$a(> a a(*`: @.@!`"@*@ې a( !֒"@ !"$!㿘!> %>  !(#> Ӑ"!( `ΐ"`$$!(^R 㿘`~>֐"*` €1> >  !(@ ( @ !(?&!(1> > !(a:ܰ @J!( &!(> > !( ͪ @t !(`? &!(ð > > (!  !(@aJ@!(!  &!( > > !(  J   n (`@ J  0> > a( [  > > a( 0> !(> a|" H y j 0u>  1> !(` m J *!(@*@ !(@ J!(@ J^ >> ɒ!0@  "#>cȒ $#>#'>Д@%> +> )> 1> ɚc̀  ? $#$##J`c)#Ѐ@cȔ!/` @$#̐$#`$(v%!!/` @$#̐`$#`#%!J`e `a*@Ȓ`#aJ  S!>>#̦#Ѐ@  J@ >#> ɒa/  `̐  "###̀ "#J #Ѐ>> ɰ!/@  $#̐ $#+> #Ѐ)> `%> %!J`  a*@Ȓ`#aJ  !$(`!c"@ >Ԑ#] 1> >  !@( T"@> ! (Z"  >>#̞ Ԡ+> ΀ )> 4'>`!@  K`"KK@@2K>#> ɒa0!   " `@" KK"KK@" K `!@ !В`$#+@%!Y `! Ж #> ɚ!0># *Ȑ  ##$#* $а !$#* 0%!> > ! @А % ^ > (   *( 8 (*!`$(@%!(!"@! (Œ"  SS0Z0TSSdZ0TZ0XTZ0XVZ0UxZ0XDZ0UU Z0T0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0Z0T㿘@> > Ų> > ɢ  "#"a(""@v @O !*!`"@㿘@  0 @    ?vmmapbsyvm_map_lock: failed to get lock㿘>   x > > "`|" > > > |"#>؀ >  > |@?J@`"> > ܝ㿘>c܀ "c@$㿘>>"#"c܁Bad character in number Bad escape String too long Bad character 㿘0? ?߀ ] ?Ѐ ` 0 ># O o T  t X   x> #> ""0 0S$0 /  9 7 0 ?Ѐ ? ?  ?Ѐ ` @?4ޢ?0?Ѐ  ? ?  _># a ?  ?  _ \C > \ !< ?2,>#@,> "p %>#>+? ?  ?Ѐ  _ \ :2, \2 , ?2,֐@, ϐcP0H `??*`>ؐ# €> <  .4 0 . , * ( & $ "       <   >  Ӑ>@Y#h?cclclclclclclclclclclclclclclclclclclclclclclclclclclclclclclclclclcc bcbclclbbbbcbbbclclclclclclclclclclclclc$bcDvmmapbsyvm_map_lock: failed to get lock㿘>> c@ >#@yd@Qݒ @@$@ @ `@>$--db_more-- 㿘>Jah ah#> %>L@ L @ c"$c q c ?c?$c$c $cLx  xL@Ѡ L Ȑ 㿘>#` ># ??߀ ] !>@>#>`"#@ c@ >c$# "c$cc($# @ >> >"""c0 !>#>#c@xQ8# $c >c "c@s > 㿘>#>"@ >@3#vmmapbsyvm_map_lock: failed to get lock%-12s%#*ln %s+%#lr 㿈> > #b@ 1#>ڒ@ @ `H@ @ 쀢>!` >􀢀  >@ X`">>@ `>@ h Ւ> Βb`2`vmmapbsyvm_map_lock: failed to get lock [after %6d] 㿘@ Y " @ ? "  " &@8  >  `& & > &@"H   &"H$ H> `? "`> "@`>@!ߐ>@! H   "H >  㿘> "H     "H + > a #a"H `   $"H@t> H  H   Jp"  > > > > > > > g ""@ #bH""#"L㿘N> p`? 3> 5> 7> 9> > g #H&b@ &&'"L㿘N p`?3>  ;> > 5> 7> 9> > g&bH @ '`&&'"LJc>    H> > > > g  "!"`"Lvmmapbsyvm_map_lock: failed to get lockbsd[ %s symbol table has bad start address %p ] [ no symbol table formats found ] 㿘> > Ϥa>ۀ!@>ې!H@Д0>!P!P`'> $@$@&    2>$@!xNo slots left for %s symbol table㿘>  @   ``+``2`` >ے+`` #`"`""@ "@@|?Unable to find symbol table slot for %s.㿘>   , @ " @| 2  >ې"@X0 > ,  "  "  # " 㿐@H > #x@* *`` :*  **`'􀢠#x㿘@| 2N    @|}`?㿘@'D @D  invalid symbol table name㿘N  %> ->L : , ` ,`@`"`@|J 2`` :`,L 䀢 :@6 > ,`@%> g  @N `$`@  %s%s %s 㿘@L`@}ڐL  2L@ 2L` F>>ܐ!@0!@Sifting table %s: 㿐N  %> ->L@ :`,@  , @`" @{Ԑ 2   : ,@L@ 䀢 :'', > $ @)>'>`" `@Q"@!`? 㿐>!X `  @; >     @  ` `  㿐> g?>   '"b   @@:` %"`` &㿐 !> g&@"@ "&@&%s+%#r [%s:%d]%#ln㿀>!\ .Д#>!`@ 쀢 >ݒ @!H``>@!P`@䀢  >!X@0>ݐ!h@㿘> gb@L㿘> gb@U㿘> !   㿘> ! €㿘> !   㿘> !  㿘> !` `@㿘> !   㿘> !vmmapbsyvm_map_lock: failed to get lockAfter %d instructions (%d loads, %d stores), Breakpoint at Watchpoint at Stopped at RUN AT LEAST 'trace' AND 'ps' AND INCLUDE OUTPUT WHEN REPORTING THIS PANIC! DO NOT EVEN BOTHER REPORTING THIS WITHOUT INCLUDING THAT INFORMATION! 㿐 ' > ΐ '> ΰ"` 4> !` >@ > > >L@  >>@ "`@ ؒ"``> "> "`_ ">>@ >@ >@!@"` vmmapbsyvm_map_lock: failed to get locklinestabstopsmaxwidthmaxoffradixUnknown variable 㿘 *>>>!ah  #> @ya  *> > #b@ #> @ya &   *>l# 㿐̐ @  㿐'D @D  㿘  &@ 㿘  @"@ No value ? 㿐x >$# >#j b > [ > ƒvmmapbsyvm_map_lock: failed to get lockAll watchpoints used. 㿘>a "> "aa>  >ߐ "a@! >"  No map. Already set. Too many watchpoints. 㿘 >>@"H0,! @ޒ "   2  > 2  >@p"h0 @m"X0 @$ $$ $ >$"!Not set. 㿘>! ! "  8   @ $@0   2>@>#XNo watchpoints set Map Address Size %s%p %8lx %lx * 㿘!>! >>@#0@ ! > (%>#>y @`H  @#  㿘h㿐  jYU㿘㿘>a  >! > "#>   8  a @  2 $ᨁ> 㿘>! $ > "  "   @: 8 8    @* 2` >"!? vmmapbsyvm_map_lock: failed to get lockUnknown size %#8n = %#8n Nothing written. 㿐N h  l  b> ">"   ?'> %> v >@J"% l  2&>g"&$P$vmmapbsyvm_map_lock: failed to get lock㿐`b ?`\>!*` €>#> #>#>#@=!>"l'@ 2 / "l> #`$ $"l! !>"p'@    "p> #` $"p  -\vmmapbsyvm_map_lock: failed to get lock@#@#` () 㿘>J!`!>! А  *`: ?Ѐ4 L@: @ L 2 L !   ` 8L ` *: @: J - -L@ L  >@_"HL   a`_2 @ L   >@K"P Score: %lu/%lu 㿐N s > N`/`94> > " >  "`;> ->3> /> ` o`  >  #>  -*  ***` ` %|`x , `2  E @,T`@zN* >"@b('̔ $2 - @,<@z6' J :%@J  ??   ``8J@ %@J 2  % > a "a`|@ `    :|+`: N -2| J   *`:  ` `: "J 2JJ   > x8?"@. "x |8 _. & || >  x`9 |%> ΀ #>%!> ` !J  >  `  `8 *: *? :`? +@ J   |`!!c@3$! |'! `?   @*@`  `*``  @*@`  @ `*`*@`  @ `*`*@`  ` @*@*``㿘㿘ܔ@ * @*`*@@ * @*@*`  `(`  @(`vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapcdlinemicheadphonesspeakeraudio`? audio: missing method audio: could not allocate play buffer audio: could not allocate record buffer recordmonitorsourceoutputmaster`>@["?> ;> 7> 3> />$ 2(` '>( 2,d >, >0 >8 >@ >D  >H >\ `>@"&`4&`8&`4&`0 @ @ >&`4@ #0`h @@  @2>&`4@#80>DD&` &`  &` ?&` ?&a &aD&a &a  &a &a &a .`@&a@ @@@&a0&a8.a<&a@&at&a|.a&a&a'  >ch@t ̀ "  >cp@t̀ "Ȑ 'H€ >>"b$'/>->+>)>"!>〢 a0#\x@h#\atc@#䀢 Ȑ@sҒ#p &aȐ 'H€ ``""!  - auddetaudiodetach: %s didn't detach 㿘 &!@ d@ `H /d * % !? &!>!X>*`" *! @ >#@3 H 0@_ @\ h># @ 6 >"D>b  "D `@ , 2` @Al   @Ag   @Ab   @A\  h' @sD  Ȑ ' 4 H€ 0 ̰?㿘\@s) &`@s! ~ ?  &@@ 6 ( @**@``$, @@s 2(`@ * %`*`$ ``4*" &``  &`(`@ *@`2( =.` ; &@@ 5( @**@``$, @@rǐ 2(`@ * %`*`$ p``4*" &``  &`(`@ *@`2(audio_attach_mi: NULL 㿈  >''|'@C >@8#ذ oplmpuaudioprint: unknown type %d%s at %s㿘` ">  "> >">> " @ H@ P>@ p 㿘 0 4" l   T &@ h` @ &`  L    &`   @p5 &` `   㿘 4 P  0` 0` @r 㿘?2  @>t @ t+`@ "- ! " 4'  2!"  `$!`  ``2  @@!? $!@!㿘     0    0 @@ 㿘?2  @>bt   bt*@ 2!&  "!!   `$!`  ``   !@ !? $!@!㿘?2  @>bt   bt*@ 2!&  "!!   `$!`  ``   !@ !? $!@O!㿘?2  @>t @ t+`@ 2!'  "!"  `$!`  ``2  @o@!? $!@!㿘?2  @>bt   bt*@ 2!"  "!   `$!`  ``@g !? $!@ڐ!㿘?2  @>bt    bt*@ "#?! "!?  `$!` ?``@|?!? $!@!㿘 `$ @j @j  ? & & B&  . ;@& & & & (& 0. 8. 9. :㿘 4ِ h  =   t x 0" Ő &  "  = "     0"  `` ("`Ȅ8"``""``"```  "`audio_open: 0 precision  r `< n `4€`0 f&`X&``&`d.`&`.`.`&a &a(&a, `<  .`< `<` .`<2a>DD&a&a &a &a&a&aD&`&`&` &`&a&aa >` p>@}!&   @ja'a 'a'a'`'`'p`'|`'t'x&`l&`@  "  `4 @`0&a,.`<.`=㿘H /d4 4* % 4 4  !, " 0 =  0€ H 0㿘H /d * %   4&!$`4 0€ H 0audio_drain: copying in progress!?! aud_dr㿘M ߀   4 l 2.L`9`` `@p$`" @#`:` H /d * % `$`$`@lH 0 >L`9 >@ǐ ,`9`0 H /d* %" > d+>!X`*`" * >"ؐ % d! @ !`% d `0 >H 0㿘> "t. @ 4H /d * % ` 쀢 " !,  40,@". 0@ 0.  `&  퀢 " N ܀ 2 4U 2  4 `" 4@ 0 4 ,@ 0.  @ 02 <` ` < = `. <. =`2 <`2 &!, < = `. <. =&!,& XH 0 aud_hraud_rd㿘>"t . @hM ;  , v = s` H /d * % $"@  #>6`x`>"ؐ $` !  @X `$`  )$"@ 倎H 0`*@K$@$$`  0H 0 #H 00H 0 #H 00H 00}` z xH /d * %   (!>ꀎ 쀢  @ Ҕ `>"ؐ $` !  @ݘ `$`    ݪ  - 9H 0  ""@@& `*0@  @@ %@ H /d * % % % - 9H 0`  㿘H /d4 * % 쀢   `  `@r & ` 4 0@ 0.  퀢  d  d@b & d 4 ,@ 0. H 0㿘  4`!   h>"?@@p|#?` ?``?2 ` ?€ 0$   >(  U        ` *@`0`*@`4*@ `````((````````x!  `  @ 8  8@6&@`  aud_wraudio_write: cc == 0, swcode=%p, factor=%d 㿘>"t . @L;  `    $ ,  =` `&`@ B >``23`(`. 8 ` <`B#&`>`("$(``2`Ͱ H 0Ű #H 00>@#,9 `  H /d * % $  !>뀎Ӕ#d>"ؐ $d !  @I `$d  $  ,9H 0$"@  " @f@f@&`* @~q` $@0>u : H /d * % $$L:`$ @eܐ% @eא%  @l% "@ ,:,9 퀢  L8 @`H 0 `  R㿘>"t . @  4@ )!@ " @ "V !@ 0@"  !@ " 8!"!@"!, @"`\  b}@"+ !@"`8!@ "!@ 00!@"b~@ٰ 0!@0"!@ 0΀ "$ X X "$ Xư  H /d * %  " =H 00  퀢  ` @O  =   쀢 `@H 00&&H /d * %  &   l@n," & t  |$ "@ &H 00dH /d * %    "   @@ :  &   @n" & $ &H 00=<&@7@2E -``)@ 0% <&` € 0&`\@ 0  `<  0€ " $!,02 0@ 0&㿘> "t. @H /d`* %` `" =0, = "$@0 @ H 0 @L0 Ā@ H 0  @@H 0 㿘>"t . @ 4\@ 0 "3?X  @  )?L ; 2  0 , ;   H /d4 * % 퀢  @3H 0X 0 㿐 4`d !#\`d> 0# t x l >`( 0 t@ l 2 .  㿐N ߀ 2  4  @6 4  ``  #\``> 0     >`$ 0 @ 2 .  㿘 <  4  @ &   $  $ !@c (L ;@$ ( ` > $  0@0 "$ L 9 "  x, : @j-$@$!@ccL 8 " 0 4 $ 4 $ 0!(@ &!( 耢 " @    " @   @ ( "@ * &     & &   @@ :  $  $@ +$  耢 ! @ @  #@@@  @  ( `@" * &  ֔  `& &  Δ ` 2 = $> 0 @ " =g = "!,L 8 2!,   4!, d  d@ِ & d@ @ X "!,@wΒ !,  `  @Ɛ ` L@& ` X @w 㿘 < h ^ 4 @<    $  $  (L ; `$ (`d H> `( @ 00? L 8 ` $  4"   @ $ 4 $ &`dL 9 2 `d 0"   @ $ 0$ $ `d 2 ` `(>  0@ " ` `  `@b & `@B L X @wW ``   "`2 ``+  "`` 2` "`` 2` "``><(``"`  `   㿘  &`&`.` .`  4 @€ 0 2  :  &`.`  4@ 0 㿀    :Q &  :  @:I" & : @2` `2'g [ ,'`4 '`D`0€ R` H`$`4  耢@2  ?' ΀ 03 / `4 '`D`0€ (` 耦 `$`4 "`? 'k "` "` @K㿘 &` 4 D€ 0  ` &` &&` 4D 0 ` && p@ '؀'`z ''іr` /' 4 '`D 0€ b`  \'`$`4  耢@2` ?'؀ Hؠ A 4 '`D 0€ 5`  '䀤@ ''" , `$ 耊 `4 'zЀ ܢ`Ж  ''` , ` @`'@`'؀  &.*`&@`*. @`& @"@.㿀` 2@J @F ` '> '  `$`0 2`@ 4'@ 0"` '䀢`' `$ @@`'耦" 4耢 2 4  @€ 0 @>㿀@"/ ` '    4' D€ 0   ` ```"@`0 ``@`H`4`8 g ` ` '` '`'a'a'a'a 'a'a'a'a@'' `쀢? `' `8?"` 'Ȧ ` ?" '  ?"`'̦`?"' ?"`'Ц`?"' ?'Ԧ qȰ  jఒ    ` 0  ''ܠ   ` $  '' `?`2``   ,`= ,`= `=` a,  `,`=\\@`0 2 `=  ?''' '2 `=?'''' `= `0@Ȱ Ȁ  ''' ' ''''$a$a $a$a$a$a$`$`$`$`$a$a``l " `Ғ ϒ `? `2``oat b ? `2`a0 S `?at`  B?a0 1`3 at`3   3 a0 3ِ `p?"`0a `4`s '''/D€`0 `0 ` "' 0,``0 2" 0 `퀢 2 0 `= " 0H /d * % H 0  0 ` "'`t,` 0 2"`t `쀢 2`t `= "`tH /d * % oH 0 `t?`2`tʐ`t      ,`€`0$`$`l,``?" `=   `= "q``@`0 p`"C`xH /d * %  )``l" `= `=   `퀢  (  `=    `쀢 H 0 .`x? ` 8 ( `6C $``|  `?8`66 $``x?2``|?  ```Đ" 4$`İ 㿀4 `8v 0&@&`8&`$&`$&`  B$ t$=&`@`k$&``HE`@`3"&`p4  '''D€0 2&`p&`p &`$̐" &`("@$( &`,$, .`0 ,0Ԁ@ .`1@ ,1,2.`2 <2  .`6 < `,6 .`7 ,7&` h$ &`t@]3&`x@]/&`| =&` 㿘 \  \2  &@b 0 2㿘 \   @r  2 㿘>"t . @֒ 㿘>"t . @0!@ + 4 ! !@ "}@  06@"0!@ 0.    @`Ԕ  \" "$ \ `8&@`H`D€ 0`@€ 0  `` @ 0 vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapccdattach: count <= 0WARNING: no memory for concatenated disks 㿘 4. >@ (* *`  @`{#> g$c @`u c%> h`$ 2>>@  @c "@bE   @b? 0"" @]В@]͒ccd%d0> g*` * 㨐 * $ >$ $ aH@  0  * * @`4    $    a     @$@]"$0`  `@` ` 2$` @@J { $``h @KV n `  2 `  (* @@a˒  @aȒ  O ` @e& W:$`$` ` $ @ `   `  &!: @&`   % `"`   " ` @a  @a I  "1 *`  * @@:$` `* @ *` @ *$`  2 ` @ak  @ah 0"` @ad  @aa  3$ @" (' ''  @d('    $ $ $㿘   *  @_[@\&           @_H $ $ $$   "@``  @ a$     * @_/ $  *`  *  @ " @:  *"<$ @[ $ $   *`  *   @ " *` *  *  *   ,`: " ` *`  * *$3X$ @d㿘? 2  @>"4` B * *  > gc* @ 5 `   `* `@z`  "  @6 ,` ` " "  $ $    $ @ܐ㿘?2  >"6  **  *  > gc* @ " "      **@$  **@$    @ @$ 㿘 D? @2  `@3 * * > gc * `2  < 0  <(& 4& @& 00% # `  `@.  <& @H /d * % @ H 00@p㿐> h* * @` 8@ `D ``T *`@`@    @]*  @[c*``H` > "而 "`< `<0#\@L)`0`\`t "`t@J `"$ 0@2 $  \t`"t@J $<` @զ  @%,`"  0\`t "`t@J  `@ ,`@_r ccdbuffer㿐`\ ` `  @      Q& @`/`@Yd`` "$ $@ *@`  3  :`@`  * 2`@ @Y::`2`@ :` *` *  @_ * @@Y&@1- @*`  2$"* & - @   @]  @Z~ > "  2 @\ $ - @" $$`0> @a&0&X`,@&,&T&D&<&\&x&|@&&&H'> #>)>@`<  $ Hb $bࠔ X @zј  H $ '` ; 0@6  @\ @Z' > b  2 @\ $ @.   $$ D$ \$ x`% *` *  *  *  : '`$ <'$<!> " H * @@  8*@&8* "*` " $㿘`0("`<`<&`@`< 8`@@9" @ (mirror)%s: error %d on component %d%s ccdiodone: count㿘 > g- *  |㨑*   ` !H0($0 4`" >$4!X>4!` @`0 (   @ /> 3>> " ,` ` H @5*    @  ࠔ@& Hb @{&b  @] <@] @@(">@!  $@- * #* @eH 0㿘? 2`  >2  * > g*  * @` >>\!X"h @`I 㿘? 2`  >2  * > g*  * @` >>\!X"h @`%  p? 2  @>"4  - * > gc* @XԒ  "@"`  m@"`e e@7 0  h@: 0 e`f@ `g@=0"@ ` | y @g t>   b ''`'a:` @] 耊`"`'  @[*   @[ * +=* I#  @w " @8 .` ` @C@& +`` ''' " @ .` ` @Cp@& > g* * @@X4 Ȑ@\ @\ @0> h"*` , &!>  ` `&耊  `0>c#\ܔ @$ $ `0$``@ې`8@[@԰ ϰ @ ʐ  `*@  ` " `` "`@Ɛ  %> h`8 `  @C `  @\> `*`` @ "``.@` @\- `.`2``@\$ `@\! `,  ?@$``@\  @\ @," @H/ /@u@W ȑH 0^ ` I`,!U ` @ `&`*`` H&` 4C @1 >`$`` @`İ 2`@2`- ?`5# @ `* * >`aX@`İ` @&$` " 0` 2  `$` $`  㿘!>    ? @2  `@ `2`*` * > g *  `2 ?+  `?`  ?  @'''''ܐ @AJ 8 D   @F`@@B ) `@@DWP   @E`@@A 0P @E &   @E`@@A  ccdfictitious㿘? 2 @4`,`* > gc* !@V@V"  $ < $ ($ ,$ 0 -$ 4$ 8>a @V  4 >a @V . 4 H4 J$ X$   !W $ 4 $ , $@j,`?`6  @  .  `4 * >aX@ @default label㿘  * > c @Uݔ ccdlck㿘  1> @$ !#` @vȘ "    @   $ 㿘  `@&  ?& @xvmmapbsyvm_map_lock: failed to get lockMSG_INMSG_OUTUNSPEC2UNSPEC1STATUSCOMMANDDATA_INDATA_OUT㿘 \ @  *@E b? -p  h ` ? 2: \ 2  3  X* \  * \`* h> @ "?,  \-E  h @ 렄? \ `*   $ \ h `@> \ `*@&㿘 \ D ` b? -  h ` ? 29& 2  2  X .   \`* h> @ "?,  \,  h @ 렄? \ `*   $& h `@>&㿘'>  Ȣ $@~ᴤ8 8 $L,`  ` "? `,` d  6 :&%L& * \ *@ `* h*@ t h *@ `@㿘 \ *@,! \ * `a*@ d"* t @,㿘    `@@   @9  @ߐ㿘 `" @   & %P 2   \  ``*,V%P &%P@ `@ncr5380_cmd_timeout: no scsi_xfer %s: cmd timeout, targ=%d, lun=%d 㿘H /d4* %  >@Ɛ!h0  ` >   @! `&  2   $L * *`@"  @rH 0ncr5380: scsi data uio requested%s: polled request aborting %d/%d ncr5380_scsi_cmd: polled request, abort failedncr5380_scsi_cmd: poll didn't finish㿘   ` `d>@"H /d * % `  >  "@O >  >@ΐ"  Ȗ    ``8`8, $ `4`#   ?# #   #  $# # #  Đ $ 2$$H @    >@# H 0ncr5380_done: state=idlencr5380_done: current=0ncr5380_done: dma free did notncr5380_done: sense asked for sense %s: target %d, bad status=%d ncr5380_done: bad state㿘 2 >@W! 2 >@Q!  @ " >@D!8 ,  $,, 25    `%` `>!   # !$,   >@!X$,$ & &  $L *`*  '"  $,>  !@ $, 2& >@! $L *`* @" @}8 $ Đ& `@ػ$& ncr5380_sched: not idlencr5380_sched: current set%s: reselected while polling (abort) %s: select found SCSI bus busy, resetting... %s: ptr but no data in/out flags? 㿘  ` @ " >@# "$H>@#&$H$ *" *  О @ Ȅ$L@ " ?- ,@ `Ȗ 8`8 К  2@    `@0& @Ò -   z> @# %P` & p&%P, $L"&    &  `& &%L&%P&%T&%X``0  >#@ {$, &%L& & &%P&%T&%X   $  & <&%P 9b !3&%P@2  > @ &  "  "    @& € "   `" @   >!X)K@PΒ# @{ @ "B ncr5380_reselect: current set%s: reselect, BSY stuck, bus=0x%x %s: selected as target, data=0x%x %s: bad reselect, data=0x%x %s: reselect, SEL stuck, bus=0x%x %s: reselect, no REQ %s: reselect, phase=%d %s: reselect, not identify, msg=%d %s: phantom reselect: target=%d, LUN=%d 㿐 " h>@# >" @`>)]  h ΀ @2)T  X  2 >#Ȗ     *@" ># @ٔ 01  \ *@"+>)*  h "  \`> @  \* h*@ t h @ b? )   h ` Ԕ? > 8@ U 2  >  P d* X @ /> h @ > *, $L0> &  &  &  & @&%L&%P&%T&%X `*  ` $*@   `@  0*#@T 0# @M    \ & *@(   v &%L&%P@2 d *@ h* t h @* ?& 㿘`  `d*`\*@``*H /f * ' `X *@`` *`\ $`\(d `\? @ @ (\ `\ @ 2 `\ *@(S `\ ` "``*``*@H 0ҐT *`h*@H 0` `X* *`\*@(- `\ * ('`h @'a?( `h `@?  `\*@( `h `@2`\`d *@`\ *`` *@`h*`t`h @*0`\ *` ```` $*@ %s: unrecognized MESSAGE EXTENDED; sending REJECT %s: unrecognized MESSAGE; sending REJECT 㿘   d * \%L @ %p:" ?& %h&%p  h @> ` "? '  h `  ?   2   2 l ` " %P 2   \  ``*'%P  `&%P&  2A \`$ X%P 2   \  ``*'o%P  `&%P*& > ` `%p*  &%p%h (: ``27 ``%h ` .`$  \%h %i @$ ` \* h> @ "? '1  h @ Ơ? 2 \ *@g `` 9> ,*` €]%P  %X \  ``*'%P \5%X "9 H \` ` B %  =%  &  8& %j   >"@ %P>#@ %P 2 %P \  ``*&%P \ &%P  `4( %P ` &  \  ``*&%P &%P \* h> @ "? &  h @ ܠ? 2 \ *@ݤ0x8%s: SEND_IDENTIFY while not connected; sending NOOP %s: unexpected MESSAGE OUT; sending NOOP %s: weird MESSAGE OUT; sending NOOP 㿘 d   * \  *%L` %d%\@z"%P%T &%P&%T%P%T  *  &%P&%T` 2&%X>#ȓ*` € 2 >( X :     2  .%\       .%\ > @  .%\ > @  %]K&%d `@N>"&  h `  ? 2> \ 2   28 \2 %d%P 2 %d \ *@% %d&%d > X *@ \*"%ѐ  h ` ?  2 \ *@ `4 h%P o` \ *@`"$DDDDDDDDDDDDDDDDDDDDDDDDDD㿐   d*` /  *`// ///     @` $ , %P`  &  \  ``*%Z%P &%P %s: sense phase error %s: aborting, but phase=%s (reset) %s: data phase error %s: too much data padding 㿘 ` @`><!8 d*@4  j   `>b* @ >!P@ 0[2   @>!x 4` ` ٖ  hy  h @2  ; >!@ $ "  d & d @) `*  x  |    @ " $ $ %P ` $  \  ``*$%P  $%Pncr5380_status: none? 㿐 d  *@   >& @C# ncr5380_machine: state=idlencr5380_machine: no current cmdncr5380_machine: unexpected disconnect. %s: no REQ while aborting, reset %s: no REQ for next phase, abort ncr5380_machine: Unexpected phase 0x%x %s: parity error! %s: reset SCSI bus for TID=%d LUN=%d %s: %d extra bytes from %d:%d %s: Target %d LUN %d stuck busy, resetting... 㿘 2 >@c 2>@] 0 m  h @ @>@ː P % ,X` @>` "'>?  C -$ d h ` ? h @2   >!,  €ɒ/m+F'#> @ %P`  &  \  ``*#%P &%P> @t `&%L`") l   @ "   &  @ t `" l%P    \  ``*#%P &%P l ` > @@ %P`2 %P \  ``*#%P &%P`^`` >`& !@# ```  `>!8 @ &  8% (`4> h `b@#_  h `@" \? >!X@  \ * ` *@ d`* h* t h @*  &%L&%X& & & & &%P&%Tvmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map㿐'P@SS" "@K P !P@  !P@b"P!P@"P 'P bWARNING: no memory for vnode disks 㿘 . * "* "*  @M֔  >@p"0@KD> >"!"b㿘>" `2` ] * * " * > " a* @ِ N d 2 d$ @M   `` *  4`2  `   02`   *@$  $"  `*@ `"     $  $    @ @$ 0@vnd devicefictitious㿘`!@J̐`@Jɒ"  d"$ ($ 0$ ,`@R d$ 4> a $ 8@JO  4 >  a @JH `Đ. (4 H2`  $ <4 J$ X!$ $   aW4 $ $, @z6   p4 * > `c@P 㿘>" 2` *,  * " * > " a* @) " "      **@$  **@$    @ @&$ ` D> 2`*` * " * " ᄑ* >  ` 0 (& 0& 4 < T`& @ 0 (& 0 & 4     @캖  2 D@05 D  (%H /d * %  & $!$ `$!H 0 00"4("0 @%"@& @@ 0 Ф  D * `@ H' <'''' T * : ?'' Ȓ`@6 h$  0 '  @7y & 4!P " H < : T !P  H < / T' Ȓ @7r & 4!P  H <  T  $  @8є 4` 0(& 0@& @! H /d4 * %  ! $?$ $!H p@  D * `@ Ȫ@ X L-`  0 @ @ ~ H 'Ĕ@6`@G Ȓ ̖@8Ħ Ȓ @8Ȁ?" @N %Ē I *  @Kɔ ̖"0"< 8"4"8`<? ?` "D"Dȑ< @"H"T ,> ̐ ","X"\ "h "l `"` d"d p"p t"t"x"|"@H /d * %  @x ! Ѐ@`$!@H 0@㿘  0 $@z,&  0@ \`t "`t@8㿘 |>  D `2`*` * " * " ᄑ* H /d4 4* % 4    0h$ 0@n$ 4 < @ " @M$ @ @ < "@@a  `0@z` "a0?$aH 0㿘>" 2`@ *` * " * > " * @` > >\#"h @O 㿘>" 2`@ *` * " * > " * @` > >\#"h @O  vnd%d  2`@T’!2 R>" 6N ,* "* > " b* @   m@"+e e@ܰ 02  h@߰ 0, e`f@ %`g@0"@! ` @  @  @'x'P't'T'|P @2Q " @0@5k`  `@7  @`&  @7`$+ 3`  $ @ 2  & @JR     `@2@0Œ  @J< H$P@  @G@L $P@Ģ* &`$@G > c0@>bĠ0$@x^$X@@T   @0   *@     @9z @P @Gc P@Kʒ @x0H/ /@"@GS!XH 0Z $S!Q $J &*`` D&$>? @ސ :$ @S 2@2? 2  @?`4 # @ `* * > c@x ~@$02  " =$  p>  @S$ ̐" @Io  ą* 'Є" Ȗ   ?''''''`@3{ ̒ @4q  Ȓ @5@K, > `8  "  Ѐ " Ё㿘>"*` * " > * " *   @!X* @*`"@*`"@a*` * vndioctl: null vp㿘>    Ȑ ?`& > @*"H ̐ @1 @S & & & ́ 2 * > (ᄄ (> (@`2`Đ? vndlck㿘 1>  @$ !#  @fؘ "    @   $ 㿘 `@& ?& @hvmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map㾘> ad T "ad@?>  2`8 @~Ho o>  ` a?  *a a` `,a @ @K8  a  ,a @ a,@ a,@ > ( @ <CB8 ( 8(H 0>!X*` *> "@  @o_*`>  d㿘>  !> !` +!#!  !+!  + ! +B; 㿘%> >  ! !`*!"! `  ! `@ *! `  * ! * !` ! `*!"! ` D ! `@ *! ` (* ! * ! ! ` `*!"! +` !@ `*!  * ! * ! < ! `*!"! ` +` !@*! `  * ! * 㿘> jb 1 !>  > h>"c@n> >  @na>   @ @" $  $`> !"@E"> "h@E $>    *?I  $? 0     ;n vAMaX ֣d° x㿐> j"`Ā > . "@ . @`  􀢠Q@` `" #@ `& & 4 4 :?  ; ?#`: `: `:`:2`>>bȆ ̐" :    0 ` > x`B i:x$`$`$@2 >> Ho o> "h:<̀  Ȁ > > ! pB: pH p@0;" " "" ! ` `(`B ; ` @Ȓ`B  8̛. !!   8@B 8B :  >  `  > h" @mɐ"H 0㿐> h@n"> h`B :hHo o-> )>i/>' 'H 0 %> >     " 2 c* $ , 1 #* @g * @ * #@ +  #@ * @@ (@@ @ @ @ * @3@  @ ʈ  @B =  & &   `   & @f9 Ho o"Ȁ>   "h@ <%"%"̀2 &H p@ 0>   2," % %,`~>+> `  @Cѐ@Cܒ @D /@  @///   ////  `" 2 c* %` - 1 #* @g * @ * #@ +  #@ * @@ (@@ @ @ @ * 3@ &@ ʈ $ } $ @B X@B > @B :rndrd`    @8Ho o? 2 `b>#4*` €\ > `  S #> ሄ X> ``C :X> $В!  @c; =  2`@8> `B :?# 0*`,`:`#?#?c ,`,  $ 0?# ,  0 H 0   ?#@YI ` vE\EdFF(F`` 0> @  ? @ `2  2`y  t ?# @8*`2  @Y  Z?` , *`2 `*0` , 2 ???%> >   " @2 c* $ ) 1 #* @g * @ * #@ +  #@ * @@ (@@ @ @ @ * 3@ ?$@ ?ʂ` ?` ? @2   > "!d㿘 Ȓ@"@% "@ "d 8""@"H  @"v   "@"   b~@b}@ @Ho o>  &H 0o!2@M 2h Ho o> ``  "`"`H 0Q!2@M 2J H > "`H 0;!2@M 24 >  `?- #H > "adH 0!2@M  Ho o> !@A"H 0 @ vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map   `  ``\ ("  `X8 @ "8 "" vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe maph  @ ''?'  ' '"  @.   X <`"?  А@ \  @T@/  @/ @+ 27܀  @- @܀     @/r `T @܀`   @/] @,ڔ "!T' 'M =`?'؀ Ԭ'̀   (`"$ , X@@$ ,  ' $ , :`   @_ Z> b` ' "` X' ,  " ,@ , :   @< 7 H ` , *s ` w  q `  !@k7!T "@ ` `ؓ2` ``?@UԀ M ."!`򀢠6 M`! @pM`! m; ,@`!  ` @)`T*  ,$'2/$ 0! , @T* $ 0 0@f2  @E] V  ,$ , , l&$ 0 ,耢 B :@:@ @M;`   @  `H$$ , ( ?7$ , "@-@@ ̀  r p?@$ 0䀢` > b` "` ̀ ,$ ("( 0@ @. 0@X@ @  `@+0?܀ / ,@+  '@20/   @@@ "X@ @ _@ ܀  @-ג "@@@ 㿐  `@G `?@ @ '` H @ & 'vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map㿘>ap> g 9 @V|> > g"b"ȁ 㿘>  '> g%> 6` | *  " @ @2 2  `@  6` 0 2  㿘 > g 2 |> @ * > ` 2  @2 22"&& # 4 @7    2   " "cd9660_inactive: pushing active㿘 > `X    D > @ $ @- x`@]  cd9660_reclaim: pushing active㿘 >`X    D >!8@Ò@8 " @ $  @B :&  㿐  '  6`x6``@     `. :   􀦠< H 26  @`x!6`x @2 `x @6`x  2 `x 6`x  2 `x 6`x  2 `x 6`x  @2 `x 6`x  * @&`|  * @&` `x&`!m6`x&`| @K㿐'􀦠 `  `  *@ :   􀦠'`H ` 2! ```=@ ` @@`p ````d&`p&`t`@`h ``p`t&`h&`l` `p@ `p`t&`h&`l&``&`d @㿘 gl '    &`&@H đ*` * " * " `  @;R* @, : $ @;H d@;D? * @,`,`* :`* $ @;5"?, * * "@*`@*`" 0*  d ,:`*`" *  * $&@&`   * ( ?А㿐 ?/  /  /  / ޒ / ڒ  //}   (  *  * `(vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map   (@2 x   *  ( @* | ` *  ` `(@*   *@ 2`"`RRIP without PX field? 㿘>@+ @@Y ..RRIP with incorrect flags?㿘  `(@`$F`0`2 `,6  /,@ ` >  ` ! >"D*` €  $@ `$@  `@B> > j  a  >@ސ `,``,*   @`(&`$2&`0   0`( &`0&` `$" &`$2`  ?&`aaa,aa4aaaa<aaaaaaaaHaaaaaaaaaaaaaaaalRRIP with incorrect NM flags? 㿘N > `  > *` €  > > j  a   ?>@m"`,``(@2*``,2`@  ` `(&``$""@&`$2`$`$&`$ `  ?&`cDc@ccTc$cTcTcTcTcTcTcTcTcTcTcTcTcTcTcTcTcTcTcTcTcTcTcTcTcTcTcTc,㿐> `$* * *N !   !`a`  #\ `$ `@`(0`( `( 2@   (  *` *`  ( "`"`JC   `( x0"`㿘  (  2 "@@ƒ`h  @: h  @`` @ h l" `" d  -@`p.` 2  "@@`h  @: h  @`` @ h l" `" d  @`p`@ h l" p" t` ?&` 㿘@! 㿘   ( ``. `.` (. (? 07 ? 0?@ . @(@@ ` ` 㿘 `? @`@&`![㿘 . (. &`` / ``..> >`  .  (.&`$IEEE_1282IEEE_P1282RRIP_1991A㿘  2-    2% ` 2  >`А @?Ɣ 2   2` >`@?  >`@?  `" =&`㿐 `!`' `!a`@ `2`  *` * + `  L "\`!X  ?#  ` )&` `  "`L@L@2 L`L @2 €` 2  ` (`@`: `` ,`) ``! :` B8 2  + ?@  H`` @ @.  2  €   2 ` '>''ܔ\X6  !` x`!7'' '''ܐ !@b>#@` Ĵ ?'Đ8`$  7>'6'''Ĕ'& SP`>!@ "&a\@>     1&a\@>  2?"'>'ܐ"? vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map *    ? * 㿐Lf ;) ;Z  А S, * @ ?Ѐ –.`@*`@ <$    ? ,"@ *"@  " . ; 0`;   ??? 㿐`\    =. `.c  ;` .F6vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapcd9660_mountroot: can't setup bdevvp'scd9660root_device >  >c> @a̰  >> b<#> @ߒ`P >@}Ր!007>>!Xa`@ /`P'@   ?"@@; 0> " "Ȁ@  #a "@a"` D@@ْ    , p  <`@| @   @ Po @&(&&$&&,@ d< "@/[ > `@& @%Q ``@#ې @@$! @0; @&K<@@2  @9  @ ! Y  Z`@6$@  z Y `@6$@ L o p@ D0@ԐCD001%/@%/C%/E㿈   '`< ''   b @  ]@ j >  P T `@  @ k I쀢   ?@# >  (2  (?@# > H`ؐ @<  2   " 4 :0 - ''&l 'X>`@`@`@<[  "   2  @_'􀤠c( @U'? * b> ?   9@8!d@6/!d$`P ` `+  P* `@ @ *@ $`a(  "  +  *   *` $aL ` `+  গ* `@ @ *@ $aP$` $a`?$`0`%0@ &a&`d` `< &`h&`<&`@$`$`$`  " l`2%l aL?`* ` @`` P H $aXl l ?&l`0 "`0@'l  $@` $aT $aTaT #`!a( - "  *  *` * $aL ` * `@ `* @*@ $a`$aP0 &0$ @    @ @   쀢   @"ʔ?`@9ؒ 9&a㿘@($`D   '>,($`<$`T$`0@="8$`@@@  I`H @;L  B > c$, 5? * b ,( (@4Ĕ  8 @4  " "   !W<  @&&&.6&&&&.&@e 6 `0 $`0@ 㿘6` @x a   ?# @"F @ @9S 9`<*@$`<$a㿘!!(!T `?@v -㿘! D @ &`&` &`&` &`&`&` `T < Z ` 8 Z!La 4 p&`4  㿐 `` & x` &@ & F㿘 @1 isoinodefhtovp: lbn exceed volume space %d fhtovp: crosses block boundary %d fhtovp: bread error %d fhtovp: directory crosses block boundary %d[off=%d/len=%d] 㿈! & > ! @  & :@6ΐ @4B >@ 4 @- "`$$$  @ "!2F'6@ @ F>"P@`!  @w F>"x@z80Ӓ , ?@뎘  @g@>"@z&0 H @ @@V " @ > "@z@  F$  @$ 6@$\@    3 @-0 H   * *   *` $T ` *` ` `* * $X @ $\"<T ' "' ` *@ :   'P쀢 " @p "x@x< @ >#2`  `&"<> #*` €> #"`8> !" 8@ > `$ "`" 8@7@$'TL@`@ "`@ &PPPPPP  2@ "`\"`㿘!@6`  `0`4&& vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map `@, `2- ` 2) `$2% `,2! `?2 `2 <`"  < >!@(    $,,$,,  㿘  x /| @ `   `$ `$ `x /4 `4 `|$ `$ ``$ $`d$ (`h$ ,`l$ 0`p$ 4`t$ 8`$ D`X :`< `X .  < 2*   @5$      $?'''''''''''@]耢 А$ < @6͒  $ <$ @`$ `X :< H <$ 㿀    1`  6 @U 0 $   @;c     @" 8 X @:b   2p `; k ;  > ( , > ,h'X* ) :`?#\#`@" X* ?'#\#`@鐚 ?@a$`@%@8 `H@H@  X : @   `0 "`0@ "u 㿘 0"z@"      @     㿘``*@ `  ? 6`#0@* &#@#D`#H 4"@&#@?#H`?&#D&#H @Hh#0 2>#8 㿘"" N" =`?  " !!? 2!@7S ""!  # ! 2%.!   # ". "   ?  6"#(!># "  #(>#" ..㿀#P`    @3' '쀢 ,!, ,",!, $#0 $#D  2 '* @3 $#D$#H $#@ <#(#,   S @5S 0 X#(  @  "#(@#(   3  H ` 8#(  @ @ 8 Co<#(` ϐ  ˬ `!@,"  I$"T* $"#(  B<#(!T >""" ``>,"#(7# `#," "` 4"L! 2 "," % "  L! 2!T ,"!T!`  !` #\`? `"V `,"!T`2#(#(" #(>`e #,8`#(  !T  ,"ǐ & ` @4  #H""@"@ "#8@,#8?  #@@4#㿐    !T " V ? ?2@*@  @  +   H   (`@ :  $@ @2l   ` @4> @ 0@`  `@" $` "@"  "@F@4 㿘  @ @ 㿘  @ @ 㿘   @)t 4㿘   4 @)i`cd9660_strategy: spec㿘` \<? >$@t'"P T P@2 T   T@ "  T 0h$ 0@O$ 40?2 T H@/\ <$ @ T?> ` $ D#8*` € 0@5 tag VT_ISOFS, isofs vnode 㿘>$@ud#X 㿘 `@( 4`>%8(`!T`     %` $` "`     ,, vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map㿘` `* @?2 "! @ "8! !0@! @ @@ɒ @`exec: a VTEXT vnode has writecount != 0㿘`&``&`` &`` `@&``&a``2`` `` H` @ d >%@sD!p@ "@``@*`@``>,* @` &`*`" ` $ `$ ` $ @` $ $ ``@*`@o``* @` &`*`" ` $ `$ ` $ @`` $ $ ``@*`@Q``>,* @` &`*`d" `  "`` """ @"㿘`&``&``c  2 * &`` `@&```&a`@*`@``>,* @` &`*`h" ` $ `$ ` $ @*`  $ $ ``@*`@``* @` &`*`" ` $ `$ ` $ @ ``  $ $ > ```@ * @ "@ ``@ >,@А``>,*` ``&`*d"  " " " " " @㿘`&``&`` &`` `@&```&a`@*`@``>,* @` &`*`h"  `` $ `$ ` $ @`>    $ $ b```` *  " "``@ >,@t``>,*` ``&`*d"  " " " " " "`` *  , &`@.vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapvmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map㿘@= 2!  $! @SF2  @2  2  2    2  ,  ӄF2,  @2%  >`d *@8 *  2  2    2   , * 㿘?"`  ? &   " &   @&"@@2   '@`'@  `'@>   'b`" 8 E@  @  @} >,* @  & *`"  $ `$ $ @$ @$ @ "B @* @\ >,*   & *h#  "@$ `$ $ @i$ @$  @* @: >,* @  & *`"  $ `$ $ @J$ @$ @@ @8 @  @ >,@ >,*`  `& *d"  $" " " " @" 'x   #`#\#d#h#l @$ 2`   D 'p'''''@s   < w `@@>䰒 o X <`i `@@! 2[`x  4 2Q`   w D  ,  @. 25`0 'l %'h !` plh  l@ p   @ "@&&pl 'p`@ՠ ` @@/ p@'exec: a VTEXT vnode has writecount != 0㻀`  ` 3'/   8 2 ``H " ,`@ ݰ >(@oː#` ,  @-` Ɛ?&`&`/, >  2,#` >  > p&a>? '`. 0  `"@`: " @` @   `{ . 0, 9 , ?'''䀢`)>)#p*` €``^ ``ߚ쀢 @  `&`耢? &`&`&`&`&`, ̑, ? O> b`@*@ 'O   @,$  @, $&a &a$$ *$ ,$ $$ &a&a &a@. `@@'"@@. @r` TTTPPPa a$'V aR  @. @. @O`0C` ` `@`€@`@   "`@8 & ' '' > " ''  ''''  ''''a''' @@.J @.G    㿘,,   @,U`Җ 6 ,* *  2"   *  @,9 `   `@2 ` @/` `0* `@- @- vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map#!exec_script_makecmds: epp already has a fdexec_script: copyinstr couldn't fail/dev/fd/%d㿐a`? )?` %>*b@2  2 `  @ 8  @ L  2` , @ J@ 2`*@@ *L     J@ "` "` L %  J@     2`J@ "`*@`J@ "` "`J@ " ` `J@ *@`` , ` `!@R`  "`a ">*@m"@ a |a  &a2` >!"`"(2`` "` ?"a  &a@+D   ?@+? @2j$@ ` ? @+4$`@2^`$ ?@++ $a  >* @$   >*@mB"a c@n $`&` `  4@@$ 2"`a  &a@@ @,ْ a&a ` &ah@2`" d. `+" " 4a   &a ?&aa@  `@@z ` 4@,@  `@, ?  @, ?@cvmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapvmcmdset_extend: not necessarydiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../kern/exec_subr.cocnt > 0㿘 `>+@l# ,`>,>,>, `(p@l `,`& ? @*l*  \,   @ @,@ ?& 㿘  :    " @   `  & @," ? && 㿐`+> "`@ 2' ` 2#  "`  @ϩ  2` A`c  ` #\` @u  `€ 0 㿀` -> "` #* &` #\ *  ` ?@T? 2&  #`#\@ ` #d`` ` #h@#l 2`2`   ` @  8  @ @ 㿐`> b`A`#*&```   * #\` ?@?  㿘<>&`&` > b4` `* &a``>,* ` &`*d"@ `@ a`" " "``"`"`"` "```*``` * ` &`*"@ a@ "`a`" "`"`"` "` vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map swappercannot mount rootcannot find root vnodefork initpagedaemonfork pagedaemonreaperfork reaperflusherfork flusherupdatefork updatecryptocrypto thread㿈@+!> > "h@Qj"`@c1>@l >-@l!@@E@W@N@@>@O@|B@?.@/@Z@> `$``"` "$` > `$a>  "`" " > "`$`D$`@> !0  #!0>"bp  $`,$`>-,`1,a a !H >ub`p@O>|a4`@O>  $`@2" `> i"@`>!j> 3 `"`2`&2`$`8"  ``"`"`"`%->1> )> i9> +> 7> 5> ?  $`$` : : >!t`  @@< @4$!> "  8+@ 8  P< @  !> <`!$> i @a8> Ē  $`$a $` @. @I@m@u@@d@@y@̀    $ @  2 @H /f* '@x  @H 0@E"@5> !$`$@6>@=!>!l @6 !>-@j(!P< "<!  €"쀢 ">-@j!ha @$ " @@d$  `%`"``!``#`&"'!"`"ܚ$`$`   @ >-@i!@.k> ">/@&b>/>-#ܖᐒ @ ">0>-@iِ!>- ᰒ @~ ">0>-@i͐!>- Ȓ @r ">/>-@i!>-# @f ">0>-@i!>- 4 @Z >-@i"@@&@$@ > g@"#/sbin/init.bak/sbin/oinit/sbin/init/dev/consolewarning: /dev/console does not exist warning: /dev/console error %d P>/  @ '''''@d  `>/>/@jߐ!0@jܐ!(0@init: couldn't allocate argument spaceexec %s: error %d init: not found no inithː> " >" c'#\Ԗ ?@l?  >/@i/!> a"a؀7> F -/"Ȣ `  s/ِڦ  * "$@ @* $@  ?L ?F?B'''@ >/!@j[ 2 ->/@jS!>/@hؐ"㿘@k㿘> @`㿘> @`㿘@㿘@vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapP !2@0l J@  '''''ܐ@; ;@ <    @@ , > h!`#> b؀ "@> @M  "b @@ $b$@ >  ` $>1a`@M@@> h!  ` $ @3"$#?:  Ȕ@2* @7@7`'H /i* * > `ؒ`"'`" 'Вb@ ??H 0 @`7Д̒b?' '?/a ?>!X;>!\@!" 7``` @! 7`0 `,@5 7',  ' ` "? l?' 3 /@ڐ  #`#\#d#h#l  ( @< @2$㿘@*a . c   6  `  # (.` 6 `.` @.`6 Accounting resumed Accounting suspended #> b؀`%!> h`< 2 `X  ?@  F$b P >bL\@*p dd@/> hb>1"$bؒa0@gz '>!`*`< 2 `X  ?@  $! P >bH\@*I dd@>1!$b$!aH@gT >!X>sP@Lvmmapbsyvm_map_lock: failed to get lockweird hz㿘 > > " @{"`> #܀`!>!X>  ""@ > d> "bd>!\"d!X d> ! @"  ` <>10>10> $  >10 >10 "a>   "a "a>  "a@fĐ"㿐>  &!> @` !\` " `@J` 2`@5 ` !\`  > @J` > @5s > #܀`> @ː> `>  `> !\ `"'`'> h #@ Ġ > В@"?@"?/!@"਒`">>bt?b|   #bt :`+ #bt $ #:+ "#bt Р@"?'>R"h>> "l?/!X@ #"l'6'>3!`* €>"\   ($bX& $$bXTa@& >? $bX'T a@& > $bX ' $bX>"\`0"$bX>``>"\` >bd ;4> Ḕ ?*@ `$|"\` >bd ;4> !#@ + `$|$|> >"x  Ḕ " | : "@$| |"@;  $|> #>XḀ `|*@  $| d <|`6:` :  "@ @6: : "$|$"@J / >H 0!@K0 >  *`  ޒ 0 hʘ 㿘H >     # " H 0  А"@? - (c(c' >, "@*`" * * >\?@(R  !X1#@  #~>\@(?   #㿘 , (> # `& ,`!"#> #܀`H /m * . > "d> `> > "@zP"`ȑH 0㿘 , &> # ߒ& ,`"#> c܀  H /m * . ܖ > > "`@z%"ȑH 0㿘 @$> >   ,`  @jĔ > `Ȗ ? S"` L! `B < > c` 2"`> cА -"c`Ȗ ? ;"` > > ` >  ؒ`B < > c`  "`  >  В`B < Д "> c` "`>  Ā " d> jbȐ  $ d> `  "`@Ct㿘>"\`Z􀢀>@ "b`? >> "b` * ""`>b\ >" > >  #"b\"`"#"`%!>@`* "x"x : "@$"x:d!>l  >"d "x*`: " "d"x*`:  $"x>"h"x@4$"x @&$"x㿀>\>!X>> > '!`''c܀`'' @< vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapfileplfdescpl㿈 )!>#>#,cT#h> >4 Pc 0   #\#`@Yk#d '> >4#h;` Hc#\!   @Y^ 8 **6*  6 *  ? * "?fd_unused: fd_lastfile inconsistent㿐 @ @.`   @ @dup2: fdalloc㿐 ``@@.`@   ` 2* ` (& >!t @ 2`& @n 2">5@c%!@Œ@ax@ @, @`"D `` ?>7 *` € ``  2 ` .>!t ( @.ܰ #ܐ@+ @ &`  @  @ ?*@  ` *`:  *`?:` @&`ؒ 34`` %  ̒@`4` `'ؐ~ ` `@'`} 2`ܰ  4`'`~0T` 2``( `(& `w &T`  ` `("(`",@ "0   &`@& 2!  &``  `v` PT`  ``(a  W W䀒@耢 6 薠 ` ?` @ b ` @ B ?W "#   0c 0`` ",`$, ` ,`$,   @@ AT` ; `(`  3W W䀒@2` 耢 6 ` 薠 ` ?` @ b @ B ?W      @  @ `  $ל״  *`  ' (`" 8` +`* `#   @ +"@   2   3`* @ `+"@ @4! " 㿘.`"  @ >`&  *@ ?2   2*`   * *#  `  * *"  @>5@ag!(& 㿘 .` `2 ; @  ?*@" *@ @>`$  *@ ?2   2*`  * *#  `  * *"  @>5@a.!(2 ($  (@@א@:㿘 @`@ 8 @`*@@`2`    2 !2@( 2'` `㿘 @`@*@ 2R  " ( -`   "" @ y` -㿘 > at@ @ & : > @ !` >  "@, @ ?2 ?2,   2  2 *  ?, @?2,   , ?]8?O  ,   : "@,  ?2 ?2,   , ?88??,* 6$> +    +@@"  2 3 * +@@" 4$ $$ &v r  1 2*  8, ' @* $@h@_$ @’ ' :`: ` :`: @7,` ' @ѐ,` ' @ː :  : * ﶔ@@4$ :  : * 穀@'$@ :  :  $ $@ '@ '$$> b$$$  "b >t " "@`  +  " ?,  2?`쐂? file㿐 ɔ > l>at0  @;`&  *@?2   2*`  * *#   ` * *" @>5@_\!(>9 & >9@_G 8 ">  @V P@ 0 @`" > @ $@" "@ $ aa $a" "a$   `* "@$  $ @ "@&@& 㿘`"  "` "@@& > > & "ؐ P@X㿘 >  @Vf H@H!   @l$` $` @f>!j `8` ``?4`&4`$$@$`$`$`$`$`($` $` &0& 㿘 >  @V8 H 8  " @: " @4  `6 & 8 &&   `c*`@,`4`@: `c,` * @4`,` '@s & &`:  :   '  &  &  @`, & ,  '@[ & & ,`KG < < , @ , <  (?  @ "  R 2 ђ `@ ?& (& ,& 4& 0  @#`"  `   "`  `@ 㿘 &?* `B4&`  "$@> &   @В ' :  :  $ @Œ '@’ ' " @= ",@7, "4@ 4 "> @ >  H@Wnclosef: count < 0㿀 `" `, " T 2  (   ??77 @ @ ? $ ' 6 >:@]#/*  @2  (   ??77 @o    € 㿀 ``@@.`@@`2V` 5 2 -`(  ?7 ? 7`?А*@6`   7􀊠27 ` 6`   0   @ ? 0 "\ 㿘.`   . @   5 2{S  " s #@2" l  >` +`* ` #    +  "  @ ?2   3`* `+@"  @4K& J "  >` +`*`"@  * (   "  @ ?2   3`* `(@"  @4&  >&  *@ ?2   2*`  (*"   ( * "  >5@\ː!(2 &  㿘  `` `V` $`㿘`4 €`4R` (>"`8 "`"  4(  `2``"` 4 `("   㿘@   > '      2 ,!"  @$,!2 "   & 4 6 ?Ȓ*  0 & & 6  & $   ( 4  `2``"`㿀< ,@@    &    (  `  6 & (# 2  ,   ? .@  $ '77'''@   &  @ 㿐 g  2` 2 >""`  @ @/ && " (& ( &$ (&  㿈`@` *@@p T " j  $ `  Ŕ  Z&`` D( ' ' * `鰕* D $   o4 @D ` 14 $ ` 隔 `  ``?&` &``@ *` `* " @ &` &`   &``` @&sunknown filter: %d 㿘V`    `  `8  >"ԓ*` 2V`>=@\!  "2`0@`*@@2 հ  $ @`(:*`,@ "7` 2V`T @"-` "*` 2V`T @2`"`@2  `4* @ "` 2 2V`T @2`   J 2&`@ 2$ 4} $ $ 8`$ ,` $ 0@&`&` $ ` $ `$ ` $ `@}$ $@ 0+$ ,` $ 0`$ $Ho o 8    (  $ (@H 0` " ` 8@@3 "` ( H $ (H 0`  ( Ho o  $ (@H 0pkqreadP ('T * A#@'` ' ?C` @>   H /i * * >  А  ? @ ' '?/a  ?H 0` '' `    ؀H/` /``2"'6`  #>> $`!@5 H 0 Ӏ? # " `'`"@$`` @ ` "` $`   "@H 0@0 (` $ (`?n$`  2  8` € 2   ( ?$ (`[$`& & & &  $&   ( ?$ (`$`H 0 8@T@kHo o " $  ($ ?$ ($ `?$`` $ `"@$``H 0,, T Ho o `2t@`"` $`"H ` ,,*%'@   㿘 ( H /e`* &`     @p   $ H 0㿘 (@3 `   :6`>`0&`@ 㿘`  (! ( ,*@ @ @  8@ 4ݒ@$`2  (& , 0 !?  4*@ @ @  8@@t$`2  0 * 4@G & ( 㿘   ?& @6`   ?& @p< @ 㿘  8` € "   (  & (@  2 8㿘 @@@S@ 2 8㿘 .`,@㿘 8@ `0 2   @  @+,`0$`4 `02  %`4`(  ! (!  @, `(`,*`($* @@b*``, "$`(@ƒ $`($`, `,* @@&&@& (㿘 8`` , 02  4* @@ "@2" ( " 8@` 8` 4@diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../kern/kern_event.c(kn->kn_status & KN_QUEUED) == 0㿘 H/` / (`" & >@>A>A#`P@W#c & "" ( & (`"H 0  kn->kn_status & KN_QUEUED㿘 H/` / (`2  >@>A>A#` @WP#r` "` "  "@ ( & (?"H p@ knotepl㿈>>c,T k> >A#`#d#h#ؚa#\ @  @L 㿘1>  Ѐ >  А & > #@N 㿘> #@Pvmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapx`(D$($$@ &``<    @@`䰒 24`X <  "`` 32`@@ @ 2{4`` I 2r @@a  2k4 #`#\` #d`#h#l @L J> ` X"   &` > , €  2aa  <`X  ,  >a@8 `@@  `􀢀   $   ` @@@ 4@ 04@ @execve: argp == NULLexecve: no vmcmdssys_execve: falloc indx != i㽠> j@"`(+>> X`>   @8%"?@ ''" ?'''@'"''''' ''''ap''ؐ N>b  @| 2>B@U!  "  J@,`J@   @@ ?  @ ?ؐ ?'``  2` 㙖  ?` ?%@'ʔ   `` ?{  ?"԰ 0`?%@'㩔    0#> 4 ?bp"@  "@bp* "@ @ b ` *   " А ? ' '@> >$`0 ( 2 $$Đ 2 $В@ 2@ $$耢  >B@UM!؀  @ €@ ` 趐 '$'>`$"  n#=c6  h` c0"@+ ] O@!ܐĒ @8  'В?,2c 42@0 @k, $, $ ?H@2$,  , @,,*@$,, , ",@ ,!  $, $@ @"@,(0",$4">! `' @,  '   R  ( `    0'  21      ?>B@Ty!@rp@ @ ``H "`H  2` 2  "` "(  $< 5 @߁, >$, " ", '" H /i * * @9h$$$$ࠖ *@" " @ "`"`H 0" @y,@’  @@޵ ,€ U (,(@" Ԓ ?@$ @`E @ @ Q؀  ?'m@l @w@z " @x@s ?0# @>耢 "@h @e  @M@X" @x@W ?@ @? 㿈`` ''᠔  2V !,  **` ` '&@'ቔ  .E쀢 7  @ ?' 'o  ? &`e   !쀢  ?  'N   vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map㿘@@ *` init died (signal %d, exit %d)㿘 4 'H>E">`@S` ,     @ѐ H ,@ w&!4`& , w H@0& ,?&! @8)&  ` ` @k@|H` 2! @>! `@2"!` "&`` `|2``x  @!1 @8` ` " &`@" ` "&`@&`&`!@; T 䀢`& @֒  . 1 8`" < <"`< < 8"@ ` "`   ">  &  "` "&  T`> @0X``H %> `L@T`,( 7&`,@!E 2`L` H6!0 ,!4!4`@S  !4@`H& h  ,@>  H ,@  >   H@% T 2 ,@0 ,@@  ( (@ H  @! @0 H ,@@@0@Ґ > @ "`@k& 㿘>  & 8   8"`<"& <@/ reaper㿘#> %>F``   @-` 8`" < <"`< < 8"@@rא ,     H@ , 1@/ H`@`wait㿐@ 2`!` &@`?" T    , @" ` 4  ! @ 2{ L`  ( "s L L 1B2L 1 ( 2i LL 1 E  4&``  !0'ߨ 2p` `"  X!4ߞ H 2f X " `@ $ X@\ ( B ,@  @ J@/JK  ` $ `@ 8 & `4!0 !4@ H @]09 2 L2 L2 4`" L 4$ ,&``  !0*  'T  L 2u , 2` 2&>FА!  @-  "_ T H > @2L "(LP PPL `T "L`TL P"`T`T"P"H㿘!4@ @Y `"  "`   "@ L`" P P"`P P L"@ @ ? `? "` @@ @ * 쀢 "> i@ > i#@JO>b?"bvmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map㿘   @8 㿘   @. 㿘@` @ @ "  $@ ` `@    `@2@` 2  @  procppwait`>!l>  b'H'P'T 'X 2>H >H@PS!P #@  :   p  > t c@p? #>c@v2 ' > i @G#   @''@ T'''6'ؔ''Đ '> ''> gc̐  "'>%> +> -> i/> #%  #c@  @c% $   X?\@ ?ܺ p7'ܐc$ *> >4 ``  #`4  @ ` 4$`   4$24>>  ц >b> " , 1 H$ 4$ ( $  "` $$ $ $ 4b$ * @ $ 8@  8"`<b$ 4 @ *`"  4 * $ <$@ Д$^>u@4H>|4@4C $ , $  , " ,^ ,! , @ $ , * @ I $  :   " @ " 쀢 $ @ X $ z$ |$  ` "$ @% $ ` "`! `  ,   , $ ," @ , $ , @ $ @ @ @"`D& @$ D$ H耢 , $ , T $ L T L"`P& T$ P$ T @" $  䀢 $ @} ``$ `@ @$ $   &  , @ò<  @K $! Đ `P@oTȀ  XX %X`` @%" X "`` @"" X "`` @ "  " `` @"H /m * . >     " "4!2, 1@q[H 0> b &  " "  "Ԁ` 4 Ԁ " 4 , " 4#>H aX @*F  ,`  4 X""㿐> 'T'X"h "  ٚ @@ ,"' ,! @OT2& WARNING: thread `%s' (%d) exits with status %d 㿘  !>  >J`4"ha @O . unable to allocate kthread_q㿘  @   2>J@N"@ Q $ $ $>b`""`㿘>"  $$` @ @   2vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map㿘 䀢 ` @9 䀢 & @㿘 ,@  @f46 `4a &  { h @&   @ t 6 $@$`  `*" 'Ȓ'@ѐ@ >  *@& X @&   ''Ȓ7''@ *@& h @&  @'Ȓ'@ *@& h @&  @Ր'Ȓ'@ *@& h`M  & > b  8 Ȓl  @  `'@'`'`'Ȑ@] %"@&`&'  "@+  8 @4 א@   *@& X @& $ .` >`''Ȓ''''@ *@& ` @&   ''Ȓ''@ *@& P` ` @  *&   $ @ @'''''ܐ!@> 2|  @<`  @@  *@& l `>  `X`䀢2`@ &` ` ``2`B2` =  !@  "5  `/` @i@1`@``@ `  @M@"  @@  *@& 㿘@ ( 2`;`&` `2`  &`?* &`&`% ` @`   㿘 ǘ T`  L " Hktrace write failed, errno %d, tracing stopped h 䀤 , @ ,Ȑ  '?''''''̀` '`(`, ''''`@ @ @ `>M  ` @K>  " 䀢2 &    2  ` 2 2  2  2`   㿘@  p?& & 6 & & &P  2 lockmgr: using decommissioned locklockmgr: non-release on draining lock: %dlockmgr: not holding exclusive locklockmgr: upgrade exclusive locklockmgr: non-zero exclusive countlockmgr: locking against myselflockmgr: pid %d, not %s %d unlockingexclusive lock holderlockmgr: draining against myselflockmgr: unknown locktype request %d㿘 ?4 0 @@ p`  >M@J"h>M >M"@J  *@& `  & `v>O"ؓ*` € )  'k   '  `&    *` @&l:` &   M N  & 0I  &  >M  >M@Jk" ? *`:` & 6   ;& & 0 !  ?& 0& >M  >M@JK" ?&   !2   4  !0  !&    `&    *` @& :` &   M  >&  $& &   "ڐ >M@J #   @'ސ  @>M@I#0  6 0À   '   " 0 &  `&    *` @%:` &   M  "& 02 M   ! `&    *` @%:` & 怎   =& v $& &   "h >M@I#   @>M>M #P@Ix ?6  ` ? ;& & 0   ?&  E@'N0A >M@Ii# '5   1 -    h&    *` @%0:` 2 21 M '     & &  6 0>M#@I0  (" '2  2  2    w& @&8;0999`<=t lock type %s: SHARED (count %d) lock type %s: EXCL (count %d) by pid %d with %d pending㿘 >O @Jd"   $>O # V @JY  `>O@JS#Pvmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map>  ؁ lkmopn㿘?2   0&% >c  #>P`##`&#!`8 @$ 2# `#>c $# 㿘  @` H>?" $`"" D" " "> `` " ""`㿘`"  "`> "  "@@ >c?"c 2> ؁x ز   &% >  /  ,@  2 >#  & >  ؀ 2  &㿘>c % >  ``,    "  `D?"    "$c" $c>c @m  " $c㿘1># # >  `## @%&# DDB symbols added: %ld bytes 㿐 c @' #@> #@Ő a'c@] ['0# @"10# @  N'10 #@#@E > #`4B "? > " `4 #@  "`1>$ &#@m" 0 c""@ & `""4#"<@l "`8"`0 & 0 #@"`8"`4"`0& > "c> #` 1>#? 8   >  `` " (` U@ '``    &# "3>c?   " >  `8`4" (`0 &@ ' 8 4@@   &c`8"`8> #` #` >#   2 7> >   @  "@ @, t   "(   ' &#Wc084@  <,  >P"D<@H+` "`G&#> #`C 2> I1>  6& `(   .  >n"c (31>   & $> &, &,& &@    &`, &`,`&`,D '㿘@8㿘@Y 㿘>  ؀ "  , ,`@ 2  "  2 , 㿘 ,`8 >`< "` 5 a>! >Ra     `a.`@ 2`a> > !.``Ք `є  $` ` >.`a `ǔ 㿘 ,`  4`2   @#@I㿘 ,` `} "`   "8`  ` `>"@  >#h>Ra  #h `@  2`b@@ .`l 9>"@@ 6f .`$>#h, `d `7 `>#  >"D>Ra  "D `@ , 2`c쀦@ .`9 >#쀦@ .`1 , $>"D, `. ,` ,)$` ` ` .` .`">* ch ` 0 @*`"@>"D*`@`  ,㿘 ,`A I`G "` @ `> X  >  `  `@ .``2` X@ ># > X@ >  .``˔ `ǔ > j"" $` ` >`.` `Ի > j""㿘,` >T *` €  ߒ    OOOPPPvmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map㿀@ # H /i * * @]>>"lbp''?H 0@қ  >b\ @@2 `a   b"`l> &>"X&P@ o D z a2`@ " qH /i * * )>%"x '>$l %>$p  #>b\# ? @ $b\ 1>&"d >>"` 6: : '"x> 'l>'p'b\'"d d'h''БH 0@ D b\ @@2 `a   b"`l> &>"X&㿀H /i * * @\V>>"lbp''?H 0 @ vmmapbsyvm_map_lock: failed to get locktemprp_addrip6rrNDPip6_optionscrypto opspacket tagsIPsec credsSPD infocrypto dataknotememdescpipeUSB HCUSB deviceUSBpoolUVM aobjUVM amapRaidFrame dataVM swapVM page bucketdirremmkdirdiraddfreefilefreeblksfreefragallocindirindirdepallocdirectbmsafemapnewblkinodedeppagedepvfsxform_datatdbpfkey datapfilEXT2FS nodeadosfs bitmapafsIP queue entadosfs anodeadosfs mountmiscfs mountexecttysMSDOSFS nodeMSDOSFS fatMSDOSFS mountISOFS nodeISOFS mountmrtether_multiin_multiip_moptionsNFS daemonNFS uidNFS srvsockExport HostNQNFS HostNQNFS LeaseMFS nodeFFS nodeLFS nodeLFS segmentsubprocproclockffile descfileVM pvmapVM pmapVM mapshmUFS mountUFS quotanamecachevnodesNFS nodeNFS mountNFS reqfhandlemountiovsessionpgrpcredioctlopsgprofnameisysctlsooptsifaddrzombiefragtblroutetblpcbsocketdevbufmbuffreemalloc - bogus typemalloc: out of space in kmem_mapmalloc: allocation too large???%s %d of object %p size 0x%lx %s %s (invalid addr %p) Data modified on freelist: wordprevious type%s %d of object %p size 0x%lx %s %s (0x%x != 0x%x) malloc: wrong bucketmalloc: lost data㿀> Ő!(.`@`>V@B!X(   5 3  @0 . "!) ' $$ "  0    @     ,"@> *` @H /f * ' ``@?>#c.`,`  4`   @ ``@` *@  ` $`  o;> $ b* b` *  >>(b 0>@ :@ , @f: 2> >V@A!pH 0  !> &  :  *@ B < 2 b* @ ?#$2>V@Af!`$` &2   B < Өb"7o$   @b" *"@2`"@" "`  "$  $ *`2` >#:` >V!  Z'>#` 2 `   >U&`@`  @ `>  @`"`7`  M"`>U@A P>V>V">V#`#d"(a:b@BlA> ` &`@y ` >   `  >V#`>V>V!ab#\ @BG$?" 6 7o""*" 7o" 2#\*> ab&`&: > * R@@>V@@"` >V@@"xH 0! 2  `*B? < $` @``B ``< $@@ $`$`H 0free: non-malloced addr %p type %sfree: unaligned addr %p, size %ld, type %s, mask %ldmultiply freed item %p free: duplicated freefree: multiple frees㿘> !.`> Ő!( @>  耦 > >#.` >X!h@@3b`& > b: * R+ > " *   *@ H /f * ' b䀠 A>h!`b` `@`3 1 / - da( $& $ ," ( @@40@ 4 0@ < 8@4@@ D @@ L HT!*`  b>#.` >X!@?Ē* )!>> (@d͕+  (*@ "$44  6`@`?B$<`H 00r7o"@ @`>X!>X 2`!@A@?!`    7o""@`@ *"@6   4` * @ "3  `$  3 2 ``$(`>X@?Y!`(@8 `02 ```,@(``0`B <`0`"B<` $ 6@@?`$$@`" & $`H 0kmeminit: minbucket too small/struct freelist too big㿐#> b@_@%> @d,> "bb!> #> !`M> `#\  @bV > `>""`(  *@  @:  Š!<* @*`@ /$? 6$> "# %d,%s,`` \``` `". ``  -0`"  -> %> "@   #>Z .@@@0`@   ?* ǖ(( "  @ 4> > G E!04> > @!h>! $!4> > 6!4"4> > /"H-"4 04> > ""4> > #(#` @4> >  # #Ѐ4> >   @ 8''  8 g > ő* (  @8[>a O >    . L># .   @@ ``  Đ@7%!>Z> Hc  #>Z. !@`P@?~   !*? > _J@ "*@   !@vmmapbsyvm_map_lock: failed to get lockphysbuftodo < 0; minphys brokentodo > MAXPHYS; minphys brokenphysiodone < 0; strategy brokendone > todo; strategy broken㿘>  `  `  ` @- @ @ @] @  `&@`?@H /d * % `0 # !>[`0@&`0   @" `0``0 &`0H p@&`D&`4&`,&`x `@-   "` &`0`*2 @ &`T &`<&`H`<6@>[@=  $>[@= Ȑ  $, 2`H@^ `H  @] `0 (&`00&`4@S@H /d * % `0" #>[ ` @ `0b" `0 &`0H p@@`H@]i?$`0h"`<`4 " `<`@@@>[@< $ >[@<! "  $ $`;`` B# ?` '`@   o` &c@H /d * % `0?# @&`0@00  `0 @`0*@&`0@DH 0㿘  2 |@ |!P?#!$ h$ $ lputphysbuf: private buf B_WANTED㿘 \ @Ϣ 0 @">\@<7!  <@4" <procpl㿈> " > "`> " > !>!l "aؐ >  ) : @ $!l> i"b:>  ) @!l> ΀"a:>  )@ > "ad>>,T )> i>\;`#h#b#\!8  @1 chgproccnt: procs < 0chgproccnt: lost user㿘> #> !d @ *`  ! 2   +" 6>\@;#`""`"@ i )  >\ @;# ){  "" $""" > "   42 H 2 4 > $> i @( "   4  8 2 4 > > Ά @( "     2  enterpgrp: setsid into non-empty pgrpenterpgrp: session leader attempted setpgrpenterpgrp: new pgrp and pid != pgidenterpgrp: mksession and p != curproc㿘 "!>]@;"!!  @`>]@;"O@  4>]@;"0  e  ݔ   ֐ 0! $$ $ $ `     ,> ` ?& ,  $` >]@:"X! $` @ "@$`$`> > !@* `$@" !@* @"@$`$`"% @W !@S  @` D"`D D @"!` 2&!@# &!` & @` @"`D`$`& D 㿘 @` D"`D D @"!` 2&!@ &! 㿘  `"`x""`x`"  "` "@ ? " - * 㿘 H!@` ` 2 T` &`? &`@% T !@" L` 2 L 1?  ` "`? "`@  L 2!㿘  L 1 2 @  @  @  @ 0 2L 1 4" H4 " H4 "! "㿘@` 4@"!{ 2!  !`   ! `&㿘@` 4@"!_ " !!`    ! `   4& ` "`"  " , "" ` "`"  "㿘@`  R` &R @:`   Ǣ.  2& 㿘! 4 @ "  " 4 J  4 &㿘` @A  4"aސ "5  2a. !`  2( `,@"a! a ` 2`4`4ΐ " ` !   㿘`@`   @ 2 / @ @ `@ @Ԓa2 `@ @ʒa2 2 @"$ ? $ $ @ $" `,!$`,㿘`@`2  @"  @ @a2  @̰ $" `,!$`,㿘`@`   @ 2 & @ @ `@ @ra2 `@ @ha2 2$ $ @ $" `,!$`,㿘`@`2  @"  @ @Ea2  @s $" `,!$`,㿘`a2@2 2@  @[&``e,  22` `, !$`,R` `(@ :    *   ` @2@㿘   P@r P &㿘H /f * ' ? &Ē H 0㿘  ” Pؐ &㿘Šǵ P &㿘`  &`!` ` @㿘 !2   !  @ř` ?"  ,2  &  vmmapbsyvm_map_lock: failed to get lock㿘@  )  "`M "'`I    2:N! 9 )` ! . )  * )N! & @ 2N!  ) >  `&`>   )` `2 N! &  2  ) )?&  㿘@    "`R "-`N   A`@D; ` ! 1`  -``@. @ `"` >  `&`>  ` ``2  `@`  2 `` 㿘    `` 4 &?Na 6 .a !2  .a @Ȑ 㿈`Ҕ  @@㿘`(     .`@    @ 4  2   @(   !2\ " s` ``  `"`@_ & `>` `` >""   >!t>!l :`? 4 >2  (>@4  ` @`>`2%  "> "@ " "  "  > "8   @  @ @hޘ  << 㿘@ 4   * `# 㿐H /m4 А* .   ؑH 0 D@B2 > '@'`&@ u&`'r'     @N^> !!`" "@  < 3`+ @+` b 2**@ b 2`* *` B 2**@ > C@@[ Д @U@&@Д @@&`@@E Д @?@'@А @@ '`@@- Д @'@'А @Ԗ@' 㿘@ `   \ `  H`r H@Д""?`"?/""`" ` " ?/"" `&"  `@"` 㿘 *    $ $ 㿘 ? & Ē *vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map A2 ,!  ; ,4>d* "* @"% @ 0   " @  @"  @   |||||||||||||||||||||sigapl㿈>>c,T *> >d#`#d#h"pa#\!4  @*' 㿘>  @+ِ"p $6!4 $!0 $"`$ $0 0㿘 $!0`@& $㿘 $a0? "a0> & $@-Ȑ"p㿈@   $` ` `2`Z ` G,`@ `'@ $ $  a*@ 2$ a 2a  $ a "a   $ a `  @$ 2  , " ,  $  ,@"   $   2   $  `* $  2`   "@  `$(H*`"  ("?`" `,#`, " `,`4`,`,(#`,8"8"@  "  " "`> 2,, ", >`*` 2a`耢` #`a#aa  a #aa #aH>`  *``*!"!``*`㿘Ґ! ! $>!`! * 8 &!*` " ! &! & *$@!`2! $a $a$a$a ,*@& , " H "`  "` "` ? "("?"H    "pause㿘 $?! `$!$!@ 3>f& !(` @  㿈 $! 2`!  $! ``! *@ $    !  ! ?$!#@  ! $!$!$!$!  㿘`` / @  2`$ n 2` ` @2 `    @㿘 $ >  L4 $,"24 `@24/ " ! 2 (  !4 $@,"2@   ` 1? @̒@24  㿘 I)s  B  >   "  "   2 @@ @ 倦06    "  "   @w㿘  ( @ 㿘    , @X @ 㿐 ,  $* =!":$a( 26$a( <  "< @ ` .`@ q ' @ `@  & a@`!* &!>!``" $@!&!$@$a(@ psignal signal number㿘 ( >g@1"ب@ >!`.`   ,(* !   !   N!  .!  ! `   *@& 萊 *@&  耣`  & 耣 lN 1 hHo oN 1  %> G  , PhK `"1 耢?`2>!`A 6!0*  H& ,`  @֐02 ,h/` & `` * & "! l  . 1" l * & 耢 `@ 0  >   "b! 2 2.!@&H 0Process (pid %d) got signal %d issignal 㿘>!`   ,*@ +  ,  ? * !*@ $  ,("  , h(2) $@@ 4!0 , 1@@j  , H @[@a ,(" !0 " ?  *@ 2  * $  $. @`@`. 7  4`>h!p@1  ,(2 ! `2 H2  H4!0`,  ̒ @@ 2   2  ,(2 >h@1V!}  $ 㿘 ,*   H. 1@ & ,postsigpostsig action㿐>   $>i@/  ? * * . $ ` @  a " a  @k0G>i >i@/ Ho oa  ?a$a `@  $ a@ !* $!>!``"$@!$!$@H 0  < "<a$@ a($a('  `  pid %d was killed: %s sorry, pid %d was killed: %s 㿘 4>i @/la 4>i!@0? 㿘!2> 6!2a`.`@ $@ "a$ "`%s.core㾈, aݒ2 ,!>!`ݰ >   ( *  @: @̰ D`8$`  >i$`b@0 '''''ܐ#@ԁ! 0P@ך <  T?@*@2 @B  ?h @Ӑ@ג2 42cv!8 @d8 '@郐 $> '$' ('$'( (*', *'0 `+@@ +@ @'4 H -( ('((   0 #\;`#h#l @ . >(#`* 0"( ` *  4 #\#d#h#l@֖  #`#\#d#h#l   @ @ر @Ա "㿘  N㿘@n &&  & ` >j#*` €& &  > ਄ 2 " 4`" "`  4  `2``"`@*@   "  @ uiomove: modeuiomove: proc㿘  >k@-   `>  `>k@- U Q` `?&?&8  "'@ "@   2@@ "@0# 2@@ @&@`@"$`$@@"B &>` 2ureadc: zero residureadc: non-positive iovcnt㿘` 2`>k@-@!``4@>k@-9!  2` &`&@  "   6 *  `?$ $```B >`&`hashinit: bad cnt㿘 >k@-" 4< , $, < ϑ,     @?*``@&&㿘  깔  2&  `&  && " $  &" $ & $hook_disestablish: hook not established㿘 2 2@>l@, ``"`& @`"㿘@  2 㿘  l  2&  & >"`" && "" "powerhook_disestablish: hook not established㿘>""@  @ ` @@@2@`2>l@,\!8 "@ "` @"@ 㿘Ho o >"  €  2 0""    € 2 H 0vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapsysctlsysctl_disklocksysctl_kmemlock㿘> >l x!$ ৘ > >l  !$  > >l 0!$  X`    '`a2 ` z @*ْȰ sȒ?` #>m!*` €>m` "  >o!>#> >* !>' !>#> @L -`   C` > Τ x  ๖ 5`@L"   ੔ & ```` #\`` @L> ΐ x   ` `l <d|pX㿈`\   ' , 1 3? ?`2>o ȓ*` €> > ÐO> > @p>͘!p>Ƙ!l>!t&>  #$!> #'@ G E# 6 $#@6$#`4 8 $#5 > j!@h! * '> %" > "@X!  > " !> !А'@$!АƢ>  @ @@Ȓa     悒ư>#!>!> > b"s>!@Oe ` [ V > " a@|  G> " a@" l   #\D]>  > > X @ F @gR=>!>">"@. @)'!> "p@Ҙ"p"p2 "p 2 "p> b*  "p   @ -$@\|t  8L`4t8`t ,Tpp,㿘`\l ?` f>o#d*` €>;@> g5ᘐL F> j> `(* => c> j >(" * 2> -" @ />">o@ @  > #>*`# @++  > #@5 -  8X4㿘  @     `&@  ؔ 㿘'P` @     `&@PĔ 㿘  @     `&@   㿐''` @     `&@ 㿐@#\㿐 #\@㿘\@ `  @@  `,  `% ` "&@@   ?*?@B@@*&@9  */㿘@駐   @     &@㿘  @ ` `&@ 㿘` @   ` &@ِ㿘@  > "ذ ` *` *  (&@`!> "&@!  !&&@   `/ 0   0&&@   ` `2l   > d >  J "G``->q"*` €`4 "@a   `, "1`a ` "+` l @` ` `   `,"2`h@1K!8 a8E! bȦ8``2N`1 >    $@& & $ŜŬ4㿘&@!` `  P&` &` &`  &` &` &` &` N 1  1 8 &a&a&a &a @w&a &a &a &a  H "&a0 4&a0! &a4! 6a8 , ?` `?`l&a<`x " #&a@`|&aD&a<`  @ &a\! `2 &a\ `aH>o! @ቔ `.aO`6aT&aP6aX6aVa`@ .a a@z .a    P>a%s,㿘>    ۯ > hc a > !X %> '> (@      ">  > # *"  * $,$$ ' aX*$ * >r!  (>o! @'@ 0@"@ 8;  @;  H;  P#  T# $ X# ( \# , `# 0 d# 4 ݠ 8`@*?"%c > !X >" 0# 8;  @;  H;  P#  T# $ X# ( \# , `# 0 d# 4  8 "  㿘`"    >  > !Ī   \>! $ @!  8@& @@&  㕔 @@ >   :@) 6@>!!`&@`&``&`` &``&` $&`aa &@ &`  &` &` &`  &` &` &`&`>!!`&@`&``&`` &`&`  @6 / ">   , # >  > h* b,"*    ,  $   , a"*    $@@: "&L  "vmmapbsyvm_map_lock: failed to get lock㿘#> a>sc@ ֔!> !>t` @ ϔ@@F㿘>  >H /m4* . "  "H 0 >aX > > "b @޼"@ Ԑdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../kern/kern_synch.cphz㿘> >  c܀*>   > >s>s>t#c@$  _ 1 ?` $   $ >" h 2 `G$ hH /m * . d h  d d* *  @眑* @$ h `$ dϐ@甒($ `@v !1>   ! L 1 2,! ,  22@" ,!@GJ ! @G(,!0,!H 0  2 1@a> @, >!X@ ;㿘>  ȡ*` *`@  `& `&  & ( @F "& ` ? & & `@ tsleep㿘>   `@ @a J Ho o> `>> "`>b@H 0 H 0  >tL 1 >t  >t@#"> > #a8$ ,!$ l$   " ""$ p@`"  ,  ` $ ,( @ X   l  @ , 1 2     , 1@ @"@ ! > *aH 0 , d$ , { $ ,  @ @`@D #  > #`@ p`* 2  耢`"   ,( @     @ @`@2 $ ֘  $?a *  ?  @ @`@  փ  㿘H/` / l`N 1 @ ,@ ,$& ,H 0sleep called with priority %d > PZERO, wchan: %p old sleepsleep㿘>  ` >u"@$>u@#"ГHo o> `>> "`>b@H 0 H 00D >uL 1 >u  >u@"ې":> #a8,!$ l$ $   "  "#   , 1$@ "@ `@  @  @  @2 !   ! > *aH 0Hl8> 8  2 ` ""`"lH wakeup㿘H > > c!8@ =   >v 1? >v@"[!H l2($ l"`@$`L 1 2 ( , , , 1` $ @E> > """`> @"h`Ȕ0 2 H 0㿘?㿘>  ! ,!H /m * . @DՐ  @`@:" @H 0preempt: cpu_preempt not yet implemented㿘>  >v@!#8 ! ,!H /m * . @D  D`@ " DH 0㿐>  @:L>   "@ `Đ" ` А"@ А"??/!`$`$`< (2   #X    q Xm  @4  X  @X`B <X$```" `La 2` ,a @m`> ?$`p`"p@9ခ> ؆   setrunnable㿘Ho oN 1`*`>w# €>w@!C! ,( !0  * @&  , `. 1@CH 0 ( ,ڐ , & > "h0 > ! !耢  > > "b"d\(J!  ( `  8  *! > 耢@ > > " 㿘 ` $ @8& `! 1! .!mawnusage: show all procs [/a] [/n] [/w] /a == show process address info /n == show normal process info [default] /w == show process wait/emul info PID %-10s %18s %18s %18s COMMANDSTRUCT PROC *UAREA *VMSPACE/VM_MAP PID %5s %5s %5s S %10s %-9s %-16s PPIDPGRPUIDFLAGSWAIT PID %-16s %-8s %18s %s EMULWAIT-CHANNELWAIT-MSG%c%5d %-10.10s %18p %18p %18p %5d %5d %5d %d %#10x %-9.9s %-16s %-16s %-8s %18p %s 㿐N   n.>wJ#` #N@" L@`L@ 2`L@m> >w@!#>w@!#>x@! >x@! H0n wa0/"0,>x>x>x>x>x p`@!  >x>x>x>x>x>x>x#\ `!@!na>x>x>x>x>x!`8@@!a!P^%>x)>xN1 KH>  >xa`   *@!N4L@ n">x w a" 7"'l3!h  @!:,! ? 4 l` N1, "#\#\#\ #`@!>x!  @! 2N1>   2N1vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map㿐H /i * * >    " '`"'Вb@ ?#  #`H 0!> #Ț#Ȅb?`##Ȗ #`?/a  ###`> !!`#! #`?/a  #!#`H 0@6㿈@  @7*`" * `*''+ 㿈 !2 )@ % `  #@'> #`'> ``  0` f 㿐@   `  >!X'@ا"'` nanosleepx@Д  #@؎''@ { H /i * * >    ? @ ' '?/a  ?#H 0$ > >z!! c ?"  #" ` >H /i * * `` ''ܑH 0ؖ"@'" 'Вb@ ?؀ ''ܐ*`" * `*''R  㿐@   @6@@   ``>!d6 denied attempt to set clock forward to %ld denied attempt to set clock back %ld seconds 㿈 !2 2G@   >`   5@ ' @ >z"> #`>     0    >z"@ "@= 0 C` >ad"ad" 㿐 !2| W@   O>*"@ *`" *  * "  >!`*@ *`!`@) @^ג & H /i * * > "> h"""`H 0 ` !В"@@;'"@@'`r   㿈@ W H /i4@* *@ 3   ' ' ''쀣 1>    `&'0ఀ''ఐ "@ " ' 'Вb@ ' ' * ''''H 0` 㿈@ 4t `   2j`  &`  ] Y@耢 2T @ M H /i4@* *@ -  @>  >     b? ''?/a ?3 $ @& & &  &  * """"H 0 㿘W   >  & G& ?/"?a  H /i * *      & @&  @ & &    @ 0ఀ@ $ @*H 00H 00Á}x8   Є?   6  "@ @" "    "  "  " " "  `" Є@@" "   H(> #h#lH h #`l" #dІ@;``@d` h   l"" #H(> #h#lH h #` l" #dІ@;`` ` h l##  "@ @   @4"@#vmmapbsyvm_map_lock: failed to get lock> j  >  timeout_set: on queue㿘H/` / `> j#` >}@2@@1"`@ H p@&  & & timeout_add: not initializedtimeout_add: to_ticks < 0㿘  `>}@ ">}@"ГHo o   `> j "` "  "@& > j>   @ & & "& " $ && " "2& &  ""  H 0 H`"`@"`` > j `@ ` ?"``"` H> j>       softclock: not onqueue㿘H/` /> jc8 >  "@ `1c%>~ 2@h`"`$ " ` " H p@ Ho oc" $ H 0 ticks now: %d ticks arg func ?%9d %8x %s 㿐>  >~@"X>~@"hHo o> j# %>~ ^W ^u 2'>~"' @h  2 H 0 vmmapbsyvm_map_lock: failed to get lock㿘 !2 @?@>  >  >  > ">("`""  >>> probing for %s* %d mapply: no match function for '%s' device>>> %s probe returned %d 㿘   @>b4  `>@  (V` `>>@ @V`@ H2  @ 2 `>@y P 4 >` @   " &   "&  & &   >>> %s probe won >>> no winning probe 㿀''''耦` `  ` @ > "' ,'"$  * 2  (*`: * @*``  2 v V  2V   2>"4`耢 " > >@v!@r!㿘` `  ` @ > "4*`$ %` * 2  ( `*`: * @*``  2  @C T ` 2T` 2㿀>Rbt'' ''''bt> ,V* * @g 2V  unsupported not configured 㿘8 @M"  !>"8ƀ * @ root device %s not configured 㿘  >@͐!  @# 㿘?` .@ߒ  0?.@ ` `0?.%s (root)%s at %s㿘  `  ` ` @ `* "@V   V `  6 6 > b&```&``""`@ː`>>"`@q` > "p`@k` > ""&  "  2 $V `@2 $V "6 V 2 $  6  $  뀢2@config_make_softcconfig_make_softc: allocation for device softc failedconfig_make_softc: device name too longconfig_make_softc: %sing dev arrayexpandcreatconfig_make_softc: duplicate %s㿈@ /`>@ @ T  2>@v X@ÐV`  && ("& V`V` & @   *`   @ &   *` 2 0V`&  @ $`(>@7   & $ -  , @, .`@$.`$.`    &@>  > > @  *`@X@ єֹ $ * ` > @ & ,config_detach: bad device fstateconfig_detach: forced detach of %s failed (%d)config_detach: detached device has children%s detached 㿘  ?* 2   >@#p  @  € - `>o #@  ` `>`$2`@Ȁ`2`$> ,`"! 2$R  R @"2 R 2 $ R @2$ 怢 `"  "`> ""  "@@0 `@* "@>#@ϒ @$` 6`@@ 2 `   *`"` @ $`$@ 㿘`  ``(  -   $`(€ 2$`(㿘`  ``(  -  ?$`(€  2$`(config_defer: can't defer config of a root deviceconfig_defer: deferred twiceconfig_defer: can't allocate defer structure㿘 $ 2> >@ې# #Ѐ >2@АcX2  ӡ  2">@Ð#x" "# " "" 㿘> #Ѐ #  $@` $`$ " € X `2 㿘> "` `$` Ò  2`$config_activate_children: shouldn't get here㿘> " #>``$```0 -  A @Аa( - 㿘`  `@ @.`@ 2 (  " @ ," ,㿘 ,?  & , ``@ے evcnt_attach㿘@֫ (&>@"@&> ! & ""  $"`$G" $`@@&$"="`$$@ @ $ @ 02`T T&*$$2$$"`$$2$"`$$""`$ $@ @  2`T T&$$2$$"`$"$ (   @*`2 %s%d%c: %s %sing fsbn readwrit%d%d of %d-%d (%s%d bn %d; cn %d tn %d sn %d)㿘 D? 2`  2 ?`a>@bH> >! ,  0: >`> >    ` > ȟ <> T Д: @ `' ` <`(@ `,` !> `8 @P`8@`,!>@B `,@ܐ> X X > > h "#㿘 > #`>  !X "   (@В  2 ( 㿘 ! Ȩ @ , $ , disk_attach: can't allocate storage for disklabel㿘 ,   (ߐ  Ѯ!&  "ѩ  `& 2 >@ǐ#x@! @"H /i * * >   & P & TH 0 &> X& "@"> > h  ""disk_detach: disk_count < 0㿘 G  D `"  "`> "!\ "> h>  ?" ">@s Ё0"0H(> "X"\H disk_unbusy: %s: dk_busy < 0 㿈 0??& 0> (@!H /i * * >    ''H 0  X"@' \"'Вb@ ?? ` d & ` & d?/a  & `& d`& X & \ H 8@ >`CB> H> 8 @ 얂B> @V@ 㿘>     㿘>      H(  :`@:`8:`HH(> "`P"`TH "``"`dH rootdev=0x%x rrootdev=0x%x rawdev=0x%x cannot open disk, 0x%x/0x%x, error %dcannot read disk label, 0x%x/0x%x, error %droot filesystem has size 0filesystem type %d not known.. assuming ffs )> "@ѐ ,`@*`"@>*`"D'> ਐ@  "`>"< @C`eਖ  `e@ "`>"< @2 - ` >@#!@ ">  " >2 @ 2 @ > !   !l >@!0>2` > aȀa>  Ą"aa"   a " extentpl㿈!> ! > > hc#\#`#d#h   @  $!㿘> !Ƞ@ "  @ђ   2 㿘> !@ @  extent_create: name == NULLextent_create: extent `%s', start 0x%lx, end 0x%lx extent_create: end < startextent_create: fixed extent, bad storagesize 0x%xextent_create: storage provided for non-fixed㿘@ \`>@l x > @ۖ>@` `+ >@Y  `> @O!(e @̗& ( 0& $`&    " " ' `" &    2&  & && & &  &  &   & extent_destroy: NULL extent㿘 2 >@" " `"`"@@c  ` "`  " Л 㿘      @ 9"'` '`  '@ "  & :'`  + `2@'  @ "" ' `""`"@@  @0 '` '` '@" ''`extent_alloc_region: NULL extentextent_alloc_region: extent `%s', size 0x%lx extent_alloc_region: bad sizeextent_alloc_region: extent `%s', start 0x%lx, size 0x%lx extent_alloc_region: overflowextent_alloc_region: extent `%s' (0x%lx - 0x%lx) extent_alloc_region: start 0x%lx, end 0x%lx extent_alloc_region: region lies outside extentextent_alloc_region: can't allocate region descriptor extnt㿘 >@!  @>!H@ >@!x:  >!@v>@!؀@ * @(> @g!>"0@b>@"`@ 2 >@W"4 `* `&>`     &  !Ȑ 먘 " @- # ``(` Κ extent_alloc_subregion: NULL extentextent_alloc_subregion: NULL result pointerextent_alloc_subregion: extent `%s', ex_start 0x%lx, ex_end 0x%lx extent_alloc_subregion: substart 0x%lx, subend 0x%lx extent_alloc_subregion: bad subregionextent_alloc_subregion: extent `%s', size 0x%lx extent_alloc_subregion: bad sizeextent_alloc_subregion: bad alignmentextent_alloc_subregion: extent `%s', size 0x%lx, boundary 0x%lx extent_alloc_subregion: bad boundaryextent_alloc_subregion: can't allocate region descriptor extent_alloc_subregion: extent `%s' (0x%lx - 0x%lx), alignment 0x%lx extent_alloc_subregion: overflow after alignment㿘\'H `>@ d 2 >@ H *   >  @R >H!0@M>@Ґ!hH& @ >!@>>@Ð!`>@! @: >"@,>@"`@В H>@ "  "@?          >"@ >@#  ` `*  `  " `U?@*<` `@7`&?@  " ` ?     *8(@ ? b a  }" z`:`  ` "@?  I? EC @`?@ :@8`&@  " ` ?@    ?   ?    " -" *`   `   &  !>Ȑ 鳘 )H@8  #d "extent_free: NULL extentextent_free: extent `%s', start 0x%lx, size 0x%lx extent_free: extent `%s', region not within extentextent_free: overflowextent_free: start 0x%lx, end 0x%lx extent_free: region not found㿘  >@ u H @  @@M> h@ݖ>@ a :  @?> h@ϖ>@ T ؀ 2  @q 2 j K @ ; C@2  2 `""`"@@ >` 2!@  2@  ,@   $` $` "  $@" "$`   @  @ސ> @o>@ !"  "`@[  " ?&  㿘  * 2 !>`"`'   & ` ! "Ȗ 記 20  뀎` `"  "` !"@H /f  ` * ' `>  h@ *`H 0  & 㿘 `>` &`  &` &@ " &  '&`H /f * ' >  h@H 0  &` &@ " &  &`    /& 0H /f * ' >  h@ÒH 0extent_print: NULL extentextent `%s' (0x%lx - 0x%lx), flags = 0x%x 0x%lx - 0x%lx 㿘 2>@ "P> "p @ }    !> "@ u  2 vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map㿘`%`a> "         @" a& & > > "ad"> p   p > > i p ᔁ klog㿘> " Ho o  $%> i'> H 0E #`$!X u "  H 002 @‎H 0> ia ?"aݴ  `$  @&`$ ``     " 8㿘Ho o`> "``  > iH 0  @"aH 0 㿘> !p`> i!@"? ? :? > b? ?$? }@0  ~@w@=?0?@< v@)?07H >    H `6#"> @"> iᔄ ᔄ > ia"` "` "`> i" vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mappr_rmpage: nidle inconsistentpr_rmpage: nitems inconsistentpool_init: page size invalid (%lx) pool_init: must specify alloc and release togetherpool_init: pool item size (%lu) too largepool_init: too much uptimediagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../kern/subr_pool.cpp->pr_itemsperpage != 0phpoolpcgpool㿈\`d> @ F  > ">>b #`>@ 2 `> "" ` ( ` ?@( >!@ & & &  & & h ?& d& `& <& h& \& 4& (& ,& 0& p& l& & & 8ݐ> ?`& @& T& L& P& & & & & "`& X>@ !H4`@3> @& p&  9> & 9>   "?@͒&@͍& $ $@@  & D>>>!hax@ !@ې$@!& & & & & & & & & & & & t` 2& >a (   #\#`#dV#h> >"a#\#`#d#h L  I &bP &  "" pool_destroy: pool busy: still out: %u 㿘 @t   P`" p>@ u 2]W  2 L Ѐ2 L>@ f x D@:>@ _ &  L D" & L@``"`& `@"@ `` 8 d 4 Ȑ? p`& 4@& ``"``"```"@H/ /> !@H 0 2   `"& ` "@&  `2``"  "`>""T "@> " p Ƚ dpool_get: staticpool_get: must have NOWAITpool_get: %s: crossed hard limit%s pool_get: urgentpool_get: %s: curpage NULL, nitems %u pool_get: nitems inconsistent pool_get: %s: page emptypool_get: %s: items on itemlist, nitems %u pool_get(%s): free list modified: magic=%x; page %p; item addr %p pool_get: nidle inconsistentpool_get: %s: nmissing inconsistent㿘`p `"> >@#0>  `2`P`"`P>@#H`T@>`h@{#h2`a "a`l`  ` `쇒` >`c@ ` "L`>@a# 2\ `L" `\`h>@ ΐ#>@S#ؒ`8`d  `p @`H/ /> !H 0  2$`Ā ```8`d` 2`P` `>@#2`l`  {$``$`l`h   `P $`Ĕ@`P 2`L>`h@# 2 `h> @ m >@#7o"" >`h H @` "`$   "@`L`P $`L$`P `2  `Ѐ 2?>@͐ $`   `"$ `D">`h@ ` "`$`  "@$` $ ` "@$` ` "$`  "$```L `( $`@pool %s: putting with none out pool_putpool_put: %s: page header missing㿘 < P  @  h>@ >@y  p @`  @2 *  x`  `  ``2` `7o> h@Y b&@` &``" $` $``&``$`  L P` ?& & L& P&  l  ?& l`` А &  0``2 D  4 0@V& ` 2 L2 L>@ x D@:& >@  L D" & L@``"`& `@"@ `` 8 d 4 Ȑ? p`& 4@& ``"``"```"@H/ /> !@cH 0 W `"S& ` "@M& @``"`& `@"@$@ $` "@& H /i * * >   $`  $`$H 0  `""& ` "@& ?@@``"`& `@" $@ " & &  $`& 㿘㿘 D@ɌÒ@Ɉ > \  8 d   p @ @H/ /> ! H 0 ` ` ` 8 d ,@ Ĕ , `& & ,Ƣ , 0@ `& 0 pool_prime_page: %s: unaligned page㿘 8?  $> h@" p @2!  @2 *  x` & @2 *  x"` @2 * " x @2 `*``x &  & " & &  &&& &&& &$  Д    & Ж@ & & #@  D L ??& L7o"" " "& " ??  "&  4 ̐  & 4& ́WARNING: static pool `%s' dropped below low water mark 㿘 p   h>@ A  L (@:< \  8 d   p @ @H/ /> ! H 0 ` 2 ` d ` 8  ?  L  ( & İ㿘` & ( D@a D@] D& ,& , L (@㿘`  D@I D@E D& 0& 0㿘& & & T& ` &  D@3j D@/ D& 0& 0㿘>c> 6`@+T 㿘>c@+h㿘>c> ͕6`@+C 㿘>c@+W㿈 p   #> @2 H /i * * `` ''H 0  ` 4 ,@~@` s` " '`$" `'А"@@''>"X耢@ ] L D (" ]` 2 L Ѐ  >@ x:?>@ &  L D" & L@``"`& `@"@ `` 8 d 4 Ȑ? p`& 4@& ``"``"```"@H/ /> !H 0   `"& ` "@&  4 ,@㿘H /f> * '>   >"P`"="H 0pool %s is locked; try again later 㿘H  *  >@ H 0POOL %s: size %u, align %u, ioff %u, roflags 0x%08x pagesz %u, mtype %d alloc %p, release %p minitems %u, minpages %u, maxpages %u, npages %u itemsperpage %u, nitems %u, nout %u, hardlimit %u nget %lu, nfail %lu, nput %lu npagealloc %lu, npagefree %lu, hiwat %u, nidle %lu page list: page %p, nmissing %d, time %lu,%lu item %p, magic 0x%x no current page curpage %p no log cache %p: allocfrom %p freeto %p hits %lu misses %lu ngroups %lu nitems %lu group %p: avail %d %p 㿘@ *   :  l"  p"  c" `@*  ` h> #0  $ƀ p 8> dƀ#h \> `ƀ# (> ,# 0ƀ 4 D> L# Pƀ T >  ƀ  > Ȑ 0 ̟ƀ Ѐ 3   >ƀ h " '> x  ƀ $ `7o"#>@`ƀ``2@ 2   2 >ƀ  >ƀ Ѐ  `>ƀ  p``>ƀ 耥`.  *+>)>  ƀ` ,!  0 4ƀ 8  "'>%> Xƀ  .`@`ƀp`$.` 2  2 %s: pool(%p:%s): page inconsistency: page %p; at page head addr %p (p %p) pool(%s): free list modified: magic=%x; page %p; item ordinal %d; addr %p (p %p) poolpool(%p:%s): page inconsistency: page %p; item ordinal %d; addr %p (p %p) 㿐 `R -> <` @   p @`> P@ܒ`h`X.` 2 7o">+>)> `"``P@Ò`` h@#\>@@ ``P@` h!#\@    צ@`2 < "  " " " " $" (" " " " ," 0" 4" 8"`" ` "`㿘 @N` "`$  "pcg->pcg_avail <= PCG_NOBJECTSpcg->pcg_avail != 0pcg->pcg_objects[idx] != NULLpcg->pcg_avail < PCG_NOBJECTSpcg->pcg_objects[idx] == NULL㿘 2' , "  0 2$ 2 0 )$ 0 @ < ( 6 01  , 8 $ ,$ 8  >>>!hax@@&? ?>>>!hax`@w&@* "  2 " >>>!haxx@h&C "$ 㿘  2* 8   >   2!&  2 > "ђ  @703@ L 4`& 4$ $  "@  & &  8 & 8 ` `>>>!hax@'&O*`$  @ " "@ >>>!hax@&R  "& 㿘 $"  (€ 㿘  \  <%>'>->+>)> 8?& 8   hx@@&??hxc`@&@* $   `2" hx#x@ؔ&C  2 $ "&  $"  (€ ƀ  2 8`" 4?& 4` "`&  " "& > "E 2 㿘>0 㿘> 㿐   '  `_ `[ 2Y 2V  `2Q "N  2J 2G  H /f * ' >"PX  ' H 0   2!     0 0@ h   & hVvmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapkernel %sassertion "%s" failed: file "%s", line %d㿘>"@%s: table is full 㿘>b@4 panic: 㿘>##> b@?H'H 'L'P'T'X ! `!> # @$b>@]# @t>@W#(>bl @_@%㿘'L'P'T'XH/` /@   @ИLH p@> !p`L  @ %d㿀  <@A >`@GO`  >L @3  L   > @* 㿘'H'L'P'T'XH/ /   @HH p@> !p`H  @z ; 㿘> "`>" `  `>  ````@<'  ` `>`""``- + ) ( > !d`# > "* `  " `"@ &"   "" `> ` ` `>"t@`?Ԑ㿘>  'H'L'P'T'X`,  a  `   @H ,"  ! `" @"@! 㿘  ? & 㿘'L'P'T'X       @7r    @Lx㿘'L'P'T'X  @L㿘'H'L'P'T'X   @H㿘!>"h 'H'L'P'T'X$"h  @H> "`2$"hD$"h㿘!>"h $"h @t > b 2$"h0$"h㿘'L'P'T'X  @_L.㿘!>"h $"h @R> "`2$"h $"h. 㿐'P'T'X`?' @7P*@?㿐` ?' @$*@?%llo%lld%llx0123456789abcdef(null)0123456789ABCDEFbug in kprintf: bad base8`' '   '  "Q. N nN % 逦``8  ''? N `ZY>!*` €` ? ? N ? ?L@  >b  >c< O3>c1O ``  " . L L 쀦` @L@? * :   1`"̮ < ,*@ < ,L@  ".Ӕ`L@ ` L@ 4`L@ `U`  " >.I >DN`>c !   ?    @?* : ?: ` - ,@ `>#'  x ?     @?* : ?:   2  `` -`" N  ? ' '  +N`*   ?&?NЀ   , * ?РNЀ  &֢?ՒШ  , * ?РNЀ  ' @N l2    ?/    ?``    @?* : ?:  ` -` >#   x u o  ?=t:  @ ?m" ?h2    ?   2   @  ? ? ^  ?>c '  S x ?`>#(  @ "@ @    ? 2   @  ? ? # >#0># ' ?  2   @  ? ?   2  `' ?`"R' ".  5,A> 4, 40 - 806 03- @ `0- @:  8' 8'0-,4   4 - '#H'@ '?`Ӭ/  @&+` ` 2`@  ' " ? `2 ' ". ϔ ?< `  ".'$  `  0" 0.`  "v. 2" ? 0`  0 "].~ ?# (? 0`  0"E.f ?2 M "2 .P퀦` # ٠? `  2..3 ?N`2&puup,uuuuuup4pXupPp`upppppppppplLuuuuuuuuuqTuuuuuuuuuurLuuuuus8uusuuuuuuuuulq@qXuuuqqXuuq$uqrPrq8nrus<uusuoxvmmapbsyvm_map_lock: failed to get lock㿘` @@`% 2 (  H /m * . `"` " @"`"H 0 㿘,  `@ &&@`   @ * 2` ` @   4@? $`$` ,  & ,>  "b㿐 , ,* ` @ $&@   @ * 2`@   @`    @7  rminit %s㿘 `/ > & & &  & "*"rmalloc %s㿘`> l!X$    @" "  $     2    x" "?"## rmfree %srmfree: map '%s' loses space (%ld) 㿘` >  "X@$s$  " N$?h$f$ B   >>  @$P LI$  bX  $ "9"?  ` `"@ $     ǖ ??  2$@ > /"h`""? "h#?vverbosettimezonesshowquitLlinesllisthhelpffindqexiteenableddisableDddbcchangebbaseaadd㿘>, + >>T.((S7>Ⅎ#TP4P&Ⅎ.`(@2>"b |.`(, " $> "!"--- more --- 㿘!>"  >" 2 ">"@V>"{$"",`:` `q$"`Q >>>@"> `( " %d㿘> ͢ >c@o1>">b !> "@c@]"@&">>☀ >  ( >"""━%d0%o0x%x㿘` >"x " >4 >  >> h0> `0 p%s*FOUND***UNKNOWN*㿘. > . @>*` ,@ > V `*`>! €>V  `0 > 0>ߐ 0>ې!h|h%3d free slot (for add) %3d %s count %d (pseudo device) Unknown devno (max is %d) %3d at root%c disable ??? %s flags 0x%x 㿘>b|.  >  >b*>!0y*b:  >bȐ"|& *`>"|*`> "̘ > !w0]"|: $. >n"0T@>*` ,@>d"0b>_"8V? >W"@V?"T #>ObHVL | V?T   4>><"P>7"`>cT* R  >#0  '>Vh* $ V? >"p㿘N -    N 02% N x  X2   `     ɠ  Ò  *:   2Ѐ  ? &@ 㿘     `O* Є 8O /`8 (. (> а`` ?O O "  "  " O?#66 㿘N?   +>J@    `,`b:  4- *>: c0,`: @2 `@ "`* b:`@ - : ? &@?%s [] ? Unknown argument 㿐%>  +>)>'>6c@2# (@7LJ@ "` "` "`J@    &@   ؒchange (y/n) ? flags changed %3d can't change free slot count%3d %s changed 㿘>"| 4>. E< %>#>@ސ`, :``y`Y`n`N, :  y Y^ cl. >`,*  `  `%> `  "`$`" `$@ *``TR@?  `R@?,  ` TR@?">>#0 T* E %@T?`>!;`` ,` @F %`  >f"0>c>`!0T" >!U0K>"Ȓ 4D>. < %>#>F@A`, :``y`Y`n`N, :  y Y' cϐ!>& "ȓ*`>@!8† & *` >&?b|* @>!@k>ў "Error unknown state already disabled %3d can't disable free slot %3d %s can't disable pseudo device 㿘>"| 7 . @> ,*`@R` "   "  >4 > 2` 2` >Ő >"0. :  >! >I dWv>! 0>" >>!00"Ȓ  >& ?>b|* @>!P0" enabled %3d can't enable free slot %3d %s can't enable pseudo device 㿘>"| 7 . @> ,*`@R` "   "  > " >2` 2` W >S"0. P:  >K! >ې e>@"0>" >>"60"Ȓ  >& ?>b|* @>#&0#"command args description [count] number of lines before moredev add a device8|10|16 base on large numbersdevno|dev change devices enter ddbattr val|devno|dev disable devicesattr val|devno|dev enable devicesdevno|dev find devices this message list configuration leave UKC[attr [val]] show attributes (or devices with an attribute)[mins [dst]] set timezone/dst toggle verbose booting don't know㿘>q #>bJ@ j b,@e@@})>`  %>[`` b, @ ?* : `2?*`>! €>E 08>A 04>=! 00>9!P0,>5!x0(>1!0$>-!0 >)!0>%"0>!"80>"`0>"0 >"0>"0> #   b,J@b4$DTdtĝ㿘> ""%>#>, :  bȐ ?* ?$∁%s 㿘> "" #>#0,   >"Hb? >?$Unknown routine /%c/ 㿘>"|>   P"b>>#T`,* W ? >.#T:` ,1>T- `2@@@" . :``e `s`d :0 :0 ې i < G"   T?͢` b|$?>"bUnknown attribute 㿐L@?  ->L@    2`L@,L@` "`` "`` "`:  4-`*>: c0,: @2 @ "* :`@ -`: ?2L@> H0   ǒ >G s0Ӑ Unknown pseudo routine /%c/ 㿘/ ?  c >""> , ,`Y'>.:   @`2L $ @L 2D $.:    T `` 25 $T 21 $T  2+ $ *?  d e c >" f>" $ $  $,`ʑ:  $i?  $ `Ȣ @6A? .>!>: b|"%>,`@@ ,`*ȑ?  d"" e c " f" K"K Ȑ* : '? `Ȣ@̑,`?  c>?"bValue missing for attribute 㿐NN    2 NN "  "  " N > 0ג  >.`.: U:0 %s ? Not same device type 㿐?'> > 0' )>ː!@В (LL "  "  " L < 2$L>"|􀢀 >"/`* * @@?  .`:  a>!` ' ? q   f ` Q> ` `No more space for new devices. Device not complete number or * is missing No device of this type exists. Clone Device (DevNo, 'q' or '?')Insert before Device (DevNo, 'q' or '?')h@ $>">b|   >6#80.:  >>-#X0 , `  @=`2 $@ " $ 2 > #0>#  a/̀?$* *,`>` #' '`'` '`'`'`'`''77ڒ i ̀?n a|.y: ,v: t"| !̑+` * >`, $  ?ܚ?## ?䀠 ?# ?# # ??# ?# ?# # ?>#(Ԓ@И,*`# ؔ@ "܀"" """" " ># R>"x` >"t  R"|, %"|` ? @`2$@ 2 $V  2$V4$ 2, @e`2$@ 2 $V  2$6$ 2 * : Unknown command, try help Argument expected Dev expected 8|10|16 expected DevNo or Dev expected Attr, DevNo or Dev expected timezone = %d, dst = %d autoconf verbose %sabled endisUnknown command 㿐N  />N "  " N - N    2  J@ ? @2  @] "  J`NN "  "  "  M@ [ > `V *` ?* : `2H*`># €N > > l >>4""N >t ,   >W"W N H > ` `>>""x>L  N l- O n >Wr c@M 0N &  dذ  1ϰ G >WK dN >  x  e ݒ v  >W" eN >ِ    * *:   d>W fWv G 0rN U> 0kD qs?0fN  0_x\ N  9>N#> -%>$ad  *`:   2 NN "  " N  a ad"  tadad .adadd `  >4>`?`"4>!8>!@N  >I!H T(`$0L`User Kernel Config UKC> Continuing... 㿘$#>> > ```@ (   >     N - 㿐 @`@ +`@@"  2`   `#\@ hВ ?'''''쀧 '4    @`2''@   耢 ?  #2   `  &  \ Șښ \"㿐 @`@ +`@@"  2`   `#\@ 8/    $    _  '''''y N'   '  `=     @`2   ؔ{z@   耢 ?  # 耤$   T ? \"8 㿐 @`@ +`@@"  2`   `#\@ h '''''''쀧 ':    @`2''`  耢 ?  #  2    `  &  \ Ș \"㿐 @`@ +`@@"  2`   `#\@ 8/    $  ɔ  f   '''''x T'   '  `C     @`2   ؔz`  耢 ?  #  x 耤$   Z E \">  @ *@ ٰ   2`Ӱ b b> @ ?*@  @  *@  ,,2`     ' x `xQ `0@   `$@ b|"9@"{"[T m b}b~2f @ 't    ?4    b~te@ 't  @  ?4    b}tQ'tT    ( "(  ", `A"0   'tZ 2!5  't   `vt) 2  ( `(!$@ `w@ $@`  ``w`X select㾰 @ 4&@@`2 a- - @,  ^@Ғ-  ','0''' '(88@ Xx','0?' '(` (wn 2,` ,we 2,` 0w\ 2{,` 2wR  2q, k H /i * * >  А  ? @ ' '?/a  ?H 0%>  %> ,$`@%,(@j@ 28, 24,`  $+,Ho o,`@$ H 0,%,> j>"ؔ!Ŀ H 0 ",,? ?%,  #" 2(``" `vԔ 2``v˔ 2` ` v” 2(] 㿘`  2 *   61 >#(4* @,   , `,@( `-      4 *  ,  &`zH "  & ב4  ˲@'  㿘@ 4 "&@ " &@ l> j"؀@2&@` 6`㿘 3  > c$  "c$> j6 " "&Ho ol> j"؀2 ,J1 Ɛ 0v 0 @ ?",H 0㿘` 'L'PA  * @  5  @ .2 *@`>@ %2 #@>c4@    T @``  "  `   @4  `LL ŗ* P"pollp> at@``  * `  | @u @`  `2@` `?<#@a* "**% *"@ *`@ *`?VЀ f H /i * * >  А  ?А @ 'Ѐ '?/a  ?БH 0->  -> ,$`@$,`A 23,?ҐЮ $+,Ho o,`@$ H 0,$,> j>"ؔ@! H 0 ",,? ?$,  #" @u 2@ vmmapbsyvm_map_lock: failed to get lock㿈!>  "8 S@R N@MP ' 2 >2` #P"`"(=&  2`2 "`" (&$@ $ @+@8@6pipespace: out of kvm㿘>c@  & >析 x>   "㿘&  4& & && & D& @@ & H 8  4& 0& (& ,& $@ђ #& <pipelkpiperd㿘( D! #>"$ D!a@ L   D!" D !$ D z H O$ H  $ $ " $$ $ @ V  ?$ DO D ~b$ D |$ D & # D> $ DH!   2D H D!#>"$ D!a@  2  D!a$ D 2* H" D" D  " @ 8 @ 8   4 "  D ~b$ D |$ DƐ 2 H@e $ H?  $ H D  ?$ Dõ !T@8   D  ?$ Dæ " ! D @ ?$ D|  D   <#@   9 Expected pipe buffer wraparound disappearedExpected wraparound badPipe buffer overflowpipewr㿘 ( @   D "T  ##> a$ 4   8  2  ` > a>" "a @ z a$@$ `$ $ $$ $a$  2( H D!#>"$ D!a@ / 2  D!$ D  D ~b$ D |$ D H $ H  "@@ $ `u s %>"$ D!@    D!$ D 2 H "@@(  D ~b$ D |$ D֐}@ "@ @4  ( 2, D@    " >ڐ $ 2 D   $ $@"$ >Ɛ   $>佐  D ~b$ D |$ D‘ 2@ H5 $ D†  3 # D @ ?$ D^  D   <#@   " D  D> $ D! g 2 H D 2    D H  H?  $ H D  ?$ DE   D  ?$ D8    " 2@̐ ,  D @ ?$ D  D   <#@     }@  ( ~@ @ 0@ @ 0D D    << "㿘 (`  @``"# D3  /  +  D '0"$  D 2   " !  D @& D 2  "  D  o  D @$ D 㿘`(@  `6`  &`@    @ C B?@.>`0>`8 $&` (*`" *  * &` ,&`  0*" *  * &`$ 4&`( 8*" *  * &`,``&` ``&`㿘 (@ $ (pipecl㿘 f D @ ?& D2  D   <#@ ϒ  " H  H !>9 D`& D !8 6  H` @ "   D @ ?$ D  D   <#@   " D  D` $ D$ @ ` (> > a$?"a$> a>" "a @- > "8ܖ`4(R` @ >l"`8"` " > |"`8 "`"   4(R `@ `2 "``2`  `2``"` 4(@" D2  `" `D  2     4(@`" `D" @  2 "    ` "   pipepl㿈>>c,T h> >#`#d#h"8`#\ L  3 vmmapbsyvm_map_lock: failed to get lockptrace: impossiblep@  ` 2@ @`#>"*` € 44@  ,(    2!"  4 2  4 2&> #$&  ,h  H߰ L 1 @2&0&@`#Ϣ >"*` € , ( H$ ,4$ X `2` `  :Ѐ ?@ '''''''' @j`     $  , 2`@``" @  = ?)$ `     $  , 2 @ِ  H?$ `4 X "  ,> >   ,*@$ ,$ XL 1 2` `W4!0\ `Y U ?R$  &`  , H($ ,`4@$ Xs &`  @ `    P?@ ?'''''' @\$ @ 2` Ѐ   !?@ ?'''''' @>O!h`ܸtpڤdd݌dd݌ddd݌݌݌݌݌݌݌݌݌݌݌݌݌݌݌݌݌݌݌݌݌dddd㿘 (   @3 E    \" ` \ = 3 3 3 \1  8 # ( # ,`$# 0 (  "  2  " i r   @̖   ` @   @A㿘 (H /``* !`  ``"H 40Z" `0W 8 H@   V   $ BH 0F  d"@ l h" 4  p    `  $  H 0# ϒ x  6   @ H 0  P \ 6 \H 0 㿘 (@P `06` `  @ 㿘 (  @7$ (vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map㿘.   `@ 02 ``@pB`  ``@p:@    2@ 2` 2` 2` 2` 2`  "` "@ "` "` "`  2` 2` "`msginfo.msgssz %d not a small power of 2msginfo.msgseg %d > 32767msgmaps is NULLmsghdrs is NULLmsqids is NULL㿘>!    > *`2* ">U #@$> >M!(#耢  >F!H  ?422@ ``> 2c > "a,>+!X`  > h   "`"" ` `  > h > b,`">!h  "`(2``\msghdr->msg_spot out of rangemsghdr->msg_spot != -1㿘  (> > > >V >!` > 8#*  ,2  ` 0 ,6 `&6 `"6   2V V ?"a>޿#X& a܁㿘 &`  L&` `D&` $ &` (&`  ,&`$ 0&`( 4&`, 8&`0 <&`4 @&`8 D&`< Hnj&`@sys_msgctl: msg_cbytes is screwed upsys_msgctl: msg_qnum is screwed up8 ?@c ``>!  6 * * > h" b,*  (`"~ V@  @2x "4 0n\ 0k~ e `" `  $" $ $ $Q@`2` " $>6 ؀ >0! $ (A V =l2 \ 7 (@` -  @8' ?$ $ >   a  4 $ ($ D%!  l \  "&㿘`  @`) >  . > h* b,"*  (`"  2  ` f& K  a "> Cb?  > . > h* b,"*  (`2  "2  2$ $   a$ > $   $  `$ 4 4 $ $ $ $ $$ ,$ ($ 0$ 4$ <$ D ?#*`@& msgwaitmsg_perm.mode & MSG_LOCKEDsegs_needed > nfree_msgmapsmsgsz + msg_cbytes > msg_qbytesno more msghdrsmsqid_ds is already lockednot enough msgmapsnil free_msgmapsnext too low #1next out of range #1next too low #2next out of range #2didn't use all the msg segments㿘%?@` ``>a  * * > h" b,* `(`  V@` @ .   @?`(%> 8 `` "  @  @  > a,@  > a܀   h  b4` !X  ` 4` ư `( ˖ b",>ܸ!`@$>ܲ! >ܬ!2b>ܦ!4`? 4 4`)1>!>,> ܕ!P  ܏">܊"   &> >܂"0#*  `0 #,3 4 j  S   z`?! @;4`' /> ->+>  +`: 4PH@KbXnȔ@jS %> #.` +`: ?"`>3"p?a`( 4`;( ` 2`$`  #-`?! @4`0"$``> "`  `$ `$` $`$4$`, $`4'msg_first/last screwed up #1msg_first/last screwed up #2msg_first/last screwed up #3next too low #3next out of range #3㿘 ?@c` ``}`>!  ɰ * * > h" b,* `(`V@` @ ޔ! ` A @" `")$` 1$`>ۗ#@` * >   @4 @  "`   "$`w` $`2 $`>p# 2  0>X! C ` `(  ?V@c` S  > ` `$" $` $`$ 4$`0$`< @8 iQ    09 #E03 *7> 5>/>!%@  *: 4@meȒi% > #.`  ސ'@ sema is NULLsemu is NULL㿘>  2> >#@!`>>#P᜔    "`2`᜔`@a  > > !`"@`d> " semu_alloc - second attempt failed㿘 >> ` `> ! > ` 2 "@""`%2``d`> `R` 2 @"`" `2R`` ڃ `̒ᜰ 㿘@2R>  2&@2 R "G  2&@@ R @)  2`R2` 222R % *`: @2*  #  #  @ݔ  *`:   * `2 22"  > 1R @'   2R"S  (8@ 2( " ?"2 R`@ޘ 2R㿘 &`  06` `(&` $ &` (&`  ,i&`$+P ?@c ``V` >! 6T >  ,  ""L V@  @2F  > >!x+  € 6> #> " * @*`@ *`@*`$@  :`#$ " @ ##.` *    @* @*` `" `@ "`"  @>  "!  ! *` * ""!`@@4  g]  gW @ ?$ Ė$ >   a  4 $ (_! g;  g; @M! `&  @6 ,` * @`9! `&  @6 ,` * @`%! `&  @6 ,` * w@! sf  m  ` @c.` @ f  ` 0Y! U`&S  @6O ,` * @E`  A`?  @;f  4,`@*` 2 !Ĕ %f    ` @ .`  @f  ` ?[U   "&\DXȝ㿘@  `1` >a >  .  ""  2   !>  .  o@ q` @&i  &\c _ `>! @ U >#"@ @ a a>   b" a   `@@"2 a#> 4 `. "?" "" 㰘* > " 222" +`> ` * .`"("@@#@'*` ? *`@ & semwaitsemop - can't undo undosp`?c` @'L '>!   >  - "V@ @ ˔   - ` e* " 0   7  @@*` * U` `` # * `2  2 `2 @ ` 2   2 `@2 `@ Ϛ`@D`$`ښ @?* @*``  " 2 `(2 #U` 2  4  4>!   '" ?V@c "U`s  2 ?4 ?4 M @\ܸ 5=R 9@ y 0Ԡ , * #>@"?V@  @d "?ڐ`? 0  * @*`   " 2 0` @ ` @`*` * `4$@ LL "semexit - semid not allocatedsemexit - semnum out of range㿘>     2 <T  $6 @62 ,` > `* V bV >k &>d Ȁ + @ *  @@ 2 @ *` 2 .T `@԰ $ $vmmapbsyvm_map_lock: failed to get lock> @ 6?> "`2` @ 8??@ >6 * > ( 2  :`   㿘> " 4 @@@*@ > 0>`(> j"Ԡ 4> & 4"#"Ԑ"6 "㿘`?# @> ,`ᜐ"* > b @ @8*  ?&` $>  *`$ ,  4 $ $ > "!  㿘   >!      !?!@@! "    㿈 ``>!   \*    ?`"@ ` " Q@ 2`e @!! Z>!  ` `?2 G > " 8 `     ``" "  @?@2+ '@  '4@. @ @ #\ @S  > $@@ $`4$$ఐ 4$$(&` @ 2`P `8M >Đ |*` €! 2@`b 8 9 7 20`b 8 2)?& ̖& >   a  6 & 0 2 & V $$` 6 @?c > "  `44shmget㿘> ."* @  d@4 >Đ!$ s  # ``"` @ ` && ? #*`@'  shmseg free count inconsistent㿘>! `'Pሀ>   @  > "> * 0> j>԰  (@ :@   t >  `? @ > />  b2 ሔ  `@ `8@""` @  >!"  > /> , ᜢ$@,` ,5 @`?*@% 5   א  ?c ,  @;$% 4% $  (5 % % `% > 0 4@ `(% 5 $% % ,% (:"@ ఐ % 0&P&"" @  ?Đ*@5  㿘`@` !@   #`" A㿘 >(&`!  ,  k c\&`  > ?!c`? * "@*` `$ 2`$ `㿘 >!  @ 6  ?| `@   & 㿘> "!>!e!`  $!> !"2`2` `8> "! > > j"`""ԁ㿘 &` &` &` $6` (&`  ,&`$ 0&`( 4v&`,vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map㿘H /e * & `p &`l &`p`@E &`t`p =&`pH p@ 㿘>`""`@  & p 6 & x& | 㿘`l *`I:@`( `@a@ ʐa >  `DB: ؒ` &`D> #`$B:#`&`$> i#?`B :#7` @ . 22W @p  `x` @2*`p" `!@Y ! "!@Q!  ( 퀌@`@"`p@`p  2?h2`*&`p!d=` 2  `` @ ^ @`p@ e`p &`p ` ! @`*@&`@ @ L``( "`@ `&``6 2  ` 2 `@ג @ (  `x 2   `@ @ `x Z `p) 2 " `p2 `n>*` * " D* &`p { c 0v 2h`  2W`p2  `2`@2 `(2` @@'*?`p( ( 7&`p ) ! '" `  ^" ~  | { } \2?(&`p? ( 2  " ` " `p@`@ `p2/  +`V``@` `"`p@y`@ {` `p@ m` @ h``"6`@ΐ`6``p>*@&`p 2B  >d< b`@ T@N  ?"`p@ H@B?  >#  @@ 6@0?   ` @@͒`p 2  d" @ ɐ`p 2` d` `xL @2v`p@ r`p``( # V``H 6d`p @z_`p@ [`p`@ S  @ @ ђK`p   2`ހd  6`@`(@  `p`ޒ`*`:  6``6``p@*@&`p /@8V`ܐ@  2`p `"`pV`ܐ" 8  $ `p @ ?  `p! 2`   ` `p* &`&`p@ϐ 㿘` 2 >   `d``B ;  &`d`H@  ۰? <  9 `5 `ܔ   "$ H /e * & >Ȓ`H@"> `&`d > B;`&`dH 0`܀6`?  2?  ` >   `d``B ;   &`d @`H " 6` 6`܀ ` 2 ` ?  4? 1@`@.@?`>ɐ"*` €  ' ! ^ ( ) \? @> ` \`dB:` &`d@k`H =`@ > V`܀ "2?>   `d``B ;  &`d@N`H  >#  `?`V`>ɐ!*` €4 6`` " 6`  ?6`ܰ?%%%%%%%$|$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$/dev/console0 `@#`}@? ] r@<#> ``^@F!> \`{@Y`z+@@+#> ``@%`e@ `u@#>  ` @ B` @`@< h  g@ #> 3 `@/`@ -#> !> '  L `!#@ ט !|  ,` hx ` !  " h@"7`n@>`@+ `@` @`^@ِ`a@ڒ@"q h `o@`"@fʒs@w@ѐ @> "}@ 4 "~  @ ] r@@@Wv@n b@Ue@|  g@y  `@`@ 0ّH /e4* &  p p ?$pH 0q @l&H /e * & p$$pH p@W ` ` @ӐN  4>   " > p ( (>< >ɐ" @ '''''@Q֐ .@uՒ` @@v!@xI @Y $ >`""` @= "  0 ] , 6666!| 2  , 2 x !2j  x "y w#H /e * &  $H p@Ͱ H /e * & p ;$pH p@ HHH /e4* &#@  @ѐ   H 00 @2@  : Ѐ€ " pH 00}p2   2 $ ߐ"$p@s$$$($(` |    @~  @"<  ! @4`$@K-@T( '''' ''('$,$(0$ 4$$8$,@$<$ $$0$4$8$<$@* $$($ ( 7&  @  $\ H 0 ! l  hH / * & >!*`  €. €  h*` €H p@0,hH 0 H /e * & pa   * ~$$p@ؐH 0  `  ` >!|   , > h!*`  €{ H /e4p* &p n>*` * " D* $p H 0V ! ` `O ` |" E  $|!$x! "`  , 9' ,|!| 1  , -2 )  & #$x@  @   4 44x44  @  㿘2  *@ *`>"@ D*` H /e`* &` `"V 0@   @ p  ( 0 H  H 0   H 0 㿘6  * * >" bD* `@€V`? ?2  > `&`8>!`&`8&`>*` * " D* @ <H /e4* &   "2 "H 0 㿘 `>>*` * " D* @`<@Y$`   p@`  4`  㿘 >>*` * " D* @ <H /e4* &   "2 "H 0 㿘 >>*` * " D* @ < H& R 䀢    㿘 @" @ !  (    " 㿘 H /e * & # "'>@ H 2 p p * p`2  " ̀ `& p H!@]  H  p` `2   ̀`H 0㿘 @ 㿘H /e`* &`  (`" @  ( `" p@   p>*@& p6 @6 @a`> n*  p* " ~D& p* € H` H@ ΐᯐ H 0㿘># Y 㿘  ($   p ?& p!$  ( p @2 ( !"  ( % $"  "  @  H 2  p`@@5& p @@ Ԁ €   p @& pttrstrt㿘 >ɗ H /e * &  p @ & pH p@㿘 ̀`@ 㿘`B 04 㿘 p"` @` & pސ5 22  n>*` * " D* & p !  p ` & p  @2  | "   "    `@}& p 㿘`" p p & p ` & p  @2  | "   " ْ   x   p*@  &  & p   ' ' '''''& & &  @   p *@& p㿈>   'L  '  H /e4* & H 0 | +,' x# 24  20 2-   '    > >`!@ " H /e * & !W      &S p0+  *  *  *  *   B  쀢 >     '  v  > >      ''> ఔ"*"@ *`" *  * "@  #@V'>!XZ|Дb? @b@ ( G ( p   @  L  `H 0 ` H 0 # >#>#ؐ!@H 0  #q #" kH 03> 5>E 2  $$2  x : `:`!@Ø 2 2 'f !`      $  @ ] 6 H /e4 * &   @ H 0㿘 p @%  $" ` "  @ ; H 2  p & p @@ Ԁ €  p ?& pttckoutq㿘V H /e`* &` >  `  HȀ@$@"'>`>  `耢"  pH 0 >aX & p  H  H@H 0 0` V   H /e4 p* & p*   @%  H 0  >H 0 #ؐ !@Ә H 0ဥH 0>   | 2/`, "+` x& @" 2!` 2` 2`  v    > >`!@ g `_  @2&` Hc d` 8  怤B) '> /> @@ ?6 @ 6< H `8 H40  H@ 6 ޠ$ࠖ ܚ@  d< C 6 ܒ@<& d @$  H4 ``2 4 `A&` H?H /e4 H* & H  H 00" pH 0` &` #> & p H!@ H 02`0 ttyrub: would panic c = %d, val = %d 㿐` h  *@`{&`V`ހ &`ސ> >#  `?f>Ӑ"P* €@ w`` @"s`ސ@{ n`ޑ*`:  @0fH /e * & `p`  V`ܐ`` &`p&`@ 6` @@ X ` `p** &`&`pH 0V``ܠ$  6`ܠ ?,%`ސ ? `>Ґ#̒`ހ` `p 2 &`p \@j``@e`ސ?6`ށLXLlLlLlLLlLl㿘`   `㿐 @@Ґ H /e * &  (@    @'@ ה @  @@ ɔ  p*@& pH p@ 6 6 ށ㿘`p@2`` *@&`` (  ( @      ^   ^r  @ ?j㿘i  p   x }  l( @2``@2@?㿘 @~\ 2`@: !4! & 6 6  (  h* h 4(  4@ 3* @*`@*`6 load: %d.%02d not a controlling terminal no foreground process group empty foreground process group cmd: %s %d [%s] iowaitrunning%ld.%02ldu %ld.%02lds %d%% %ldk 㿈 >  #>ԡ*` ,  , $4 a d@} d@t | 2 x> a`2`>aЀ  >Ԓa`|6 ަ@y 2 @ L1>4"`    >"(>Ԙ"0 ?Ԗ cДb? '?/!`''' @}>Ԕb8 '?/!`''@}!>Ԗ"Hh d* * " *  * $@}t2 L1> 1` "X   @Y@ 6 ށ Z  1   `1@ "H 4 ```+8 1`4  ?@ ") $ `"`4` ,`, 2`4 `44  㿘H /e4`p* &`p ( (  H 0? 2 ƒÒH p@ 㿘 ט "V , : @ ?> X X >  0㿘&> X& "@"> 0>ϐ "0` tty_detach: tty_count < 0㿘> c0? "c0>º `"  "`> "!\ "㿘  >!@}!$ @/ $ @+ ( H$@' 㿘@G @E (@C HE >㿘`   >    -0   -0> i # > #>  ؐ?vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map㿘 $ . ,   > "b@}> ""D㿘> ?D 2  @ ` > * b*   yB$ p p  $" ` 0B"$ p( # a %$ $ $ $ $ $ t ̀ " p p $ p p`2 hb`$ p%> !  p `"$ p h>a* @€@  㿘?2  . > "@*` > h!*`  €ΐ@ 㿘?2  > b. * > ` ` "h a | @ 7`, 3 x"0 (%)> '>a2c `2_  ` W    !x Ka |   `,  x2a ( 2 (6 #> (!Y "`0* $ (` "  (@ (  (  2 (@  ( ( 0  > ha* `@@` 㿘?2  > . * @ ̀   h>a* ` @  㿘 l? 2`  * @> *` p!  `  * "@& 㿘 l? 2`  > * @*``    ?" `* `*``@ 㿘 l? 2`  > * @*`` w  P`p  㿘?> Α2 bD  . ) > b* @  @$@ ̠ ̀   h>>#a$ ̒`*@    w$ ,!$, 㿘?2  . > "@*` > h!*`    € p$ ̒ $ p0?2  . > * @@ %>h f # P!   ] p `  ` ` L ` @  ,`@8 ],` > `" H `! "  H̒ 2,`!/ `  =``   d H  @ T  H   p  ?$ p Hן 0?2  > . * @@   `p w   "l``( m`")`(  d@ 8 #"  8 p`p T @`(` `(#ܖ`(@l lU  d@ 8   G`p + >!,``( # ``!2 `hG``p `h* ?  ` ͔ `p  2`>`! * "z`p`&`&` # 㿘?2  > . * @@p '` ``) 0Z= 0WH /4p* &p H  ! H 0 < H 0 p ` ` *  `! # ֌` ` "(  ( #Ѐ! o` ? 0 * > b(㿘?2  @> *`∐ *   `@$` "`  " ` `@, Ғ `((" `   `@, Ò ` 7$` 6  `*` * " >D* >ؒ` 2 `h i@"S w@"*  _@"Xq `h @M f@"3h `h ` @ ` @@ p@"[ `h `@U`@*S `h2`H> !@`x2İ  &       ?     ?$    ?$   `H@`H `h  ` ْ `x w  `@Ő `h>a* `@@  6`  !@  `N, !  X  `("/`  "+` ` @ ` @:  `@`}@`u@" `@" ` `@ `@* ` `@, ֒ `"  2  "  `@    $ ,  0  `@ ߐ $ ,  㿘 >{F & @x`:   >{5 & @x &  & & && &  㿘  " @x  | >  " &  ,:`@x` | >& & ?H4($   "` `8("@82 "  " "" " H  㿘H /e# * &  @ "  " 4 L& " @@ &@&  &  4 & & H 0$@ H4@(@8`2 `` ` `/`, a` $   `8(": ``0   ``HH(@"&"`  #  4   ""@ ""`4"" H putc: required clalloc 㿘H /e * & @`@`2` ` 2&`>"x$  " `H 08?&`&` ` *`` `"@!  :*"  *  +  :*"  * *+ @`  ``@ &@&` `&` H 0 ` `8( @"@**/+@` `8@ + "@8*  "  ( @ ( (+@   @ * +@ @ *   +@ +@  &+@b_to_q: required clalloc 㿘`U H /e * & @>`5` 2/&>ې!$  ."& " " 4K  "  @@ &&@& & `@& H 0  >  ᰀ`   `@"  @" "  "@  8("8" >    "@ "    8 ("8!"@ ?H4(&  2 "  "   ` `8 ("@82" " H  xH /e4* &  H 00?@ . `)&`' & '`'&  ` '&  `'&  `'&  `'& &`&@&`&`&` &`&`H 00H 00(?PTCLPTRTCN46㿘`h ) > ! 4 > !쀢    4   2 4   &&  & @u] `t &`&`t  㿐>  0  'b@M 㿘 >b  p*    T`% `  , .㿘`>b * R ! ` `   2  # #   *@ `# # S@ `   @(8(82??2 @("`J@("`J@"` @("`J@("`J@"` @(82 ` (82 2 @@`?22(8 08 (2J@("`J@"`?(2J@("J` 2 " ?(8* 2 J"J("J"J (2 " @ (#`J@*(#`J@:#`J@?(# `J@ (# J`# 3   3  3 ` `( ` (88 * 2 ` `( ` (88 * 2 ` `( ` (88 0* 2 ` ` ( `(88 * 2 ` ` ( `(88 * 2 ` `*  `(8: 0( 2 ` @((882 J`  `*㿘@  "@ "8"@ 0  "@ "*"@   @v 0w?# @q&> b* R ` `2c  $ @$?  $?# @ >*" $ "@ " `@  " `@  "  @ `@ 0   @ݒ`@  &? vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map㿘,   ` `@_?@`w@bZ 0 㿘``,  a ` `@_ǐ?@`@b< 0 㿘``,  a ` `@_?@`@b 0 㿘`, a ` `  a@ q @  a `  `, ?#`,@`?㿘 , " ! `  @`? vmmapbsyvm_map_lock: failed to get lock㿘!> !> >c$" >"`l"@$!!>ch "`$!Ȁ`%> ` "```:` "`` 4* ``2` > ͐ $>  ؒ >  "@ ""> #> a" >b`ʔ!> !>aԐÔ  > Ȁ" "2 :  R  4*R   > Ȁ "* "   2   : R  R 2  4R2  42 4" 4 *R  㿘`> * !Ȁ"& *`2 *8    P2404*P *㿘> !Ȁ```:`  ` 4* ``2`㿘> !Ȁ`>``:` ( "`` 4* (``2`>!X2`@ ':`㿘> !Ȁ`>``:` $ "`` 4* $``2`>aX@o vmmapbsyvm_map_lock: failed to get lockWARNING: mclpool limit reached; increase NMBCLUSTERSmbplmclpl㿈#> a>#\#`#d#hcX!   >> ,`T!> !;`>c`#\#h  ( >>!x <>!|w>!s㿘>b$> 6`@ 㿘>b$@㿘 >  > > * "G O Fߐ K @H /f * ' > !؀  !H 0 (> 6 H /f * ' > p.`  2 H p@  & && 6  > bp` "`bp` "`㿘 >  > > * "F R F N @NH /f * ' > !؀  !H 0 +> 6 H /f * ' > p.`  2 H p@   $6 & && & & > bp` "`bp` "`㿘H /f * ' > !> `"b``:` , "`` 4* ,``2`H 0> bp` "`㿘H /f * ' > !؀` !H 0 !6 H /f * ' > p.`  2 H p@  & && 6 Β㿘H /f * ' > !؀` !H 0 $6 H /f * ' > p.`  2 H p@  $ & 6 && & & 㿘H /f * ' > !؀` !H 0 !6 H /f * ' > p.`  2 H p@  & && 6 E   @n 0 㿘H /f * ' T > bp*`@ ?2@  @    "# 8@  <"`< < 8"`8>  $<!  ( $ 0 , sg 4 $ 0 ?4 > !&H 0㿘 K> "H /f * ' V * 4 @ G   "# 8@  <"`< < 8"`8>  $!  ( $ 0 , s 4 & 0 ?6 > !ڒH 0 㿘H /f * ' > !؀ !H 0 "#T``6 H /f * ' T`> p*  2 H p@  & && 6 ] 2`k  `#V @6 ` $& `& `& ` & `$` ?4`& `&  " ?@& & 㿘@+ 㿘@" m_copym0: off %d, len %dm_copym0: null mbufm_copym0: m == 0 and not COPYALLm_copym0 overrun㿐` >#   2 $ 2 > :> "b 'H /f * ' > !؀ !H 0 " V  4 H /f * ' V *  5 H p@  $ $$ 4  $ #V @4  $  $  $  $ @ 1$  $$  "$ $   "8$    1 $  $$ $ ($ ( ,$ , 0$ 0 4$ 4 8$ 8 <$ !؀ !K  $ $@?A `$ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8   $   8  `"  $ 0  " ?$$ $  " 8 $   Ah@   Ab@ 2&   > P  >~ (  > `x  "`xذ > `x "`xm_copydata: off %d < 0m_copydata: len %d < 0m_copydata: null mbuf in skipm_copydata: null mbuf㿘`>!K6>>!E&@ ` 2 =!@ :#>瀦 2 2aА" @& 㿘 2`  2& ! ` @@ *` &@Ӕ `  @ & 2  P `&$ 8" "@ " " `4 4"  0"    "    "  , 2""" *" 2" 㿘` ``a  `@` `` &@Z H /f * ' > ! H 0 "#T``6 H /f * ' T`> p*  2 H p@  & && 6   N& ``#V @6 ` $& `& `& ` & `$` ?4`&    ?&'> )`؀*` 8   $`?  &@@& ` " $` `$`&`ڀ`` &e> a  "a㿘`MͰ` h`( h@` h`   &@H /f * ' > !3 H 0 "#T``6 H /f * ' T`> p*  2 H p@  & && 6   nH /f * ' > !ؐ & $ & $H 0 $ (  & 6 & 0& (& ,& <& 8  >& ``#V @ 6 `& `& `& ` & `$` ?4` `` 8  `?  &@@& ` " $` `$`P`〤`` &E> a  "a`&  (""@`2 "` 㿘 ` "@   @8  246``8 `$" ?ܐ?" 60 @" `"`$``""`s m H /f * ' > !؀ !H 0  6 H /f * ' > p 2H p@  & && 6 Β  2 & ) ِ% ` " `$` " $  @@ 2@"@@ @@ 2@"@$㿘$   8  `w"H /f * ' > !؀ !H 0 "&T6 H /f * ' T> p*  2 H p@  $ & 6 && & &  ,#V @6 & & &  & @&   $"@& & $  e  `&  &$ K ܀ zH /f * ' > !؀ !H 0 "#T  6 H /f * ' T > p*  2 H p@  & && 6 ϐ   " ?@&   "%   6 H /f * '    @6  8& <& 8$ 8 8" ! H 0 #->  4 H /f * ' > p 2H p@  $ $ 4 $$ $ $      W 0$ $ `$ > "p >%@H /f * ' B H 0  4 H /f * '  4H p@  $ $$ 4     $ %@8(: H /f * ' > !ؐ $ $ $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8  (8 $   2$ > " @ 8$   $ $   % <%&@`]㿘 %    @f   @f   " ( 2  82 $ @f 0 2 m_apply: len %d < 0m_apply: off %d < 0m_apply: null mbuf in skipm_apply: null mbuf㿘`>" >>"(&@ ` 2 #@ :$ #>쀦 2 ڐc(" @ ߴ&  m == NULL in m_pulldown()㿘 > 3`  &@`  (   "      ( 2  8` `   "@  #@@  & $&  &    @ ဦ`0` 8`"   $ 0  @ "  ?&```     ;& ΀3 `` 8 `  $"  ?ܐ?" 0 "# ` "`  :А  "& H /f * ' > !W H 0 "#U  4 H /f * ' U > p*  2 H p@  $ $$ 4   76 H /f * ' > !ؐ $ $  $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8    2$    :I  "&      $ s $&2&㿘Ҥ`M  H H /f * ' > !؀ !H 0 "&T6 H /f * ' T> p*  2 H p@  $ & 6 && & & ÐE ܦ H /f * ' > !؀ !fH 0 "#T6 H /f * ' T> p*  2 H p@  & && 6   쀦 <; H /f * ' > !؀ !  & $@? `& $H 0 $ (  & 6 & 0& (& ,& <& 8     #V @6 & & &  & @q&  $&  !㿘` `gA o " 2 2  㿘i o "@"   2@ "  2"㿘㿘`   `2   2  㿘      8ܒ 0 㿘˒ ``     2 "@& "@$ @` "  @unix㿘>  ֒ "@ +  2V: + 5 ) f @d  4`` 4 ` $ `   $ $  @  `@j4 0`> !@2 &@2&@  4 &@ 㿘H o *@ a   ` @ H p@㿘H /` * ! ` `   @ " `H 00 `` 4`>a@>a>!@&4` H 0 㿘      @   @ x `@(gג soclose: NOFDREF㿘H /` * !     @  @X  2 @ ~ @N    5  # 2 @ʐ 2   "   !!" %>!>   !X:#V  "! "     `   @ `"  " >"6 }H 0㿘  `  @ soaccept: !NOFDREF㿘H /`4 * !   > ?(6   ` 2  5 `  @ H 0㿘  , -H /`4 * !      `2 8@4 "   8 `  @ H 0㿘H o *@ a   ` @ H p@㿘H o4 *@ a `   9`  %  `  @ H 0㿐 >   'T`'H'L'P L L   P`: - U ``&` ' T  `'T `4 "`4T`  )`)@ `0% H 0H 0H 0H 0 5H /` * !  Ϙ$ Ԁ 2d  `$2d 9`2d 9H 0H  'd` "@lh" 4 ` `'$     @  (@   (H 0 <`D=  *@ (L $  !p! # ? 5 ?5@ؐ`H 0 bPOH 0P%L`>   "p5> P @H /f * ' S!H 0  6H /f * '  5H p@ $ &6&&&&  n  &:&H /f * ' !H 0 6H /f * '  5H p@ &&&6 Ԓ  쀤4'PM'KH /f * ' > !ؐђ! &$tɒ &$H 0$ ( &6&0&(&,&<&8  (P >  %@ @8  &h8( %8 %P  L  " ?@&LwP L` & &@P `O"`` ` P` 2`  P  5H /` * !  `   PT@HH 0   ?5'T'P  P L' ? 5 ?5P TT` receive 1receive 1areceive 3㿈 ''H''X'`'&@ 2'X   ? !2+ 0 `  @  @  vy`2?;2& $" \      @  \   @ 8  6 \ H /` * !  Lo 8@ :j H@ @d <8a`  \` Z 2  $ 8 " $>  I􀌠Ѧ6 $  = \ "7  "1 2V  2   `" 9   # \ ? 6 \ ?6 \ \@ 8H 0"z \` xV > 'H    H"@c  8 @" & 8& @ H0"@& @H "& LK&H /f * ' V> bp*`@ ?2@ .  "#8@ <"`<<8"`8> $א!($0,c4&0 ?6> & L!H 0 LV > "   A 'k  8 @" & 8& @  0"@& @` " ' `2'€'& LH&H /f * ' V* @4@  "#8@ <"`<<8"`8> $V!($0,b4&0 ?6> & L!?H 0 L ' V "&V '!2"2  * 2  ( > А ?6  4 "8 "82#耢`2H 0t'H /`4* !耢  $@"& "q 2|  8 @" & 8& @ 0"@& @%& LL%H /f * ' V> p* ?2 `  "#8@ <"`<<8"`8> $!($0,a4&0 ?6> & L!rH 0 L2& 4@  % "@&&  8"& 8 4  2 @"  & 4  @Q6 @OK@# 0  ,@q 8 " L \ ? 6 \ ?6 \ \H 0 2     ``" $ V `   ߐ `  2@ 82"& L` "   `  @ 쀢@2耢`   \ ? 6 \ ?6 \ \H 0 \耢 2X`" \@"@ \ ? 6 \ ?6 \~ \H 0㿘`  ``@`2      @ p 8 $  @ 4 $@0 4 $H /f * ' @ $ ? 4 $ ?4 $~ $ ' ' ' ' ' ' ' ' $''@\ (  4 $$ H 0   `@@Ё㿘?#@'P  "Ǩ * `  @P° *"1`"6` 0/` *"+`@&` *"` *   )``| *4y *I`" ` 2 ` 6 `"| ` (x `` _6 *\6 "k ` (g ``$ " d  0H &F  8 `@S > L 7@86& p <@80& H"? ` 8`9 >!X+>2Ta\@Yc & !2Fa\@Y`` 06 6 ^ `  ` ` @P `㿘?#  " * `x@ v  G&` 4 "CV @">V "9V 0X"6V 0U"3V  ".V 0M ")V 0H  ", H    "& <4$ p "  d07 "`&  "V0- &`  ` "@V `(" V ` #"@ $"@6 $`"2V ^V >!X &` `@Y($@_>\1`$ ` *& 㿘 (  ,mV 0 P`4R`(2)  >>"`8 8>"`8 `H( "`"  $2 $H   4(H4T(T  "T`2``"`T\2\H `4( 8"`   "  $` 2` $ "`"`,  " H`0   4(H4|(|  "|`2``"`|2H 4(```d `l`h"4" `   2`$"`$2,`   , 0  `p&  4(R`" R`@  2 㿘   ;  6 @͒ @ @. 8   | "0| "@ 8   @ `㿘  " `8{6 @  `@ 8   㿘  " h0{6 @ `@ 8   㿘T T *T @ @  @N   [  4 @Y0    6 6  "6  (6  &  6 " ,& ( 0&  d&  <& ,@& 0@' `   @  @:]j  `@ 8   {~ " 6 "` 2 "`  0 2 "`  "   `"`2  2  2""" 㿘 `6 @D `㿘 ` 6 @; 8   㿘 $!  @6 $ >R &y 㿘 $  $#>  @4 $! a y " $    $  4 $㿘ϐ``$ ? 6`$ ?6`$z "  0 (k ,`D 㿘 `@" @ 8  H 2 p & H p 2 p(& p p d 8& p @* 7㿘`!>!    2* @ * @^o)! .`  .`&  & &  㿘@& & 㿘`  2 "@ 0 @[㿘`+   2  !&&  0& "& " "` 2 2@, 㿘`4   " R  2  2R @ !&&  "0& "# "` 2 2@ sbappendaddr㿘 @ >"       ` # 4 4p @ 8l H /f * ' > !N H 0` 4`H /f * ' > p" 2"H p@ `$`$@$`4`   `2@- $` `+} "$$@`   a&&   " 0@&  2   " &    2 $  sbappendcontrol㿘2>|!     ` `"   4 $"@#    a&&  "0@& 2  `" & `` 2`"` semi-panic: sbcompress 㿘 `V `` ` 2@ 2R  R V`@$%     @ VV`@` *ʔ `  @ & ` @ & ²"& &`   a&& ` `0@&  ?6& >6F"Xsbflushsbflush 2㿘 $ " > @  2 >  > sbdrop㿘    > T" " &&   &@  0"@& H /f * ' T * 5 C   "# 8@  <"`< < 8"`8>  $!  ( $ 0 , Z 4 $ 0 ?4 > !֒H 0` 2  >C ( "$ $ "@& "f&  ^ > " " &&    0"@& H /f * ' T * @6@ ϒ   "# 8@  <"`< < 8"`8>  $x!  ( $ 0 , Y 4 $ 0 ?4 > !bH 0`" &  " "& & $ 㿘 `[> `"& )> `  " && ` `0"@& H /f * ' T`* 4`e ` "#@`8@ `<"`<`<`8"`8> `$!``(`$`0`,`Y9`4`$`0 ?4`@!ؑH 0 2` sbcreatecontrol: message too large %d 㿘` ? (>!ВL  䘒   D (6 H /f * ' > !ؐ & $I & $H 0 $ (  & 6 & 0& (& ,& <& 8  2 3  (` ? & `$ $$ 㿈 9v  2` 2 >#"``@` 7c90" (&㿐 @@ ``@t  `(E3㿐 @@ `Q(accept㿈`  `&Ô   @@ H /` * !  ( `2  H 0  ! `2) $H 0 #` $   "! tV 9T    $    > 54 $ $  4 $H 00]8Ɣ찒  H 00O T& ?В   Ő  >9 8H 008 2`  2>#" "`(i  `` 8'&' `&!  6{8fH 0㿐 @@ M`(  !!2`E %`@  >t 22   !!; $00H /` * ! #>    $   "!a s "   $4 $H 0  ?4 ?" x`@`` V@`` M8 D '2  2` >#""(7ܰ *2 2` " "`('0谒 ` 2 ` &찒  ` %m   8:5Đ85531p`` ``'` @'''''И''@7؁8` %4  )#% (`*` T 䀢*%  `@'@ 'V h@԰ Т    '  '? '''' ` '  ` @h  "0' Y  @  @R   @2F``$8  ̀`$"  ?ܐ"   ?"  `?"`  "  5 '̀` ` ?` "`?  " "" '  @`2ܒ ,  T5ؔ&&Ԛ`( W̰ 耢 ?  #   e `$'   H U Ѐ p` $(  "`0'`` `'` '`@''''Ԙ'@A؁8` $  3#/ (`*` SÔ ` * ''*# @@  `'#ߔ U} h ''@԰     ? ?''''   ` '˰ `@     @`ܒ ,  Seؔ%VԒ ( ̐    耢 ?  #   $  H+ U  |$'`".Ѐ2' '' @" `2@`#P ZȀ&#E   @Kа  F̀ @?#@27& " 1&?" ` "`̀ 2!  :  & # `` ?$ @` 2 &@&Ѐ "@̀ :㿐 @@ `(㿐 @@ [`(W ` M  ``6H /f * ' > !ؐ $ $߫ $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8    7 2`  7 "` "`0 $ `(``㿈 @@O'찒 6` " '`"`  0)`(`}` 2` `쀢  8' "H `"A 쀢 >㿈.谒 ''@"(  22㿐 @@ *`"   #  (Ð  `  @ ` 8'``! `! =㿐 @@ 0`(  $ ( 9`!є  ! ߋ  `  @ ` 8'``! `! 㿐 @@ 1 `(ܖ  @ ' -X  2   7`  @   2 -    `! ``! ̐㿘8O L  ޝ6H /f * ' > !ؐ! $ $R $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8  2 < 7 $ !+ 00$ *  @*`2P   &" vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapuipc 1uipc 2uipc 3uipc 4piusrreq㿘>   `  ^ -`   ` `H -```2B `<.`>!X €`7 8@]3@0 @)` & $ @ @i`    2  >& "Wa( /@ V  2>>{#`   @`, ``l"  &`l @$`, 8`(`d#  &`d 8S$`( _# @ ր V < v>` ɤ 8@ À `  9`  >!(`8 `     7 @   "`   > # `8   `8Y` `@ , l" " & l` `@# ,` (`8 d" " & d` `8# (`  [ ې#@  5U  d&@V  ?` "?`8@&@?&``2`0> a$` "a`0 &(`4&&&,& &$`:&` "+&  & ``!u$ ` "&   "&  & `  !d `   & ` !Y  & ># ߐD`p $p$unp_attach㿐 d "V <  8V "> "> >>!8<>!@DL =!" 8 O  " 7@L 8& $@ * "@*`@*`$ 4$ 0㿘  " " @S &  "  @ @? 6  2 " i > "` P @P   ` @?? `N `@KȐ,  'x'T'P't'|@ΐP 2=` d@;td@0@z@* 0@E '$8 !7d@9і d`@9t 2`$ &  ݿ & @;  P` D`  a '''''K?  (0I* @v D< > &@@9. 5`"1 =TV@@, )  `$` h 2` =  `沔 m $  $  ` $ $ $@ @unp_connect2㿘V@V@  )`" V  >""  " ɐ "Punp_disconnect㿘 '& R`` 2  $   2 >"耢2$ & ` ?2`$ 㿘R`   㿘4 $   $ ) Oz unp_externalize㿐 >  2`/  "4 ( @z'&? * (')> +>  .ה `8^ * #@  `" ?K%"? 㿐    `?#@2X  @Q 2  @  @` '* @`2` < c "8 ` `2 @&@  '>  * ` ' `  "` ‐ "`$ ` ,!    㿘> ia  > !> i  %  "a?#  4  2 a 5?>#`#> i%>  `(  a4  $a 2 @ 4 T 2 (" `2 ` "L@U@ 2  a> bؔ  &L* a  ` @2    2  $@ ` $  2 @R` 2 ?`( "??` @0 ?`N7 &%㿘 > @bx㿐 2 +?#R 2" (` 2` 2@?2  `  @`? 2R  @> i  @2㿘 > ‒" "0@ vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapbremfree: lost tail㿘   > # >    #Ȗ # 2#Ȁ2 8> # 8 > b?"b 0@2 > j  0" > b?"b ` "`"  "㿘> # '>!>-> ""*"0>  ` > "a0 @G"4"4@NA00@S0!P#!1> g +> ! |@H> !,`? $ l$ H$ D$ h$ @$ xbb$ 8 8$ 0` > j> `>  ""#> "> `"" $  "` ""$ > `Д`Ѐ $`" "`$ 0`@ |0> "#   :2: > "`L> "L @G  %̐ %0` `̕: 4%́㿘 @e  0"2' 0 & 0  h? && h@8> `, ",'@ 㿘\ @< 0"`0 &0? h? $&h@7> `, ",``2" @@ 2)@@ @ 0"0  "0? h? $"h@7 > `, ",@ Ӳ`@㿐\#`'P'T#\PT 㿘 0 2 \ \ " \ X "  \ < @" \@TP ``< 2`X` ` `"`p`t "`t "`p 0? 0a $ 0H /d* %  > @ 2"  \>  `0 "0 \t "tH p@ 0@ $ 0@7=` @<@㿘 0 #> 0 & 0H /d * % @>  "H p@>  `0 "0>"@ F *>"@ #h*`  @0  0 & 0 0b& 0@R㿘 0`& 0@6buf_dirty: incorrect number of dirty bufs㿘 0  0`& 0@> >b0  "> Ȑ#buf_undirty: incorrect number of dirty bufs㿘 0  0 & 0@> c? "c>  㿘H /d * %  0  0 7& 0 0"@" 8 0 & 0 8 $ x 0@8 x > (`@ 0 > # 0"# & 0 \ " 8@?@Đ 8  > j> "> `"" > > ` ""# #& &  0@> #> j  0` " > "> `""> # 0 "&  &  "` # #&   &  "@#  0>ߐ# @& 0H 0!> #Ā #h $#> g"` "> > b̀#"h  0 @ 0*@& 0hɐ㿘 @M> `> aБ*  "  P2  \2 0  2 P getblk㿐 '@MԐ> `> aБ* @ >> P25 \21H /d * %  0  0  & 0 fr H p@ Ӱ 0Z 0@,H 0 2 P >  @ 2@@ &@" $@& & P& TH /d  0`0& 0JH 0Հ * % @yH 0 `"`0 "`0@4㿐 @Ґ 0 "0> ЖЀ "@"`"" @allocbuf: buffer larger than MAXBSIZE requestedallocbuf: negative bufsize㿐> "@@ * @ ( 8>#"& <:A 8%> В @ 0 "0Ѐ "@"`$"  8 8$@ 8  H H @ @ݐ" 8@& 88""8`8`< 4"`<`8 >#0   8 ǒ  8(<& #  'H 0$& <0 "0H p@ H 8H@㔔" 8""`8& 8"<`0 "`0& <getnewbufDirty buffer on BQ_CLEANBQ_CLEAN has buffer with dependencies㿘& -> +> )> '> H /d * % cL@> g#"̀@$> >  > `> g> j > g">`"""e H 0`\ 0> # >  "#> #Ĕd H 0耢` 0 $ 0 0`" \>! @PH 0 x " h>! ?$ 0$ D$ P$ T$ X$ 4$ @$ <$ d$ `$ t$ pP $ h l?"P$ l`"  "` "@&flusherClean buffer on BQ_DIRTY㿈>  > j'> "`-> /> +> L@ > >#P  d}  ?H /dc* %c  > # 0 $ 0H p@ 0@ӐH /dj * %c  0 2 x>b X 3 0@.> 0    ! 0 $ 0H /d * % > j` "`$  $ "$ 0 ?$ 0)c<>  L@ L"@ '"'Вb@ ?耢 pH /d * % c `Lbiowait㿘H /d * %  0"  #>c0 c˘  0b H 0 0$ 0  ;$ 00  0(  4 " biodone already㿘 0">  0 x"& 0`> $`@ 0@  0@*  \& 0@ 0 @  0  X& 0€4 0 0 0 *@& 0elvmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map㿘>!H`2*@&  > a` "` * &> >  T  ؑ*   2  T@2L 2@H ! 2 2 > a`  s"`2 > a` D"` 2  T `;&> a` "` `  "`   "@$ > aP`$ `""`H   > a`  "` aА "a `  "`   "@$ > aP`$ `""` ?'&@ `>  "`  P"   "@` "` "$ PP $ P "`  "`"PP$  cache_enter: name too long㿘 $>> (!H`\#> >!p`@ > >  ~#@A @`%>  $`!P!P E ` "` "  "@ ` ` 2"  "@$ `$ `T $ $  T !$ , *>:$ P` $ `""`>  T> c  ر* @@ $@" "@$ nchpl㿈> !P"!P"`!> >ap> 㼒 Y< >>$ ؒc,T > >#`#d#h#a#\ @  { > Ē Ĕ"`T> >  ؇(*Đ  2 :Ą""`T> P`5 P`",`X""`&`"```  # ` ` ` P@2 `@ "`PP"`aP` ` "P"` 2`vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapcluster_read: size = 0cluster_read: DONE bp㿀`> H  ` "0` )`   @   0> `$0`,  "`,  >!P`" &`@`  &`&` ?`   ; @Em 8@ @/ ?$`4 `` : @*&` @ `*` 8 &` &`` 4'  #`#d#\Y[  ; @E$T8g@b! ]@/ T?O$`4 `` : @*&` @ `*` 8 &` &`` 4'  #`#d#\ @e  `0$`0$`T@`  >  `, ", `0"> `@/``0" `0?# @$`0`@/`"` `<@>X`P@&`}cluster_rbuild: size %ld != filesize %ldcluster_rbuild: too much memory㿐X L\` d>!XS  ; @DQ<8@ y w  0& T& 00m#\@h 0"a. + A &&&&  L< &`@& L1   L `8`@@ `H@ >!`0 &`0W   @ `0&`T u&`0`0 &`0 @*`"`&   "ʒ 2  0 & 0& L& XC +ΐ㿘`   `0"\&`T\`0> @`&`T&`X&`0cluster_callback: too little memory㿘 0(  4 L& L  H??@$  H@ݛ 8$ <`$ 8 0$ 4($ 0 8"& 8  $  86 H>d $ @u" @p$ & <& XC  + 0 0 0 *@& 0a#㿐 P \&`&`&`&` ` " X` 2  X <` ;`  T "` X@L@F<`?`P' <``8# =@C ` `@2  <2 <` < @` *`` @-ђ ` M *B + <` @{ <  (B +?&` < ; @Bё=@"  T@-M  T? Ȑ&` T&`&` !&` &`&`&`&`u&`    @5 &`&`d&` T&` cluster_wbuild: size %ld != filesize %ldClustered Block: %d addr %x bufsize: %ld Child Block: %d addr: %x Clustered write to wrong blocks㿘 X L > _?s   2 ` [0͐  `0 0I0 r `0 2`<?͐`8@1?Đ?/  + ? `<$`8>$$$ `L$`0$`X`H @$`0@$`Lg  8  0 2 Pb   $ `8`T:  T@ >`PZ!  T> PU!P>ڐ!p 0?a $ 0 0`$ 0H /d * %   \t "tH p@ x > `" H@ H@Ŕ`<- `8@$`<$`8 8@"$ 8 "@   ``  `0 $`0$`L$`XA> +?"!㿘`` "  *  ?H +`  & @&  .` <5?`@  .`" `& vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapvmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapvop_generic_revokevop_generic_revokeall㿘>  ` >"  @(1! >"& @  \ 0(!(& @ @  " @`  < <@2  " @ Ґ  @(2  @ >& @@ ߒ 㿘D 㿘  $@   㿘    5  㿘   5v P > 8 `@" "  2   vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map -operation %s not listed in %s. vfs_op_descsvfs_opv_init: bad operation㿘 2 !> !(  >8* !(@;*`"  >>#> >! "  a8XCah * $  2vfs_opv_init: operation vector without default routine.㿘> *` > >"Xa(     a( * " a( 㿘> ch@ " ch   ch@   Ƞ  >h >   2> "a(   "a(㿘@ t> @A#>>#`cd"#` "cd  @?`(vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map㿘W` Z  "@T @ B&M `` @2`?? DB?4> 289   (  7`/  =: 8`< < $ $ 4 $ $ $ $$ (\ 4   0@@6@> (0> ( 㿐V  $   (_  @> ( ###> @    @2`l>ϒ ( `lc`@ ># @   @ @2`?*  @2 &  6 @ 6 & & , ( ,& 0 ("@$ (c Zɘ    ,` 0"`0"( 0 ,"@& > (@D 2'  @W  `*`>" €`" "& V   R` @Q   (>T2 V R 2>I (w  @  @ " `B  & :@@'^ V   R 2$@  `$`,`"0"`00"`(0,"@" ", (,"0 ("& ( $2,`  " ` '&  "@= (v  & "   B?:@'e`" "&  `B :@ hdhhi`jPj㿐  2'0O`B L:@@?`C> L*` € ( "=05 @   @"  @R $"  ( "=   B?: ' `B  : @V  kTktkkl㿘@( "  6`6` >@ 2   ?2    @ b `B >` @?  4&`&`6` 㿐'  V   `  @ 2T lf_findoverlap: default㿘'` ` `@> "  `@6  ? ? 4 @2 $        2     4   8  & '    @     z 4  ?  4 2c  ] 4 @@  ? @ 4 2E   ? 4   @ 422  @  ? &  4> @ @ 4   8 2>?>  >|!p 4 㿘 `@2   ` @2 ``B > /&` `@  `@  (` B?> &`  (:F 8` (`: (D  : :  :  0: : 0: " ," $ $" (`B> &` & 㿘 $`0"`0& (0,"@"  Y˒  $2,vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapnamei: bad cred/procnamei: nameiop contaminated with flagsnamei: flags contaminated with nameiopsp,$ `@$0` ">``2$>{"?"`>{" $>{"`$ 9 $` $` ٖ$` `  @` `.j   "  "``;y $@"$ `@? J? /2 `? *`L /"?` ""$, $  $ > i"$ `J`/2  @  `;C 0~@  K  $ 9T `'` $  ?'''''''@%а   (P`; K`$ # ?( ` `; $`*@@$`J`/@w @`$`@4$ @`@ @@d`:  $` 2  @%  `$  >`:ʒ @I@$leaf should be empty㿐$`$  `` `"` `@$` b*$``$@"ߔ`J /2#$` J /"`""@$$`< v J 2` 2$k $`  +$`$` $`@$`J  /2``"`$`Q ?$" $J`/2`J /"" "$$` $`*@$` J 2`` `*@$``  $`  * $`` 2``J` .2 `J@ .2`` *@$``@"%$ ' @ @͐`@"L > i"쀤 2@$$@` "$`!"X$$@" "8`   >z,#?@ ?X`< ?'`@@`@"$` ` X <` $@v  `*@$`` ""@$` "@$$` J`2`  $`  @k 2<  €@ 2g`@}$< ` a<  @@  @@"$$` S$``@ = ` @2 @$`@`@? `( X <`# X <`` `@ @$2`@`  @#  `   @@@#ؒ @@ $relookup: null namerelookup: lookup on dot-dotrelookup: symlink found.㿘 ` @*@ b&`@!+J@ 2>y(!@">y!!@!v "@@ ?>y#Q O  X <`J@I @|E  < @">x"?  &  X <`!`" X <`" @`@T`2@  @#J     @@#? @@t&@vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapvnodes㿈>>c,T #`#d#h> > !  `#\ nE > > > i""T"a"> #"#"`> g""""`> ""> a"a" > @ p"bāvfs_busy: unexpected lock failure㿘 <@@` @& <UP   @ -   > xR!H㿘  -w vfslock㿘> > cd``@8 2`$`2  6 !@3~!>    ,ۖ   $ $ @ $ <$ $ `> `$` <*  $ <` @2  /,   Y &  %s_mountroot failed: %d 㿘> "8 "> #d " !>  "  $ #0yU  $ 2  > ȆȀ@" `d 2 @`h 2@ @ 2`d 㿐 > > @  a * & d`& h`4aa?# @ `>  ȑ* @Ȁ ''a `'4a & dJ   *`J8*  ???: H2 " X": " <" @" 8" 4" 0" ," (" $" D" " " " " 2 vnodefree vnodefree vnode isn'tcleaned vnodecleaned vnode isn'tClean vnode has pending I/O's㿘> > > > ja p"*`  #a H /d * % pb > g"`"> #`#쀢 "H 0 > ͒ nx!@2Z b X$b 2 DH 0 >!v!&V  "  \>!!@J>!v!` `"``" ` \"@ L $ LH 0  < @Ӑ >!!@(>!vː!H /d4 t* % t  >!v!H 0 $ @$ L$ $ <$ $ 8@ & $ D$$   X ` d" h h h h d ` " X`" d` d h`"`" h㿘@  㿘@ 㿐?> &@#  ' &@$ <@  '@&@ 㿘<> `  Y @H @>` ?> * ` @@    ` @ < <@2 D @: 瀦      < "  3 $@ " " " $@"" @$@ @h@& @ @ |@( 8& 8& W$<vget㿘@@@ @! "& @>"h  Q˜ J  D 3` L ". DH /d4 P* % P    \`2  ` `>  "# \`" ` `"``> g"" ` \"@ L ?& LH p@  D` & D@ "  D? & D@ 2 vref used where vget required㿘 D 2 >#u & DUse count is not zero!vnode already on free list: vnode already on free listvput: null vpvput: bad ref countvput: ref cntvput: bad writecountvput: v_writecount != 0㿘>  >#uG! D 2 ?>#!@>#u<! & D @ 0P H >#!@>#u*!H /d4 D* % D  >#u!8 L "  P>#!P@k>#u!p `& L> #> g" < 2& \ & \ \"`` \""& ` \& `"@"H 0 @* vrele: null vpvrele: bad ref countvrele: ref cntvrele: bad writecountvrele: v_writecount != 0㿘>  >#t# D 2 ?>##@>#t#Ѐ X& D H >##@>#t#H /d4 D* % D  >#t!8 L "  P>#!P@>#t!p `& L> #> g" < 2& \ & \ \"`` \""& ` \& `"@"H 0 @`@\ @LPD2P\"`` `> g `\ "\> \"` P"P㿘>     : X/ d @ 2)"  D H "" < 2 D  " <? @ @,> #$ 8]  2 X`  vclean: deadlockvclean: cannot reclaimvclean: not cleanvclean: lock not drained㿘 D  & D @!"!>$sː#p& @@`@-@-` ? @  ` ?@W@ @"@  >$s#O D? J& D P >$s#H /d4 D* % D  >#s!8 L "  P>#!P@Ӓ>#sv!p `& L> #> g" < 2& \ & \ \"`` \""& ` \& `"@"H 0 ! ">   @2 >$#@ 2 & >  & 8Ò @ @?c > "& & @ & @Q㿘 D  @ 㿘>  @vgonemissing bdevmissing aliasvgonel: not clean㿘 @! ">%& @  N٘ 0  X M  <? 8f D `"b D@`"2`"  2  "2 @>%r" @(4  @    @ < <@2   `  @ < <@2 `" `>%r#2 @`@ 7#`@ @ 7& @ 2> &  D `;& < L 7H /d4 P* % P  >%rj#> g"@" \` `"``" ` \" & \ \"`` \"`"& `H 0 ;` ?> అ(    @<@2 " 㿐@ ?* c`@ * @ؔ @ `@`㿘 @(2 " D  @@ ` ` `< <@2  D  2 VBADVFIFOVSOCKVLNKVCHRVBLKVDIRVREGVNON%s: type %s, usecount %u, writecount %u, holdcount %u,|VROOT|VTEXT|VSYSTEM|VXLOCK|VXWANT| VBIOWAIT|VALIASED flags (%s) X >&s#`<> `* `H>&`D#s`P`@`/>'`(@5`@ >'`0@5ߐ`@ >'`8@5ؐ`@!>'`H@5ѐ`@">'`P@5ʐ`L >'`X@5Ð`@(>'`h@5O >' xr֒` >'>'rϐ 0r̐ @㿐`6 >#dF    $=  2$6 \#\`,-    `% ->#`HW > #d   2$ I* ( -kinfo: vp changed 㿐 > j" ` *` * " * " * N&@$@&@J > @!!ȶ ? />  c / ''+>'`X > `r6cH``dɔ  2`” 'SȀǐ$@&@   .  @* %  < <2  `  < <2`"  㿘\`  <"z $`0`4 P $`4 < "l$ <`i d  @ 1.@+`XF\ U `\@$d_,`d" \`3 B d@$ g,  . 4 `  > !Ȗ `"@2`` "``$€@ 2  7  @"  $`0`4 P $`4 / 1㿘 `  / 1㿘 %>(    (/z & 㿘@" < <& <! J " <!& < 㿘   )> '>)  @  p( 2  >)p"P>)p}"ެ syncing disks... giving up done 㿘H o@>)pc#0> b >   @"h@  >)>)pP#H0pM#Xsoftdep %d 㿘>  > "h @ה  ' @c /> g5> 0* ဒ"@*` ? 6  )>) 0  "  0 &ထH /d * %  0 $ 0H p@❐  ` o# ဠ?  `>)#oH@㿘`  2 -> #` >En \㿐  -\#\ِ 㿘  t   t L`$ L`J " tvwakeup: neg numoutput㿘  t??& t>*n" L`  & LK tvinvalbufvinvalbuf: dirty bufsvinvalbuf: flush failed㿘`IH /d * % >*  p`.H 0@[  H /d4t* %t  p >*mÐ#H 0@ː0H 0H /d * % `l` `P  ````P &```p` 0```P &``9 %>* P &,0 0  &0 IP "lH 00+[0 &00``0 &0ᰐπ l  p >*m@# H 0 vflushbuf: not dirtyvflushbufvflushbuf: dirty㿘H /d4 p* % p ' >+ 0   0 mX 0 $ 0H p@ \` 0`0Ѡ`` >+H 00 p  p` H 0>+"10H 0bgetvp: not free㿘`\ >,l g&`\ <? ?  &`D&`D l &` l`"`  l& l&` brelvp: NULLbrelvp: holdcnt㿘 \ 2 >,l !P#!@  `"  "`   "@&  L`"& \ p 2& \ # L x`" | |"`| | x"@& \ P`2 L>,lo  # P` D  \`" ` `"``> "# ` \"@# \> gb` \# ``""`㿘 \  0"@`t`&`tr ` "`   "!P!& reassignbuf: NULL㿘 \ 2 >,m"0M!P#!@  `"  "`   "@&  0 2 L L`0 l p 2-@ $ L x` |"`| x |!"  p <   > > 2`@ :`  `>`@% > @ܐ@ & @ "` $@& vfs_register called with vfc_refcount > 0 㿘  >,m5#>#d #d @+~   $  $  > `@4"`& $" (`" @ 㿘>#d#d $  @+W  2 $ 2     $$@d     4 $ 2 >"#`  <  㿘H /d4 D* % D  >#kV!8 L "  P>#!P>#kK!p `& L> #> g" < 2& \ & \ \"`` \""& ` \& `"@"H 0 vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map㿘#>!> `  =""> `"$`>@>> " H4L(L x"|| ||x > "*` "x x |" "|L"LH sched_sync: fsync failedsyncer㿘>  > />"`+> 9> 7>)>5> 3>." * `@ %%H /d@ * %9  @  /H 0  @ @H /d4* %  p  > < ">>.ja ( ` 2ǐH 0@  ?% ` (`H F% 㿘H/` /> ` > l @Hِ H 0>`>2   :   > `# "  㿐> "Р ǖ 0$  "`H> >  a "`<"> > 3 2   : :`#a  "> 2 :`#a"  $ 㿘  "X> ϐ >  ĐW  `< ?`$`< @    " `< @$`< c 㿘 D 2X  @ 0" x`"||"`||x"@"HJ  syncer vnode 㿘 >/k  ">/ >/j  vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapvfslock> `  21) a`@ D'h'@'d'DF'l T@`P 6@ 2XG  <  <@ @$ < l@  02 "ڐ0+``!* &` @`@@ݒ  @  0ϒ2 "0`" `!  &`@   <  @   !>#d@`` 2`$``yʰ @# #d``@( 2`$`2f -  _  &!@#!>/   P   (@>$ $ `  <* @ $ <`@#p $ `$ l` " < < `@$ < <>ߐ# $ <`  ~ @  $ <` `@ <@ & <@ $ < <@*@ $ <$ < <     8 "$ *$ 0C$ 25 ` $`> a$$ aȀ  #!"!" @2 @ <`2ɐ   D ` @0 " ﳐ' mount: lost mount㿐 D 6   € "> >0g#P `%> i` 2  N$  2 ` D$ ``2`쀢6$nP@ D'''''룐 . X`l   /l2 "`<O0`<@ @ C ?    `@ unmount: dangling vnode㿘 <@@& <!>  @`  < [& <  " <C < 2   @ " @    %>  < 2  <  2 <$ <@*@& <@`bĖY  <@*@E <*@& <1"Ȕ!Ȁ@ "` Ȁ@"@ ` E"`  "  @>1g!@`bĖ(  <@Dѐ&  㿘> ! @+%>  q "`<` 2` ?$`< @@0`  @ "``< @$`<`tȀ@ڐ P@ @'''''ꦐ   X `` `@`㽨@ @'''''ꌐ $ X  D  > <* $ D !2.K  G!','(`! L@ Q@ #L`( X  D` > <* $ D !2.   P!'t'p`\!``@)U!> !ȶ!@@F ?#P/>   `3@,*`D`` " `<@ƒ`<2 $- Ӕ!'t'p! a@Ȁ@Ð` ( ''홒0' 㿐`@@  @ (L`@ ˔ <`  `@@ @u $ `  F  ` €\    @ذ $MP@ D '''''@3 ` &`P !2 -G 2@ D'''''@  "  $  $ 㿘L   <   `@@ @ 0@ Т`40  ` @$`` @ 0'`8 '8$`\@+ '\'<$'d 0   ; 8@  H4  ?`\ 0 ?0 &?" 0l0w $`\4 2`4>2 4!"4 0("`(  ?7 ? 77   0 @M4 @ ;4`@ 4 29`@ @ ֒4` 2`X  <` `<  @  '4  ?@ {  @ 4S @  s400 @0 &0 !2,B & D@'''''a ؐ@  X d' h' X$  `f 2,'T ``  @`b \X `@;  S 2  FT` h T'T`< ` -  !@ ǖ dT`<  @ Z |T @  udT@k T @ T@ `i  ?T@  WT@ f O`T`H "`H\ `2`\ 2 \>!"`\`0T3"(  ?7` ? 77`  0T@$ T\ @hఒ  \S  @ T\X 0T`@ \ 2T @X  &k\XT ,`a2+< %x@y  두 2  Ft`  t@ t `a ` !2+ 2/0@K  2'c 2   F` ,8 2, X P    <>*@`!'P*`a2*֦ o` `j @ 't 'P'x'T'|P ]` ( t`<`$ /`* `  7 '8    2  '' '  2d` @ dtd@   d@ gd0d`t@ ,@ ܒtdސ S Ր@  'P't'x'T'|惐P 2-` d@ t`@ `. ` 0  '$`  *7d@  d`@ ߔtP@ @'''''G : <   ` ''''5'ܰ & "`@ i@k  d 0 @ B`@ < Ē@ ԰Q  $@$ؖ 2:`  'P't'x'T'|P -` d@ $t`@& `원 ` f`$ `8 !7@ dd`t@ Ę! P@ `'''''岐 . @2`@ @ X   ٞD @ IJĒ@   @ ’AāP@  '''''v '`@ @ Ā쬐0"  @ʈ @   @ { Ĕ@ 8@`+ @@ 2T E B  (`< = ``? " `  & 00 0-` @ B &  @ B <  @  ``@ B  @ C < `2``  `<   >P`?@2 ` D $  ` $ @'''''ܰ 2$ ``*`` !``2`@`@- @ }$ $ @ D'x'P't'T'|䰐P `@d`  !2 (v 2'` `@ 'x'P't'T'|䋐P `@Ɣ?`  !2 (Q 2'` `P@ D'''''g `@ (@ '''''Q ! <  `` `  ?''''''''@ `а`" &@ @'x'P't'T'|"P 8`` @ B`@X`< & `?a2`' `@ؐ ?   脐``'@ِ꧐0`@@ <`  (@ `@ؔX`< ' `?a2`' `@ ?   A``'@@ ) `?@- @ @'x'P't'T'|㑐P !` @`@`X`<   ` /7@_-0`?@+ @R@ $  (@`@X`X`<  ڐ` /7@.@  @ @'x'P't'T'|/P K`` @O`@'X`< 9 `?2``?!<`a2& 2`> \`<`@ږ ?Ð*@ <##灐`7`'`'@@Ӓ顐@'P't'x'T'|אP K`` @`@ϔX`< 9 `?2``?!<`a2& 2`> \`<`@ ?Ð*@ <##)`7`'`'@@{I0`@t@ N`  (@`@zX`< 9 `?2``?!<`a2&9 2`> \`<`@- ?Ð*@ <##Ԑ`7`'`'@@&@ 潠`  @v '''7  D耢??'?2@?'@ @'h'@'d'D'l@ - P @&`@`X`<  + *" " * *   * *''''@@Ȑ薐 a`  @vW '''۔  B耢??'?2@?'@@  0   (@ΐ`@`X`<  + *" " * *   * *''''@@p@ @ @'x'P't'T'|qP +` @`@i`<` @ @@  `?@50@.@ , 2(&  @W`@/`<` @ 2子`? @@ 㿐@@  ! (`@@  `X "  <@@U@k @# `'''''ؐ 2< `,` '''h'l'Őh  @b|x`< `< ` ` `<  " "? $  @ @Ā  @@` @Ű @ @Ĕ|@<x@@結`*`"%@祐p  " ? @ `'t'x'P'T'|?P /` d@ttdv0q ䷐` '$`` *7d@B d`@t `P@  ''''' 2`<   Ā`@      @ @ @  Ĕ@@Ā0挐8@@ z'` 2`(s '`< m ` `''''''''`@   ?  @'' @:  E`@ > `ؐ????Ȓ@  (`@2`  @ "`  X`< "` ` '  "(:`  q`'"@ & $ "`2$@ @'x'P't'T'|6P " `@    "!2  `D `@(@ X @*`2P   " 㿈 @`@ +`@@"  2R  (`< " ```? #\n 㿈 @`@ +`@@"  2R  (`< " ```? #\nӚ 㿈 @`@ +`@@"  2R  (`< " ```? #\o: 㿈 @`@ +`@@"  2R  (`< " ```? #\ox vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map8`,`d$b ;  $`(i$`$ L$`(6 ` 2`⼐`'7@N ``@`$ {#`@V`$``@W `̐ `h$`h }$`$a  D$`( ]`<  T -bP d` !@ D`d< = @? 8 @ 1d"< 2 @L @`@ÐJ  ?@ @H ` H &H^㿘 X <`" @ <` >?!*` €   @ " @±   ԝ㿘` H?$ H@䮐p`d hl`@a'\ '''?'쀦 '' '@I@V$  "  @ 㿘( @N`@&@ > < * @@$ @ C >@@ 㿘 ( `<   2   2  2  `X " < "  @`@@>@ @$B>@@N 㿘 (@8@ "K&@&` <?`>@!d*` €  ( 0&  *2 @ 2 >`86`6` &` &`&`>`0&`&`&` &`$&`(&`,&`@&`D&`H p | 8`( <?`->@"̓*` €"@0@@# 8`$ " 3&"z@ T`@s%!@    @T`@b  a@ ` "[ "`   T T L L T㿘  (@TV vn_lock㿘@? @c#>@ @! "@@`  @ $ @ c 3Ϙ  @@2 @㿘  (]V 㿘 (@5vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapdefaultvop_islocked㿐>!L 8!L''*` €vop_lookup㿈>!x 8!x''''*` €vop_create㿀>! 8!'''''* @vop_mknod㿀>! 8!'''''* @vop_open㿀>! 8!'''''* @vop_close㿀>"( 8"('''''* @vop_access㿀>"T 8"T'''''* @vop_getattr㿀>" 8"'''''* @vop_setattr㿀>" 8"'''''* @vop_read㿀>" 8"'''''* @vop_write㿀># 8#'''''* @vop_lease㿀>#0 8#0'''''* @vop_ioctlx>#\ 8#\'''''''* @؁vop_select㿀># 8#''''''* @vop_kqfilter㿈># 8#'''*` €vop_revoke㿈># 8#'''*` €vop_fsync㿀>  8 '''''* @vop_remove㿈> < 8 <''''*` €vop_link㿈> l 8 l''''*` €vop_renamex>  8 '''''''* @؁vop_mkdir㿀>  8 '''''* @vop_rmdir㿈>! 8!''''*` €vop_symlink㿀>!, 8!,''''''* @vop_readdirx>!X 8!X'''''''* @؁vop_readlink㿈>! 8!''''*` €vop_abortop㿈>! 8!'''*` €vop_inactive㿈>! 8!'''*` €vop_reclaim㿈>" 8"'''*` €vop_lock㿈>"4 8"4''''*` €vop_unlock㿈>"` 8"`''''*` €vop_bmap㿀>" 8"''''''* @vop_print㿐>" 8"''*` €vop_pathconf㿈>" 8"''''*` €vop_advlock㿀># 8#''''''* @vop_reallocblks㿈>#< 8#<'''*` €vop_whiteout㿈>#h 8#h''''*` €vop_strategy㿐 \>''8*` €vop_bwrite㿐 \>''8*` €vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map    dead_read: lock㿘@  " >DT `@   dead_write: lock㿘@y  >DT ` 㿘@o   > #\8*` €  㿘  \ " @U    `0("`0̺ 0{ 㿘 @@ *@&   2 @7 >  "4 8*` €㿘@&  "       tag VT_NON, dead vnode 㿘>DU"  dead_badop called㿘>DT6"8㿘 @!   "& @1  @!"vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapfdesc㿐 <@@2 -@& <I  Yΐ Z`@H"  @D Z>D"㾔   㿘6` ߲  㿐  @   "`< @ "@&@㿘      D `D*`"  * "" &`&` &`&`@&`&`&` d` j  `Tf Z` b Z `@t   vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapfdfs㿘># > g#> > !> 1>E>"D>cP  "D  , 2  *  t0  &J $b$!X"    㿘>  > "  k F> b0> @$* @@ >  2 `X2   5 2@ $& 2 > # Ж "   "`?$ $ $ $ $ @ $@" $@$ " $ fdttystdinfd/0stdoutfd/1stderrfd/2..㿐        Q `2 N .2C%@H " * ʰ 2 >Ec`@  2 X  j %@`"<' 2( >Ech@  2   , " ! ` 2X   E  %@"<`{   0$>Ecp@   >E#x >Ec@  >E>E#  c@   >E#  =X  U  "`%@"<9 0K  >Ec@    XR 69 А  ,`*`* :` ?Ѐ@  N @ ,`  `2X  `  `" %@`%@㿘  `>F#*` €   "`\> gat         fdesc_getattr8  ` ` >G#*` € `@ ;` $ ` `` !m!m  4 $4 $ D`@3` < > g!t!   4 $$ D4  <  "4 4 < $$ D$ $ `X" d> $ $ Ȑ  $ 4< H$ $$ ($ ,$ 0$ 8$ <c$ @ `   * @ Y  ????????????  2CҐ< @ >2` # $4 ?# @4 4 $ $ $ $ < $ $ $$ ($ ,$ 0$ 4$ 8$ <$ @$ DЖ @ < H>GQ $`< H H d H H㿐` ` `  ` 2 @?. -, `  #@? -  ( X`<   < `Ґ` G 0 -%d㾐  `   2  `    @    7` 2M, >* c~ >c<y @    2 ``, "'a `2 `? + @" `'` ;/ `/ " H` B #<&@=? 69 41>H/>E  4   '/ `,@ /, @ ' Qؔ?// "k   ? ` Ԁ < <㿘 `< "` `   -`@ "E㿘  `  -> gat   㿘  `  -> gat *  㿘  `   -> gat   7  㿘  `  -> gat R  㿘   7$ < 㿘  `"`" e &  `>I(`  ` "`  `     $ $ $ $ $ $ $ $ $tag VT_NON, fdesc vnode 㿘>IP!( 㿘   ! 㿘    fdesc: bad op㿘>IOY!vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map   㿐` 9    $`  R  $` $ D  $  " $ ǒ $`$ ` 2` 2     $    2  $,͐ "    $   2  $,  ! K  G+>) H!`  *   20  . $   &   ! +>) !!`  *   2     4 fifo_read mode㿘    @>JN{! 2 5 "`!4`      ϐ `X@2 ` ?4` " ` >4`  #2   ` " fifo_write mode㿘  `` >JN/"8 "  !4        % ` `  >4 h  "~@"#       'm   "  "  ` ' l  h   ` 'm\  0"  ` 'mN   㿘   7  "       㿘    `? $`G`  " D` ? $` E@D  {@`w @  $tag VT_NON 㿘>KN!0@ >K N!@, fifo with %ld readers and %ld writers㿘 >K !xN " "  "    "     -fifo_badop called㿘>KM6"8R  2 >p" 88>" 8` <`" "``$2`$  <T  "T`2``"`T\2\ <8"    2    ?(2 `   <|  "|`2``"`|2<```d `l`h"4" ` 2  ?(2`p  vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map kernfs_get_rrootdev: no raw root device 㿘> -> < (">#  %>?# '?b< @ `2 @* * @ @ @jh$b<  c  ?>L$MՐ Ёkernfs㿐 <@@> 4 -!  2, @    "<@`"@ <&! & <"z  Y Z`@y"  @u Z>L!Ȓ   㿘!6` D ` ے 2 C!  @&! 㿘!>  `o`&@㿘> &@""&`"> j&``> > j!p D"" "&`&` &`@ &`&` d` ۡ  `T۝ Z `ۙ Z `D`@  vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapipsecversionusermemtimerrootdevrootdevposixphysmempagesizeosrevosreleaseostypencpumsgbufmodelmachineloadavghzdomainnamehostnamecopyrightbyteorderboottime...%ld %ld %d %d %d %d %ld %u 㿐 5x [ "#    0! /M 0"s> j _ Y 0K kr 0@c>MaL0l>MaL0f d&> " a@"b   @ @Z " U @ 6"@ "" 8 "` &D >  > j  ! >  > "2 ڼ ** > `Ȑ( `Ț(>MaL0 > >MaLx# 0@i @ ]"& 㿘 / _ J?` "!> "{> " J?` "!> j!m> " , 㿐     %@? q   >L . >%@`x_ ">  ` ` `@   ``[`@ >  ` G> `?5  `   -  %@U 2# !X     "` " ` " < %@` 㿘 `@ 2!m``   ڒ 㾈  ` @S҇$$ X" d  $$ @bw<$$*`" *  * $,$0@ $$:   44$ 'c! 2< <  @ - 㾐 `<   -`@ 'C! ݔ  㾘 `<  # -`  @   @8 "   2  .@ 㾈  <` L  8F    @  7>`,` 1 >b@, G2  ?" 쀢 " `  '/ / i    ` @& <`<㿘   $ < 㿘   &  `>O(`  ` "`  `     ?L ?t ?t ? ? ?\ ?h ? ?ttag VT_KERNFS, kernfs vnode 㿘>OJK#  㿘   z 㿘   p kernfs: bad op㿘>PH Hvmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map㿘>  `  > "`, null_node_find: vget failed. 㿘> !`> 6` ,> * `` #>P`2@`  X2 @ ~  I``2` null_node_alloc: no alias for device㿘>    % >     0`<  $ <   $ `` " $ $` $` " <&ޒ  <? >  ֒ >   $ <$ 8PU +> ? 6`;%>  >  `: ?*    "     < <@2 D ِ  怦  " " "`&>PGِ! @$ @ @h & @F``, *   $@ " " $` null_node_create: aliasnull_node_create: lower has 0 usecount.㿐"  'Q ِ`D 2 >Q 8>QG P &vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map㿈<@@a -~  [ T&(&&$&&,Y PҘ& <   D  *  X$@  z 0*@ "@$` `X< "$< $<$o Y Z`@m$@  Y `@b$@  㿘!6`  D ` ϒ 2 7! &! 㿘!>   `c`&@㿘! @P@"!!   "P& DT&@X@ &`\&``&` d&`h&`l&`&` d`   `T{ Z `w Z `D`@   㿘!   - -vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapnull_bypass: %s >#耢`@>R`G!@`  *`1> x  @ $@ "$ @ 8 @" $ @$ @` "@ <  ` 2x@@8*` € ` @?3`>!x@@   x@"@X@`" `!2  2  "@  `X] <  ` ؐ㿘   `X  d"`㿘  <` X <` f㿘   M 㿘  "`"`" z &  tag VT_NULLFS, vp=%p, lowervp=%p nullfs lowervp㿘 >S  H` G >S p㿘  \``$ \$ \㿘  \``$ \$ \㿘  ` @*@&  㿘 @* "  㿘  `   X`<@?  ?   X`< @   vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map㿀<@@_ -0  Y   R (` `J ,> # Ė耢 A  ڐ  " Ԑ  "`<@ "@` Z" "@"`# # `" <$!$< Yҥ`@ $@ қ Y`@$@  㿘!6` D ` Ђ 2ѕ!   (! !Z $!㿘!>  ` `쌐&@㿘"   D&`&` &`@ &`&`&`&` d` J  `TF Z `B Z `D`@T  vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapportal_closefd: error = %d 㿈'3蒒 >TE!Ё㿐   '%? I   > L .%Υ <  `X 2/ "`<    "` L +>`J@ "$   ސ $`$@` $` %`% ,㿘`"! =VV@@"` )  2` =   沔  &`portalconportal_open: %d extra fds ``'t@ 'l  \  X a t̖ ltbP 2l` (t lH /` * ! t` `$ '>U` `>!X *t  "W t` `$ "`H 0t`$ 2`^t2 tx \ @ @3 \t @2` ``'x`'|`'` 7 P'''    ?؞P''t ''''' 5 jl 'plh耢 ' &` @'ht'p  Pp "lg  'p k@l  " 6l ْ`8l`@?2  2` . = `>U? D_ $  @?` ,@ `R     =H 0l% \ l "t"t  t㿐  ` @0$ $  X  d""< $ $ @[  $ $ *`" *  * $ ,$ 0< H$ ($ <$ @$ D @  !$ 4 $ 4  !4 4 $  $   @2  @ -  㿘   ߰ 㿘    "  &      " `>Vl(`  ` "`  `     Z$ ZL ZL Z` Z` Z4 Z@ Z` ZLtag VT_PORTAL, portal vnode 㿘>VC" 㿘  G  㿘  = ̼ portal: bad op㿘>VA#vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map(%s)X Ȱ -> b   `1? `,>Va C  z 0`  `4`n    &`2` @b` =` "``  Ț   '?''''''@c'䰒 2k``    '?'''''''@cȒ 2W`    K* :I`  '  "@`   '?''''''@c / "?`@ 2L "        # q" 2 `  *'`` @z&`ג vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapwaitrunstepdetachattachusr2usr1infowinchprofvtalrmxfszxcpuiottouttinchldconttstpstopurgtermalrmpipesyssegvbuskillfpeemtiotabrttrapillquitinthupprocfsxprocfsprocfs_control㿘#`4 4@2`, ( @5 `,6a0`H(@&`,`4&`Xwm  N`1  `H`,(0)6a0>X0|}4>X0w`,(} 7`H&`,`4`X " `, ?`,*@&`,3&`X_N`1`  &``,  @aW @i` J&`0O`,(1 N`1  `H 5>X! @  N`1  `,( `H +N`1 2' `H2# `,( N`1 !>X!  H  N`1 0 ? PN`1   㿀 6 - '@䰒 ,>@ !Ȓ  -` >@! N`1 2``H2 ``,(`f6a0 ` vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map㾐@* 9! $@@  `  &``, `@`` @i.  2` 2 `N`1  @i%` ? &`> ,2   vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map total: used: free: shared: buffers: cached: Mem: %8lu %8lu %8lu %8lu %8lu %8lu Swap: %8lu %8lu %8lu MemTotal: %8lu kB MemFree: %8lu kB MemShared: %8lu kB Buffers: %8lu kB Cached: %8lu kB SwapTotal: %8lu kB SwapFree: %8lu kB `> "  D L(   +*" +@( , + +@ #t* + >Y(#h#l#p#x###\#`#d#|##@" 2  "@  `   㽐"'@  `2  "@@''`  "@ vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map㿘  @ `,@ ` `   "`` @`@wW` 㿘 `  2`,!" `4-!2  `4  > #  vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapH    @'@=  -vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapH 9 P $@@  `  &``, `@_ ` @g / 2` 2 `N`1  @gx` ? &`> ,2   vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map %d %d %d %d %d,%d %sctty,%ssldrnoflags %ld,%ld -1,-1 %ld,%ld %ld,%ld %snochan %u, %u,%u 㾀 H  4 4!       4@>[@$ ,` @Ȓ! B /`@>[#\8?.!`ߐ@ , '>[ `#?`l 2  `n >[H?!`@ @,!@;L@D ,H!?>?`@ >[`  P>[!X>>[```א@! ` `>[!h>Ԑ>[```Ȑ@L ,>[p>Ē!`@ , >[  ܔx ؒ!>`@M@H# l>[>!`@fĖ >[#\>!`@Q l>[`  0@ @"V @E`>[ >i!`@- >[  >Z!`@V  >['>[,   >G!`@V @V  , >[Ȑ>2!`@`@ 㿘   -   %  &@4` z vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map> 8 8  procfs_allocvp㿘>  '> 8>  2 X2   8&@g 2> "@` "@`$b@ ْ 8> i`"$b@ ě Bb@@   $ "" ""* "">] . €!m2  $ @$ <!$2 $ <!m2 $ <! !$2 $ <>\;""8 " "" b@b@ `$b@ $b@q  t, tH tH t\ tp tp tp tp tx t tx tx t t t㿘 `""`> ""<" + &  㿘     `> "h24Y  2  > #`$ ` 2 K ?` F>]#(*` € ; "4 - >& ̖  /    B - v v< vX vt v v v v v w㿘  @"!   ( & "  > .@@p J?` 2&?.@& 㿘 @   2 vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapprocfs: invalid directory entry sizeprocfs㿈 <@@5 - "'Ƞ  "* " <%  < & <  W &!  ZE Z`@"  @ Z>^ 5  $`㿘@  > T`      㿘 2  h@w> >!l>bb&`Ԗ Dؔ b#@ &`&`&`&` &`&` d`   `T Z ` Z `D`@  vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapexecmdlinenotepgnotestatusctlfpregsregsmemfile...cpuinfomeminfo㿘     \> "h`2 "  2   (2    P "   ($  ` >_ć(`"` | | | | | | | | | | | | | | |  "       㿘  ` ">  "h S  㿘 `>_(`  ` "`  `     } } } ~ ~ } } ~ }tag VT_PROCFS, type %d, pid %d, mode %x, flags %lx 㿘 >_`"8` ` `:`㿘  Q  㿘  G   %ldprocfs_getattr㿀      *  "> s"h` p >  < $ 4 $ $ @ $ < H@QZ< $ 4*`" *  * $ $$ ($ 8$ ,$ 0 ` >`"*` €`,!? " @4  4 `@ $ ``$  4 $ $  `K*`>`! € ">   4 $ $ 4>_b:;: < 6< H   < 4 $ $ -< H 4 ` " $ ``< $ < H -` >ఔ ( *   :  P !  < H< >_8\#  T \ ( ( ( H H H H H t t 8      Ȳcurprocself㿘 >    %? а  2 M .2%„ð `  l 0@    >`"@C `?   >`"@8 `?`2X` `X   >  @ ># ` @j  ` @X€ ``@ `@X a @#\ > #"h RXJ @"`XHI ">  "h 9>#> @ 2c8  @Ē   " X€ `@  2 X Ԑ`S  %`<    쀠@ 㿘a `    㾐    ` а @q  7 I 2  "> "h`>#8-`@>c@  "  X€ " `` *  '  Ʒ/ /  "   `@& }>  ` t q=``K>b!ܓ-` €` >^#x'/Ƅ ,@J/  '/>`"    '/>`" n 4/X!`  . '/>^ #X!` - '/>^#Q  /# 4>_ *  '4b8 //   `  `=`= 4 4 h %s㿈  `  >  `4>_ b >b>`a7o  # Є #* ((Ї8 #2  vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map   㿐`X``  `<  <`>c!*` €>#쀤  ` ?3, ` .> c  , * >bD"* `$@j  , @S? r  `D  S@S{ N , >* "bD*  $@  @ $@ ```݀0.>"@ * > #`` ?`  >, #h"@*`   Ґ , ">ch* @``  $ spec_read modespec_read procspec_read typex     >c55"  2  >  " >c5)" 2<  >c ߕ> D*` * " *   `0  6 (` ' `>"@ *">*" ch* ` @`   `h@   `  ` " ``"$' ( 2@ >䀢 M J @=  > @ﵐ &@ 8 `?'#\#` ?i" @"@8 H䀦 " 04z"(֐ 㿘    spec_write modespec_write procspec_write type㿈    >d4V! 2 <>  "<>d4J!  >d ޻> D*` * " *    `' 2 6 > ( b@*">*" ch* ` @`   `h@   `  ` " ``"E ( 2@>=` H`"F@^  @ג %@ 8    '?`@%@@8``H@@`u쀦`"3! spec_ioctl㿘   < `` 2>e* * >" bD* `@       *>*"@ h*`  @ *>" ch* ` @  @ 3[ ȁ㿘 `< 2 `> D*` * " *    㿘 > bD $*`  * " *  @@ (   € spec_fsync: not dirtyspec_fsyncspec_fsync: dirty㿘 < JH /d4p* %p  >e 0   0 2 0 $ 0H p@0ڠ` >e Ğ p` H 0>e")0H 0 㿘  x   F> `">@>, "@#h *` €  "    "     2" spec_close: not special㿘`  <`/ `U>f{ ` ! ` `!` "f 4 @!+4 * @*`>"@D*` -``V`  `  W`ɒ = 4 @!4 >* "@h*` 25 ``tag VT_NON, dev %d, %d 㿘 ?   >f 2 "3 `>fL(`  ` "`  `      , , @ @  @ ,㿐      #\ P  spec_badop called㿘>f1ؐ#vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map㿘>  ᘐ  > "`(  6?@  *@2 ?*  6?` ` 2 ?*@㿘> !> 6` (> * `@` `2@`  X2 @ | 2@0`2` umap_node_alloc: no alias for device㿐> >  c   "`<  "< `<?     "``` " "`$ $  &ܒ `<? `Ӓ  "<>  `" 8J0\@)> `<6`? @'> ` > : ?`*  @`       < <@2` D א   `"@`"`" $@>g0ΐ!`@"`@ @h& @9& ( @*   $ " " $  㿐(  'R ܐ &㿘/!` b``ܒ`?2&`#&``Ҕ?2&`?#&``@ ?# @?"&@&@ @ vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapx `  <@@{ -R  t T&(&&$&&,- il&`< "ސ]   `X@$耢``ː0J*$ $ !  C"* <ܐUܔz 5ﱒ 0*@ "@$  `X< "$< $<$*ؒ Yآ Z`@($@  Yذ `@$@  㿘!6`  D `  2 !i &! 㿘!>   ``ך&@㿘! @P@ڒ!!   "P& DT&@X@ &`\&``&` d&`h&`l&`&` d` 7  `T3 Z `/ Z `D`@A   㿘!  㿘!  㿘  X $vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapumap_bypass: %s umap_bypass: user was %d, group %d umap_bypass: user now %d, group %d umap_bypass: component credit user was %d, group %d umap_bypass: component credit user now %d, group %d umap_bypass: returning-user was %d umap_bypass: returning-user now %d umap_bypass: returning-component-user was %d umap_bypass: returning-component-user now %d >" `     't>i 0)"  . x 3>  $x"  "$ @ 8c@" $ @`$ @` "@<`  ۀ ?"$ ?&  `>i/"`Xʒ "  ``>i`/Ґ" ?&'t ?!x_"` `  `>i/#`X  x`>i/#@x@8*` €  @?   x@`"@P@<`  2 ?"  a2 `2  b2   `XH ?"! ?  `>i/\#xŐ&  "  ``>i/M# ?"?   `>i/<#t@` "   `>i /)#umap_getattr: mapped uid = %d, mapped gid = %d umap_getattr: original uid = %d umap_getattr: original gid = %d 㿘ː " G> X `d "  ` `>k x.  X`b` ͒` " ` " >k .ג #"` " ` " >k .  ?#"`  㿘   ״ 㿘  ` @*@& m 㿘 @* a" 㿘  "`"`" ɒ & G 㿘  \` $ \ $ \㿘  \` $ \ $ \ tag VT_UMAPFS, vp=%p, lowervp=%p 㿘 >k`#`.\ umap_rename: rename component credit user was %d, group %d umap_rename: rename component credit user now %d, group %d 㿘 `  ͐>"` $`  `>k .&#X"   `>k .#ܐ}$` vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map8> !(@8 26  @, @?؀`' ! ' ؔ`   > &(@͒  '&@  㿘> "H |"? 6"> "@熒 >l!(>"` 㿘> "ȱ.    " "    㿘> "ȱ.  `"   "㿘 @ 2` 2   ` ` ː Ɛ @ @2 (@ (  ?& (`"  "` "@@"   "?  " ~ &   "?& ??& > 8  "???& > 0@> "H,  & " @ " &  (`& (|㿘 㿘 }㿘 < 3 ???`0 2 `4   :`02`8`8`< :`8 @ union: unidentifiable allocationunion: . not lockedunion: allocvp not lock owner㿐a\ ` ` `>m+%" " `< <@" @'     "'} '􀥠@T 2  "` #>  #> "? `";7`"74  #> , bH`$` 2@`  2@``X2@    ђ  `2```o@2`(`( 2> >m*"( "&`  4`@  ?$` >m*"@`(` > ``(`$`(r  ` $`( 4?$`@` @` `"` ` "``(  ?$`(`ɒ    $`   * $`   `*@ $` "`{` % @2   2> !(  ` ^ Ӑ hUd   H`"`@ "@`< <"`<??$`$` <`8<`0$`$`o`  $`(`$`,$`$ $`(>  "? 4 $`@   $`   結 $`   `J*@ $`$` $`$`> "H, $@ " @ " $``(`$`(㿘  (  ?$ (`"  "` "@  "  "   "   "   " <  9 &  p   ?''ҋ !c ޒ }  V@ / жت )@'''''' < ?% '''''' >耢`   㿐@ P`(` `$`(`  ќ 2`( w ў`( $`(k  @.``( `$`(`$   f`$`@ $`$㿘\ `' 杒   '  ' `*  '' '  `2  '  ' '  ' c 2 ؐ0T ' p#\˜ ""   |'7і A ҡ  &` ٔ@#\ `H0̀  x~{ 0` X!  ci `$8% !@`'`  ` '' 't'p'x'|` '`'{'lp` ;3`l `$`l@%ll 0"f'` 4``? l`.  l  H`" Hl%ul㿘` H?& H[㿘>  @ (  ?& (`"  "` "@ (` & (  8     X  ؀   union: dircache table too small㿘> !( 8 `"@" &@`&>q'`!8 &    ۔㿀`'B  ,`'ǒ  '*  ' `"`,"'' @'  `@@  X #\#`Ԙ  " ,`" ,u 㿘 , )   ,桒 & ,vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map:::union_mount: bad um_op㿈<@@    -    P&(&&$&&,  &<    h  ``$ ``    } $  $$ $ $$ < 2   W g  $ @ "@ $ 8 !`$    X <@ "  X`< "< $<X<< ` $<$ Y  Z`@ၒ"   ">r  >r0 >r0 >q # >r & (@笐  Z"@ڔ? $@U@0 幒  `/`* 㿐!6``@6 1    d `@"   2 `D (`y   "@@ `k!l $!㿐> ! !  2  " ͖`       #\#`  V ` 1   @ ( "(P!@ฒ!    X  2[\`&` d&`h&`l&`&`X  T TDPX&@&`&`` @QT&` `@KT&``@T&` D@\` `dhl`&` ` ` `@ &`&`&`&` d`   `Tܔ Z `ؔ Z `D`@  vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map㿘 ` (`& (㿐@@ @ "' X' ~&@@ @ 2 X 3"# @2`̥  4 ` €JI " & < 2& `& union_lookup returning. (%x) not same as startdir (%x) >  X   !  ` $ ` ``'''P'`( 2 l %`(`$`( Ɣg @` @`( $`(`2  `"@  ?$  ? @2      ؀    >`2= `$ 2 $ `$ $   d .` @ ' '`"@  ?$  @ ` `    '6 `˵`2  ?$  "f % <`# `( ?$`(`ː`( ` $`( E=A'   X #`#\D   "" $@ `  @2 Ԓ    J`. @>t!(#I㿈   `' ( M ( $ ( X˕  #`#\  0ʰ 㿘 >   `  - ( 2    㿈``  )  ( d ( $ (` X` `` ` ` ` #`#\ 0  㿘    ` ,  `< 2 $4 ` ` ( =" $ $ $`ʜ. 0 ( 㿘  ` 2& `$`?"`$& >"(8*` €㿘   `  `( 2  x   &` !`O       Xa` `  ̶ `8      (  2 :   26`? ? 2 <     Ӓ `? ?u @ "  @ 2 ` 2  `X  d"`㿘`  ``  <`2 ``` ` @ % !  ( 2 א `` ʟ` ``?2``? `? ` $?㿘   "> `? ``ɏ  ( 2    |  )    ` 04  4   ?ߘ?0 84   <   ?ϔ?union: missing upper layer in write㿘 >   ``>w!?! ( 2 N  >     0   4  ??㿘   " & >#08*` €㿘   " & >#\8*` €㿘   " & >#8*` €㿘  `  ` " ``?`Д  `( 2    G : union remove: null upper vnode㿘` ` `  ` >x  @ 0 (  ( $ (I`( ( $(<`     &  Ő0 2   X ` ``union_link called without LOCKPARENT set! 㿐   ` `>x!!E  88@?  2:  `2` @2   ʨ    ` @2 `    P  ʌ 0*   ʄ 0   ` '  "`( 0  i`( $`(  ɏ㿘 >  8!(        TJ  8(@28` F`   "` 38(@` /' ( $ (^ `(`8 2 ` ` ( $ (K   I 2 `" ؐ 0 0` + 㿈   `.  ( {ې ( & ( ג   & "  0 X #`  #\  0  union rmdir: null upper vnode㿘` ` `  ` >y%"H 0 ( 0 ( $ (`( #( $(` p    & ے C0 2   X ` ``㿐   `  ( F ( $ (}   ȸ  "@q  㿘 >   ` ( 2&  & >!X 8*` €㿘   "> `? ``Ƈ & ( 2&  & >! 8*` € 㿘   " `?( ``V &  2&  h& >! 8*` €ȼ 㿘  E  ȱ  (`     㿘 { union: dangling klockunion: dangling upper lock (%lx)union: locking against myself㿘  > @. ` ` (  `D    " (3 $ ( ( "  (>z"C>z" >  "  ( 4 @@2 ($ (>zӐ"ؐ`$ ( ` "? 4$ @ (  $ (union: unlock unlocked nodeunion: unlocking other process's union node㿘   (` >{ 8>  " ( 4 @@ ?$ (>{ X ( ?`$ (   ( `$ ( $ (\$ @ 㿘 >   ``?`a & ( 2&  r& >" 8*` €Ȓ  tag VT_UNION, vp=%p, uppervp=%p, lowervp=%p uppervplowervpdircache:㿘 >{  "  ` `>{"8  `>{{"@  ,   !>{n"H  2  (2  㿘   "> `? `` & ( 2&  & >" 8*` €U 㿘   " >    7  㿘   " & >#8*` €union_strategy: nil vpunion_strategy: writing to lowervp㿘  \  " & \>| h 0@    >| LJ& \vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map㿘>!d> ͑*`" * " @K%> " @4` <@r@ <* .@k@ * > 2#Ta@a> , ,'",  !n!m:"`> > @  @" `@:*  '488D* @48> #68&% * ,  , @ܒb.86@dos2unixtime(): month value out of range (%ld) 㿘 6` &k& g2`**`" " `*  , **   d@> a'> =)>?"2ađ2     !`"!n!m`@ ` > > ȑ6  ?>|#0+  ?  ?*@  ?, @*`" *" * b $!d*"@ *`@  &@D d* "*"@ *`@*`@*`&  >> `>  (   >>  ` `+``    "*@ .*@ ``  >>  ` `+``  *@㿐  ` *? 6*.`  .2 2.@а@ .  . .`@ .@  `   " ."       .`"2  < *`#"@ &  ?>  .@ `2 @ .@   $ &   ?? "? ."?   >  .@  `2 @  .@   $ * 2@ _.@@ ` .@7 5  @-  0?,@݉   @ ?@ "&  " @ "  ~  .@    @? "."(("@   ( ** *  * 2 ? (@((` ? @((` ? @((`   @*((  @* @ 2?V? ?(("@ `K@ >  * @   7` 3 >   @   #`  >     ?@   `  ?<璂  @ ?ca @ (( ` *` ` 2?R` @?(( @  (  /">( ` 5?< `  (  /%0 ` (*`8( ?< `  (  /" ( `   *`( ??<    ( @0`㿘`? " .`` ?` "`."` ` @Ȓ vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map㿘>ap> Γ2   ;: Ȕ > j"` 㿘>  6@+> )> j#@` * @ "  @2 2 2 , `  `> > j `0(   2  2  2 ,"   2 @ 2" """@   2   " "denodedeget(): pcbmap returned %d 㿈>  `tc 2``"`<`z  &> i"@   & =  @} >   ڐ 8"` $ $ $ $ 4`$ $ @($ `t "$ 0 "`0` $ ` $ ,`t#@&`<@## @ "@, d`tc 2$ p`<$ p`@2`$ t !4 n4 f, e4 h4 jS4 l@ :찒 p X  c, d , e  * @4 f  * @4 h  * @4 j  * @4 l  * @4 n  * @$ p  *`  * * $ t 0`t    *` * $ p d  " < p?c @z  >`T*  $ t!  "`< ۰ &㿈  X`<2 >    *`" *  ' * `%'`  &  n lԖ  d . d 0 `   j Ŗ    h f e  ?&    ? d`&  , r @ 耢 2l Xߔ   d * *  e*`  g* f2 *` i* h2 *` k* j2 *` m* l2 *` o* n2 *` s* p2 *` d  w*` d  t2  *` d耊   u*` d耊   t*` 0 tc ` p*` p* } 0detrunc(): can't truncate root directory, clust %ld, offset %ld 㿈` @ `d``0  t#@>` `   ` @ `t@` ` T@ 2@  @j "  `0o`p?''$`p `@  T@g2@  X@/ ? \ T" *@ D  @  T \6@ "@* ` ` 0C@U``H `@"@$`t` $$``  `   􀢿 @?  T2@$`$`쀢`  t2@ ??@&deextend: file too large㿘 `@   0t#@" d4  d " t. @ 8`>Ґ#h@T@?2@ 2 " P@   @    t     & t $& N 㿘 d 8msdosfs_reclaim(): pushing active㿘 >`X    D > W "& 3 =$  msdosfs_inactive(): pushing active㿘> `X   ``D >!X X   , `X <`   ?  , X   X` vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map㿘 h@8 ln 4"@8f  4b  8@@ &2&  h@ظ'㿀> `H `0 "`H'?2`p `p 1' `d ) T`t.@ ϰ  \ @"2@& \ <".@@&2&   T`t.@ `"@ 8 ' 2&   `''@&@'> ` "`> " * `" Z# t2?x  @ק g쀢 "  ?P谒 W t H   *`  * *  ' H  *` ' t/2 t 2 ' t ' t2 ?8'  ' t2@ ??   T \"@  D?*  && $`x$`|0& "t$`?$`  x    "(  " " x?  :" 㿐 x X P ) | 4 *`   *   L :4 @?24      4 4 * " 4 *`@ 8?& |  x$?  & x!  H S* P2 * P* P* * |2 * |* |* @  Z @"%   6   4 `<  ' H`<C`H @ 8  & 4 @Ɛ0)㿐 P 2* $ P  * *@# @0   @" P$ P& fatentry(): function code doesn't specify get or set fatentry(): get function with no place to put result 㿈`2`> "h  >"~  `L`J@`Ϙ`?  E0)`t#@  H  *  *` *   H ` * o2 23  3 8 &`b?`t#"' R#&K耎 H  * /  < / 3 `H* 7 `H*`H '* < H  *  *`  * ( 3 `H3 3  * `H * `H * x &`d'耢  㿈`@ L?  0@V  ? #v` t?#1 a4\蒎` H   *` <  o +` 3  H*`H * `8'5`3``H*`H*)  @ H<  *  * @@ *@ ( 3  H3 3 @*` H@ *` H@ *` '@ 􀦠2q  $ d 㿘6` *@` L?*2`u `"  "    * @" ?] 8㿘   2`* `(  "  P & P `?   2'`2'@ 㿐`   q@)Ȑ :`  qbm  L`9 @ @$ 4` ,  `  * ?@, 8 ?t: L` " @ 4` @!4` ,  `  * ?@, א8 ?O(` "     X㿈'?@ 耢`֐ ? "0{ P6`  $ P* ` * *#  t?#@")o" R@ #@,J t` `H   *` 3   <@`H3 *@ H@ /*` H  ** @  H !*  H@  @ (  *`+@  H+   * H6` @*` H@ *` t@ 6@ ?8@ `( L@(p 耢`Q 㿈L  2  '?," L 2 *L \$Pg@,@h 쀢 2t쀢 "dݘ ? "tS08#@  H@ @  *  *` *   H ` * o 22  2LP4 $P*  * *# L( extendfile(): attempt to extend root directory extendfile: pcbmap㿐p  0 d > H > !`"!p ?> !"!c   `0( 0 2' '? p&@& p 2  $p E     ?$J$F' d  `T?`\ `D" `*@ '``@t !`\`T "@. ``i `\`T T P"@ :  ! ?$ T T?2 H> x H@` <$ @& א?`'`2p vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapP  '`'` '  ''@?'  ''' 0"@ d 2` ? ` @ 8АI ] . T(/  "  "̀` ` ̀      T ,̀`   `c ڦ"@` `J .2   J .  #  'ܐ  "    "` `'#` '  '  2' 2 'Ԫ  Y?ذ i؀J H ``2?'` '3U A &    $``'?' @ @ "% $?'% $T% (ؤ ` `  + 'Ġ Đ"* @'  2"` "` , ` `R  % (% $`̐(`$` ?`@ Д   *  ct    * @*`< " ܀ "` '# t#@ "<`2 -#8``   p ܀` а "Ӗ԰ Ԁ `"@   5Ȁ`0 -#2` { ` t p2܀`m ܐ԰ eԀ` "`([$`] V # Tܐ԰ `ɔ0À`0 -` &p`00 p ܀`*"@Y԰ 00  Ԕ  "`@Ԑ 㿈`$`t@ `0?``"@`T 2 '  ͘   t ?ט 0`T`t*@ &`t`$`T2   ^  `$`X ` ?"찒 X`$ `X`H @   d , , e, g, f2 ,  i, h2 ,  k, j2 ,  m, l2 ,  o, n2 ,  s, p2 ,  d` w,  d 2 t2 ,  d  u,  d  t, 0 tc 2`(p,  p, `( <א `(? 1&`(`$`X@!K谒 L`$&`$`T2@  ٘ @?`~찒 6`$`XH &`$?u Ψ !谒 "`  d p'`t#@`<"'  #G. .. 㿈 0    =`??~J .H# %>#> `" 2쀢`@̨ `@̢  H@    0  doscheckpath: source and target on different filesystemsdoscheckpath(): .. not a directory? 㿐`d ' 1' d "i `ppb a`00@"`t> "@V #@>`<N9 `d H` `  >`@< " `<  `c`t*   ` `*` * pԀ ( `<#`*' s  `d Ֆ?`\`p`T?" *@`D`@ }``    2> " Q 㿘 X` ` T  \2 "@  @* * `2  T T \6"  <*@@  \ D"@*    ?}J  ~ &  X H  '㿘  0 㿈`,$?0 &`,  *`?  `X "*}찒 1` 2- `X( ' `T?4  , ?`| ~{0`XH  `"Ơ $"  ~l  㿈 0 ``Ԗ  C A   `4 2?| ' H H@   @  ~% `ͤ~  ~㿈 0   2/ ?|{ } 0"H@ @   @  "` `  ` @ * @} Ӡ }  }ސ  vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapx q |  <@@"Mx`  ` @    <@2 - ` 'x<@"x ```( @!  0 ` *@$`x x`X| @&(&&$&&,  < " 7 > `@& - `"<< !!`ݐ  0m M<@@2 `@j   "0Q$` $`4`` @ $` $``"$` p`t#@2$`@t @}0't``   $`8tp YNp Z`@Ȓ$@ x YCp `$@ @ýL8 |RRaArrAaU㿈   Đ >G >  P 5 `C@  C    `<   ?  x ' `h ?R 2`( "y``  ܰ O  "zߖ? 2  0 ; # 0!H@I!$@   *  @4`  * @4` ,`  * @4`   * @4`"  * @$`4  * @4`(  * @4`* ,`$x`2`"+  + (*2  $*2  ?8 O`"2   *`   * * $`,  *`   * * $`0 * @$`,$`0`?@ʰ2``0 @8_ ` 2,``" 2W `4 2S   * @2M #  $`t$`$`  *`   * * $`4  *`  $`` $`x A`t#@ # 2 O`@@2 O`0  @@ 8 O`@`04`$`0`,$`,`}4``"y4`"`4u$`4q``tc $`8 " !*  #@ $*@ *@ $`<`4[ ``8@$`D & %* @$`x`4O `` `*`8 $`<@ $`D$`@`0 `D @" `4$`H`6$`L$`px /`  `?`*?* 2  ?/  `t ///  ?#  $`t$`$``t/2@`*` $`h``h@ʒ$`l?$`\?$`X$``|? *@ $`Th Oz'`x`9$yg? 2[> Ha@Ք  2%$`x>a!@͔  2$`x>!!@Ĕ  2$`x#@ǽ  2 $`x ! !*` ! !* * $`|z'`L < 2  0* $`$`$`" 2`< ` $` ` $` $`d` &a&`d  &`h" " 쀢 z  ͔?` ` "ג <Ԓ ;&a 㿘6` ܒ  a` "`` `  ?5`ű <Ů ;`<*@$`<$a㿐! 픖  `&@㿘! D`@ &``&`H&` P&`P&` &`&` `T Z ` Z!La | `D`@  msdosfs_sync: rofs mod㿘!d    6 > P  2` X2  <  d%   <` p `@`    2 `2 X`g` 2ڒ 㿐!`` 2& `&  2@ "` "`㿘!`  `0`4&& vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapmsdosfs_create: no name  p`  $ t@h `$2p>"@Q Ȱ 2X``  ! >  /''  h *`' " '|*  0 *  <''l'ޔܖ j'hԐ /`  ڔ Z  ؔR 'd0 2``@2`g ^ d "`\ T㿘  Q I  㿐 `D 7`ѐ 2>    *`" *  * ''  $  &  n l  d . d 0 `   j     h f e  ?&  㿘 !m `d `0!   㿐>   *``0" *    * ''` %2  $``n`l絖 `d ,`d`0 `` `j 禖 ` `h`f瞖`e` ?$``$ `d` \`p T?"  D* K `p`  \` T?"  D* <  <6` 2 $ `d !m!4`0  4 `d @4 4`0 ` ,$ `0 $D$`t <`n`l`0 `  `j Ö$`h4`f `e $@,0$4$8$$$($@ `d 2$<@$@$<`0``$ `0`tX* 0 䀊 " t =_  " W  Q "t@ B 2 t@ݒ = t 2  (   ,':`t '  B  2+``@ ((``:```@ E@`TB B?@K?4"@   䀧 պ  Ӏ  'v̀ `T?2 ?';  'ܐ@!`\% @Ɠ`X  @ P @E @@Ƃ @@z4``2t@ 8 ``t 42````@- v 'H@<T"@P`\T`T"@ ;  ^ ?"`T`T?2 u "b 0a``?t  `X`` "  t <  B 4  &t  @jc @j?HY`t}`` ut  &  `T @t܀ J@ H   䀈?L " @ b %= t =?@ 2   `h   㿘   `?   R`?㿘   < ` I  K  H㿘  - > msdosfs_rename: no namemsdosfs_rename: lost to startdirmsdosfs_rename: lost from startdirrename: lost dir entrymsdosfs_rename: updating .. in root directory?X >    ' ''Xa` d  $2X>C! X@  " X@԰ fԀ hݐԀ SYW0f   ` ܒ `d`" J`.  ` ` @ @Дi  $` 'Բ   ` ` $' +/ðВ P `pp2  $`" `tԒ 2``@2>!(p 2`Բ   `!`d  ذ B`հ ygΰ 3 ɀ`9  x ` ? $>t!P` )Ѐ 2 >_!x `ђ  $' @>H!x ` N v`Xؐ  Ö$(Đ$$   ``,`$`,$$ `ĐT 3 `   `? };` X @$` P` l'`&`p`2\>!T?" D*@@ `q "s3  H s` *`p2 *`r2̰Д? `qo` ?$`Ёmsdosfs_mkdir: no name `p `0`$`t@ d   ?C 2p @>   <  h*`" *  * 'h'l'ޔܖ 'Ԑ /`  ڔ     ؔ ?'d  \ T" D*@  `@ s  H@ ` H>  @  H+`d2 +`+`ؑ2 +`+`֑2 +`+` +`ڑ2 +`+`ޑ2 +`+`ܑ2 +` t@ `p <" 2+`;+`:+`0ؖ2 +`1+`.֑2 +`/+`-+`2ڑ2 +`3+`8ޑ2 +`9+`6ܑ2 +`7 t@  d+`d+``p+`4 `p+`5q\ /d$2> `ޔȰ "d /''`'` '|`N d@2 | `  "j w o㿘    `'  " B` @ BE  wlJ    w` ;9㿘  - / ...p`?` '   d  0 ' @!  ` "$ `"  'ܑ2  .# `"@`" p 2 t#@i<2f @  @'2]؀@ Yq +`q'`ء5`:  I'>#aX t2 '\<T?D" * Y '  /   >!P/ 7>!X  /7/  ? 7@  % 2`` E `" &@ݲ`  $t:` 'В@ T@Deؚ X%@ ` "@ 8  t"  8 籘䴒 ?o|䴒  @" H@@  @ k 2 ` ?'Ԁ   |Ԑu'?q'Ԁ , ` `ct*   ` `*` *   \<T?" D* \TD" *   '/\?TD" *  <  H$@ :` '/Ԑ  ૒/*@?  ? '7@  W `` &@`અ` `H` E @ o p`  2``"@""@ $< t@ Вe @  b 4`2``8 `` "@p90" 㿘    8㿘   8 `㿘 `{ 8㿘   `0` "  2  2" \T "@  ;  枘  msdosfs_strategy: spec㿘  \`<? `>  T P@2 T`0\ TT"@  ;@ w ?$ T T? H@ <$ @ T?>`  ` $ Dc 8*` € 0stag VT_MSDOSFS, startcluster %ld, dircluster %ld, diroffset %ld dev %d, %d, %s (LOCKED)㿘 >`! p   >"(?  2` k >>"@"P% 8 㿐 `  t #\   4 {q``0>( `  " ` $`    `     w w w w\ w w w wvmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map㿘`>".` €  ..  . . . ` H /f * ' > !!H 0`" 6`H /f * ' > p 2H p@ `$ &`6`&@&`&`&`  E $&`4&`H /f * ' > !ؐ! &`$E] &`$H 0`$ (` &`6`&`0&`(&`,&`<&`8` 2&`  7&` &` `"@&` &`_  `X  Fw x xd x x x x x xp xX x x| x x x x" `"`"` bpf: ifpromisc failedbpf_detachd: descriptor not in list㿘 4  . 4 @    " >א#P   >`@ː#h2"  2&   "@& 㿘. *   #> $`%> @$`@@   "```㿘?> 2 c  >  . `*  2  @Ғ `>! & @&  㿘?2  . > * @H /f4 * '   wH 0@ bpf㿘?2  > . * @ 2`  @ H /f4 * ' ?   $ 21$ $>  -$ $+$ $ > $> `?  >!  # ? #H 00I     )$    6 "   " $  $  $ $ $ H 0  H /f   H 0 * '  $ $ $ H 0㿀?2  > . * @`2`5  `0 `  '`< (8D  (  /H /` * ! ` H 0 "" 0" " " 0" " " ,㿘?2  > . `o* @  5q@ "i@ "`"h@ f@rj@"` "@O s@t@"`8  w@n@>  ~@" br@" "k@bp@" bu@}@"۰  bm@>   v@bg@9 0 "l@x0"f@"` H /f * ' ` ``@H 0&` 2    8$` &$`@H /f * ' ;H 00| vH /f4 `4* ' `4   @ ǒ   ,`4H 00] "[ X ` "U  @0P@L!X>!\@E @$`  < :$` !X` @y&` @>\-&`,&`0(&&,`66#6@ $`8 ?$` $` $`<$`D `$`H @  $`L`D ($`@ `@&㿘`  (@ 2L H /f * ' & (H 0-@b1,`  ݐ` #@ H /f * ' & (tH 0    㿘N@ .` ` А ( `>   0@   8.@ $@ > !\`"@ ` 7 @r 23@ 4 2 1 2  @S 'H /f4 * ' @   H 0 @`2` 㿘 8 㿘`2? ?2  @> *` * H /f4* '   6 "  "  H 0 ? $ >  "$ ֒TH 0 㿘  !>( ,& , (@Ζ @G"d 2 ,bpf_mcopy㿘#> 2 c Ô@㿘`   ` @` #> ,& , (@ @c 2 ,㿐    @ 4   ?@ $" 6 `2  0 f& 0& & & & ӆ&  <   @` D Hø L [ T& T " p <   @` D Hâ L E T& T @$$@"""  2 $%&  > `  ` & & & & $& 8&  <   @` D Hj L  T& T㿘   &    & & &  㿘  " (   "   " (  ( "&ے &bpfattach㿘    2> >"!\ "@"!\""" "&""㿘> !\ B!\> />+> 5% @ 6 bD >  ĒbD`@ `,@ 2` '> %>   `@  `    }  2 & ( D"@ @6   @ " @ * ( (,  ,   % "  " @  @ * ( (  * ( (  * ( (  "  "@ @6   " *  2" "   * H  (?? `!>"*` €    B2  t`   K2  ֖  [2 `   #  6    @ 2ڰ  <@ @ *` *  *     @ 2  l@ @ *`   2 `   #  6 yJ w@   2 `   #  6  @ @ ^* \ Z  * U@ * P@ * K"@ * F"@-  () '  *# !  2   "  (  *    2  "  * "  0  *2  "     @K     * 2  ޖ  $  L 0 L T \ <  | T 4 8 x d l    ( 0 P 3 2   )  $ 944    Ҕ*` `?㿘!> #H>c@㿘>!>`"! `6 0%> '> ᠨ 5>6 a 5>@  * @6* "᠒ *  ϐ@Cᘀ " ᠒4  %ᘡ*   @/ 4  $a* " `>!& @] 9(   , (  @`(,`( , `0}a,  0*` 84 , " $`$`  `$``"``& $`& $@$`,  * & & & & & ́㿘>!`> ""  & & Ѐ & А "` "`"А& H㿘>!`> a"a"  & & & a` & `""`0㿘 @     0@P   @  *   @  *  㿘H /f * '  4>>> , ;c6 4& & & @v/ ( "   "    >  / > Τ! #>,  b (  , @H@t `"  "`> "!  "@ #> "8`"`& " `   <`@"`@$ @<"@ w  2H 0㿘> !Ѐ , "%  `  2  @ @  4 "   "   " @ڒ    2  2  㿘> !Ѐ " 4 "  "  `  2   `"   @@    2  2 4 㿘      >! > >!. : > !Ѐ`5` "-` 2$    @   @`* " @ "   2``2` > Ѐ`` " `    2``2`  㿘  C ` "? `26 ` 2 @$ "/``"'  @ 2! #  ``   @   @`  @  2㿘 ,`D ( `$`   `D` ?@ &`D"` &`D    $ > 㿘 4 t @6 4 "  8   2      0;   `& & " & @ > Τ! #>,   b4( , 㿘 4 t`@6 4@@m> Τ! #>,   bX( , 㿘;u  & && 㿘H /f4> * '> !Ѐ  T 2   2*` 4 2 `" @  2T 2H 0>!Xː㿘> !Ѐ "  @ 2    㿘0a@ a$@@OKܐ  D !J@ 4 a2@ a1@a@La@"` a@"aI !F@ !F0aH@aG@a@"% @a@"6` a@a5@"` 0 !6@" a~@"  <` 0!K@" ` && 8|k Dа2  4  H /f * ' ƐH 0 " 4 4 2 4H /f * ' H 0 4?bR!   4 4 42 x$ @2 <    <@f@c 42 u  R  g -! "$ ! "8!! "` 0a"a"a "a!` a a" a% ` 2`  .a#` ` @0a a "   4aa2 46 4 `H /` * ! @kH 0x@  > !Ѐ 0   !  `  2 &@[ > !=`:` 0!  }  7 ` | {= ` " {2  2 {+`  @ 2  ̀  ؐ |̔  @F { "@"&@㿘 ` ` & & "` ?& `9=   x`" $ 4`2 $ 2  & $a 6 4? & $ 4 > 6 4   4  a7ذ %s: can't handle af%d p 4 A A  ̠ 2"8 `4  @  `8?$`8`4 "`4`x " `0`4  @[`0@͒ $`x 2`4 A " `\>  @ : @ A @    ğ'`'' `> $*` €@ "v `! ( 4(沔 9K (7֠@ !"7`0`O ` K ` G ` @{ה  4(P M沔 9  "F```'8# `$"   ܐ"   "    $$  8   $ {  { `7֨ {} {w   7>   ՠ /@"=```'`8# ```$"   `ܐ"   "  `  &` &` 8 <  $3 {' {#  {  , {  , +   B   , @  2 2  A   ,` 7 z A͐ @q Y H /f4 * '       @&$7d  7 2" &  &  &  " `  & "  `H 0 & ` h & h 4$ @H 07, x $ daltq_etherclassify: headers span multiple mbufs: %d < %d 㿘`` % ` `  < `*"@27&  23&h!"݀@      (`  @ > &`"@&` &`   0 4&&&`` "@&` &`&&&㿘`9M @㿘 4`2 @ +h>  ` @"`  2` `  @l  >!@d  !"6 d & d \  & \ ,``   ? 6@s' ,   !2`@2 @  p & p #  4  4!  ؒ@&  4 h") 4 h `0] 5@:!"݀@=`0T>  `"`# > >  *`  { > iz > i!x >  " ` > >  *`  z >zӐ ># 4 @0> @ " _ > >  *`  zے > z > k"Hf4 c @ ^  ` Z*@"@U "8_ ?& & & 8 $#@"   "   ?`&&  5۔    &:@2`2`2`2`2` 2 ` 62 5m0&H /f * '  @`5X"0 & 2" "" "H 0> >` :  0 *@ `  *@`*@`> *#`㿘 ؀      . . . . {H. . >   % . 9. :& <& . 8 ( "& "   2  * 9 *` 9xe &  w 㿘 `""`"@ : 7 2㿈H o4 *@ g ` ``0_- 0\ x-  x'Y   2  >!Ȓx >*!А     ^//////  2  2   2   2 >!ؒw >!w  3   //////wؔ  H 0[ / 耊 2 `H 0L  @8  2  @1  2      & H p@.  7   H 0  7w  w  & & ` & ` "`&``& ``&`H 0 4㿈H o4 *@ g ` ``0_- 0\ wW  wQY   2  >!ȒwD >*!А     ^//////  2  2   2   2 >!ؒw >!w  3   //////w  `H 0@ /` @p  2  @i  2  2  H 0$ ?  & H 0  `"  "`  "@ 7`?&`H p@ 4! X t  l  T lcp!        ipcp# X < < ' ' ( )H * < < *ppap# Ș < <   L  P < < chap%s: input packet is too small, %d bytes %s: PPP packet in Cisco mode %s: invalid input protocol %s: Cisco packet in PPP mode %s: invalid input packet %s: protocol queue overflow 㿘 4   \`  & \`>` f  L l`& l2& L0`55  "! |0  !  > `ؐ   <  L 0!@"3> #`!H  !@"<! !@*#@".!! ! 0&! ``! +  3  @-  > a     p & p#@B0@! =@09 7@l03 1>#Ԓ@-0+! 2P 4>  `"\ > >  +*` 0.! 2 k> /aXh  5@ p & p@10\>  `"[ > >  *`  v > iv > i!x=> a   嚔 5 L 4 0`"/ LH /f * ' `` @&&`` $`H p@ >aؐ r   L` 2" $@`$``$`H 0 %s: no memory for transmit header 㿈  H /f * '  4`@@ 1wH 0= 22 `@6 4H 0>#@H /f * '     ğ''`' 2;``  * ` 19H 0  1   䀢@6 `  2 >` '( ` !* @ "  `! * @ 2` ```'`8# ```$"   `ܐ"   "  `  &`&`  1, ` ` `` &`2! 4 >bh 䏔  T & TH p@ 7 ` **  ** ! (2 !2!` 2 2`0 T & TH p@a /`  @  `0& " 7&` 2" $$ $$     @&&`0e  7 2" &  &  &  " 4  & "  4 T & TH p@$2 ` @ ` & `H p@ 㿘#> c؀ !> >˒b# >!X*@ *`ȫ#>cؐ# &! $cؐ > 2b. 8& & &"|&"& & 6! 6!&! &!@t&!@ ;@@㿘> #؀ !! "! 2!!"@؀ 2!L> #ܠ!L! Ȼ ȶ㿘        ؠ  /ǐ  ` ` & & "` ?& `@@H4 ؄( ؀   쀠 `?H 㿘H /f    K € F* '  쀤    & & $  ?& 0@ ~ 2 ! ' ؀    & & $  ?&  ̀ Ɛ  2     & & $  ?& H 0㿘H /f    & € !* '  쀢`! " !  ؀`  ̀ 2ߒ  2  H 0 㿘H / * '  2@ 1@z@w @#p @"  4j  !@e 9@]@"I[ 0:@S~@"N <Q ' 4@?Ȑ*@6 4 4`   @ @`? 4@  `?`2! `! >#@` 4 ?6 4`! 4! @`6 4>#@0!Ѐ(& %s: cisco unknown packet type: 0x%lx %s: loopback %s: up 㿀` 4  \>c0  0V ``>@c``#\` #``#d` #h @A 3 ;># 066!`! @&!!  > # 4`6! !@8 !  t6! &!  4@  6! R># 0  @􀢠@ %s: cisco output: <0x%lx 0x%lx 0x%lx 0x%x 0x%x-0x%x> 㿈> >  Ȓ"@ *`" *  4 * H /f * ' > !د H 0 " 4 H /f * ' > p 2H p@  $ $ 4 $$ $ $  +Ȓ  N   $ $ $ `52 *<c"*43 3 3 # # ?2 #\ >#` ax#d    @   `& -H&   $  2" &  &  &  4$  @  `   & `%s: %s output <%s id=0x%x len=%d> 㿐/  42   ` ԑH /f * ' > !  H 0`" 4`H /f * ' > p 2H p@ `$ $`4`$@$`$`$`  +& `]/ 2  `$`$` $` , ,,4 , 4p*`.`@*2 @  >#\`  v  ">@G>൐ H  @  `& ,&  T   & T$` 2" &  &  &  4$` @` ``  & `%s: %s invalid packet length: %d bytes %s: %s input(%s): <%s id=0x%x len=%d%s: %s invalid conf-req length %d %s: %s tlu %s: %s id mismatch 0x%x != 0x%x %s: %s send terminate-ack %s: %s: ignoring RXJ (%s) for proto 0x%x, danger will robinson %s: lcp echo req but lcp closed %s: invalid lcp echo request packet length: %d bytes %s: got lcp echo req, sending echo rep %s: lcp invalid echo reply packet length: %d bytes %s: lcp got echo rep %s: %s send code-rej for 0x%x 㿐`4`  > b`߰ 0  a*`@ @ #\> c#` ߘ``*`2`@h>֐ H@4 ?` Ī>!*` €`4  > #0ߺ``La* @   4    * `>!ܓ*` €  @ ,@S 8  @0 a,a* "  @ 86@ > cX !` ( a( `    e> #hV```La*@`X>!*` €a+`a," @_ 0H@Z  ,@ 8@Q  8a+`a," @G > cX Ԕ` ( a(   > #h ``L ` 2   $  a*@` >!*` €aa,+`"  8@  ,@ 8@ G 8 a*@`ܚ >!|*` €@ > c w`    0đ+`a,"@@Ӕ  ,@瀤 a* `>!\*` €  @ 4@0@  ,@N 8 !>`#@S ` 3 a* `~>!<*` €@ 0v0 !@]0o0 !V a* `  ^>#P`Z`L`4V>0 aȀ  >`B#>c€0F$> P3`+  3  060 !@ a؀@2*`L` '> x`0!> `aȀ@26a0>  Ȗ ``a &a  ˔ `L &`L 4 4 4 4 4 L 4 4 4 4 4 L 4 (   4 4 L L d 4 4 < T  ( ( ( h X | ` `%s: %s up(%s) 㿘`4 a *` !> "(@`X  a* @  "a0@ 0 a,"@ @  8@%s: %s down(%s) 㿘`4 a *` !> "@n`%  a* ` >#*` €@ 0@z  0@0 @r 0@m  ,@ %s: %s open(%s) 㿘`4 a *` !>  @&`ݐ  a* @` >!*` €@7   0a * a,"@@,  8@0@$  %s: %s close(%s) 㿘`4 a *` !> !0@ޢ`ܕ  a* @` A>"*` €@   4@ 00@ 0+@ߔ  a,a* "a  &a     ,@0 a* a,"@a   &a   n @  ` ` ` 㿘 a,+  a"@ $ +  *  !L@ *` , !LanK@%s: %s TO(%s) rst_counter = %d 㿘`4 H o *@ g aa, !>*` #` @B` *`   *` ?  $  *  "  0;: @G * 4@B % 4@> ! 4 * `#>!`*` €a  &a   ך x0@  8@0l 8@H 0   (%s: %s %s->%s 㿘`4 a * @!> `@ˠ!x@Ȑ~  a* " *` * !L@  >"L. €( D D D D 8 8 8 8 8 D>X%ܔ   "!"!"!"!"!"!"!"!<"!"!Ё"!%s: Up event(incoming call) 㿘 4%ܠ ``@  @&!&!6!&!&!&!6 4#> >b & !  "!>e"!c &!`€c>X"c%s: Down event (carrier loss) 㿘 4 >c  ># 4 @"! @! 4 &!H6 4㿘"8 !  ?&!!> &!#㿘>#&㿘>#%s: lcp parse opts: %s [invalid] [invalid chap len] [not configured] [rej] send conf-rej %s: lcp parse opt values: 0x%lx [glitch] [empty] [non-empty] %lu [mine %s != his %s] [chap not MD5] send conf-nak max_failure (%d) exceeded, closing send conf-ack 㿘 4    >`ؐ Z s ` p!>%>" @@ @ڏ @ "   0F C  ` H0 ` A0  ` 90 4 `"+ `b ' `0 `* @#@ 2 ! ` >P! `! 2 ! >E!  `  &!><!8 `i `@ `% @ ` >%!@-0`!3 ͔  >>"耤>aP Ȕ ` 9>;>" @@ @ @ "3 `  "L ` `S 2{ ` ` `*  `*` * ` !Ȗ  q>!pܒ m `>֐!x! !Ȑ 6! 8 222,`,`,`T,`  `  `  ` J>ٶ!G `>ٰ!,`,`,`6,` `*  7&!>٢!3 ` ` `* @!@" !@"8@ٍa!2 ,`!,`0"#@2 ` ` " >y!Ȑ ,` `h͐ `@ `% @ ` d,!<!  &!<>Y!ؙ-0`!3  # 0(>I!! >#F >#@6! &!< >6"&!<6! .0`!3  m  %s: lcp rej opts: [don't insist on auth for callout][access denied] 㿘 4  l  U >`p ط D`` @>#%> "@@ o@@ "!  " !#`2!`!&!Ȑ ?&!Đ ?&!Ā  ":  >ΐ !Đ ? &!>Ɛ @`&@` ǀ >ص" %s: lcp nak opts: magic glitch %d 㿘 4    }`>bH K l`` i`'>"@@ @؄@ "J`  -M`2K`!Ā FE` 2C&``*`* `@*`@ !Ȓ@ 8@ `>["`jt*&!(&!>R!$`"` 2 &```*  >"pA:$"$8%!&!̐  &!">>3 >#@`&@` ``>!"c %s: phase %s 㿘 4@   >h>#  >!  , @ `"  @  , !Ā  !   &!!@ *!>  ם>! , @ `"  @  , ! >! , @ `"  @  , >!  !Ԁ ,  `2  @  ,`! @㿘 !> &!@ ޠ R   )>!Ԁ!,@ ` 2 ` @@@,㿘 !> &!@  , "`@㿘!>  &!@   "`@㿈!Ę !Ȁ  ig&!Ȑ / , !Ș 2 2 2 , , , !, !Ā  ,   , !̘ 2 , !Ϙ ,  !Ā  "8,  *0 2`"#@   , *2 ,  0, b#2    ,  ! + 0 &! .!(`!3 Ԕ >!Ԙ   *`  ``* 㿘!   >#@"!@"!"!"!㿘># 㿘>#L%s: ipcp_open(): no IP interface 㿐 4 `@ c    >’a c 0  >!! `&!&!>#g㿘>#! @ l 㿘>#*%s: ipcp parse opts: %s: ipcp parse opt values: %s %s [ack] [addr requested] %s [not agreed] still need hisaddr send conf-nak send conf-ack 㿐 4      >’b  `4  1 />" @ / `   >   >!8 ep  $@`  ր >!@- ` `!3 Δ  >"  @ >’c ՟ [  X ;>9>7>€" @ Ԑc 29   * *`  *   ` "!@ յ#(!  &! >ժ#8@ pգP, , 2 ,  ,  d  $@`    !    2 2  2 -@-`-`-`-`-` >p#h >i#-  ``!3  4>Z#. ``!3 %  `?%s: ipcp rej opts: 㿘 4    / >Òc  ``  %>"@@ @$@ 2`! ?&!`&@` 뀤 >"Q %s: ipcp nak opts: [wantaddr %s] [agree] 㿘 4  X  R`>Ē` ԣ A`` >`)>'>"@@ @ې @ (`% 2#&```* `*`! `*  &!@ Խ!  @`>Բ!`&@` ɀ``>Ԥ" !Ԅ"!ԝ㿘!Ԑ &!ԁ㿀!  @0  /  ,@  ,@  ,@  2 ,@  ,@  !   &! .!)`!9 %s: chap invalid packet length: %d bytes %s: chap corrupted challenge <%s id=0x%x len=%d%s: chap input <%s id=0x%x len=%d name= value-size=%d value=%s: chap success: %s: chap failure%s: chap failure %s: chap corrupted response <%s id=0x%x len=%d%s: chap dropping response for old ID (got %d, expected %d) %s: chap response, his name != expected %s: chap input(%s) <%s id=0x%x len=%d name=%s: chap bad hash value length: %d bytes, should be %d Failed...Welcome!%s: chap unknown input(%s) <0x%x id=0x%xh len=%d 4` `>Ēcx z 0``4@ `  `0{\ `0v ?$? `!>0 # `!>0 #ؒ @"#``H -`@ 42`>Œӈ @ >ӂ H@ @ɒ`" @ P@@@ !/ @ >`>#d #\`\#`#h#l  @ٚ07`>Œ`  $ >>I 0*``@2`>A"H /f * ' !0! ?b# &!!Ā  !Ԁ  H 0 0H 0 @0>Œ`8 Ȑ  >  0*``@2`>"0>Œ`P ҵ 0 ?$?`!>0  h @"#``ҟ *``@o2`>ݐ H0`!+  `>Œ` ҉ 0"<@ @ >Ő@ >Ŕ `v -`2`@b>ҷ  @* @X2`>ҭ"耤`"@!$@0@Ő"#``>#\ aQ -`@=2`>Œґ @>ҋ H `h>Œa8  8 0`@ @ƒ`"\ @M@"( @@@=  !>` \>Őap#\ @٘  ,!$   `>>Ő \a#\ @ǘ !$ #!> \_  (@0@/!$`@>`a#\  *``@2`>  H "!$"!H㿘!0"#@!Ā  !> \ 8@!&!8( 㿘a$ > \ %s: chap TO(%s) rst_counter = %d 㿘 4 H o *@ g   !>!$@ՠ!(!8 ь !8? &!8!$ !> \ ,@ 0!$   !&!8!> \ 8@Ԕ H 0%s: chap %s, reconfirmedtlunext re-challenge in %d seconds re-challenging supressed 㿘 4 !": &!8c!?c >2 t!,”>!XcQ>!"`` >"p>ǖ"  ": >>ǐ"Z0W"H /f * ' !! ` &!ԑH 0 0 H 0 ! @%s: chap tld 㿘 4 >Ȓ`@ ܔ !!> ?&!c€p"(@"c,c)&"(c&$`c#$`$` !  /! .!+&! @Ր!+ #d>#\#`#h \#l  @p%s: pap invalid packet length: %d bytes %s: pap corrupted input <%s id=0x%x len=%d%s: pap input(%s) <%s id=0x%x len=%d name= passwd=%s: pap success%s: pap failure%s: pap failure %s: pap corrupted input <0x%x id=0x%x len=%d㿀 4`  #>ȒaX S 0``4@    0؀ 0` @   `$ !>0 ! @ #``! *``@2`>_ H0!` @U! @0@w #``>#\ a ,`2`@>D!@>> H`  4/@ "<   @"\  /`>Œap !> #\#`#d  @" ,!    /`>Ŕ >#\#` #d  @! !>   (@0w! >Ȓa Ϥ  N@`" >> 0,``@2`>ܐ"H /f * ' !0! ?`# &!!Ā  !Ԁ  H 0 0Ȓb `  N@`>Ϡ 0,``@D2`>ϙ"0>Ȓb K 0>`b0`  A *``@2`> H "! "!D㿘"80 #@2 !!Ā >!&!4  !0 #@> P@!>ʒa !Ґ㿘a > n %s: pap TO(%s) rst_counter = %d 㿘 4 H o *@ g   !>! @'#!4 ސ !4? &!4! !>  ,@8 0 ! > / H 0%s: pap peer TO 㿘 4 >ʒ` έ > P@㿘 4!䀊  &!4> >cX Κ H /f * ' !! ` &!ԑH 0 0 H 0 @1%s: pap tld 㿘 4 >ʒb j }!|{!!> ?&!c€p! " .!*&!  @u!/ @p!* >#\#d#h#l#`#p /#t  @㿀`4'T 'XH /f * ' > !b H 0 " 7 H /f * ' > p 2H p@  $ ' 7 '' ' '  {  k  '  **  * 2 ,`T  X @]}@2 ' '  4` @@5` > `` #\ ` , `@2`> H``@```&`&``T  &`T' ` 2" &`א0`&` &``4$ `@ ``   &``㿘  & && %s: down 㿐H /f4> * '> #؀ M >#!`"D! 4 @?`2!! (:!! 2!>˒ Μ!!`"ݫ !@!  4!!  ! ` $! !멒 !! 0! !Ȑ ' $! ,!ؒ`!  =! 2!H 0>!X*> @ #ӓ*`        2    "   `"   22"`2"@  2 "  2"`Z" `t @"@"@ i 0!:@2d d\M"|@˒ @Ȓ @Œ @’ Z"N!9@2J ! XD   0#@#@29 ` 0#@#@2. \!@ D6!!\ | |"\ `"8@ D  6"86":["< "\[   㿘 !>  @&!? >! , @ `"  @  , >!  !Ԁ ,  `"  @  ,`yconf-reqconf-ackconf-nakconf-rejterm-reqterm-ackcode-rejproto-rejecho-reqecho-replydiscard-req0x%x㿘 ` (>͐!*` €1>&#1>##1> #1>#1>#1>#1>#1>#1> 1>  1> (1> #x>͒`81 4l 4x 4 4 4 4 4 4 4 4 4challengeresponsesuccessfailurereqacknak㿘. 06 `# b#4`"1> `   ` 1>'!@%!P1>"!`1>!h` 1>1>  1> 1>  !p1> !x!1> #>͒`8ϐmruasync-mapauth-protoqual-protomagicproto-compaddr-comp㿘 ?`>͐#*` €1>"1>"1>"1>"1>"1> "1> "1> #>͒`8 ̎ 7$ 70 7< 7H 7T 7x 7` 7laddressescompressionaddress㿘 "1>  1> 1> "1>1>  # ###>͒`8 \initialstartingclosedstoppedclosingstoppingreq-sentack-rcvdack-sentopenedillegal %>΄* > h> p> > > > >  >  > > >ΐ  9 9 9 9, 98 9D 9P 9\ 9h 9tdeadestablishterminateauthenticatenetwork >΄d* >!> !> !>!>!>ΐ  : :$ :0 :< :H㿘. 06 `!"1> `#  !1>1>  b#" 1> 1> # 1>  X  #*>͒`82˫ %02x-%02x㿘>ΐ#(m .`  !>#0d *`  \x%x%c㿘?.`#`@#>!> ^ Hc `C#*  @%d.%d.%d.%d㿘!> #ȗ6 6 >Ϛ 6 ` ]    2lo%d㿘??5>Ѫ! >>Ьa"#>ϐ ؒ k  %@ݒ ؀ `> j"" ,  , 8, :$$ <4 4$ $ , 9  $ $  ( W ??ِ ؁looutput: no header mbuf%s: can't handle af%d 㾀` >U!`(`4   ''' 'W&`4! @"`P4  3 A`P $`P````@$```̀ "`>А"@2 ``ğ''`'```'`8# ```$"   `ܐ"   "  `  &`&`   ` ` `` &`2 7`"H /f4`* '`   ````@&&`  7` 2" $``$` $` "`` $``@H 00b  > `> i!x  > "H !L /H /f * '   @ `# H 00 7&`  2" # > ࠠ  , @ # # "ࠒ > > > *`  Y `HY `H $`H``\ $`\H p@ lo_altqstart: can't handle af%d 㿘 H /f    " € * '  ̀   2  ` ` & & $` ?& H 0`e`@   > "h> i!x `>  @4`bH T?0IH /f * '   @  `*# H 00.$`  2" # > ࠐ , @ # # "ࠒ > > > *`  Y  HXߐ  H & H` \ & \H p@0j` "`T  @   42 4>ф" 2@1@ "  /  /  "  " " " "" " ifmedia_add: can't malloc entry㿘  &  2"`>H!"` "`"@ "`"& 㿘 `` ``ifmedia_set: no match for 0x%x/0x%x ifmedia_set㿘@ 2 & >ѐ"pȎ8 >"㿘 { `xv0!50 !6"$m `@v 2c ` @2&2&X &&@ P&M& ` `&`&`&`&`€`   *   ` .$@` &2 02   ` *`$T "` O &`  ifmedia_match: multiple match for 0x%x/0x%x 㿘 8  @%>  2   2 㿘 #< 2 @2 $ & "@   ꀦ>  @2` @ sl%d㿘. "* "*   '> ΢ 5$!> $!@o!@,0 >>%`Ш '>Ҕ$ ؒ`dz !(  2 $ <, 8$ $ `$4 4$ $   $ ԘА ۖ ᘀ@sl%d: can't allocate buffer 㿘 2!H /f * ' > !<!$!H 0!`( 2`H /f * ' > p 2H p@ ! "@!" !$"!2`!" !"`  N $!! "C ؑH /f * ' > !ؒ!!"`$! $`  !"`$H 0!`$ ("`! 2!"`0!" (!"`,!" <!"`8! "  $ 2 ! >͐#x 4  4 4!(0 $ $ $`$ @t$ 㿘>  `a2 f`h > ` !> ΔYc#ܢ`H O? "N 7&`& `& DH /e * & `p$ &`pH p@ْ H /e4`L* &`L"Q &! `` @ &!$#x|  H 00&! &!$H 0   㿘 ؀`'. hH /f * ' L$`&  aa $a $`$` $` Hea$<a H 0X@ ?ؐ "%s: af%d not supported 㿀    ȟ'`'' >Ԓ  ސ p / $ p Ӑ 2p 2  4 @2 4Ɛ A@ ` w 4H /f * ' !`"$ H 2  #> " ' " 'Вb@ ? $ ! `@I$!     @&&`w  7 2" $  $  $  >   $  H 0 T $ T`#$``"  `H $!@  H 0 ` #Զ  H   ̟@ H 4- + L H" "Q%H /f4 ܐ* ' ܀   % % $ ?% 䀤"  h % h߆  €    2    % % $ ?% H 0#-> ` Hв ` `S?@@`  4@  !(@s:  @*#`  /S '`%& H`  ` `% `> "/>  1  ` `? $  `% `     ݐ    ` % `H /f  T!0* ' T* 5  "#8@ <"`<<8"`8> $T!($0,4$0 ?4?ؑH 0 2  "  `֐  X`% X P `% `% P㿘!H /f * ' > ! $!H 0!`( 2`H /f * ' > p 2H p@ ! "@!" !$"!2`!" !"`    $!! "L$!H /f * ' > !ؒ !"`$! $`  L !"`$H 0!`$ ("`! 2!"`0!" (!"`,!" <!"`8!`  `0`$ @$ $$$$ o $! 㿈> i`ؒ`B d:?2 !`p 2  \` @2 \! S$!  4 `&$ \ 2 $!! > ! @6$!!  @!  $!$!! 0+> $!   ܀ "!   2 ! 2  ! 2   $!  ?$!  " `#` Qa  @ @*  p 2 4 O*@ 4#@  @r–!( ג0@Ҁ p2 L`'͒  p@r!( $ L 44 4Ɛ #`"\ H ``' 8# `  $" 4   ܐ"   "    & &          & } *P H /e * & c H 0   H>  $ H`#$``" H /f * ' > i!x @ `" L l`$ L =$ l0 &  2" "xx> ࠒ`"" "ࠐ 7, > >  *`  R 0Q H 0!  @`*@$ $!! $! L $ L!`$ $ $!$ 㿘H /f * '  a2@ a1@a @a@"9 0!{@2  `2- / 4 )6 4 `"# /  /@{ 0`\&``$ `H$ `P$ a0$ a4$ a8$ a<$ a@$ aD$ $aH$ (aL$ ,H 0ppp%d㿘>   a@ +>)>'>%>$ bHА %ܔ  "8$ <, 8, :$ $ $!`$ $!0$!D$4 4  $ ΰ!p  `ޠ!㿘>  !@! ``!@   ``! 2`` 0'%$! %4!!X $ @{1$!" }  $!@oi!t$!|$!!P "? 6"$!T$!P>  $!$!㿘N 4& ?6 4&!   !  &!&!"!?&!!$  !$  &!$&!("!,?&!,!8  !8  &!8&!<"!@?&!@!P  &!P!P2!L  &!L@ѐ!&!| &!! &!&!! "! &!&!!  &!%s: comp_alloc failed %s: decomp_alloc failed %s: no compressor for [%x %x %x], %x x Q@! S@ "a8  Z N@"@.?0倦@ "0` V@(?0 J@y?0 `G@ `F@R@PY@?0  M@" `K0 L@&?0a,&`&& !2  @H /`4`* !` @ @@7H /f4`* '`<?c $`H p@~  !2 w> $@(p4ao l& !2s fa aH /` * ! @n> H 0L  !2R E 4A$a !2I < 8  L 0ـ >"`" 2z  < H /`4a|* !a|  ax@$ax€  $a|`@@>ِ!` 7H /f4`* '`* $`H 00H /`4a* !a  a @$a€  $a`@@>ِ!w` 7H /f4`* '`* $`H 00 `@@{>ؐ"ڒ` Q  ! 0 L@2 at&!2 at@  H /` * !  * #`@A`@H 0a H /` * ! > `a"&a" &H 0F "*    {SK }* 00   }  &    G@aaH /f * ' ""H 0 |   㿘H /f * '  2@ 1@1@") @"!n @" 4h 0!z@ "P!{@"[ @V  @S ?Q6 4  `  `I$ <"F / B@ /@x= 8!X&!\&`!`&`!d&` !h&`!l&`! - &`!` &`!`&` !`&`$!`&`(!`&`,!` &`0!`$&`4@x 8!| "!!x`€! !`4€,H 0%s: af%d not supported %s output: 㿈@ "- 2`4 @= 2` # 2`  ``ğ''`'`?Ȗ*@6`>`  !t` !6` *   ْ` /   2" ````8```$"  `?ܐ"  `?" 4 `   2&` ° 7?&``<* * ** `  `&` `` @` @>ܐ `@ 2!!p` *@!  Ǹ 2! ! Ǭ "`>  $!`*!p H /` * !  !T`"&`Y$!T`@  !8 @& &` `%"0 7&` 2" "" "$     @&&`  7 2" $  $  $  "   $ " H 0 T!l` $!l$ T@`P```$``$`PH 0 Ӑ㿘!P l!P   *`@ `! !t"Z YO $ @ #  !8 @ `"0 7 2" &!8" "%        @&#    7 2" &  &  &  `"  & `" T!l `& T&!l  h$ 2 &!T㿘H /f * '  >  *@ & #  1I > >  *`  L< 0L H 0㿐!8    $!8$!<& !@?$!@   ̀   2     $ $ &  ?$ 2 !h  € }  $!h  ` `*  @! `  -01 ! ,0!( `  0  ` 02 @jH  p " ,` / -,@,`,`,`@Ԕ 0 !3  "0 !| + @' '    !x !| <   `@`   `  2 2 􀤠 0 !"     & &   2 ` @,`,`   & & 㿘> !@H /` * !  '   !8 "`H /f * ' $ H p@  @`!@H /f * ' !` ` $!$!"`!?$!H 0 `߀`H 0if_ppp/ccp: not enough data in mbuf (%p+%x > %p+%x) 㿐` 8`@`` ` `` Ş ` `*  @@ @ @>ߐ  ܔ0 @?`> x*` € H /f * ' ?# & H p@ 0 ` @ ` 2(!!|~@!x @    rH /f * '   & H p@ 0[ Y@! @#\$  ! KH /f * '  @ 0*@& H p@ 02 `/2!!|)@&!x@ 0 @!(@ H /f * '  * & H 0  } ~8 p p } } p p p p p p p p 㿘!| "!!x@&!|! ! @&!㿘H /f* ' ` 6`&`! 2" &!!> ࠐ @ &!&!"ࠐ .Β > >  *`  I 0I H 0%s: got %d bytes %s: decompress failed %d %s: VJ uncompress failed on type comp %s: VJ uncompress failed on type uncomp %s: input queue full 㿀!\  &!\@ ' `   >!@` ` `*``@ ` @?А*6`H /f * '  (& H p@ D!B8  <! `, 2 ; β` ` `* : @@>" <H /f * '  (&  @& H 0    @ !`0€  2    `  h-!  @hƔ H /f * '  7& H p@ -X/ Y! U` #\` @h˚ @ @F>Z"(H /f * ' > ! H 0 #/>  4 H /f * ' > p 2H p@  $ $ 4 $$ $ $  Ò  $ $  (V`H /f * ' > !ؐb $ $Z $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8      8 `   $ 0   " `  ?$ `"`0 " `$ `$ `$ ` $ `&` ?6`  !,@,`,`,``Fh !  $ ` `"@ &`&`      8 `   $ 0   " ( a$  ?$( X$2V$   `F4`  `  $ H /f * ' V`> bp*`@ ?2@ `  ` "#@`8@ `<"`<`<`8"`8> `$!``(`$`0`,`u`4`&`0 ?6`@$H 0"!  ! ` #\` p@gs 6  ! @@>"Pn 0,`O ` K H /f * ' > !H H 0 " 4 H /f * ' > p 2H p@  $ $ 4 $$ $ $  a     X &`  &`&`` *! L "! B "`>  &!`*!p !!-  4 !t "`֐0k> ``  ?&`&` `&`#  +Ȓ > >  *`  F > iF > i!x!$ H /f * '  @&&` "H p@  @@>"  l & l 2" ""`"H 0  H  \`& H& \!@0 q L!`` &!`& L%s p +  | >   2  @*   @ *  ** ޔ  >*>*#(Cvmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map㿘>   !2|y ^H /e4`h* &`h  `؀   H 0@  4 2 !H 03 `">@>at3 ؐ! 6!@o&!̐?>>>"&!&!& &!&!& &!@ &! 4`@6 4` & D)&`ؑH 0 㿘H /e * &   ؀  . h&  @ oH 0 㿘H /e4!Ȑ* &!Ȁ  }&!!̀ " v&! $K  ;& H 0㿘 ؀  z H /e :%>H 0k H 0c* & "%>    @  H 0C # !˜   h " !$H 0+ " pt (!$  $!$$!($!,?$!,H 0 `  "㿀 p     @2 h˰  h Ű "ð  <` @`` (0> "pH /f * ' > !!H 0  4 H /f * '  4H p@  $ $$ 4  o &$ `#(/ H /f * ' > !ؐq $ $i $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8   "  82 `   $ 0 @   "@  ?$ `@8  j$ ` l/`B `" ` #` 㿘 ؖ  s? P@_  U@0X@ Y  W@ "  T@M  O@F!2zA KH$!!E& !2z4 >;$!!8& !2z' 1H /e * & !B !!*  $!$!$!H 00!B 0    R@@֐>(*  @2 (2 `* 2 㿐` H!AaȀ> : "8 H  ?ad ~`&adђH?# 6a> " U@a@ @ 2`*  `* a `@ @ @2 *`  *"`@ IHad$@&ad%+@&H /e * & H } < @ ,H 0ad` &ad@`? s o aܘa8 ;`*`   * `  }//H p@݀H 0Հ/aܔ 8 :` `;`*  `*  },@`` ,@,@` ~,@`H /e* & H H    a?0 * H 0 $ad &ad $P$ H /f * ' T* 6̒  "#8@ <"`<<8"`8> $u!($0,p4$0 ?4> !_H 0 "&aa 6a܀&aȑH /e * & @0  `$` `$&`H 0㿘H /e * &   s (H 0㿘 ̀` ؟@ H c` p    @  z 㿘 H o *@ f  {& В H p@㿘H /e * & ! !> "p 2n H /f * ' > ! H 0   4 H /f * '  4H p@  $ $ 4 $$ $ $    <&H /f * ' > !ؐZ $ $R $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8    0$"$H 0%s: bad char %x %s: bad fcs %x %s: too short (%d) %s: no input mbufs! %s: garbage received: 0x%x (need 0xFF) %s: missing UI (0x3), got 0x%x %s: bad protocol %x %s: packet too big %s: too few input mbufs! 㿘`؀`K`@G> i@aX`B :  $aX`@@> 8`"* `2` "``p'>`n*` * " D* &`p 0  `p`̐ >` &`p@0 H /e * &  ``@ $`>> * a(@  * `` $`H 0`@@ޒ ~2`aa 4aؐ@Ӓ?`0@  1<aڐ @- H /e * & 0 $`@>aڐ PS``La`` $a`$`L0*$`H 00 4(aЀ @> `5`H /e * & `La``` $`$`L$a`H 00l` ?  "` aa@ 2@$aa! " aa$a"` `H /e * & `* $`H 005@ +  ađ*@'H /e * &    }  $`H 00 *$` H 0a؀ @ à 2aڐà 2 a`@@> x&` a`  `$``$&`$a`<c4aڀ $a``@@>  *$aԐ *aؐ`$a4a`  &` a؀ 2a؀  @`@> `a`a؀ 2a؀ "aa*aؐ aВ`$a4a  " a؀  2`@@o>aJ ؕ*:`f`a*2 `  4a`@@Y>2 a`  "@`82@` ``$`0 `  "$ @+` `  ?&@ 4$` @ 2@7@ 2 @`@@(>!`#`$a` &` `$ ``$&`$a` > &` aԖ(*@aڒ`*2 $aԑ* 2@ (4a@$H /e * & `La`` @ $`L$a`$`H 0`@@ %s input: 㿘`!!*@ &!! `  > "h!@!&!%s p ">  >/pq>2aH @ + @  +  +   * >+ +a 0 ! " ," 0" * " (" $" " 4㿘  , )#  $ (  22 " " & & $  #   & , $`*@o͐  ( 8& (Ȑ  㿘 @&@ <&` H&` D&`  8&` 4&` &`  $* &`2``@o`&`㿘6 & 0㿘`$L  2H   2D  6  2?  `!>"p*` €#  #)  "] " Ϥ ,  *@ P j'   @g P .` j  & Lk  & L&& . & .  㿘 L "kے kؒ 㿘 㿘 㿘`@ 29 ` 25 `6` 20  ` 2+ "! L "  !  L*2@  *#@2`T2`V. \&  &  . K 㿐#\#` 㿐\ #\#`㿀`'H`*  ` '`? ` 'T' H"T4'TH /f * ' > ! H 0  4 H /f * ' > p 2H p@  $ $$ 4   H R"$ `T@ (/`H /f * ' > !ؐ $ $Q $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8` @ $      8`"  $ 0   " @?$@  ` @,@``,@`,@`,@``2 ,@ ``,@``` 5` % ''쀦 '@? `* @,P@ * @`@  `  :$ , P@@ @ Ȩ`-> `"p '耤`'7 ,@`@* $@$ H /f * ' > a $H 0`! 2`H /f * '   5 H p@ ""`"2`  $ LT" .$ H /f * ' > !ؐ $ $\ $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8      82`"  $ 0  " @?$@ d/ `@ * ?@ `'-` .` X@*`@ `T22#2`T26&`%`% 4@2 -> "p 耤`'7 ,@`@* $@$ H /f * ' > a5 $H 0`! 2`H /f * '  4H p@ ""` " 2  $ LT" .$ H /f * ' > !ؐ $ $ $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8      82`"  $ 0  " @?$@ d/ 耥`$@%`$`  %` `%`$f !% *> bp耤` '7 ,@`@* $@$ H /f * ' > a $H 0`! 2`H /f * '  4H p@ ""` " 2 : $ LT" .$ H /f * ' > !ؐ9 $ $1 $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8      82`"  $ 0  " @?$@ d/  耤` ' * 2 ,@`@  $@$ H /f * ' > aܒ $H 0`# 2`H /f * ' > p 2H p@ ""`"2`  $ @T" .$ H /f * ' > !ؐ $ $6 $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8       8 `  $$@$  * ?@ `@ `  -`  `@ `<%`@T`%`<H@ ;H"`4`8` %`8 %`4`H `D `%`H%`D㿘` ``*       4   `& 46 ` `?V`S` `X#@ @ *@*P  * @`      :" * P @:   #` @ *?* `.  *  T@"2 T1 3 #  L& + ,  2   @2@, @`2` 5  $@ & & $o 4  8* <  @`& 4& 8& < & @   . bsd_decomp%d: bad sequence # %d, expected %d bsd_decomp%d: bad CLEAR bsd_decomp%d: bad code 0x%x oldcode=0x%x max_ent=0x%x explen=%d seqno=%d bsd_decomp%d: ran out of mru bsd_decomp%d: peer should have cleared dictionary 㿀  'L&`"'  '  '` ?`"O ` ` $@ * ?    I> "33 4H /f * ' > ! H 0`" 4`H /f * ' > p 2H p@ `$ $`4`$@$`$`$`  , `2' $` "H /f * ' > !ؐ͒ $`$pŒ $`$H 0`$ (` $`4`$`0$`($`,$`<$`8`@`$`   ?`8`" ` `$`0`   "  ?$@  0***!'h``d@? * '' X3+'a' @`0@`2`  Z G> B" ;'@ @@@@ -> J">#DD @ ''L,    ' > #0$$ @ <`$$` H /f * ' > ! H 0  6 H /f * ' > p 2H p@  & && 6  2  A& &$@H /f * ' > !ؐ & $a & $H 0 $ (  & 6 & 0& (& ,& <& 8     8``"   $ 0   @" "   ?&" ``, V*``P *,*, "HC, , @+  P@.-    :# +  P@*X`*` `T23`#2`T3`2"L$ *@+2   "',  @`2` `$ $` $ @ $$$ " H > #PH `D@<@ $@$D$H$<L"㿘6ѐ bV 㿘d1 㿐`29   23   2/   ` 2*   & 2` "  d b/  >>! aD& 8& <#\&  ?   @֚ &  H@_ 0c  㿘@] c 㿘$# @  2 ` 2 ` ` 2 2`   2 ` "&  & &  @& 㿘 @&z_compress: deflate returned %d (%s) 㿘 `# `*`@ &@4H /f * ' > !> H 0  />  4 H /f * ' > p 2H p@  $ $$ 4    i&@$   (/ H /f * ' > !ؐ $ $ $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8     82 `   $ 0   "  ?$ `6   $  $   @- `- - -  : - -  $($$А"@$($$   $``$  "$    2(" ($ $" (  $ H /f * ' f $H 0`# 2`H /f * ' > p 2H p@ ""` " 2  $ N' .$ H /f * ' > !ؐ $ $ $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8 $$     82$(`"   $ 0   @"   ?$$( А"@$($$@ސ  >0#(>#P  "D( ?  ($$ 6@ 2P " @PT`$P$T@ "X&@X\@ $X$\HL@ $L$H㿘 H&@ L#&` P&` T&`  X&` \&`&`*&`2`@e+ &`㿘`24   2.   2*   ` 2%   ! 2`   d _ʔ  >>! aD& 8& <& $ @p  &  H@]. 0a  㿘@E a 㿘$% @  2 ` 2 ` ` 2 2`   2 ` \  & & & &  @& 㿘 @&z_decompress%d: bad seq # %d, expected %d z_decompress%d: inflate returned %d (%s) 㿐'L&` ` `" ` `$@ * `` *     " > ې  &H /f * ' > ! H 0 #;>  4 H /f * ' > p 2H p@  $ $ 4 $$ $ $  Ӓ  "O $ %H /f * ' > !ؐu $ $m $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8     82 `   $ 0   "  ?$ `6   $  $@  -@-`-`& & @`  ` & $& (     2 (`"  (`& ` & ` @`  ( & ( `  -` $? ( & $& ($ H /f * ' a $H 0`# 2`H /f * ' > p 2H p@ ""` " 2 ꣒ $ zH /f * ' !ؐ $ $K $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8 & $     82& (`"   $ 0   @"   ?$& (@    > 0  >#Pk V "9  ( 4$@$  T H  L& T P@L& H& L& P" 8 z_incomp%d: inflateIncomp returned %d (%s) 㿘` # *`@ <:8 &` ?& & ?& &  & ` & ` @ "@  > 0 #>#P 0`2` X \ H L@ & L& X& \& H㿐#\   @ 㿘  &  ?   2m? 4h?`` $ a?' (   W? ,@,@ & ?$,$L$$(  $$$H$D@bP$$P  ( $0   (┟$$8  D ( $<,@ $   (0  $8  >< 2 >"ܐ@0& ?␑*`  $ $ $ ,\$|$ @$㿘 "(?  "$? " ? $  ?. ,& & &  $   $ $    * q $ $ @Q@L  2` ( " (" 㿘  `8  `` .z & ` $`   @"& & `" $``$` 㿘 ` 2@? 2 `` >"԰?$`` 9>  *& ( |?* :``( *` @b  $ q&   "  ` "   |2   q`& `2u  `" `>"?i$`` ` l ```2 |"&  | @Β @ 2L ` "H `.`- "(`` @ 0@ p0 @ 3 `  D <*  2? D <@YM*`B` ` |&  `2   2  % ?c ( ?& `?㿘   2 0.?`" 8 $ $* ( 8`" < $ $* ( <`"  D $* ( `" $* ( $ (&  㿘`` 2` "$` `2@ @@& @-W@`@$`$@㿘 $ D*` <*  & 42? D <@X*`> |b*` `& x@  & @ `& @ & X& t& @& d& T& l& `㿘`$`d~`0`t`p!  `0`d`p``8`, 1 ^  Y T  N  &~ 6'@ /'@ ('@ !'@ '@ '@  '@ "ɴ'@!  ` `h@ ( ?2㿘 $ 4 l d"@ @ ??9?2 $4?~  / 0, h d" T# D" <+`@& h& d& T@ "2@2@ 8+`@@ "2@2@2 #  0 d l@ ܒ@  l@`& l 0 d @ & @ ` P L*  & @ l! `2 4㿘 & p `  d 0 ` @ P L*   <& @ ,* @  8+ 2  @ <*` f2 " X d $"@>@8 X ڒ& X X l 8& X XF d h@ )"  X l x" (& l %& X d 0`& d@  @ P L*   <& @ ,*  @  8*`2  @ <* f2  X? & X d  X d& X@ 0& d @ & @ ` P L*  & @ 0  d@  l d & l& d`" l T  0   d" @  d & T `"&  l!_ l!`"  T T  0   d" @ d& T  `?㿘آ `( X d 0 ` @ P L*   <& @ ,* @  8+ 2  @ <*` f2  X  h& p& \`+& X x@:( p d $"@>@8! p  & X X l 8& X X`8 p  `2  p d h" ( p& X p(V ` X Q d l \ `# @> l p " & l& p d @& d 0 @@  P `*  L  <  ,& @*  @  8*`2  @ <* f2@  p? & p d  & X& dJ& ` T  0   d" @E  d<& T )` ` ) 0 d  @ " d T  0   d" @#  d& T d l & d& l 2  l9  d  l & `& d& l l!( l!`"%   `   0 d  @ & ` T  0   d" @ d& T  `? $? $Dx p x> > > #   ؞   +  # b(+@ ?` >!p* >  d   >  * $@ +   **@ ?  *"; >!p>  d *>  + "?,@  ` ?(!*@?  $`2? 62> #  ,   2 7耤 !> # ,  3  7ꀤ!!> # ,  3! 7怤!> > # ,  3! 7> #@=!>  x  4`@T 4@  `㿘>  z`Fbbbb b& >>>& 4H"\ )*t&+&+&+&+$&+(&+06&&@!0t060 H060" 2"" " 㿘.T7H.46.P*` /  ) (`@/`@*  / / / T@.@@  ..  .'@ ..T 㿈`+4@ '`  +R ' 2@ L +T'*` * @2  `<;",@, @* @ `@$22 4!,`   5 $* @@@* @ & *@ @& <쀥C- ?,``,``",` `?2 *   2  2 " ",@  * @ `" ?@ *$@@&6`? 2`ߑ,`xؚ    * 2 ` ` ` *` *6 @2 6 㿘 LH"= & ?@& P+T " 2  & * # +@`@`H +T '+4`P b b  *  & % % , 4 + ?&   "@ &  急 H&2`@ :`` `4 H L P*+X &&+X ,`+X?&* $ +`?&* $  ,   4  @` -+`,`2  2`&+Xe  Ϡ `L +X& *% 5㿘?  `   .<c:0jt "-.@7@ .@7@j 6j 4jj6j6j `       ͞㿘 ?      c* @R 1 +`b tbv "@.6 (&6 .@ "&>6@(6&  `v@,v+`b #@t.6 ( &0.@ #&>& 6@(&6궺b #@$.6 ( &0.@ #&>&6@(&6b .@6 .`6` ( &0. '@( 4J꺺b #@$.6 ( &0.@ #&>&6@(&6b  .@6 .`6` ( &0. '@H(Lb #@$.6 ( &0.@ #&>&6@(&6b  .@6 .`6` ( &0. '@&>@& 6(&6      @    * 㿘+; + 7)+(>"X  *v $  * `"?  * `@$ 㿘  ~+  6  `+  3  *   & 2`*  " ;6 & &  ~* @6 &  *  6  `*   3 *@   & 2 *  " ;6 & &  +  6 &   +  6  `+  3  *   & 2`*  " ;6 & &  * @6 &  1)"">"X *v`  * @+ @6   * ` & 2* `$ & ; 6`* @*@  6&㿘  .  6  `. 3  *   & 2`*  " ;6 & &  .  6 &"` * @ &@̖ 㿘" "   *  ` & 2*  `?& & 6 & @b   ?& 㿘   +@  6  `  *   & 2`*  " ;@6 & &   * @6 &> #d⸢ #d +@  6  `  *   & 2`* #?;@ 6 & & d * @6 &!" ` @& "" " [ "  +@ 6  `  *   & 2`*  " ;@6 & & "  *@6 &cd #d +@  6  `  *   & 2`* #?;@ 6 & & d * @6 & ` @& " &㿘!" `?  `&@Vz+w+""    2 2 (     &@{&  `0p 4  +@  6  `  *   & 2`*  " ;@6 & &  * @6 &> > cx@Ɛb 8b  +@  6  `  *   & 2`*  " ;@6 & &  * @6 &++ ` @)b b   &  @ b  & "6 㿘" "*`2 "` *@ & . @  +2@ " >  & b @ *  2 `>  *`>`! @*)`   >`! *`@ 2  | '"2# d> Tap" *)  @@$`?`" "2@ 64  bb  `?㿘☺@ > >@ @@+ @ ) / @@ #@$@@@.7@ ``(@ `'`0.@@ #'@@@('@7@> ⸅(`  @"@@$@.7@ ``(@ `'`0.@@ "@'@>'`7@@@('@7@(`+> "@ "@'@/7@ / `6`(@ `'`0.@@ "'@>'`7@@/@'@7@3  (`@"@ "@$@@@.7@ ``(@ `'`0.@@ "'@>'`7@@@('@7@>p+> d"@ "@#@+7@ +`6`(@ `'`0.@@ "'@>'`7@@+@'@7@@ 1"d @"@@"d@.7@@ ``(@ `'`0.@@ "@>7@'@ '`d"@(@7@'@d'@     *```` ` *```` 3  *``` `?*  0`* 2 b b ( "2 (" "2 b (   " 02 " ( "2 ( " (""2㿘ڐ" & 6 8*@  & *@  & *@   & 3 *@  &   @ `*@ & 㿐 "? 2& ?& &  ` " @ 㿐 ? ` $ 2`0 @ $  (  $ 㿘 2 1?  (  )& "  `"   "`  ( ː?"  `  >  *@ѐ  "` ?㿘ǒ unknown compression methodinvalid window sizeinvalid reserved bitincorrect header checkincorrect data check㿘 "? ? `> "*` € ܔ  & &  @   `" &  ">bH 2    >""h &  " "   & &  @ ` &  ">b   * @Sz  $>b $ `@{`      @+``  " "~  @ `  "@ "@  b? `& &    * "` &"  `O  & &     *` " &" `:  & &     *` " &" `%   & &   " &@   ">b &  "" " ? ?`2   " ?" # # $D $ %D % % &p &x㿘` ?@L㿘 F?`2@0@  "@"` 25?     `0 `  ?( "@$$$ "` $$ "@???㿘 8 " <&? 8  `$*`(  2  ( @ u @ @ (& 8& 0& & $& 4   & <㿘   ( @    (  & (& ,& 8& <0 ( $ @ invalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid bit length repeatp 0 4@` $ "? ,"` => #*` €?  *`` 4  `&  `/`2  `4 $@&إ4@@耢 & & $& @&``$  &`&@& 4? && &  &4> &!&`4& $& @&``$  &`&@& 4??  *`` ?c82   > &!&`& $& @&``$  &`&@& 4Ŕ? ` &&  q `& $& @&``$  &`&@& 42D  , ` 0 ( @ "?"`22 & 4@] 0 4 "@ ,? ," ` 0 ( @ "?"`2 & $& @&``$  &`&@& 4h 8  " %%@&     &?  *``  ?, `& 4   ! > &!&`& $& @&``$  &`&@& 4$?@ ( ` `(  & & $& @&``$  &`&@& 4 ? & &4&   2  @> "l¨?  *``   *@ *`"  & 2  4    >"l* *`"  &  &   @& ?2& $ && $& @&``$  &`&@& 4 &&  4   ! @  >  8 @,  r?  *`@ ,   *`    $@ * "  & R4    @  V?  *`@ + 4$@  4 @ ! @$@ 4   > &" &`& $& @&``$  &`&@& 4>?  ( ? + "@ &  4   ! @    @y  4 #\&  `   !`''#`@ܠ ?"&& $& @&``$  &`&@& 4@]ؠ 2 @G@D& $& @&``$  &`&@& 4ߔ?`(*`$ & & & && $& @&``$  &`&@& 4@K @}  @ @  0 4@` $ "? ,"  `V&  && 4@a 4 0 0 4@& $& @&``$  &`&@& 4 && $& @&``$  &`&@& 4q & $& @&``$  &`&@& 4c?& $& @&``$  &`&@& 4U& $& @&``$  &`&@& 4G& $& @&``$  &`&@& 49& $& @&``$  &`&@& 4+& $& @&``$  &`&@& 4& $& @&``$  &`&@& 4& $& @&``$  &`&@& 4?@ * ,$ , . / 0 4\ 5< 5 5㿘$ (  ,`(`$" `(`$ @㿘 0 4@":? "`5?  ,@" $"  8 <& <k`@&` ,$@& 0 ("& 0〤& $& @&``$@&@&`& 4 2?"  #+3;CScs !1Aa  0@` 8'H\'L'P'T''''''''''''''''*`  " H  !":  `   , `" @*   ,``"@8 " *,  @   /`,` @?"  '' "@`  ,  *`#`" H`@*  '?'p ͮ / '@"¸ ._H . @``'(`(`  "? " `@*8 (''' @  p@`? ! p"" //'*` $4@, ""4H*`'  / /L    `/'LT" *  `P/L" P* '4@ *  ?, * ""   *@ @" @4 @2@ *@? @  %*.? @ E 8/ ` `2?oversubscribed dynamic bit lengths treeincomplete dynamic bit lengths tree㿐#\#`    ??>  & @>`&?oversubscribed literal/length treeincomplete literal/length tree㿐`\>>#\T!#`!L ??>!/$ -@@>a$ %?,`>>#\L"#` - ??>! $ 2 @@>a$ ?@@0 >>  ( ܐ">⸢   ")>%> -> '>  +> "`"" Ub>>"cx?h'pH "? 6"  *```"a a *``a"a4 l *``a"l $l#\>>! !T!#`t "? 6"p $p#\>> #`L"Ĕ ax %"bl?$b%p&@t&ax& 㿘  ? *`$`( ? 㿘 (    * * " " "invalid literal/length codeinvalid distance code㿘 0 4 @` $ "? ,"` >"*` €)` '& $& @&``$@&@&`& 4   @o  0 4@ ` $ "@? ,": $   $ $ $ @ > `  *`@ > `8+`@   * @  @$@ 4  $ $  @ $  $ $_   $>$!&`& $& @&``$  &`&@& 4? @ > `Y  *`@ >  8+`      $ $@ $ $ $4  @ > `H  *`@ > `8+`@   * @  @$@  4 $  $ A$ @ $ :$ >$!&`& $& @&``$  &`&@& 4H? @ > `  *`@ >  8+`    $ $@ $4  (    ," "@  "$27  ,  0 ( @ "?"2% & 4@ 0 4 "@ ,? ,"  0 ( @ "?""& $  ( ,   ( ? $ $2D  ,  0 ( @ "?"22 & 4@Ԑ 0 4 "@ ,? ,"  0 ( @ "?"2 & $& @&``$  &`&@& 4 (m$& 4@ 4 0 0 4@& $& @&``$  &`&@& 4r $& $& @&``$  &`&@& 4b & $& @&``$  &`&@& 4T?& $& @&``$  &`&@& 4F& $& @&``$  &`&@& 48& $& @&``$  &`&@& 4*& $& @&``$  &`&@& 4& @&``$  &`&@& 4& $& @&``$  &`&@& 4?@ F F G Hh I\ I K LH L L㿘`(`$ 㿘 4 0@`  ,"` " `"&`&` 8 <& <Ô ,@@ 2)&`  4  (& 4 4`"   " `"&`&` 8 <& <@&` & 0㿘04@$  "$" ##@""""4 , > 8. .`(  ( ( @`x@> 8 `!d7`(`!   7 (   (> @@ 8 `!97 `( & (  (`@!'@@ 7'@/@ `/@ `,& &/@ `(/@ `6`@2 1 (`@ ("`@` (` (`  !/@7`[1 " "$" ##@""""4?` e 1  "$" ##@""""4 0.95Pbuffer errorinsufficient memorydata errorstream errorfile errorstream end㿘?6  ` f a !E&@`@`@@`@ `@@`@`@@`@ `@@ @`@ @`@@ @` @@ `@@@`@ @ `@@@` @@`@ @`@@G#@G#񀦠,`vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe maptun%d㿘!> Α. $"T A "T#> *`@>$a"T :>">>`#)>.  4 ؒ" Ɛ  5@$, 8>!+ $ <4 4$ $ $ $   $  , :$ X$ L$ T$ H$ P$ \$ ` (  bT 㿘@J2 "?> Α2 T @@   > !*` `؀   2`ذ 㿘> ?bT2  @ s > !*`  ?# 6 ؑH /f         * '       ` ` & & "` ?& `H 0 4 "1&  ؀$2-& ܑH /f * '   4 @  `2   ؐ2 @)o   2H 0&  `4?`ؐ` A2`492`ؘ2/" `4"`4`؄2``4" `" `4"`4`2``4" `" "` 2`2 㿘 H /f * '  a@ a@a @% a@! a1@ a2@ a@" 0& <"  / / H 0㿈`ؐ " & @    ğ''`'```"`8```$"  `?ܐ"   ?"  `` ?`&`&`  < `" `` "`` &``" ( "`` H /f4 * '       @&&`ͻ  7 2" $  $  $    $  H 0 X %$ XH 0 P ``$ `$ P`؀`@?# @4`_`؀  `܀  `O3`֐` > ? T0   > (H( "}@"dw@"z@"d0t\@"<0n ]@"!v"~@"<0b@T [@\"< *824["D" 8242DS"4 H H 24:24H 9 "؄+2? "؄!2?2؀"""" "  " "H   H  tunread㿘> ?bT2  @   > !*`  ؐ ` ? @# @6 ؑH /f )>H 0ذH 0а* ' )> ؐ " !>!! [  ؐ  ̀ *  2!  ` ` & & $` ?& `%` ؀!`@H 0 # € ɒ `@6 ؐ!! [ `" ؑH 0`i`_^`> "` @ 8 ``QH /f * ' T`* 4`j ` "#@`8@ `<"`<`<`8"`8> `$y!``(`$`0`,`?>`4`$`0 ?4`@> !xH 0 `"` `͐" L & L㿐?> ΰ 2 bT  2 > * `c % (H /f * ' > !v H 0 #+>  4 H /f * ' > p 2H p@  $ $ 4 $$ $ $  ɸ    7\ 7' Y` T> "p 8 $  Q,$``<H /f * ' avC H 0  4 H /f * '   5 H p@  $ $$ 4     쀦 `    "LL z$L" "`( `"` ?" `?"`0 > i!x  > "H ٰ /0RH /f * ' `` @` #`H p@X 7 $Xʹ02" ``#@"``> ࠠ `, #`#`"ࠒ > > *`   Hp H $H\` $\H p@㿘> ?bT2  @ 6 > !*` H /f`* '` `0  > H 0 `0 H 0  H 0 㿘  ̀ + ̀    `"  €   ؀`@?# @4 [ ؀   ܀   K m bridge%d㿘. * "* "*  ;t %> i D$!> $!@8! :>!>> a!%>%#> d "/ !$!$!4 4 4 4!4 ! b1$!P ` , 8>!%ܐ , :$ <$ $$ $ $  ( A  Ҡ!Xx>   @H / * &  T@"]`3 !@"`4? E@"`@@ : S@4P@ 2 *`@"` <@E=@ $ G@zH@N  0S@P@ !N@ "`!M@  A@iF@" 0 B@Ð 0!C@ >@ D@(O@ܰ 怦 `Da2 ߦ "ٰ `, Ӱ " `8ϰ  7 `4 ,ؒ @7O`4) `4`47`! ג   @7:`4! 4`47` Ò      2   :Z    `8    @7Ò    7$ x, `$ $ t$ d d$ h$ l l$ pP`$P" $PP$ k$`,`D#a2 kP & t @A  2 t " ,v t` "` "@@  t@ ;  2 t ; 8 @g4L "/ `,2+ P "'  t2 "   x& \.$ `.% t `1.&Cϒa2 ( "  `,2 P "  t2 "   `8 2 $ xCa2  " `,2 P "߰  t2 "ذ %, `@ fа`Ca2 А @İ`C|a2 ĐՐ " `, 2 !"@    `C_a2 @ʒ"&`CQa2 @$ CFa2  $` >!X `Zx u& "`4@`4 m @Ɛi `C a2 hy "\ `, G2V P "R  t2 "K  ? 8E ! ` ?`@  ?! 4@ v /Ba2 0A "$ `,  P  t2  @ } @Ba2  @'H 0㿘 ,P  t2`"  "` "@ @@@ I: & , 2 tp!P     ``2!P/ ,`'*,* В  @5? t`@5:  x' \ (/ `/ t` 1@/ ,``(?&`  'ޒ ,* &`h`  `  `, 2 aP``t 2@`2`d `l `   ` `2  ?,* "* ` -w` @4֐`tؒ`@4є  /  ./ / / / / / / / / / / /`$ @*/ L,` .?&`  ʦ`l ?,* "* ` -6` @4`tؒ`@4  /  ./ / / / / / / / / / / /`$ @/  ,` .?&`  ʦ,* "* &` 㿘 4 @%!T 2 4 7  &!T !T*"@a&! 4! @ 6 4>!X!   ^㿘 4 @ ^ѐ!  @ 4 6 4㿈` ܒ  ` ,H /f4`4* '`4 @ @   :   @ ſH 00`  @" aPŰH 00܀qt 4 @"h 2  @&   & `T`W$`T  沔 B  2 3`T           @&$ h  7 2" &  &  &  `" `P  & "`P`T $`T"`` @$`P$`` `& ` h & h 4$2 @ . .. catchmodZchgrpZ cp dd df edexpr$ZhostnameB ln lsmkdirZ mt mv pax tarcpio$Z rm ksh shstty$ZsleepZsync$Z . ..chownZdmesgZfsck_ffsBfsck$Zreboothalt$ZifconfigBinit$ZmknodZmountZ mount_cd9660+` mount_ffsB mount_nfsBnewfsZ mount_mfsBping$ZrouteZshutdownBslattachBumount disklabelBpdhclientB . ..miscbtkeymaps . ..termcap @ ;Jx   @@;Jx i@@`@@<@`bT U;JXX (A;Jx6=;J~X;;J~X;oeg?A;Jy;Ju*;Ju* -'YGA;Jy ;Jy ;Jy  A;Jy ;J/q;J/q D)2Rk;J/q;J9;J9@HP*dE ;J4s;J8ـ;J8ـHPb$;J1-;JÀ;JÀ/tmp/disktab.shadowj)?;J]J;J]J;J]J/tmp/fstab.shadow8\;Jр;Jр;Jр/tmp/resolv.conf.shadowQ ;J X;J X;J X/tmp/hostsC|F fC@29%I ^g2'@F f uTkDKo^RZ8%I oK|ȩ '~he_rVFj D~y;x#1'NEQPf|p/B01N1COjq06^ĝ%O}mmu`z#1PeGS~T+Kv"8mz+x3W's"/pD>E~sk.Tim9K'">rE?Ƴ^wjrԀJGö\1~0Gt$YaB"WG2HvpG@ΫC8C j~NGsce6߅czE6*/Xto(9XRNqC?8hTokUvUuwx8;GZAJ]NS*?>ck&U .4%~iic5+V $QrrWU P4dWdumb|80-column dumb tty:\ :am:\ :co#80:\ :bl=^G:cr=^M:do=^J:sf=^J: unknown|unknown terminal type:\ :gn:tc=dumb: pcvtXX|pcvt vt200 emulator (DEC VT220):\ :am:km:mi:ms:xn:\ :it#8:vt#3:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:SF=\E[%dS:\ :SR=\E[%dT:UP=\E[%dA:\ :ac=++,,--..00``aaffgghhiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :ct=\E[3g:dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:ho=\E[H:\ :i1=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:im=\E[4h:k1=\EOP:\ :k2=\EOQ:k3=\EOR:k4=\EOS:k5=\E[17~:k6=\E[18~:k7=\E[19~:\ :k8=\E[20~:k9=\E[21~:k;=\E[29~:kD=\E[3~:kH=\E[4~:kI=\E[2~:\ :kN=\E[6~:kP=\E[5~:kb=\177:kd=\EOB:ke=\E[?1l\E>:kh=\E[1~:\ :kl=\EOD:kr=\EOC:ks=\E[?1h\E=:ku=\EOA:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nw=\EE:\ :r1=\Ec\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:rc=\E8:\ :rf=/usr/share/tabset/vt100:sc=\E7:se=\E[27m:sf=\ED:\ :so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[24m:up=\E[A:us=\E[4m:\ :ve=\E[?25h:vi=\E[?25l: pcvt25|dec vt220 emulation with 25 lines:\ :co#80:li#25:\ :is=\E[1;25r\E[25;1H:tc=pcvtXX:tc=ecma+color: pcvt28|dec vt220 emulation with 28 lines:\ :co#80:li#28:\ :is=\E[1;28r\E[28;1H:tc=pcvtXX: pcvt35|dec vt220 emulation with 35 lines:\ :co#80:li#35:\ :is=\E[1;35r\E[35;1H:tc=pcvtXX: pcvt40|dec vt220 emulation with 40 lines:\ :co#80:li#40:\ :is=\E[1;40r\E[40;1H:tc=pcvtXX: pcvt43|dec vt220 emulation with 43 lines:\ :co#80:li#43:\ :is=\E[1;43r\E[43;1H:tc=pcvtXX: pcvt50|dec vt220 emulation with 50 lines:\ :co#80:li#50:\ :is=\E[1;50r\E[50;1H:tc=pcvtXX: pcvt25w|dec vt220 emulation with 25 lines and 132 cols:\ :co#132:li#25:\ :is=\E[1;25r\E[25;1H:tc=pcvtXX: pcvt28w|dec vt220 emulation with 28 lines and 132 cols:\ :co#132:li#28:\ :is=\E[1;28r\E[28;1H:tc=pcvtXX: pcvt35w|dec vt220 emulation with 35 lines and 132 cols:\ :co#132:li#35:\ :is=\E[1;35r\E[35;1H:tc=pcvtXX: pcvt40w|dec vt220 emulation with 40 lines and 132 cols:\ :co#132:li#40:\ :is=\E[1;40r\E[40;1H:tc=pcvtXX: pcvt43w|dec vt220 emulation with 43 lines and 132 cols:\ :co#132:li#43:\ :is=\E[1;43r\E[43;1H:tc=pcvtXX: pcvt50w|dec vt220 emulation with 50 lines and 132 cols:\ :co#132:li#50:\ :is=\E[1;50r\E[50;1H:tc=pcvtXX: pc3|BSD/OS on the PC Console:\ :tc=bsdos-pc-nobold: vt52|dec vt52:\ :bs:\ :co#80:it#8:li#24:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\EG:as=\EF:bl=^G:cd=\EJ:ce=\EK:cl=\EH\EJ:cm=\EY%+ %+ :\ :cr=^M:do=\EB:ho=\EH:kb=^H:kd=\EB:kl=\ED:kr=\EC:ku=\EA:\ :le=\ED:nd=\EC:nw=^M^J:sf=^J:sr=\EI:ta=^I:up=\EA: vt100|vt100-am|dec vt100 (w/advanced video):\ :am:bs:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :@8=\EOM:DO=\E[%dB:K1=\EOq:K2=\EOr:K3=\EOs:K4=\EOp:K5=\EOn:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:as=^N:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:do=^J:\ :eA=\E(B\E)0:ho=\E[H:k0=\EOy:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\EOt:k6=\EOu:k7=\EOv:k8=\EOl:k9=\EOw:k;=\EOx:\ :kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:le=^H:mb=\E[5m:md=\E[1m:me=\E[m\017:mr=\E[7m:\ :nd=\E[C:rc=\E8:rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :..sa=\E[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t\016%e\017%;:\ :sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: vt100nam|vt100-nam|vt100 no automargins:\ :am@:xn@:tc=vt100-am: vt100-vb|dec vt100 (w/advanced video) & no beep:\ :bl@:vb=\E[?5h\E[?5l:tc=vt100: vt100-w|vt100-w-am|dec vt100 132 cols (w/advanced video):\ :co#132:li#24:\ :rs=\E>\E[?3h\E[?4l\E[?5l\E[?8h:tc=vt100-am: vt100-w-nam|vt100-nam-w|dec vt100 132 cols (w/advanced video no automargin):\ :co#132:li#14:vt@:\ :rs=\E>\E[?3h\E[?4l\E[?5l\E[?8h:tc=vt100-nam: vt100-nav|vt100 without advanced video option:\ :sg#1:\ :mb@:md@:me@:mr@:sa@:se=\E[m:so=\E[7m:ue@:us@:tc=vt100: vt100-nav-w|vt100-w-nav|dec vt100 132 cols 14 lines (no advanced video option):\ :co#132:li#14:tc=vt100-nav: vt100-s|vt100-s-top|vt100-top-s|vt100 for use with top sysline:\ :es:hs:\ :li#23:\ :cl=\E[2;1H\E[J:cm=\E[%i%+^A;%dH:cs=\E[%i%i%d;%dr:\ :ds=\E7\E[1;24r\E8:fs=\E8:ho=\E[2;1H:is=\E7\E[2;24r\E8:\ :ts=\E7\E[1;%p1%dH\E[1K:tc=vt100-am: vt100-s-bot|vt100-bot-s|vt100 for use with bottom sysline:\ :es:hs:\ :li#23:\ :ds=\E7\E[1;24r\E8:fs=\E8:is=\E[1;23r\E[23;1H:\ :ts=\E7\E[24;%p1%dH\E[1K:tc=vt100-am: vt102|dec vt102:\ :mi:\ :al=\E[L:dc=\E[P:dl=\E[M:ei=\E[4l:im=\E[4h:tc=vt100: vt102-w|dec vt102 in wide mode:\ :co#132:\ :r3=\E[?3h:tc=vt102: vt102-nsgr|vt102 no sgr (use if you see snowflakes after highlight changes):\ :me=\E[m:sa@:tc=vt102: vt125|vt125 graphics terminal:\ :cl=\E[H\E[2J\EPpS(E)\E\\:tc=vt100: vt131|dec vt131:\ :am:bs:xn:\ :co#80:it#8:li#24:vt#3:\ :RA=\E[?7h:SA=\E[?7h:bl=^G:cd=50\E[J:ce=3\E[K:\ :cl=50\E[;H\E[2J:cm=5\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :do=^J:ho=\E[H:is=\E[1;24r\E[24;1H:k1=\EOP:k2=\EOQ:\ :k3=\EOR:k4=\EOS:kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:\ :kr=\EOC:ks=\E[?1h\E=:ku=\EOA:le=^H:mb=2\E[5m:md=2\E[1m:\ :me=2\E[m:mr=2\E[7m:nd=2\E[C:nw=^M^J:\ :r1=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:rc=\E8:sc=\E7:\ :se=2\E[m:so=2\E[7m:sr=5\EM:ta=^I:ue=2\E[m:up=2\E[A:\ :us=2\E[4m: vt132|DEC vt132:\ :xn:\ :al=\E[L:dc=\E[P:dl=\E[M:ei=\E[4h:im=\E[4l:ip=:sf=\n:\ :tc=vt100: vt220|vt200|DEC VT220 in vt100 emulation mode:\ :am:bs:mi:pt:xn:xo:\ :co#80:li#24:vt#3:\ :@7=\E[4~:RA=\E[?7l:SA=\E[?7h:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:ho=\E[H:\ :if=/usr/share/tabset/vt100:im=\E[4h:\ :is=\E[1;24r\E[24;1H:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:\ :k5=\E[17~:k6=\E[18~:k7=\E[19~:k8=\E[20~:k9=\E[21~:\ :k;=\E[29~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=\177:\ :kd=\E[B:kh=\E[1~:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nl=^J:rc=\E8:\ :rf=/usr/share/tabset/vt100:\ :rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :..sa=\E[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t\E(0%e\E(B%;:\ :sc=\E7:se=\E[27m:sf=20\ED:so=\E[7m:sr=14\EM:ta=^I:\ :ue=\E[24m:up=\E[A:us=\E[4m:ve=\E[?25h:vi=\E[?25l: vt220-new|vt200-new|dec vt220:\ :5i:am:bs:mi:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :%0=\E[29~:%1=\E[28~:*6=\E[4~:@0=\E[1~:AL=\E[%dL:\ :DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:F1=\E[23~:F2=\E[24~:\ :F3=\E[25~:F4=\E[26~:F7=\E[31~:F8=\E[32~:F9=\E[33~:\ :FA=\E[34~:IC=\E[%d@:LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:\ :SA=\E[?7h:UP=\E[%dA:ae=\E(B:al=\E[L:as=\E(0:bl=^G:\ :cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:\ :cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:\ :eA=\E)0:ec=\E[%dX:ei=\E[4l:ho=\E[H:\ :if=/usr/share/tabset/vt100:im=\E[4h:\ :is=\E[?7h\E[>\E[?1h\E F\E[?4l:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k6=\E[17~:k7=\E[18~:k8=\E[19~:k9=\E[20~:\ :k;=\E[21~:kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=\177:kd=\E[B:\ :kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:l1=pf1:l2=pf2:l3=pf3:\ :l4=pf4:le=^H:mb=\E[5m:md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:\ :nw=\EE:pf=\E[4i:po=\E[5i:ps=\E[i:r1=\E[?3l:rc=\E8:sc=\E7:\ :se=\E[27m:sf=\ED:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[24m:\ :up=\E[A:us=\E[4m:vb=\E[?5h\E[?5l: vt220-w|vt200-w|DEC vt220 in wide mode:\ :co#132:\ :r3=\E[?3h:tc=vt220: vt220-8bit|vt220-8|vt200-8bit|vt200-8|dec vt220/200 in 8-bit mode:\ :am:bs:mi:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :AL=\233%dL:DC=\233%dP:DL=\233%dM:DO=\233%dB:IC=\233%d@:\ :LE=\233%dD:RI=\233%dC:UP=\233%dA:ae=^O:al=\233L:as=^N:\ :bl=^G:cd=\233J:ce=\233K:cl=\233H\233J:cm=\233%i%d;%dH:\ :cr=^M:cs=\233%i%d;%dr:ct=\2333g:dc=\233P:dl=\233M:do=^J:\ :ec=\233%dX:ei=\2334l:ho=\233H:\ :if=/usr/share/tabset/vt100:im=\2334h:\ :is=\233?7h\233>\233?1h\E F\233?4l:k1=\EOP:k2=\EOQ:\ :k3=\EOR:k4=\EOS:k6=\23317~:k7=\23318~:k8=\23319~:\ :k9=\23320~:kI=\2332~:kN=\2336~:kP=\2335~:kb=\177:\ :kd=\233B:kh=\233H:kl=\233D:kr=\233C:ku=\233A:le=^H:\ :mb=\2335m:md=\2331m:me=\233m:mr=\2337m:nd=\233C:nw=\EE:\ :rc=\E8:sc=\E7:se=\23327m:sf=\ED:so=\2337m:sr=\EM:st=\EH:\ :ta=^I:ue=\23324m:up=\233A:us=\2334m:vb=\233?5h\233?5l: vt220d|DEC VT220 in vt100 mode with DEC function key labeling:\ :F1=\E[23~:F2=\E[24~:F3=\E[25~:F4=\E[26~:F5=\E[28~:\ :F6=\E[29~:F7=\E[31~:F8=\E[32~:F9=\E[33~:FA=\E[34~:k5@:\ :k6=\E[17~:k7=\E[18~:k8=\E[19~:k9=\E[20~:k;=\E[21~:\ :tc=vt220: vt220-nam|v200-nam|VT220 in vt100 mode with no auto margins:\ :am@:\ :rs=\E>\E[?3l\E[?4l\E[?5l\E[?7l\E[?8h:tc=vt220: vt200-js|vt220-js|dec vt200 series with jump scroll:\ :am:\ :co#80:\ :al=\E[L:bl=^G:cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:\ :cr=^M:cs=\E[%i%d;%dr:dc=\E[P:dl=\E[M:dm=:do=^J:ed=:\ :ei=\E[4l:ho=\E[H:im=\E[4h:\ :is=\E[61"p\E[H\E[?3l\E[?4l\E[?1l\E[?5l\E[?6l\E[?7h\E[?8h\E[?25h\E>\E[m:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:kb=\177:kd=\EOB:\ :ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:ku=\EOA:le=^H:\ :nw=^M\ED:r1=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:rc=\E8:\ :rf=/usr/share/tabset/vt100:sc=\E7:se=5\E[27m:sf=\ED:\ :so=5\E[7m:sr=\EM:ta=^I:ue=\E[24m:up=\E[A:us=\E[4m: vt320nam|v320n|DEC VT320 in vt100 emul. mode with NO AUTO WRAP mode:\ :am@:\ :rs=\E>\E[?3l\E[?4l\E[?5l\E[?7l\E[?8h:tc=vt220: vt320|vt300|dec vt320 7 bit terminal:\ :am:es:hs:mi:ms:xn:\ :co#80:li#24:ws#80:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :K1=\EOw:K2=\EOu:K3=\EOy:K4=\EOq:K5=\EOs:LE=\E[%dD:\ :RI=\E[%dC:UP=\E[%dA:ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:\ :ce=\E[K:cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:\ :cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:ec=\E[%dX:\ :ei=\E[4l:fs=\E[0$}:ho=\E[H:im=\E[4h:\ :is=\E>\E[?3l\E[?4l\E[5?l\E[?7h\E[?8h\E[1;24r\E[24;1H:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:k6=\E[17~:k7=\E[18~:\ :k8=\E[19~:k9=\E[20~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:\ :kb=\177:kd=\EOB:ke=\E[?1l\E>:kh=\E[1~:kl=\EOD:kr=\EOC:\ :ks=\E[?1h\E=:ku=\EOA:le=^H:mb=\E[5m:md=\E[1m:me=\E[m:\ :mr=\E[7m:nd=\E[C:nw=\EE:rc=\E8:\ :rs=\E>\E[?3l\E[?4l\E[5?l\E[?7h\E[?8h\E[1;24r\E[24;1H:\ :sc=\E7:se=\E[m:sf=\ED:so=\E[7m:sr=\EM:st=\EH:ta=^I:\ :ts=\E[1$}\E[H\E[K:ue=\E[m:up=\E[A:us=\E[4m:ve=\E[?25h:\ :vi=\E[?25l: vt320-nam|vt300-nam|dec vt320 7 bit terminal with no am to make SAS happy:\ :am@:\ :is=\E>\E[?3l\E[?4l\E[5?l\E[?7l\E[?8h\E[1;24r\E[24;1H:\ :rs=\E>\E[?3l\E[?4l\E[5?l\E[?7l\E[?8h\E[1;24r\E[24;1H:\ :tc=vt320: vt320-w|vt300-w|dec vt320 wide 7 bit terminal:\ :co#132:ws#132:\ :is=\E>\E[?3h\E[?4l\E[5?l\E[?7h\E[?8h\E[1;24r\E[24;1H:\ :rs=\E>\E[?3h\E[?4l\E[5?l\E[?7h\E[?8h\E[1;24r\E[24;1H:\ :tc=vt320: vt320-w-nam|vt300-w-nam|dec vt320 wide 7 bit terminal with no am:\ :am@:\ :is=\E>\E[?3h\E[?4l\E[5?l\E[?7l\E[?8h\E[1;24r\E[24;1H:\ :rs=\E>\E[?3h\E[?4l\E[5?l\E[?7l\E[?8h\E[1;24r\E[24;1H:\ :tc=vt320-w: vt340|dec-vt340|vt330|dec-vt330|dec vt340 graphics terminal with 24 line page:\ :am:es:hs:mi:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:al=\E[L:as=^N:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:\ :dl=\E[M:do=^J:ds=\E[2$~\r\E[1$}\E[K\E[$}:ei=\E[4l:\ :fs=\E[$}:ho=\E[H:im=\E[4h:\ :is=\E<\E F\E>\E[?1h\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h\E[1;24r\E[24;1H:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:k6=\E[17~:k7=\E[18~:\ :k8=\E[19~:k9=\E[20~:kb=\177:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:\ :kr=\EOC:ks=\E[?1h\E=:ku=\EOA:l1=pf1:l2=pf2:l3=pf3:l4=pf4:\ :le=^H:mb=\E[5m:md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nw=^M\ED:\ :r1=\E[?3l:rc=\E8:rf=/usr/share/tabset/vt300:sc=\E7:\ :se=\E[27m:sf=\ED:so=\E[7m:sr=\EM:st=\EH:ta=^I:\ :ts=\E[2$~\E[1$}\E[1;%dH:ue=\E[24m:up=\E[A:us=\E[4m:\ :vb=200\E[?5h\E[?5l:ve=\E[?25h:vi=\E[?25l:vs=\E[?25h: vt400|vt400-24|dec-vt400|dec vt400 24x80 column autowrap:\ :am:es:hs:mi:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:ae=^O:\ :al=\E[L:as=^N:cd=10\E[J:ce=4\E[K:cl=10\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:\ :dl=\E[M:do=^J:ds=\E[2$~\r\E[1$}\E[K\E[$}:ei=\E[4l:\ :fs=\E[$}:ho=\E[H:ic=\E[@:im=\E[4h:\ :is=\E<\E F\E>\E[?1h\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h\E[1;24r\E[24;1H:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:k6=\E[17~:k7=\E[18~:\ :k8=\E[19~:k9=\E[20~:kb=\177:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:\ :kr=\EOC:ks=\E[?1h\E=:ku=\EOA:l1=pf1:l2=pf2:l3=pf3:l4=pf4:\ :le=^H:mb=\E[5m:md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nw=^M\ED:\ :r1=\E<\E[?3l\E[!p\E[?7h:rc=\E8:\ :rf=/usr/share/tabset/vt300:sc=\E7:se=\E[27m:sf=\ED:\ :so=\E[7m:sr=\EM:st=\EH:ta=^I:ts=\E[2$~\E[1$}\E[1;%dH:\ :ue=\E[24m:up=\E[A:us=\E[4m:vb=200\E[?5h\E[?5l:\ :ve=\E[?25h:vi=\E[?25l:vs=\E[?25h: vt420|DEC VT420:\ :am:mi:xn:xo:\ :co#80:li#24:vt#3:\ :*6=\E[4~:@0=\E[1~:RA=\E[?7l:\ :S5=\E[?0;0r\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :SA=\E[?7h:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:ho=\E[H:\ :i2=\E[?67h\E[64;1"p:if=/usr/share/tabset/vt300:\ :im=\E[4h:is=\E[1;24r\E[24;1H:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\E[17~:k6=\E[18~:k7=\E[19~:k8=\E[20~:\ :k9=\E[21~:k;=\E[29~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:\ :kb=\177:kd=\E[B:ke=\E>:kl=\E[D:kr=\E[C:ks=\E=:ku=\E[A:\ :le=^H:mb=\E[5m:md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:\ :r3=\E[?67h\E[64;1"p:rc=\E8:rf=/usr/share/tabset/vt300:\ :..sa=\E[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t\E(0%e\E(B%;:\ :sc=\E7:se=\E[m:sf=\ED:so=\E[7m:sr=\EM:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: vt420pc|DEC VT420 w/PC keyboard:\ :@7=\E[4~:F1=\E[23~:F2=\E[24~:F3=\E[11;2~:F4=\E[12;2~:\ :F5=\E[13;2~:F6=\E[14;2~:F7=\E[15;2~:F8=\E[17;2~:\ :F9=\E[18;2~:FA=\E[19;2~:FB=\E[20;2~:FC=\E[21;2~:\ :FD=\E[23;2~:FE=\E[24;2~:FF=\E[23~:FG=\E[24~:FH=\E[25~:\ :FI=\E[26~:FJ=\E[28~:FK=\E[29~:FL=\E[31~:FM=\E[32~:\ :FN=\E[33~:FO=\E[34~:FP=\E[35~:FQ=\E[36~:FR=\E[23;2~:\ :FS=\E[24;2~:FT=\E[25;2~:FU=\E[26;2~:FV=\E[28;2~:\ :FW=\E[29;2~:FX=\E[31;2~:FY=\E[32;2~:FZ=\E[33;2~:\ :Fa=\E[34;2~:Fb=\E[35;2~:Fc=\E[36;2~:\ :S6=USR_TERM\:vt420pcdos\::k1=\E[11~:k2=\E[12~:\ :k3=\E[13~:k4=\E[14~:k5=\E[15~:k6=\E[17~:k7=\E[18~:\ :k8=\E[19~:k9=\E[20~:k;=\E[21~:kD=\177:kh=\E[H:\ :..px=\EP1;1|%?%{16}%p1%>%t%{0}%e%{21}%p1%>%t%{1}%e%{25}%p1%>%t%{2}%e%{27}%p1%>%t%{3}%e%{30}%p1%>%t%{4}%e%{5}%;%p1%+%d/%p2%s\E\\:\ :tc=vt420: vt420pcdos|DEC VT420 w/PC for DOS Merge:\ :li#25:\ :S1=%?%p1%{19}%=%t\E\023\021%e%p1%{32}%<%t\E%p1%c%e%p1%{127}%=%t\E\177%e%p1%c%;:\ :S4=\E[?1;2r\E[34h:\ :S5=\E[?0;0r\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:S6@:\ :me=\E[m:sa@:tc=vt420pc: vt420f|DEC VT420 with VT kbd; VT400 mode; F1-F5 used as Fkeys:\ :F1=\E[23~:F2=\E[24~:F3=\E[25~:F4=\E[26~:F5=\E[28~:\ :F6=\E[29~:F7=\E[31~:F8=\E[32~:F9=\E[33~:FA=\E[34~:\ :k1=\E[11~:k2=\E[12~:k3=\E[13~:k4=\E[14~:k5=\E[15~:\ :k6=\E[17~:k7=\E[18~:k8=\E[19~:k9=\E[20~:k;=\E[21~:\ :kD=\177:kh=\E[H:l1=\EOP:l2=\EOQ:l3=\EOR:l4=\EOS:tc=vt420: vt510|DEC VT510:\ :tc=vt420: vt510pc|DEC VT510 w/PC keyboard:\ :tc=vt420pc: vt510pcdos|DEC VT510 w/PC for DOS Merge:\ :tc=vt420pcdos: vt520|DEC VT520:\ :am:mi:xn:xo:\ :co#80:li#24:vt#3:\ :*6=\E[4~:@0=\E[1~:RA=\E[?7l:\ :S5=\E[?0;0r\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :SA=\E[?7h:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:ho=\E[H:\ :i2=\E[?67h\E[64;1"p:if=/usr/share/tabset/vt300:\ :im=\E[4h:is=\E[1;24r\E[24;1H:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\E[17~:k6=\E[18~:k7=\E[19~:k8=\E[20~:\ :k9=\E[21~:k;=\E[29~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:\ :kb=\177:kd=\E[B:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:\ :..px=\EP1;1|%?%{16}%p1%>%t%{0}%e%{21}%p1%>%t%{1}%e%{25}%p1%>%t%{2}%e%{27}%p1%>%t%{3}%e%{30}%p1%>%t%{4}%e%{5}%;%p1%+%d/%p2%s\E\\:\ :r3=\E[?67h\E[64;1"p:rc=\E8:rf=/usr/share/tabset/vt300:\ :..sa=\E[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t\E(0%e\E(B%;:\ :sc=\E7:se=\E[m:sf=\ED:so=\E[7m:sr=\EM:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: vt525|DEC VT525:\ :am:mi:xn:xo:\ :co#80:li#24:vt#3:\ :*6=\E[4~:@0=\E[1~:RA=\E[?7l:\ :S5=\E[?0;0r\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :SA=\E[?7h:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:ho=\E[H:\ :i2=\E[?67h\E[64;1"p:if=/usr/share/tabset/vt300:\ :im=\E[4h:is=\E[1;24r\E[24;1H:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\E[17~:k6=\E[18~:k7=\E[19~:k8=\E[20~:\ :k9=\E[21~:k;=\E[29~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:\ :kb=\177:kd=\E[B:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:\ :..px=\EP1;1|%?%{16}%p1%>%t%{0}%e%{21}%p1%>%t%{1}%e%{25}%p1%>%t%{2}%e%{27}%p1%>%t%{3}%e%{30}%p1%>%t%{4}%e%{5}%;%p1%+%d/%p2%s\E\\:\ :r3=\E[?67h\E[64;1"p:rc=\E8:rf=/usr/share/tabset/vt300:\ :..sa=\E[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t\E(0%e\E(B%;:\ :sc=\E7:se=\E[m:sf=\ED:so=\E[7m:sr=\EM:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: sun-il|Sun Microsystems console with working insert-line:\ :am:km:ms:\ :co#80:li#34:\ :%7=\E[194z:&5=\E[193z:&8=\E[195z:@7=\E[220z:AL=\E[%dL:\ :DC=\E[%dP:DL=\E[%dM:F1=\E[234z:F2=\E[235z:IC=\E[%d@:\ :K2=\E[218z:al=\E[L:bl=^G:cd=\E[J:ce=\E[K:cl=^L:\ :cm=\E[%i%d;%dH:cr=^M:dc=\E[P:dl=\E[M:do=^J:ei=:ic=\E[@:im=:\ :k1=\E[224z:k2=\E[225z:k3=\E[226z:k4=\E[227z:k5=\E[228z:\ :k6=\E[229z:k7=\E[230z:k8=\E[231z:k9=\E[232z:k;=\E[233z:\ :kD=\177:kN=\E[222z:kP=\E[216z:kb=^H:kd=\E[B:kh=\E[214z:\ :kl=\E[D:kr=\E[C:ku=\E[A:le=^H:md@:me=\E[m:mr=\E[7m:nd=\E[C:\ :rs=\E[s:\ :..sa=\E[0%?%p6%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;m:\ :se=\E[m:sf=^J:so=\E[7m:ta=^I:u8=\E[1t:u9=\E[11t:ue@:\ :up=\E[A:us@: sun-cgsix|sun-ss5|Sun SparcStation 5 console:\ :AL@:al@:tc=sun-il: sun|sun1|sun2|Sun Microsystems Inc. workstation console:\ :tc=sun-il: sun-s|Sun Microsystems Workstation window with status line:\ :hs:\ :ds=\E]l\E\\:fs=\E\\:ts=\E]l:tc=sun: sun-e-s|sun-s-e|Sun Microsystems Workstation with status hacked for emacs:\ :hs:\ :ds=\E]l\E\\:fs=\E\\:ts=\E]l:tc=sun-e: sun-48|Sun 48-line window:\ :co#80:li#48:tc=sun: sun-34|Sun 34-line window:\ :co#80:li#34:tc=sun: sun-24|Sun 24-line window:\ :co#80:li#24:tc=sun: sun-17|Sun 17-line window:\ :co#80:li#17:tc=sun: sun-12|Sun 12-line window:\ :co#80:li#12:tc=sun: sun-1|Sun 1-line window for sysline:\ :es:hs:\ :co#80:li#1:\ :ds=^L:fs=\E[K:ts=^M:tc=sun: sun-e|sun-nic|sune|Sun Microsystems Workstation without insert character:\ :ei@:ic@:im@:tc=sun: sun-c|sun-cmd|Sun Microsystems Workstation console with scrollable history:\ :li#35:\ :te=\E[>4h:ti=\E[>4l:tc=sun: vt320-k3|MS-Kermit 3.00's vt320 emulation:\ :am:es:hs:km:mi:ms:xn:\ :co#80:it#8:li#49:pb#9600:vt#3:\ :AL=\E[%dL:CC=\E:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RI=\E[%dC:SR=\E[%dL:UP=\E[%dA:ae=\E(B:al=\E[L:\ :as=\E(0:bl=^G:cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:\ :cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:\ :ds=\E[0$~:ec=\E[%dX:ei=\E[4l:fs=\E[0$}:ho=\E[H:im=\E[4h:\ :is=\E>\E F\E[?1l\E[?7h\E[r\E[2$~:k0=\E[21~:k1=\EOP:\ :k2=\EOQ:k3=\EOR:k4=\EOS:k6=\E[17~:k7=\E[18~:k8=\E[19~:\ :k9=\E[20~:kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=^H:kd=\EOB:\ :ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:ku=\EOA:le=^H:\ :mb=\E[5m:md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nw=^M^J:rc=\E8:\ :sc=\E7:se=\E[27m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:\ :ts=\E[1$}\r\E[K:ue=\E[24m:up=\E[A:us=\E[4m:\ :vb=\E[?5h\E[?5l\E[?5h\E[?5l\E[?5h\E[?5l:ve=\E[?25h:\ :vi=\E[?25l: vt320-k311|dec vt320 series as defined by kermit 3.11:\ :am:es:hs:mi:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:al=3\E[L:as=^N:bl=^G:cd=\E[J:ce=\E[K:cl=\E[;H\E[2J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:\ :dl=\E[M:do=^J:ds=\E[2$~\r\E[1$}\E[K\E[$}:ei=\E[4l:\ :fs=\E[$}:ho=\E[H:im=\E[4h:\ :is=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h\E[1;24r\E[24;1H:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:k6=\E[17~:k7=\E[18~:\ :k8=\E[19~:k9=\E[20~:kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:\ :kr=\EOC:ks=\E[?1h\E=:ku=\EOA:l1=pf1:l2=pf2:l3=pf3:l4=pf4:\ :le=^H:mb=\E[5m:md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nw=^M\ED:\ :r1=\E[?3l:rc=\E8:rf=/usr/share/tabset/vt100:sc=\E7:\ :se=\E[27m:sf=\ED:so=\E[7m:sr=\EM:st=\EH:ta=^I:\ :ts=\E[2$~\E[1$}\E[1;%dH:ue=\E[24m:up=\E[A:us=\E[4m:\ :vb=\E[?5h\E[?5l:ve=\E[?25h:vi=\E[?25l:vs=\E[?25h: vt50|dec vt50:\ :bs:\ :co#80:li#12:\ :bl=^G:cd=\EJ:ce=\EK:cl=\EH\EJ:cr=^M:do=^J:le=^H:nd=\EC:\ :sf=^J:ta=^I:up=\EA: vt50h|dec vt50h:\ :bs:\ :co#80:li#12:\ :bl=^G:cd=\EJ:ce=\EK:cl=\EH\EJ:cm=\EY%+ %+ :cr=^M:do=^J:\ :le=^H:nd=\EC:sf=^J:sr=\EI:ta=^I:up=\EA: vt61|vt-61|vt61.5|dec vt61:\ :co#80:li#24:\ :bl=^G:cd=\EJ:ce=\EK:cl=\EH\EJ:cm=\EY%+ %+ :cr=\r:do=^J:\ :kd=\EB:kl=\ED:kr=\EC:ku=\EA:le=^H:nd=\EC:sf=\n:sr=\EI:ta=^I:\ :up=\EA: 2t3H 00_ 4 @2  &H 00R` `       @&&`  7 2" &  &  &  `"`P  & " `P`T $`TH p@0"```$``$`P `& ` h & h 4$ @H 0 㿘> ! 5%> i* * " * " * @@)H /f * '  ` ` $ $ "` ?$ H 0 `ё*x 4 @ ( `1 H & H \`!P@& \  t2  x " ` \   `  Ʀ  x  2 x?#@     " x @P  x "` \ ` #   @@2`0`"&  4 x      ^i" x b  ^  ^Z x @ Q d@ J @, ` # 2 d`2`4 d & dH /f * ' @9H 00 @!P  t2  x  l \   l@u é0f @ _` ```H /f4`* '`   ````@&&`{  7` 2" $``$` $` `" P` $`"  P T & TH p@0 ``& `& P``$```h $`h`4$`@H 0bridge_input(): no HDR㿘 ,    2 ?>!vĐ#6 ,4 @P  t2 ~  # >b@7  2  x@  "j  x "  \ b ` ^沔 ô  V ``' 8# `  $"    ܐ"   "    $ $    $     $   H /f * ' @& $ ŸH 00 2" &&`&H 0>  " 샒 > >  *`  v  8N  8 P Ҕ t 8`2   6  t& 2 t x "  \    "1  t `8 2(`ؐ@7*   x ` @F  t&  8`  6  t 0`@7    2 t ``' 8# `  $"    ܐ"   "    & &  ?  "S      & "J  H H /f * ' @& & ͐H 0,  2" &&`&H 0>  " 밒 > >   *`      w  㿈!P t`0`0 "x  \  "2`4 # "`4 @"~` ``@ ` $` T`m& T@ 2gl@$ "`  沔    : T  @ "G` `C` ````@&$ )  7` 2" $``$` $` `"  P` $`" P T & Tb ` @& P& ```$```h $`h`4$2`@2ht 㿘!T  2  2V  &!T !T,``c"@+&!@!T,`@ ' !!@w  27  q '  , $ , , !T,`@ $!T "`!T" !T@ S$ `@/۔   "`,` $``",` D` !!@<  1  6  , $ , , `$$ `"!$`2Ϣ!!@  1ޔ   Δ , $ , , @ $@" $@$ ! &! 㿘!T @!T* @ "  @/x    4    `' `ṕ* `+ ( `* @ `! 2 "(""2 "  2 "(""2"  2  "( ""2"  #㿘!T "1!T!!@(,!T@O!!@%!T ,`@"`  "$ "@!  3"&!!!@瀢c$!T!T` !   4  3  &!T㿘H o*@ a@  H 0㿘!T 9 !T*@$  2 `? * * "*  $ "! &!2ƒ ݖ$!T! >!X! P W㿘!T / !T*@`2 2 $ "! &!2 $!T!   4 !T2 &!T 㿘!T 1!T* @ "*  @4  2`"  "` "!&!2] ! 2  4 2  !T2R &!T ܐ 㿘!T , !T*@2 $ "! &!2+ $!T!   4 !T2 &!TpT 9 ` 6-`  T- @ "* Т` ''        /` ( @F/ -```(?&`( ݪ` #$T-`* &`㿐` (?  (":  h 5@/!"݀@+%8, ` '  ?c*   #2  2 (   5(!"݀   㿘"    `@3  2  ` 2  @3  2  2  㿘  /  `"  o `( k `!` ,  ,  ` , $ p" & p ` , $ h"& h 㿘 d " l d d@ & d& h 1/  d 2 d l  l l@ & l& p 1  l 2 l 㿐  (#'T%`     ?c* "T # ( T=  T8 T` T`    'TT<  T2 < T   i'T Ű  T@#* `6  @T T$ T 2"@ "  " T"`TT TT`  9 'TT` T`6 T@ A6 T``$T8  T`$"  ?ܐ"  TT?"  T`?"`T  " T V 'TT` T` T` "`T F  ]T``$T8  T`$"  ?ܐ"  T ?"  TT`?"`T  "   'TT` T` T` "`T    TT   㿘`  +.`^.`N ؐ>`0 &`@ `X>`8@ 6`L " 6`D`&!6`D 6`F 6`H `]6`J.`O!.`P `D  `0.`]@.`^` @6 XH o4'*@ g' t 4 @2  H 0 0《   @ H 0 0ӑH /f * ' > !gD H 0" 6H /f * ' > p 2H p@ $ &6&&&&  ]   4H 0 0& && /Ē B?//*` ` '@ ` '/ƀ/ł`@ 2`* 2`* 2`* 2 @2 ```````777/'7//////777//////( >"#  &7 ` &      @&&  7 2" '  '  '  `  '   4$ @H 0      ܄`? `8B 2` 8; `86 2` 8/ `** (`&   `  8 2  `8  2    " `Z`?㿘>``$&`>`6`Z@`2 `2 `2 ` *!㿘!P  x  @ "  \ T 2 x`    ``X`Z`? 㿐  tH /f * ' > !eؒ H 0 " 6 H /f * ' > p 2H p@  $ & 6 && & &    k  & & `ؒ &  >"  4  / B//?*'  /'/ ` H /f4`4* '`4 @/ ` `` ``@&& `  7` 2" $``$` $` `` $`  `4$`@ H 0 9㿘@@z㿘!P d  x \1 2X \ "T  @ @ 2L  @(G`"C` 8? `  @7 872  ` @80  @``@ *&8%`  8 ` @ 82 Z `@8 Z`Z@* 8  X`X@: 2 x`&  & > `> `` & 㿘!P = x 5 .  ؀@)  ܀@$  @*8      䀢@ 82 X  @8  X Z@8@ 2 x :` "` `X:`2`Z㿘!P ! x " 耤, ^ , ]i " , ^@ $@, ]@ 2 x㿘`\ @  `(@ 㿘`\ ``?  `_ "@ @ @`(* \㿘  .!!@Ԓ   !  -! @ɒ  .!㿘! @.!㿘 *`]U'D!P'P ' x `t 'x "tP `ڀ   "@sPÒ  'P /  B2P B2P 2P* @2P 2P `  P/D@PP & 'P  &Р ԅ,`' 'd?ә,d'?`?'|բ 'l'?h'T'\?4\d?X4`+,ܠ ޕ-`|-?xT?P \* X + x,`d4 @* |'t*`T3P 2`* 4@t+@| \   +. +ׄ ?  ذ  τΆ @ ??'77777 /4D//@ P  㿘}`\ : -”vi 2 耤 " @!! "  @!! @  耦@  0ɒ 㿘`\   㿘!@[ 㿘" _%    6  6 d6 @B! r!@9 㿘`\  Q `(@, 0I @  `_ @!P`" `x"@` 2 @` 䀠2@ `2`x 㿘^! @ *!*!㿘 `^ 㿘!P !  x " t 8 2 ` 1*  4 X  ؒ@&M  6 t 2 x2 @a0] ڑ(!+ ٕ+` ۠ ܆ -  ;  -`     ݖ     6 ! > 6 6 > & & .!@.!@!!L  >/a!8O!!L 2!P>!XOL!8!P ! x @G@K 2 x@@d 㿘!P "!L |@\ @Z $@X (  !L  Oi!8@K!@I! @G!㿘 \  .`_`$.`]@8.`^@6`(@4` 㿘㿘> `$.`]@.`^@`(#ܐ    6  6 (6 @! 6!@ 㿘Đ!P  x < 2<  2 x>  `  6  6 6 @Ԑ! !@˒ 㿘 26`Z6`X `@ `@ .`Z2  ~㿘&`} * _* _p`t4  '0 a6Ѐ 2 `\耊  " `\`\ X0  Z0`\ S㿘H /e * & !P! !  ! x  2 x @] "  @U " K @M "!PK!P "!P x "  @= $ ڒ 2 x!P " 4 x " @) (  @! " 2 x 4 @>!XMِ!8H 0 22 22 㿘 .` !* @ 6   㿘 =@  <@J aQ@":aP@+0AaR@5aS@'090!P@ "!8 !R?@-T@*0*@ "  !S@0!6  2 . 6!  * 6 *  6  *  6  vmmapbsyvm_map_lock: failed to get lock㿘  ` 8  2)  & (  2   &    $`&    2    vlanattach: MALLOC failedvlan%d㿘. " * % > g`"!>0h"!>  . @#Y$!x!x @'>0#>3>c<  %>0ᄒ" i>a$ $ $ $   $ v$  5, :, 8x`@ vlan_start: impossible (altq)㿈>  4bp`$6 4 ̀ )  2   "> 4 & & $ ?& "2 44 A Aऔ$ T`& T ̐ €  ଀ " ( 8 >0} (g# "|q| " $ 4  ֒  2 L & L >H /f * ' > !^˒ H 0`  4`H /f * '   5 H p@ `$ $`4`$@$`$`?$`   :H /f * ' > !^ H 0` 4`H /f * '   5 H p@ `$`$@$`4` N `2 ` L`Y& L( ̀ #V @4``$$`$`$` $` $ 4$``  ?`$` $@4`   !4 4 `4   $$ ` $`b"h $h଀ ฐࠀ@&$   7 2" $$ $ `"  Pऐ $" P T & T & P4d2 @ ̐ ;6 4㿀 > ax > g*" * @  耢2.` 2  2 &U 4  O     !777 ``' 8# `  $" 4   ܐ"   "    & &  ޔ       &   @  {Β? A A"& s? ( " Hp H`$ H{ 㾘`  Q  2 `` `L C"`L` @ /> ax > g*" * @` 耢2 򀠀2  4 A A"`1 ?&``6 ` `` &` &`&` (  ''' (oǒ H`$ H{p %s: initialized with non-standard mtu %d (parent %s) 㿘`8 @ +`耢 < $``| "`<`< $`<>3 $`< `f``4?  @4`4`8,`8`D$`D`|  $`|`0>ᘑ* `0 *`   **   `* `ؐ $ 㿘 8  ` 8 }} "   & $  2 >!% 0& <& *    * @ u* @ r  㿘 4!  xF       x9  ?$  %s㿀>   2@@ 1@ @@"  @"% 9@3 00a!@a:@Z 0{ 耢 "x `4 4`4 ` p@0l ؒ 0g`"e `| `<?@4Z `-$W U$`<`,ua2 N  GO  Iu&`4 ?<4`4 o@8 u 1  ,4 `4`@a4`40$@ɒ  耢 >3 8f; 7   F  耢  R` ` ` "``R`6`   R` `  "`  "``R`6`  @  @    ` "J2#  ` @ *J@@ `J@`  "  J   `?㿘   ` @Q  2  @>       2 `  @ `>   8@ @ @   @ ` @  㿘@V``  ` `  "``V` 6` ` `     JJ@   ` p` 20j: "  :  ,@8 `V`4 `Q K``"` 쀊 `@ :@ `" ` T4. `2+ 0 @8  "       "   2  "  2  I    2 @2`  ` 8:`( 0 " ? 2"( * 㿘@`     JJ@ *J 5&&"  *`:  ` ` @ ``V`8`     $ $ &` &   @ 2& & &  rn_addmask: mask impossibly already in tree㿐>  t @ " @> " , )> > a! [`!@U$!-> @ '> !L? "?!$@4 6$n , 6!"@@!$*@ !` !@# 2 T`Rt  0 &  I t@`0 0!Ж7` >6``b^ ! 0-   "  $L  :  `>"*`J:`@ 2 +  + @8`6   .  @ 2  :  @ ` *  Mask for route not entered 㿘> b|  "b|    >6ca  @  6 .  " & & & $Non-unique normal route, mask not entered 㿐  `    2` ` 8`=  ,:  @뀦``"T I  y   2 2$  , $ `2$`$` $ $? . & 6` $ `4  ` ` ,  @@8 T` 6 @`2*: ` "`T`&`@ 2 `I &``2`` *V: @ "$V &$&`P-`T:   0J  & E$ `T@@21,V: @&!4* "  ` >7`Xa Ӑ ː 2<`V@&$ڐ&rn_delete: inconsistent annotation rn_delete: couldn't find our annotation rn_delete: couldn't find us %s %p at %p rn_delete: Orphaned Mask㿘. 4  @@!Ŕ" 2 `ǒ        2  `"T O >8 $``h`y  >8`h`q 8  ? 2" `T V 8 4,  V 2 >  & 2> "@|""|2 >8 `>`   ` C 2 & 2& &   `  ```" >8`2``">8 "```   r & & & &  & & `2"`"`" ["`   `2"`"`&3 V  @ 2$"@ > "| & ? " " `2#"|>8>8`_ "  &`& `& ` & `& `& " " ``2"`"`  # ` , , #㿘V  6   `2  "   V ` V  6    @   2  "  㿘  t9    "3 @p t&> a`, `\ * " " @8*` 2`$`\`!> # `>7# ` >8# `>5# `>4!>9# #  ``($@$` $`$`$` $`( rn_init: radix functions require max_keylen be set rn_initrn_init 2㿘> !Ȁ !> (t@4$ t2( t`*`>9cx^ 0)   #>  $a>9^# t*@@  t> a>   "ሀ " *  **> "r >9^#㿘  > 7># "$   `4 4 > cc $c" "c$  㿘  <"``"  "` "@ 㿘  `>  㿀> #'T'X'P'H'L H  @@2@ `" `@28  "  @ 2.  @w 2$沔 =  8 w      2 8ߖ Z0   0M raw_usrreq㿘 `  k -    \ -J`U.`>;!| €  M (I "F 9DC "> 9O0 T8 1 8$ + 9 `€"  $ 1[   2   2   9I& >:]v#֐  @ \ x P  $ > h㿘> !Ȁ  "  $* €  2 㿘f> !㿘` `@  `4  @ &`` 2   X > ΐ!*` 'H / * &  `3 `€ .> +aЀ`"' 4!" 8̒     @ ' 8 $ 8  4"  ` 8 $ 8> a`  "` ` @ 4'Đ@ c H 0㿘`  `@  `4  @ &X > ΐ!*` 'H / * !  `F `€ "A  2= `5' 4!1    @ "' 8 /$ 8 " 4"( @ 4 ' ' 0' @ "  4 ' D' 4 @  0 8 $ 8  > a`  "` `   @ 4'Đ@ ֔ H 0rtfreertfree 2rtfree: %p not freed (neg refs) 㿘 2 8><\"?-& 8 4 )  > ><\"b? "b><"]v0@  @M D`" ` ?"`    ifafree㿘 2 ><[ܐ# ? 0& Xk{   3m @'  0 @2 @ 2  D@ j 2 A`=`` "`4  `4 ,  n'''''' @``4> !> 4aؐ "4  @ A  ``'@@ `> aА "aЀ" $@ 4''''ܒ@  -㿘` `  ܐ?  j jwj jɐ 2q "   8 4?` & 8 `  2 D  D " `   k  "`@> 4''?Ȓ@\㿘 ,   `" ( ` 2  (j " (` & , ( 2  (  " (j& ( ( 2& (    "  "   ,`" j& (`    $ $ d& ( (`" 3 , ` & ,rtrequest delete㿘H /` * ! `> a* @  /`$ 2&` "  "T`(0=0Ԕ`` 2 ` ̰   " `x>>ZV 8 $`x  8 ?$ 8$`x`4`D ? $`4 > b "b&`8  $`80"  2 4  D >&`$ 0&` H`&`  &`$ 2`(/ `(    u 7@S `$ $ 4$ `@s`  d 7`  `@ɒ `  `  2  x "    @   $ $ D $ @P$ PT$ TX$ X\$ \`$ `d$ dh$ hl$ lp$ pt$ t$ | T 2 P 2  x "  T$ T <$ T& 8 $ 8H 0㿘@ ?    ?    0 "  ?  @8  `(   ;  2 & 7 @ & x & 0!  x `8 ?"`8& x 4 "   & x P 2   T`T( & T 㿘@.@ @`.@ `     .@`@ *@ @W"rtinit: wrong ifa (%p) was (%p) X ' `0   -  2 7 5 " 8 D?@$ 8g 3e A L$ D@ 4 ' '''̒''```   @ 8 ` $ 8`27`24 "0 8 D?$$ 8>?Z#  D`   D` ?"` $ D $ @ `<$ T   &   @M/usr/src/sys/arch/sparc/compile/GENERIC/../../../../net/route.crt_init_done == 0㿘#>c " > j>@>@>@!aX$#Y""!> !>Ac(<>!X=" $c㿘>#`     @j && &  & > jЖЀ`&  "`"& "rt_timer_queue_destroy: rtq_count reached 0 㿘3 `"  "`   "@` "`&  `"@ "  €          ">@?& Y@#  2  ` "`  " rt_timer_remove_all: rtq_count reached 0 㿘 '#>A `"  "`   "@`"  "` "`  "@ ` ?"`Y`X?  2 rt_timer_add: rtq_count reached 0 㿘H /i * * > `H 0  ,>A 2%  `"  "`   "@`"  "` "`  "@ ` ?"`X8  2      7@x $ $ $ $  $   "`  & $ $ $  "@&  `  "`rt_timer_timer: rtq_count reached 0 㿘H /i * * > `H 0H /`4> j* !> j"Ѐ`@ 1``"  "`   "@` "`$`  "@ "  €      ʚ r ` ">A?$`X(#` " ` @ & ``2`H 0>!X;vmmapbsyvm_map_lock: failed to get lock㿘`    Y & @̒ `* (   > c ?"c > #" > #"> ` ?"` `?"`H /``* !`  >  `   V`>  ;   H 004  > c  "c > #`" > #`"> `  "` ># $ `"  @6 H 0route_outputP'L'P'T'X'H  '  `  `  ,  2` 7` 2`>BUŐ#`K('`@ '    ' 7 \ > 's + `4&@ 4 'L@ߔĤ`' ` 8[ Ȁ "  8S Ѐ " ה  "I 7 @ *B 7@` "< 7 '  `0a2 "- ?`'>D#*` € Ŕ 8 D&8Ȁ     P @[$`8?"`8"H> a* @2  / ̠ "  " 8 &8 c  π0 ʀ0 '0''H' 0"@`"'` 'D'`4 "'D '`06' @ @    " 7䡒 @ 4&P&$T&(X&,\&0`&4d&8h&<l&@p&Dt&H~& ː zȀ   m E "dG " `؀` Ȁ   "d -$ D؀ c 2  Ȁ  45 "  "  D "  D   D` Ր?"` $ D  ' $ @ $@s P D "   Ѐ 2$ H P * $ P $ $ P - "& @&"    @ >  `4  Ғ |0/ @v` m "@   24 Ā ` >2#2 >>>c0   4   t t \ \ \ t  `" `" @`" `" ` "  `" `"` " 㿘@  :  *" ?  @ *㿘 J  @*@  &@T`Y  3`8 " $@@` @4@@ 2@T`   " $@@$ ` "` @,&ݲ    && rt_msg1㿘   L  T L$ >ES5"  76 H /f * ' > !ؐJ & $+J & $H 0 $ (  & 6 & 0& (& ,& <& 8    "0  & & & @@`  ,`-@@ &@ ?   A``,`  ,4,0 㿘 &@    L  T L2 `,` @*@&@ ?    g``,`)%`$  &   "2  M  &&  & ,,4㿘>  `` @ "`"`@>#0 "`  22>> c0 `>  `@  4   D` 0 84 V 4 $ >#0$ >>  3 `>   ` `c  ->+>@ [ 4  `  `    @' `'`''ࠒ ;  0 2 `$"`"" ` >`% '0'' "`  024" "" >#0 22c0 bc```@    4`@V @  4 @  0' ' H''  D''4`'  ` "1` ,  4#  t#  P# $ T# ( X# , \# 0 `# 4 d# 8 h# < l# @ p# D t# H @`0# 3 # # # m` "`&`&``@  4> !Ѐ"d ``" 0@2X @ 'Ԕ n``C'` ?804 T4 D$  $ `3 2;+`@ `2(`'` '`' C```` `02 `"`$""` ` "`&```Ӏ '''2` x  f `a  @  '   ''''H /`4ؐ* !؀ %   0> Φ! %>G`` .`  `@2` (t `0LH 0 D 䀦@ '"  &  *` * " @ M &route㿘b@  ( .t-* "?  .L$,   6 &. . 㿘  (b @  @ /@/h@ /@`.`"* * ? @* "?  "* * $,   6 &. . 㿈@?`    ',@   B @ &` `@2``@2  ` *  @@ "/ @ &` `@@ ``@ @ ` *  @  @ 2&`& 2 ,2@&#$@" 3 @` @ ,``@``@ < @  ܐ` *`@` Ґ 2   ?* @ Ɛ "  * 2`?* 2  2`, , , ,  @ " * 2   2 , , , , ` @?#,2  4, ,,  , `  ?#x+ 2  3 , ,,  , ``!>J -` €`` ^@\`2`` "2 ` ` "2` `` "@ ?* 2  3 , ,,  , ` 2` `ϔ$ `@  `."@ `@.@ `@ ," @.@  4 "@& & , , ު     & `ޡ ` p.` `. &T & & & & & & & & & & ' &x & & '؝㿈  #\@  @` & є&@   a$㿘\p"3   ? # @/ 7 *" *  `*`* /h `( ` 2 * @`․@-6   ' '@$ ' `@   "  $? ' $ ? c 7 /  `*`" *  * /h ` *`*` 3     + `   `0  "@    # W#   @"@ P#   +     * @3  3   + ```2    *  @ 3   ` 3  ```2    *   @#    # `` `2    *   @#    # ` " `2    *  @ 6    ` 6   6 &@ " 6 6` @@`?# @3`@ @3` 8 6'@ $ ? ` ' 7 enc%d㿘!> h ؐ آ@ ( 1>K/>K->K+>K)> !HO !& 7 b$`<,`8$`,`:$`$`$`[$@ X6 @ ؠ ؀`؁㿘H /f * '    ` & ` & & "` ?& H 0 ` 0ہ㿘 `&"`T @" 48 @"  4 @ @2   4"@2 42 4 pflog%d㿘!> #@:   (!Ȥ 1>K/>L->L+>L)> #hN! `@ 8$`$`,`:$`$`,`8$@[i$`< W @ ؠ ؀`؁㿘H /f * '    ` & ` & & "` ?& H 0 ` 0ہ㿘 ` "`T @" 48 @"  4 @ @2   4"@2 42 4 gre%d㿘!>$#.   8 #>"#@*`# .  >L>Nb!|#>L aN    % /. 9. 8. :& <. &6 4& & & X& L& T& H& P& Z&  ( W c ܰ!㿈'D    D@ d  V      DDH 7 ͔ D ( " V 7Ԁ />#`2D- D` 9  D` ` * @,   D`@ * 7 '$  @    7 '$ 7@u7``$" :r` H /f * ' > !C H 0 " 6 H /f * ' > p  2 H p@  $ & 6 && & &    2`D 7> & `& ` & ` & `&` 6` b  *@ @ & & `@&  ` * &` ` `*`" &`   &&``@&` &`   *`  \4 e RD>#`2DY D` e  DD`(E /``8`$"@ܐ"   " `  &`&`   ``  `` &` `2 D 7` R"`D `"0I / ` @ - 2 * 2 . .  . `7"2 . 2 2 . . . @* 2`. 2`2`&. . . > .  . `* 2 2 . . DP`"PD ` ` @ `@(> D`T "`T㿈>   H / * '  f@e@@"T   @'@"%Ԧ 2@ϐ1@ ̀0a0g@" i@` 0h@j@"w   $  ` `$ X $ 䀦 耢``8 ?"`8$ @ 耢 2 4$ $ H 0  " 4 2 4 ?6 4    70v /,  4?+@,  4?&@"j / fd /`a2 ]`/, `7  4 ? 4 ?ؒ* L6 4?ؐ*@H6 4*@E6 4C6횐 $$ `{a2 8@$ @2 $  + 䀢 ' 耢``8 ސ?"`8$ @$ 耢 2  4$ $ H 0   6 4 'D 0 H 0㿘 @    $ , ,  4# `   $ 자 耢``@2  4`8 ?"`8 $) $ $ 2`  ` ? ( ? 228 * 2 vmmapbsyvm_map_lock: failed to get lock㿘H /` * ! >!X>N-> ",`!> ` \@ 8@ `2`H 0arp_rtrequest: bad gateway value arp_rtrequest: malloc failed 㿘>`0 `L>  `" "!> !>Ob-q>!X-`4 "` 0"+ 02 `4` &`4`4a>` `@> `8`0,`@ 04v&`\@" ` ``@ @l  >O 8`@c` `8,`@`0Y4  =  &`L>OcH 0L> g> !`#!"@ $``4$&`4> b,b, $@b," "b,$`` `D`H- &`\`@ ,`   >#̀`> j"&`@> b?"b@``"``@"&`L`4 ;&`4` "z˒ 㿈   5  `%  % @N% >!Ȕ (4  4`(  4 4 , , ׹ `׵ `ױ `׭   // arpresolve: can't allocate llinfo arpresolve: unresolved and rt_expire == 0 㿘!>!= "  ^// /   / / q/ `"`L @ 2  `2 `\>PcG Y `0>  ( 4  2  4   F 0B 4 2?  "$ $ `\ 2 `\>QHݐ > `&`\`\"* `4 ?&`4 `> ఀ" >&`\ Ȓ @  $ `D ؔ4`  >#`4`\` &`\&`4$  arpintr㿘>c V H /f * ' c c $c"`"`?"`H 0 >Q 2 >QG"h  Y  #c c   *   @  F c h@@o c@ c arp: ether address is broadcast for IP address %s! arp: ether address is multicast for IP address %s! duplicate IP address %s sent from ethernet address %s arp: attempt to overwrite permanent entry for %s by %s on %s arp: attempt to overwrite entry for %s on %s by %s on %s arp info overwritten for %s by %s on %s arp: attempt to add entry for %s on %s by %s on %s x`  `2 ܠ ,> "8 "   ,`"<`,@2< H܀  2<"HH`ج @    >a@x  !>Q'#!>R' @FG 0!>R'@  P]0F5 'ܔ @ @`? ~ z0v 5 `@< L4@!>R' @ݐ]`F 0Y@#>R'"`!>R'@Ơ!\ E`  $\@" `,`" , #>R'a8@@ \̐`Eϐ 0"  `, h \ > >㬐 $\4 ?$4 `% ` % 0B  D @ @d   4 0   -( ܒ$ ( 55  (4  //` arptfree㿘 `2`8>SE0"H $``0" `  2`*& `4 ?"`4 `   ' arplookup: unable to enter address for %s 㿐>  * @ , $ 4 X 28 4? dd"80 `"L`   !>S'"@ߐE    -㿘`H Ȗ `>P`!&`&`㿘      *   h@@0㿘   /  >0) '.0%#؀` >#  #>cԀ > ؐ @ٔ  > aԐ S >  aN  $c> "X!ސ㿈   4  %  % @% >!/   54`  4(   ؖ 4 4 , ,      // revarp㿘>#Ԫ` . >> "c"#'> %>T#>??caXГ2 : H #"?cԀ %#> !ڔ > !ВՔ   3㿐ƒ[NULL][%d,] 㿘 2>TEU#H0>TEQ#P >T%>T#>TEIX? EDc` 4>TE>#h ifa_addr= ifa_dsta= ifa_mask= flags=0x%x, refcnt=%d, metric=%d 㿘 >TE #>UE  >UE  >U $  E  la_rt=%p la_hold=%p, la_asked=0x%lx 㿘 >U   D rtentry=%p flags=0x%x refcnt=%d use=%ld expire=%ld key= mask= gw= ifp=%p (%s)(NULL) ifa=%p genmask= gwroute=%p llinfo=%p 㿘>UDÐ! t>U \! 4D 8>UD!H] >UD!PX >UD!XS 0 @>UD!` @`">U>U!pD` DD!x D>UD! Dr >UD!7 H x>U LD! LRoute tree for AF_INET (not initialized) 㿘> !>UDv" >Ua㤔 0>UDk"؁ in4_cksum: offset too shortin4_cksum: bad mbuf chaincksum4: out of data 㿀  `/ `8 >UBܐ#8 8>UB֐#X@" /7 ` ' `'   @          $@ `  ( ">U?c     @"   "  &, 2 4 @c4$ * @,    %                         ߘ ,      , "1 2 4 @c4$  , 2 4 ?c 4$ ,       ? * @ 2i >UC~#x, ?# , 2 4 ?c 4$ *@> >   ؝㿘> !؀  2  &    2  8     !""" $!&  ?㿘> !؀ "  2   8  !ؐ """ $!  㿘> !!  2   "N 8㿈> 'L'P'T'X'H!X ` "!X !X``$`0  ` : ͐ 2 ` $` "& & @a X`"0y  "@& & `X``X0gX0d  $ 4`^ `2Mv  0S"`"`8 @2D > "8'' ` ``t`<`'`'`7 `2` 2@8 ? " &`@ 2 &`> "# `` ``t`<`'`'`2`0< 8 2 `K$ 0 " > "8'' ` ``t`<`'`'``2)@8 "@@ 2`?`>X#ȓ*` €`( g&`@a &`> "# &` `` ``t`<`'`'`2`0 "4`<` 8 2^2Z ?@> 8`" 8` 2`<`"8`0& 8` ` 2`<```t`X`@@  ``"uX@ 2``nX&`` "`` "` d b `&` `"[ Y  "4`S<` 8 2" `"0D?@> 8`" 8` 2`<`"8`0& 8` ` 2`<```t`#X`@@  ``X@ 2``X&` `" `` >X#*` € &`@(N c c c c c `` `p `p ` `p㿘H /` * !   ?8 &   4`2& А?@ m& @g 2 & > "#& H 0㿘    8 ?   4`   `@ 㿐> c O H /` * ! > "8$c'' `2 `t`< ')  ? $   2  `@K  @G  $  $c ` `t`< ' ' 2 H 0H(> ؀ 2    2H@H /f * ' > !6h H 0`" 4`H /f * ' > p  2 H p@ `$ $`4`$@$`$`$`   `7> " `$`  $`$` 2 * * 2 "  " `` $` $`*, 4 @^$ 4 ` `  $` $` /' /  @e > aX`  "` >> 8`" `,`( " `<`2`, > 8`"  `4`0 " `<`2`4 <  8  ?     * H"*  @"   *  @   :@2㿘@x   . ``:` `*`?&@ #: . in_control㿈 !@  !@ 00!@0  " H@߰ > "8   2 < a@"'a@"< a a@qa@2 a0a#@ a!@j !@  aa%@` a      2 < H@2 < !@2  " 1  > >Z="2a   m x@ x$ <> b8` <$ @`""`$  $ "& D T d $$ $ , d4   , T, U$ $ t4 5 > a /"a   P  "    H ``<` ` 2`<`H 2`<` ` "  ) 1 a@a@"H4a @0 a@ta@00a"@" 4  !@~a!@ 0a#@a%@0 D& H& L& P&4    T& X& \& `& d& h& l& p& ְ  T' X' \' `'$ T$ X$ \$ `  $ T$ X$ \$ `   $  Ð T$  㽔  4 2 $ T$ X$ \$ `@ $ 4$ h E    2  D & H& L& P& H@" 0 @V0 $ d4$ h8$ l<$ 4$ p4 "! 2@A  $ T$$ X($ \,$ ` 24`"4@/ 4 ;! 7 $ T$$ X($ \,.$ `@ ` "`&  "@ <`" @ @"`@> ""< @ <"@ ?$  - 4 invalid argument to in_lifaddr_ioctl2 >\;"!@ "!@"ɰ -0!@2İ - @" 2  2  `  2  @  "  8  !@ 4t!@"  -0!@(t - @2 @ @} y "q  //q aj@  @0at @@ 2[   !@ P    `2 t  2  09 1!@x D D)4  T T"0@! h&&  @ @  D D 4  T T d d a㿘@Đ㿀H /f * ' `D &`D'`H`L&`H''&`L `P&`P' a  &`D&`H&`L&`PH 00WH 0  &@`D&@ @ ?0 @ ??&`,`4``,&`h&`4 &`,`,`d`4 @ @ &`(l&`0@&`$4  `4`0`,2`(&`X2 &`8 @  &``U   @T4 8 '@㿘 X H> "8 h @h `4  "HX @2<  <2hs    $ 㿘` 2` P `4   `X`H> "8`h 6  h. `4  " H X 2$ <  2  <`4 ` ` : ` $` 4     ,    $  < 2 h`4 ` `   ` $`?J H``4K`2`>    "A  "9`2.4"!84"0X"* 0"& 824"8X" 8" 0" (2  ̀` 2  xH /` * ! > "8` ` 2`<` `t  $@      $ 2   $  Z&  6X  2 @H 0R  && & 8 2<2 &  6H 08 t & t "`t"t&  ` @// ' a1؀  ` "`  " 6H 0  WH 0xH /` * !  ? & n `"  "`  "@ / '  a2 6H 0㿘&&     & 6 >(0 *`0 *  * 2`~0> ( 2`~> ḅ0(@ ` *   㿘 ܒ   ^ 7@ > `> #>>, '$  +, , , $ 8H /e * & $ `@$ &`"` &@ 4  6 `  `* @ $@ "  4  6 `  ` * " 4  6 `  ` * @$ H 0  & ?$ `2$ Ԑ!$ `$ ԰ 㿐8>     '@ @ > "8` 16  0    ` ` '`V`` ` `< 8 `6`'@  -`ְ 1 2"-`2  0#2 İ #> g `a 5 @  "  8 @  0a5 @ " ` 8R  2` 0`&0`266`  >> ` 2  # "X   >> `- , 2 2`@9 , ]@W&@$, 2`" 4)> g ܰ 10[?* 2`@46 : 4   ! @,0 ܐ866, &@ $@, 2`$@ 49> g  10$ * 2`@ 46 ( 4  g ! @0 ܐ66@S IPv6 pcb passed into in_pcbconnect㿈 8  ``@Sg `!"` >a7"X " [  " V / I> "8" 0  ? H2  0  4`" 0X&  0 2 0 8R` @ @ 2  0쀢 . 1'* `'`'  @v 6 " 0 0 2  6 2 `s 12`  1$ 0 $   @4 4㿘 8 `> !!` & `& `& & & @6 4 8 `@㿘 8 \"` " @ @ " `i `!@G 0@ H /`4 * !    ` "`"  "@ "   ` "`"  "@ " @U " @U Ā " @U Ȁ " @U ̀ " @U Ѐ @UH 0H /e  "@* & ` "` "  @ "`"`   @ "`H 0 㿘`  @D&`  , , 64  0$ 㿘 8  @2`@>0   @*&`  , , 44  $ 㿘` /\``+'./ 2 2` `!2  2  8 "  42  62   0 ` @2 `㿘` `` `!2  2  8   뀤` @`& @@ 4 D'`0'` '`4 `4  ``  j`00=㿘 @ 4& @㿘 @ .2  6/ 2 @2 `v  `!"  $ 2 ( 2  , 2 0   $   $  $  $@a  2{   2  2   2  "    2@  2 @  2@ @  `   `  ` = @*  2D  42@ 3` 2/`` 2+`` 2'`` !  `!2,    2$  42   0" 0  0 2 `````"  @6 ` 2U 6㿘 @ 7 @@ْ  8 `#2,             . .  &  &  &  ׬&    . .  נ& 㿘@ ` @28 8 9?"8&@2@@   @ 2@  .`.` v&`` @z @` `@ 4`"`D 2  C4  2 4 C 4 > "8 2  1 &@< 8 2 D" D> "8  2 <  D 1'  DH(  `!"14 46    @("   @(  46  (" 46   ()" 6   @("   @( 4 6  ("4 6  ("H in_pcbhashlookup: faddr=%08x fport=%d laddr=%08x lport=%d 㿘@.6/  7 @  *  1 `!2( 2$ 42  62 0 2@ `"  "` "@ &@" #@&  2 `  > ` (+ >e!p243 in6_pcblookup_connect: faddr= fport=%d laddr= lport=%d 㿘` @. 6/  7   *  6 `!- @2  2( 42$ 62  $@#  2 `"  "` " &" $&  2 ` > `>e4(",`>e2`4##,>e#(42`internetvmmapbsyvm_map_lock: failed to get lockicmp_erroricmp len㿘 ` * > `P "`P ?@ 2% `!  @*            > ϒ`P` "`  # Ɛ @E   8   @ @*  8  (8' }  9 6 H /f * ' > !ؐ) $ $}&){ $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8   ~\ h  $  ܐ"   ?@$ `( >f1 > ϐ P .` ``" *"` "*  `2 *2* "* >2*o   2    $?쀢 : >f1  ? $ $ $  @$ ?*@  #?*  2* 2 "   "p ?8@}㿐'L'P'T'X'H   $> ϒ`P` J"`@8 @ :  ɐ 2 > }`P "@& & @Q} > ϒ`P` )"`  "@& & (> Ϥ P*  `" `(>h"ē*` € n>h",  €    _P   ZP  UP   ݒ #P *``< 8 "<P )2 > C06P` "` `*``0L@ 2 P` "` * >`#`# `> " >*` *  *  `0P` "`>#T`2N.  # PG.>#T`   # P`Đ }"`Ā a @.&1& >#P`p $VP>> p" cp"   ``@p W .`h& 2  `  4 2`X " `X&   6 P6 `"* `@q# 04    P #( ` `*` `8 P` "`>#" >cp"`!>#`$   f y @0| d d d d l d t | | t | t | | | | h h h D h h  h h D h h h h h h h h h h h h h h h h h h h h h h h h h hx   ` *`}' 2   ?  " |A>  % b8 > H@p `4  p H@ p  4`" < X@2 <p  "  ` ? 2& Hؐ@ ܐ * /"؀`2 `t> b\`T y"`Ty   H`D "`t`8 ?"`8 H % ``- @     {   $ "@8`  D 2  2  $ $ $    (  `@ހ   4     *@   $  "5 @* @%  "`&  "&    |6 @ {4㿘   , "@& & 4`@O'"@4`  "@& &    @ Ě 㿐@GxT@a* &. . @#㿘`  >   *0 *0 >#P#T>#X㿐  "3  4 $> 0   š " P"P T"T X"X \"\ `"` d"d h"h l"l p"p t"t> >jbD  s 㿘> #` < %PT  `   * $ >`@ <># P c*@( !' @ <   "PT "T. icmp_mtudisc_timeout: bad route to timeout㿈 2 4>j.5"  2# P   ' ''  '0 0> b>* *  *    0 "& T㿘>#X>>  ]c\`? 㿘.`  .2 .   ,,`6 <2 @6 , 4 4@}6` ,`6 㿘%?'> )!$@ #c4  > > 22a > |2a$` 2 !>  4!! > 2a 5> 7>3> 1> ->4!! @]*  `[#$@Sc4 $` >j#8 ,,`2   , @A4*  2` , 2  @` ,2`z  @  ` ? 6&a56㿘>#a/  > > `쀢!> |!> ! $!!c 2 @/@ $!i -> > > !a`)!@̒!?4!`> c> !@ &5c> a>” . 6 vmmapbsyvm_map_lock: failed to get lock%d.%d.%d.%d㿐>k'1> !c.ipqeplip_initaeshmac-sha1deflatep"7"K7""#g E""777#h> >kcP77777 h7#\#`#d   "}   u  >>k,#X#@ *"@ *`" *  *  * " * "> b: > > `*@@ 6*@>#$  @/> + +`" " **"@ " *` * @  *`*  @ *`* " "@ *`* " #@ > @``2 `4S```:* `4@ #> iax> 4"` 8 8" >` >6` >"`> !@窒 @   +``2`*` (  #  +``2  > ! +``2`*` +` +   >k> c` @  >k> ch @"P> >k!cx@ ipintr no HDR㿘> "܀`#> iw%>lH /f * ' !x` !x` $ax""`?"H 0 ` ` +@ 0ׁ㿈> "8`o'D> "\`""\  "\{%  'D  ^$ D<  @ \`X N"`X2 <\` E"`  { 'D\` 9"`   "   D  4`D\`p #"`p` 2 ?  \ t `" " t @K  \`  "`"` \`t "`t @D\` "` \` "`$ D 2"@ "  "zW D =D D> c *  €  >" 8@<D  D@' "   4`2k  < 8 . b8D     <  @2< t`@  ` ``@ 2``2: l\42>#`bD  H o *@ f  ( @=I  D#\ @Kʘ H p@ ;\D@9 0U ?@D`   z  'D\`  C"`  H /f * ' > c   H 0  > Β %cH 0 > !    2  @2   @2  @"  2   "2 4 *` `" \`` "``H /f4%c* '%cH 0 0  * 4 *  f \%>`>0`,  $`@`d $`dH /f4%c* '%cH 0 0>  h! 0`d $`dH /f4%c* '%cH 0 0 `$0*D" @" 'DH /f4%c* '%cH 0 0|`@ $`@` * @H /f4%c* '%cH 0   "4  ΐ < ` l9 7 )5 3 1D  H o *@ f  ( @<  D#\ @J H p@  \\(D`u"(0\4>  "4 b @ >* *  *  D  0uD> 8=H"8  4 40 ", >`"!<`2<4"<X`8 `0`(2 <`  `2`2H 㿘`  ` *`  " & -&     > > aa &@" "a&` <.` ` .` `6` &`   &` r&`3 `2w` i`` ` `  `@` ``  (`````  " ` >  wƒ`2`"2`4``  +`)>->  @ "@ "@u` @``"``@"h" 0?` % 0`  4`2 @` $` " &` `  $ $@" %@$`  `  `` `@` `  p `? @c *   > \h`@b"h^ ` !> w"&@! h>`0?`"`0  !h 0?$ 0w 2 5``%` `%`@`"``"``@"@͒  @ * @& @  *  "@&   @& \`tY">  h!q>`0 ?"`0㿘 "'> %>tD ` "` "h!U0? $0`"  "` "@{ 㿘H /` * ! H /f * ' > c   H 0  > Β $H 0 > !> "\ ? *`  `$` 2 H /f4$* '$H 0 H 0㿘H /f * ' > c   H 0    $H 0   "> a  > "\ `!`P$`! 2`H /f4$* '$H 0 㿘 2#> Δ\ `/"a> ,*` > 0: @?> attempted source route from %s to %s h   * ?   `> @7>`  ? ` @ $`Dw ``Q`ά%`2ʬ%> `"   < $6 />`% ?  '@#%t `2 6$  6H@'Ԕ< H% [  < , 8 @ @ ?  ? v  C5  H`@'Ԕ H3   _,,耢$逢` 2   *` ? {'E% А?   "   ($g $c   ^<" 6:  #H   M 5e  /'̒ ̒Ք  /% ``  >#`@p 6 4 'Ԥ@ !>q#('ې&   ?  ?  $   *"@ 5  9 > b\`P  "`P㿘> !?` #> ` #> `8 ?"`8> "!  , $ ,aa   Dy > save_rte: olen %d 㿘>  `@>s &`+ !> " G2 >"`8$?㿈   //'7 2 8L D 4 ?$ 8 4 $$2: 8 0 `> 3 804 !Ѐ`"+ 8` "#` 0  @2     `@怒 2   8 ?$ 8    2``2`  8 ΐ?$ 8 ip_srcroute: nhops %d mlen %d hops %x %x %x 㿘!> 8  pB   8H > + `& >s" &c  8> b *    "@ >s&R#?  *`*` `   @   %>s  "@&:@$@ >  "`$>s#&* 㿘  @` * r"   "`&  "& @* @@ $@forward: src %x dst %x ttl %x redirect (%d) to %x 㾰>  `   >t`  `% ` ! > `' 2 `> \(`p"(0ƀ`  , >> > !,` -> `@    8 ?$ 8> "!  ,,`ǁ$      0` D4 qC  " @ @ `sy*` @ @2> 4 0.>  (>#`$`#> > D 4` 0 > 4 "` 0    >t! %a> `  !#\  @ > "\(`"(> b\$  "$-p+0), ",$A >u ȓ* €      T` @'\ b\`L "`L   Ԭ X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X d X X X X X X X X X X X X X X Ԥ X X X X X X X X X X㿘` ?`>v!t*` €>Ř#>#>  > #` > > !>6  ` !>  >` $  !>     ⻒ $ !> >`  0>m >g >a >[ >U ,>O#>I#>C#>=#>7#>1#>+#>%#>#>#>#>  > "P># > !  -  ( @ h X ֌ p ׈ נ ׸ h  0 H ` x ؐ ب  ֤ 4 Dip_output: IPv6 pcb is passedip_output no HDRip_output: tag of length %d (should be %d'X'p'H'L'P'T't 'x   `!t>v"!!t `>v"" @||'ttp`  <* @ &6=  `* *` > 6&\8  "8֐ "$ *  W @2 4 "8@" 8 ?"8$  p  ,,$p "1C 2 1g @>   . 2`2`t> "\ T1 A "`t4`D `@0< 8 H& H /e * & t x^ t `$" >v" !z $ @3 ( t?'xtx, `#\ x @Bg tH 0x ?V "'xtH 0J - c$xaa  t `@  a@ t @}  txH 2  `'laH 0t  @" @ D t? c " < 8 p`2V2@H 4 "8@" 8 ?"8$  p  ,,$p "0Y 2 0} V>   . 2 `2`t> "\ TG A "`t4`D `@0 2H& < 8 q tR !"t` 2  `.@ 2t .t  T`4@ " `4 2  2  > "\ T 3`" T'x  > 8`" 8` 2`<`H& 8` ` 2`<``t`  ` 2 `t ` "@Z t`4 $t02t'# "t`4 p 1'x` 2 'x`<@Ot`!` >2`p$  "  P   6 H /e * & > h`ؐ 2Zt  t A'xH 0Vt`l@2R   A'xH 0Dt@> @Nta JF>   a:` 8 2=ta t8Ð /$ H 02`"'`4 `'  /'/''' "`T` (`8 Ӑ?"`8$Ð (  <2t@P 'xH 0xt v=  t`|  @? ktj A  @``| `,  @{ t? c "  `| `,   @h t` ?"`  1t  At'xt `<@ 3* `| "6 `, 2 6  >  " b\`x "`xt@?&6 t`  @`> Βc a, "a,> jb`0 "`0`t'xF@ ('x4   P > `<T 8"T> b\`L ="`L" ? '| (5'x  @ |@ t? c " | t`> > "pb\H /f * ' > !  'tH 0t`& 2`H /f * '   5 H p@ t "t"`t $" t2t" t"`  i 'tt  %@> t" "t`$$ $  $ $ t` #@2@c ?  `**` $t&" ?Ȑ*:`@4  @ 4 | "@'|  4 ~@4 |k> t"@t@ D|"`t"``| "4 `, 2 4 t `" `x'`xt@>4 `H '`H| K't$ lt" t` 66`|`"6 `, 26 t>  \`" x "x> "\ < 7`" < 'x Dxt@=6 `'tt`"`x  `t'xjt 'tx > b\`D "`Dxp```8 ̐?/"`8x (t@Pui㿘 ?` c @ ` 2$    $ " :f H /f * ' > !ʒ H 0" 0H /f * ' > p  2 H p@ $  0    g :>    `       &  6     ?`& &  &   &   @& &  & 7   ɔ& 4 malformed IPv4 option passed to ip_optcopy㿘  * ?쀤'`  $)>{ ,@` 8 ѐ#`  ʐ#`@$ 〦 " ,@  `㿐>   `   `  2`>~#ē*` €`@Ԓ`" ` 2 ``>~#*` €.`e.`l`` &`` ?&```` &`` ?&```` &`` ?&```@`" ` 2 `"``"`` " ``  ?&`` ?ߐ &`` ? &```" ` 2 `8 ` H /` * ! ```"`"``"H ` H /` * ! ```"`"``"H >0= ,08>  63.`2 2, *.` 6&.`2 2 .`> $ 6.`2 2 .`> ( 6 .`2w ".` `@:<`<*@ * &` -` =  jA 22` "`  ݀` ׀`` "&`@:&` "&`@:&``Ā " &`@: &``̀ "&`@:&`    n.    7 n$ $ `4  4`  i"#" Q`.";K`?* 2  9T J `3` ":&`@:6&`?* 2  %T J `` "&&`@:{"&`?* 2  `Ā "&`@:l&`Đ?* 2  ڭ n  `̀ "&`@:Z&`` H /` * ! ```"`"``"H `  H /` * ! ```"`"``"@H ` *`f`>~#<*` € eܒ '` "$`  $` ``Y` eː ' `>$` >~#(*` €6`e4`l``1 ``2 ``2 *`@2[ e ' $` ``  2   $` " ` `"`````6" e ' `$` >~#*` €`7` 7`7`7``Ѐ 2T `2@`  @ $`  `3vT  * t P X ` l x      4 4 4 4 4 4 @ H P t \ \ \ \㿘 `e`&`  `U eŐQ La`   F `&`  Ғ`@ `$4`  "0`   `- )'``2$@` ?&` ,`@ `$@` ֐ ` ,& eu 㿀@   X 5' &@ ,$,4?`>"D*` €"  2 > $"8`  `H2`<`2`  T4@"װ 1$"Ұ  2ΰ  ,"ǰ  2ð  8 ,"  2 <8 @@ 2   /' */" " 1 @> "8`  `H 2`<`2` p T4@l @` @`@  ,` @2`@2`@ `f 0b ;,` "@ Y 7 U4"R  2N <8 @@ "D   > "8`  `H 2`<`2` "0 1 @ ,` @2` 2`@ ,` 1 ;`@ ,` `$?@  ?4 -  @@@@ 5&@ 8 $㿘 cx   &0  # -0+ ``"` @`> "8`""` 2`<`""`H"" `` "` ` ``"` `*  -㿘     , @ Π  , ס 5㿘沐 e  ` 4 `@7*`4 Nu 㿐  @ +   " ۠ * ` 7 `  <c7 `   0 , 2       0 2@ 㿘> ΐ `ީ 㿘>  > `  ` `"`D `!2< m`"0 @240`"  @2, ` @2$沔 d  8`{A c 8zC  8`2`8`{# c0 z&  0     䛘 > c> "\ 0 4" 4" 0㿈 'P'T'X 'H'L ` ` J`  ?`#@I ``" 8`  $"   ?ܐ"   ?"    ?`& &  c  "    "   &   .`6` m.`  6` 0.`&` /&` ?#$ c- (@@  "`  `@ 2 <@6`c  > 76`> b\`\ "`\  U @㿘`  C  ?b쀢" 5k3d1 0' `" ` 8`  ` `  ?$ ` bn\ a ' "  `  "@  - bZ rip_attachrip_detachrip_usrreq㿘``   ``2 `.`>! € "`>"H > > y x> Β``B q`n, m` "i 9w >"XW_ > !Ѐ`"U 1? 8O 1 "K$ 0%$ "F 1C$ 0 = > !Ѐ`2 6 1? (/ /wg$ +xZ'`   8 2 9    -ߝ ߨ>"ha  l     T `  p d       㿘> > j* @*`"@*`"@ *`h@ d""g$@4 4 $  t   t@П   4 <!4 p 4@Б <4 p $ $ $  $ $ $ $ $$ ( $ ,$$ 0@v (4 p㿘 ` 8  E  2 > Δ `au"ٰ  +>  ``"     `" $)c ``` " `$!`@` #`` ; Ba?;`Ԑ E0cܒ"&`@&`c `#``Ȓ ; B;`a% `"  "` "@m E " ` " $6 " "2 c $ 6` $ $" $ & $" $$V  $M  "I   T  j  8 `& T  ` `  $`  "@ `"  ``!"  `@  @%   " ` w E`` T  ͔ w/   㿘H /e  > @  0>* & >   .`2   '<` @"  R` 2 6@ "`2<``<`@" R`  2 ή c `| 'L "`|'P'T'X'H  2`'''7''`'̀`     `'0 ``0`(( `0 `  c   ") b    " '@Ґ5  2 ?߀ @  !( `" "!(@3* `<5$&  a( <"a( "'`2  2 ?#@ 2  2  ?#@     y @ (  ` m"` @ 2 * `Ԁ@" ` ]"``;' @ : c   ` v"` "     '` '$ J 2 `@B @2  2   ''''  `>  Ֆ > ' 'fآ`2$`< a   "a `>    >    ] 2`< a "a>V  '̓*@''`8  &  7 2!> j #(I < > `8"`8"" " """" " $"$ tj 2 &ta `  `< 2 * * @$ `` '$ `` "`` "`$ `` "``Ā "`$ `` "``Ȁ "`$ `` "``̀ "`$ `` "``Ѐ "``$ `` "``` a`` !$`` k,`kd$`d 4`6 $`$$`( $`,$$`0$`0$``< 6`<@ h H o *@ f  ( @$E  #\И @2Ś`: -@0{ ` 2 `! "`$`!` "``Ȁ 2 `!| "`$`!|` "``Ѐ ! $`!`  "````"`"``"@$`H 0Ѐ V 6> 6 @ @ 6"@V  Ē #\@֚@ 2 V&`Ԓ@&dV 28 7 28̀Ѐ@,8T28 <@28(@28 ؐ"  > !&&Ԁm$"@ $8"@ 48<@*8V 28 !̒` "!> !Đ"@ @ @`V" "  @ 2 $" `` <`B ;`#` ` ```!" `@  @褔 `v,&L]3&$$@2V6 26 s` $@2X8 T8<"@D@" 4 4I8@   l " @  T &T ;`B 8  `"  ``!"  `@  @F    6_v@8sƐsWϐ  08<"D@"@@ @ `& T"@@ & V &P   { | C u@2   2 @r   @`  # [      < 8 K [M  F G g  $ **<" " ""2`d* "`$'`('`,'`0'`$ `( `, `0  $`$$`( $`,$$`0@z /$`$$`($`,[$`0``!  $ ** " @2`0`$`0z $`0[[@ &@i 7'  #\@@  "` &@`&8@&8>  `86 &L&66 &\&,&&(&$&T ` w"`  a ["a$" U " P ̔  8"@ E "@ @ q@ =m i" 6( &$&(6@ &`&\&T6"  &@ ( $8" ! `p"  ` `6..͒  іV`"@* & 6 &P@"@]  `ؒP < `ДB;`ؘ '#`и? ?&0&X̀ " 2!TЀ`Ȁ <T> !Ԓ"@@ 4&Ԛ  :`` aB #a#`;`T" :` &`?6?ߠ?Ԁ 6Ը?`` < B #` ;``` < B ;`#`@&Ԑ"'@"6?6 V  " @M `]" TP@ " ?  Ԑ  ,# В : ؖ B ; V 2PT"  }(@@!'MP  T@   6`" ؒ < B; ؐ] Ը?"'̀ Ѐ@  ؐ"  > !&&Ѐ  ؀@3?* : `> *` € = 64$6  `" @ 6޴  À  V  ~ } `ok"  ` `6..͒  &0$" 4p@Ԁ Y 2U6<_ ` $`V`Z> * :`@ F6< ( 2 @ГL@6(  &@ &L66```B <``@}V@&66&(&``B@j<``V(@$ &&(@ @W&{@ 6 >V '@'  ' &V @ 2V&@ :6@&6V@&6"  ` "`$ "   ̑<`B`;  # > !Đ"@ @ `V" "  @@2V6 ' 26 @ӒV  ?# * 8 &"` `" ```!" ``@  @i `@  `<" &<`q  q<"&<  or( &$&(V "`   0, % 0'`%   nY> "*6  6 6@ x6 nJ ` @ B x>6 4 0@ @4 , Ԁ & <@! Ԁ 4@ < a "a&<&0&4@8&Ĕ ' ":T"6TV 42T8>a  (6-?X@ " $&XT8"  ? $4 @4lȐ ?.ր@!Ԑ@X"@ 4&XԀ 2V aV ]T@E A>   6Ԅ T &T ;`  B 8 `  ` ``! `@  @a Z8nnz @ZY`6@  @h Wѐ? "1V ,  nT `6&TV "      x6 6 6@h x6 m26  " `?  > j* ԓ:`(   > *ԓ:`8    {@)0w KWl`@60l> >> #(T`Ā 9 6  # 1     < 8 !    @   Ԑ 'Ԕ   @  `0c0,"  8`  > j*ԓ:`( 8 0 > * ԓ:`8 - W`b++++11+1㿐\V7`P>"*` € 2I@ D`C @@ 2=@ 8   @6 `@8/. π 2-@ '`( `$  >  !6 @& &  @ 2@ 2@ " @ "6 @@&$ @`` $  ` $  @`@)989h: :H:\:\9" X l  #?pt ''`` T" 4p"t"p`t"" l  l"  & l@А ` T   d& l& p 6 T "p"t l T d n  l `'$'  `t `p" 4 l" " "`t $ < "`t"`p  l `''?+ l  pt ''`"?"`"?  $& lĔ  "p"t l耢 4 l & l l?  + ?p?t"x"| & p& ttcp_sack_option㿐 @ 2  " D  & D  > 3!  "  $" ဦ`"   " Ӏ H "    & H`$ $ $ $ & D& h  @">` 8 $ $ # '>  ,   $  0" "  "  $Ȉ ȃ & H DS?  $ $ @  $   $  $  " @฀ :$ 43 " .  t  )  $`$@ $` $` @*$`  $   $  $  @˔" ฀ :$ $  D & D "  h@&  9   h$@$` @l">` 8 $` $`@$`$` $ D & h& D 㿘 @ )V  % $`&@   H`"& H`" 4 @ `ג  D?& D<& H` &@&` & H p" l   ` L< 2 2  $`     "  tcp_pulloutofband㿘` > 8  &@>א# < Ȑ `** "  ?& > Ά  * `(:` * 2 2(& (8"@(  2 2((22*822*`R(88822  22ʝ㿐> ج   T` @`N` (   T 28"`C``4 20`<` > `2(`< ( "!`<  2`<  2`< ?#@2`<  > `2 `<ț' `<"?쀦 ``<"?ؐ * `44ಀ 8 @*b  ` 4ర?2$ 6 4@J$4 㿘  X 8 ~V 2>dl ":dP @a @* 2``6  ` 6 =`$@6 p "*`z@֒`H6 2 :  : 6  V * :  :   6 6  6 d "d:?$`@ɮ>a 8 i`` "<?@ɚђ>a 8 i8``"h<@Ch ,` * & 㿘``L@ 4`4```($`(``$`" `@ @o$``(& `$`$`(` `$`"@ `"@ " $``@ `H >  &    < `$  2   H` ( h``  ` " (``<" (tcp_output: options too longtcphdr too bigtcp_outputtcp_output: template len != hdrlen - optlenP '$  8`? '  'TT@&@$@  (@<$($< "@ >T@" @ 2L> T@ &Lj "L   $"  "@  L " $L  ' 24``* ? 4` ``  "6  $4T$( 4@/   '$(``   ?`<`8 "@`D`@" 4   d :[L 2Wđ2` `2P@ K`2J? ͐#* 4, T" " 69* 65`21 2.," 4) `#@""" T  T  4 T T @4       .0 .0 ( < 68`1$(  //ѐT 7Ɛƒ   Ր@ 2  @A"@A 'Ԫ    @"  @c "Ъ` ` 2@ 2@  a"@> Ė@B` " " "` @ ?#> T <`( ""7`(l2 $"Б2 @   ` 6*pt ''̀`" l#̘ # l`@&p*@Aa  `((>C#0" ' ?> b(>2#P"L  2 (> Β `l "`l(@ > Κ `X`P <B ;`X #`P `H`D <B ;`H#`DH /f * ' af H 0 " 6 H /f * ' > p  2 H p@  $ & 6 && & &  N  > H /f * ' > !ؐ% & $N & $H 0 $ (  & 6 & 0& (& ,& <& 8   O > b ("@"@ & & `tP  &O 7'`tR( & `` " &  > Β# `h "`h > Β `x "`x,$" > Β# `p "`p> Β `t "`tH /f * ' a H 0 " 6 H /f * ' > p  2 H p@  $ & 6 && & &  MĒ  6H /f * ' > !ؐj & $N b & $H 0 $ (  & 6 & 0& (& ,& <& 8   OC >  7T' &  & & `2` >ʐ#`&"`>Ð#p       ?  (@$(2 ( 2(T "(` $` 2' $` ' T`$`В`]` `2`<**` $` ,` `<2 ?& ? ͖#* 4T"@ & 2 = 4`,("@` @ 8 ` 4` ,` $$, "   "LL  @& * `2 ?c 8 "  4`ؖ &  @ (4`L  T 2V( ( $(" @( `$(4@  (`" 2@@" $(T  $ > 4$ ` "`@ T` 2&`(@" TT`444T 2`($@"`T` 444@"@ 4$`  T  U&  "   5 1  > 2 `l* `e* `@` ` ` g '   ?, 4  @ ,  ` @  @ ' !> `7 @[ 5 ( @{ - A 2(T  !4 `@  "`@T@"@ 4$?cT $4  }' tcp_output REXMT㿘 V * : V  : >5" &V > * z * :`` 6  `x x6 V   `6 tcp_init㿘> >  v> ؑ2 > ;"aĐ <"> b < (>>"@"㿘  Y  L2  2  "   >  "> "  (& > " `( `6& H /f * ' > !ؐ' & $K & $H 0 $ (  & 6 & 0& (& ,& <& 8  2 L_   "' G6  @ܐ  4 , 0?$ * 2  2  2* 2` * $ 2 2 # `" #4<$$ ( $ , $ 0$  $ $ $  $ $d* $, @4 ,   (46 4* <*@4 $ 44$$, 4㿈   `8 @ < 8 D" " 4    `? `@@< `? K  > " &ؔ <Ӕ (+ Le&& <& ``(`'` '`$'`'&`` &``&``&` &`$&` &` &` (& ``` &` &` 44  <`( 4`  (`& && * <*@ $ $ $  ,  ͧ<?#44 #4  $@,`   @ 4`,`4 ` @ ( 4      @ 0@ 4` 4 @4 >4` >,` `  $  @ 㿘  H  > @ &>> >ڀ `?6 & @6   > ܘ *`: *`6 6 & 6 6 6 6 $ ` 6  `& a&   &  `!> #, k> , l$ <㿘 V   `86 @> Βc `  "` > Βc ` "``<V ʀ 2@4 $㿘   8 @ "d ` 2 ` 2 ` 2 ` " d   "d   @ d 8*  @@ <b ^"]  P @ V *"@ *`" *  l * ` 2 $ l$ l P  V *"@ *`" *  p * ` 2 $ p$ p P 2  d `" d h 2  d2 @:   * 2 2 @@`(   `<`( h  2 $ h$ h  +#> `"  "` "@J % E 2 H #> `"  "` "@J  E 2 H "     2   "JZ `0$<ǥc ` "` ?  * Δ ΄ * ΅* * ΁㿘 `k"@ g e ?>" >c!  >  0 `N>  "  6 `@ <@ L^  >  `ʥ   N   @e0#` @i#\0 > #` #\ @i֘ 㿈`>`P" M> L.   >/"? >c(!؀  > `>  `*`      >> #@  ># 0 >  `*`'   #\\0 nj  < ਁpؐ@g  > c@   > > //'#`''' #\  @iX 㿘 <h `" $`4 2 `TǗY  `T i? $$ (㿘 <F    4 wQ?> ␖     `(((2 *`0㿘> "tq >   > `  ?`  @ > > "!3 2㿘> #a/  > > `##*``6#2 r4> `? * .  㿘H /` * ! >   ?> Ψ#c   <"    2`  `f$`  2  > `*> `` ""(H 00E@ :1>  `< 1`T  ".   T *` 4  8 @~ @2` 2` 2   T   `4 4 @2`<!Đ &!ēH p@  2?㿈``` H " & H   2 & H`"> ``" 0`V   > "(V @ >  6 `*`:  6  > 6 c `$ "`$V ʀ  < > Βc `( "`( V * :   :   V > * *ȑ:  * :`@ 6 6 ` 6 >  `<6  `"9V V  5V  3 `8 ``"-V Ð "   4 "  P 2 V  ` @  //` u' " V  P  $ Pْ V  $  $ů   * : @6 6  $6 & (  <& L 8  2 @( ( [& & 6 #0ec `, $`, V * :   :   V  > V 6 `0>*09: `0`=$`0 . 9. > Θc  4 # 4V '   8`>>`> (V  @c  8`# 8    $ T{?> 6 >  6 c <`"< <xvmmapbsyvm_map_lock: failed to get lock㿘@tcp_usrreq㿐 `    @@n= b  Fʐ  0H /`4* !  ` H 0` ` F    < € _ 8@@ [  " T 2 x4M < `!@cӒEA 6   `!@cÒ   0  -4  ` C ` ` 2  2  "  "  2 6 2 6?#@2 6 `< @8 `'   6  @cz 쀤 @d*) `< 8 ' 2԰ `' ̰  6  B À d   $ ϐ 7 <4M[%>  >` "  4 4 $ L$ 8$ ,$ $ (%$ $ -@ `!|0~  [@ 0  } gy `\_p 5kd&@H 0t 4 2 @"Y !2U  Ȁ  O  K #&  E*@ Ȑ A, `d"@lh" 4 `Ei1 7\\`  $,  $ ,$,  `!@f0   `!@f@   .@ >Ӑ!     U H 0zh}zz{@}}}}~~0~D~l~`}㿘 H /`4`* !`  H 0 6 D\ <`  @` ` / @ǘ ĘH 00ySo!C **? *"<  (8 `"   /4 ?# @*4 "(  (# `$  @4 4 "  8T   4   $" `"$ @$ @#D0 0 CX ' " "  *"   * "@ "@ @"@H 0㿘`d >`<  > >>!8<Z !> ` `_ 2 2`` ? 64`` 7 4` `!  "` 㿘 V ` 8   T  }  Y\ސ 8@  㿘V `>!d*` €6   6  V    Yq`8V  > "*6   h 2 2 2 @"  i" 2y  2s  @}  В @}  _ Z H /` * !   `!>  &!> '` '`÷Ȕ> Βc a   "a`   ``   8  ?'8`'?''H 0"&@"㿘`\ ?` V>!D*` €>G >A >; >5 >/ >)  '> !΢ @>!<> !8 > ͙ *D\t,vmmapbsyvm_map_lock: failed to get lock㿘>!D> n"h㿘@@! > j"'L`'P'T'X""'H 2  '  0  /  / `с   `@F/ ` "`"    `2 ` "` " 䀤 8$` s"`E ''' ''+  2  2 ?#@T      ?#@F @y* `67 ` 9"`/` * 2 ?! ``("`(B"`0,@   6 @ʐ* `7 `B"0& `( "`(`  "` 0/@ޒ  //7  @'// 7'@ɒ  //7 @|+ @// 7 @|  < 8  > А'D  ʀ> "h"h@  ``!2`6``!2``6 @2`"`0`$ `$`(  `$`, `$`0 `$@j  `@2f`"` ` ``  `` `` `@K  ` ` @2G``4@2B``8沔 B  0 '``@@Cߒ`8X A1 A+`   "` W`  '`8` " ``"h@j`` "` '``@@HC`8Xu W{`  !> "h ~  '"h' `?`$  "`$"h  "h     ' "  c` "  @ 0& & & &  &7 0 K H o *@ f  ( @  #\ @`?`8 `: -@” ` 2 `! "`$`!` "``Ȁ 2 `!| "`$`!|` "``Ѐ ! $`!`  "````"`"``"@$`H 0 6 '``@@i `` 7  @) 'B`8 8W `8V 8`8   0 `  "` ? ?㿘 >ǒ    I `& $ $$  㿘 82 $ 8V\ 8 8    8VQ `8>!l`Ѩ ` @ ɀ ǐ? >c!    > 0 ` @` '`'`  '` '` '`''@y  "`  @_   // ''' ' @o'  `@'`'`'` '`'` ''@yO ]`P@ W@+  A@"   //``'` '`'`'@of' @y# 1 %> h   [   @r#\#`h@^0 > > #\#`"h‚ @^ 㿈>`2!l` .@ * (> L. ?򀢠 >c!؀ `0 >  `*` ' "h#\0"h  IPv6 inpcb to udp_outputx ` 'X'T'H'L'P  >:!? #@  (    0 8H /` * !  " H 00 2  9``' 8# `  $"    ܐ"   "    & &  >  S 7     & J 7  @  .` 6`  0>&`  &` 66`@ 4 6`6` /  & ` 2`*`2`@ + 2@ 3 2 @ @*`22`?#@ @8"@6`6`6` l> j.` e.`,`", 8 @  0 S#\ϐ$ 0$ `H 0=ސ=ِ㿘@udp_usrreq㿘 `   `! @e  3D- ``2 `.`>" €  H /` * ! > bhtH 0` >>!HLT+    `!> #. k> . lH /`4 `* ! `! @ZH 0ŀ  `!")    8        H /` * ! @\H 0`  8H /` * ! H 0` RZ{  `!"         d 9H /` * ! ϐ `! > !!` $ $`$ 0`$ ($ ,$ 0H 0  ?>6 S;  `!@雖;4RJ@H$  `!@] M  `!@] Q   - ->0! <<,XlX`hP`X XXXXX㿘H o*@ al H 0㿘`!  >    *0  *0> !@! @ >!L>!Hvmmapbsyvm_map_lock: failed to get lock㾐 @G L/&  H $ H \ @C$ \ `0 `* @@ ``@2r @2`@2` ` `* @h!"݀@ > ] > i !x'@ > "ࠢH e > >  *`  ْ    '<    ""@& & &  (   ''' (kH /f * ' `` @``;$`0 & ` 2" $@`$` $`H 0 㿐>#'L'P'T'X`'H;0 _ / ;~㾈>'H #'L'P'T`A'X@ 7 ;& H &H \@&\`  ``*`*`@ * ` 222.` .` .`.` ``*`*`@ * ` 22`2.`.`.`.`.` `*  "@;00S. **@  *`@ "* " ~@ "& `"@6` "& @6` `@ʓ*`6` (> i` !x '''( 'H /f * ' `` @``:&`0 & ` 2" &@`&` &`H 0> >  ` 䀠 2    4 ! 㿘`    *>\#㿘`    *>I#vmmapbsyvm_map_lock: failed to get lockIPcompIPsec ESPIPsec AHIPv4 Simple Encapsulation㿘 l@ ` lw  l @ `;#@ i  (! l?#8@8N dL c@&@ (BH /` * ! @;H 0 2)@k$ }! }}!$ $,! $ $@e,!>#̀`> $aX ;`  $ $< ҇ (  '@ 㿘>!`y >!` )>+>c1 $!! !c( %!!@  @,  ?$ 2 @! @  @&@! @ a a8  @ @[a  8  @  @  @ ,`@  2@!@` 2!2㿘>!` >!` `)>1>b $a!  b %!a7 @   @,  ?$ 2 @!" @  @& @! @ !~ !8  @ @ٔ!  8  @  @  @ ,`@ H!`@2@  $ 2<  @!@ْ 25 !` ` " !@ p ") ! 2$ !` ` " !x@ _ " !x 2 !x` ` @ N " 0   2!㿘>!` >!` `)>1>a $a!  a %!a~~ @   @,  ?$ 2 @!~i @  @& @!~Z @ !}ڐ !8  @ @ !  8  @  @  @ ,`@ 7!`@2/  $ 2+  @!$@  2$ !` ` " !@  " ! 2 !` ` @  " 0   2!no tdb hash table tdb cnt bucket cnt %d%c %d +X!>!耢 > 06@ؒ @>! @!,`   `` 2`*` ` @ " > Ԡ )>'>%>   `ДŒ`` 㿘>!` * >! $ a,`@ ``!@@       !!@a㿘 $  @8 @Ő㿘 $$   ̀@@( @㿘 $  @ $ & $㿘 $$   ̀@@   $ ;& $㿐!>! K* '$! * ! K  * !   K* !`*`@!`@*`!`@ *` a>!*@o'1>/>>!`  `[> "a!  `Q &!>! |@ @  @-   ?$ 2 @!|̐ @  @& @!| @ |= 8  @ ,`@a  8  @  @  @ ,` $& >>ao>1>/>>!`  _> "a!  _ &!>! |n @  @-   ?$ 2 @!|Z @  @& @!|K @ {ː 8  @ ,`@a  8  @  @  @ ,` $& >>ao1>/>>!$`  _w> "a!  _m &!>! { @  @-   ?$ 2 @!{ @  @& @!{ِ @ {Y 8  @ ,`@a  8  @  @  @ ,`@ $&@ >􀢀 >>a K>a>"a K>a>"a K>"!㿐H /`4'* !'>!1>`(;>! K  * !&`*` K !'a`*`  K>!"`@e*`!`a@`*`!>`@Z*`>!a`a` +>9> a$^ %a  ^ %a{=@    ,  ?$ 2 a{( @  & a{ @ !z !8  @ @ߔ!  8  @  @  @ + @ p k"!* * ` d ` a^B %a  ^9 %azʐ@    ,  ?$ 2 az @  & az @ !z& !8  @ @l!  8  @  @  @ +   &@"  a] %a  ] %azf    ,  ?$ 2 azQ @  & azB @ !y !8  @ a@!  8  @  @  @ a,`  &`"  a]{ %a  ]r %az  ,  ?$ 2 ay @  &ayߐ @ !y_ !8  @ >@!  8  @  @  @ >!,`@ &`#@ > >"; '":XH 􁊀㿐>!耢`>! `!! X p +>3>!$ ( @''\ %a  \ %ayy@    ,  ?$ 2 ayd @  & ayU @ axՐ a8  @ @a  8  @  @  @ H4(*   ` @2@"@ ! &\t %a  \k %ax    ,  ?$ 2 ax @  & axؐ @ axX a8  @ >@a  8  @  @  @ >!,`@ 2  "@ ` `2` "` !\ %a  [ %ax  ,  ?$ 2 axv @  &axg @ aw a8  @ >@-a  8  @  @  @ >!,`@ 2  "@ `"  `2` "`  &  @ & `"`&!"@"!2 !`"`&!"@"!2!  `"`&!"@":!2 $ {]& $ސ! "!@&!! "!@&!! "!@&!! "!x@&!!x "!|@&!x!| " @&!x `" ` ""`  ``""` K> b?"bH p@㿘  K#!@!&!!&!&!!&!&!!&!> `>`!`;`?> >b&!p (>b @>c$ X>cT pߔ㿘>>!at@ .`2 @` `@*@ uniqueinvalidhalfivpfstunnelingnoreplayrandom paddingskipcryptousedtunnel (0@8@P `@pπSPI = %08x, Destination = %s, Sproto = %u Established %d seconds ago Source = %s, Proxy = %s MTU: %d, expires in %llu seconds Local credential type %d Remote credential type %d Local auth type %d Remote auth type %d Flags (%08x) = <none> %s,> Crypto ID: %llu xform = <%s> Encryption = <%s> Authentication = <%s> Next SA: SPI = %08x, Destination = %s, Sproto = %u Previous SA: SPI = %08x, Destination = %s, Sproto = %u %llu bytes processed by this SA Last used %llu seconds ago Last marked/unmarked %llu seconds ago Expirations: Hard expiration(1) in %llu seconds Soft expiration(1) in %llu seconds Hard expiration after %llu bytes Soft expiration after %llu bytes Hard expiration after %u flows Soft expiration after %u flows Hard expiration(2) in %llu seconds Hard expiration in %llu seconds after first use Soft expiration(2) in %llu seconds Soft expiration in %llu seconds after first use (none) 0>c Hs !>#''' ''''@ǐ E> ` `@ 8>b 8`$#>(@,`(0'4'8'<''''@  A`@#>D@H`8'L;>'P'T'X'''@!>@ H᐀ ``: ᘀ 2xᜀ (x`>``Pᘕ:  `  @ޘx " |>@Ԓ`x| " >@ʒ`ሀ " >@`ጀ >@䷒`а>$`䱐@$xQ >@䩒a->7> 9>  ->7>9>)> $@@䔒! `` 2?>@䇒a䂐@``@>ya0 "  >@oa@ "  >@eaX!>@' !x''''' @' aF !>@' !''''' @'  a'਒"@䀒@"`>`b:  @b 쀒@"``>`b8:  @b "`@$``>bp`@C: @ @c $  `>b`@C: @ @۔c $ @>Ғb$!@>ɒb$ @>c$"@>㷒c8$ $̀@>`>Ȓc``@C: @ @c ؐ@c$$"$̀@>`>Ȓc`@C: @ @c А@c$'@>w` @s`HHashmask: %d, policy entries: %d 㿘`"U !> "8@ &@>a`>a >#a`>!PP`?>!耢>8  ޒ"8H p@-! (  >H / * ! +  `p 2"p2pH 0  ߰     @?    >  >   >$@   `  -`` "!`` "`"`ᤐ`"` "`  `` "!`` "`"`ᬐ`"` "ᬁ%d.%d.%d.%d㿐#>b`'"@ (  !> "8* >c$bb*` . (unknown address family)㿐 ``  1> '@\ # " "  `?2  2   2      ipsp_reffree: illegal reference count %d for object %p (len = %d, malloctype = %d) 㿘 `4  >V    ? & : 㿘H o *@ a       $ # $> :; H 0㿘H o *@ a       $*@# $> :; H 08   )   ))20T3ː 0  .Ȗت  * @Ȑ` . ( @i )?ت @3!   $6  `@C $` .  , , , $ $ $ $ $@ )` (.@6? .x@ H /``* !`   //'`Ȑ ̒ //'''' 2 2 $H 00   " H 00n 2 H 0"@ .`@W  `  ` K `6   $5  =`@ $3` -,  -, `  , , $ `2$@  , , $ $ $ $ $@ 3  -̖ * @@㿘@@2  V ` @U   >!P\`  &    ?&@4 4@0 @,   ,` 0`, `6 /& 4`,`  -x   -s   -n  ////`'` ' `  24` @ k -V  -Q 0?>4` 4`,`  -F   -A   -< , ///`'` '`'`'`'`'` '`$' `(  24`* @ . - . - 004`,20#\&#`5  A`"8`  8 ?"8 A$  `?"8 2  A`>"@*` € A }  "   a ?0 >   bp >  "  bp @W  2 a  a  " h  d 2  l 2   p 2  t "   $   ` "`"  "@$ ` "  ?2 2&@ | 2 &'> WX  X2A  (< @27  | @ 2-  "   !`"$  "  "   !`" | "  9 !x`" n / `"  "` "a  "$   < X -X &>   :`<  |H $ $ ! $ !" "a&#\#` "   & |  `@z  ߐ?ǒ |Œ"M  ǀ |a$@[a$ 2@ a@2;  "  a`"3  ".  "  a`"&  ! " $  ` "`"  "@$ $ a $ a"@'a&#\#`"> @2  $ |@ $ ":  `"  "` "a  "  < $ >!X @ #!X  >   :`<  |@  $ $ ! $ !" "a "$   . ;&  5& 0?ꀤ |  `@ "&?ꀢ 2 |  `@ #\#`&@" & ꌝ㿘      0 9  "   ` "`"  "@ !>@3  Ȁ`"  "`>"!h  "@ " n " h " b > \ > !k!P?$!P㿘#  `"  "`>"!p  "@  >  ` "`"  "@> #E㿘 " @@  2@ ipsec acquireh >~  #>   m" >#h`xc#\#`#d   @ c c @Ԓ kO  >c8 0 , , !, P, Q   "b4 "*c4 "4 R , $ 4, T 8 "   | ' ' ' ' ' '' " ?$ ($ ( 8$ X < "   | ' ' ' ' ' 'g' "  ?$ ,$ , <$ \ />, 0 @->, ` +>   ٦  4 2 B4 b 4 4 D4 d4 R , $ 4, T 8 2  < 2   @ 2  D "&  2 | 2  |  2 |  " | ' ' ' ' ' '' " />$ ( ->$ ,+>$ 0 $ 4    g X*? 6* H/>$ ( ->$ , +>$ 0  $ 4 8 $ X < $ \ @$ ` D$ d H 2  L 2   P 2  T "&  2 |  2  | 2 | $ " | ' ' ' ' ' '' "  $ 8 w$ <  h$ @$$ D* 6* ($ 8 $ < $ @ $$ D H$ h L$ l P$ p T$ t (, H X, x X X *4 J Z4 z ,4 L \4 |Ē Xl+$ al$ "@"$  $  "@& $ @ݘ` >l"  22 vmmapbsyvm_map_lock: failed to get lock㿘>"`` , 2 > ia` ! "` &P0!@@! 㿐>"'H'L'P'T`'X  ,  H> i `&2" 0H@ 㾐> ia "a   (i  2    (0 &0 ) ,a2 `  /` @2 /( (; 2   " (    (ג a` "`2   "    @I  2`/@I* $* @$  "> 4 23 >"`-> !Ѐ`"* ` ""`  ` 2 ` @z"  ` 2  `@u  "ma  䀤``2`  a" :  B; > i!x > "H (   '( ''' H /f * '   @ `%H% a  " H p@0-&   2" % > ࠠ  ,@ % % "ࠒO, > >  *`  j  0 a$`%"$0 i H 0㿈  'Sa 2 `/`"a0]a%  > ia( a 2  > i,`$",& ``' 8# `  $"    ܐ"   "    & &  %   <     & < @* @ *@@ $@ >4` 4` ,`a($` a $`4`  &ٖ  ,` &Ӗ`` 4`ǐ  &ǖ )2 /,` 4` /@H6,` 2a%a 2 a%a 2a%a > ia% > ia, 2 a0 2 a4 2 a8 2  > i,`$E",&ܰ 7??  ? ? 22 ? ? ? ? 2 2 ``' 8# `  $" ' (  ܐ" '  " '  ؐ (& &  ($I        (& 2  > ia` 7 "`&>$@ @  `,@ 4` ,`a$`a$`a$` a$`$a,$`a0$` a4$`a8$`   )& ,`#&Q / ( % )2 /,` @Gm/@* @ $@#> i&a`( 7 3"`(> i!``#`&a  `` `?쒂B>` `?쒂B;`a 2 `` `?ؒB>` ! ?ؒB;   "   ipe4_input(): should never be called 㿘>c#P #K㿘`    *>"vmmapbsyvm_map_lock: failed to get lock8> !>"'L`'P'T'X" 'H  , 2   `#" 0 !`#$!0 %I ` ! ` 0 ! %ڒ  ؔ! `""0̐ؤ@ @   2``` 0$    ///%/  %   ///$/  $"! $!%A !  @ :C  8 $ڔ   06 ` >!@m   !"6 % > ! -7> `؀!!`܀ !`4 A  @I !@@  ! ,`!!ٲa!!`"A"02>`.  *  c`& d "dH /e * &  * @^H 0 !`""㿐a%   > a   > a% `@ > `` (  `!"°   HH /f * ' > !֒ H 0`" 4`H /f * ' > p 2H p@ `$ $`4`$@$`$`$`   `2  > `"! 70r#V @4` ,$` $` 0$` `$$`  &  ?6 `> @$`$`$@$` a`#```(# ; B;`(a    ;/`<* @ *@@ $`>4   a, , , 4 4 4 a($ a $ `>"  `*`2 *a"a"a" a"$a,"a0" a4"a8" /4/ *& 㿘`    *>ǘ"vmmapbsyvm_map_lock: failed to get lockp 2> g> ``, "`,b0`( "`(  2> g> `Ȑ "`b0 "b0 3>" ` 3 l>"$` l2 >"(`2  ѐ 22> g> `Ȓb0`L "`L -"  2  2> g> `Ȑ "`b0 "b0 3 l` "  ؐ` "'Ԑآ@ /ـ  0 /ؐ  "Ԗ0/ؐ  "͖0  22> g> `Ȓb0` "` .H /` * ! Ԓv 2$H 0 Z 22> g> `Ȓb0` "`u  "H 0 C 2> g> ``4 `"`4b0`0 ["`0 2 H 0 * 22> g> `Ȓb0` "`E  2Ȁ l> h & ̀@2 > $:  >>X :@ؖ @$$ >X :@Ж p`  H 0  H 0 @>   a :`a>``22> g> `Ȓb0`  "`  z " 2 `2> g> `Ȑ "`b0 "b0k 7    `*`4 @Y4 4 `"'  `*` !ߖaA  aD`쀢 aA   `22> g> ` )2  `*` (!aA aH aL  aP aT aH@B  aA   O`22y> g> w`Ȁz  '"6 ( 2 `2> g> `Ȑ f"`b0 b"b0  2 !r " ) !iaA  aD`쀢 aA    `226> g> 4` )6  (!GaA aH aL  aP aT aH@Δ  aA   ې`22> g> `Ȓb0`L "`L ) a l$  $(  a`2> g> `Ȑ "`b0 "b0t  b a *` `' (`2 7 `2`l` "` $6 `  > h   (6 > h! `''  ,'''Đ ')`302`3`l`20) 0&@ې&@m"@,`l`20 0@@ @B .㿘`    *>" 㿘`    *>Ϙ"$㿘`    *>"(㿐'L'P'T'X'H   3㿘> i!xH /f * '  @> g0 `""H 0֐' 7&  2" "> "` "" GŒ > >  *`  b 0b H 0 㿘 `  @  @ 3㿐'L'P'T'X'H   2㿘> i!xH /f * '  @>  `""H 0l' 7&  2" "> "` "" G[ > >  *`  bN 0b' H 0 㿐'L'P'T'X'H  5 l㿘> i!xH /f * '  @>  `""H 0' 7&  2" "> "` "" G > >  *`  a 0aΐ H 0 㿀 ZX<  R2!'N <@   //'`5 H /* ! ϔ  $  7> H 00##> $ @?2 &H 00$!`   Ȱ  3 *  *  4@@ & > gb0! "b0E $@; !㿐'D 'H|A > !@>> `l"># D 44> H 6  ``B >` ,> 0a'> 8 #> 0`*@D0`B :0* @*`@*` DH>  @`B :D esp6_input: l went zero or negative㿐@`'0 `('  (%>ɰ  3 *  *  4@T@@ & > `Ȱ! "` $@ !㿘eipcomp6_input: l went zero or negative㿐@`'0 `('  (%>ɰ Ȗ 3 *  *  4@ `@ & > c! "cd $@Z !㿘㿐a2 >" `3l>"$` l2`>"(`` 2`$3 A a  ``̀@"> `$:  >`>X`@ :@`ؖ `$$ >X`p :@`Ж 2`a " " (  "װ 7 ` * a 2  0`$@+``% a ``@2|`a a  aa aa "l`a@  "f`   " 7  @  `4`*`@X4` 4`  ' ( "| 7 ?ؐ#@( q  ?4 r ` "    [pW'a  ' "`$   U  2`C 7` 4``$@ &`$``@51`@,(a  "  ( a  @ *  a l2`   "@@ @ @ 㿘>   a :` >` " 0  2``' ?ؐ#@  ?2`> `$ @   $$  a.  ]K a *` `$ $``a  a        %      @  a23?0.``$a`2 ` `$   ?D  a " (0 㿘H /` * !  # )> '>$!       > "> > > > " "(""H"h"` *u ` 8q & ` $ @6!*`2 6!  ">  >[ >W "##  @"& K   & &!d`&!h L6 * T2 &!`\E @Ò $  '''* ''   L 6 * 42 &!\\% @ $ @ * ''''   @V 㿘!\ " !`@ !\ L&!\!` @~ !` L&!`@V   > 㿐`$` `a a    " 2> 4 a> `d"  a *`$@2'   aad@Hah  >   "  Ȕ`"> (`"(7 0 ##`# ; B>` > """ :   8@ B ; 8`$"`$``@8`$``@ @Ȓ U Ű `$!``@ ``@ @Ұ`$ ~&`$   "^  `(a@``@` a@  2 2 @X[ ɐ` 0 0 L2   @X`P 7 p"`P@ 0$ ,$" `"@" """a\"`4*  " "@ޖ 0 $ >͐# $$($$` <$ $ $$ (`a$a Z, -$ " $a" $`$ @ aa '  8* a` '  $ $a`$`* $`@ @W x  `(`$`,H /` * ! ` `>@} L 2 > `` "`    @" =   # > H 0@VҐݰ`` "`  > ``P  "`P`  " 7 `0@ђ  > ``$ "`$  @W: $@!  Hܠ  >  Ȓ`" ȕH 0j2  ]  25"0$@ *! ( L"@  " "@$$ >"   2$ " "@$ $"  Y "$ "@$ Ȗ"@ >   `" H 0 $@2>   `" H U( ` vK lH p@H 00@V㾀``@ a  `''$'`('> h! '' 'ӹ`$@a   " @0`@-$ `  > ` 0  $ 0`$@ 2a ad 2 a a " a ݐ   b$   @?@#@ Ȑ`H ( L"`H` . D"` `# ; B>` `@# ; B;`@`$ !``@8`$``@ @R ߐ `$! ``@8  ``@ @:`$ ~&`$   " 8  !  " 8" 沔    Ȑ`T%ܰ 7"$Mٖ  2 C` 7 "``X `$@ ad'`&ad X`@R 2`$ 7@   ,@  &@r*P  2/u ` 2 @U C4@`$'  " ' ' a%@' `$ @ 4atatݖa X?a 6   @ 8* a &   ' ' a`' `* ' `$ 0 L*    0@U`P 7 4"`P@`aa$,  X   >А" $`$`$`($` $```<@$ "@$ "$@$a\$`* $`$ @@ @TA㿘  H /` * ! ` `u@ L 2 > `` @"`   @" <   # > H 0@T 6`` "`" > ``P  "`P@T $ @! " o!t H 0H 0@Tl 2+   " : (# "   >  22>  (# (  (㿘`t ``   "  *  W P  2   !    *H H /f * ' > ! H 0 2H /f * ' > p 2H p@ """2 a 2&l 0  &  & ` $`  p ">   >>  >8 > "## >#<#X  ` $  &!d& & &!h  L6 * 2 &!\ VА@  $   *'''@P 㿘!\ @ !\Z L&!\@QS   > p``y 0C &> gb0 7 8"b0 ,, 4 `4 4 84 4 @  @``> g ` 6!@ "9` @*  @$ @@`4 `&  @  ٲ@@@ `Ҡ  ?U  >   U@@> g& @ΰ А Ĕ (Ԁ  > g0`p"0 ('/א ؐ ``/ِ " 7ڀ` ِ  `7耢``  `   7 rD ((  ؐ L   > g0`."0z 7 (q آ (  ր_`+K@`<`0JI@  * 6;!> g @2*  *  "0`$"06G L?   `>  UR "0`$"00 L(  * & @ *  L> g0`"0    (q  L 㿐`$!`'D   a ", `$2( D  aadah  > g  "  00 7D`"0> g0  7D`w" 0*`? > g0$ D`h"$0D> g` `""B>``"0 8""@ B ; 8`$ !``@8`$``@ @ ݋D> 0`$!``@ ``@ @`$ ~&`$@Q  D! 7@b0`$#@ #`#` #`a\ #``*#`}   (a@D `@D a@ߔ  D 2 0  0  L]   D 7@QBb0`P E"`P@Œ 0 D  0D  D>  pΖDa ʘ  ' L@Q$D `>$`$`D"h$`$`(`a<@$` $ ($ $` $a , T $ , @ @Pcx   ( $ ,H /` * !  ֔Ӓ L`2 > gb0` "` ```@" =`  # > gH 0@P(b0` "` @P`  > gb0`P  "`P`$@   2ߠ 0 @ > gb0`  {"` , p)  jp ؠ > g"0`""0H d  2      ;4   *# ("    `" "@$`$ "   2$ `" "@$`$" @ @S6   "@$  `"@$`H p@H 0`  "@P㾀` @~'D> h! `a h`D'''''' 6> g"0 ,`$ ,ad 2`$a  `$@ Ds   X$ `$@  a  2DD? c  W ("0`H ;"`HP ."0` 4"` `# D; B>``"0`@# ; B;`@`$ !``@8`$``@ @ oD" 0 `$!D``@8  ``@  @ʐ`$ ~&`$D !  " 8"     `"0 7`D%"00"'D$@ D r  2  D۰ 7"0` "`D  ?2 , 4 `> $ D nĖ`$@ad$  &ad@OD  DD 7 "0 $""`""a\"`* "`$@  00 L    D 7@N"0`P v"`P@}u 0`$ @F 3D ˖`0a  $ 3`2Qݔ  @7D nl `4Q̔  @7D n[  3* 0D/nR Da N    L@N0*/D n>D `>$$D l$$(``<$ $`($`$`a$@a Q,` `$ @@ @M㿘   0 (H /` * !  S L`2 > gb0` >"` ``@" <`  # > gH 0@M4b0` "`  2 `$> gb0`P  "`P @mɒ @N%H p@H 0 @N  p > #& & &!h $@|  @'В@Kl 㿘@K   > 㿘` @N   0 ~3>  L~  (@|^ 0`$" >א" ""$ ,#"  " $`$`($`$`` l<@$` `a$$ ($ $ , P @M  N@M> c`@ 7 "`@㿐   ( $H /` * !  A L`2> c` "` `#  ; B<`> "  : # (@ B ; (`$ ``@8`$ ``@  @ǹF  `$!" ``@8  ``@ @ǡ`$ ~$`$  ``@" <`  # #H 0@L` "` #`@  x"`@@M   @$ i% 2# $#H p@ c   /6   6?2$ @ *! ( $"@   " "@$& "   2& " "@$ &"  Oː  ?& $lY z H 0H 0 =@L㾀` @{ > h! a  ` '''''' ͒> c  $ a   0 ?@#@$ 0?@#@  8 ( $ 8`# ; B>`  0# ; B< 0`$ !``@8`$``@ @Ɩ # א `$! ``@8  ``@ @~`$ ~&`$   " 8 @ !  " 8" 沔  b   `` $u 7"$@    2 ` ` 7 `"` @zh`4 a  " 0   ,  , l` . E"` l/ ka@K  2$ X1 "  0"@"" "@ L"|  @z. 0` $ (a$, aN  >ڐ D &&(&&& `@J>  *@K`@ 7 "`@㿘  `( " H /` * ! ` `@~\ L 2 > c` a"`   @" <   # > H 0@JWc` D"`2  > c`@  ;"`@@6 ! ~' L@K1H 05  "0 2`? 2` > c` . "`@K H 0H 0 @Jcc||ww{{ kkooT`00PggV++}bMvvE@}}YYGG Ag_E#Srr[u=L&&jl66Z~??AOh44\Q4qqsb11S*? RF##e^0(7 / $6=&N''iuu X,,t4.6-nnZZ[RRv;;Ma}R)){>^//qSSh,@ `yȶ[[jjFgr99KJJޘLL԰XXJk*OCCŚMMf33UEEPPx<!KKa pp|>>BqffHHaaj55_WWiX:''8+"3iip3-<" IUUP((xzY  e1BBhhAA)Z--w{˨TTm,:cc||ww{{ kkooTP`00gg}V++bMvvEʝ@ɇ}}YYɎGG Ag_E#Srr[u=jL&&Zl66A~??O\h44Q4qqsSb11?* ReF##^(07 / 6$=&iN''uu tX,,.4-6nnZZ[RRMv;;a}{R))>q^//SSh,`@ y[[jjFgKr99ޔJJԘLLXXJk*OņCCךMMUf33ϊEEPPDx<<%KQQ]@@?!Hp88cwucB!!0 mL 5&/__5̈DD9.WU~~Gz==dd]]+2ss``ўOOfD""~T**; ʌFF)k<(y^^ v;Vd22Nt:: ےII lH$$\\]nCbb917yy2CYn77mmdҜNNIllVV%eezzGoxxoJ%%r\..$8WsQ#|ݜtt!>ݖKKa ppB|>>qffؐHHaa_j55WWiX':'8+3"iipى3-"< IUUxP((zߏY  e1ƄBBhhÂAA)wZ--{TTm:,cc||ww{{ kkooT0P`0gg+}V+b׫MvvEʂ@}}YYGɎG AgԢ_E#Srr[u=&jL&6Zl6?A~?O4\h4Q4qqs1Sb1?* R#eF#^(07 / 6$=&'iN'uu  ,tX,.4-6nnZZ[RR;Mv;aֳ}){R)>/q^/SSh, `@ y[[jjF˾g9Kr9JޔJLԘLXXJk*OCņCMךM3Uf3EϊEPPKݖKa pp>B|>qffHؐHaa5_j5WWiX':'8+3"iipَ3-"< IUU(xP(zߌY  e1BƄBhhAÂA)-wZ-{TTm:,cc||ww{{ kkooT00P`gg++}VbMvvE@}}YYGGɎ Ag_E#Srr[uᓓ=&&jL66Zl??A~O44\hQ4qqs11Sb?* R##eF^(07 / 6$=&''iNuu ,,tX.4-6nnZZ[RR;;Mva})){R>//q^SSh, `@㱱y[[jjFg99KrJJޔLLԘXXJk*ŪOCCņMMך33UfEEϊPP<KKݖa pp>>B|qffHHؐaa55_jWWiX':'8똘+3"iip3-"< IUU((xPzY e1BBƄhhAAÂ)--wZ{TTm:,cccc||||wwww{{{{kkkkoooo0000gggg++++׫vvvvʂ}}}}YYYYGGGG𭭭Ԣrrrr&&&&6666????4444qqqq1111####''''uuuu ,,,,nnnnZZZZRRRR;;;;ֳ))))////SSSS [[[[jjjj˾9999JJJJLLLLXXXX着CCCCMMMM3333EEEEPPPP<<<>>>ffffHHHHaaaa5555WWWWiiiiَUUUU((((ߌ BBBBhhhhAAAA----TTTTQP~AeS:'^;kEXK 0UvmvL%O*&5DbޱZI%gE]/uLFk_mzRYԾ-Xt!Ii)Du‰jyxX>k'qݾO f}:cJ1Q3`bSEdwk+pHhXElR{s#rKWfU*(/{70(#j\+yNie4bĦ4.SU2u 9@`^qnQ>!=>MFTq]o`P$ֽ闉@CgٞwB[8yۡ| G|B 2+HplZrN8V=6-9' dh\![T$6.: gWOa ZwKi⓺ *<"C ǭ-WuLݻ`&\rDf;[~4C)v#ܶhc1Bc"@ J$}һ=2)m/Kܲ0 Rw+lpHGd"Ġ?V},"3IN8ʢ 6ϥz(ڷ&?,:Px j_̛T~Fbظ.9^ï]iГ|o-%Ȭ;}cn;{&x nY욷One~!Jo6 )|1*?#1ƥ05ftN7ʦа3JAP/vM֍CM̪MTߞѵLj,FeQ^5]ts A.gZRV3mGa7 zY<Ω'a5zG8$4,£@_r% ('qOf }:cJ1`Q3EbSdwk+XpHhElR{#srKW*fU(/š{70(#j\+yNie4bĦ4.SU2u9 @`^qQn>!=>FM潵Tq]o`P$ֽ̉@CwgٞB8[yG| |B H2+pNlZrV8='6-9d !h\ћ[T:$6. gWҴOŢa iZwK ⓺*C<"  ǹ-WLu`&\rDf;4[~vC)#hc1Bc@" }J$һ=2m)K/ܲ0 Rwl+pH"GdĨ?V},"3LJIN8ʢ6 Ϧ(z&ڷ?,: Pxj_bT~Fظ^.9ï]|iГo-%;Ȭ}nc{; &xnY욷Oen~!ٺJo6 )|11*?#0ƥ5f7tNʰ3JAP/vMMCT̪MѵLj,FeQ^]5st. AZgR3VmGaz7 Y<Ω'5ah,8$4_£@r %(kXq'Of :}Jc13`QEbSwdk+hXpHElR{#srKW*fU(/{70(#j\+ϴyNieھb4ĦS4.U2u9 @`^qQn>!=>FM捵T]qo`P$ֽC̉@wgB苈[8y G||B H2+prNlZ8V=9'6-d !h\Tћ[.:$6g WҴO aKiZw *C<"  ǭ򋨹-WLuݻ`&\r;Df~4[)vC#hc1Bc"@ $}J=һ2m)/K0ܲR wl+pHd"GĨ?,V}"3NLJI8 6ԁϦ(z&ڷ?,: Px̛j_FbT~^.9À]|i-o%;Ȭ}cn蜻{;x &nY욚One~!ٺ6Jo |)1#1*?0ƥf57tNʦа3JAP/֍vMMCMT̪䖵шLj,QFe^5]tsA. ZgRV3Gma z7Y<'Ω5ah4,8$@_£r% I(kq'O f:}Jc1Q3`SEbdwk+HhXpEl{Rs#KrWU*f(/{7(0#j\+yiNe4bѦ.S4U2u9 `@q^nQ!>=>FMT]qoP`$@C̉ٞwgB[8y| GB| +H2pZrNl8V=-9'6d \!h[Tћ6.:$ g WҴO awKiZ *"C< ǭ򶨹-WuLݻ`&r\f;D~4[C)v#hc1cB"@ J$}=2)mǞ/K0܆R wl+pHd"GĨ?},V3"INLJ8ʢ 6Ϧz(&ڭ?:,x P_̛j~FbTظ9^.ï]Г|i-o%Ϭ;}cn;{&x YnOne~!ٺo6J |)1?#1*0Ƣf5N7tʦа3JAP/M֍vMCMT̖ѵjL,eQF^5]ts A.gZRV3Gma z7Y<'a5G$4,8@_r% >>>KKKKyyyy xxxxZZZZݨ33331111YYYY''''____````QQQQJJJJ ----zzzzɜ;;;;MMMM****뻻<<<޺?>??` * `(` (@ @. @1 @( @@  ``@  ` ` `  ` ق```(`(`.  ```(`(`. 9 `>޺?>??`* `(`(@ @. @1 @ (@@  ``@`   ` ` `  `$t ` `, `(ӂ```(`(`.  ```(`(`. T `>ޞ?>??`* `(`( .1 @.   @ ``@`   ` `$ `(  `,% 1 (1 1 `  .  @ ``@` `< `0 `4 `8`  㿐 ې' ( (@ ?"@"` "`"`"`"`  "` " ` >ނb?`@?`2  c@ 2`(`2`@@2, @2 @2  @2` c` 2@2  @*3  `@ - *`@3 @ c3 *@ @ `>ߒb + +`@ @ -@ @>>ߖ∯-(b@ (,  * @ !>>ߠ",,  `+,` >@ -  `>b . .`.@@>@∐. `!>-`"@'@@  '`'`y'` 㿐'D/`*@ + /    *` +(  . (D* **@  @  @D@ 1  ` 5>ۆ∴5>'/`5 0`0`0`` #,` 1 >ۑ5 5  .  "#>*  cb@ %>  51 >܄ # >ݔ/`+  >ݑ*  >ݛ+`" D```   `5`1>ۂ"5`%>ڤ/ 0`4 9>ۅ(c"5+  5;>ۖ b@ 0`>ۚ c" 4 4 >ܚb+ #@5 c@ 0`%>ܔ  5`>ܢ cb@ >ݔ/ `/`  `>ݟ+∆ D  >`$, `(" `, 51>ۂ"5%>ڤ` /  5 1 9>۟5 5  (c"0`+  0`;>ۖ b@ 1 >ۚ c" +>ܚb #@0` c@ 1 %>ܔ  5>ܢ cb@`>ݔ/  /`  >ݟ+ ∆ D>, "`4`8 `< 5`1>۬"5`%>ڤ`0/  0`4 9>ۅ(c"5+  5;>ۖ b@ 0`>ۚ c" 4 4 >ܚb+ #@5 c@ 0`%>ܔ  5`>ܢ cb@ >ݔ/ `/`  `>ݟ+∆ D  >`D, `H" `L 51>ۂ"5%>ڤ`@/  5 1 9>۟5 5  (c"0`+  0`;>ۖ b@ 1 >ۚ c" +>ܚb #@0` c@ 1 %>ܔ  5>ܢ cb@`>ݔ/  /`  >ݟ+ ∆ D>, "`T`X `\ 5`1>۬"5`%>ڤ`P/  0`4 9>ۅ(c"5+  5;>ۖ b@ 0`>ۚ c" 4 4 >ܚb+ #@5 c@ 0`%>ܔ  5`>ܢ cb@ >ݔ/ `/`  `>ݟ+∆ D  >`d, `h" `l 51>ۂ"5%>ڤ``/  5 1 9>۟5 5  (c"0`+  0`;>ۖ b@ 1 >ۚ c" +>ܚb #@0` c@ 1 %>ܔ  5>ܢ cb@`>ݔ/  /`  >ݟ+ ∆ D>, "`t`x `| 5`1>۬"5`%>ڤ`p/  0`4 9>ۅ(c"5+  5;>ۖ b@ 0`>ۚ c" 4 4 >ܚb+ #@5 c@ 0`%>ܔ  5`>ܢ cb@ >ݔ/ `/`  `>ݟ+∆ D  >`, `" ` 51>ۂ"5%>ڤ`/  5 1 9>۸"(c5 +'0` 5   1 >ۢ c0`, #>ܐ #b@0`%>ܒ c 1 >ܐ"  5 c` >ݔ/   /`+  >+  D      'H ` e'P5`5`#>%>ۢb.4 @/ 0`4 @5>ۅ(5@9>ڕ*" 57>ے c 0`>ۖ  4 >ܖ∺c5 0`5`>ܘ ∐ # c  #>ݢb.@` `.@/ D+ @ @ @@ @ @1 1> ("5>ۄ5>ڵ.5 >ڹ/ 0`5  c1  9>ۚ c" 0`7>ڙ+  5 >ܚbc@0` @51 >ܞ∐ # ` #>ݢb. / @ D.@@  *@@ @  @ H@ 0`%>ڵ.0`5`#>ۢb@5`@5>ڹ/ 4 5>7>ے c(" 4 9>ڕ*" 5>ۻ4  b@ 5`>ܔc c5 >ܞ 0` >>ݞ∐ #.b@`.+  `#>D/  b@@ Ȅ ̲@@ @0`1>ą("1 >ۄ1 >ڵ.5>ڹ/ b@55 c5 %>ڗ* 0`;>ۘ #b@ 5%>ܤ 5  #0` c 1    >ݖ∵. `/ . @/`@ D   І Ԅ ز@  ܂@7>ޱ5`∰#4 0`H(?D?+`?c @ (@ 5`@('D @`@(5P1 4 ,@1 4 ,`1 (,`,`  D@  `(0`55,` 5@ 5,`5@@ (,`,`@0` @ @(5`#5 ,`5 ,`   5 ,` ,`   `0`,` 0`,` 0`,`,`㿐'D/`*@ + /    *` +(  . (D* **@  @  @D@ 5  ` 1 0`>∞ #1 > ,`55 >5  .  "550`#>'/`*  cb@ 1 %>  0`> # `>/`+  >*  >+`" D``  `` 1 1>"5%>ߤ/ 4 4 9>(c"1 +  5;> b@ 5> c" 55>b+ #@1  c@ 4 %>  5> cb@ >/  /`  >+   >D, "`$`( `, 1 1>"0`%>ߤ` /  5 5 9>5  (c"1 +  0`;> b@ 5> c" 55>b+ #@1  c@ %>  0`> cb@`>/  /`  >+  >D, "`4`8 `< 1 1>"5%>ߤ`0/  4 4 9>(c"1 +  5;> b@ 5> c" 55>b+ #@1  c@ 4 %>  5> cb@ >/  /`  >+   >D, "`D`H `L 1 1>"0`%>ߤ`@/  5 5 9>5  (c"1 +  0`;> b@ 5> c" 55>b+ #@1  c@ %>  0`> cb@`>/  /`  >+  >D, "`T`X `\ 1 1>"5%>ߤ`P/  4 4 9>(c"1 +  5;> b@ 5> c" 55>b+ #@1  c@ 4 %>  5> cb@ >/  /`  >+   >D, "`d`h `l 1 1>"0`%>ߤ``/  5 5 9>5  (c"1 +  0`;> b@ 5> c" 55>b+ #@1  c@ %>  0`> cb@`>/  /`  >+  >D, "`t`x `| 1 1>"5%>ߤ`p/  4 4 9>(c"1 +  5;> b@ 5> c" 55>b+ #@1  c@ 4 %>  5> cb@ >/  /`  >+   >D, "`` ` 1 1>"0`%>ߤ/ `5 +0`9>"5 5  5   5>( c1 , 5#> #b@1 %>c c0` >" c ` >b/ @ /`@ >+ >+  D      'H ` e1 5#>%>b.5@/ 4 4 @5>(1 @9>ߕ*" 57> c 5>  5>∺c1  4 5> ∐ # c  #>b.@ .@/ D+ @ @ @@ @ @5 1> ("1 >0`>ߵ.5>߹/ 5 0` c5 9> c" 1 7>ߙ+  5>bc@1  @0`5 >∐ # ` #>b . / @.D@ @ *@@ @  @ H@ 4 %>ߵ.51 #>b@5@5>߹/ 1 4 >7> c(" 59>ߕ*" 5>4  b@ 55>c c1  >  >>∐ #.b@ .+  #>D/  b@@ Ȅ ̲@@ @1 1>ą("5>5 >ߵ.0`>߹/ b@1 5 c5%>ߗ* 0`;> #b@ 0`%> 5 #1  c 5    >∸ ./ ` .@/`@ D   І Ԅ ز@  ܠ@1 7>∰#54 H(?D?+`?c @ (@ 5@('D @ @(1 5 4 -@5 5-`5 (-`-`  D@  `(54 0`-` 0`1 @ -`0`@@ (-`-`5@` @5 @#( 55-`-` 5-`  -`  ` `1 -` 1 -` 1 -`-`㿘 &  & @bd 0   & 7l 㿘  㿘 F H;j&. 0㉘ `va  " : "" " " 㿘 .3`+  `?@ @C ">   `@7+ @e  @` @ @@@& 7@㿐'D`2*@`*2*2222 ///////*2@ `? @" /@>b0 D "   . . 2 .  .   ?`X?@?`?`?`?` ?`(?`0?`8?`@?`H?`PH?'D?;?   (. 6`0&D @0( 1 )  0(5`-` @ 0(5- @Ć0( 5- Ȅ@ 0(0`(` @̆0(1 ) Є0(5`-` Ԇ@0( 5- @؄ 0( 5- ܆@0( 0`(` @0(1 ) 0(5`-` @0(5- @0(5- @ 0( 0`(` @0(1 )  )3a6 . 5`-`  -@@ 0(5- @-0(5-  -@ 0( 0`(`  @(@0( 1 )  )Є0( 5`-`  -@@0(5- @-0(5-  -@0(0`(`  @(@0( 1 )  )0(5`-`  -@@0( 5- @- 0( 5-  -@ 0(0`(`  @(@0( 1 )  8 0( 5`-` @3zc6 . 5- 0@0( 5- 1@ 0(0`(` 5@ 0(1 ) 50(5`-` 5@0( 5- 0@ 0( 5- 1@ 0(0`(` 5@ 0(1 ) 50(5`-` 5@0( 5- 0@Є0(5- 1@0(0`(` 5@0( 1 ) 50(5`-` 5@0(5- @-3# `܆0( 5-  (@@0( 0`(`  @)0(1 )  -@0(5`-`  -@0(5- @- 0(5-  (@@0( 0`(`  @) 0(1 )  -@0( 5`-`  -@0(5- @-0(5-  (@@0(0`(`  @) 0(1 )  -@0(5`-`  -І@0(5- @- #܄0( 5- 0@@3*T aN0( 0`(` 1@ 0(1 ) 5@0(5`-` 5܄@0( 5- 5@Ԇ0(5- 0@@6 . 0`(` 1@0( 1 ) 5@0( 5`-` 5@ 0(5- 5@ 0( 5- 0@Ą@ 0( 0`(` 1@؆ 0(1 ) 5@ 0( 5`-` 5І@0(5- 5@0(5- 0@@6.0`(` 'D'''    1@3(c0(1 ) 5@ 0( 5`-` 5@0( 5- 5@ 0( 5- 0@@0( 0`(` 1@0(1 ) 5@ 0(5`-` 5Ȅ@0(5- 5@0(5- 0@@0(0`(` 1@0(1 ) 5@ 0( 5`-` 5@0(5- 5@0(5- 0@@ 0( 0`(` 1@0(1 )  -@3ta$0( 5`-`  -@ 0( 5- @- 0(5-  (@@0(0`(`  @) 0( 1 )  -@0(5`-`  -@0( 5- @-0( 5-  (@@ 0(0`(`  @)0(1 )  -@ 0( 5`-`  -@0(5- @-Ȇ0(5-  (@@0(0`(`  @)0( 1 )  -@0( 5`-` 5@3\b0( 5- 0@0(5- 1@0(0`(` 5@ 0( 1 ) 50(5`-` 5@ 0(5- 0@0(5- 1@0(0`(` 5@ 0( 1 ) 5 0( 5`-` 5@0(5- 0@0(5- 1@3\ b0( 0`(` 5@ 0( 1 ) 5Ȇ0(5`-` 5@ 0(5- @-ذ3]b6 . 5-  -І@0(0`(`  @(@0(1 )  )0( 5`-`  -@Ą@0(5- @- 0(5-  -@6 . 0`(`  @(@ 0(1 )  ) 0(5`-`  -@@0( 5- @- 0( 5-  -@ 0( 0`(`  @(@܆0( 1 )  )԰6 . 5`-`  -@@ 0(5- @-0(5- @0(0`(` @0(1 )  0( 5`-` @0( 5- @0( 5- @ 0(0`(` @0(1 ) 0(5`-` @0(5- @ 0( 5- @ 0(0`(` @0(1 )  0(5`-` Ć@0( 5- @0( 5- @0( 0`(` D    D@@D&&&& &> b. @ >    "/`7`!@  @@  > 7 / b` 1 @)    > 7`/`@ @6. @1 )   @ @ >   5-  6.@  %> 7  / @ @5- @ @ 7`/`  7 / @  1 @ ) @ @7`/` @  @6 .  1 ) @  ' 5 -@ @6. @  $7  /   5-@  @(7` /`@ @7 /  @ ' ,1 @)   7`/`@  @06 .@ @@  41 )  '||5-   6.@  87  / @ @5- 'x@ '> @ |<7` /`@@ 7 /     5 x't1 @) -  @ @ 7`/`  @4t6 .,  @ @1 ) @ @@  4`5-,`@ @ @ 6.  07  / (  @ @@5-@  47`/` , |z#@ @ @@@ @7 /   3`@1 x) +`@  @ @ @7`/`  06.(  @ @@t1 )  3 + 5- @ @@@ 6.  4 7 / ,   @ @@@@5-@  5`7`/`-`@  @ @@7 /   5@1 ) -  @ @@|7`/`  6`.`@ @'6.@ x  @@@ @1 )   6`5-.`@  @ @@6. t | 67 /  . @ @@5- x@ 0`7`/`(`@  @ @ @7 / ' @t  0`@(`@ 1 ) @' @  @7`/`  5 -  @'ؒ@ 6.  @1 )   5 5--   @ @@@6.  47 / ,  ؒ@  @@@ @5-@  0`7`/`(`@  @ @@7 /   0@1 ) (  @'А @ @7`/`   3`6.+`  @ @@ @1 )   05-'̒ ( В@ @ @6.  7 / @@ @@ 4`̐أ,`@  5-  @47` @/`,#`ܤ @  @7 /  @  @0@1  ) ( @ @ @ 7`/`  3 6 @.+ @   @1 )  @ 4 5-,  @6. Д  @   5` -`@ 7 /  '̔ 5-@   @5`7`/`-`@ 7 /  @ؒ@  @@ @@ 'Đ   ȗ5`1 ) -`   7`/`@@  @6`6..`@  Ē @1 )  @ @ؖ @@  5`5' --`  @ @ 6.  67 / .  5-'p @В@ @  @@4@  , 7`/` '@  7 /  ̬@   @5@1  @) - @   Ȓ@7`/` @ А @ @  5`6ē.-`@ @ ̒@ @ 1 )   5 5--   @ @ 6.  @@ 07 / (@  @  5- @@ 0 ( @p @7`/`@   @7 /  @@0 @ ( 1 )  '@  @ 7`/` ' @ @ @@@ 0`6ȑ.(`@ @   @1 )  @ 05 -(  @ @  Ą6.  07 / (  @  @ @@@@ @5-@  3`7`/`+`'2֚@  @Ē@ @7 /   3 @1 ) +   @@ @p7`/`   4 ,  6.@' @ @@1 )   35-+  @@ @6. ' p7 /  3+ @@'@@ @6`5-.`@ @  7`/` @@@7 /   6@1 ) .  @@@7`/`  36.+  @@ @ @'l1 )   55--  @ @@@@6.  5`7 / -`@  l@@ @5-@  7`/` 5  -  @@@47 / ,   @1 )  @@ @@@@7`/`  4`6.,`@ ' @@@1 )   4 5-,   @@@ 6.  37 l/ +  @@@@ 5-@  07`/`(  @@@ 07 /   ( @1 )  @@@@ @ 7`/`  3`6.+`@  @@ @1 )   3 5-+   @@ @6. > p b> b"@"`"`l "` "`"`"`"`"` "`$"`(27 */   > b `,5- `< `0 `4 `8 @  @   @& && & & H;j&. 0㉒`v"" " " " " " 㿘 . &  6  & 2 ?`? @"  (1  ? @ ? @   &(@㿐`      #* 2@, >b ` !! #>b ` !!     @# *`2 .  㿘&0@@33#3. $(``@7`7`#7`.`$(`33#3. $(` @7`7`#7`.`$(`33#3. $(`@7`7`#7`.`$(`33#3. $(`@7`7`#7`.`$(` 33#3. $(`$@7`7`#7`.`$(`(33#3. $(`,@7`7`#7`.`$(`033#3. $(`4@7`7`#7`.`$(`833#3. $(`<@7`7`7`.`#((`D`@@&@&`㿘&0`D@33#3. $(`@`@7`7`#7`.`$(`<33#3. $(`8@7`7`#7`.`$(`433#3. $(`0@7`7`#7`.`$(`,33#3. $(`(@7`7`#7`.`$(`$33#3. $(` @7`7`#7`.`$(`33#3. $(`@7`7`#7`.`$(`33#3. $(`@7`7`#7`.`$(` 33#3. $(`@7`7`7`.`#((@`@&@&`1 ߵ/r߷j&~|E,$Glⅎci qWNiX=~ trXqXJ{TZY09*`Ѱ#(`Ay8yܰ`:l>w1K'x/U`\`U%UWHbc@U9j*\4AΡT|r铳co*+]t1\>ֺ3l$\z2S(w;HkKĿf(!a !H|`]2]]u&#e#>ӖmoB9. D iJ^!hBlg aӈjQT/h(Q3n lz;;P~*e9vfY>CEo};^ou؅ s@DVjNӪb6?wrB=7$ HISrɀ{%yPyL;lO@`^\j$cho>lS9;RomQ0,́ED^ 3Jf(.K˨WEt _9Uy`2 ֡@,ryg%̎2"߂\WoV.iB(~ìg2ƌOUsi['X]=!Jl-[SyEeҎIKڤ~3bA 6wL~+MꭎqkՠЎЯ%<[/u+d O^h񑳨//"wu-otΉ♴O|;ҭ_fws!w ewTB5ͯ {>AӮ~I%- q^"hW$d6 UcYߦxCZS }[Ń&vbϩhNsJAG-{JQRS)W?+`vtoWk* ce!4.ŅVdS-]GnjKzp鵳)Du .&#nI}`f쪌qiVdRl±6u L)Y@:>?T[Bek֙?֡Ҝ0M-8%]L p&c^ hk?><kjph5R↷SP7>ޮ\}DW:7P  uA8͙;/2>1NT8OmoB  ,$|yVyrޚwٓ?.Ur.kq$P柄͇zXGtK}z:ۅc CfdG2C;7$ºMC*eQP:q1NUw_5Vףk<;Y$ ,*wN=)eܹ>Rf%.LxjxEⶣlOOBBjeO;A!yMKGj=bPb[&FǶ$itG V [Hbt#XB* U>#?pa3r𒍓~A_l";|7Yt`@w2nPUaٗ5i Z ܞDz.E4gsUg_ygC@4eq>8=(m >!珰=J+ۃ=Zh@L&i)4A vk.Ԣh$q3 jCԷPa9.$EF!Ot@Mpf/E m1˅'U9A%G (Px%S) ,mhbHih'O?臭zֶ|7_x@k*B 59׫;NKmV&f1㗲:nt[C2hAx NE@VH'US:: kЖKUgX̩)c3*JV?1%^~)1|'/p\(,Hm"H?A@Gy]n2_Q՛A5d%{x4`*`cl2fOсk#3>;$ b" r -(xEd}bTIo}HÝ'> GcA.t:on7`Lnk {Umg,7'e;) 9i f{} ^/Q[${yv;79.Yy&.1-hBj+;uLx.jB7QKcPk=%DBY  nի*dgNچ_dW`x{``MF8wE6̃Bk3qA<^_wW$UFBX.aNXt8SfȳtuUFٹz&a߄jy_FnY WpUL ỂbHut f- 2F3Z J%n= ߡ(hiܷڃW9ΛORP^ ''w?A`Laz(`X0}b#8cSݔ4V}Yvo K|9r =||$r_rM[ӞTUx=|MP^alQZ4ח,+Qլ:}}>|}-(%ϭZִrZL)qGč(;Wf)y.(x_u`UD^mԈma%d{Q!dwO2~)=FHSid怢m$i- !fF dEXl Ȯ[X@kݢj~:YE>5 DrΨdf~of,"#W2v#51VbZun6sޖbILPqVǽ2z E{ɪSb%5qi"|v+S>@8`%G8 Fvw u``NzL~H\ji\ޠ? %-柷Na2w[W:r$?j.psD 8")1.NlE(!8wTf4 l)|P?յG ىyP?##`H>a! *`2`  *0 : *0@`( ` 2㿈.7 6ݐ, 2 @ + @2$@  7'' , 2`*`$@ `**`2 $@   , 2   Ւ.`2  `* *`+`&@2&  , 2  , 㿈/ 7 7 , 2 @ + @2$@  .67'' v'o', 2`*`& `**`2 &  6 ,  2  O'H'e, 2   * *`+`&@2&  / 2  נ㿘.;6㿘.6  : *`2 `  㿘.6   *`2 `  㿐 .``(`*`@*`*`@ `+ `+` @ @ ? 000000.@.`.`.`.`.`.`.` ֲ`㿐 .``(`*`@*`*`@ `+ `+` @ @ ?+ 000000.@.`.`.`.`.`.`.` ֲ`㿐 :   @  . ( *(*`*@ + +` @ @ ?0.00000....... ʴ㿐:  * ( *` * @ +  +` @ @ ?000000? ,, , , , , , ,   ,( ʠ  * ( *` * @ +  +` @ @ ?~ 000000,, , , , , , ,  @ ,( 0@ԟ k/?%z!?/M`@ϟIԯ'@Жuncaf"(h;oY#yw_PC@/V|ҽ-4lHam"T/*2Tk"V:Af@ȧ9/M/-ޗ?JRvD7,QYoZ z{hА."TY5Km/PdfI-3";K4]E@1?.Ueձʭ-Էm P"@ nO8O[rVL/ŜSITFiXcE]WSj9=7*T:x}_bvzB j)r'^Pg8Ƶˌ*ZJ'ѓk*҆Vґ׉C`B\u &ql-sJ5&{M 0n٘&fVH%^V c|cp EP(r#Hp -;MyBA &G LGMj| ^\#Y8r۫Sn/#qFVEn9 q+A|ʉiHCyB}B{ZIݏ\e  [i~9?Caz zUrQyNr5Zc60_ }/{Y6 DDY̳A; *{B [%AzzƩX0ދw?Nyi${[P5%a_b1T UKc]h!fY=cs4~\g+!a9b60W;`/d:͜F5-' zyl0%7^oo; jEt'N:4Oi>M5YdE8Cfr%c3N?( 'ᛥզRTUfpdw M&g!CX`T0orSGUb]hVk-n;ۦк=\w 3L9{^+_Soa Cd^xc"g&рI"{^U-%Rr7yҕ LHϢ 0qc/ S!ET(5c)1BƎI# 0(_qȾ`a輨M/".pN40';yaٸHi?(;CZᗘv/܆7ӱÓnƼ>Q7Bh(Re-jw5'K \n.ے^)XXOTi{&g̅`HK8` #l8~ I` 5sܱGLV>#d8^FB kzOdEA^\#>];Cוr~m|llq`9spvE#@%]=G`6KDʐPQHX_0.r| ],*IPڈ'WyoIR}rY}@EE]t>OuVi#A.`' v䶔etyvwvNHam❄/}4 ȖH0b \8D=`nm`T:IW'H+8 $hE%;` E}(/P4b +md+10ZRXAB휤1\2>F63S57 ާ{sJO{dWQC~(zc _5y Cddc$J(_OC@ " 07O-${MQgqL-_d_ !S>^'Ҹ_Bar%΄q=Ko&;~ԄT~DmLl&I߮63P?~w a8rPP.wWOgF3Ti 1M5=\f][̩o꟒oF"/9F}mCOC!N ? (X&Hn>׊ptw|- %y 껁(;#iޭ8t߇b!@7{ @YVOv/@U{ MV3i5W#'ȰVÑke^anu2Uw?[-;%m;$ cf8( 2T2bZg,uzT1w&16o FjHVZyjLRC~/v t,߷t*M . k|AT嶠5!=B,|&aeR1%i &c1\!^ rIyٍ 1p>d >Ӷ È0lrqn/ބkD؋V9ñ/ʴ1x(o}2X~$ŗ{sa0-!!))*\e0,Ъ?\Ԟ, T ͆_wޠ:xV^V!\uㇳQ#wE)/i߯zpIJ[̘v9F څ8/sgD)k)I/•fgni~/%p^QS$jlD!>Yye)CA9y+WMN҂z) Gl ыiWw@~˳PM xQ VA$ VWUnaX $K'{UahwdlkDMfdi~կI/07O,5jsI@v;M(BDHsnL )_}Oao.w+᪐r<}F+YEEYTNmHo |cD_sVjprn] `yE`۩11\"NB\rr,%@N2N/@g#\xnu"xMkXnD O?H{wv#uV_F*+ (=8 6RJf;tQZרխly ueXJh&pSF\l(vk07h)҅6*$gk %huUD,eI40ʸ"W ubIb~U^vSEFmG,lLHg3|hC\2US `ߡWc톹^9283Ia7b^~N#tq܇&3@~C/ ^A (lؑ0~foo䬘s`*4-K6%░#% =HI6oJ8@CzT¼pOWAZ:TUY5|ūZǵޯ:G:S%e=~jT&IQwP[]Dlvȸ!`Xi[)Y;LJ]5UkLD5$bI/T81q(TH9)[u/@3+gf-V*o` ('Md)P,2\K6ޠ_AP! NhÁ\yCMIP8CA<?f϶&`ued$zHܩóf(` ߨ5mw 5k*HiMuN{:_Cg7I3BfΌAT:lG()G%7j+z \D7bB ntgr9X7EXVn0!$Eˆ)^18FXJNFFPx)C_$;,NmdTJOëoxnn<UV6;]޻a<tb3<L(m tyl{nwe\R0+@`>x7T0}ȧm2羾-yy"SuwXkxoZc\]3򎿰€vzҰyBq3j'`CP=Ăm+NvH%6f(NAa =IϺ߶_撮d:枨 +}?pP+ObZjyb.H@@Z,Қ"-E4S֙)nIloIrB~>VofblqTL+*)9ܰX򮞢RVLf.v9Si.Ӡߦi>҅tFL+OuvV]93x2#O=2]K&ǟ/<~~^O?v)f=oEӵ4+4NrgU="Ҩ`g8k0=8}cQXӐTyGawY-WSVXNcF.xe~yU@0ј5?P=@!IXLQ6p΃yǔqoKK0 ڽ5dw$,ϰ/ t*Bv-:7ޚޱ ,p) @$:7ϴNy ]H 1hZfB1?ru3 BQ\}mc@!d SWz13]oCqF8"ΔԸGi[bUfg N[GLoŽĸWrndzx]D`Փl 9_] c~2p PI) *m~SHX~;t.R/G~'ͤ![<z8BOv5`9'5ɯ{6 g{qp-^3TIZd,= p4wB&Ob$ҿF%dN>7`xͥE{_ v"1.{$%r_m LPm=O%#so(%Iy4azn|n6lTAV'JA<șgmB`{u $ž9g;?q0T;2dB̰E}JBp} W[z?Z MΤ(y043w;S7x倳Nhȳ~ 9|*OC/}"6ʢ7ߓ+$W4xgaoHR^^A$e.{@鎠XӐ[HV8Wrs޼[d1~OPa`{ I8,v%ѷ%$K vGX YѤf 0nN&Qd# Ph㿘` `(`(`.  @#0(3> > .3> @ #@3`> ` / c. `+.   D@ # 0(33c(3 @#.  H@ # 0(33c(3 @#.  L@ # 0(33c(3 @#.  P@ #0(33c(3 @#.  T@ # 0(33c(3 @#.  X@ #0(33c(3 @#.  \@ # 0(33c(3 @#.  `@ # 0(33c(3 @#.  d@ $# 0(33c(3 @#.  h@ (#0(33c(3 @#.  l@ ,# 0(33. 3@ (c  ^@ p 0#0(33c(3 @#.  t@ 4# 0(33c(3 @#.  x@ 8# 0(33c(3 @#.  |@ <# 0(33. 3@c ( @0`0`0`2`2`2`/ // / / / / / 㿘@`.`/```(. (`/ `` > > !> c#> | <'0(6". 6bc@6"@b. x@8' 0(666c@(#@. t4'0(666c@(#@. p@0'(066(c6@#@( l ,' 0(6".`66b"@b. @ h@('0(666c@(#.@ d$'0(666c@(#.@ `@ ' 0(666c@(#.@ \'0(666c@(#.@ X@'0(666c@(#.@ T' 0(666c@(#.@ P@'0(666c@(#.@ L '0(666c@(#.@ H@' 0(666c@(#.@ D'0(666c@(#.@ @@'(066(c@6#(@ 1 *1 1 0`0`0`*******X   & 'Ȇ ''`   'Ā& (& @?(&? (& &ĸ  `'>>>'Ąd„ > ׅ(". > г7`7`ȳ.`@2 (7 ('؅7 7 ۴. 2 @@'߇6(66@(2 @@ #@@@7`'7`̷.ӱ7` . .`@'''_'%> ߤ܅(. س7`7`.`@2 (7 ('ȅ7 7 ˴. 2 @@'χ6(66@(2 @@ #@@@7`'Є7`ӆ.۱7` . .`@'''''Ą V    0M  3> 000(b@> 6  #6 /`+6 #> +`" + 2`2 #2`,` 2**`, *@@ @ @@ @  @ @H `%> 0(. 0* *`67` 7` > c7 " 6++ ,`67 .  7 @+`#,  @@ @@ @  @ @ ` ` `    G 'A> ޱ. .`(($%> ձ. ˳.`χ((7> . ڶ޳.`( (> ϱ. г.`Շ(("@@``@`  @ ` ` ` Ā@` ```  @ ` ` ` Ă`8'Ĵ  '   Ą'ā㿘>"p  !?x l,``&@  * $ ` $㿀  @ '@  ' @` @' @     ' $@'  @   @ @@@ @@  @ @ @` @  @ @    @  @@  @@ @ @` @@  @@@  ` @@   @   @`      @ @    @  @   @     @ @ @ `       @@`  @       @@ @ @`   @@@  ` @  @@` @` @ @     @ @      ' @ @@`@@`  @  @ @    @@        ` @  @   @ @ @    `   ` @ ` @  @ @ @ @ @@ ` @ `  @ ` .@@.`.`.`.`.`.`.`x    ' '    @  @ ' @@   @$ '   ' @ @  @@@@    @ @  @ @  @ @ @   @ @ @ @ @ @ @  @      @ @  ` @@ ` @ @     @ @   `@  @   @@@@  `  @@  ` @  ` @   @ @@ @` @      @@`  @ @ @@`  @` @ @ @     @ `@ @@ `   @     @ `'  @` @`@ '܄  @ @ ` @ @     `@   @@  @ @    @  `    @@ @@@  @ ܄ `      @@  `   @`.@@.`.`.`.`.`.`.`                              A@@A@@A@@@@A@@@@A@@@@@A@AA@@@@@@@@@@@@A@@@A@A@@@@AA@@A@@@A@@A@@@@A@A@@A@AA@AA@@AA@@@AAA@A@A@A@A@                              @@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@                             libdes v 3.21 - 95/11/21 - eay㿐 *   * +    *`  *  * ''@000000.`.`.`.`.`.`.`.@''㿘0`(@@7`?(@@0` ̆3(@@7`?(@@0`UUU(@0`@(`7`/``@>!#%'"$& @/ 7  ?7 @(`7 @ 7 `?(@7` 7`7`` / 7  ?7 (`@7  7 @`?. 7`7` 7`@`0`>!#%'"$&`x @/ 7  ?7 @(`7 @ 7 `?(@7` 7`7``/ 7  ?7 (`@7  7 @`?. 7`7` 7`@`0`(`1 ) 0`UUU(@1 ?(@0` ̆3(@1 ?(@0`Æ(@$$㿘0`(`7`/``@>!#%'"$&  @/ 7  ?7 @(`7 @ 7 `?(@7` 7`7`` / 7   ?7 (`@7  7 @`?. 7`7` 7`@ `3>!#%'"$&`x  @/ 7  ?7 @(`7 @ 7 `?(@7` 7`7``?/ 7 ? ?7 (`@7  7 @`?. 7`7` 7`@`?30`+(`$$        0 0 0  0 0  0 0  0           0  0 0 0 0  0  0  0          $$   $ $$$   $ $            $$   $ $$$   $ $                0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0                            ((  ((  ((  ((  ((  ((  ((  ((           """"    " " " "((((((((    """"( ( ( ( ("("("(">x * ``( >x ` `(  㿘> | @8h     ` 㿘> x`" א ? " ? *`   +  *  @  *`* @ *@ 1 c @. (` 33 ) 6 @@ @ 6 @ 1 UUU . @ 0`? . @ 1  . ? # # *`@ @><"8@ 3 @ 2>  @ @  - `(`) 0`1 (`) 0`1  @ @0` 0`  `00`0``? `< ,`1 1   <  +1 1 ,  00`0`   0` `8( 1 @ ?,+  *@ @@  @?.   3` &@3`+`` &@  ` 㿘4㿐 + *`   +  *  *  *`  * 0c *  0)?# *  0' ̐3 *  0%? *  0#UUaU *  ?`?0 *  0 *  0 *  0 *  0 *  000000.`.`.`.`.`.`.@.`㿐>!@`m H /f * ' >!D 1>!@    `0 H "!  F 2  2 `@ @`  0 aD `2  aD T`T ژ TaD , H 0! * @* H'      @ <@ "H 0㿘>!@` < >D@ 4 H /4*`* '*` *  a@* @  ?"@a@ P€a@@ F @  @0` TH 0㿘H /f * ' >aD   $D l!P2ɔ >` "!@H 0w$DD *@ *`@ @0+*`D D>!@   `L 2   `F 2 @ "K  `T TDJ.  . H 0F?* -  l2   DH 04?!>* *!@*eD*` *  * @/ݐ@D- *` $D!@$@ 4> l$!@H 00# H 00H 0?㿘>D ` `42 >@+ H(. (!@(0(!@.`0L\&P&H&L!H 㿘H /f * ' >!D ``>!@`. * * @ `0 @ 2 *@H 0, a@.`  0 2  `` "``* * a@ T@/6`a@ F`* Fa@"H 0 㿘H /f * ' >L   ,>"!P"LH 0 Q!L0 >P ,""PH 0  㿐 "i  ( 2 $c #>a@2 & @ V >D @ 4  4 "04`24 $ `  #> #& @4 *` *  *  `F   a@ L` $4  4 "04`24 $ `  #> #& @ @ 㿘 $H /f * '  $`" > !> `4& $l  $`2`4> "lH 0cryptopcryptodesc㿈H /f * ' 1>!H '>  p>%b#\#`#d#h 8  h > >% #hb#\#`#d 8  h  &!HjI H 0' H 0 @. 8'> ΐj* @.  8 $$ 4& $H 0crypto_wait㿘H /f#>* '#>%>&!L!L $ ` Nu!L`, $aL!L㿘 (@crypto_check_alg: unknown algorithm %d㿘?` *`>&! €  >&rf!(|||||||vmmapbsyvm_map_lock: failed to get lock   0#e ( @  #g #f@ 0̀@ 0`>'"*` €>">"(> "H> "h>">">"`>'!*` €> "> #># >#t>#@-D $Р@-@ $&*`'' @D  @ @ &  L /:  ': .2'Ȁ * ''    &  L /: Ԁ'ܔ:     "1T L܀ 41N L00Ԓ :;`#\ :#l#h;p@ޔ &@ @@@  @1P$0<Hcrydev㿘`#     ! @4ڐ  ! X@,l   p$ t$  l$  \$ hX$ @,\$` L ".`"@  @$ @ @ 2   `$ 4  `$ X` ` `  %`% % % <% @* % `    ?$ `$$$$$(* $` X>( L$`$`$`$`($` <@``X  T,   M``]  $ $  $"`  $ `$`" $`  D' $`0>'P  LH ``x `X@`k`  ````  ``0`  X@ / L㿘   x" `#N   W   -㿘  (`"`$ "@@ 2/Œ L& (     㿐0#d@"  L -͐ &@&`&`` / L0 2` 2 >!X""`(&   2  " 2 "   񀢀  "@ "`  "  "`"  㿘`\ Lh l p-pt,4 / 7`< $ $$ ($ <$ @$ $ $ $ Ւ㿘3  $ " </0 L < "/* L/' Lvmmapbsyvm_map_lock: failed to get lockiov2pages: unmapped pages㿀  'H'T@ ? > " -  `/1>  @  $5> 3> i'?a8쀢 >)o,!%%'T ( "@ "@$"$@ ݠ  &`   2  " '@H "cuio_copydata: off %d < 0cuio_copydata: len %d < 0iov_copydata: empty in skipcuio_copydata: empty㿘 `>)#XnВ6>)>)#xnɒ ` `2 n#@ :&@ %>)`2 n"y&  cuio_copyback: off %d < 0cuio_copyback: len %d < 0cuio_copyback: empty in skipuio_copyback: empty㿘 `>* n{6>*>* nt ` `2 nk @ :&@ %>*`2 n`"@$&  vmmapbsyvm_map_lock: failed to get lock``   @.֒ 2  P  ` 2 `  4  'Ā!`  `  . '`'Ā  "@   . '`  € @р  `"= " ` ` @" &* ` € 'Ā &`  `  . ''Ā&  "@   . '6`   d`^  Ā  K % O İ   @U Sؐ    6 `  * & ` €#   €`    * & 2ȒĐĐ@ "b  @ "' "'Ā@  E  &  @. &  `€(Ā  `€&   @. & 2ȒĴ' @ L4 0I `x  ` =``l   ` " @C`  @ +  (`` `€`C`` ``€`2` ``€ ` %  `  㿐`  !    , l *   & ٖ "   "* &` "%   0+ƒ l2&`    c &+ l 㿘 k`i>!`#>a :` " a  ,`2`a20`a $a * $aa l* )  aa 2 $a$a @M7 7@&*`  a2p*+X l$,@`!&  l)l  $@&ޒ @?`>.!\*` €>"> "(> "H>"h>">"` `  :  l)> "``  "`  #>">#>#   l)$ "` `   l) "` ` #>'> @  6*@ ` & : &`  €```  *  2 ` ax :  @"* 2  @  j*@ ` & : &`  €```  *  2 ` Ḑ :  @"* 2  @  \*@ ` & : &` F>#<>#X  l( "` ` ` &  l: ( "``  ` & : "` ``   p: €```  *  2  € " >#"` @!  @"` `  ,8DP\㿘>!@  >!`.`@N `K   a"`9>.# *` €   `@   "*0   @%` ) l  "@%v` )ݒ l   @%k` )Ғ l  "@%b  )ɒ l)ƒ la 2  ,,,,,\\\,㿘 2 $e  Y   T>!    >!*   J&      ! 9 `    0  2  ) ?`#>/!*` € l   & `4 N  &  &  & `4`! ttttttSoftware crypto device cannot initialize!㿐a!> g$">.#h#\ >,>.#ta   "#\     "#\    ޚ "#\    ֚ "#\    Κ "#\    ƚ "#\     "#\     "#\     "#\     "     #\"#\     0>/h!`vmmapbsyvm_map_lock: failed to get lockmbuf2pages: page not mapped㿈'H'T'X 9 > "? 9>/ `,/>  ` $5> 3> i?a8 h#% % 'T ) @ "@$$@   2 X    2  " X"H"vmmapbsyvm_map_lock: failed to get lockDES3DESBlowfishCAST-128SkipjackRijndael-128/AESARC4HMAC-MD5HMAC-SHA1HMAC-RIPEMD-160Keyed MD5Keyed SHA1MD5SHA1Deflate㿘 㿘ޖ 㿘  l&  @#&!㿘@#x 'ߒ l&㿘ޚ 㿘! Ԛ 㿘  l%!&@#U!```a㿘@#D!' l&㿘” 㿘 㿘!  l% H H@#&&.|6㿘@#`H' l&㿘౔ 㿘M 㿘!  l% H H@"&㿘@" 'Y l&㿘 㿘㿘  l%b ( (@"&ܐ㿘 ,` " `@"ƒ! l',`` @" ('# l&㿘Ҕ 㿘!Ô 㿘  l%,#В&@"#е. ! 㿘@"#& l&㿘.2 㿘.@"2 㿘.Ω2 㿘@  㿘@ Ȧ@"Y 0XP "? 6">2>2b"@'''' '̔ $ɒ l,` % T "@ .` $ l,` % T"@  $   PT''>#[ > ##\?  U 2e,`* ֠     T̀ ؀`2܀`K`I l$|  C&'& &`'ܰ  l$l  2&Ȯ # @ I@@ l@&-&@ $<@ l@&!& ` @ 2@&  && l` @  ռ p 㿘 l$ 㿘% l㿐a"@  o6, p ' "  "`"@"`"`  o6   @7 `   i  ' 7  h6bind failed krpc_call: sosend: %d RPC timeout for server 0x%x rpc denied, error=%d rpc denied, status=%d h ` /'А Ԕ   Ш   '̖ "  "`"@!?#  `  '̒` "` "Ԓ#    v '̒` "` ,@,`$`H /f * ' > !\!H 0 %>  2H /f * ' > p$ 2$H p@ """2   "  "Ԓ Ĺ  X H /f * ' \!'̑H 0̀`!  2`H /f * ' > p" 2"H p@ ̐`"`2`"@"`p '̔  "  ,@,`4`$`̰t̀ >2f#0 H /f * ' \d!H 0 2H /f * ' > p$ 2$H p@ """2 !  " "Ԓ $  À    @  %  >  <$$ @ <%>cȀ $Ȓ  $$ $ $ $ $ $ $ 8$ 4  '̒` @`'$$ 沖  e'Ԓ   ^'>2`e#XЀ "'̀ !@'''ȒД̘ؖ ÚȰ # %M$  ` `Ȁ@` >2 e#x `` >2e#`   }   ' 7>2#@e `    ? ̀`'''@ d_Ѐ Yԁ㿘` ? C  ) 6H /f * ' > !ؐ[;! & $[3 & $H 0 $ (  & 6 & 0& (& ,& <& 8  2 Ȑ   & t"㿘   "    ?      8.@& 㿘    "  " " " " "㿘    2    "  &@.@ .` .` .`T vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapnfs_read modenfsbioread nfsbioread: type %x unexpected 0 X!      >5c"` 2u 6p " @b@ < 1ྀ  %  2U"Ē  2LĀ@" @ @   <@7+3% @  <``'`>5 <> b` "`@5<`   @ `a:`  >!x `K'਀ G 1 `a:` פ 2"਒@! "  0" 0@$ 0@ "  0 $ 0̐Ȑਐ  : @ ǖ k   0@  @@ @ "  0"   0 $ 0@Ӕ d'$@ 8  "@@&  /$. t p@@ t $& t @ "u  0 d $ 0 0 >5a"p  ` T t@ "@&- ,> 0`"0 $@} "E  0"2 @ 0 $ 0@p  @$" @ 8    c9"  2 H'3 <``>5 c!"``2  4 @nfs_write modenfs_write proc8  X  `  !>7a   2 <>  "<>7at 耢   `  ?`5`" @b@" `  %` @   %`  `=   6 ְ Ҁ"  @ `B 2 ` 0   0h$ 0| 7>  @6`$ "`$ @<   @ $8 O:` @ "  l?2`@ &@$ l`<5`  B` 2 d`( d  B=``   @  d @ `@ 6  H $ , V  H2  d`@ `8@ $ ` $ d$ `$ d t   ` & d p d@   d$ p $ t8  @ $ p $ t 0 ?$ 0 $ , " 0@  0`$ 0$ ,@ޙ  :  O 㿘 X! @!՘ 2#> @\g  aX+ Շ "   { nfsvinval㿘 X! @  >!X!*`   '>8 4   P;   @\& 27  `4   @\  ? 4 ?4 =̐    䀧  ? 4 ?4 =  㿘>!x`A> > g!c   .` 0@ h?2& "& @ &@& h 0@ l & 02 & "& @ &@& l&  & "@"#=y # ``Θ  0D @ H /d * % ӦH 0׵ Process killed due to text file modification nfs_doio: type %x unexpected h \ 0` ''@ % % -%  T : <2` H* @ % *`  0?Ѐ@= > b`  "` % @y> b`,'̐ "`,% @dj 0@"n T < H% ''% `<  I>9U`< T> b̕: `* 2 * #`= @  & p T <* #@@ "  @8 H @:@& t <& t%`@ !T >9_ې!X-  &> " 4 `" 4 = @ `8!z 0& 4(& 0t> ( `:  d2 H* #($% * @ 'ԑ< 0C @=   @'Ѐ`% '̐ ' 0@ & 0@ĘȤ ̀  0  0 ?& 0 0@*@& 0% 0 !H /d * % ҈H 0 0 Ȁ"  0$& 0" & d 0(& 0%& 4 5& d& ` `& @@n`Xxnfs_boot: no suitable interfacenfs_boot: using network interface '%s' nfs_boot: socreate, error=%dnfs_boot: GIFFLAGS, error=%dnfs_boot: SIFFLAGS, error=%drevarp failed, error=%dnfs_boot: client_addr=%s nfs_boot: set if addr, error=%dnfs_boot: bootparam whoami, error=%dnfs_boot: server_addr=%s hostname=%s X> h Ԁ 'Do1>:ؤ5>:Ħ7> ;>:9> j> !Т؀ 1>:5>:Ħ7> ;>:9> j   4  2   >:]"H _&"h  ̖ ">:]"0anۖ ">:]"1 `7!n͖ ">:]" ">:]"0y'Ē^@Ȓ  / ,! $n >:]h#(R@ ?'//ɐ!&@v ">:]S#H0J'Ē!^ĐcpD  nfs_boot: bootparam get %s: %dnfs_boot: mountd %s, error=%dnfs_boot: portmap NFS/v2, error=%d㻘@ "j>;" ]@ a>;"@] bؖ ">;"`] @iO :.` K.  * .nfs_boot: bootparam_whoami: bad reply 㿐 % '` "` #a b$$ W$  "@ b$  o4'  >`    %'   >  > j4a$" '> "> b '2 '>;^ #x H " nfs_boot: bootparam_getfile: bad reply 㿈>  > j!  '@} "@4 ab  | ) Y' '쒒 '#' 耢  '@   &..><]!( 㿐#ab   0@3 '& b  4 `  H` #   _ $ '  ʔ 0 H]vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map㿘>ap> ͒ .є > g"b    㿐>  -> g+> ͒a * `> ` X 2@T`2@`@ 2 @` 嶔 2d&`2`>   R  &Vɐ˒  a!@Ւ!$!`L2$`` @ɔ 2 $`< 2@ $<@ $@$` " X X@ 2T 2  @  2  $@" $@$`   $``$``4`& nfs_inactive: pushing active㿘 >>  X  ` D >="H|   <` `$`   ߘ @"G Ò ` 4`  | nfs_reclaim: pushing active㿘 >`X  ``D >=#8D `" `< 2"  "@`< 2T  " T   T @  Ԛ`} $` vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapbuild > MLENL0 @8,'TE'P  "    'PTP @d=L wL - HL $T<8;`#\  H @S @ <8;`#\  H @R@  Ȑ  TL  H"_ T  P@ "@    'PTP @cL 2L  L T  P@ "@  PT@dk  0'PT  P@ "@   'PTP @cȘL w0LL0 `#\#` 4@j "3L $T<8#\;`  @R@ <8#\;`  @R|@  E L  H @h ְ  4!0@JG 2 4`<     0 @J5 2,4`<    0  @@J# 2,X4 hJ4 $TL <8#\;`  @R@ <8#\;` \ @R@  ِ L  H@h*<    8 `    $ 0@  "@` <L   ?# D !P!H 0 2H /f * ' > p 2H p@ """2 ^ <"'<" < '8< 8`" 8 '8$ L  0  @X 8 ,'TE'P  "  ` 'PTP @bL `L@ - H L $ T<8;`#\  H@Q]@`<8;`#\  H@QP@`   T L  H"$ T  P@ "@  ` 'PTP @bIL L ^  L 0T  P@ "@  PT@b  ߐ0'P L0 `#\#` 4@h , L $ T<8;`#\ @P@`<8;`#\ @P@`  "  L 2? H 4 4 $ T L <8;`#\ @P@` L  D T<8;` #\@P@` s   L  H <{      8  L  D T`    $ 0@  "@@  <L L  ?#@D !O8!H 0 2H /f * ' > p 2H p@ """2  <"'<" < '8< L 8DT#  L 8 T D'8@g$P80 @ 'L , ?E  "    ' @a䀢  - HL $TԒ;`#\  H@OԒ;`#\  H@Oٚ؀   L  H"w   @ "@    ' @`Ҙ䀢   L   @ "@  @aD  0'߄`  @ "@    ' @`䀢 > !   @ "@    ' @`䀢 m  /7  @ "@    ' @`g䀢 T!@  @ "@    ' @`M䀢 :'  @ "@    ' @`5䀢 "!@  @ "@    ' @`䀢 '  @ "@    ' @`䀢 !@"  @ "@    ' @_䀢 ְ       ?  @ "@    ' @_ɘ䀢   (  @ "@    ' @_䀢 '  '>    *`" *  * ''  @ "@    ' @_䀢 u  (  @ "@    ' @_m䀢 Z'  '>    *`" *  * ''  @ "@    ' @_G䀢 4 f  @ "@    ' @_.䀢 ' L'  @ "@ $ ' @_䀢 Đ0?# @@>  /7 x@2' x@2'  x :? x@"'' x@"L'*`" *  * ''LȐ `#\#`Đ ̖@e8 4`L $TԢ#\;` @MԢ#\;` @M؀ _ " #\L ɀ H5 #\ 8 Q8̬    l@ p@ # :߀L $TԢ#\;` @MU`  xԢ#\;`@ME؀  " #\L x H #\l ??2`<Ȁ &  X`<0`<   Ȓ @D ̖T̔: ̀ $TL `Ԣ#\;` @L` D xԢ#\;`@Lۚ؀  `L  H ` #\8@bn     8 `    $ 0@  "@`C L  ?# CDԑH /f * ' > !Ke!H 0 2H /f * ' > p 2H p@ """2 " "'"  'Ԑ` И D#` ЖD@cZ'Ё80@ 'Lp,  ''F'  "  ` ' @]K 2z@ /L H $T;`#\  H@L;`#\  H@L  Ր  L ) H"   @ "@  ` ' @] 24  L   @ "@  @]x  "'  @ "@  `' @\Ԙ 07@ 4 ? $ H )L  $T;`#\ @K ;`#\ @K X " LL  H L  ``'#\#`#h''#d@_ך`  ' -L  $T#\;` @KN  X#\;`@K@   ]L ^ H VM @ ߒ @ X d% h% X$ L. $TL #\;` @K  `D`X2 X#\;`@J   L  H  @a[ r    8 `    $ 0@  "@` L   ?# DH /f * ' > !Ix!H 0 2H /f * ' > p 2H p@ """2 5 "'"  '  ` " ` '#@᜔ n    8 `    $ 0@  "@` L  ?# DH /f * ' > !I!H 0 2H /f * ' > p 2H p@ """2 Œ "'"  '`   #`  /' @`@`0m    8 `    $ 0@  "@`C L  ?# CDH /f * ' > !H!H 0 2H /f * ' > p 2H p@ """2 J "'"  '`  D#` D@`'P0'@08'L ','L'P' '''H'  " $ '  @Zn c 1 HL $T#`P#d#\ܐ  H@I;#dP#`#\ܐ  H@I,    L  H"    @ "@ ( '  @Z& ̐ ; L >    @ "@   @Z  0'> "p  ''ȑH /f * ' > aG!H 0  4 H /f * '   6 H p@  $ $$ 4  c H /f * ' > !ؐGk! $ $Gc $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8    0  ܀`$ ''"' @$($"$ $  % c% { LА `   %%=%#`Ș#\Ē %%%@_ఒ 5 L $TP#\ܚ#`#d @H.P#\ܚ#`#d @H!  L  H @^; Ұ `< " ؀`  p /L쀦 "$TЀ $TL P#\ܚ#`#d @Gޖ؀   \P#\ܚ#`#d@G͖  L  H"  @] 2z ` Ъ%@ ` $"@ @\"    8 `    $ 0@  "@` L   ?# DH /f * ' > aFM!H 0 2H /f * ' > p 2H p@ """2   "'"  ' `"  '""nfsrv_read iovx0' L@ 8'H','L'P'4'0'H  "   '040 @X,, , 0 HL %TP#\;`H  H@F #`P#d#\H  H@F    4L  H"ݰ 4  0@ "@   '040 @W, n, L 4  0@ "@  04@XV  0S'0`!4  0@ "@   '040 @W, :,        0@ "@   '040 @W, , 4  0@ "@  '040 @Wx, '0X,L  '<   @4 L '5L H %TP #\H#`#d  H@F)'P #\H#`#d  H@F' L  H  L `#\#` H @] 1L %TP#`#\H#d @EP#`#\H#d @Eޖ  L  H   <       !  @=L   @  @=L8 L ' P׼L %TP#`@#\`  XP#`I#\ 2'T' :`F TT("' %TL P#`#\H#d @Eb ? `P`dP#`#\H#d@ENP P 'L  H">  q    8 `    $ 0@  "@`c L>   ?# cDH /f * ' > !Cޒ!H 0 2H /f * ' > p 2H p@ """2  "'"  '>   d" ᜒ`d'$'lT    8 `    $ 0@  "@`G L   ?# GDH /f * ' > !Co!H 0 2H /f * ' > p 2H p@ """2 , "'"  ' `H" 'H'D` ?`1 `     8 `"   $ 0   @"   ?$   %  l H /f * ' > !B!H 0  4 H /f * ' > bp` 2`H p@  $ $$ 4   H /f * ' > !ؐB! $ $\B $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8$ &@ 4r .    "`5 2 >JK    8 `"   $ 0   @"   ?$    %   @##    $  "`:`"`"`"`      8 L D' "4Հ %TL P#`#\H#d @CR   XP#`#\H#d@CA   L  H4 8@YZ, "C@Z(8`%@ 4   ?@ "@@@X%@  $@ > !> #$$(0'@ 8'H'L'L,  ''''`'@ `E  "   'ЖԒД @S̀  - HL $T;`H#\  H@B`;`H#\  H@B` w  L  H"հ   В@ "@   'ЖԒД @S̀ Y̐ټ L `  В@ "@  Ж@T  0>'Ѐ`&  В@ "@   'ЖԒД @St̀ & '      ?   В@ "@  'ЖԒД @SP̀ 0ē ?  . `*Ԁ`К  "@ " " ` "`" " `" #"@"   2 60LL  $TH#\#`#d @A  `H#\#`#d @AԖ `  " #\L 〦 H #\  `#\#` H@Y9 /`L $TH#\#`#d @A `H#\#`#d @A` b " #\L  H #\Q 8L' < `         @9SL 8ӁL $TH#\#`#d @AW``  xH#\#`#d@AH`  L W Hp #\8 @Vug 3 .l %%` "" "2    %=%%%z> H`"H  0L " $TL `H#\#`#d @@``  ``L```2 H#\#`#d@@̖`  `L ۀ Hـ`#\@U8 2     8 `    $ 0@  "@` L   ?# DH /f * ' > !?V!H 0 2H /f * ' > p 2H p@ """2  "'"  ' `" ` '    > #Ȑ#  n     8 `    $ 0@  "@`C L  ?# CDH /f * ' > !>ܒ!H 0 2H /f * ' > p 2H p@ """2  "'"  '`  D#` D@V'nfsrv_write: nd_mrep not freep'P'D&D`'L" L 0 @ ,''% (% 4 % H>   :`4`, @,`b2*@ *@ b 2`*  *`> `@C3`+ >#З+`<B <`BI=` ` " ' @P  3 H`L %`T#`P#d#\  H@?[#dP#`#\  H@?LP P @'`L  H  @ "@ ' @PD T `dZ `L   @ "@ @P  0; '$  @ "@ ' @P $       @ =`%`H  @ "@' @O  ?  =` ` ;`B=`%`P #  "@ " " ` ""  "  # "@"   @ 4c %`T#\;`  @>#\;`  @>w #\ 8 @S  %`4=@%`,H /` * ! `H @   `` @`` `8`` @8` ` %` ` ` "`$`  $` %` `H` "`$&`H`H%`$`, h `p *  @@`  `d d@ǔ  2 ` `` @ `d``  @`d d@  "`"4` %```"`$``%` L `` `@  ` @ P 2@  `@`d `@`d d@{  "`L0 %``"`$%`H 0> ``: 0(@(b2*@ *@ b 2`* @ *`>  B2**< @ B H /` * ! `H 5 1 2 4  + 4 2% `" $ $"`$ $ "@ `"  "`  "H p@ , L% , 8 #\ L `#`  d@TΘ ' '䀥8Lu' <      ' 2  H L@5  H    &&& >  "&6`H   2 2  + &@ & "" "2 2W> H`"H  L '> "p &% T#\#`#d @< #\#`#d x@< #\8@Q% T  `L``2 #\#`#d @<~#\8@Qɚ    8 `"   $ 0  @ "  J>   ?# BH /f * ' > !;*!H 0 2H /f * '  5H p@ """2  "'"  '>  `"  ' P `H Ȅ  m     8 `"   $ 0  @ " C J  ?# CBH /f * ' > !:!H 0 2H /f * '  5H p@ """2 t "'"  '`  D#` D@R' ,`% 4>QC"hH /`* !   =`H% `H "`$&`H% $`(   `" $ $"`$ $ "@H 0  H /` * !   =@`H%` `H` "`$&`H%`$H 0> ̀ H 0H /` * !   4 "  ` $"`$ $ " 4P"D"@ 2 4H 0 nfsrv_coalesce: bad off㿘``"``"```"@` `"`$`$"`$`$` "@` @4  "` @ ` @`>VBZ!$ ,^`, , (@ `,@@ 2@"@`> `, (`H` &`,`2 ( H 2 (& H ( &`  (` "`$& (&`$`(   `"$$"`$$ " ( "  ( "`$& ("$`(2 㽠`8 `0`@`' `L `, ?@'''''$'EP  "  ` '@D@ @K< <@ /D`L H %`T,(;`#\  H@:l0 ,(;`#\  H@:_0 (  D`L }H D  @@ "@ ` '@D@ @KX< y< n `L D  @@ "@  D@@K̔  D0` '@D  @@ "@ ` '@D@ @K)< J<@ 4 ? $ H".`L`L %`T,(;`#\ @90 ,(;`#\ @90  " `L`L H% `L$ ` #`@D''#h  '#\#d@N+$` 8'T '$=`L %`T,(#\;` @90   x,(#\;`@90 W`L Hΰ #\8 @N$ ð 0^D  @@ "@ ` '@ @Jv< <@ "     'T ' Dl D  @@ "@ ` '@ @JM< n<> @! D  @@ "@ ` '@ @J2< S<` /7D  @@ "@ ` '@ @J< ;<@!@D  @@ "@ ` '@ @J< "<@'D  @@ "@ ` '@ @I<  <@!@D  @@ "@ ` '@ @Iј< <@'D  @@ "@ ` '@ @I< <@!@!D  @@ "@ ` '@ @I< <@`      ?D  @@ "@ ` '@ @I< <@  'D  @@ "@ ` '@ @Ih< <@'` '>    *`" *  * ''D  @@ "@ ` '@ @IC< d<@  H D  @@ "@ ` '@ @I(< I<@'`-'>    *`" *  * '!'D  @@ "@ ` '@ @I< #< H   '7 @'  @@ "@  '@ @H< <$>2 c <@' ' /` 7``  `    :? ' ``!2]   lHα ' ``   ' : 6x m`L %`T,(;`#\ @7B0 ,(;`#\ @750 { `L 2wH0u'  ɾ: `L %`TՐ,?# @'''q' & @@`ɟ 蒒`L` %`T,(;`#\  ,(;`#\  ɀ  r4t j[?  @.  ƚ? Ƚ@S @X d' h' X$  Ȣ   $H@/  2 $樒'$%`T`L ,(#\;` @6\0   `D`T2 x,(#\;`@6E0 `L dHb|,    8 `    $ 0@  "@`# ,L>   ?# #D,H /f * ' > !4ג!H 0 2H /f * ' > p 2H p@ """2  ,"'," , '(,>   ( $" (ᜒ`$'(#@``#@  @K#\8@J ,    8 `    $ 0@  "@` ,L  ?# D,H /f * ' > !4T!H 0 2H /f * ' > p 2H p@ """2  ,"'," , '(,  (` # (  z'(,    8 `    $ 0@  "@`C ,L  ?# CD,H /f * ' > !3!H 0 2H /f * ' > p 2H p@ """2  ,"'," , '(,` ( D#` (D@K'(# "s m _@a ֐  㽸 L  0  @  8  ,P?H'(',E'  "  ` 'HLH @ED D@ /L L H % T40;`#\  H@4z840;`#\  H@4m86  L L Hð L  H@ "@ ` 'HLH @EfD PD |  L L  H@ "@  LH@Eڔ  L07 'HL  H@ "@ ` 'HLH @E7D !D@ 4 ? $ H". L L % T40;`#\ @4840;`#\ @38 "  L L )HJ  L `, HL''#`#h '#\#d@H9,` 8'(9L L % T40#\;` @3840#\;` x@38n( L ۀH #\8 @HҘ,  -  H@ "@ ` 'H @DD }D@> b* @?      cKL` `H "  ` 'H @DeD OD> @! L  H@ "@ ` 'H @DJD 4D` /7L  H@ "@ ` 'H @D2D D@@L  H@ "@ ` 'H @DD D@'L  H@ "@ ` 'H @DD D@@L  H@ "@ ` 'H @CD D@'L  H@ "@ ` 'H @CҘD D@@!L  H@ "@ ` 'H @CD D@`      ?L  H@ "@ ` 'H @CD D@  'L  H@ "@ ` 'H @CD jD@'` '>    *`" *  * ''L  H@ "@ ` 'H @C[D ED@  (?L  H@ "@ ` 'H @C@D *D@'` '>    *`" *  * ''Ȑ? &L  H@ "@ `'H @CD Dǐ;,`?@c *   *` '   'ăᮔ H B  l ^.᠔ W!?# @''''Œ 2@@ < ó/ؐ@E @ X d% h% X$ ᲖÔ, ᩖ,% T L 40#\;` @1^840#\;` @1Q8 L H|(4    8 `    $ 0@  "@`# 4L>   ?# #D4H /f * ' > !/!H 0 2H /f * ' > p 2H p@ """2  4"'4" 4 '04>   0 $" 0ᜒ`$'0#@``#@  @F(#\@F8# "\ VҒ H@J ¿  ¹ 8 0  @ ' L ,  '''F'  "   ' @A 2z / L H % T;`#\  H@0``;`#\  H@0S`    L  H"   @ "@   ' @AL 24 a  L   @ "@  @A  "'  @ "@  ' @A ɐ0 4 ? $ H + L % T#`#d#\ @/ `#`#d#\ @/Ԙ`  "  L L  H  L `  #\''#`#h'#d@D`  Pݖ'E - < 2  @˒  @    @ ĔĀ0  ߣ'  % T L #\#`#d @/X`  x#\#`#d@/I`   L  H  #\P@Dt 㼰80@ '<L ,  '8'4'0',h'd'`'D'@'('F'  "   '`d` @@\ 2\ /dL H $TLH;`#\  H@.PLH;`#\  H@.ޚP   dL  H" d  `@ "@   '`d` @?ט\ 2c\  L d  `@ "@  `d@@J  "dI'`d  `@ "@   '`d` @?\ 22\ 4 ? $ H ".LL $TLH;`#\ @.oPLH;`#\ @.bP + " LL  H+ L`'$` `D #\ d''#`#h< '#d@BD`  f'8ΐ 'D CL $TLH#\;` @.P   LH#\;`@. P Ґ 8L  HӰ #\ @C6#\ H @C.D   Gd  `@ "@   '` @>\ w\ - HL $TLH;`#\  H@-PLH;`#\  H@-P v  dL Q H"v d  `@ "@   '` @>\ 2\ (Ļ L d  `@ "@  @?  0'`d  `@ "@  '` @>v\ % D\ $ H%L`, `#h@ ' '#`(#\<'#dh@A@`  Hc'0ː '@  ޽tDx <` <    ` `  23 2 `  `2X  X`X@  B   B  Ā  @ "?  |Ĕ|xc@f ې "֐RXV?" Qp͒ D ۖ'4DD@ ђ',:@8 $TL  LH#\;` @,P   LH#\;`@,pP 9  L  H 84@A#\0#\,H@A' D "@@ " p\ Ԁ S ɒ͐` 8  0  @P' L ,  '''Ԑ' ''F'  "   '  @= 2 /  L H $ T;`#\  H@+;`#\  H@+ݚ     L  H"    @ "@   '  @<֘ 2   L    @ "@   @=I  " L' L G   @ "@   '  @< 2z /  L H $ T;`#\  H@+p;`#\  H@+c ,    L y H"x    @ "@   '  @<\ 24 q  L    @ "@   @<ϔ  " '   @ "@  '  @<+ ~ِ0-`4 ?`$ H * L $ T#`#d#\ @* #`#d#\ @* ~  L  H  L `#\#` @BM < L $ T#\#`#d @*  X2 x#\#`#d@* ~p  L  H @@#\ P  <`2  L S L  ` '#\'#`#hД'#d@>ښ 䀢` Pڛ' '䀦 ,`    X`X 2   Vސ @ U  c'䀢 ['쀦 $ T L #\#`#d @*  X2 x#\#`#d@) }Ő  L  HԐ@@#\ؐP@?! 㽈 8 0  @ ' L  ,  ? ''''F(  "  ` ' $  @:ј 2@ /$ L H % T ;`#\  H@) ;`#\  H@) }[  $ L | H" $   @ "@  ` ' $  @: 2=   L $   @ "@   $@:  "$#' $   @ "@  ` ' $  @:Z 2 @ 4 ? $ H ". L L % T ;`#\ @)# ;`#\ @) |ߐ "  L L  H'  L ` #` $''#h '#\#d@=[`` 8' '  `ɐ`V$   @ "@  ` '  @9 > @! $   @ "@  ` '  @9Ř w` /7$   @ "@  ` '  @9 ^@!@$   @ "@  ` '  @9 D@'$   @ "@  ` '  @9z ,@!@$   @ "@  ` '  @9` @'$   @ "@  ` '  @9H @!@"$   @ "@  ` '  @9. @`      ?$   @ "@  ` '  @9 @  ($   @ "@  ` '  @8 @'` '>    *`" *  * ''$   @ "@  ` '  @8͘ @  ($   @ "@  ` '  @8 d@'` '>    *`" *  * ''$   @ "@  ` '  @8 >@$ {6_ H 줐    h?x'p''h'l''t'  'p@6 `2.@$   @ "@  ` '  @8P z)`7.@ D غ@ 1  >`h `2`*?# @`'''`'  Đ@骒 @Xd%h% X $ { `  'i % T L ` #\;` @&`  `2 X`2 x #\;`@& zg ` L  H` |     8 `    $ 0@  "@`#  L>   ?# #D H /f * ' > !%0!H 0 2H /f * ' > p 2H p@ """2 w  "' "   ' >    $" ᜒ`$'#@``#@P  @<@#\8@;M)  "  "ג@    `` 㽰 L  0  @  8  ,'L?H'('$',EP  "  ` 'HLH @6ؘD rD@ /L L H % T40;`#\  H@%840;`#\  H@%8yc  L L  H8 L  H@ "@ ` 'HLH @6D -D   L L  H@ "@  LH@7  L0 'HL  H@ "@ ` 'HLH @6dD D@ 4 ? $ H". L L % T40;`#\ @%.840;`#\ @%!8x "  L L H  L 'L `, HL'#`#h#d '#\@9f,` L8''( ',< L % T40#\;` @$ٚ8  x40#\;`@$ɚ8x( L PHh #\8 @9, ] QdLL  H@ "@ ` 'H @5D LD> @! L  H@ "@ ` 'H @5D 1D` /7L  H@ "@ ` 'H @5D D@!@L  H@ "@ ` 'H @5fD D@'L  H@ "@ ` 'H @5OD D@!@L  H@ "@ ` 'H @56D D@'L  H@ "@ ` 'H @5D D@!@!L  H@ "@ ` 'H @5D D@`      ?L  H@ "@ ` 'H @4D D@  'L  H@ "@ ` 'H @4͘D gD@'` '>    *`" *  * ''L  H@ "@ ` 'H @4D BD@  DL  H@ "@ ` 'H @4D 'D@'`)'>    *`" *  * ''  H@ "@ `'H @4hD Dw,` /7  'גِ0OԐ# a ,@ے @ X d& h& X$ LH*, L>'$,% T L 40#\;` @"8  2 X2 x40#\;`@"ܚ8v L cHa|(4    8 `    $ 0@  "@`# 4L>   ?# #D4H /f * ' > !!n!H 0 2H /f * ' > p 2H p@ """2 t+ 4"'4" 4 '04>   0 $" 0ᜒ`$'0#@``#@  @8~(#\$8@7 4    8 `    $ 0@  "@` 4L  ?# D4H /f * ' > ! !H 0 2H /f * ' > p 2H p@ """2 s 4"'4" 4 '04`  0 #` 0 '04    8 `    $ 0@  "@`C 4L  ?# CD4H /f * ' > ! !H 0 2H /f * ' > p 2H p@ """2 s< 4"'4" 4 '04` 0 D#` 0D@8t'0 " @ w   8 0  @ ' L ,  ''''F'  "   ' @2I 2z / L H % T;`#\  H@!`;`#\  H@! ` tӐ   L I H"H   @ "@   ' @2 24   L   @ "@  @2v  "'  @ "@  ' @1Ҙ t0 4 ? $ H + L % T#`#d#\ @  `#`#d#\ @ ` tT "  L L ʀ Hɰ  L `  #\''#`#h'#d@4Ӛ` Д' ' : L % T#\#`#d @ G`  x#\#`#d@ 8` t  L x Hw #\ @5e8 l  <   Ā  @ 2  2Ԑ Qѝ @ 0  '8' % T L #\#`#d @ܖ`  x#\#`#d@͖` s  L  H  #\@48 X L  0  @  8 ,'L','(''EX  "   '(,( @0$ $ - H L & T;`#\  H@{;`#\  H@n s7  , L ǀ H" ,  (@ "@   '(,( @0g$ U$|  L ,  (@ "@  (,@0ٔ  0:'(",  (@ "@   '(,( @04$ "$        (@ "@  '(,( @0$ rÐ $:  ' L ` > < % %%4 L `#\#`  @6R 4 L & T#\;` @'Р#\;` @'Ѐ'rx  L  H"ΰ Ԓ @4ɔǰ  Lʔ'쀥    @L@q &L  L & T#\;` @t'Ѐ  X#\;`@d'|'Ԓ A   㛐0''̔8'?ؔ'? '0?@'L'4'8'<'H'P'T`' [ 'L ͗`Ȕ ϝ`@ "   LT '  L BH /  " L)  L & T#\;` @  X#\#`Ԕ#d@ q  L A H" Д@4 0  m & T  X``#\#`Ԕ#d@ qwԔ@3    8 `    $ 0@  "@` L   ?# DH /f * ' > !M!H 0 2H /f * ' > p 2H p@ """2 o  "'"  ' " '  k    8 `    $ 0@  "@` L   ?# DH /f * ' > !ݒ!H 0 2H /f * ' > p 2H p@ """2 n "'"  ' `"  '> #>     0 ''䀥@ ' `'' @  '䔒` @  ` "`  2 K & T L #\;` @  X @@#\#`Ԕ#d@l p5  L ƀ HĀuԔ@2    8 `    $ 0@  "@` L   ?# DH /f * ' > !!H 0 2H /f * ' > p 2H p@ """2 m "'"  ' " '      ̴ 8`   $ 0   "@   ?$@ ~ &@@$ H /f * ' > !!H 0  4 H /f * ' > p 2H p@  $ $$ 4  mC H /f * ' > !ؐK! $ $mC $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8    0  $ $  @> !&@`@ ~ &@@$ H /f * ' > !!H 0  4 H /f * ' > p 2H p@  $ $$ 4  l H /f * ' > !ؐƒ! $ $mi $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8    0  $ $  @&@`@ ~ &@@$ H /f * ' > !!H 0  4 H /f * ' > p 2H p@  $ $$ 4  l= H /f * ' > !ؐE! $ $l= $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8    0  $ $  @@&@`@ ~ &@@$ H /f * ' > !!H 0  4 H /f * ' > p 2H p@  $ $$ 4  k H /f * ' > !ؐÒ! $ $lf $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8    0  $ $  @&@``> "p@ | &@@$ H /f * ' > !w!H 0  4 H /f * '   6 H p@  $ $$ 4  k6 H /f * ' > !ؐ>! $ $k6 $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8    0  $ $  @@&n$@u@ @.@?`@ ~ &@@$ H /f * ' > !!H 0  4 H /f * ' > p 2H p@  $ $$ 4  j H /f * ' > !ؐ! $ $kI $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8    0  $ $  @&@`@ ~ &@@$ H /f * ' > !]!H 0  4 H /f * ' > p 2H p@  $ $$ 4  j H /f * ' > !ؐ"! $ $j $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8    0  $ $  @&@`` '? ''  @  ` 耥 ` ?" @`耧@ 1@' @ ~ &@@$ H /f * ' > !!H 0  4 H /f * ' > p 2H p@  $ $$ 4  in H /f * ' > !ؐv! $ $jn $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8    0  $ $  @> c&@`@ } &@@$ H /f * ' > !.!H 0  4 H /f * ' > p 2H p@  $ $$ 4  h H /f * ' > !ؐ! $ $i $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8    0  $ $  @ > !&@> &@ `@  &@$  &@@$   X0' @8L'L, ?@'''E0  "   '@D@ @'ɘ< w< - HL %T,(;`#\  H@0 ,(;`#\  H@0  jT  DL e H" D  @@ "@   '@D@ @'< 2< L D  @@ "@  @D@'  0'@D  @@ "@  '@D@ @'T< j0n<  ' L   @  < % %%4L `#\#`  $@- 2'L %T,(#\;` @0'Р,(#\;` @0'Ѐ 'i L ƀ H Ԓ HH$   L  $ @   @ L #L$L %T,(#\;` @0'Р,(#\;` X@0'w'Ԓ DŽ$ ޔ '''Ȕ,(0?'? ?'$?''' '(',`' ܞ 'L$ڒ` $ $şL$ FL` "  " @ $ "q n L %T#\;` @= #\#`#d X@/  h L  H\ Ԓ@+HT $#\%TД#`#d h@ h͐ԐВ@+&,    8 `    $ 0@  "@` ,L>   ?# D,H /f * ' > !!H 0 2H /f * ' > p 2H p@ """2 fZ ,"'," , '(,>   (" (> '(     ۢ۟ 0@'' @$   @ " ` 2'䀥  '`   "  "   h''耦 %TL #\#`#d @4 #\;`@'  g L  H"T А@*A,    8 `    $ 0@  "@` ,L   ?# D,H /f * ' > !!H 0 2H /f * ' > p 2H p@ """2 eu ,"'," , '(, (" ('(  ,`  ( `8` ``$`0 `  "@ `  ?$@@  > "p`" $ X  " '` 2u@  Xd#@h#` X $   ÉL iUe`t` @ ''쀣@ L'@*6|> a 'x'''p @ }'t,@(` &@@$` H /f * ' > !H 0` 4`H /f * '   7 H p@ `$`$@$`4` d H /f * ' > !ؐ! $`$eJ $`$H 0`$ (` $`4`$`0$`($`,$`<$`8`  `0  $` %`` @&@`@ |,@(` &@@$` H /f * ' > a`!H 0` 4`H /f * '   7 H p@ `$`$@$`4` d H /f * ' > !ؐ'! $`$d $`$H 0`$ (` $`4`$`0$`($`,$`<$`8`  `0  $` %`` @&@`@ |,@(` &@@$` H /f * ' > !H 0` 4`H /f * '   7 H p@ `$`$@$`4` c H /f * ' > !ؐ! $`$dK $`$H 0`$ (` $`4`$`0$`($`,$`<$`8`  `0  $` %`` @&@`@ |,@(` &@@$` H /f * ' > aa!H 0` 4`H /f * '   7 H p@ `$`$@$`4` c  H /f * ' > !ؐ(! $`$c  $`$H 0`$ (` $`4`$`0$`($`,$`<$`8`  `0  $` %`` @&@`p> "p@ |,@(` &@@$` H /f * ' > ے!H 0` 4`H /f * ' ` 5`H p@ `$`$@$`4` b H /f * ' > !ؐ! $`$cE $`$H 0`$ (` $`4`$`0$`($`,$`<$`8`  `0  $` %`` @@&Ҕ$@u@ $> .@?`> "p @ |,@(` &@@$` H /f * ' > aA!H 0` 4`H /f * ' ` 5`H p@ `$`$@$`4` b H /f * ' > !ؐ! $`$b $`$H 0`$ (` $`4`$`0$`($`,$`<$`8`  `0  $` %`` @@&8$@u@ ?' ' 4l$@ ~,@(` &@@$` H /f * ' > !!H 0` 4`H /f * ' > p 2H p@ `$`$@$`4` a_ H /f * ' > !ؐg! $`$b _ $`$H 0`$ (` $`4`$`0$`($`,$`<$`8`  `0  $` %`` @> c&@`@ },@(` &@@$` H /f * ' > !!H 0` 4`H /f * ' > p 2H p@ `$`$@$`4` `ܒ H /f * ' > !ؐ ! $`$a ܒ $`$H 0`$ (` $`4`$`0$`($`,$`<$`8`  `0  $` %`` @ > !&@> &@,@ `@ `&@$` (` &@@$`   `L0 @8,'E'  "  ` ' @˜쀢 v@ - HL $Tܒ;`#\  H @ܒ;`#\  H @ bM  L J H"I   @ "@  ` ' @}쀢 1  L   @ "@  @  0'  @ "@ $  ' @N쀢 a0LА `#\#` Ԗ@% 6L $Tܢ#\;`  @ܢ#\;`  @ a̐ " #\L ʀ Hɰ #\  @#/8 Ԗ Ԗɔ 8Ԗ Ԁ $TL ܢ#\;`  @ Śܢ#\;`  @  a " #\L  H"~ #\@" 2s     8 `    $ 0@  "@` L>   ?# DܑH /f * ' > ! C!H 0 2H /f * ' > p 2H p@ """2 _ "'"  '>  ؒ`" Ȑ '#@ #` L0 @X8,'E'  "  ` ' @) `@ - HL $T;`#\  H @  ;`#\  H @   `  L u H"o   @ "@  ` ' @   L   @ "@  @V  `z0='L `#\#` @$  3L $T#\;`  @  #\;`  @ ~  `G L  H @" `X ` t $TL `#\;`  @ F `  X```4#\;` @ 2  _ `L  H`@"J 2     8 `  4`    $ 0@  "@@  L`  ?#@DH /f * ' > ! !H 0 2H /f * ' > p 2H p@ """2 ]w "'"  '``  4 `"`  4 `+':  @  $$ : @ $ $   ;`@; $ $ $ $ $ $ ($ $$ 0 $ ,$$  $ $ $  L  0  @X 8 ,'TE'P  "  ` 'PTP @kL `L@ - H L & T<8;`#\  H @ :@<8;`#\  H @ -@^  T L vH" T  P@ "@  ` 'PTP @&L L ;  L 0T  P@ "@  PT@  ^'P L0 `#\#` 4@"a 3 L & T<8#\;`  @ ̚@<8#\;`  @ @^ L  H @ ٔ 4ܨ 4#\& T<8;`   @ @^_@ <    8 `    $ 0@  "@`/ <L   ?# /D ! /!H 0 2H /f * ' > p 2H p@ """2 [ <"'<" < '8< 8 0" 8``0'8R   "?  #`,#` #`#`#` #`(#@#`#`#`#`#`$㾰L0 @X8,'TE'P  "  ` 'PTP @L `L@ - HL $T<8;`#\  H @ Ԛ@<8;`#\  H @ ǚ@ ]  TL u H"A T  P@ "@  ` 'PTP @L L Ք L 0T  P@ "@  PT@2  ]V0'PL0 `#\#` 4@  34L $T<8#\;`  @ g@<8#\;`  @ Z@ ]# L  H @tΰ  \, 4 V(  4 O$ 4 H 4 ^@4 $TL <8#\;`  @ @<8#\;` p @ @ \ϐ L  H@  2y <    8 `    $ 0@  "@` <L>   ?# D !!H 0 2H /f * ' > p 2H p@ """2 ZQ <"'<" < '8<>  > 8`" 8, '8"(" "c!$"" "x L! , & T;`#\  @e `;`#\  @Y` \"  L 2 H x T ,  L & T L ;`#\  @3 `;`#\  @'` [  L 2 H 8`2 < X <`"  @ <    2 @&  @  @x  `   @" vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapnfsconnfscon sotype㿘`$P P TfDX P R $\  2H /f * ' > !q!H 0 )>  2H /f * ' > p$ 2$H p@ """2 Y-  "  " n/  H /f * ' !+!H 0    4 H /f * ' > p" 2"H p@  $ $$ 4 X   $  ** 2 " eZ H /f * ' !!H 0 2H /f * ' > p$ 2$H p@ """2 X  " " m  @ \ O 906`fɐ 1H /` * !  &$`$ #>>!X "*bp `"$ 2 ``<@  2 $`>  4$H 00H 0`A>!X*@ 44^4^4T  ࠖ!ऀ * ! !ऀ *  * " > "x `"H H /f * ' > !!H 0  4 H /f * ' > p$ 2$H p@  $ $$ 4  W֒   "@ ?$ cl֔  R `2GࠑH /f * ' > !ϒ!H 0    4 H /f * ' > p$ 2$H p@  $ $$ 4 W   " $  l !a* *` p2 #>aX> \ @ |@4@4\* $l$$$x$t$p$$$$| $ ?4H p@@/㿘 %> @( #>?  bp И   >  `" `2@`$ @"`$@`2` 㿘 P & Pk dnfs send error %d for server %s nfsd send error %d 㿘$ "Y D P 2 ? @&$Y : &$\ R    " V` @? ` e !> `  $  @  &$>`@   ? # 2 short receive (%d/%d) from nfs server %s %s (%d) from nfs server %s impossible packet lengthEgad!! receive error %d from nfs server %s `>  &"@  T "  P@g 9   $`@ 0- P`@%> " 沒  Y4``$` `W   ? " @p 0 $ @2 @i  s}x ̖А  ''?''''''آȲ @'Ȑ   gH #   # $  #"'Ȁ 耢    " >a     w *@  ! ' > >aȔ  ֐ b ' @'Ȑ  g  #"'Ȁ "'Ȁ?"'Ȁ L耢H>  a̘ "   > !'''آĀ !Ā Ȓ 'ȐfښĀ`W͐ #   # $ = #耦 "Ȁ  > ː"  " " '̀ G E?D W  & > b `  @g / " 0*2. ,    А"@'''̤آ'Ȑ fz # $ 倦 #"'" '̀ "W`&@ƒ nfsreply nil㿀> "@r  @  @  ? #\ P2 $$` "W&  '쀣`' '  @a䀢 W$> #  !(`W%!($>  `> 1>##` 2@` 2@>$` $``耢`]$`> c * * " `4* " `4*` ` dl|` *`l |  :    : *`l |  :    >  `4*` ?*  `4*` ?*    d  h` $ (`$ "`8"@ #`  ?"@$#4`$< @@@ $$`$ ?$`$$`$ #`4* `*` l `8: #@  `# `4* `*| :`#@@ " $`2Z` ` @!$`VH%!$ $2 $  > ؐ#`  is alive againnqnfstry@'D X !'H'L'X @Ǚ L$<H$4D    $$  @' $+'ܐ 'Ԫ@   Ԕ@$  "#\#`@#{ ": UH0 W     *  '#lH#\#d#p#h#`ܖL@ ܀`   T <L``"8`$"  ?ܐ" 4 ?"   ?`$$  U "   $ ? "@L$̓*`$ '/> ->   e h$(> $,`$8 $$$$> "a$  "aH /` * ! `$$""` P ? T  (  @2H 0  \ @  P `  U  \`@+  $ @  !% $` $$H 0 ?$8  H /` * ! `""`" "H $` $$ ?% 2 $ > <`@ ' '   "    'ĖȒĔ @ 2>  @ "> a2 -$> " 2 2  PАT"@T  T$ ` #\@"İ  `Ȓ` Đ " 6   @=Ā 0.'  Ē@ "@ $ 'ĐȒĔ @  k  Ē@ "@ $'ĐȒĔ @ T30W A"& #" FT" @.`7> #> c 㑘 @ > @`` F2nD" X"@\"@` " S  X"@\"`"S4 0 Sݐ +S+ build > MLEN㿈\H /f * ' > !Ē!H 0`#)>  4`H /f * ' > p 2H p@ `$ $`4`$@$`$`$`  Qܒ > "  /H /f * ' > !ؐ! $`$R"w $`$H 0`$(` $`4`$`0$`($`,$`<$`8>  @ $ $` `> `X & &I > >  &   > b.& &` ??$` > ! & & &" &`L @ `@t *  L > `@2`<     @- ꀦu> l?'p '&&& `  `8` ``$`0 `  "  G `  ?$@ 4@ H /f * ' !ђ!H 0 2H /f * ' > p 2H p@ """2 P  $@$   $  & &&& &J KHxy Los & &  8` $0   " G   ?$ 4@ H /f * ' !O!H 0 2H /f * ' > p 2H p@ """2 P  $ $   $   & &s  p& m&k&  8` $0   " G   ?$ 4@ H /f * ' !!H 0 2H /f * ' > p 2H p@ """2 O $ $   $  @&&`%@`"d "> ba "a not responding㿘H /` * ! >  )> > "   $ 2 <@ " 8 $ $ $ ; $ 8h2"d 4>#ؓ*` d *l@ |  :    : *l@ |  :   ` > @*   8 `4 $`$ $  ,@$  (> <`@W $` $ $ , (@& T  $  $`r$ $ ` dl$ , di$ ,P`e?$ 8```d"@`l`h" 4  `V (   $  @6J 沔 Q  "A  `    @     `@  )?' #"&\ "!4`$  $`"` ,  $ $ d$ , d$ ,:  $!$ਐ $$ $!$$ 8 2#    : 0(@(b2*@ *@ b 2`* @ *`B*2< *> Φ@ HB  H`"@8 `8@8 2 HH 0>  |ސ`"`$" @" 耢` *@!(  nfsndlck㿘 `  `@`<*  !)  @@!@'>`ʔ  & ߋ !2>!X *`@@2`@@& nfs sndunlock㿘@@*@>  & *&\nfsrcvlk㿘  *`@! '>  < "  $`@A a2>!X *`@2  $ nfs rcvunlock㿘@*@>>" & *&㿘    "   Y   ?  6  0 $" ?@&  &  &       8 ` $ 0 "&O @4KJ .  Y   ? 4  $ $    $ "  82 `"   0 $  "  $  ` $%` $@`      $  2$ 0 2o Bad kerb verifier Not fullname kerb verifier Kerb nickname short Kerb nick verifier bad P`0`@`,''   " ' ( ' (@  > $`X 0   "    ' @  $`T$`L> "Ȁ@  I>  p@  J  K`2 $`L`$`D `8 L`L ` L2 `D>b8* @$`D!`L> `Ԑ ? $`L    "    @ + 04'  @ "@   ' @  `@! P $`$`$` g  *` "    ' @ e  `4*"`4 *`:  4`@~`!2 '   "  ' @  0> b   x ?  ``&`&` 'MŐ H   Ж`!?''''Ԁ 'ܔ@    @ "@  ' @  }  > `  @ "@ ` ' @ Ę Z  > `aД  &a`L`@$`L` &` >l!v`  @ "@  ' @  %  >G! Q`  @ "@  ' @ l M0P' @c'` *   L``5> `2``< ``    @` 뀦` >  `h@  `l@ ``pĀ@ `&`h` $`D$`T @``L  $`L  $`D$`T  $`0$`@nfs server %s: %s 㿘 " u>a} h`0`V H'`$ 沐`t&`0沒 "'̐'ԔؖИ [̠  #Ѐ2` ##`0%   "`8" $@&`&`8 "&`  2&` @T > `0 9&`0 6&`0沪"ԦؤТ̐ '̒' [ZЀ`  (Ԁ`Д "`( "&`$" &`("    ` #2`0Ѐ Ր  `$ `0 @nfs getstream㿐 0  > H $ 0 < G 8 $ 0    j   `?& &      *   `?& &   8* ?$ 8$ < 0  0 ?$ 0 < !@ F 0 8  $ $ $ <?$ 88  @ .  @ "@ Lh $  < "@&  < ""@&  < 0 #  $ <@֒ 8$ "$ 8$ < 0 ?$ 0 ,  ,@@ 2@"@ 0 "e < ,ڒ ( (` ,"`$ $ ,$ ,V$ (㿘& 0 ". 7 $`2`( 7 & $$`& (T`  $   Р$ ,$ 0$ <`$ @[  &&a K4 nfsd wakeup㿘 0 #> #" 0>  ? `" D `& D܉" 0 2 0> g & 0`"vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map㿘>`>  4<y > "b> Β"X""X"`nfsrcnfsrv cache㿀 <  > x >, P  H >  X b<2  > bؑ*  q'> > Τ"X X @2f   D 2a       8@Ȓ  "U   2ΐ  ` ,  "` "@$$ "@$   >"!X2 a,  )$a, a4 $a4 #`#d#\      a4 $a4  K & a0  $a0,    ,  , Ȑ0 2 X> Ж8#> cВ` "8 4  @% cВ  $c, %> > "X  " #> ,  aP ٢ X     ,  `"  "`   "@`"  "`X"  " " J   @"T H /f * '  > R bp`*@ ?2@  `  TB   `"'  8 ` <"<  8 <"`8> $! ( "4,$0 $   2  "0 > @!' H 0  , $X$ "@" ,  X$  8  `  ,  $ 沐 @,  8 JD $  F4  Xb<2  "ؐ * ` $  X 2  * "`  Xb<2`@"ؒ @ *`"  X2  * $  ,  , Ր 㿘 < h X> b<2  > bؑ*  [> >>a<"#> X @2M   D 2H       8@ R  "<    aP ,   ؟  X  , `,  D*  `"  L 2  * ` T $ 沒 I $ `,    ,  , k0 2 X㿘> "X"> "X` "`  "@`"`$`"@ $ 4 2> "#Ёvmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map㿘H /f * ' > !!H 0  6 H /f * ' > p 2H p@  & && 6  Ff (/ H /f * ' > !ؐk! & $Gc & $H 0 $ (  & 6 & 0& (& ,& <& 8 & &build > MLEN㿐  ?'D'L'`hpH /f * ' > !,!H 0#7>  4H /f * ' > p 2H p@ $ $4$$$$  FD `( / ۑH /f * ' > !ؐ! $$F $$H 0$( $4$0$($,$< $8 " @$ $$ `  ` `8` `$`0 " D %@ 4@ H /f * ' !H 0  4 H /f * ' > p 2H p@  $ $$ 4  ER $$  >a  $ ` !>!  (pb $!'%!!> -> ('b!> -> p `&! %!!a&$@ `$@Ȣ`$@`$@``  $@``L$@L>"* $@`􀦠$`$@K   8 ` $0   " P   ?$G $E H /f * ' !H 0  4 H /f * ' > p 2H p@  $ $$ 4  D  ($>J#$  $ $@@`$@D`` $@D`? $@?`$@͢`,  $@`> "p  8`" $0  @   ?2mH /f * ' a!H 0  4 H /f * '   5 H p@  $ $$ 4  D  (/$H /f * ' > !ؐ%! $ $D $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8$$    8`" $0  @"   ?$8 I &$ @U "$ $ ,? $   8` $0   " G   ?$ 4@ H /f * ' !H 0  4 H /f * ' > p 2H p@  $ $$ 4  C^ $$   $ ɦ`\ $@\$`> "p  8`" $0  @   ?2mH /f * ' 8!H 0  4 H /f * '   5 H p@  $ $$ 4  B (/$H /f * ' > !ؐ! $ $C $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8$$    8`" $0  @"   ?$8   &$ U\ " $,? $ $`$@ d$%`l%`"㿘  "@ "P ` $] @`2`W @@`*0"L H "@` ɔ` `` < B#$@>`&`$`@@`8@``?&`&@"@@`""`&4`&&6 @&nfsm_uiotombuf: iovcnt != 1㿘  > 8@`? ?"۬ Ǫ> "p     8`"   $ 0   @"   ?$ H /f * ' > !ڒ!H 0  4 H /f * '  5H p@  $ $$ 4  A "/$ H /f * ' > !ؐ! $ $BA $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8$ %      8 `"   $ 0   @"   ?$            $  <`  B#$> & ?&"`")"``$p    ` 8``   $ 0   "@ J   ?$@A $? H /f * ' > !!H 0  4 H /f * ' > p 2H p@  $ $$ 4  @ $ % ` @*@` $ '  ''@ nfs S too big㿘 & &@&@'@t q H>3!H /f * ' > !펒!H 0  4 H /f * ' > p 2H p@  $ $$ 4  @K $ $"$  '@&@  " H    ' @"$ $ @ 40$ & &@   "   H &" "@㿘      8 ` $0   "  ?$ ?@"@ ` $   U &$ > "pH /f * ' > !ْ!H 0 4H /f * ' ` 5`H p@ $$$4 ? (/H /f * ' > !ؐ읒! $$@@앒 $$H 0$ ( $4$0$($,$<$8  0  $ $  "@ `?$      ?"@ @&$ n&  &@ 㿘>aX> ?a >  >  > !> "x3> %> '> )> +> -> /> 1> #> $!# #`p&c$$% %b %%& $c d@ !> $ |$ |@  +!> >  " "`">eb㿘> g!>  L"? 6"c"c"  㿈 DX@!  b"  T 0쀢 ` @>`' ``+`D*``*'`H  %'@> a* @`< >#2`  ``4'`8*`" *  * ''􀦠2<" <'$<> ! $8<? > !X$8}ے > $ $$ $8]$$&$$(( /6 & D`& ,& 0X`d-& ` "6 `  & ` & ``     @ > & ``       > H`8& `<& $`@& (`L& 4`P> P& 8.& @` 6 ` & `& ` > `& ` : 2* @* > H`(& `,& $`0*`" *  * & (& (& @`< & 4& 8`@ > P& <  2 @!>  2   8 2   @( >  < @\Ӕ > <>  $T `$!"&$&(" &,&0 㿘 > `  X!`#`@8" < 2` 2      > b`  E"`b̠`( "b ` 2`( `@!`( 2 `  8 `2  ` @( `<  <`` @\] <` ``$!"`&`$`&`(`" `&`,`&`0 㿈\$`  $ΐ$ @  @@"@ $ "| H "K  /2 n `@$  ,@ @`'@ ?",@& & 2Q  $@$ #\$ h0 #`@Ô 2> `< }ِ 4 } `$$ # !$ d$ w 2   @@`  }.}}'  $@d$   !     +" ' (0! , " "   ( #2" 㿘\`@h@    8`   $ 0   " H   ?$ 4A H /f * ' > !_!H 0 2H /f * ' > p 2H p@ """2 < $  $  > c $ #@w    8`   $ 0   " H   ?$ 4A H /f * ' > !!H 0 2H /f4 * ' > p 2H p@ """2 ; $  $  > a $ #@` #@#`,`#@0#`4`#@8#`$@'@@㿘`h    8`   $ 0   " H   ?$ 4A H /f * ' > !u!H 0 2H /f * ' > p 2H p@ """2 ;2 $  $  > c $ "k`    8`   $ 0   "W H   ?$ W4A H /f * ' > !!H 0 2H /f * ' > p 2H p@ """2 :̒ $  $  > a X$ "@`X&'㿘V`&`& ` & L 0>@* &`? /&`&`&`H&`L& `F&$`D 3`  &(&,`&4&0`&8`$&<`(&@`,&D`0&H`4&L`8E&P@>a* @&@`2>> @` *` 0 ` &`&` &@ ?`D&`H*2 @ & `&$`&(`$&,`(?"&0@Ғ#&0`,&4`0?"&8@ɒ#&8`4&<`8?"&@@#&@㿐>  \&`x  2 a F`0 2X `   O` ` 2`c R`` h`+0"za11  d ` &`&R 66     "R   6   $$`       @  H( ``X2 `p `d00 0`2`XH  L`R D>((R   P?# @ >  ( * " **  㿘@D P &@  &` &` 6` V 6 V` `   " V V` Ð`㿘`>  X !`@" < 2!!!!`     vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapcld kerbnqnfstimr㿘@;  @27@> !   8 ̀@8| Ā 2 | 2 &  & &  @& &B  ` Q & @24 #> @2 &|a  &@2 @>aX@  Ē!`  ?2 @  ` "`  "@`"`& "@ ƒ 32  #" nfsd init㾘 @’!2 R> ic "@ '> #>#H`$# c0 ǘ #`H@ 4 N!6` { 0 D'''''q %@ " X xra쀦  @ @ $ ` @  `{  Z `'Z)  @ܰ`{ | @ À   `0 "@@" *  L    @2  <      ے  逤  >!`@ 6 `0 $`@ | 3 `0   3~@ ` `"  "`   "@` "`$`  "  9~   $ |ޔ PT $` 4 $ $ l> $ lpx$ p  xt  |$ h < "$  `   $ ` $ 沐 $ Ḕ`< : $ $` $ ` "@$` @ *  L` $ @ *  L "` @ * " L@{ *  L@$ Ḑǒ``L @"`L@ " `"` $`@  ? 㿘(` R`   > "0`"T@8 T@  !!O "T@80Ӏ 2G` H /f * ' > !ؒ!H 0 2H /f * ' > p$ 2$H p@ """2 6  "@ ?" cK ` `2J`\R 2F`\H /f * ' > !㊒!H 0 2H /f * ' > p$ 2$H p@ """2 6G  " "  KI `\4`^`  ?4`\4`4`  2!@(!$  $ $> ΔH$ "@"$ $   $ $ H /` * ! >"$`$` $ 0H 0 nfsdmbuf siz=%d Bad nfs svc reply㿐'L'H'   H /`   L Q`?"`* ! L  4U!&@Ȓ!L%!%> % "@">a "aL`  #``, 2 @ mL  2  #> g!`!>%> !`% $!! ' ! $! a " 2 > g!`> "H0 ` 2D  $0$D% 2 a ?$a " 0 W  @ ?4$0 9괔 n!>  :`, 4` ,`@c3`+  +` b 2* *> @``C!> 3`+    +`<B  H`" @ 8  2 ` 8      %  0   " h 'H 0 `  `V@4􀢠E> ` "\``"``< ""`8  # ?%  8`& &\!&d`x  2 h!x! 2 Hx | ޴     ?%  "`D "T > ">  H.< 9􀥠2 ! D`>>#Ѐ` !   Dd*` ! !`'!-  < " 6~!>  D#x+   $ " , +>   !@  > p> $ `:$  ``"  8 `  $"   ?ܐ" 4  ?"     " " 6|  "    "   $   "@ 0   < 6  `` @Q <`"X ,H /f * ' > <bpR `*@ ?2@ <`  @C  < `* 8 ` <"<`<8<" 8> $!( "4,$0$`< ?2`<" 0> <͐!ؑH 0 ,  5 @ 妐 ?2! @SH /`* !u > ``@ʔ 5z`,5w`< > Œ '> ``: 0(@(b2*@ *@ b 2`* @ *``B2*`*;@ B H / 4H* !H` @   2 `    H 0vH /` * ! 鼔 "Y   % @% Q L?"`"  "`> "# "@H M 4>a&? "a@ΐ 㿘 0  ? & 0 &   Gi"  `PH /f * '  > R bp`*@ ?2@  `  ?   `"'>  8 ` <"<  8 <"`8> $Ɛ! ( "4,$0 $   2  "0>  ᮐ!ؑH 04 4 $  ! ` "`   "@` "`&  " 4k  3`2 H /`4 H* ! H  "$$$ $$ "@   2 & HH 0㿘 D? & D 0 `"  "`> ""L "@z 2㿘> i# " >結#0$ #> +> /> g)> -> jbH bH 0 ` "`$ "@N 2 2 0 bH$bH$  `$ $ac" %cሐ ?%ሔ  2R!%"@Œ!"`"` "` bH "bH" $ "bH$bH" ! 9 2%@!" "" " "@$ > * (      2 L@" D@ @ D ` 82 ` `>  \"*  `( ` (`"@ ( ` ` `"   !"nfsidl㿘>  `?      +  2  > *" x `` "x %``, '> @'>  g e`> g!%>! $@ § `T ! P`"``"`" ``"@`0 hG ;?!`\H o *@ e  p    0 2 X 0 $ 0   0 @$ 0Z \`t "`tH 0 l 2`\`2` `ax?%`"&ax㿘> V`2 nfsio㿘>    >, `2  ,  )ጐ  8 " "#>!>a  ߖ!ذ? a  >  , @        , 0ጀ 6"ጁnfsauth1nfsauth2㿘\@ %#>>!X@&*  bޘ `<  F@">*@&  !&!& & &  & ú&  2 2 ;>5>X * b `<ݐ@ X`  *@& P "  k *@&' ̐ `$ur * @ & *@&s nfs_getnickauth verf too small㿈`4`>儐  C@6*  耧`> `2``> `h 6@> ``"`& `@"@'@ '` "@&   1  "`t & &" '`l``   `  `p` ``'`l`'`p`'`p`l '`p'' '' x @'\ '   "  ` ' Ƙ܀ ܢ1t~@> `'@ '`@, a,n>! ܀ 6   & ܐ | 3ɔ `"  "`  "@`"`& "@&`&x&h &l&tt&p& & "@& `@y C*  耢` &`@p C*  "` `@h C* " `@b C*  &     " &  ' Ԓ 0''@vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapbuild > MLENp L "'  :  5 @> @> b` "`  D ' R`  ` ?`  ` `8  ``$`0 `  " $S `  ?$@$S 4S      8  `    $ 0@  "@ T?  ?#K?HH /f * ' > !Q!H 0 2H /f * ' > p 2H p@ """2 .  >㶐!X"'" '? @" ' R`#  "  Rsky 찒 r/02`  `8` ``$`0 `  " L `  ?$@ DH /f * ' > !͒!H 0   2H /f * ' > p 2H p@ """2- "'"  '   #  ' r #\#`  N谒 " .#'  @ "@  ' 쯘ܖ 9  ؖ a -؀ 耢 .䀤` `  " 30   4''  4xܖ /' 0b&@ 8 8&`"&`      @ + 3`  &`        @ + 3`  &`      @ aC 3` +  &`c &`$  &`&`&` &`&`&`&`D@ `Tr= Z`r9 ZLar5 X `D`@G .m?p> b` "`  D`R``  ?'𖊠   `8  ``$`0 `  " ``  ?$@`4`     8  `    $ 0@  "@ T?  ?#K?HH /f * ' > !Z!H 0 2H /f * ' > p 2H p@ """2 ,  >ῐ!X"'" '? " `@'R#@` #?` Rqt S  -0#\#`  Ú찒 t .'  @ "@` ' & $@   ܒؔ 쀦 M  @ "@/$0 ' 0 - 08@a >$  $$@a >$ $$@c <$: $$ $-{root/root on %s nfs_mountroot: getattr for rootnfs_mountroot: can't setup swap vpswap on device 0x%x swap/swapswap on %s nfs_mountroot: getattr for swap> > `;  <"А@%!(>b> b@!> @7 P>"8> a&& aȀ  """ h_p Pt >ࡐ#@H /e4>* &>c> j à #> >#(bDbD>#P0 l>chQ> cp@>@lh">|#xl "`<l?"@l$bD%` @, >X# *2 @ %`nfsnfs_mount_diskless: vfs_rootmountalloc failednfs_mountroot: mount %s failed: %d8>!g >.!<@"<@v X    j'''''' +^  @   o$ @ݖ >"(nfs_args: retrying connect nfscon㿘H /` * ! ?` ` ` +@ @  @ &H 0` 0 `, +#>%> |@aXr @ & d|@aX d@6aXaX@|& d|@* "@ d*` @* "@*`& d` " ``0  d& h d& h`"`  ` " `  > & "&   @   4&  @ 4& ` " `$  > & "&   @   4&  @ 4& `@" ``(  <# & $` "  &  4& ` " ``4  $& `@" ``8  $& `@" ``@  $& `@" ``H`?#@$`J6!`@" !`L`?#@$`N6!!! 86!`@ `P`?#@$`R6!`@" !`T`?#@$`V6!!! 86! P "  T 2 %>#>  !>G0` #P  ϝ  &  &$ &( d&, h&0 &4 &8 &@!&H!&L!&P!&T8 l  2p   Hl ? a K Xl * W'>a 6 < "a,  <@@!쀢` D @ b '!Lv9 @4 lp 2.@ Yl& 2$ Z$@@l Y 2$@@@Jږ  2 '@㿘`<@@ *_  !@o!&a$``$`f_>aX> |@$`    $`h$`$`$`$`$`$`$`d`$`$`$`    < $`L4a4a4a4amŒ` ` ``@ה `m Z`m ZaLm X$``  `$`X$`Tή &`L   *.nfsdism㿘!6`  `$%> #> `   ` iw *@$d @$ɐ) `$ K  㿐!`L`  `&@㿘 ` $ X2` 2 d p ` gw ߖ 2h  d 2 X -㿘`(7   $ -002!L&* !K!L&$ !> "kI!L  aL  "k6!LА >!4 Đ     - -vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map㿀 ऒ #\#`   .)Cbuild > MLENpX  b<  `<    ` `> b`P "`P  HeR``  ?'𖊠   `8  ``$`0 `  " `  ?$@4     8  `    $ 0@  "@ T?  ?#K?HH /f * ' > !ӿ!H 0 2H /f * ' > p 2H p@ """2 &|  >$#"'" '? @" 'R`#  " Rk S T (d0    8 `    $ 0@  "@` L`   ?# DH /f * ' > !:!H 0 2H /f * ' > p 2H p@ """2 % "'"  '`  "`   ' <@  2 @2  #2 @2 # #\#`  Ѫ찒 I .'  @ "@ '   ' 0.   ܒ演 쀦   @ "@  '   2 '0@Yؐopen eacces vtyp=%d 8  <   `>܋"F `    zԘ  ": @D"$` < 2   <`  Ē (#$`   "`Ā@"$` < 2   <`   z   @C$`$` 㿘   < #    X!@     @W   4    zw $   ? 4  x X!  ` "3  ! > Q b`D "`D  D 1'R`  ` ?`  ` `8  ``$`0 `  " $S `  ?$@$S 4S      8  `    $ 0@  "@ T?  ?#K?HH /f * ' > !ш!H 0 2H /f * ' > p 2H p@ """2 $E  >#"'" '? " 'R"@` #?Riy   "r &/0`  `8` ``$`0 `  " L `  ?$@ DH /f * ' > !!H 0   2H /f * ' > p 2H p@ """2#’ "'"  '   #  'i+   #\#` ψ찒  .   '䳐 % 0%㿘` `  @? - ? ?2X $?2 X ,?2 X ?#@" X <`y  ? ?"F ,<?`#> ̓*` €e  ,?? $?? ?#@ ??2 ? ??N ?5< X <`F  ` ` ` x  6   <@@B <`?2< $?"`<  ``  x  2` `` @  ?2< ?<@A<@08888p X> !H  "Hb  D`  < /`' R`  ` ?`  ` `8  ``$`0 `  " $S `  ?$@$S 4S      8  `    $ 0@  "@ T?  ?#K?HH /f * ' > !φ!H 0 2H /f * ' > p 2H p@ """2 "C  >#"'" '? "  @'R #? Rgy`  r`$,0`  `8` ``$`0 `  " L `  ?$@ DH /f * ' > !!H 0   2H /f * ' > p 2H p@ """2! "'"  '   #   'g( `?`#@q    8 `    $ 0@  "@` L>   ?# DH /f * ' > !Ύ!H 0 2H /f * ' > p 2H p@ """2 !K "'"  '>  %> `" ᜐ ' `n     8 `    $ 0@  "@` L>   ?# DH /f * ' > !!H 0 2H /f * ' > p 2H p@ """2  ܒ "'"  '>   `"  ' `?p    8 `    $ 0@  "@` L>   ?# DH /f * ' > !ͯ!H 0 2H /f * ' > p 2H p@ """2  l "'"  '>   " ᜒ`' `l     8 `    $ 0@  "@` L   ?# DH /f * ' > !A!H 0 2H /f * ' > p 2H p@ """2  "'"  ' `"  ' ` ?p    8 `    $ 0@  "@` L>   ?# DH /f * ' > !Ӓ!H 0 2H /f * ' > p 2H p@ """2  "'"  '>   " ᜒ`' ` l     8 `    $ 0@  "@` L   ?# DH /f * ' > !e!H 0 2H /f * ' > p 2H p@ """2 " "'"  ' `"  ' `?`?"t     8 `    $ 0@  "@`  L>   ?# DH /f * ' > !!H 0 2H /f * ' > p 2H p@ """2  "'"  '>   # a ' ` `k    8 `    $ 0@  "@` L   ?# DH /f * ' > !˂!H 0 2H /f * ' > p 2H p@ """2 ? "'"  ' `"  ' `$>  r    8 `    $ 0@  "@`  L   ?# DH /f * ' > !!H 0 2H /f * ' > p 2H p@ """2 ͒ "'"  '  ` "  ' `$ `(     8 `    $ 0@  "@` L   ?# DH /f * ' > !ʠ!H 0 2H /f * ' > p 2H p@ """2 ] "'"  '  `"  'l     8 `    $ 0@  "@` L   ?# DH /f * ' > !4!H 0 2H /f * ' > p 2H p@ """2  "'"  ' `"  ' `,>  r    8 `    $ 0@  "@`  L   ?# DH /f * ' > !Ò!H 0 2H /f * ' > p 2H p@ """2  "'"  '  ` "  ' `, `0     8 `    $ 0@  "@` L   ?# DH /f * ' > !S!H 0 2H /f * ' > p 2H p@ """2  "'"  '  `"  'l     8 `    $ 0@  "@` L   ?# DH /f * ' > !!H 0 2H /f * ' > p 2H p@ """2  "'"  ' `"  '     8 `    $ 0@  "@` L   ?# DH /f * ' > !}!H 0 2H /f * ' > p 2H p@ """2 : "'"  ' `"  '     8 `    $ 0@  "@` L?  ?# DH /f * ' > !!H 0 2H /f * ' > p 2H p@ """2 Β "'"  '? c " ` '>  x <`>> @@ *` 0  $`?2$ >  x$ ` ?2$ >  x$ `$ `$$ `(?"$ @#$ `,$ `0?"$ @ #$ #\#` a c .`Q  @ "@ '  G> !   @ "@  ' ٨ .'  @ "@ ' ٓ    Eܖ   'ؒ:ؖ + 0(    X! @  & X <`" <? а  < ̰  'xH( :  8> TZ  Y  2'&T  xO  @ > " `"   ($ I:Z&> b`  `L "`L"` `` ? $ H  `' R`  ` ?`  ` `8  ``$`0 `  " $S `  ?$@$S 4S      8  `    $ 0@  "@ T?  ?#K?HH /f * ' > !Y!H 0 2H /f * ' > p 2H p@ """2   >ξ#"'" '? @" ' R`#@` "  R^sw`  p`0`  `8` ``$`0 `  " L `  ?$@ DH /f * ' > !ג!H 0   2H /f * ' > p 2H p@ """2 "'"  '   #  ' ] `, ?`  ?`  `  8      $ 0@  "@   ?#4     8  `    $ 0@  "@ U?  ?#L?IH /f * ' > !9!H 0 2H /f * ' > p 2H p@ """2   >͞#"'"  '? @# '#@` "]U  ѐ "  #\#`  ä .n . ''|  @ "@` '  .@   ض| "|D `!   @ "@` ' ݘ @  @ H"    "  @  ' ֻ  vxs qR`2  X`@B 2 XT 0q"x qx`F 't  @ "@` ' փ @   t5 t'p  @ "@` ' a @  p  0} 'l l ul& ($R`2  X`@Ӓ 2 XV px x0 `F'h  @ "@` '  ;@   hÔ /h'd  @ "@` '  @  סd  d '`ז`  % `  "($@"& x 2 &x\"EG&c ""W1     X`< ?  ($㿘 `< 2    h 㿘 `< 2    h pX> !T "Tb  D ] 'R`  ` ?`  ` `8  ``$`0 `  " $S `  ?$@$S 4S      8  `    $ 0@  "@ T?  ?#K?HH /f * ' > !´!H 0 2H /f * ' > p 2H p@ """2 q  >#"'" '? " @'R#@` #? RZy` J "r`Z0`  `8` ``$`0 `  " L `  ?$@ DH /f * ' > !0!H 0   2H /f * ' > p 2H p@ """2 "'"  '   #  'ZV `#\#`  찒 " R . "'  @ "@` '  5@   ܒĔ )쀦 )  @ "@` '  @ H0   0p X  =`B " `E p0Al H0=h 09`7> "p> b`X "`X @ , P ͟' R`  ` ?`  ` `8 "``$`0` ` @" $S `  ?$@$S 4S      8  `    $ 0@  "@ R?  ?#I?FH /f * ' > !!H 0 2H /f * '  5H p@ """2   >[#"'" '? @" ' R`#@` #?  RYx  ӌ q0m`  `8`"``$`0` ` @"  J `  ?$@ BH /f * ' > !q!H 0  2H /f * '  5H p@ """20 "'"  '   #  ' X     8 `    $ 0@  "@`  J  ?# BH /f * ' > !!H 0 2H /f * '  5H p@ """2 Œ "'"  ' ` "   '#@ #`#` #@`#`#@#\#`  찒 "| .9'  @ "@` '  (@   ܒӓ ܀   @ "@` ' ѿ  ` 'ؐؒr   @ "@` ' Ѡ @ ߀  ϶ @%@ 2   ` ` `> hX !'T@ ''``?  B'P 'L 'Ԁ`  Ӱ     Ѐ > "p5> > b`\ "`\`Ԑ  ? 4 X ;Ԫ 'R`   ?`  ` 8 "$0  @" $S   ?$$}S 4{S      8  `    $ 0@  "@ Q?  ?#H?EH /f * ' !H 0 2H /f * '  5H p@ """2 O  >#"'" '? @" 'R`$ #?uR༐ + q;9  8`"$0  @"  I   ?$ AH /f * ' !H 0  2H /f * '  5H p@ """2ϒ "'"  '   #  'V8Ԁ`t    8 `    $ 0@  "@` I   ?# AH /f * ' !H 0 2H /f * '  5H p@ """2 a "'"  ' " `' $` $  $P $ n$    8 `    $ 0@  "@` I   ?# AH /f * ' 0!H 0 2H /f * '  5H p@ """2  "'"  '  " ` `'$ $ $ $̔ ֠`L#\#`   .Ԁ    @ "@   '  > !   @ "@  '     @ `?'  @ "@  ' ј x  ܖ Є m܀ d  @ "@  ' Ϋ RL 6@% " "@;` `` b >`&`Ѐ`  'Ѐ2@ "'@#2 `А`T @'@@   T "@T   'ؒؖ ؀`T"`' > Ѐ P"&`h X ! ` "D  > nO2 k - x> l``"l  ? 0 T`` `<  `' R`   ?`  ` 8  $0   " $S   ?$$S 4S      8  `    $ 0@  "@ T?  ?#K?HH /f * ' > !q!H 0 2H /f * ' > p 2H p@ """2 .  (>֐#"'" '? @" ' R`#@` "  RSw  "p0!  8` $0   " L   ?$ DH /f * ' > !!H 0   2H /f * ' > p 2H p@ """2  "'"  '   #  ' S   ?`  ?`  `  8      $ 0@  "@   ?#4     8  `    $ 0@  "@ U?  ?#L?IH /f * ' > !O!H 0 2H /f * ' > p 2H p@ """2    >´#"'"  '? " @'#@` " Rj `  `_     8 `    $ 0@  "@` L>  ?# DH /f * ' > !ɒ!H 0 2H /f * ' > p 2H p@ """2   "'"  '>  " ?*`  '#@ q    8 `    $ 0@  "@` L>   ?# DH /f * ' > !U!H 0 2H /f * ' > p 2H p@ """2   "'"  '>  #> `" ᜐ '#@n#`    8 `    $ 0@  "@` L>   ?# DH /f * ' > !!H 0 2H /f * ' > p 2H p@ """2   "'"  '>   `"  '#@    8 `    $ 0@  "@` L   ?# DH /f * ' > !y!H 0 2H /f * ' > p 2H p@ """2  6 "'"  ' `"  'c#@    8 `    $ 0@  "@` L   ?# DH /f * ' > !!H 0 2H /f * ' > p 2H p@ """2  ˒ "'"  ' `"  'c#@    8 `    $ 0@  "@` L   ?# DH /f * ' > !!H 0 2H /f * ' > p 2H p@ """2  ` "'"  ' `"  'c#@$>  r    8 `    $ 0@  "@`  L   ?# DH /f * ' > !1!H 0 2H /f * ' > p 2H p@ """2   "'"  '  ` "  '#@$`#@(#`    8 `    $ 0@  "@` L   ?# DH /f * ' > !!H 0 2H /f * ' > p 2H p@ """2  ~ "'"  '  `"  'l#@    8 `    $ 0@  "@` L   ?# DH /f * ' > !U!H 0 2H /f * ' > p 2H p@ """2   "'"  ' `"  '#@,>  r    8 `    $ 0@  "@`  L   ?# DH /f * ' > !!H 0 2H /f * ' > p 2H p@ """2  "'"  '  ` "  '#@,`#@0#`    8 `    $ 0@  "@` L   ?# DH /f * ' > !t!H 0 2H /f * ' > p 2H p@ """2 1 "'"  '  `"  'l#@    8 `    $ 0@  "@` L   ?# DH /f * ' > !!H 0 2H /f * ' > p 2H p@ """2 Œ "'"  ' `"  '#@?     8 `    $ 0@  "@` L?  ?# DH /f * ' > !!H 0 2H /f * ' > p 2H p@ """2 W "'"  '?  " F`'#@D 2  #`    8 `    $ 0@  "@` L   ?# DH /f * ' > !(!H 0 2H /f * ' > p 2H p@ """2  "'"  ' ` "  `'> @ > 0*`  >  x$$ $ $ $$ (?"$ @v=#$ ,$ 0?"$ @v4#$  #\#`  찒  . `  @ "@` '  @ C`!  @ "@` ' ʘ @  @ q Hڀ     " @  ' Ũ  X`'  `/  @ "@` ' ň "@@   @ "@S  T T 0~'䀦 ؖ 'ؒ! s؀`"F  @3  ` d  @ "@ ` ' 7 G> @!    @ "@` '  -  ` @ `?'  @ "@` '  @  ưЖ   Ѐ쀦 "Ff @4h&@zג  ` 2` " FN㿐  x FAh X  ' b   \  X (> "``"``  ? ( L` `< 'R`  ` ?`  ` `8  ``$`0 `  " $S `  ?$@$S 4S      8  `    $ 0@  "@ T?  ?#K?HH /f * ' > !ߒ!H 0 2H /f * ' > p 2H p@ """2   (>D#"'" '? @" 'R`#  " RIw` u "p`0!`  `8` ``$`0 `  " L `  ?$@ DH /f * ' > !]!H 0   2H /f * ' > p 2H p@ """2 "'"  '   #  'I `  ?`  ?`  `  8      $ 0@  "@ `  ?#`4`     8  `    $ 0@  "@ U?  ?#L?IH /f * ' > !!H 0 2H /f * ' > p 2H p@ """2 z  >"#"'"  '? @" '`#  "` H`  T dc     8 `    $ 0@  "@` L(  ?# DH /f * ' > !7!H 0 2H /f * ' > p 2H p@ """2  "'"  '( `"  ' #    8 `    $ 0@  "@` L>   ?# DH /f * ' > !ʒ!H 0 2H /f * ' > p 2H p@ """2  "'"  '> `  "` 8 `'`H> #> "#  "N## ?#@q    8 `    $ 0@  "@` L>   ?# DH /f * ' > !I!H 0 2H /f * ' > p 2H p@ """2  "'"  '>  %> `" ᜐ '# n#     8 `    $ 0@  "@` L>   ?# DH /f * ' > !ڒ!H 0 2H /f * ' > p 2H p@ """2  "'"  '>   `"  '#    8 `    $ 0@  "@` L   ?# DH /f * ' > !m!H 0 2H /f * ' > p 2H p@ """2 * "'"  ' `"  '#    8 `    $ 0@  "@` L   ?# DH /f * ' > !!H 0 2H /f * ' > p 2H p@ """2  "'"  ' `"  '#    8 `    $ 0@  "@` L   ?# DH /f * ' > !!H 0 2H /f * ' > p 2H p@ """2 T "'"  ' `"  '# $>  r    8 `    $ 0@  "@`  L   ?# DH /f * ' > !%!H 0 2H /f * ' > p 2H p@ """2  "'"  '  ` "  '# $ # (#     8 `    $ 0@  "@` L   ?# DH /f * ' > !!H 0 2H /f * ' > p 2H p@ """2 r "'"  '  `"  'l#    8 `    $ 0@  "@` L   ?# DH /f * ' > !I!H 0 2H /f * ' > p 2H p@ """2  "'"  ' `"  '# ,>  r    8 `    $ 0@  "@`  L   ?# DH /f * ' > !ؒ!H 0 2H /f * ' > p 2H p@ """2  "'"  '  ` "  '# , # 0f#     8 `    $ 0@  "@` L   ?# DH /f * ' > !h!H 0 2H /f * ' > p 2H p@ """2 % "'"  '  `"  '#    8 `    $ 0@  "@` L   ?# DH /f * ' > !!H 0 2H /f * ' > p 2H p@ """2  "'"  ' `"  '#    8 `    $ 0@  "@` L   ?# DH /f * ' > !!H 0 2H /f * ' > p 2H p@ """2 O "'"  ' ` "  '`>> @   0*`   >  x$$ $ $  $$  (?"$ @l#$  ,$  0?"$ @l#$ `` #\#`  찒  .   @ "@  ' P  `C!  @ "@  ' 4   @ ۰ Hڀ     " @  '  XV  /  @ "@  '  `"   @ "@S  Te T 0~'䀤` ؖ 'ؒ s؀``"`=J ``` @)v`  d  @ "@   '  G> !    @ "@  '  -`   @ `?'  @ "@  ' h   Ж    Ѐ`쀦  ( #`7` <Ő  (` ` 2 ``@*"`q) `` 2`" <8   `<  `5 `D ฀ $  Z 2W $+   Q     @$ "    ฀ 2 @(H pܒ  !p `"p" $H   'R``  ?`  ` `8  ``$`0 `  " `  ?$@4     8  `    $ 0@  "@ T?  ?#K?HH /f * ' > !!H 0 2H /f * ' > p 2H p@ """2 Œ  >m#"'" '? @" 'R`#@` " R@"xS  p0`  `8` ``$`0 `  " L `  ?$@ DH /f * ' > !!H 0   2H /f * ' > p 2H p@ """2B "'"  '   #  '? =* ?  ?`  `  8      $ 0@  "@   ?#     8  `    $ 0@  "@ U?  ?#L?IH /f * ' > !!H 0 2H /f * ' > p 2H p@ """2   >L#"'"  '? # @'#@` "?   }#\#`  R찒 " 6l . d  @ "@ ` '  G> @!    @ "@` '  - ` @ `?'  @ "@` ' y @  +ܖ   ܀` 2`" 㿐   XX @     "!` X@ 4 "` D (`  `2` <  @% 2`9 `` ```#\`@6#` <`   < (3(19 9 999 " 㿐`` #`` `#\@pX> !@ x" ?` "x   H ђ 'R``  ?`  ` `8  ``$`0 `  " `  ?$@4     8  `    $ 0@  "@ T?  ?#K?HH /f * ' > !)!H 0 2H /f * ' > p 2H p@ """2   >#"'" '? @" 'R`#@` " R=CyS  q0`  `8` ``$`0 `  " L `  ?$@ DH /f * ' > !!H 0   2H /f * ' > p 2H p@ """2c "'"  ' `  "`   '<   ?`  `  8      $ 0@  "@   ?#     8  `    $ 0@  "@ U?  ?#L?IH /f * ' > ! !H 0 2H /f * ' > p 2H p@ """2 Ȓ  >p#"'"  '? # @'#@` "<'   Ӏ R`   ?`  `  8      $ 0@  "@ S`  ?#S`4S`     8  `    $ 0@  "@ U?  ?#L?IH /f * ' > !\!H 0 2H /f * ' > p 2H p@ """2   >#"'"  '? @" 'R`#@` " R;ux`` q`0    8 `    $ 0@  "@` L   ?# DH /f * ' > !ْ!H 0   2H /f * ' > p 2H p@ """2 "'"  ' `  "`   ': ` ?`  ?`  `  8      $ 0@  "@   ?#     8  `    $ 0@  "@ U?  ?#L?IH /f * ' > !:!H 0 2H /f * ' > p 2H p@ """2   >#"'"  '? # @'#@` ":V  Ґ #\#` `\ 찒 "6 .  @ "@ ` '  > @!    @ "@` '  ` ` @ `?'  @ "@` ' ˘ l@   ܒ} `܀`  @ "@ ` '  F@!@   @ "@` '  - ` @ `?'  @ "@` ' m @  ؖ   ؀` 2` 2`" " p  X   X b  `i8 4̰ 4)Ȱ `  `R> |`"|`  ? D   'R`  ` ?`  ` `8  ``$`0 `  " $S `  ?$@$S 4S      8  `    $ 0@  "@ T?  ?#K?HH /f * ' > !h!H 0 2H /f * ' > p 2H p@ """2 %  >͐#"'" '? @" 'R`#  " R8x  q0C`  `8` ``$`0 `  " L `  ?$@ DH /f * ' > !!H 0   2H /f * ' > p 2H p@ """2 "'"  ' `  "`   '8    R`   ?`  `  8      $ 0@  "@ S`  ?#S`4S`     8  `    $ 0@  "@ U?  ?#L?IH /f * ' > !H!H 0 2H /f * ' > p 2H p@ """2   (>#"'"  '? @" ' R`#  "  R7ax``ݒ "q`0"    8 `    $ 0@  "@` L   ?# DH /f * ' > !Œ!H 0   2H /f * ' > p 2H p@ """2 "'"  ' `  "`   ' 6 ` {S ?`  ?`  `  8      $ 0@  "@ `  ?#`4`     8  `    $ 0@  "@ U?  ?#L?IH /f * ' > !$!H 0 2H /f * ' > p 2H p@ """2   >#"'"  '? @" '`#  "` 6?` `  "`ː`` #\#`  찒 "6` .'  @ "@  '  n ܒ   i`  @ "@   ' ǘ G> !    @ "@  '  -`    @ `?'  @ "@  '    @ؖ 1  `؀`(`ey  ` 2`" ` " 0d " h>  Xa h   b"h@g-  ?`  L (`  < 8 `' R`  ` ?`  ` `8  ``$`0 `  " $S `  ?$@$S 4S      8  `    $ 0@  "@ T?  ?#K?HH /f * ' > !!H 0 2H /f * ' > p 2H p@ """2 L  (>#"'" '? @" ' R`#@` "  R4w % "p0`  `8` ``$`0 `  " L `  ?$@ DH /f * ' > ! !H 0   2H /f * ' > p 2H p@ """2ʒ "'"  '   #  ' 43  n`  ?`  `  8      $ 0@  "@   ?#4     8  `    $ 0@  "@ U?  ?#L?IH /f * ' > !q!H 0 2H /f * ' > p 2H p@ """2 .  >֐#"'"  '? @" '#@` " 3 `  p`?#@q    8 `    $ 0@  "@` L>   ?# DH /f * ' > !!H 0 2H /f * ' > p 2H p@ """2  "'"  '>  1> `" ᜐ '#@n#`    8 `    $ 0@  "@` L>   ?# DH /f * ' > !{!H 0 2H /f * ' > p 2H p@ """2 8 "'"  '>   `"  '#@    8 `    $ 0@  "@` L   ?# DH /f * ' > !!H 0 2H /f * ' > p 2H p@ """2 ˒ "'"  ' `"  '##@    8 `    $ 0@  "@` L   ?# DH /f * ' > !!H 0 2H /f * ' > p 2H p@ """2 ` "'"  ' `"  '##@    8 `    $ 0@  "@` L   ?# DH /f * ' > !8!H 0 2H /f * ' > p 2H p@ """2  "'"  ' `"  '##@$>  r    8 `    $ 0@  "@`  L   ?# DH /f * ' > !ƒ!H 0 2H /f * ' > p 2H p@ """2 냒 "'"  '  ` "  '#@$`#@(#`    8 `    $ 0@  "@` L   ?# DH /f * ' > !V!H 0 2H /f * ' > p 2H p@ """2  "'"  '  `"  'l#@    8 `    $ 0@  "@` L   ?# DH /f * ' > !!H 0 2H /f * ' > p 2H p@ """2 ꧒ "'"  ' `"  '#@,>  r    8 `    $ 0@  "@`  L   ?# DH /f * ' > !y!H 0 2H /f * ' > p 2H p@ """2 6 "'"  '  ` "  '#@,`#@0#`    8 `    $ 0@  "@` L   ?# DH /f * ' > ! !H 0 2H /f * ' > p 2H p@ """2 ƒ "'"  '  `"  'l#@    8 `    $ 0@  "@` L   ?# DH /f * ' > !!H 0 2H /f * ' > p 2H p@ """2 Z "'"  ' `"  '#@XJ ?  ?`  `  8      $ 0@  "@   ?#4     8  `    $ 0@  "@ U?  ?#L?IH /f * ' > !!H 0 2H /f * ' > p 2H p@ """2 迒  >g#"'"  '? @# '#@` ".  ` `ꪐ2    8 `    $ 0@  "@` L>  ?# DH /f * ' > !|!H 0 2H /f * ' > p 2H p@ """2 9 "'"  '> > ` "  'D x@$$ $ $ $$ (?"$ @W#$ ,$ 0?"$ @W#$  #\#`  찒 "` .`   @ "@` ' D @`C`!  @ "@` ' * @  @ Ѱ HĀ    " @  '   XA  `/  @ "@` '  `"@@   @ "@S  T[ T 0h'䀤`  'ؐؒ ]  @ "@ ` '  G> @!    @ "@` '  -`  ` @ `?'  @ "@` ' t @  &Ԗ   Ԁ`쀦"'ސ\Z  `` 2` " 'ѐ " h > `  X ?a  d' "db $ H  < $ ' R`  ?`  ` 8  $0   "    ?$ 4      8  `    $ 0@  "@ T?  ?#K?HH /f * ' > !|!H 0 2H /f * ' > p 2H p@ """2 9  >#"'" '? @" ' R`#@` "  R+xS  p0  8` $0   " L   ?$ DH /f * ' > !!H 0   2H /f * ' > p 2H p@ """2嶒 "'"  '   #  ' + 籐  ?  ?`  `  8      $ 0@  "@ `  ?#`4`     8  `    $ 0@  "@ U?  ?#L?IH /f * ' > ![!H 0 2H /f * ' > p 2H p@ """2   >#"'"  '? @# '#@` "`*w   ] ?`#@q    8 `    $ 0@  "@` L>   ?# DH /f * ' > !ђ!H 0 2H /f * ' > p 2H p@ """2 䎒 "'"  '>  %> `" ᜐ '#@`n#`    8 `    $ 0@  "@` L>   ?# DH /f * ' > !b!H 0 2H /f * ' > p 2H p@ """2  "'"  '>   `"  '#@    8 `    $ 0@  "@` L   ?# DH /f * ' > !!H 0 2H /f * ' > p 2H p@ """2 㲒 "'"  ' `"  '#@    8 `    $ 0@  "@` L   ?# DH /f * ' > !!H 0 2H /f * ' > p 2H p@ """2 G "'"  ' `"  '#@    8 `    $ 0@  "@` L   ?# DH /f * ' > !!H 0 2H /f * ' > p 2H p@ """2 ܒ "'"  ' `"  '#@`$>  r    8 `    $ 0@  "@`  L   ?# DH /f * ' > !!H 0 2H /f * ' > p 2H p@ """2 j "'"  '  ` "  '#@`$`#@`(#`    8 `    $ 0@  "@` L   ?# DH /f * ' > !=!H 0 2H /f * ' > p 2H p@ """2  "'"  '  `"  'l#@    8 `    $ 0@  "@` L   ?# DH /f * ' > !ђ!H 0 2H /f * ' > p 2H p@ """2 ᎒ "'"  ' `"  '#@`,>  r    8 `    $ 0@  "@`  L   ?# DH /f * ' > !`!H 0 2H /f * ' > p 2H p@ """2  "'"  '  ` "  '#@`,`#@`0]#`    8 `    $ 0@  "@` L   ?# DH /f * ' > !!H 0 2H /f * ' > p 2H p@ """2 ୒ "'"  '  `"  '#@    8 `    $ 0@  "@` L   ?# DH /f * ' > !!H 0 2H /f * ' > p 2H p@ """2 A "'"  ' `"  '#@    8 `    $ 0@  "@` L>  ?# DH /f * ' > !!H 0 2H /f * ' > p 2H p@ """2 ֒ "'"  '> > ` "  '`8 x@$$ $ $ `$$ `(?"$ @O8#$ `,$ `0?"$ @O/#$ `` #\#`  찒 6  .   @ "@` '  @ C!  @ "@` ' Ř @  @ l H     " @  '   X9"  /  @ "@` '  "@@   @ "@S  T T 0j'䀦  'ؐؒ _؀d  @ "@ ` ' F G> @!    @ "@` ' , -   ` @ `?'  @ "@` '   @  Ԗ ర   Ԁ  ` 2` "   `"`g `` `@ а  `<`2  `" `P`"`SȒ Gp  X   b86S { > t`"t  ? $ H  'R`  ` ?`  ` `8  ``$`0 `  " $S `  ?$@$S 4S      8  `    $ 0@  "@ T?  ?#K?HH /f * ' > !!H 0 2H /f * ' > p 2H p@ """2 ݭ  (>U#"'" '? @" 'R`#  " R# w  "p0!`  `8` ``$`0 `  " L `  ?$@ DH /f * ' > !n!H 0   2H /f * ' > p 2H p@ """2+ "'"  '   #  '"  %, ?`  ?`  `  8      $ 0@  "@   ?#4     8  `    $ 0@  "@ U?  ?#L?IH /f * ' > !Β!H 0 2H /f * ' > p 2H p@ """2 ܋  >3#"'"  '? @" '#  " !  e "u} #\#`  8찒 "6l .d  @ "@   '  G> !    @ "@  ' ~ -`   @ `?'  @ "@  ' _   ܖ   ܀`QJ `` 2`"  Z X "     'hX!< 'l    2 2:& 2 Ā@2 > b`  "`!'d " ư  d@TQ  .O   "@ "" @b ̔ $N p'` > `'p'$ 't'`'|$'?'x'@ x@bl #@2@*@%@   x@l #@" ` c# 9h       &``  `p` ?2* 2 @ Ԓ  'h` h  l > P`   `"  PW  " "@@""@`"<`2 l > d 2  > b`  "`  ""EEK! readdirrpc resid > 0 ``X> "p`'`  к ` "'L'P''  '> `  "`  D   ̐  '`R`  ` ?`  ` `8 "``$`0` ` @" $S `  ?$@$S 4S      8  `    $ 0@  "@ R?  ?#I?FH /f * ' > !R!H 0 2H /f * '  5H p@ """2   >#"'" '? @" '`R` #?`Rny  ̰ r 0`  `8`"``$`0` ` @"  J `  ?$@ BH /f * ' > !ϒ!H 0  2H /f * '  5H p@ """2َ "'"  ' `  "`   '`     8 `    $ 0@  "@` J   ?# BH /f * ' > !a!H 0 2H /f * '  5H p@ """2   "'"  '  " `'     2 p   j     8 `    $ 0@  "@` J   ?# BH /f * ' > !!H 0 2H /f * '  5H p@ """2 أ "'"  '  " `' Д` `#\#`L e䰒 " ~ . ?'  ܒ@ "@ 'ܐ Ƙؖ \   Ԓy QԀ   ܒ@ "@ 'ܐ ؖ ;' ' O0<  ܒ@ "@'ܐ ؖ   ܒ@ "@   'ܐ rؖ      ܒ@ "@ 'ܐ Yؖ ?   ?"`"@ (`  5@@ "@@" "`"@ &``8 3(@@2 &@-5b- ` @&` "@`? "`8 @$@+@@"@@""`"@&` ` `ܐ "  @ ~ 0'܀   ܒ@ "@  'ܐ   ܒ@ "@ 'ܐ ̘ؖ b؀ "&'&'&" /   ܒ@ "@ 'ܐ ؖ 4`?J䀤 > `""@ 5@@ "@@" "`"@ &`      ? P " H0  0` >&!PEEK! readdirplusrpc resid > 0  X  'x't`'Lx # ` ''P'' 'p'l'|'h> `"h 2 \ R``  ?'   `8 "``$`0` ` @"  `  ?$@ 4      8  `    $ 0@  "@ T?  ?#K?HH /f * ' > !!H 0 2H /f * ' > p 2H p@ """2 H  >#"'" '? @" ' R`#@` #?  R S h      8 `    $ 0@  "@` L   ?# DH /f * ' > ! !H 0 2H /f * ' > p 2H p@ """2 ƒ "'"  '  " `'#@`#@  ` 2`#@`#@`#@``#@`t  #@ #``#\#`L r F .'  @ "@` ' ՘ %@       @ "@ `  '  @`'`@'`` l    @ "@ `  '  ` ` ׆ p ?"`"@ @ (`'p 6@@ "@@" "`"@ &``@8'll:+`@@2 '"`p`'p.6".'p`@&` "@?"@@& &h @$@,@@"@@""`"@&`` ` "  @  0r'  @ "@ `  '   ]l  @'"@`@'"```@ ``  "S  Tw T 0;'  @ "@` ' ֘ &@L  @ "@` '  @``@`` ` "    ' W`2 X`@K5 2 XZ'| '.   '|_| '''7 '' (>`0*@  2 '| .x@#  & `@&@  2|x``+|  @ "@` ' = @` ``  "    0z'| '|  @ "@` '  ^@ lb   @ "@` '  A@`?՝ l > p p""@  6@@ "@@" "`"@ &`l#     P ?` #n|j|e H|`  |` > k | 'nfs: sillyrename dir .nfsA%05x4.4㿐` ' F P $@G$``< 2>A#, `  4>cg $` ``*`:  z,``@@ f  `@@  "` `P|@HO hX> !L `""L  $ H 0 `'R`  ` ?`  ` `8  ``$`0 `  " $S `  ?$@$S 4S      8  `    $ 0@  "@ T?  ?#K?HH /f * ' > !!H 0 2H /f * ' > p 2H p@ """2 D  >#"'" '? " @'R#@` #? Rw  p0`  `8` ``$`0 `  " L `  ?$@ DH /f * ' > !!H 0   2H /f * ' > p 2H p@ """2’ "'"  '   #  '+ ӽ~ ?` ?`  ` `8   `` `$`0@  "@ `  ?#@     8  `    $ 0@  "@ U?  ?#L?IH /f * ' > !~g!H 0 2H /f * ' > p 2H p@ """2 $  >̐#"'"  '? # @'#@` "   р`#\#`  |Қ찒 "`` . `!  @ "@` ' 0 @  @ װ H`    "  @  '   z@`"%UR` @ '܀ @4 `F `R `@ ܀ @ D "`ܐ 2 2 X@Gw 2X *Wܰ 0P `-'  @ "@` '  "@   gؖ ؀ @ P 0 'SԖ D `?쀧`@   0'@pX!  > b` "`  DdR``  ?'𖊠   `8  ``$`0 `  " `  ?$@4     8  `    $ 0@  "@ T?  ?#K?HH /f * ' > !|!H 0 2H /f * ' > p 2H p@ """2 {  >##"'" '? " @'R$ #?R S S c0    8 `    $ 0@  "@`  L  ?# DH /f * ' > !|9!H 0 2H /f * ' > p 2H p@ """2  "'"  '  #  '$$ $ #\#`  z찒 z .  @ "@  '  R> !   @ "@  '  9'  @ "@  '  $   ܒ 쀦 &  @ "@ ' Θ } 0А@E^  ٔ !1l㿘  "  `X L F2` $ nfs physio/async㿘  0`  >#h 0  >   0@" l h 0 #? $h㿘    @ nfsfsyncnfs_fsync: not dirtynfs_fsync8  ' X'T!쀠''L'P*  !@ '??    X!@a T`^ H /d4 p* % pI F@ 0 2:q 2ll2?0- $0"@ T: `3`+ +` ;B  2` (`  `d"@ @ :`C 8 @   H 0 n? P&e% ! ,@T: `* 2d #* @ ; DlPF !1@  X 6, `0?c $0M%H /d * % ( t & t0?`$00! $d$`$0H 0Γ,H /d4 p* % p[ @ >0 *L`2M`2J0  $0@`^ H 0` ~P ba>!X *`'0 `> PT 0 2r`T`0 0$0H 0-t0H 0`L 4H /d * % >hH 0` ~JP a >!X *`' p T`\`  ?`2` 㿐   `` #\ s tag VT_NFS, fileid %ld fsid 0x%lx 㿘 > # <j8 <`2>4>a#H 㿘 @  bwrite: buffer is not busy???㿘>  0   0 >ΐ# 0?! @& 0H /d * %  ` 2  \" \`0 "`0 \t "tH p@!@  @ 2 T : `* 2`  *`  0 : d@ "@ & 0 \ l , 0* & 02  0& d ?& 0& ` !1 \ `X ` 0@ & 0,f`2 e` `0 "`08   X <`  <        *  2   㿘 > ` >a3 > # `*"@ *`@ *`# * @㿘 > ` >b3 > # `*"@ *`@ *`# * @8 ` c &>d4 `D` >`X <`> e !" ' ' ""  ' '  )>"(> *` €㿘 > ` >a3 > # `*"@ *`@ *`# * @㿘 > ` >b3 > # `*"@ *`@ *`# * @8 ` c @a > ``$ `*" *  * $  " > ``$ `*" *  * $  $4 `D` >`X <`>ݐ !" ' ' ""  ' '  )%>"(> *` €vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapdev = 0x%x, bsize = %d, size = %d, fs = %s ffs_alloc: bad sizeffs_alloc: missing credentialfile system full %s: write failed, file system is full 㿘'@`  0  %@> @  ? `>"] >" >ݐ"2  Ā "C   ">  `  ̡, <  (@9 d$ 0>  @P9 " $06 2 `@B @9>"@b  a `@ $`$a'@ @P  >@> #  dev = 0x%x, bsize = %d, osize = %d, nsize = %d, fs = %s ffs_realloccg: bad sizeffs_realloccg: missing credentialdev = 0x%x, bsize = %d, bprev = %d, fs = %s ffs_realloccg: bad bprevffs_realloccg: bad blockno%s: optimization changed from SPACE to TIME %s: optimization changed from TIME to SPACE dev = 0x%x, optim = %d, fs = %s ffs_realloccg: bad optim㿐\% `0 e@> @ 2  ?  @  >`0!}`>!H2`>~!` ".`````̡,`< B`(@8Œ d$ $`.` 2 >`0!`W >~ܐ!?  ': @OF "`&0@8@ `dT,@">~!ؒ $d `$6 `2'`<`*`(@8n `̀@#>>a ~`$``<`(ڒ@8] d`̀@`0> b(~`Ԑ  $`>"X`>~u">"@) 3= `d,"`T@X <@ @ 6 `T&?  @ = `$O$0 ""0H@9% @N `>@># .`԰ ffs_reallocblks: unallocated block 1ffs_reallocblks: non-logical clusterffs_reallocblks: non-physical cluster %dffs_reallocblk: start == endffs_reallocblks: unallocated block 2ffs_reallocblks: alloc mismatchffs_reallocblks: unallocated block 3 %d,>!`|' ` $ u  `` `P?'#>`, @Td0@ =: 2 }b&` `d8->, `P " },   T+@>, `T " }T@7^:T@7W:2! Ȥ @Eؖ 2  @Eϖ 2 `*`'x * ?0?0  0'x H @` *` * ?  ?* @*`  & >}0#0? @ H'@6>"!x@֖ '|. |H ` `Td0@ : 2`>|#8Td:@@  >|#``X <@ x  0#\@' % #\@)%8 @  x>a @&@> ` %`   @ >a r  0| `X <@  ``Td0@;: `d,@ "T``Td0@ : 2>>|{#!`>#}8 @դ @xx   mode = 0%o, inum = %d, fs = %s ffs_valloc: dup allocfree inode %s/%d had %d blocks out of inodes %s: create/symlink failed, no inodes free 㿘& Ȁ f<@ 2@k,s@: @?4<@ L @   *@ @ ?*@  >#!$@ "9 X  @ 04 `" >!}a>{!>!}W& &  &&   &  >@ 8>"(|ƒ԰ 㿘 `,`@5`@5`@5  @`"<`b@?\`,`,` cP*  @ 6 `& `&  ` `cP@ 6 `& `&  `  @> < @: , ``8@5, & : , `4 dd  ` `0 @5% &@5  @8  @58 " `,cP*  6& &cL @?  6cP6& &cL @% 6 cP*  @6 `  cP @`  㿘 `\@;^ .? 2J`8`t @  @=``N .?   @=`@4v@4r` `,@;3`@4icP*   6$`  8 cP @ 6``, `X (& * ``*  " `@0 $b `8  `D ``|*"@ *`@ @4%*`?@4! `8㿘  "`,. @@6&@  , `,@:   ݲ``,@"   㿐 .`P@T'` : 0? 8? 4ɰ   A <.@   d, ?췘 @HbU  > #Ԁ  > /  * 0 $ @:aT>6!8@"U    :`c `   ?":@ ؘ 璀 8" # 4@"U   ` :`c `   ?":@ "T T> # *`@ ?#@ #*`@  #@ T>/ @"U.`   ` :`c ` `  ? "(*@* $ $ $̚`P?$̒@` ?"`  , X <@ @#o㿐 .`P  2 02   i d.@   d, ?ߘ @ H bU " #Ԁ     > 0> O ǰ  $ 02 T@ܔ08>   4. `   `@ `@ "`@ I  L@@9X8 .`# 4@"U  ,` :`c `   ?" +@*8`@8  $"@ $ $̗+`P@ $̔  " ,   O0W@  ԰ 0L@.` 4!,`@"U  ,` :`c `   ?" +*@`*@ $ "$ $̀P"$̒@` ""` , ? $@*`    X <@ @"kpos = %d, i = %d, fs = %s ffs_alloccgblk: cyl groups corruptedffs_alloccgblk: can't find blk in cyl㿘'H`  `H@1֐ (8 @8@bU ``@<> 2`X ոP Ѱ| *@1@bU| -TT  @"U"X-  *  @8L@1  @8A@8? @8:@ @1p@,`U` @`@ ,`U`$`@,` @,`U 4 U `@,`U`$`,`U e @8  %`@1<. L -`#\ T * R? ?> "xÖ> wH"2T-`#\  * R@"U`@ 2(`L?2Xe` `:@ $ > "x> w"8@6 6$(x ,`@bU >`@~?@ǐ$Ē$ P* " 0|@0| *@7s@0 $| @7i@7g @7b P@0* @"U@- Ԑ XP * @?4bU -`TT  ?", ``X< H@ ͔ffs_clusteralloc: map mismatchffs_clusteralloc: allocated out of groupffs_clusteralloc: lost block㿐` .`T 6` ° .@   d, ?' @ HbU  " h#Ԁ  h.$     `@ @  @ T.`` `$z#  t# @/"8  @6`:  l:`*  &  *@    p *`    @   A @& @"U)>" # `@) 2`uА!@$ `*@ @/".>"u!( @3>""8uaX@@v0 cg = %d, irotor = %d, fs = %s ffs_nodealloccg: map corruptedfs = %s ffs_nodealloccg: block not in map㿐 .`P  2  .@   d, ?<  0@ H`bU"` cԀ` > 魐   $`@5 `:`b@`\@  ?&:@ W.``0` `:" , `@"U@:@`\@ @/ 2``@"U@ b`\@ @/ 2 ``0># vq>#t @bU " @`\@ *  .`  *># vT>#tِ!$`0 X <@  @͒`@"U@:b@`\@  ?  &+@*` <?$` Ȗ P$Ȕ?"  ,` $`P`$ "`ߐdev = 0x%x, bsize = %d, size = %ld, fs = %s ffs_blkfree: bad sizebad block %d, ino %d bad blockdev = 0x%x, block = %d, fs = %s ffs_blkfree: freeing free blockffs_blkfree: freeing free frag㿐 08 @> @ 2  8T@>  $  >$0!u>$t4!8@.$@ >$ u!P>$!@h0 ni-@   d, ? h0@HbU`  > cԀ > Z 0 $`@40 v`@`bU >@c``@@ ˔ 2 ` >$!xuS>$sؐ!@"U@"``cؒ@@  @`-` $`ĐP $`" |@-|@4L@-|@4B@4@@4;P@-q* `@"U@, Ԑ@ `XPܠ@* @ 4`bU ,`T8?.@  `@"U@:c@``@    " %  : :@ `4?@ T > >-`@"U>$@,``:`c@``@   : *#:@ " ` x t>$s-!"``@@    ?# @ *@ +@ ʘ `$$`$̀ P@$̔ "  `@"U@:c@``@  8 " ?% ::@ @  `@`"U@= c``@@ / c`$8 " $`$8̐P#@$` #@#` ``$`P$`" |@,|@3L@,|@3B@3@@3;P@,q* `@"U@, Ԑ@ `XPܠ@* @ 4`bU ,`T@`T@ @ "@ ,A㿘 X`< @)@! ffs_freefile: range: dev = 0x%x, ino = %d, fs = %sdev = 0x%x, ino = %d, fs = %s ffs_freefile: freeing free inode㿐 ,@*>& !r.@5C wr,   d, ? q0i@HbU   > #Ԁ > c [  $ @5 @bU 6` \ `:   >&!s]LҀ`2 >&qސ" @"U@6`b \  +@* * 0@*$ 0 , $ <P`$Ȕ     " ?$ P$ ?" ,x bsize = %d, size = %ld, fs = %s ffs_checkblk: bad sizeffs_checkblk: bad block %dffs_checkblk: partially free fragment㿐 0  @> @ " $>'  r>'qo @*>' qh @+9@+2*   dࠓ, ?$ 娰?0U@HbU  " #Ԁ "噐 F?@1Ґ0  @"U@# ``@ {>@ .T >@ ! @"U@,   ; # ` ` ` ?#@; 2` ``@ >'p U`?start = %d, len = %d, fs = %s ffs_alloccg: map corruptedbno = %d, fs = %s ffs_alloccg: block not in map㿘 @1j`  ` `, & ``: ``@:bU "@``@`8>#ؓ*   ?"? * @5} +`@"U@ c``@`8#ؑ*@  ?"? * @5] 2 >'#h`q >'pt#" *  &`,:.@"U>>a!    `:`c@``@  `8 "& $  : : @ @*`@  @ + `@ *`8Ӏ >'#q`>'p-# 㿘$l h>`.`# (.> . # (.@.$p@8(& .` . @ ` @  '? 8(! .> @ ?@ !$4/  ".  ". "$ (T  ? .`.`&uid %d on %s: %s 㿘>)` Ԙo vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapffs_balloc: blk too bigffs_balloc: ufs_bmaparray returned indirect blockCould not unwind indirect block, error %d(  P'T'X@3 < @0 ?>)o;!p\" P @*] c ` 40 *:  8 <20 @8<0  D L 0 @ B `> =0#\Tؖ V`X <@  , Td: 0@@#\P + ;   @ = X`dT:@$@  % :  ސ ,   P* :  8 20  0?ᄘ  ":P< D L  @  ?l i0Ŗ#\T` `X <@ P`Td: #\@1E* :  8 D2 0 (0DL TY  ㉘ X'd*@ " TH@)<" @`X <@  #\ @  dT: $@ \`% "@6} x 4>)n! * @' E' > 0T X'Ė 0 2'd, " T<@):H"`@`X <@ 0 #\` @ < *  % '`%  ` ` Z.`2 0  0T Ƒ.`$@*  0 ߐd', <"TH@(`# @`X <@  0*` *  @ޘL* * *` & `& X`.`5.`* 0?2 q H*@  D0TI V$@0 v d'X, "TH@({<" @`X <@  #\@O X* `&| \h"g X 0?՘ Y0 3 'd, " T \H"@GC@  @0`0@ `!"?/`* 0ߜ ">)l!@*X H`&    < T @=$ ! "@ % %!vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapffs_update: bad link cnt㿈>    *`" *   * ''`X`<`   ?%  @    ?%   2     `@% `%   % %  H`B = H  " ఔ% *`" *  * %   ?% e,`4 ! !5 5  ` @/9o`@/2`* g`` @/Ɛ@/&`x``?* `d`0, ژ찒 "`X^0* <@ @( `xU   "`x>,k @/  H* @   `X <`@Bߤ ffs_truncate: partial truncate of symlinkffs_truncate: newspaceffs_truncate1ffs_truncate2ؤ'T'HN  `< `2F   2`<< `< '`X @:`  ` `! " >,k#@&ϐ   !  > & ` @;Ɛ 2@ԭ& (& ,& 4& 0`X <@ 34 > > @,ʐ " !>   Tѐ "   @;?@ʔ>   T  > !`&   C   A?e08° e4   !T#\`D  T  2> @E@!`eT  T !`&    @*e<  2`PJ> @/Z   !T#\`D  T  2h > `P * :  8  2`0 8e<`0e<eD `L @͐`<`T$H@%T૒`T`0ުT`0  : D`P@/ B??'`t$ '`tג$'`0 :` 'L J < X'D? @ "@ "@ ."@ `!&    D# < <>  >  >   TD ?'`t"@ '`t ܠ "@' `d/ @ΚP 2HP` 'H$`0ÐH 'H ~ޠ? -  , # &`P* :  8  2`0 8e<`0e<eD `L H< 'Hٴ K-  G 4`0`P * :  8  2`0 8e<`0e<eD `L > `P * :  8  2`0 8e<`0e<eD `L # >-i   `T:  DH< @'HH D >- 0.@ "i 0>-  D@"iw@> !H" &!&! `&  ?@9ޖ ffs_indirtrunc: bad buffer size㿐  ''P'X    t?P@#0:  t `0" >  `, ",`0`<@ `8$`0$$`T>/i! PsXu"?"`H0 & 0Ԓt, "@@$M*` X <`@ _ 2't?:?&@,  d. ?? 2'0|?@ P @)],  d. ?^ 2'(c  X`0 $`0X"vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map㿐  P @, 4 0*:  8  2 0 @8%< 0%<%D  L '?4 ܸ0 %< H @ & '㿘8>؇/  (-.`>>ᴀ  ': ) @@2 8&/@/8 /`/ 8܀ Disk overlap start %d, end %d overlap start %d, end %ld Disk buffer overlap㿐>"0> g* <" !*  T:` @  ;)>0"4 | 0@2/ | \ *  h 2$ |` @2 | < " | T4 |: $ |>0" <" T;  i3?>0g#( | ˀffs_isblock㿘 8>>10#  >1@ `?>@ *  @ *  *@  `?>@ *` @ `?g pffs_clrblock㿘 8 >  >10 >1.@>@ *` @ *` * * .@ >@+ * .@gQ!@ffs_setblock㿘 8 >  >10 >1 .@>@ * @ * * @ .@ >@+  .@g"!ffs_isfreeblock㿘 8 ">  >10 >1@`?>@*` @*` *   `?>@>   f"vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapffs_mountroot: can't setup bdevvp'sffsroot_device㿐>  >c> ?a̰  >1> b 7 P >1h-#0?>1>2#`k 7 P@   ?"P&T 0%> " "Ȁ@  #a "@a"`!   Ԕ Yz @ D+ @} WARNING: %s was not properly unmounted WARNING: R/W mount of %s denied. Filesystem is not clean - run fsck  _ l W < @ @@N  L Ҁ    Ӏ  @<* $<@p  Ӏ <@2 L Ҁ 2 Ӑ@ $< Ӏ  <@ L Ҁ  *@$< <@0@ E<@B ``  ! U L р 2 <@>2>2!gC Ӱ !hg> Ӏ   @@Y  , #  ,@!$#L    @ `0 @&(&&$&&,钐 < " > `@&  `"<< !!` w 0  v<@@#   `  2   )  Y Z`" @   Y Z`@ $  Y`@ $ @W 4L l D`&@<@"&  L Ҁ,  Ӑ  , #L$Ē  <@   ?, Ӑ@  2ffs_reload: dirty1ffs_reload: dirty2㿈<   ` ֐   א I  >3dɐ#``h ?  " (<  @ ; ׇ? F H%\aT @ 0@eg8  ð N0 ` P##PT##T + ]hh#@40 "0ߢ (@1&@D@4?@I #P8@04$d@*@ ?3 H$ز8@@@ Ӏ @ $ $, @ T$`",@  "Y  X>  dbT @`4    " >3d#x`@'&\༠@'* T @'@'x`?* d0, ǘ Tx@'` H* @ `U`%`@2 X 㿈 ?9 } >  P t  `    + ``<   ? 7 T `h  ͚ " (<' @ _  F HaT%\  O 0@@eg( , L ѐ ?`, Ӑ , `<@>2>2!hdے %L!d֒  %L?    !(!P@!P h !! %` H h h#@0 "0ו'`  ,  4@ %$  ,*     @$$#P 8@ 0 4f%  d@*@  HҔ`' 8@@@%$ Ԁ `` , @ $#T%$`" ,@ &a&`d "`  "` &`h &`h`<%( &`@&`<%`%@%` t %`  d %`$ 8%`(" 6"@t"`" , $#L    ,@$#L!"`Ԓ" @%0=aH 0   @"; B?%0 8 <%0%4 <%0C Ӏ @ %   #P"< #L"9  , , `<@   ?, Ӑ@  #P"# " 쀢    ` ` "  "  &a㿘  *   @ &  %L?&  &%P%, 4&$ 0 *` * ?:   t:`>%0<  @", %0 B >%0 H L8 8   ;`; >%8>%@$ 4$&$$  @&$ 㿘6`<` @`@ @? 9L Ҁ 2` Ӑ` `, @  "#L), ! `  ?"` ך L Ғ  `   p?`#P!} !z !w <*@$<$㿘`< a y` % , `@4  , e  `    ffs_statfs㿘!F aTe\ "`4>7at!(&``0&``(&` `8``̠ &``<`(@9 d$&```,?&``Ȓ D@ &` `T" Z ` Z!La l `D`@,  fs = %s update: rofs mod㿐!` LЀ   LҀ "  >7" b>7a)"0  "2@ X2  <  d%   ` p `@`     2  u32 X@< `` @ 2 2 `@ <@ 2 `ђ`` Q 2` D @5)LЀ`@ڒ 2inode㿐a @) & > j#   c > & X !@! >8@T  I >"` 4$  $$ $$D"?@) " ǐ0q@#༠@#*  @$@#{x`?*  d , /0 "xԱI&@$ H* @ X <@ "T@0$ԙ> j> g"l@Cu " %& $  2, `$ $ X`<2, $, $$  &㿘!`  ` O,`@  F@76  2@ "`"`㿘  ` `4?@ *cP`8`0`4$%``d@*@    H`@А`8$ 2`8&`8 6 `T`d@$&" `h  ,`> `$` `hkHeL?H"Pe, 4H8 H"@"H`:0ӓ0 2ffsino㿈>  2 >>c,T  - #`#d#h> >9aH!#\!   U @@6㿘`  >   -0   -0>   >!>!6Lvmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map%s: modeffs_read%s: short symlink%s: type %d㿀   `>9>9"_b`<`X  @@ 2 ! 2 >9>9"^bЀ ( >9>9"^b0 ΰ 2 4@(0ŀ 2    @ b  '  @#@ `` '*@ :   20 8 <0P  <<  D L 0   *<@* :  @ <> `  ?#\#` $ɚ2 $ ' 4' * :  2' @8D ' D L '?#\#`I ? )% $`@$6`H`H0q ҋ'   b 4XP`8TP " s  % ffs_write%s: nonsync dir write%s: typex' '  >9>:"]b< #  >:&>: &  >:`"=  @ ࠀ  ऀ@0  >:>:#]Œb>:# ]b'   @  e0B  2<e4 <  `@ ` D  2   ,t ߰  ` ࠐ` ?耧   `P@"  e<`0 @ "* $ #\ u<  Bࠞ   ऀ @ D   <@Ƒ '@k` `@`P`* : ࠀ8 2`0ऀ8`0  e8`L @e@@ @ "@&H/c H@l`"`0Ѐ  > `$    "   $ `2o  (  "    "  34  䀢`  i @@  ' @ b % =   ` `   ffs_fsync: not dirtyffs_fsyncffs_fsync: dirty㿘 < 2   "   <@" @А   `?H /d4p* %p  =# 0 $ 0  p _> ` + 0S  0  ><\g X"  P &G  x  0`     0$ 0); 0$ 0H p@ ?0ϔ UH /d * % p  " p +><p ̖ H p@@ ,H /d * % p  k< >< AH 0     `?@ 㿘  @% >  UI!$  vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapsoftdep_lock: locking against myself, acquired at line %d, relocked at line %dsoftdep_lock: lock held by %d, acquired at line %d, relocked at line %d㿘 ? @3 >  `4 >=>= x[v Ȓ[qH /4> * %>  > &4`4 & & "4softdep_unlock: lock not held at line %d㿘 ?>=[H!Ȑ?& H p@ 㿘 ? @,! >  `4 >=>= x[* Ȓ[%>  > 4`4 & & "4softdep_unlock_interlocked: lock not held at line %d㿘 ?>=["А?& ?" " " " "㿘 `&`!H   6 `!K!L  >  ``4& !R sema_release: not held㿘>   `4  > 4 ">=h!]>=Z# &&8?& worklist_insert: lock not heldworklist_insert: already on list㿘> 4 2` >>Z  @ @ :!>>Z 6`  &@" &&`worklist_remove: lock not heldworklist_remove: not on list㿘> 42 >>Z_!P @2?  !>>ZU!p*@6 ` "` "workitem_free: still on listworkitem_free: type mismatch㿘  @ > 4 ">>ݒ!>>Z("   > 4 ">>ϒ!>>Z"0ѐmax_softdepstickdelayworklist_pushblk_limit_pushino_limit_pushblk_limit_hitino_limit_hitsync_limit_hitindir_blk_ptrsinode_bitmapdirect_blk_ptrsdir_entryadd_to_worklist: already on list㿘    > 4 ">>!>>Yː#> 6 ` `&"`& > > #`&" "& > `4" "`4㿈>  > > `" ܀   > ia  z?"a> a   @A> h$"(7 > ia   @ΐa> h$a"(7 > `` '' 3+>   a@> h$"(6 a  @a> h$a"(6    " "'耢'А"@''耢  "?`4   @-> ``ƨ 2? > i> ?```` "7 %s_process_worklist: Unknown type %ssoftdep???㿘!> 4"x>   ```` Z``!`@!` `@ 2@` 4"H > 4 4"4"` V"` W U"`$` Z2 ``" @ ѐ(" @ !" @Đ`" @c>?>?"b>#* >?" X softdep_move_dependencies: need merge code㿘`x "!>>@X  4 " x$ `x`""`  "@`x "`x" &`x " "" $"  x2 4"softflush㿘> i!` '> #>@ ` ``$ ` a 41  ` $ `?$&@!#  $`@ &@`1   `$ `5softdep_flushfiles: looping㿐 [    2?  @ <@ >@W" pagedep_lookup: lock not held㿘> 4 2 >@W#X>  X>  <    * @@    @  2  @2  2 &7 > 2& 4#  $#@ N~ @@ @ N4 $  $ $ $ $ <  8"? 4 #@ $ @ "`$@$ & inodedep_lookup: lock not held㿘> 4 > >AWp!(`> > c *  @  @2  2 &S > iN&> !8@    >  @ݒ  > ٨ > #Ф`4B "#@ O $"  X O ??4 4 < 0$ $ 4 $ $ ,$ 8$ @$ <$ D D$ H$ L L$ P#@ $ @ "`$@$ ?& 㿘> a > > i a* @  @2 2 &  > &"  P  $ $ $ @ $@" $@$ & pagedepinodedepnewblk㿘> i""> "`> #> @ap, @ 8 > "!8 @}>  N) > "`> >B #`  ap>  O) > "c > >B #В`( >  P  )} @> i"a> >B"`8  > >Z#c;3 ffs_mountfs: superblock updated for soft updates 㿀Ӏ U ʻ0Q@ , @6;蠒蛒,@   d, 䰒 ,` H` $ '  '  ' @'P  "  " " $" },@&@c  >BW!h۔  softdep_setup_inomapdep: found inode㿐> 4r$`  { "$>BU#?" ,  @ @Q2  "`$ $"`(""`($softdep_setup_blkmapdep: found block㿐  ">>CU  4,$@ "  "` "`""`O$bmsafemap_lookup: lock not held㿘> 4 >CU `x "  4  Q 2  4*$є  QL  Q6 6 & & & & & $ې`xϒsoftdep_setup_allocdirect: lost blocksoftdep_setup_allocdirect: non-zero indirsoftdep_setup_allocdirect: lost entry㿈 R  <@ < R 4 $ 4 $ $ $ $ $$ 8@$ 8  $ 2>>CU! 4%    $ 4`2 $ 0 4  $ 0`""```"`$ ( ("`,"$ ,`" "`@`" P\ xJ`  > 4%4>CTԐ! <   ۖ쀢 ,L  @"$ 4L$   $  "@ #  4 @B  4T%V0# & 2 > 4D%^>CT"$ $ "" 4 @  41%eallocdirect_merge: lock not heldallocdirect_check: old %d != new %d || lbn %ld >= %d㿘> 82`>DT\!@@ >`$ @>`  > 4%{>D!h` TE`&`$&`$8`2`8 `8&`8&8@{ newfreefrag: frag size㿘`"  8T@>   U>DT"x  ! ? *   U2 2 " X " " " " x ?' ! ` ''  ` * ' 'ߙ' U㿘  T 4@- 4  T 6 6 & & & 0& 㿐\> 4;& <   x ɖ  x x x 4\&@7㿘 !> 4&+ xD&-@setup_allocindir_phase2: not indir blksetup_allocindir: lost blocksetup_allocindir_phase2: blkno㿐 P  >ESi! )>&Eݐ 4 x` ` S2@`  4 x  4&Q  ` G 2>ESA!0&V 2 &0 6  &0`"`  "@ &(("`,"&,`" "` "@ʒ P  &$  &      2  @" > 4&s>ER!P &   & @D"   &   "`$ &  4`H*&# `͐   ! S # S   S 44 $$ T P@   \  T5  T  < ` $ H <l H8&Esoftdep_setup_freeblocks: non-zero lengthsoftdep_setup_freeblockssoftdep_setup_freeblocks: inode busy㿐 >FRr Д  VF p@  p! V  6` &`,  &` &` X `0&`! >`->>` &`(  @ #@ "@ ```  @ "@ "@ `  > &!   @O @H * }   @ܐ@< x `*  d 0, ? >F@m!4 @ x H* @ ֒&   b`&>FQ!  <^@@6 D D`4' ů V'@ϒ `p `p'Y@S(0' "0y#;'`p@   ? 4@4b'@deallocate_dependencies: already gonedeallocate_dependencies: not indirdeallocate_dependencies: Unexpected type %sdeallocate_dependencies: Unknown type %s㿘 x?`>H *` €` !" `> 4'Q>GQg !` 4`  @``  P >` TP@> 4'Y>GQL H H <ߐ` xt x *`$   @ $ *`<@`< `  ` "`  "``$ ` `<5 u 2 ` `"``"``` "@’ N+ x@U& x> 4'`>G` >#*` >?"P > 4'`>G`!>#*` >?"Pΐ `2R`4lllXfree_allocdirect: lock not held㿘> 82` >HP 0 2 ` `(`"`,`,"`,`,`("@` ``"`& `` "` 2`8-`8` `4 < M R㿐   WT  W6 & 6 6  >&  4`X& '   @ '@0 @'ށcheck_inode_unwritten: busy inode㿘 `2A  8 2=  < 29  @ 25  D 21  L 2-   ` ' 6  $`" ( ("`( ( $"@& ,  @"  ʒ O& @   > 4(>HP!㿘   @` 20  8 2,  < 2(  @ 2$  D 2   L 2   2  "  `"  "`  "@ O> ib ?"bhandle_workitem_freeblocks: block counthandle_workitem_freeblks`  !  '`  ' ''`   ' ,?x'''t ?@ $ 0 : 'Ī ` 0 `d,@ @[Ā " 0)Đ'Ĩ? ,@`# 40P* : x |20|8<0<D L ē<  'Ĥڑ, (Ā@>IP >I 8@  Vindir_trunc: lost indirdepindir_trunc: dangling dep㿐     )>tn?  4( + +'`x ( 4  S >  > !> 4(>IN"P S x`(>IN"p( 4( 0? "/ H0t? !:`   , @` d.@  20g'?(0 "0 free_allocindir: lock not held㿘> 82 >JN 2   (`" , ,"`, , ("@  @"  `"  "`  "@ ` ` ڐ`<6 T㿈 'D`00`  P@ג'%< @ X  - @   X 5 5 % ` %  !>5  4)X 15  Y     Y4  4$  Y   !>4 4$  4$)$#> ibb$`"`%b$`x)'Ɛ),`  ` ` 2 b ?# @5  Y쀢`$"`$b$ <U  DIx% > @t*  $` %  @k*   $ " @b*  " $ @[*  $@% = ` `<@44Y)H㿐>)_ 4 e<   `P; X&&  @'<*  - $`"  "`  "@@ *   $` &  @ *   $ " @*  " $ @ *  $@&   2 >` & @ <@  2   <  2 & 4)}free_diradd: lock not heldfree_diradd: unfound ref㿐> 8>KM"h ` "`  " 2  `  -"`  !`   "  `0 *> i"  `0    *@ 6  `"  "`  "@ Y` `0 " > 4)>KLΐ" X㿐@M  ` & `  "` "  ` & > 4^)0"   `"   ` " "  ` "  >` 4& B)@newdirrem: whiteoutnewdirrem: not ATTACHEDnewdirrem: inum %d should be %d㿐>LLp!> a8!> 2  # : $#  @  #  Z $#   4 @  Z6  @6 6 >`X 4& *& '` e< ` `PP; 2`x>`& @ ͒ *  $  2 2  <  2 ) 2  > 4Ò*->LL! @ > 4*1>L!8L  ? ' c 4 $  `6 㿐`  %<`  X   @0  X 4 4 $ $ `   2  2  "   "` & " "> 4h*0Z $  " $ ?# @4 $  "`  $ ` <` `4 < $ < "`<&<$  8%> @ *  $` $  @ *  $ "`@  * " $@  *  $$  <ʒ> 4*softdep_change_linkcnt: bad delta㿐> 4Ò*  ̔ V  @ *>MK:! " 2*؁handle_workitem_remove: vgethandle_workitem_remove: lost inodedephandle_workitem_remove: bad file deltahandle_workitem_remove: bad dir deltahandle_workitem_remove: truncate㿐 >  `   >M@K"p0> `4e*   m 2 *>MJݐ" @  ?* `:  $ 4 *>MJʐ" " 2u+0' ?* `:  $ 4 >MJ" " 2`+!  @ >M@#  M>  " \ Z0# +& 6  &   =  /+,.y0 ߐ @$+2#handle_workitem_freefile: inodedep survivedhandle_workitem_freefile !>! 4` ʒ+P , Ӑ+R`" >NJB!0'< P`   'D 'P'8'࢒ >N!@ Wsoftdep_disk_io_initiation: readdisk_io_initiation: indirdep gonehandle_disk_io_initiation: Unexpected type %s㿘 0@" x>NJ"`i`?` R@>O *` €@V@"Q` !"`>NI" 2 <`(0 "05`` ?*@4` @`"``"``@"@ S.  S!> 4$` 5+` ?# @`4`  H <ـ` ``H <{ H\+`>N`">#*` >?"I `2`;l;<<<;<<<<<<initiate_write_filepage: already started %s: dir inum %d != new %dinitiate_write_filepage㿘 "">OJݐ!07!>6 +ؐ 4 *` $ $`?#>'>O)>O`H   "  4+H IC!h "$  $  4  2`H `ב*``4+initiate_write_inodeblock: already startedinitiate_write_inodeblock: already doing I/Osoftdep_write_inodeblock: lbn order%s: direct pointer #%ld mismatch %d != %dsoftdep_write_inodeblock%s: indirect pointer #%ld mismatch %d != %dsoftdep_write_inodeblock: Unknown state 0x%xsoftdep_write_inodeblock: lost dep1softdep_write_inodeblock: lost dep2㿘 " >OH"" 6 x@ q `H*  @  O>OH"  & t @ 0` D> 0> 4, D S />O)>O->O  @   4<,$>OH"耢  *`(@    4,,* *@  Hs#@ * `X@    4,1 `*@  H^#@  * `  4,8>O HQ#?# @ 4   D W  ` T``( *``("  $`B0@"?  ڀ`X $ : >`   *>!>O@  < 2"@4ʒ,RH#"@ ` >!>O@  * 2"@ 4촒,\H#"@`4쪒,b0B ` ` $ `+ `08 `: 0 `2 `   `(*   *`" : >`  `X ?* "@ 2 4h,softdep_disk_write_complete: lock is helddisk_write_complete: indirdep gonedisk_write_complete: not gonehandle_disk_write_complete: Unknown type %ssoftdep_disk_write_complete: lock lost㿐> 4>QGu h?"'`?` >R ē*` €@* @͒  x" "`"`"`2`"0 2 (`",,"`,,("@@ `2 `$ 0 4  (`" , ,"`, , ("@@` 2 ` 2 $`"(("`(($"@",`2 Ӓ QV x@ Q x` `@4` J x` `@4` C x` !" H>QF ` ֹ <`  S` ?# @``4` $` %>Q@`FԐ 8 0 > ` "` x`>Q` >#*` >?"F  x`BF x` 4`?"?>QF!"`EEH(FG(G`GDH(H(H(H(Ghandle_allocdirect_partdone: dangling dephandle_allocdirect_partdone: lost dep㿘` 4`0 "`4>RFk   D 0  $  2 $ 2   L  2 >RFN!(` ` `  D 2` handle_allocindir_partdone: dangling dependency㿘 7 0 " $>RF$"@ " ` "`  "&  "`"& `H  * " `"  "`  "@ "뿒 Thandle_written_inodeblock: not startedhandle_written_inodeblock: new entry%s: %s #%ld mismatch %d != %dhandle_written_inodeblockdirect pointer%s: %s #%ld allocated as %dindirect pointerhandle_written_inodeblock: bad sizehandle_written_inodeblock: filefreehandle_written_inodeblock: Unknown type %shandle_written_inodeblock: live inodedep㿘 b!?>RE#h! @  6 x@ 7  * `H@ C  . O& `0 > b4 "b4  D2 #>R%>R'>R!>S>S  >REX# 4*`( "cEI *`X@ " cE=(#@  0 آ `"  0`0 2 0> gc "c 0?  4?2`>SE @` 2 0`  4@? 0 8`??`> 00 D" < <`3 Ꙑ`>T T* €  >SD h@h  <@8 <  <>S` >#*` >?"DՐ  <`  ̐ >SDǐ    2  D OOO\OOtO㿘 ` ` 6 `"    ` "`  "<& < "`<"<& `8handle_written_mkdir: bad type㿘 @" >TD  * 02  2  ` 2 `"  `"` " <"  < "` <# <" `"  "`  "@ Yhandle_written_filepage: not startedhandle_written_filepage: attached㿘 b2?>TD2"! @6  `"` " "F  2  <  <   * $ ,?#>T  D(`H   "    ` 3  ` "`  " <#  < "`& < <# `2 ϑ*`"  <`0 > `@ "`@ < 2  $    $`@ "2  `"  "`  "@| N 㿐V >&  4!.   * O.0` ." G& softdep_update_inodeblock: bad link countsoftdep_update_inodeblock: bad deltasoftdep_update_inodeblock: bwritesoftdep_update_inodeblock: update failed㿐> 4ڒ.     . V @U>UCO  V "@ " .>UCB!?# @2   `x蠒 @: D "  菐 < @ ` `4`,`4Ȓ.0@֒ `4.  r`, >U@\!@ `>UB!h㿘" D @6  ` "`& P  "$ $  "" 2 L  Dw L 2 L` "`& P  "@$  H $  H"& H L 2 softdep_fsync: pending opssoftdep_fsync: Unexpected type %ssoftdep_fsync: dirty㿈> >`  4/8  /:`@ >`<  >`D >`L  > 4*/A>VBu H&0`8 `4  X4/H >V` h>#*` >?"BY      $` ``4/Y>VBE @!` `4/n촒  `) N  !     P`*  :   2 0   0 %<`%D  L ` @ђ _̧ `4h/ q  8 2y `4/摰 softdep_fsync_mountdev: vnode not a disksoftdep_fsync_mountdev: not dirty㿘V 2>>VA# 42/ p /'>V 0 %  0 $ 0 0`2 x4W/A   Q 0 ?$ 0 /D/ p א@{  45/softdep_sync_metadata: Unknown type %s㿐`  2 X <@  >J   F  <@A> 4ђ/@F /1 p@   2p4/$ `x Ғ  ?` >X"ē*` € 2 0'@ `Ր4 . 0(` 2 0'@ϒ `!帐4  0 r`( `"` 2` `0'@  4%喒4 V9 `2` h @  a4`A $ @  @Y ~`K '@w B`h`4  0f`o '@^ )`}G4  0M`4> 41` >W`!0>#*` >?"@q  24  @-``4'#`qג` @L  2 p``ư  `( 4`VN `ɒ   `t    ``  `_a$`^l_T^a$a$a$a$`P㿐)> 4 +丒`ߐ|` 腖 l  D%䦒쀤  c0Y 4]`   2  0'@ ܢ 4 ǐ L%x  50+ 4/a   2  0'@j ܢ 4     flush_pagedep_deps: MKDIR_PARENTflush_pagedep_deps: MKDIR_BODYflush_pagedep_deps: lost inodeflush_pagedep_deps: flush failed㿈>   ےa92  a@>Y?T ` 9`4#aR`       @" 㡒a\2t " ` ϒac>Y?! `  眖 2 > 4㿒ar>Y? !@` 2`4`,@ƒ `4%㯒{ ``, ]k2>`4-㛒` `@1`@`* )`` @@`x``?*  `d`, `0 ,*찒 '62 h>Y>!`  +> X`4#Wa6  !  9 > 4 a㿘> !8 * * @^" > 2 : @ > > i"@ >  cİ  "cārequest_cleanup: unknown typesoftupdate㿘>  > `܀(> a8@2 > `4`> 4a˒ =  : > a䀦` g"a> 4⺒aa   Z  `0> > !> ia` > #!#a"> > i!> a` > #!#a "> 4Œa>Z>!h`!>aₐ 4> h> (c  ` "(> @`& "  4!">Z   (ϐb(⮒"b(`?$b(ⓒ" 㿘> #!> h"(`"] "(  > @> c " clear_remove: vgetclear_remove: fsync㿐!>b(- 4> a A > >`a*   #`#` -%>[ #4Fb2 ` " @ 0  >[@Ր 8@p ,0 2 a  `4bHclear_inodedeps: vgetclear_inodedeps: fsync1clear_inodedeps: fsync2㿐>b\ǐ 4>   > # >` *   :  ` ** #`'  `4bj0h>[@!0d> !Ȗ!Ȁ  <@"! 2x  @?  吖 "@<) 儖 "/`"ᩐ`4 ` À@   g >[@9!0 \ ">[@-!@Ȓ DŽ`4G"`@ː`4xbsoftdep_check_for_rollback: Unexpected type %s㿘 > 4'b x V ?` 6>\!*` € 2 D`D  D <`> 9  "5`5  `,  $@ " `&  ``2 > 4b >\` (>#*` >?"<[  2 > 4bq$pqpqqpqqpqpqpqpqsdsdty㿘> 4#) '>\2#  0@$ 0&c 0    c  "  0 逦` 0   0  $ 0drain_output㿘`2 t> 4}c  t > 4!%>\ L`& L##   tԒ ೒#% t 2 L`> 4c(softdep_deallocate_dependencies: dangling depssoftdep_deallocate_dependencies: unrecovered I/O error㿘 0(2 \>\;#`X 4@ >\;#%s: got error %d while accessing filesystem 㿘>] X=vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapmfs_mountroot: can't setup bdevvp'smfsmfs_root㿐>  >c> a̰  >]> b<%> P >]< 0W>]>]! a(! O . 6 $> > b> g⌒ P" 8" " $ $ $`4$ $ q  ?"  .0%> " "Ȁ@  #a "@a"`!  `Ԕ Y ٜ Dɒ@R  㿘\F!T@2& 0@@4! eg8$ >]44> > "8G#!> c?c ?*`@   > g> "b<#c"mfs_mount: dup dev t @<@>  NҀ ` @    jNҀ a<@2].` "̒  i| X!> #?c |?# *`# <@ | F "#>]:# . $# g $|" |$  $  4$ $ $֧ &|x Ԑ!Bx"`Ԓ" @7 Z Y3x Z`" @L( t ?ŏ$ mfsidl㿘! `??`#+>)>^$`@` 2 $`!  #   2  ұ "`耤  ,("  ? *@, &`?2` 㿘؇ ``D@  D@ !LaƔ t -㿘zvmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapmfs_open not VBLK㿘  <`>^9ΐ#ȁ  mfs_strategy: bad dev㿐>    y D `D 2`>_9 `  ` T 0* @   Ho <0  Hj <Ր0" ` 42``@ 0& $"`h 㿘 T 0* @ @ Hnj <& 4 Hnj <& 4 4 "& @ 0(& 0 "    "     2" mfs_close: ref count %d > 1 mfs_close: dirty buffers mfs_close㿘 `$`` 2 $    4 D`>_:!` >_:!D >_` "?>_9"$` mfs_inactive: not inactive (mfs_buflist %p)㿘  ``" >_8"   o 㿘  .  $ tag VT_MFS, pid %d, base %p, size %ld 㿘 >_`#   :M mfs_badop called㿘>_8ʐ#vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map㿘 "   ` "      @  ufs_bmaparray: invalid argumentsufs_bmaparray: indirect block not in cache` X  a쀧 >`` >`8u `'@`L@@?"Ȁ "Đ@  6'Ę .`$*@ `&`" `` 4 @6 * .`( @ 2  @` ` '@6 ( "@ 0 * @ _  z &`L S  0"2`>`8   0$ ,@ $ 0$ T> `,`",  H*Ķ `,`)`( @#@ė.` ?( @ @` '@ @ @ .` H ?( @ "@Đ? 'Ā`В   "$ $,@`&?& 㿘 X!'`& ` X    &@   @ >`   2? (?`?%@6  ""@ "&&& "  @   @ݖ@Z &&:& @S  "  2 2' vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map㿘>ap>    > > "bh">  >   h(  222㿘>  '> %>  @h*` " @ @2 2  ` 0 2  㿘>       T> a>  @ h* @` `2 @`@2 @ T   `2`!@ bh*   & " " &    2   "" vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapffs_inactive: pushing active㿘 > `X    D >b!8’ "3 V 4%  X <`2  @ 2!??@ !   @? &  `!& 6     !`    ઔ `  ufs_reclaim: pushing active㿘> X`"   D >b"m o  @B$   `"@ ͐$  vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapmangled entryi_ffs_size too smallh' <  'Ȑ ' '  ''@ ` ?ǰ  u @   X <`?  0 [ 2@ T/     "Ѐ` `z Ѐ      `Tj Ѐ    ϔ`'@J S ''耦'䀦2 X "X   ?'X`L'`|  `:`   2$`` 8$`$`  *'$`Ԧ@  a:`     > 0'$`  `` "`ܒ'> a` 'ܐ "`` aB 2` * @ `* ' ` "`>` a`:    ٦ `2 H?' H@   >"`@ ``>b@ɐ `"" @$`Q`( * 2   ?"@`@``2' 䀥 '`@2` "' "`  2` @Œ  2`X @`$  "c $` z$`' @$`    `&r܀`| '$`  2L `   @ @ 2D  "@ ` ;  4` `$`taB 2` * @ *  $` 耍$` $`tؐ% $`t $`@$`ta,c` ~ $`$`x А(% w ? @VT@7 ܀ 2`> a` "`` `   `8>b`>b @ `  `  <`$` ` >$`|G B g `!$`t" $`t`` 2X'@  `" "'@a" '@!@ "'@1  '@Ѐ`~  x ,̀' $  g`` 2X`   Y '@ (Q%  L # ݸX `` `,06Ѐ`( %!   0&`` 2X'@  Ѐ ݀ '@ @@B %s: bad dir ino %d at offset %d: %s bad dir㿘 >e`X#P  4[ D`>e2ݐ#xFirst bad Second bad 㿘  ""  @ >e ? @ $>e44#     >e4*# @    J@ `@ &J@J   ufs_makedirentry: missing name㿘`(2 >f2 &`.``S  X`@< 2 ..ufs_direnter: newblkufs_direnter: compact1ufs_direnter: compact2㿈 t  ? `v " X>f2S!X! <@   #\:`  " "  X <@ ":   <@i$"6 Xa`L`H @ X <@b`<@6 "`H2 b`<@&`H:  X X`<2  İ° : 82 t : <`:      X <@      ?t  @ ("`4  `  X ?` <"@  @  t [t@   @̒  : 6>f1u!p66>f1p!4 8 X <@ " : &d  )$x %:  8` ` ۴x @:   ``"㿐` !`:    \ "@ * t !"@  :`   F t "  2`X <@ ` `&`L 0 ``?``&`&`6``X <`@  t  "  $ 㿐`a`:  `  /" X`@ * `?&` X`< " `C䝒0 ` &`6` X <`@L`ۊ` $``   2D ?` ܐ  #\#`#h#d#l   20 ܀ 2,     4 M  .`2M  "  M .2    D4 @8  checkpath: .. not a directory `` ` '= ; 9'܀6  ܀ 21 ?  (  @逢`# ܔ`X 찒 <   #`#\ #d#h#l   m  2>h1L"܀ vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapundefinedgroupuser㿘  X @`!! @d @  " D D 2 !  D@S    㿘`@ؐ`T`#?# @ , @ 6 ^   (,&(&(  6 , 2  @  , @ @N 2   ,  , @ 6 *   (@ 6&( ,   %s: write failed, %s disk limit reached %s: warning, %s %s disk quota exceeded %s: write failed, %s %s disk quota exceeded for too long㿘 @.  (  `" $  2X E! 2S E >X" `>i/"C  $ C`"B  ( >  . Xa ,ఒ@ $ 8! 20  >X">i>i"`/Ö# >   8 $   2 E! 2 E >X". `>i>i"/  4  E 㿘`@`T`#?#ߢ @ , @ 6 o   4,&4&4  6 , 2  @  , @ @A 2   ,  , @ 6 ;   4@ 6&4 ,   %s: write failed, %s inode limit reached inode quota exceededinode quota exceeded for too long㿘 @.  4 , `" 0  2X E! 2S E >X" `>j/"HC  0 C`"B  4 >  . Xa 4ఒ@ $ <! 20  >X">j>i"`.x# >   < $   2 E! 2 E >X". `>i>j".Ė  4  E chkdquot: missing dquotmissing dquot㿘   X>ka!>k*  ` < `  @ `  `X- p*Ha @'أ.''''ܐ ' y` <` @ i @d <  *`< @ &`<@  &@$N" , " 4@#@&$  @ 2` 8 4& < 4$@  `d2`X2`" < dH  ( 2`e   ?-@㿘a. <S @   *@ `   <  d   @@" d2` X2``2 <@6@ $@  C%@?%  ?- @  .`"`<*@&`<㿐! @`    @a p!  @DԀ 6  h     (' 4'   8' <'܀ " (@  $ @ > . ,@   '耢 " 4@  0 @ ؙ. 4> @  '& & $& (䀢 & ,& 0& 4& 8& < ?# @6  4 0@? #ߒ @6  0 2  $ 2  , 2   2   6 ?# @6   6 @ϐ  p! T @Ԁ K6 Ւ   2  $`" 0 (   > . ,@   & 8 0` 4  쀢 . 4> @  & <& ( $ & 4 ?# @6  4 0@:  ?#ߒ @6   6 @r  㿘!  >   ```,``"``5  1 X2  < & d@`     ,` @ `" `` "`@^``$  d2 2 X 㿘>ap>  H > "aX> !h"!h"`dquotfree dquot isn'tp. @>  < `> ' b<> aX *  %> !h 2   *` 2    ` "` "  "@@ϐ' 2 > !h'> ` >>!pܓ*` $$ "$$܀  h  辐 @@2 @ܐ %$܀ h>m*͐"' D ?@" >m*ΐ" ` "` "  "@`"  "` "@@`Ұ@ $@" $@$ @u 4 $ $ 4 .  .`    ?ؘ''Ԣ ''''''ӄ   @ @@Ғ @    T 4 `"  "` "@@6.' 0 2  $ 2   , 2   2  4   "' 8 2  <>  , $ 8 < 2 ' 4> @ $ <'  2 㿘`` ?6`` @`?* ` 6`> &`ah``&` `""`dqsync: dquotdqsync: filep>  `>n*"` 2`] ``* @ >n)"```6`Ԓ `  U : ` `* ``6`  ` ?''''+`'''' АÔ ` " ` "``?# @6` dqflush: stray dquot㿘> "> X*` @ % @>o *`   )|"# "@" 2X @:@vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map 㿐 `   &@㿘  >`#&2  `   " ` !2 K``H    @ #1 %!" 2 &$ )# %wf FF㿘!<`@  `0`4&& 㿘> c  "cn 㿐 `` &` a`@"&\ & F vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map㿘 >`0* @  @  "     㿘 >@`0* @`  @  "  " `` "``D?2"` " <4$ `  2   `"` D=5"> " > H @":H> ""> " > H @":H> "" 㿘  `<`>q (*` €X <` - 2`   @"    ,`! 2 L!èèè   6"> " > H @":H> ""> " > H @":H> """"22" " "D:"$"(","0"4"8"@"< <( " 2 X@" L" : 0( @( :H < "H:P㿘     T ?2  ?2  ?2  ?߰  D? L? #`  @$`  @?c ? $` @ @$`` $` @`  ` @  2X ?" X <`   @ y ?2< ?"" $< "m  " X a "Xa <`^ a  @   R $?2X ,?"5 X <`2E a@O!2 " $ X 7 3 0 $?" ,` $` ,?"a` $`a` , $  ?#  X <`   @ Ւ 㿘 !@ 2 "* "  < b"!  O!  2 d"  < o @ @$ 4  @ b2 @0 chown: lost quota㿘a"a a@2!2@  !2a   2 a !2 a 7a @`@$`@@2a`D$`Da  G? `@/  '? $a $a  2/$a @`@$`@@`Dx$`D  2   1    ]'? $a $aڐ ?@`@M$`@@`DF$`D  Ֆ 0$ >r%b#2`@` $` @ @` 74`   ` ;4`    㿘 `<  ` @2   ` "     ` ̩  ̤ L0ufs_link: no name㾐  $ >s$#< 2 X&y X@q   ߔ 0d`#T ` @J `` `$`4`$`X+<"XkX`<a2   > "``?``$`4`$`X <@"@D "     ,ufs_whiteout: missing nameufs_whiteout: old format filesystemufs_whiteout: unknown op㾐   >t0=*>t0:X`@ B @ -`(2X>t$A!X @`4'>t$:!x `/`` / ǘ X @`4`>t$ !x*  $`  $!`$`ƒ ` ;$`ufs_rename: no nameufs_rename: lost from startdirufs_rename: lost to startdirrename: EXDEVufs_rename: same fileufs_rename: lost dir entry㾈     ''$$2`X>t#Ȑ#X  " X 耤 b耢 \ؐސ0 ` ް  ` ؒ@ , `< ϰ ͸75 ? %>t#t#0 %.쀢`_ [ \ #@ ̒   @ ` @ ͻ  <  :      耢     ͝ g  @J`.@      ̀ J $` ʉ 4   `$4$ X`< ה`X< 2`   J`  ˄  ?`2% # `" i   @2>t"#Pd u  `2w``@>t"#p9 7`#S `` `$`4`$`X!<"X)X`<a2  "``?``$`4`$`X <@(` $`ᅯ   ```?`$`4`$`X <@ "aa`   `ɴ ؐ`@>t@>t"#p`@2`>t"#""`  `" `a@"`a Ͱ `<  ` ° B`  B  < 2  2% ` 2``?$`X`< "`v`?%``X < j#X <@  2 ```?`4`$`` ` 5`%`   !@ a` @萂  8 ? %>t!{#07쀢   ">t!k# 0^@">t!`#  >R",$  %+ ` %`쐂 `В ```q0,``` ?$   ? $4$ X`< 0Eufs_mkdir: no nameh`  `$`>w ##@  !  ԰ 2   $a .$a 2    ; "`  a`  xv04` $`Ԑ "`<4`$`!X <@" c @"` $` `$4$X <@"XKX`<2  2X @`>"(>"@'' '  '"''`''a #\  N `" <`$`Ԓ @"АH$ X <@ Д"`<6 Ԗ"`H 2 Д`<&`HԐ`X< a2`  "X?  <@ 6а  팔ԔА 2 "`Ǟ `!"@!?`$4$X <@"`ԯ`$` $`4` X`<Ԣ ߤ 㿘  @  " @0v  j   f B`R` 2`] B @X   @"`Q)$` ?$ X`<"`WU`|  ` $` `$ X <@/@>) WX <@```$`4`   ?4 $ X  <! @ @?` @ 7 㿀 (`  @ /  "Ӓ @ X @@ 6    <`$ <   #`#\  #d#h#l  Ų Ґufs_readdir: lost in space㿘   !o $" "    2N  "J >y >y" "@"  @ D  4@#@ #@<  ܦ, "@ " @ "D @42 8$    @  2   @8" "㿘 X @@ 2   2  ɐ   z 㿘   Ӧ T㿘   T ӛ`㿘 `( Tufs_strategy: spec㿘` \<? >zT! T P@2 T   T֘ "  T 0h$ 0|$ 40?2 T H@ى <$ @ T?> ` $ D#8*` € 0b tag VT_UFS, ino %d, on dev %d, %d flags 0x%x, effnlink %d, nlink %d mode 0%o, owner %d, group %d, size %lld 㿘 ? >z " 2   l  >z "fV  >z!"! _  <`~ T>zT#( 㿘 >`> `"b#* @㿘 >`> `"c#* @㿘 `D A`  `  ":>  # >  #    >  H`B # ; H  "# ?>  # ">  # >  #    >  H`B # ; H  " ?>  #   ?# >"(> *` €㿘 >`> `"b!* @㿘 >`> `"c!* @㿘 `D A`  `  ":>  # >  #    >  H`B # ; H  "# ?>  # ">  # >  #    >  H`B # ; H  " ?>  #   ?# >"(> *` €`>{ԇ(`  `   ` $` "`     ﴝ㿐   `P` #\ . 㿘< >`c 2 @`!$ <>|!L*` €$ 8`T >  &  @*$ @$ 8$ $`$ 8` 2`H @ $ @`H>   <`H  *` * " *  * " * <`H&||ufs_makeinode: no name㾈$`>|b!p'<& `   0  $a  `$a 2    "` a`  ߐ0q  >$`4`c2 @  " <4`$` X`< "`ǐ`$"a  2  Ӓ "` ;4`@` $``X< a2`  2S} 2@ێ  &ۆ ~`$` $`4`X <@ on P > 2 >X 8>h 8x 8 < "   <  `2``"`<`@ 4$ " @  2 `@" "  2   , `@  " "  @  2  vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapext2fs_alloc: missing credentialfile system full %s: write failed, file system is full 㿘' >}"0 `"/ "  @"' : 2   (@?& $@&&> ,@ $ & :  `$ $   '>}@X>}$"p mode = 0%o, nlinks %d, inum = %d, fs = %s ext2fs_valloc: dup allocout of inodes %s: create/symlink failed, no inodes free 㿘& ` L<@ 2@P`(@?`( >"А@ "2 X  @0- `"ಀ" >}#d>}|#@ɒ > p> ఐ  "p"pp  &>~@>~ gd 㿘& @r  ?&,    $    㿘` ` ` @& ?# ?*  *2` 2  & `.괆<.` (@.?d    㿘  "f. @@6&@  , f@چ   ݲ`f@"   ext2fs_alloccgblk: cg=%d bno=%d fs=%s ext2fs_alloccg: dup alloc㿐 .`&,  `R &?*  &   0q H  $&@ܼ 2 &@R &: * N& : .&@C2  `2 "  @ 6  N "*``@ &N  @ 6 N "*``@ &N @ڒ - :`*N & :   >~#͖$>R  * .  .`&,$ @` ?2` ,& $  cg = %d, ipref = %d, fs = %s ext2fs_nodealloccg: map corruptedfs = %s ext2fs_nodealloccg: block not in map㿐 .`f, `|  ?f*  f _ 0m H`(@ܮ `(: * L& : 5" :`2  @h   @`   >"PHd>͐"p" L*  .`@ *  >"5d>":*  &+@, `<f,?$`  ?2 ,ff,@ ` 2`g`( bad block %d, ino %d bad blockdev = 0x%x, block = %d, fs = %s blkfree: freeing free block㿐   $@ۇ&@ @ > ߐ > @0:&,*`?&*  ,& 0* H  $@&@ `:`*L@ &@ :  @  >!$>7!@ * +,@  &,`$   2 ,&ifree: range: dev = 0x%x, ino = %d, fs = %sdev = 0x%x, ino = %d, fs = %s ifree: freeing free inode㿐 @` 8 (> "$@&,,  ?&*  & F 08`H@ۗ (6`L@ `: 6` >"ДL$L&`6`>͐" @ ` +@*@,@  ,&,`$  <  @ 2&,@ `?2`,&~ start = %d, len = %d, fs = %s ext2fs_alloccg: map corruptedext2fs_mapsearch: block not in map㿘 ``$@A&`$2 `$ `2 " @@  @   > d >l " N@*   *   >"Ւd>Z uid %d on %s: %s 㿘>aؔ$v vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapext2fs_balloc: ufs_getlbns returned indirect blockCould not unwind indirect block, error %d0 ?'T'P'X'`' ` S .` ?# -?* *@ 2 @2@ #?f?Ș RL0ҒP  *` +  2 2 % % $ `% f  'fX*@ `" TH@ <" @  4>"h  * ?c '?** @ 2 @?2@ '#?>' P Pe m% 'Ė f 'f*@ " TH@<" @ 2' @ @*`* @22` +   %   '`%  S `M,`   P ,`%% *  f sf', <"TH@z "`@ `'* @*`@ * ,  2 2` + $ X q,`,`* f?И ~? H+`c **9? @ 2 @2 @ @ 5? E P XX %**` * , @ 2 @ 2 % @+ % `$  ff  f'X, # T H@ <" @ T"@ Xf?f f Ę 'f, " T Tb#@@  @f`@  &D "@* * @f?, ">Q"@*X H`$ @,`* ' f p' 0`@" 0 @$4   " `% % vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map㿘 "   ` "      @,  ext2fs_bmaparray: invalid argumentsext2fs_bmaparray: num=%d ext2fs_bmaparray: numext2fs_bmaparry: indirect block not in cache`X a쀧 >` >#`'@`L@@?"Ȁ "Đ  L'đ.` ?c ?* *2`  $2 * ?&`ܰ `` @ԑ.`   * *  @3`* @ ( 3  2( @ 2 @ `` '@&  ` *` ?# ?*  *2` 2?   >#>7#0 k   &`L d  0"2`># 0$ ,@ $ 0$ T> `,` ", ? H+`c *`*?  2Đ 2 `, `)`( `@#@ė.` ?( @ @` '@ @ @ .` H ?( @ "@Đ? 'Ā`Ւ   "$$,@`&?& 㿘$m?#? ** 2` 2 &@  ** 2` 2 &`  ** 2` 2 &` ** 2` 2 &`   ** 2` 2 &`  ** 2` 2 &`  ** 2` 2 &`  ** 2` 2 &` ** 2` 2 &`  $ ** 2` 2 &`$ ( ** 2` 2 &`( , ** 2` 2 &`, 0 **@ 2 @2@ &`0 4 2`*  6`4 6 @ `2 *`@6`6 8 2`*  6`8 : @ `2 *`@6`: < 2`*  6`< > @ `2 *`@6`> @ ** 2` 2 &`@ D ** 2` 2 &`D H ** 2` 2 &`H L **@ 2 @2@ &`L P 2`*  6`P R @ `2 *`@6`R T **@ 2 @2@ &`T X 2`*  6`X Z @ `2 *`@6`Z \ ** 2` 2 &`\ ` ** 2` 2 &`` d **2`  2 &`d Ș @ @ *`+  3` 2` &`ȁ㿘6 @E?5? ?`. (6`0& @. (6`0& (. 6`6 & 0(6  0(6 (06 Ķ 㿘? @ `2 *`@6@ ?  2`*  6` `( @ `2*`@ 6`  (  2* 6`  <+`( 3  0&` +`( 3  0&` +`( 3  0&`  +`( 3  0&` +`( 3  0&` +`( 3  0&` +`( 3  0&`  d+`( 3  0&`d h+`( 3  0&`h l(+`3   0&`l p  + (33  H&`pvmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapext2fs_inactive: pushing active㿐 > `X  ``D >! "5  21  $ `X <`2      @?>    *`" *  * '' $ $       @   ` 㿈  X`< 2j >    *`" *  ' * ` '` % `"@%    " H`B % = H   ?%   ?%   2 7 ?%  `(? @ߐf,* @@w@f$`?f@*@ f찒 " 0 ?%  f$?@_ H* @ n 0ext2fs_truncate: partial truncate of symlinkext2fs_truncate1ext2fs_truncate2ext2fs_truncate3 'T'H `<?   `X @@    >V @ˣ  `& B&       `&  7    24&(1&& &@ԪD  T`T  2C& @y^@y:`~T "T `&    ( `2&+& @y  TTܚ 2& &@y,@yT$H@3T`DT&T&  : D&@IB??'&2`$ '&2 X$'D'&: 'L   Ȳ? О? ؆??  ? ?  ? ?'@ 6 "@ ."@ `&    DT <P <&  (>  >   T u?'&2`" '& 2 ?"@'  8? @ @ *`* 2 2` &@, @tP 2HP@` 'H&H 'H@ $ն ?# ,+?@ @*` @* 2 2`  &@&H: 'H> 0 D@">  D@"2 & `l >`p >!0&   H "@ & & ext2fs_indirtrunc: bad buffer size㿈  ''X'P    2 ?P@ȏ: '  `0" >  `, ",`0`<@ `8$`0$$`T># PX" `H _ N,2" * @4ߐ 2'2 ??)&@?#, ? @ @ *`* 2 2`  . ??| 2'Ԓ?ݲ@ $P "`@Ւ,  ?c ? + *` 2 3  . ?N 2'`В  X`0 $`0mX"vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapext2fs: e2dir->e2d_namlen 㿘 !@Ȥ?c ?*` * 2 2 &@   .`.`@ȹ``` `6`h     <`  f  2  ??? ?'''''y    4 .p "@ @K'  4?$c* @ ߲ @  E"@&@@: =`  * 2` 2ݠ =    `   2  8#@ #@`  '@ ""@"@mangled entryi_size too smallh ? @' `'' `'    &'& `  @ `X <`? Y [ 2 `Ta/ @ [  "Ԁ  @`˔ ۔Ԁ`   @  5 TC eԀ  @  ` -`& ''耦`'䀦`2 `X @"`X  ?'`X``L  |`"$  @@$   ' $  :`   @7  ' ?@y ' "   :   @ פ  ??'' H@   >"`@  >=x?  %  $ Z 3 ? 2`*  * 2`  ?"  2`''  쀢' '2`   " '耢"  2  @ǀ  "| ? 2` *  $   * 2` ' @j@܀  | '$ ```2D @"@ "<`X <`"1 X *  ?@Ϋ'$  $ t$  $ t؀&'ؐ@Vϒ $ x`$ Ԑ($ ?@z`x ? ? + *2 @ @3 @ $   * 2 $   ?   >W   ?`$ $  @``  $ |`F` @Aߒ ? @"@$ t$ t  2`X&   " "& " & @ "&  &Ԁ` f y `,Ѐ' @$ h   2`Xa   Z &(R$: M @$ 1`X ` `07Ԁ`) @&`  L0&   2`X&  Ԁ @ &@ rec_len is smaller than minimalrec_len % 4 != 0reclen is too small for name_lendirectory entry across blocksinode out of boundsbad directory entry: %s offset=%d, inode=%lu, rec_len=%d, name_len=%d ext2fs_dirbadentry㿘? #`  `  * 2` ` >$!p >!` ? >! >!@? *` * 2 2 >!?@# ?*  *2` 2 >" c> "P direnter: missing nameext2fs_direnter: newblkext2fs_direnter: frag sizeext2fs_direnter: compact1ext2fs_direnter: compact2 %u %uext2fs_direnter: compact2` (&> # ?# ?*  *@2@ 2@ '/ L #` ` < 2 ?` > *` €           //At` < ??> h# :2+    ?К'''Ȕ 7'''''X`X`H  > C#?@T$`$Ě:   @ ? c 2` *   t @ &" `  *`@ @4 @   2 *  "@@ Ĕt@  @@@?>## @ `*`2 @76 ?>  S>ؐ 0#@`*2  *`@ @74 ` $x`@  :` 4 ===8==8==8= =8=(=8=0㿐  t` :   @\ ("" :   @M ?  @ ` *`2@  * 2 3 | `$ 㿐 :   @& @`?# ?*  *@2@ 2@ "` `L %``  <` 2 ?` >"ԓ*` €           * * . `$ BdBlBBtBB|BBBBBB`    2U P` ܐ  #\#`#h#d#l   2A ܀ 2=  $ "?  40 L .`L .2& ?c ?*` +  2 3  ?   *2 @   D 4 @8  checkpath: .. not a directory checkpath`` ` 'G E B ?*# 2< ?  3 ? *  *@2@ 2 @ @`$ #ܒX  ܰ 2'< ߒ  #`#\ #d#h#l     2>Ð >H vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map%s: modeext2fs_read%s: short symlink%s: type %d㿀  ` `>>"b`<`X @@ 2 ഀ 2 >>"b ( >>"b   @; B?`  2`` (`0 2  `@  b   _'@J`    `$' <2@(*@@ ?$ ?'#\#`y  ?yn +%$`@$6`H `HŐ z'` `  b   ` "`Xz`X  <@  %ext2fs_write%s: nonsync dir write%s: type㿐 `>>"@a`< "#  >%> %>" <  @  `а  >>!a>!aȀ`,   : @ @D B?2`<@  `< `` B    Ծ  `    `_ @M   @"* $ ?   D <  B 4       @n%@n@"@@& HՔ`x  y yR  "  %`2@       35%@ @ b $ <@ `  D vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map㿐  f@ɩ' f?w y0 f H @ & 'Disk overlap start %d, end %d overlap start %d, end %ld Disk buffer overlap㿐>"0> g* <" !*  T:` @  ;)>"4 | 0@2/ | \ *  j 2$ |` @2 | < " | T4 |: $ |> " <" T;  5?>#  | ˀvmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map㿘Аext2fs_mountroot: can't setup bdevvp'sext2fsroot_device㿐>  >c> à  >> b  P >u >> a,  P P0J@L  ?"  P07> " "Ȁ@  #a "@a" a "$@ !1  L`  @ @  ?$ @q DՒ 0@) %s: file system not clean; please fsck(8)  l  `<@@"ia N #`@  @  @   :   6:@ڒ  ڐ .`<@0@ N +`<@( `` @u! / 0 +: .6: 6: . @ @&(&&$&&,  < " Ő > `@& y `"`<`< !!`k $ 0] ۔`<@@2@>   "a0B !"d@" L  ` ?+ @"@ @{ Z` Y Z`@@k" N  : .>  &0>"@  ext2fs_reload: dirty1ext2fs_reload: dirty2㿈< հ      ># `h ?  " (:  @T$ $u?  < H `@< "w0n0`  " @Đ$, ? :<` 4 8 `$$$ $@Ů$4 ($ @ŧ$$#$($* ?uV `HȒ, ?@v & "L  X>  dbT: @`i   R " >I#8`(?@Z,* @@@R$`?@*@ u t`?@$ H* @`vՐ2 X 㿈` ?{  >  P@     `<   ?  `h  ' $t  @QH 2  !P @!P  &0&0 @% `H v'  ,: 2 4:4: , " @ľ$, ? :<` 4 8 `$$ $$@Ĩ$4 ( $$@ġ$ $(֐ [  $$,$* ?tH .`H, ?@u' &` &a&`d`< < &`@&`h&`<% %%  2 %  % (% $`&" , 쀢 "u`1  Ԗ   ݒ ڒ &a㿘6` `@C >a` L& 2`@  2 ` : 2` 4 :@ ``< "``" ``L&  `  ?`&,   `<*@$`<$a㿘!  Ē` C  8 ext2fs_statfs㿘!; cS`8 "f> Hf(```L5@`d 1 f  f D/`D    @   +` + *@ " @ 􀢀 񀢀   2݀f f D`D&`f&``@"&` ` &``"@&`@&`` &` `T Z`  Z `@-  fs = %s update: rofs mod㿘! L   >" >."0  .` X2  <  d!   ` p `@`$    2`2 X``s 2f L  > , $0@ 2inode㿐a Ӓ & > !   }& H! @ ! > T i "$ $$ $$$ "( ΐ0Z@´,* @L@¬$ ? @ *@ r` 9s<&@4$ H* @G s$> > h!⯖ " !& $  > p> ఐ  "p"pp$X <` $ &㿐!`  2' F (& ` &`   ` ``@"&ϐ & F   2@ "`"` -㿘   $ tB `H̔$` ras㿘` f   + f`$f* *   t f"f, ? Hif`r/rӐf &f  2Ext2 fs: unsupported revision number: %x Ext2 fs: bad block size: %d (expected <=2 for ext2 fs) Ext2 fs: unsupported inode size Ext2 fs: unsupported optionnal feature 㿘 8?c  * 2p cS " Le ? * *` 2 2 ?> X   *`*   2  2 `> ϰ 0A "?  T @*` @* 2 @  2`  > X  * 2` >  ` @*` @* 2 @  2` ?>  0`2  d @ @*`* @ 2 2` ?  vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map㿘 >`0* @  @2 㿘 >`0* @   @"  @`  #  D?c ?*` * 2 2 # @z @" <@$@`฀  `   㿘   ` "` `` &` `  # > #   >  H @# ; H > #  #  ?#` c#` ?3` 3` #` #`    (*` 20 #`D  ;` #`(#`$ #`0#`, #`8#`4 0#`@ 2#`@ #`<`<( #` 2`X@#` L#`   2`*  *` ;`H`<#@ H;`P㿘     T ?2а  ?2̰  ?2Ȱ  ?İ  D? L?  p< 2XːK X@ÐC    06 #@( %  0"  ` 4 $   \   " `   $ 4 `  Ȓ ext2fs_rename: no nameext2fs_rename: lost from startdirext2fs_rename: lost to startdirrename: EXDEVrename: same filerename: linked directoryext2fs_rename: lost dir entryext2fs_rename: mangled dir`` `  ` `'`'`$``$2`X>"X@  " X@ ؀ ؀  01  `0߰  ` ڀ ( < Ӱ ki` ? %`>"( %@ܔbܐ2  #`@   ` 0     `<  8   *  ؀   ! ܔڒ t ` `J`.`   `  ܔ W $`  vب  ```4`$`  !  ܒ f   ܒ  2%# R "  i N@2>"P @ب  2;  `@>"p #@  ` 4 $   Ȗ      `4 $   谖  il` @>`@>"p `@2 >"""   `"   @"  ԰  <   } ư B € sO       $ 4  ?5 ?*` 5 >W"   ז   % ` ? %`>A"(܀   "`>1"i 0_ >&"JH   4  $  #`#\ #d#h#l    1  >?  >  ?#?*  .@2@ 6@ '#`#\ #d#h#l   n r< 2    ?`5 %   ?%   { v`0 n l ` ?$`ܔ   `` $`4`W0܁ext2fs_mkdir: no nameext2fs_mkdir: blksize`` `$`>  #@  !  ݼܰ 2܄       4`` 4`$`4`# <W4``4$  L  y@ `?# ?*  *@2@ 2@ , '7/` `L  .``  / ./? ?* +  2` 3  '   f? * 2 7/` `L  .`` 2/ .  /#`/#\ #d#h#l    2 X ! @&H $`> $` $`. "` $4 " ``4` $`"@ ~㿘   ` p9  . B  2 % B "  0 `  $ qm4 K 4   q^ `97㿀 (`  @ '@ X @@ 6   5  $  $   #`#\  #d#h#l   㿘 X @@ 2  ഀ 2  {   , 㿐 `   #\   P w㿘< >` 2 > `'$ <>#* €$ 8` "`b y> # & $ 81$ ܐ$``$ 8` 2`H @ $ @`H>   <`H  *` * " *  * " * <`H&|||||x|ext2fs_makeinode: no name㿐$`> !<@& @  a Y0M @ >4  2     4 4 $  " < 4  C   Q  ;4   q  2켔 2@"   &  4  $  㿘   *`?    `?= ext2fs_reclaim: pushing active㿘> X`   D >"  o " _&  ڒ H$  vmmapbsyvm_map_lock: failed to get lock Nvmmapbsyvm_map_lock: failed to get lockAMAP_B2SLOT: invalid byte countamap_lookup: offset out of range㿘> bb?@ >#(6@ & >ܐ#H* @amap_lookups: offset out of range㿘> ""@  >Ð#( 6@@  & >#ؓ.` |.amap_add: offset out of rangeamap_add: replacing null anonamap_add: slot in use㿘> ""@  >#(6@ @ @ > x.` @`>y ``"    > ! €   .`  >b   "  *`"   $  "amap_unadd: offset out of rangeamap_unadd: nothing there㿘> bb?@ >9#(6@`@ @ &` >.!.`@ 2"@ >&"`` @  *` ?.`# `@ `* "`?#`㿘 8`  $   $  $ ` > b   " 2 " $@ $ ?` > "  * @ؖ 0    4@Д# 㿘 8  ?@03 $    ?$  $ ` > b   " 2 " $@{ $ ?` > "  * @?0  ? 4@# vm_map_lock_read: intrsafe mapamappl㿈>>c,T b> >#`#d#h `#\ (  1 㿘> "" >s#( 6>l#(> @?2 `ΐ  ) & ,`&& & $& & &  b, &  b%  &  b  &   b  b  *@ amap_free㿘  >  >!"x ג b Ԓ b ђ b $ ?"> ɒ b>  퍒amap_extend: amap changed during malloc㿘>    "  8  4>#(`@ 2 >#(6@  @   $ ?@̖ 0  $ ? 6  "* @  $@  $*  " * ? ""$  ,`?  b   b $_ b?$ $ b x b s bn  & ># $@  R* $  *K -*  @4 $  *=  * @' $ %$  *. * @    $ $ "* @E  *  % * ?%" b$ $  b b ? b㿘> ""  "  8>##(2 4` @ .1> ` , @ "    !€ &` 0 '> `,   4@  @6 `` *`  €` &`amap_wipeout: corrupt amap㿘  #> ,  *` `@ ?̐c "@@    & & & 㿘`8 28 "*` ` > `b"2   , @@@ݔ@* ` ` @@F` `&`4"@  &`8` > ` ?&` ""` `" ">n#(2> @? `А  (. $ $$ $ $$ $ $  b/ $  b(  $ ! b  $   b  b뾐  L`8   `  &`  $ 0=@6!`4+` @ *`  "  @ `"`@ "@  "   *`"   $ `@&`4?    ? $  ?` `?`4@# ` &`8 ?&` &`4amap_cow_now: non-resident wired page in anon %pcownowcownowpage㿐`8 @V?!->-`@ - `2>#Ò $?`0 2;`(   4`("͔ @   #\   @:)  `  ">@>@@ڐ#@5H- ?$ " `( @@46`(`@&amap_splitref: split at zero offsetamap_splitref: map size check failed㿘> bb?>^#(6 2 >V!@" " 4$>L!h 2 @   &` `" &@㿘  b*   & $?& $  @*  $  8"`"@amap_pp_adjref: overshot targetamap_pp_adjref: negative reference count㿘> " ">#( 6 $-@.`,`  8 &@ $  $ "$@ $ $  ۑ,>͐"A.@,`  8 & $  $ "$@  $$$ `>"8 $ $ "`2@ő,㿘 66  3  ,   + *` , @@#@6"  *` "      +`  ?+ "    *`"  ?& ` @ ΀`vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map㿘> " > ͑: "ad> "@"uvm_anon_add: can not allocate %d anons uvm_anon_add㿘> "\X@"@ <$\ b ݐ >c, @v `2 & >"l>"& > cc &" & "c @X `@$`$X> ͖! $`T""T"> \  \> ͖ T > ` "T `"" " uvm_anfree: obj owned page with no loan count㿘    0  @@   "  ( 0 ?> `$ 0$ `> @4 (! €@:6@> ͔ T> & b``"T "``㿘  @LՒ   & > b`P?"`P   0    .2 ." 0㿘> # "!   @6 ,`@  6  @ "   `@&  2  anon_pagein: uvmfault_anonget -> %d㿘  @`"$ ``" `>> " ` @Li $`  (> ?# @4 (> a€ @2vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map㿘 (>` $ * @ @ >` 2  2 >   0!  &" $& > &   @c @uao_set_swslot: uobj = %p uao_set_swslot: attempt to set a slot on a NOSWAP objectuao_set_swslot: didn't create elt㿘`  >?  >u ` @2 @  2`, >d!* @ "@   " ?" `"`"> Ő 0Ò 0` .`@"@㿘  @0  ( &/>  $*@`> "+> Š `,  " @K P?$P  , @畐`0  & $ $Ò c㰠 /> > " , @ " @Kd `P?$`P  &   cmuao_create: kernel object already allocateduao_create: asked to enable swap on kernel objectuao_create: hashinit swhash faileduao_create: malloc swslots failed㿘> " `  . 2@ > > >## ?$  $ $  "` >> `# >햐#  "> #  $ $ $ ``*> 6` @ : ! 8  cp ( $ $>r#. F c $ >h @  `  ?$ >"`$ $$  $ $ > XX $ ,X ,"`0"X$ 0uaoeltplaobjpl㿈> T & "T> "#X>  c"c\> > 0b X   #\#`#d#h>>c,T> >#`#d#h#b(#\ 4  Ș 㿘@ " 㿘@㿘 ` 5 2&  ,`" 0 0"`0 0 ,"@   > " (`> @4 (  ! €@V @h@7  2 (`  & uao_flush: strange, got an out of range flush (fixed) uao_flush: weird flagsuao_flush: unreachable code㿘 `  > b    * : : > 8    +@; 8D ;` @  2 (  > ` * :    :`@d2`*  *`  2 @ `  ` `" @.n  g   $a ` 2^ $` X @ :E4 @. D` "  4:> 7> 03> 0 22 , 2.> ! €@/%  0 2 , 2 (`@4 (> ! € @h @z@6 P` ``4`` uao_getpageuao_get㿐'Td@h   @Z > ?"a?H@. 1 @'      @  ʔ `* `  .`@ `#\  @4 `(`. ` 4`(4`.`( @ `@>  4`(& > "` :D@T"   @ ?!  2}> @x> !> " @  @ ` 4`(>" `4`(& @- 2`(#\  @3 2`.>@:b# 4`. >>   "  @ 2 `* ` .`@`2@.`(@Hה  `( ?ʐ?g@H `(?ϒ @ @54`(0> bА 4`(€&> "` :D@z uao_releasepg: page not released!uvm_km_releasepg: kill flag set on referenced object!uvn_releasepg: pages in object with npages == 0㿘 (  >Ꞑ > ! €> "@ @"`&@@5B  "   " >ꁐ 0     >x h= 㿘 @GӒ 㿘> #X`Q@ "`,U0R  㿘  @,  ( &?  $+ @`"? `*6 ` *`@@@ " (&*@`2 ?< $ 6  , @ 6  @  2  &  uao_pagein_page: uao_get -> %d uao_pagein_page: found PG_RELEASED page? 㿀> "'.@  :`  #\ ' #`#d `". `` >0>$ ΐ#  (@ ">Ő#@@ @G* ?(! @2(> ! €> a€ @,vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map>  `>  dudv_attach㿘 >* @*`"@D*`  ``>!`@[>!@WFB? P  2d 1> @?C" #> c``& (`2` ` (`` `&`>> #d"( c``` &``&`` ?,&`   c```2` `ݒ c` >"& &&  & &  & & & c`c``&  "`$$c`& $ " udv_detach: pages in a device object?udv_detach㿘%>#>!>   ?)&     "    & "cH Ľ#d  ` $"`$ $ " Ƨ  udv_fault: !PGO_LOCKED faultudv_fault㿘 ``@\>讐 (  >   ` ϒ S  >*` * " D*    &@  @"-> j@8K `$ @@  >   `  >@7 H% > " @ @ `, > , ?   >  ` }  udv_put: trying to page out to a device!㿘><"vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapfltamapcopy㿘 #> '> & &   2!    $   H   @``" 1  M" >"X  $  @  2  (  ` #``      " *&  ` " ` ` ``  &  `& , `        `  > ` `` ٔ >@6"   `  ɔ anonget1anonget2flt_noram1uvmfault_anonget: got PENDING for non-async I/O㿐> " `"   >  a @  "@>  a D "D> "    0   1 ( @` ڰ 4 (`$     ਐ p > А" =   ਐ ` >" - #\    @/    ਐ E >`$@6Y     ਐ 5 |`$| @D  2   $ ` "`>"x਒    @਒     $ H` ( ?ı (?aϐ  4 (> ! €`   ਐ    >$``2 >殐!&@Cْ ?& @1]`   ਐ ʔ # > "П@@)`  "  4"    ਐ    $fault: advice mismatch!uvm_fault: pgo_get PGO_LOCKED gave us a RELEASED pagefltagain1flt_noram2uvmexp.swpgonly botchflt_noram3flt_pmfail1uvm_fault: pgo_get got PENDing on non-async I/Ofltagain2uvm_fault: object has no releasepg functionflt_noram4uvm_fault: want to promote data, but no anonflt_noram5flt_pmfail2>#> 'Lbb d  `?'D# d.@ ''+'ؑH/` /> bԀ0 @ 0*4:H 0  '  ؔ'<''` > >͐"x`   @l쀢  >      " *'`  `>    Ҕ ' `'耢Ű `$   >     `   >      0 'HL`H 'HH`2  `  > `   :> `Đ }"`8   D>    v r D`,<>* bț*  @ > >6!X @ #2 8  @ " 2 ?.@ #  @  'D      4% @  <`2N'@ &$ #. @ "   "  ( 2  0 2  , 2  > ! €@' &. > "``%  .@ `      .`@> `.@ '@@T X ?@ >  T  ;&@ "8&@ X2&@@" ,'@@ `"(> `0 2$> `( 2> @' > "> j "ؖ@ ` 4`0   0a@> b``@@`  @#`#\` <LX t o 0qn@ 2l'L> "ОX "``%` B 'PP`#\ @ <#`#d  P`D'L @@> ?"c -+(@@>!p 'L@'` > j`$ؖ `4H  0 a@`( 2`(> "`@̠ @'L@ - @<O   > > <  ` 0`@ `2< 9`#\     @,2 2 >  ` ϒ >@2!@'T> ! € "  `0?"`0 ?"  . 2.$  . (  @ 6 (6 .& `W>  S> `ܢ "`ܠ   #\   @+   2(` ">     > "PD@ >I!@2  k">`"@2!a@& (?! @6 (4ܖ 퓒# @? $@b ؒ`"  H` ؀ 4`0> j! @ >    3 > "`D`P >!>@2?!L` @% (?# @6 (y> @&H>   `?'L   ` @ L >  ! @`"@>   bD "bD   > `Ԕ  "`'P L܆P "  B``#\  < #`#d`   >␐" > > 0  i > "` $`` "> >w"x  ` @ > `   `  $`L (@   4b"  >   t  )L`( L L( > " `" , >*"@€ N@% L? (cϔ D2 (b > "  $  `2L 0 Հ`2#\Ѵ     @*  LL`( LӐ L?(#ϒ @2(@%QL> `    >`$ @1("p@% (!?! > 6 (aL€ L`( L L#( 2(L  $@+ϖ  @+ʒ'L>ᶐ" L#\8@?    @*,   8LL> `( q @$LL? (cϔ 2 (>    > "`P`D@ >{!@`  &`ɐ`>`&`@0"؀?#> > `"`@%  > ! €LL`( L, L? (cϔ 2 (L@$ "` "`4ܖ 롒# H` ؀` 4`0> j! @ &L ( " ( (?!ϒ @6 (>   B > "`D`P > !>2 @0L"+؀ @# . ? (# @6 (> b @l  } (@$M ( " ( (?aϐ 6 (>     㿘%>    @ 0  㿘 !> >౐"x   ؔ @J  ϔ uvm_fault_unwire_locked: intrsafe mapuvm_fault_unwire_locked: address out of rangeuvm_fault_unwire_locked: address not in mapuvm_fault_unwire_locked: unwiring non-wired memoryuvm_fault_unwire_locked: hole 1uvm_fault_unwire_locked: hole 2㿈 >W  0@ > 4>M @  @>C!j> > "tb>   >2!@`@:` >+!x@  (`@>` >!' 0`>@*֒># 2@#> > "`2: * * 2` #  #@2: 2? **`"  *  "b@"b@@ > vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map㿘  >  8  5>` !> >߭ `  Ք @֔`  ɔ >b   > !@ >b0* @* 㿘  %>   >y   >  8  @  㿘> "@ 8  @ 㿘> "@ 8  @ uvm_fork: uvm_fault_wire failed: %d㿘a @>@x &` >c Z  "" >'"&`  @ݔ   H`n"@;㿘@ >c@"! &!   :`0  :8 :`  > :(b``(   :`P㿘> ! @ H /m4N 1* .N 1  @ , & ,H p@> & b` "`schedulerschedpwait㿘>    J1 2, 2J ?* @ "@@ $  2J1` > > >"h  } > b``2 > > @-ѐ > 㿘>      . "-> ,  2#  2 L 1   (  4  @ @@$`(    2 ,`> @* 2@   " @㿘>! |@  @)@H /m * .  ,N 1 ?`& ,@H 0> & b` "`vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapuvm_init: page size not set㿐> "䀢`2> >#H | @! > ("`Ԑ@"@@@@*gC@%+ vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map㿐` ` ?@  =#@| " > " @  8   g ->@    Z䀤 W 4* *M L $8`$`"`   >$``  = `>  @`"`~`  M"`>I ` $`@ {@` >   `d   @    vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapuvm_km_init: could not reserve space for kernel㿈>'> ""> g"b B> > > ͚`0"a""" ""> "#!> "  "?"" ""!> #! "#h@ݖ > iE!8c'$#h#\&  ?@ ? ">>Ɛ""#uvm_km_suballoc: unable to allocate space in parent mapuvm_km_suballoc: unable to create submapuvm_km_suballoc: submap allocation failed㿐\`@> b#' *@ #\ ?@? "@>܃ (&@  @@g 2 @>r `@q$@@ >b uvm_km_pgremove: object %p not an aobj㿘 >"`@> >!J"&2  *   @I   @ " (`@4 ( 6@ @&ސ@@  0,  )      $8 2 $( (`" @4 (@z`@& 2 uvm_km_pgremove_intrsafe: object %p not intrsafeuvm_km_pgremove_intrsafe: busy pageuvm_km_pgremove_intrsafe: active pageuvm_km_pgremove_intrsafe: inactive page㿘 ?> >#`" &2@  *`@%@Q#>!>   @ `( "`.ۤc  ۟#>ۛ#@&O @@  0/ `, ` $` `$@8 2`$(`( "`.>u#  >o#>k#@& `2` uvm_km_kmemalloc: invalid mapkm_getwait2㿈> i!8@"> >N!"  0#'  @* '#\?@q? G  >C@e@> #`06" ?#'> j%>   #\ @# `( 2`(2 `@*R?2 `4> " `4 b ᠒@ b&@2Ә 㿘> "@ 8 @@ 㿐 "   >&      >  @`"   M" >"  & > " @ 8 @ @ >    Ԕ  @ { uvm_km_alloc1uvm_km_alloc1: non-released pagekm_allockm_alloc1w㿈> i!8@>ڀ > " > ͠a  0 x@ #'* '#\?@? >P #``0B" ?#+>-> j  x@ `( >K 2`(  x"`' "` x#\  @" `( 2`(2`4>@)v! ` @ &@   `Ƞ  @Ք$uvm_km_valloc㿈> i!8@"> > "> "?a 0@ #'* '#\@1?  uvm_km_valloc_waitvallocwait㿈> i!8@"> >#h" 4@  0* "@ @  #> ͐a  x 0c''#\?@?  >   a 㿘H / * ' > "䀠P`?H p@㿘H / * ' > "H 0vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapuvm_loan: intrsafe mapp " >c!p  '> "-> '''''` "`>L!P u @쀢    h   " *'`  `  T ' `'耢V 4  `6 $   ؒ@P `ؒ@  `ؒ@ǔ ?  ? > " @ Π     `*@& @    2v' Ԑ": ` @@ @e loanagain㿘".     > ! €  &@+"@ 8   # !?> > P  i  0 20> ! €0`@&0@ "@@ &@fltagain2uvm_loanuobj: object has no releasepg function㿀 `` `8`  @& #\#d#`  '  '     ׀  >   ` [   ' `& #\#`#d      ?> >    ٰ > # b  $  ` 7> >!P`਒ #   @ਐ      $  (@   4"    >  `   %`(  ( ` , >װ! y @  ? (cϔ 2 (o `0   > ! € `0 "`0@3@H"@   &@"@`@&@`( ? 0; `( I ? (cϔ 2 ( >   `  (?&"``0 2  > ! € `0 "`0@@"@ &@(`  ? (cϔ 2 ( loanzero1loanzero2㿐Q> "4#>   ` J >@&a"h 2 !  $  ` "`> !P` 4   @ > ਒ )     $ `"q #\     @q ?(! @6(@"@ `@&@ W&0"9%>     "I?">@& "x 2`!  $` ` "`>ַ!P    @ > ਒ Ք  `  $``"  Ɛ #\   @ ?(! @6(@@ "@@ &@㿘`@ ? "@ΐ `uvm_unloanpage: page %p isn't loaneduvm_unloanpage: page %p unowned but PG_BUSY!㿘`-%>#> 0  xK?$ 0@4 0      ( "> a4! €@  ٲvmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map㿘    @&vmmaplk㿘 ( & x& & (& ,& >& 0& 40& p& t& &     & |& & Ho o> ԘԀ "Ԑ "`"& H 0 㿐 "   >&      >  @`" ޔ  M" >թ"  & @ې >    Ĕ  @k uvm_map_reference: reference to NULL map 㿘 2 x> @5 & xuvm_map_deallocate: reference to NULL map 㿘 2 x>ݐ!X@5k4?  & x 0 4@9 mapent_alloc: out of static map entries, check MAX_KMAPENT# uvm_map() successful calls# uvm_map() back merges# uvm_map() missed forward# map lookup calls# map lookup hint hitsvmspplvmmpepl㿈>#> >Òt"t"("`"` "`"`> >Ô"ᴐ"H"" ""> >Òl"l"`"`"` "`"`> >Ôx"x""" ""> ">" ##b" " " > ͐l?"l> ``" \#\"`"\`H#>!>c,#T > >Ð!8b    #\#`#d|#h> >#`#d#h#b#\ H  o 㿘 ># > # ", @H /f * ' > ͒! `\  "`\H 0  2 >Ԍ!, @@<`< `< `< ` < `(< (`0< 0`8$ < 8 ``&`@ B >`&` 8  4`4 p & p@$@ $ " "`   0 ` 㿘 ># > #˥ ", @H /f * ' > ͒! `\  "`\H 0  2 >!, @@<`< `< `< ` < `(< (`0< 0`8< 8&` $ ` `& @ B < `8 `4␒ 4 p & p$`$ &` "`  f 0 ` €uvm_map: unknown offset with non-kernel object㿐\4 0  2`4 @ c     >  @` ܔ `?`   &  ,@" C  #@   >&    q  >  @`"   M" >}"  & @ #`@#\@H  >  >      ct "ct  ?  (>>K## `0@" W` @@R (@N`J"` ``"@B?@=` 8`$4`(0`,,`<(`0 $`8 >   > a  "a `"`8@`8 ` $`  t@& t2 ` (@"  @`@2 > bl "bl ># > #7 ", @H /f * ' > ͒! `\  "`\H 0  2 >ҫ!, @@@$ < $ $  $ $    $  $ $ $$ ($ ,$ <$ 0> " *@   $ 8$ 4$ 4$ 8 p & p$`$ $` " t @& t`  @:&  >        ( "> x x@    > ᠄ "  , ( @  " # 2 "#  㿐0'XX@`'H`E 'H4H@` 0@ (`  `)  'H  'H` H?"4@"ՒHH48 *   (@"$` ဧ`$&uvm_unmap_remove: kernel object mapped by non-kernel map㿐 0@* 48@8`   @&    @  (&  ('l& i J   0"  $ 0* "4  `-> i!8>u#2 > "€ >#`0  "  "@   @ @>#`0  "  "@  $  ?$  @   2 p&  p?& p "@ " t"@& t$ '@`* & unmap: still wired!㿘 B> ͢!  0 " 8>" ?     @"  @  `" @@  @  > #~H /f4`\* '`\& $`\H 0  2 0㿐> " 0@  .@ & #\  `?uvm_map_replace1tmpent->start=0x%lx, tmpent->end=0x%lx, end=0x%lx uvm_map_replace2uvm_map_replace3uvm_map_replace4uvm_map_replace5㿐C `2 ` 2 ` 2 `8 } * >>@ `{ @ ( >o X     >e p  >^ 2@>U &  @"&  ""@&"` p?& p@&  2 p&  p?& p@`"`@"  @ > #ɥ  H /f * ' > ͐!  \"" \H p@  uvm_map_extract1uvm_map_extract2㿀> " @'L"`>#'耏`"0>#(0'L L$  @ '   `'"   >&      >  @`"   M" >ϵ"  & V ` &@ `@&   `ɠ  `'ٴ (ը`'䀏` ` 7 `     ܴ`   "$`"># > #ƽ "/ @H /f * ' > ͒! `\  "`\H 0  2 >1!/ @ "_ ' ''  "@ ' '  `' ` "€ @B   ? `` '  ( $' $ (' ( ,' 0' , 8`' 8> b 4 4 ' 4  Ӑ' 4쀥``' <' <%`` @:    " '` @2`2%L    >  @`Д`?`  &  L @  `  >     `耢 Z `" '&  `*'& '8  (4``` #" @耢 @ ' p?& p"@""  '` @р``"   >   N   >    C 耢   `R  #L   >&  ޘ >  @`"  M">" &L@ B >         >     7` `L@ 㿐 "   >&      >  @`" ̔  M" >͗"  &  0@* 48@8- `@”` .'`"! `2 `  ` `8 2 ` 2  "`  "` ;   >    s 㿐  "   >&      >  @`" V  M" >!"  &  0@* 48@8  `@ L ' (@`` 2M `(2H `@ "= `*` 7  `$&`$&`(&`$`$>  ``` ?a `0 2` 2` ` ` @   2 `@" `*`  >    ̔ 㿐4b 6 ]  " (   >&    g  >  @`"   M" >s"  &  0@* 48@8    @  $ , "  *  >    g  㿐 "   >&       >  @`" J  M" >"  &  0@* 48@8   @ ? (  (4 6 $ < >        "  *  >      uvm_map_pageable: map %p not pageablevm_map_upgrade: failed to upgrade lockuvm_map_pageable: stale map㿐  >͐ ˡ % 2# 0   >&    r  >  @`"   M" >~"  &  0@* 48@8 2=  >     2 K @ (     @ `  " * 0􀦀 0 "  ' 0 ɐ  * 2   >   ?   (a ] 0 2  2  "  $   2    4 @-  0 $ ` ' 0 # @ ` ( ?' 0 8 02  >       "  * 0   &  #> ` ϔ   @  0 2   $ " B`  >ʃ H 瀊`& Y  @>u p?' 0 " * 0 0? ' 0 ' 0  2 02- ` { # 瀊`&  ` j   e >3 H 瀊`&    uvm_map_pageable_all: map %p not pageableuvm_map_pageable_all: stale map㿘  >ΐ" #`   >&      >  @`" "  M" >"  & `!` , (@`0 "``&`0` |`@2`0 `& >    ~ հ `  & 2  , >    ~ ð  (@ `$ " ``0 2`` `" `@ 2`$> "  2  <@ @ (   >    ~  @ %)> `$`"``0  ` 2`0 `2`` 2 `0``  ְ `0 &`0`@2`$   &   ~  , @`0 2``` y`$ "`G  ~p >> H 瀊`&   @@>0"`$ "``0?&`0`@ 2`$ ,@" `$ " ``0? &`0`&`0` 賐`@2`$   ~1  瀊`& ؐ   ~#  uvm_map_clean: FREE and DEACTIVATEuvm_map_clean: holeuvm_map_clean: page anon vs. object inconsistencyuvm_map_clean: anon inconsistencyuvm_map_clean: wierd flagsuvm_map_clean: unreachable code㿐 2 >Ȳ#h #> >Ȭ"Ƞ ` }Ӕ  0@ 48@8=  ` }   ( 2` @"``  ` }   *   8@>^#e c>#`_&@  "X4Y "L> ` G "/ 4=>Ѐ :> 06> 0 5>  , 2b . 2    "*b> #> >#! €@ *> 4 0 , > ƒ@? $@Z>  > b䨥&@ @ "      "  s@` | 㿐r @  (@" `@*  `$ 2 ` @ ` 㿘>  !8@ 㿘 @W @ `@ܐ @+ & & "`   㿘 `  @@@~& @T㿘 @T` 2<`` "`` 2#``   >$``  3 `>  @`"`|t`  M"`>?"` $`` `$`>   `|^  d>0 `4 {`0@b@.& @㿐 ? ;&  2# p   >&      >  @`" |,  M" >"  &  p   0 4&  @> !8`&fork: encountered a submap during fork (illegal)fork: non-copy_on_write map entry marked needs_copy (illegal)㿘 2#   >$   >  @`"{є  M">Ɯ" $4 0 VZ ,(2+>  `" ` >Ɓ# 2,>{# "w 4 2`   Ӱ  ># > #ǒ ",`@H /f * ' > ͒! `\``"`\H 0 `2 >;!,`@<< < <  < (< (0< 08< 8 8$ 0  `"  p` " p€  p ( & p$@ ( $`"`" `" @m ># > #a ", @H /f * ' > ͒! `\  "`\H 0  2 >Ր!, @<< < <  < (< (0< 08< 8 8 а  `"  ` " €  $ 0` $  p ( & p$ ( $ " "8 "0  0    ؚ 0  8 0ӱ- "(  ( a$    $  @   " @ ` $ a 2 t& t >   z{  㿘>@< MAP %p: [0x%lx->0x%lx] #ent=%d, sz=%d, ref=%d, version=%d, flags=0x%x pmap=%p(resident=%d) - %p: 0x%lx->0x%lx: obj=%p/0x%llx, amap=%p/%d submap=%c, cow=%c, nc=%c, prot(max)=%d/%d, inh=%d, wc=%d, adv=%d 㿈 0> 4ƀ"@ p> t"X x ƀ !>Ӡ"@ƀ`1 ( ,@->Ӧ"%>``8`` `#``4#dƀ#\`  F T  F T  F T`,`$`(#\`0#``<#dƀ`@2`㿘>@& OBJECT %p: locked=%d, pgops=%p, npages=%d, refs= refs=%d PAGES : <%p,0x%lx> 㿘>  p ƀ  ` 8>>ԟƀ `ƀ `">ԟƀ   #>3> ƀ`ؐ@  2 ƀ`   @  >ԟƀ 㿘>@z PAGE %p: %b flags=%s, pqflags=%s, vers=%d, wire_count=%d, pa=0x%lx uobject=%p, uanon=%p, offset=0x%lx loan_count=%d [page ownership tracking disabled] >>> ANON DOES NOT POINT HERE <<< (%p) anon backpointer is OK checking object list page found on object list >>> PAGE NOT FOUND ON OBJECT LIST! <<< checking pageq list page found on pageq list >>> PAGE NOT FOUND ON PAGEQ LIST! <<< 㾘>Ԓƀ"!>Ԥx ("># œ .>#X ŋ *> , 4ƀ" >   0ƀ"X>ԟƀ"`g . 2 "  > >>Ԑ" ƀ .ƀ" . >ԟƀ#  2  ">>ԟƀ#  .ƀ#@ .  @F>  (* a     0 >  !$> !,> ! >ԟƀ#p 2 >>ԟƀ#0ƀ#vmmapbsyvm_map_lock: failed to get lock㿘> `@͒  2>> @ >#> h2`@:`  㿘>  ` J`1   2 ` a 8`` 8` ``2J`1>#(  UI%@,` UD4 $X=#` '\#\ @#7`4 `/>֐ *` €>  @) 0> !$> #  Ę  -XWXxX<XXX"""" """"" "$"(",> `8> `,/J`1+>ք@(> a>2`:`2`:` "22``2`,> " ",   L  "  L "  " "(""" "$YYYY<Y<vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map N Nmincore: user map has submapmincore: holemincore: user map has kernel object㿐> "@  ` ` *  8 2 i  ↖  `#> >" ` w ~  (o@ "`>Ȑ":` >"؀ `"b   (\   "`  8`>" ,`2::Q   /􀤀+8`   4˗$   @  ```$ B @ה 2 P  ٦'@> `*` >    v`WARNING: converted MAP_PRIVATE device mapping to MAP_SHARED (pid %d comm %s) `` @ ``'`    > " @8  e #@@  '@>@@      @ *'q& 6 (@ 2T  2  (`<       @E 4 @ 8}  `@޶` > `<22  >4"0 `    0T `@ip G @  0> 0:`6     > "(  *   @ :c 2@ ( #\;` d#h@ &㿐`@V`S  P "> " @ @ $ *  C`"  )> >6"   u] Ԕ    "@ uM ""   Z@ "    0   0    㿐> "@`   C$ "V >@; 8N   #   >& X     >  @`" t  M" >Ð"h  &    >    tܔ   `>    t͔   t  㿘> "@` @  `   #@  @  B     㿘> "@` @   ` #@   ϔ@   0   㿘> "@` @   ` /#@ ,>ِ"* €  @    @    @       0   0  #  fffff(ff<㿘> " @`   $ *  @:   2 < (  #!2 "   K   㿘> "@`   $ * @:  !2 "   (   㿘@`"  !2 2  d   # 㿘    㿐\ `¢ >   :  2а 2̰ `2@@ *  &@@ 2 #@踔@@ `??2 1 < `?@!Ɛ`  @' `   ?ɘ  ` <   2/ @/ `-`  @#\m X "l  2#    >& X     >  @`" sD  M" >"h  &  #`` 6`<   >    s%  @@@ H  ") @ @  >    s     @     0   0  #vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapH&(H> > ͖   3@L@D(H (H0    2   2  $   2 H ,2D,.> " >  .? > 2.`"`. 0 2 >  (" > 0 .?2. "   ,2,,(2,> "! "  " > b`"`.2.` "` uvm_pagedeactivate: caller did not check wire count㿘 . " .`"  "`> "!  "@ .?# > 6 .b`?"` .`. , " `0>Ɛ#P "> > &!$&!, &  ""  .>  6 .b`>  "`> `€ ? (# @6 (`.!0 @2 ``>  ("`` > 0`@ `.? > 2`. `,"`.@> ` `! `@ > 2`.> ̈́ "@!"`" 㿘 (?#> @\ 46 (㿘`(?# @> "6`( 4€`4uvm_page_lookup_freelist: unable to locate physseg㿘> > 4 b> 㘀2`2: @*`  2  `2: 2?2`>"H*`  uvm_pageinsert: already inserteduvm_pageremove: page is faultingvm_page_bootstrap: no memory pre-allocateduvm_page_init: lost %ld page(s) in init uvm_page_init㿐> ͔! 'D'H > > > > d+`` "" ` +`"" $"  ,"`> "!4 !"`H"`D""`L#!" > "a\>#`>#  > "` "@  > b b* @~`8.`$, @@v7 > @ R> > "`+`" @ >ܒ$@ߐ>d#> @",`"*+ >  bx"@` $&@ " 4@4 @ > @8  `% '@>  `8>㘚@+`> "> d!>  L@*@D "@> da >*H "c # ,"0> "!L# ("4uvm_setpagesize: page size not a power of two㿘> b䀢 b"bb ">#` "    `* 2`# uvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: out of memory㿐> ")># . #> d!> da@Ւ! a%#!8  @ $a$!!a">ݐ"># * $a '>%> @  b vm_page_physget: called _after_ bootstrapvm_page_physget: out of memory!㿘># > !> ""`(#>> !<`"`>[!(` > @| ` @ 29``  :4` `*& @ `   @ #@ c ?7aX c(>` #@`#? @ #? #?#?  #? #? #?#?  ` ` 29` @ 3 * &  ?@  @ h# c ?aX c^(>` #@`#? @ #? #?#?  #? #? #?#? I w?c? A> "`(>  "` @ ` (@@ :0*@&`@"$"c 2?>!X@ c>#`#? @ #? #?#?  #? #? #?#?  ʘ? 㿘       uvm_page_physload: page size not set!uvm_page_physload: bad free list %d uvm_page_physload: start >= enduvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx uvm_page_physload: tried to add RAM after vm_mem_init㿘> "䀢` >0!0>ߐ!X**>>%!# >!>ߐ!   0\ > "` ` c (`"c `? >"  "` "`  ( :c"`(@ +`? #  @ # $ # (# ,  # 0 # 4 # 8# <?   ?  c   c@uvm_page_physrehash: WARNING: could not grow page hash table 㿘># `)>  ->> "`  "@    ! ,  &, ! `H> `D" ,,   8    > X0l ?  "" ` H /f * ' !  " L" DB" H*@9> > ! b@` "` ` "@ $3LD *  L3 D *@ `"$2@ L D * @"`@2Ñ*H 0> d!@rehash: physical memory config [segs=%d of %d]: 0x%llx->0x%llx [0x%llx->0x%llx] STRATEGY = RANDOM BSEARCH BIGFIRST <>!!!! number of buckets = %d 㿈!>#>#F # @ #> "` ->-`      ;`   P%#\c`@  >#x>#> ͔ >H#ȁuvm_pagealloc: obj and anon != NULLuvm_pagealloc_strat: bad free list %duvm_pagealloc_strat: bad strat %d㿘\  >o > "0@ > 4@ 8  > 5!D    b   8` b``,4`(`( >  > aH>       5> ̀`> /`.> ! *+  @@ %@  !@  `  0 > +   *   ` р`>! ` "`" "@b?" (a $?"$ (!  "  ", *" > 6 (6 *& & 6 ,& 0& 86 . 4b   $L2  D* H /f * ' &  & ""H 0 &    &  "@ "  ( `@6 ( "6 . ? (# @` 6 (> "\@ 40֐ 㿀!> "  . '' #\#` @  >i   0c''#\ ?⇚? "@ U Q> ͢! `x&  0&@   ( @> >6#8"` $`L2  `D* H /f * ' &  & ""H 0 &    &  "@ "  ( `@6 ("> "  4" @㿘  J (@`@>#`A> ">  $a 2 `L `D* H /f * '  ` "` "  "H  `"  "` "`   "@ (?#  6 (?" *& `6 *`A *>  ( 6 *`@& >#8> ">  $a 2 `L@ `D* H /f * ' &  & ""H 0 &    &  "@ "  ( `@6 ( "uvm_pagefree: warning: freeing page with a loan count of %d uvm_pagefree: loan count㿘 (`@V 0`?# @6 ( (@`@>9#`B> ">  $  2@ L D* @H / * '   " "`  "H  `"  "` "`   "@ (?#  6 (?" *& `6 *`0`" . .`?# @6 .y& `"  .>!X >ݐ!耊 %> `"  "`> "!  "@ .?# > 6 .b ?" .  0  `2   >  "!(`"  "`> "!0 "@ .?# @6 .?" , 6 ,` ?"`  (?" @6 (&c> ͠a *  [& *  U"@* "  6 .``$ "`>#$ 4ΐ㿘> '> ͤ" $@6% 4    `` @ ` 2% 4 00` "`$` " $> "\@ 4 (!4 (` $`" $` `$`$ $` $$$ > "`㿘 (@`@>#`B> ">  $  2@ L D* @H / * '   " "`  "H  `"  "` "`   "@ (?#  6 (?" *& `6 *vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapuvm_pageratop㿐>  > i!8 2> > P">c `2 > "`2`@: +  * 2`` "  #@ 2`@: `2`?? > b`+ `*" @ *  㿐>c!> ͠!x #\ ɚ > > h> "bP""?$?"  >#, @@` @ , pager_map㿈     q 2&?  > " > bP .@ #\' ?]?  > `rՒ !  "`>> hP#" ΀ #> jP  4a@"䠤 @ 㿐> bP>  " .@ "'>    >$    Ę  >  @`" h  M" >А   $ bP@`bP$bP` >   `g  ጒ uvm_mk_pcluster: provided page array too small (fixed) 㿈  'X X ` @ > 4 ??耢4 ?> `(?>  @@vb :  2  @ (  >א x& x&b@@vѐb*`&   & `b  : BJ`(\ "U . 2 ( M (@ ` 2 (>  @ ? (# @4 ( ( 4 ( ( ` 2> !`4 (€ `2?&* &b &``? *  : D` 4 ``耢4"```㿈'XX````$ ;`#\`$ &'@ &   ` ``@  2 N L `E@\ 0> `9@P!` `  `. > ` " "`@u`   ` `@ؒ`@Ӑ`  '@&@uvm_pager_dropcluster: no releasepg functionuvm_pager_dropcluster: object died with active page㿘 d?> cϨ"c @@V 2`(`. !"`(` " " @` @u`  œ @`( "@ @(@% @.  @2(> a@€ @]`& `,2 >!ȟ  >! 2(> !€@> bП€@@`( 2`(`vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mappagedaemon: deadlock detected! 㿘 H /d * % > ͠! > ` <> (>aX: | 8> " @{"H p@㿘> "` @j_ `: @ $`0 : $`0 $`0, @jM $`4 $`4` @jE $`<daemon_slp㿘>  > "aHH > " +> )>H /da * %a  d    8"! & @` "` d d$ d" H 0> " `"@ $`@ 2ߐ  "    @i 4 $ 8`$ 8  4@ 8  @S,@ Ր0pagedaemon: page with no anon or object detected - loop 1pagedaemon: non-loaned ownerless page detected - loop 1pagedaemon: clean anon page without backing store?uvmexp.swpgonly botchuvmexp.swpginuse botchpagedaemon: pageout returned invalid 'unlock' codepagedaemon: no pgo_releasepg functionpagedaemon: invalid nextpg! reverting to queue head p> `@: * 6`2`*`# p'@# p'  '     ` b >  $ @@'耢 "`.ΐ! z$!`2``2!`(`  >Y#X2 `(`0 2?>P#`$`04`.`( ba  X"a a  "a  !  M$! ! $!`( b`. 0 b`P "`P> ! €ڐb`  1"` 2-% >#4 * @4$DP@ $`.>  0  @ bb b D L $`.> `0  2`(`" `.` "`.@ N `" `.  b @sV` ` f `(> `.` 04`(@  b` 7"` " `  @ & % @s3` E. b @:@ '@ w  2 `(?# @4`(.  &@ % b @s`   `&''  "@@ b6' 'b $   ;`   #\  `` $ $`. "@@a'_']'M 2`(>C 8 "`(`(?cϐ  4`( % > ! €@'ݨ +  ,> p€ @  '耤 > s> !@ > !€> bП€`(`4`( '耢   .  `>i @'耤```k 7b@  4 *`   ]  W'pagedaemon: page with no anon or object detected - loop 2pagedaemon: non-loaned ownerless page detected - loop 2㿘> b`  $```46 `` $`@ `  ``@ > !$`> !, ""` 2 `@ > !$" 4@ 8"" LD@ > P > ̀ "# > `! \ .`2   2 (  >T#2  ( 0 2?>K 0`$ 04 . ( 2>-` .    "  .@   ?"  (c 4 ( . " @q      `@   (?# @4 (` > ! €$"a "a `4 (4 (vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapuvm_pglistalloc: alignment must be power of 2uvm_pglistalloc: boundary must be power of 2㿐'L>ɐ#?>#> " "   * @oː?  8" ( , @ ̴ > "tL Š"`>#4 ` > "`2`@: * *2``# #@  2`@: `2`?Y"  c4 > "`2: *  2  E2: 2? 2"@o_,  @@) *" * @ .`!> "*" * @  4?@  @  '*" * @ .`*yŠ @;'> ͤ! *`$ , @ې (2 @   $ **`  "  "@"?" (a $?"$ 6 (6 .& & 6 ,& 0&`& `"@'` @' 1"0@ > 4@ 8 > !Duvm_pglistfree: active/inactive page!㿘 8> > ! b .  "> 8` "`&  " 4 .$h*  b$ *  \"@* " $ @$>#$`4 2 .Ԑvmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map%s = %d 㿘># #>    a  2 Current UVM status: pagesize=%d (0x%x), pagemask=0x%x, pageshift=%d %d VM pages: %d active, %d inactive, %d wired, %d free freemin=%d, free-target=%d, inactive-target=%d, wired-max=%d faults=%d, traps=%d, intrs=%d, ctxswitch=%d softint=%d, syscalls=%d, swapins=%d, swapouts=%d fault counts: noram=%d, noanon=%d, pgwait=%d, pgrele=%d ok relocks(total)=%d(%d), anget(retrys)=%d(%d), amapcopy=%d neighbor anon/obj pg=%d/%d, gets(lock/unlock)=%d/%d cases: anon=%d, anoncow=%d, obj=%d, prcopy=%d, przero=%d daemon and swap counts: woke=%d, revs=%d, scans=%d, swout=%d busy=%d, freed=%d, reactivate=%d, deactivate=%d pageouts=%d, pending=%d, nswget=%d nswapdev=%d, nanon=%d, nanonneeded=%d nfreeanon=%d swpages=%d, swpginuse=%d, swpgonly=%d paging=%d kernel pointers: objs(kern/kmem/mb)=%p/%p/%p 㿘>Ґ"!> ">"   ɐ"0 > "h    0> 4" 8 < d> h" l p t> x#  >#P > #h   > #    > ̐#   > ؐ    > ` >    !>!   z!!>! t T @> X! \m ` L> D!H Pf >c!> >! !\!vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapswapsysuvm_swap_init: can't get vnode for swap deviceswapmapuvm_swap_init: extent_create failedswp bufswp vnxswp vnd㿈> d"!> "c$> >   ^S > a> ͖à "!>c3 ">> >  8#\ \  > d "a>~ @> >!`h#\#`#d#h   " > g>#К`p#\#`#d#h    > >!`x#\#`#d#h    @ 㿘> d!``` $Ȁ 2$8$@ $82$` `2`㿘`< ,  \ g&$Ȕ@c >`.`,  \ f&$̔@cؒ &$Ё㿐j> "  ,"    h 2     #\    ,  &  @ 㿘 ,   ,  $("@ ;  $ȑ* @(@ $ȑ* @(@ ("@   ( ": ȅ( *@ @  㿘> d! #>   4 "$ $  $  $   "` " $ ᴔᴀ $ ᴐ "`"$ h3 \&  &$8 &$< 2 $ "$8$ b`@ "`@> d*> "! b$42$8`$8 $<" <$< $8 8 @ # @" 2$4 2 㿘> d!@  "$  "@ gڒ \ 2swapdrum_add㿀> da    #`#d#\  ">"&$,&$(> d```"` $(&$8$, $8 2$(` `2` minirootswapctl: miniroot copy failedswapctl: copystrH> `   \@  > #$  &22> d! )` `> "`$ * : $ 5$ `$5$  $8d` 2&ذ 2oQ Ӑ``2@>  P 1 Ű @ * >#$5f " @>f#Ȁ    $5, 2ఒ  D'''''+E @    ( 0 2 `< "` >  "@` \ e ƒ   u k0Q` c  \ d$Ԡ \ d  @aÔ$Ԓ $ $$4`< 2?` $`< o@$$ĒD \  d$$$$$4 ">#@b  t`< 2$n$$f \f \01?0_ 2     @+ 1fఖ [۔ swap0x%04xdisklabel regionswap_on: miniroot larger than swap?swap_on: unable to preserve minirootPreserved %d pages of miniroot leaving %d pages of swap 0> d4 `P @ @O  <  2 4  >* "@h*` `" @?)  @O PX + 3`    D PX> `L&d@8   &dD&dD> <  2* &`"  @aM* <     ` \e  c ># >##` #\  \   &d0   "P> P(> i"`XD 86:` b*  * :@ $d0>ِ   ">>ϐ ؒD!$@>! ?>#̀``b ? &`&d`D  "`DP @NM swap_off: sdp %p - %d pages still in use (%d bad) swap_off: swapdev not in list 㿘`d( d,&`" 2 `d(d,7 "d `  A&`d$ "d4> p <`> mMd>  Pd4  @N d4 0d> " D d" " Dd4 >J  > da d(d,d07d \d \㿘>>\"Ԙ"h g㿘>>\"Ԙ"h g swstrategy: vnode type 0x%x㿘> " T`*` :@ 2 4 0 (& 0& 4@0, <(`$ , : >" H /d * %  8& TH 0Oݐ0 @sw_reg_strategy: swap to sparse file㿈H /d * % > g#' H 0 %`%`%` %@%``<. `H &`@$4$@@^y'O*씒 ?>#"$@H /d * % %`@e $6̐ &H /d * % > !Ӓ H 0`0 @$ 0$ <$ 8$ 4$ H<  $ T`,>!P Ȓc!$ ,$ X$ $ \$$ h$$ l$ x`d > $ `$ d`<``""@$ ``<`d""@@8$ d`t 2`<$ p$ t`p""@$ p`<`t""@@8$ t T$ |$ @H /d4`* %`  `  %` 7E$H@:H 0UH /d  `s `* % `` ?`%```"> g`0&`4(&`0> g#YH 0㿘  & $$D & $l" !$&$l&$0\`t "`tN $$D6 $l2$  ?& sw_reg_iodone: vnx pending: %d㿘 | H /d * %  < @`@" "@$`@ ?$  4 2$  \  > 6ܐ \ > 6֐> !  "`@`0($`0 $`4  2" 2> g#ے 2 `" >L 2 > g#ƒ~r$H 0㿀> #$`$\ > d!`O``F> "  "<$8$ $ 46$8$0   #`#d #\  2'$8$8@$<$`"d<$<@$8"d8$$8`$$<`@2`$`"$8$`$  $$  L % L$( $`` `2``` & 㿘Ԑ$$@"$$uvm_swap_free: uvmexp.nswapdev < 1 uvm_swap_free: startslot %d, nslots %d uvm_swap_free: unmapped address warning: resource shortage: %d pages of swap lost uvm_swap_free: inuse < 0㿘?`> " @``> 2 d(> 0>~ Xd0&   > d "$d  L"@$ Ld 6>>f #؀`. ' "d($: * @d̓*` 2d($: * @d̓*` ` 2@Z ߠY 㿘@?@6 uvm_swap_get: ASYNC get requested? 㿘> b T  'D$ T>"2 P ?$ PD  @    b`P "`P㿀> " @:@ *`2``2`'H*`.@ ` # : '`'D 'D    >>#̀` '>c؀ 쀢`He'쀢 a   x _  i  <@1'> " H(" : * @̓*`   2 @  4 ,`@ .@2.`@. ``. :  :D@ @֨ iD'   H /d * % 䀢   > > H ` `> !H 022 쀢`Y  H(" :`*` ̑* 2(":* ̑*  ` @*HӰ  2   > bh$0$,`!P#!$h$$l$H$T$xH /d * % > !$\4H 0> b0.@ %$<$`>ؑ.`$dHH /d * % > at "tH p@0>>cp @$|$0$X$$$K f 0$4>ؓ2` 5 `0@10(- H'<`> " H ($ :* ̑* -@ @ј -@:  @ : D `0@쀢`cH /d4\* %\  3> !H 0uvm_swap_bufdone: private buf wanted㿘H /d * %  0 @" \>"p "> 3q> ͐!p&   |&   "" }ߐ?ԑH 0uvm_swap_aiodone: aio too big!㿘> " @: *2  2  * # @ `>ܐ#P   #,   $ @    .`@ ِ0   } H /d * % > !/H 0swapmount: no device swapmount: no device 2 swap_deviceswapmount: copystr㿐> "D> 0J)  \> 0A ]R$Ԣ \ ]M $Ԓ @Z+ $`$d4 $@  \ ]:$d $d>d -T !> >T  Ւ  )d4d^ \^ \0  Ivmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map㿐`*  >   -0 -03>c̐'v$    &c#>#Ԓv5㿘6  #> &  cА $cЁ㿘@>c&  && & & "cԁ㿈>cؠ  "cؐ@| > h8 8''7` ''/#耧`@ &` &`# &` & ` swap_decrypt: key not initalized㿈>#ؠ`> @8 > h8 87`''''# 耧`"@&`&`c&` & ` @&&&& 㿘!>#Ȁ  > h#`> h# $#ȁ㿘!>#Ȁ  > h# @X!$#ȁvmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapsbrk: %s %ld failed, return = %d growshrink㿈>  b` @   * #   E'$8@   *  @ @*@'3 `##\ ?? 2>  6@   @  >  4@ "  $ `">">"`&   㿘 ༀ@>'  (>త*#@: >0 " 2 ":`0 B ; @b4  @  $ర  uvm_coredump: user process with submap?p`   ( (  , ]=> #b "$>_!( "KF >@ 8   > ( * "* 5  ( #* @#@ aH ''' #\#`#d#h#lC  @ D #`#\#d#h#lC   @ D & (2 vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapuvm_deallocate with null map㿘 >#P > "@ 8 @  vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapuvnsync㿘> d"!> d> >"a   Qk uvn_attach: blocked at 0x%p flags 0x%x uvn_attach0   #>!>`` ` & "  xw  < 2  > h*`" * `"  " <  `& ` q&  "m> d & ( ("`,"& , "_&  `!&  > ch*" * ` @>   `h@  `(  @\C   >  @E "  >  "& z& & #& &  & &    & & > `& > d & ( ("`,"& , "& &} yސ " uvn_deref: vnode VM object still has pages afer syncio/free flush㿘 ? <&  @  ?` & @    @ '0+`&     @  `  & ""   (`" , ,"`, , ("@  " >#H & y&uvn_termuvm_vnp_terminate: io sync wanted bit set㿘  ?  ?&  `H&     @ʚ  `" !>  &  "  w[ `2     & >g " &  (`" , ,"`, , ("@&  y3uvn_releasepg: page not released!uvn_releasepg: kill flag set on referenced object!uvn_releasepg: pages in object with npages == 0㿘 (  >&!> ! €`&@А `"&   " >"  b"   (`" , ,"`, , ("@  " >"H "$ xѐ$  uvn_flush: PGO_SYNCIO return 'try again' error (impossible)uvn_flush: obj=%p, offset=0x%llx. error during pageout. uvn_flush: WARNING: changes to page may be lost! uvn_flush`> "@:@*`2` 2 * '#p '  '`''#' 8 ;    ;`D    ; @_ d2`*  *`'؀ ' @ `'܀`G  $`B܀"& `;/#؀ 2`(` 4` `$ 4 `(2 ``$(``( 4`(``ܲ ?`(*@4`(> b @ :E܀" ܔ S'؀ `` 4H` `$ 4`2>``$ `8`> b @ :E```(  `* ` '` $' `" `(`. > € `(  >  @ ?`(# @4`(`( 2  4`(`27`(܀  ` ``)`?`,` 2> € ɐڢ`"ע`(`@4`(> ! €VǢ> `4`(€ `*7ֲ2`'';`#\礘` `"`>{#x`  ܀ ֑*``*2 @2 `ܒŔ  .`@v `**2 @2 ` ۠ U#` ( ?w (?ϐ   4 ( >p  `4 (> "П@`?`,` *> € !`  (`@4 (" > `>` c#>`#'> ! €㖐``@@ ܀``܀"   !> &  " 0 t ` !" v   >& uvn_cluster: offset out of range㿘> @4 > $@> @  > B?8 : :` @ B   @     8 ;  @ 8C  @ ?㿘@ǘ uvn_getpageuvn_get㿈d`@6    (   @?ڠ '`("  `>  2`(&@ >  @ :D ߲`'t r   k ?!#ϲ @ Y> `U '>1>`( ! 2`( " sؘ@ 2`(&@@ O '#\  d ' @@ ">   @9 `(  u `( 2`(t0> `( 2`(П€&@>  @ :D ` uvn_asyncget called 㿘>  uvn_iosyncp@6  `%>'" !&  Ж sd ` 4 2  $ @?  $ 2 2   &  > " 'Х. @ D 4 $>  $(> ">    ?''쀊`@''''' ` ?* 8  ``@  `@$   @ `A 耤$` )R@ 䀧  `. "@Q   ?`&  tŐ `  㿘   "   `& !L !>   & AG  >`  㿘   4  2>  $( >   > 㿘#> !> `  K˔ > da" "a> d!#  "X2( 2(    $!! $00"`$a(〦 a#਒     1`" (`,"`,,(" $j0 ਐ  Kv 㿘 8>  >  X  ` p > "8`" 1 6 2  $ 2  ( 2  , 2  0 2    `  `` ``` `` ` /@j "` &`  `` 2 ``?#@"r 1` 2`  2 ",` 26`` 2 6`` 26`` ,`6`&`# "R 1 ,`L 1,`2  #2] 2>> ap4 `i " ` 8R  2`, 0`& $` & (`& ,`& 0` 2 `` 2 ``?#@ ``<* @ & d`2 6 6 $@  a 㿐`8> ` 7 `     `2`` `` >> ` 2]&  # "X   >> `-`,`2 2`:  ,` @X$7$@,`2`" 4+>  ۰ 10\?* 2`@45: 4  \8 ap `$_ƚ ܐ96`6 ,` @X$7@,`2`$ 49>   10$ * 2`@ 45( 4  \ !p `$_ ܐ6`6` P` ` 'g'`   /`  1`  `  `?#@02)`$` 2%`$`?#@`$  `( 2 `$`, 2`$`0 "4`.`$ ذ `( ?`,#@"@0̀ 2 @`( 2 @`,?#@ @'`'`'` '`'`'`'@͒ "&` `$ 21``( 2-``,?#2'``0 2#`@O   //$ `8R` `@_ @O 7 # `@``@`$@ 2 `@ h 1'd  @'@i,`k`$`` ``(  `$`,  `0 `$ `6^  A 0`$ `(  ``, ``0 "`6`2 ``( 2``,?#@2``0 2``6 2 $`$ $`( $`, $`0`$``  $``$``$` `4`4`_$`dHuh? Thought in6_pcbnotify() never got called with mapped! x``` 2 ` !` 2 `` 2`` 2`ΰ  `  `?#@> P> ''' '''""`'`''`` '`'`''܀ `>> !!`  `'`'''耧` >c!> 0 .6`!u`!/ $ / ( / , / 0 / @ " /  4  / L`@Tg  L/   `8 ?d*@ $@TN  4`@TG  228 ".4 `6 2& $䀢  $耢 $쀢 $@T%  26`4 22` 㿘`  @N&`  , ,`64 `$`$$ `( $ `, $ `0@a$ 㿘`  @M&`  , ,`44 `$ `$ `$ ` $  gif%d㿘. !> ͐$!  PZ* !*>@ " @Mȓ*`! & > a@>>"c@#>a  >a% & <. 8& 6 4& & & & ( :  !㿈@M  /H /f * '  ` ` & & "` ?& H 0 `  , ބ 0ٔ@  0Ձgif_output: recursively called too many times gif_output: attempt to use unconfigured interface %s 㾐'D   D@SA  _     x   DD`B"X  ! ~`D <6`4` D ؀ > ܀ 2 (D>c 07   '''('D`P "`PD`` "` `  " 0D@ID@D>bؐ "   2 D`T "`T㿘 !F@M  a@" a @a@ a1@ ~a2@.aI@"" w 0aH@"@  !J@' !F@! f aG0H!H@ ", !G@" W 0!K@"7 P L2J /I !F@", !F@"   ` !J@" ` `    " @" / @  2  `  "  /      !F@"   !F@> ̀>  /> ! h'> @]!`܀ "Z`؀T ` @Q! L!  `@G! @@B! @R 2 `ؒ@Q @ "Ǥ 1      `` `" 1 ` $!   ! !  !  !`` !`  !` !` " 1! ؀ " @P' @ NB   3 ܀ & P  N3   $& ܑH /e * &  4`@6 4H 0Y " O &  ܀ "PO K& ܀ E0!G@0H!G@> 1  47 - .0!H@0H!H@' 1  4  `" 1 ܀  @ @ 1 NULL pointer passed to ip_ecn_ingress㿘` >А#" @ @ .@NULL pointer passed to ip_ecn_egress㿘`?>  (   @  .NULL pointer passed to ip6_ecn_ingress㿐`2>  @22`//@* * @&@NULL pointer passed to ip6_ecn_egress㿐`2@> g!H22`//* * @&㽸 ؀F ܀C  ? `; 4@@ۤk 3@J! @J  /e/d<'h/I/H`'L'T"7 ``" 0 (0  t  2B 7 @ *  o6 /`' Y * 'H     ݐ ;C     l 㿐  'L ,'P'T'X H'H> !>` @1 3 ؀ ' ܀ #  2   2 4   2 2   2 @" ՘!`& `H`#`H`\   #`\0㽸 ب 䀤`N ܀K ` G C 4@@@I! @I  /e/d`<'lc` `'p`'t`/I'x/H'P 'T'X'T'\"7 ``" 0 (0  ݑ  2m 7 @ *  ڌa /`' v 2U  'e 2F @ 1 &&  @  @OD  @IA   - -%  % % %  `"  `8 ܐ?"`8&    1 5  3   @N 㿐   , b'> >!  H ؀@! ܀`"=  8! ` 4! 4`/@ @N  2  ` 2 ` 2  ` 2  ` 2  ؒ @Nʔ   ! ܒ  @N”  "!!# H `$H !\ $\@0[ ! P'@Hm @Hi  > / > / bpbp' ''''''  ' ''Ā 'Ȥ@1   ` D@ "` ?0 ` "` `  &` "`D``8?"`8㿘 0   @ 4`    8?$ 8㿘 >  X   0 @M  2 ``$ `v  #> >??#*` ??? 2  " 2?  @"   *  @   :@2㿘@G   . ``:` `*`?&@ #: . @ > 0 @ !k`@ 0!j@@BZrh0 W@")0!V@ "&!UL@N@0HaP@ aO@aM@ ai0J!J@ 1!K@  aiC @e=@ag@ ad@af@  !0!e@  !"$ @ݖ@ "!@ 0!@" @ #0H? ?  `"00@" 2 `0@ "@T0Ha"@a!@x Ha@".  !@'a @$0Ha"a@a@0H|a"aI@"]`a%@W0Hqa"aQ@QaR@S0Hha"` 1  /J`:   I& @F `( $@,`),`(4 ``$`,`a,``$`@F > X`|$`` $` ` ``` 2`"`"X``  $` $`$`"@&`  $`  !@0Hh`0H^ 1`Y `? P ` ? I 0Ha"@"G4 H@"4  !@6 @0%@@0a!@0aQ@"` a%@1aI@=0 aS@"; aT@N0`(&`,&`0&`4&`8& `<&$`@&(  ``&`d&`h&`l&`p& `t&$`x&(`|&`&`&`&`& `&$`&(`&> 0 >0`8*`@Eɒ ǰ A ð > 4 >0`<*`@E! )! ?``'`d?'`h'`l'`p'`t'`x'$``$`d$`h @ $`l @ $`p$$`t( $`x`j`"00@ 4`j  a ` k$`  1``$` 1 _ &`&`&`V&$`$`$`$` $`$``?B$`@$`@. :$`| $`$`$` $`$$`(@E)$`  //7'``0 '``4 @'``8 '``< @'$`D$`H$`L$`P$`T$`X$`\  `( &`,&`0&`4&`8& `<&$`@ &(`0@J  " 4 " I-  ް /I  ذ /H @H $`|L$`P$`T$`X$`\$``$`4 D- @@``?'`d?'`h'`l'`p'`t',`x'$``0$`d4$`h8 @ $`l<@ $`p@$`tD$`x`j`"00@ذ $``$`d$`h$`l$`p$`t$`x4`j  @f  V4@ @Dh'$<0c'  7'/7'@ "d ?$`h$`l$`p$`t$` $`$``?$`$`@\78 #"` " ` 0 6  ``$`@n a` "@@1 "@  - - Didn't unlink in6_ifaddr from list 㿈@n@ƒV`4 @1%> @C  <<`0c'  77'/'` ` @ "`  2`` `   @IÔ  2 " @ʐ ` "`&`  "@  ?& X 2 `  $X,tX ` 2`` > "`,a0 pА "@@) " @ ?& invalid argument to in6_lifaddr_ioctlx2 >"!@ "!@"/ -0!@2* - @" 2!  2  `  2  @  " 8   !@ ^p!@"  -0!@Rp - @ @v " 1@ڤ ` Ԣ ` ܰ  @C x~ z' '  l ' '  //Ȑ> *@' a@BӒ  @$0* PD Pp T X'P\tx | 'T'X@H'\ 2  !@    P   ` `pP @ d h'`ltx |  'd'h@H'l   ` 2۠`0D 1!@ ((4 ` `0@B^!& *&@BT xϔ  ((˒4   `` @B= || H'<a㿘`  4   `  -Ӕ ` -Δ ` &`x H /f * ' `(&`('`,&`,'`0&`0 '`4&`4'`8`<&`8''&`<`@&`@`' a  " `8H 0&`(&`,&`0&`4&`8&`<M&`@ `8 " `  "`0 # `>p#`>r Ha&`&`H 0&@w`(&@`@&`$`4  @  &``a   -B  ` &`gT`4 @@lin6_savemkludge: no kludge space㿘  ,> d "   2  !> d J  ` *%  ?"`   $ &  & " $ & `2 0.#H     2  >ߐ"   ` ) & ?"` &  & " $ & `2 > dH 2 ` "` @"  "@ " "`2"`" 2㿘> d#H    2   6Ce @@ْ $ $ cHcH $cH" $cH$ 㿘> d#H  2 @ `"  "` "@E 60 2 xH /e * & &` ` @ "`  2`` `   @F  2  ,  &  6C  2 @H 0% 7 & `& `& ` & & & `   "   2  2& D 6H 0 1&Q  `$  & " $  & ؐ@@6 ` `  @`/`/`''''  (0 a1@& `"  "` "@Dv 6 ?$ H 0  @TH 0xH /e   ( "ؐ* &  ? /& @T`"  "` "@ `` ?"` ؐ@?ƒ      / /  '''' a2D 6H 0 ?? " 2  2  2 㿘 `"  ` 2 `@E}  2 >,> d(@ ȓ*` >@ ",   :  2 23 *@(2  0 2  0*@`*@` *@`*@` 0 @*@ ` @*@ `0 @*@ ` @ *@`*@`$ŀ  ,aȑ(* *22 2 0 ? ?> ' X`"# `0`2``4`2``8`2 ` `<` ``2`0 㿘      0%>    "    0 0  !@D  2   ``   㿘̐ "  0   ?    @ `  (0  in6_are_prefix_equal: invalid prefix length(%d) 㿘>b`K   : . "@D_ 2  @  "@ : `?in6_prefixlen2mask: invalid prefix length(%d) 㿐        ///////`/>c   0@>, ``: * @ &@ . `@ &.  ?. in6_ifawithscope: output interface is not specified 㿘# ? >" 0> !Ѐ`{/> D@2n`` "j` ` `?` 2Z  2W  2T  D#6@ `6F   >#`"?  ";  ") # " *  4&  4  $ 42 `  0  2`` 2 @蒂`B &:耥@,),*p B; @@p `B ; @ `B ;㿐h ? ' 5' ` 2-  2)  2&  2#  >#`2' F`2  2 0~y $   2 ' ># `2  2  2   2  2'  2  " 㿐@  ' `2   @g,  2> Ѐ >042 0(@824 > @0 X@<@= >  > ja@=@=?` `   .` 㿘 `"s?@  2 ` "` `2 ``2@a? 8  #; %  ?0SD ``M?>`H@B` 7>`P@BY 0```є %`2#`  .`  .` .` .` .` .` .` .`` ?  `@<4 `   .`.``  ?  .`>` `H@B  ? %s: got interface identifier from itself %s: got interface identifier from %s %s: borrow interface identifier from %s %s: interface identifier generated by random number %s: failed to get interface identifier %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x 㿀? `>!`N>`  Ha,  > >!`;>`8> !Ѐ`!>@ 2`  >!`" `` s a``耦@ >  "?>!`>` X a >`#l     #\ #`#h#dC  %s: IPv6 not supported %s: SIOCSIFADDR error %d 㿀 2&` & & &` `&` "& ` > `X   &`   2 $ $X`  &`  `"'H /f * '   a 'H 0䀢1/ >>"3  `#֐ #* ```"`& ``"@` ?&` `$ #U?$X` ?&` M?> bp`@@ڔ      8 >p`#ܒa&`&`!`(  `| $ `!`,&`V 4 @'@: `<< 0c'  7'/7' 8 " ` #  0 ` &` %s: no ifid available 㿘  = @:  4(`$`$$`| $  @:u$> "P` "P ` $`$$$ ,|@:d,}( ,`@:_,a<b 4 0`,(,)4042$4 $<$8{0 >!`>b   >  ? @$$ ? 㿘  < @:)  | ( `$   $$ @:$ > "p"p `  ``$ $ $ $  , |@:, }> !!  , `, a$ h$ l$ p@9$ t @$ $, (, )$ 0$ 4$ 8$ < ? bridgein6_ifattach: %s is not multicast capable, IPv6 not enabled %s: failed to add link-local address ia == NULL in in6_ifattach 8 8 耢 7 5> 0>0>  @C#   >N  / 9z> 0+>`> '>`4 X@ :X * @:* "XX *  <@90 " X,0= X>*`" 8%0  ;@9s`4  ,`4=Ԓ X>%`4" <xV 4 @>` ~7 0$ 2 4Ő  2 4>!n /> *3> @9< a x    a' '''/@9+/> "P"P` '`'`''/x/y  ( "ך a  'ta'l 'h 4  'p{h  Ր  2V 4>}!( @/>@8 > "@"@` ` ` '''Đ '/@8/> "/ؐ"' /   0'''7 ` @ "`  2`` ` @>  22 4 ( !"l d 4 Aaa'h` `'t`'l'p h> bb '''' ` @ "`  2`` ` @>w  2@   (  ") d@ < *%@ 00* `2 0  :ߐ  0 0*#  00*@8L  0`4* `  :ː! 0!`4*#  0`4*@88 @P2%s: didn't unlink in6ifaddr from list x@@R ؀`/> @ ``#`2@ `h@ `2``? ? 2Y` )>  ` ` `( " ` 6, <   `|! ```"`& ``"@`  ?$`  X@ 2 ``% X  X` 2``  >`"` !`>c | ` ?$` `2@ߐ@Ry@7   '    0/7/''' @   0 !D4 in6_cksum: mbuf len (%d) < off+len (%d+%d) in6_cksum: out of data 㿐 @ >"p|@7`  ?/'?   ? ? "```?`` `  `  ?` `   ?? "``` `` ` ``       8 &   " `& + 2 3 ?c 4#  * @+ `  %@`` ` ``  `  `` ` `` ` `` ` ߚ` ,@`` ` `+ `"32 3 ?c 4# `@``+ 2 3 ?@ 4# +   @     ? @ * @ ?    @  ` *`& + 2 3 @4# @ * @+ `  %@`` ` ``  `  `` ` `` ` `` ` ߚ` ,@`` ` `+ `"12 3 @4# `@``+ 2 3 ?c 4# +   @     ? @ * @ 2l >z"+ ?# + 2 3 ?c 4# *@ 㿘  `'@`           2  2  2  " ` >!*` 00? ? " $` >!@ } >!* `  ? ?@ > j"ΐ ```   @PÔ ŀ`@O "`D0 $@`I 1@ ` @;?  " @@`8 ?"`8$@@ ` @ 2@`@5+  .` ,`&` &`  &` &`&` `" $@ @   D  0@ D0 A 1'@  `  `>>`0!0(`#`  # `# `# `"? ?? ?9 '`` `>(` 3 ` ` `` 0 3  >  >+`3 2" @# `?# `?# ` # # @ @ ? @?  > "# 0"#  3  ? @?? @?2 in6_prefix.c: bit_copy: invalid args: srcsize %d, tgtsize %d, off %d, len %d 㿘     >by 05  8?  " @   :   +  @.:. `8`  * @.:㿘 Ԁ  ` 2  2 `S@4 in6_prefix.c: search_matched_prefix: addr %shas no pointer to prefix %s 㿘`Ӕ`, > `: @ ` 2```%`,4``+ ` 'Ԁ #!>  ` 2  2 @`   4  !> @ # `xo in6_prefix.c: mark_matched_prefixes:no back pointer to ifprefix for %s. ND autoconfigured addr? 㿘`Ԣ ,  !h ` 2"  2 `ǐ0  8  *  4   P @ @$ P@$ P  2` `2 !h!> @ ` 2(``0@ 4 ` &` 4`` @P @  "P@ "P@  w"0``2@㿘 Ԁ ! `2  2  " $ 2  P& P  2 Ԁ ??2   2  P  " P  2 <>  L " D" D 8" " @ L" @" @rr_are_ifid_equal: invalid ifid length(%d) 㿘 { >!apw  : " *& @ "  @8` 2   @ * `?㿘    $@ Β  "㿐@} ".   0% " `  " H /e * &   "@ "` & " H  @GT ?T  `0  @ @X@24 > #p ".  ` @2% H /e * &  T "@ T"`T & T" H p@ T@4  2  ip6_prefix.c: addr %s/%d matched prefix already has another ia %p(%s) on its ifid list 㾠`0?  ? "z`0`  ؒ 2I @@1˒ T`    /'//Ē   /s  +*   ?/''''@ @90A @1`7@H@, 3`  +  " ` "&`!>" p` 00vN 0$``  &` &`  "&`㿘` 9В`0 ".`H /e    * & ` "` "H  `` ?"` 5 ~`` @ 㿘 Ԁ `  2 @ 2in6_prefix.c: add_each_addr: addition of an addr %s/%d failed because there is already another addr %s/%d in6_prefix.c: add_each_addr: addition of an addr%s/%d failed because in6_control failed for error %d  x@0ѐ` `@0b`   ////Ȕ`$  v `  #@  n ` m`" "= `"&` ?"` & % j &f &!>#`"&` ?"` &  .%  @ `  0辐 uP 0 >  '>   `aݔ  !># ` u5 in6_prefix.c: rrpr_update:%d: ENOBUFS for rr_prefix 㿘` Ԁ ` 2 2 ` 2 ``$ 2`` T `P`P@(`H˰ `,`H`L,`L`8$`8`<$`<`@`P$`@`D* $`D$`P` "`H``"  "` "@s   `` ?"` 4X ~!` H /e * &  $" $$ H p@ ` 2`Z`H }2N   >#c t"g 74 T$``> ````"  "` "` $`" $`$ ` 2``$@ Ԁ`" " `` 2`"` ,` H /e * & #p#p $`#p`"`##p$`H 0 `H@" ` "  `` ""` 2  㿘xCouldn't unlink rr_prefix from ifp 㿘H /e * &  Ԁ@2` "` 2`` >$ "`uI#@ ` "`  "H 3y }in6_prefix.c: init_newprefix:%d: ENOBUFSfor rp_addr 㿘  ~1  &@.  >%`@ sʔ#3 7㿐@. T . ` &`  . ..$    L `  "@ @ @    | ` ,# >  " "  " "   *  " "@"`&"    &8 &< @ "`H 2 H *`* &H @"`H 2  H*`* &H $ .L .P㿘 `"  "` "@ ` ` ?' "` 2 ~  2 @`԰  ` 2P @ E  >  "  2㿘 P`(, C @``"``@"H ` 2 " 2` ~   ` `` ?"` 2N ~  H /e`* &`ʖ H 0  㿘 Ԁ! `  2 P `2in6_prefix.c: link_stray_ia6s:addr %s/%d already linked to a prefixand it matches also %s/%d 㿘  "8 )>& ` 2.  $`4&`2    "@ "`$ 2  `   r<!2 in6_prefix_ioctl: preferred lifetime(%ld) is greater than valid lifetime(%ld) 8   . ah@ ag@ ad@Zaf@0ΐai@0!e@&0Ő J " 1 Ŕ   !g@=0) " 12 1 P. .8&<&H6J6L6 N6"&$ &($&,(&0,&40&84{&< >&cq p @,ʒ T'/$/(','0'4'8'<''''7 7"77 B 0`"( ` 2$`?? 2 * #@   <  "@"`'" 2    1"00O 㿘>  !> !>' Ub>!X>OĒUH /e * & > #p``@  6 `D`  `D 6``H 0internet6m_pulldown malfunction㿐@     @:>(p    2 X!   *  ֖   @:>(p    4? +> !@ @  $  `  ` `B =  `  " `   $@ @ Ғ?" ! $ ۢ@&@ !㿘> >a""`8"`<m_pulldown malfunction㿐'D'H@'  m   @:>(p"8    > da! > d#T? %> d 4   @1O   P?`8 ?"`8> d"#PP P@+>   , , $  $  $  $$ )P "  D 2  `2   @ >0a> 8 > 0`*@!`B : ""@   @s >0a> 8 > 0`*@!`B :> !@`B:`>!0 > 8 > 0` *@"> x`B :x>  8> h "`̮  !؀ @28 @0  28 (@0  2826 >#5>  `' p D`& -  f@* D@̐$ $  x$,, ?$ $ $  $$ $( $, $0 $$@$4 ?@2 $@, @"@   @̔ '`̒@`1 $,?#@  @y .      $ ( , 0 4@ $2@ $ ,  @* $`$@ 4` ,` ,`  4` $`$`$`.$`" 4  " `@$ @ ```@"@  " `` " .C  @   2h'`  `2^'`5> ``@"`@ 2$d. 2`.  ?5 % %  % $% (% ,% 0% 4% $   j  %% ޔ   @-ڒ ?D&# @ P*@-Ȓ ?` &   @%> !@h`B :h>0a> 8 > 0` *@D`B :D"@H"''`̀>0a> > 8 > > 0`" > *@> `B :> a@ !`B : '`́㿘 @*'> `@7``           $  (  ,  0  4@X $-D @2`@-; ?$" `" ` "`     " <`8" 8`8 <"`8 8 < 8 < 8 <㿘H /e * & > !8> h  "`̀ )> '> > !@ ?,  8 < ` `(`B <`( <2  㬀@`< > !@ `0 <Bo<`0 㬀@(% < 2`0%̑H 0㿘> h ̀`> !8@ > !@ `  8BJ<`  82` 㿘@<>c>"`>>"``6 `` `"+(\`;`"SXV`R>,H*@L:@G:@B:@=: @8: @4:(" 8*`0@(:0@$:8"H"@`" P`@:@@:H@ :P@:X`@:`,@Ticmp6_mtudisc_callback_register㿘> ` `@`2`  *3  2"`>,lU!`  "@ " $ "`m_pulldown malfunctionENOBUFS in icmp6_error %d 㿐> c B:c> #XL ' (   #    2  ``퀦  2  2   2     א?' ) @Ζ 5 :23  @  2   @:>,k"   `2 J@c `B :    @`2  c`B :  @ c`B : $$В"@ `` 0 8 0`  $"  ?ܐ?" 0  0    ?В`0& &  0>       0&   0Ғ 0 2  >!`D>,b( k!y0>? ?#  #  #  #  #  #  #  $# $  @ ? @? 2 4  ? ? ? ? 2+ (4 + ( (c" * .`&  `B ;@ ʒ (0ICMP6 checksum error(%d|%x) %s icmp6_input: unknown type %d(src=%s, dst=%s, ifid=%d) 㿐`'`" >  `B :  `@ 9   @:>,j"  ' 2 >  !`B :  : >!` #>- b梐j > (`B m:( > c+ @ `B :   0>a> < > 4` *@"M`B :M   > 0a> < > 4` *@" `B : ?`>2"*` €  > 0a> < > 4` *@ `B : >2!,  €   > 0a> < |> 4`x*@͠ `B :Ơ Ġ   > 0a> < > 4` *@ 0`B :0 c   > 0a> < > 4` *@  `B : c    > 0a> < > 4` *@ (`B :( "f    cjcfY W   > 0a> < > 4` *@ 8`B :8 Dc沔   "F   :p H /f * ' > !` H 0 "&V  4 H /f * ' V > p*  2 H p@  $ $ 4 $$ $ $   2 #V @4   $$  $   $   ($  &  6 $  L   0 ("$ $ 0$ (@ , ,c(8$ B`B ;$ ;(8@   |> 0aw> < s> 4`o*@l @`B f:@   1> 0a,> < (> 4`$*@!p`B :p  > 0a> < > 4` *@x`B :x沔 Ԗ  @9]'@9U  > 0a> < > 4` *@`B :3c6>c 0  $  沔   c@Р   cH /f * ' > !_Œ H 0 ' 4 H /f * ' > R p*  2 H p@  $ $ 4 $$ $ $  R 9 4 6 H /f * ' > !ؐ_{ $ $_s $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8    "   $ "  82 `"   0 $  " ? $  ̰?>  4  (`( `0@# > j!`4 #V @4   $  $  $  $ $  $$  4$ $  ,`(, Hc(8$xB`B ;$x;(8@ . (< .c7  > 0a> < > 4` *@ H`B :H c沔   @O '@O  > 0a> < > 4` *@ P`B :P ܔc沔 R  @Q'@Q   > 0a> < > 4` *@ X`B :X c沔   @Ey'@Et  > 0a> < > 4` *@ ``B :` vcy沔   @Ht'@Hk  > 0a> < > 4` *@ h`B :h Cc'F沔   @ 8B'@ 4: +0c3>!`>-" VS `" `0f M  @ !0c`B :c0`B :0@ϐ!!(ltp|0``Ɯh4icmp6_notify_error: in6_embedscope failed / >  `B s:   `0@ 0ܖ   0@:>,e"   2K>  ϴ '>, 33<+"< ,"  "   2  `@    @:eP   ` 3 ` *  * @ @  <`@ u   @:e'   >   `**   2'  @@הQ   @:e   `> ` 2 2  *  @ t@ `@ '|  | @:dِ   ?#@2 OE 0x  x 0@:>,d"   w@   / /`'`'` ' `$''' '̠ 5'А  2>ؐ@Ԓ   //`'` '`'`' ' ֖  >!`6>3`Hd 01@?*@'ܬ`'''''/'t't'> " >*` *  `*   >  ?`B : ?x >   o`` >  @c>  `>  @Xؐ@]   //?' ?' ' ' ` 07@ ͐ .> 4 "  P  $ # PȐ > @ <   T >  @`B ;@# T > 8 ?# 8>   @ 2 h`  8'̴ ``   Ԕ   @:>,c"   Ѱ @ߒ    /٬ /T rԐ     `"`?``|-     s-  ` "9>      c ` ``  `   `  ` " 07@$~  <0```*@  > j@i! U Q M ` @@`TД   @:>,c"   2  @4 +Z - 2   2 >#`>#`2 " <      <@u̓* @*``8h4(0 <H /f * ' > !Z H 0 "&T``6 H /f * ' T`> p*  2 H p@  $ & 6 && & & 2  2` #V @6 `& `& `& ` & b&  $`5& hH /f * ' > !ؐY & $`Y & $H 0 $ (  & 6 & 0& (& ,& <& 8  g& & ` (  `(  "     M, & G,, B4 , 4 'Ȓ`8ڔ : , >   > j4 "8!@E 1&@ -`   #& ,   8`&  & `  82̀"   $ 0  `8" ?8&̐@͒ 8& &  ,40 1 " , should not reach here㿘(`H /f * ' > !Y H 0  4 H /f * ' > p 2H p@  $ $$ 4  В  43 H /f * ' > !ؐXӒ $ $vX˒ $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8  | x $ $ * ` r $      8 ``! $ 0@`[@@  J@ ."`@ *J@  @/@@+ @  J@N  .2 @ (?& ,@`@@J@ ."`@@*۴ @ ?,@ `? $@$  0 㿘@ @"  c `_\@J?`2Y J? 2T GE& 4H & 4B N`&> N9`?48 ?45 `ˀ`ŀ`%#@ 2" 4 4  @! &&&& &  㿘   `    B ?> !Ѐ: .  `2& `  0`@!  " ܠ " `  ` `   "   `@"    22&˨㿐> > !>      d` bo Y `2P    `"ED ` 0 2>  0J "    1  - "+   @"% (4` ?'"'' `z  0? ? "4``  2 2 2   6`p 'В`   Ԕ   @:>,_o"   ǰ!@   //ْ   > ha a ~ `!"u  j :2q  $  $ (   $ ,  $ 0  $ @   2[             @ l  2E  ؀   2`*  `* "8 3沔 %  +`@Д@8А 8ؔ 2 8SЀ "'M 'Ԓ 88 "'  'Ф ἀ2 `*`@@yϐ8А 8¦ 2 8!Ѐ !T 88 !   ! > @PB?:P!sanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d /usr/src/sys/arch/sparc/compile/GENERIC/../../../../netinet6/icmp6.cassumption failed in icmp6_reflecticmp6_reflect: source can't be determined: dst=%s, error=%d  ''X>!`>:>:`   (^'0(آ  (P 0 0    (  ` 0 0   : `(.` `?`('` '`  '`$ '` ``&``&` `&`@\&`$//`'`'` '`$'   a@E //'''' 䡐 I > `X``0@'  2`` 2```? ? `  @2`2'@`@     5\```8 w?"`8`2@>!`!>:!XyД\]ɐ 0 :&``&` `&`` &@@&`  `.@.`   > 00*` .`> #.` : (]55  |6     @ǚXX > 0a > < > 4` *@`B :X ` 0ᔀ> < > 4` *@`B :`>= *` €X  0ᔀ> < > 4` *@`B :oX l 0ᔀg> < c> 4`_*@[`B V:X R 0ᔀM> < I> 4`E*@A`B <:X 8 0ᔀ3> < /> 4`+*@'`B ":X  0ᔀ> < > 4`*@ `B :X  0ᔀ> < > 4`*@`B :X  0ᔀ> < > 4`ݑ*@Ȓ`B :X  0ᔀ> < > 4`Ñ*@`B :X  0ᔀ> < > 4`*@`B :X  0ᔀ> < > 4`*@`B :X  0ᔀ}> < y> 4`u*@qВ`B l:X h 0ᔀc> < _> 4`[*@Wؒ`B R:X N 0ᔀI> < E> 4`A*@=`B 8:X 4 0ᔀ/> < +> 4`'*@#蒂`B :X  0ᔀ> < > 4` *@ `B : tHP X(㿘@,~(src=%s dst=%s tgt=%s)㿘#> d!>=cp"ސې\ǒ$ICMP6 redirect sent from %s rejected; must be from linklocal ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s ICMP6 redirect rejected; no route found for redirect dst: %s ICMP6 redirect rejected; redirect dst must be unicast: %s ICMP6 redirect rejected; neither router case nor onlink case: %s icmp6_redirect_input: invalid ND option, rejected: %s icmp6_redirect_input: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s 㾘  `   `'` '`'`'􀥠>#`>#䀢`@ @   @:>,Z1"   `2 `>  `B {:  ?'` '`?'` '`'`'` '`$'07Ȑ 07  >!`G!>=#Hΐ ` >!`:!>=# `Z 1>  @.  //餔 - >>0`"! ` >!` !>=#ȒY 8 !?`@  '>!`!>> |Yǐ 8 ?$8!`!>> h4m8 ?$8Ȁ  >!`!>> ? ? ؠ`?@ `? `>!`!>> HY > `(@-<@- >!`!>>!0.Ye 0{` ``*  9 ?>!`r!>>!h 9 YA a> @4 `?+>`M'> @U`@H @@D  @@   /a/!/A/`H/ /@賔 h诔 (諔    `>C[`@ @  //菔 K !0> >  `B ;assumption failed in %s:%d p> #X '뵔 >#` >#` ``4 `@ @͒   //' ''''@/ ڀ  Ր @+ ЀH /f * ' > !O H 0" 4H /f * ' > p  2 H p@ $ $4$$$$  ђ H /f * ' > !ؐOw $$Oo $$H 0$ ( $4$0$($,$<$8a  $  8  `"$0 " ?$e8% 9 ? 0@ ?s  ;`0  0`4 ? ?   $@ @ : ```,@,` ,``y `u  ,`(`(- % `4  `0g `@c   (`0\ `@X  (*@.< $&@ 9 ? @&@4 $$&@0  &@"$    - (< .`  *  9-@&@$ j$%@  @ ? " & &  >@    >@>: `W;*I? 6&   ?-  ` " `  8 "   $ 0  @ "  ?&      " "@ & &  " "@ & &   & @L <  .@.``&@$$ $  $? ? "5  "5  "5   "5  :?4`5 ` (ڵ5     @"Ԁ 1> 0a > < > 4` *@`B :Ԁ >  0ᔀ> < > 4` *@"> `B :> ``B  :`  㿘 `   : @  =9   242 * "  ( "  `؀` &  2 *`؀    ' $ `ؔ   㿘>#>> e#p:``?㿐  "3  4 $> 0   & " P"P T"T X"X \"\ `"` d"d h"h l"l p"p t"t> >Bc א icmp6_mtudisc_timeout: bad route to timeout㿘 2 4>BUݐ#x  2  P     00  @ <& Ticmp6_redirect_timeout: bad route to timeout㿘 2 4>CU        0vmmapbsyvm_map_lock: failed to get lock㿘`h ?`b>C"p*` €>S#>M#> - H>= >7 >1 >+ >% >#>#>!>  > >!,N * (  dd Pd h   d   (@ip6_init㿘  ;  >>CU"`#@ *"@ *`" *  *  * " * "> b: `*@@ 6*@>#l  @/> `+ +`" " **"@ " *` * @  *`*  @ *`* " "@ *`* " #@ > @``2 `4S```:* `4@ >`(> "H@'" tt> "c@ 㿘> jb#>5 !> "@ >m 9bc<aX9!> ! @>'b9U aX9㿘H /f * ' > H` H` "H""`?"H 0 `@ 0܁ip6_input: packet to an unready address %s->%s m_pulldown malfunction㿈 (?'''D    > @Ȫ `B 4:Ȕ@ `B -: "@> j"> `0!@ * 0  > !@*  `B ;@ > @ `B  :> @ `B :D  > 0aa@> 8 a@> 0`" a@*@"a@`B :a@D`B =a@D g Za@D` '" `9 ( 'D``B K<`> 0aE> 8 A> 0`=*@9MD` ` a@`B :` &> 0a!> 8 > 0`*@`B : a@*  >`B 8 €    "     2  2  $ 2   `B < Dc      ?#@Oa@     ?#@A         D  D D $ DD``4  G a@`B :` `4%? ? ? ? ? a@? ? ? ?  ?  a@`B u:? ? ? ? 2 D `06  ? ? ? ? DD `06 D 4`?  ? 2  Δ  D  撖 0@    O> D  "D 0>a> 8 > 0` *@D`B :D ` ` @ "`  2`` `    @ޔ  2 2 > H`2Da@  @B`DB ; @; y`D ""4 `  @   ba@p`B (:pD $bb a@x`B :x8 ?"8$b!> "@  ?  , ,  $  $  $  $$ b,>4  '>@ 8`">Dऀ D 2ऀ > 6 !`!>D!  R; 0#`2# a@ @B: @D` t> 0ao> 8 k> 0`g*@c8`B ^:8 '  ~@W쀢 RD`  G  2D` a@`B :` > 0a> 8 > 0` *@D8`B :8D  > 0a> 8 > 0` *@D`B :D  \ 0 ` (` )   (Ζ蔒   @:>DQ!  'D`a@`B :? @>#`2 DD`؀ `( ( ` "@ #` D ("`Z   > H`D@   a@`@DB:`@0 DD0D@ 0  `2   2   ?#@a@  1a@  2.P ?#@2(Pa@ B: D` ~> 0ay> 8 u> 0`q*@m `B h: `B c:P`B :P>0a!> 8 !> 0` !*@!@`B :@!C > >"`l># D`@Δa@`  * @*`@*` !>0!a@`B :` > 0a> 8 > 0` *@0`B :0D㿐 )  (Ö   @:>DPt!   2 &>   (  ( * `(  (   @:>DPO!     > @?`B :@$ && ?length of router alert opt is inconsitent(%d)length of jumbopayload opt is inconsistent(%d) 㿐V?# @ "  0; 06? m> `: g> `>HbpP `߽  (&U> `>HbP   `  `ߦ  %(0>  '9֔$@ @@?9 &@4 > !@ ֚`C : $@  y &?> !@ Ԛ`C : $@  k ?!@ Ԛ`C : $@  ^  ?> @`B :?㿘 @/ "- 0( > 0#> @`B : 5 ?@`B :`   ` #    ??x 8  `  `@     ) &@ `@@* ``  `   7…  "  0'   ) &@ `@ 'ܒ   ) &@ `@/ . `2( ` (@w >     *   0L> @`B W:   z ) &@: `@G (  3  <  +098@? ր 3 ` *  ` *  ƀ 3" @ <  + 0   8 ) &@0 @ 3ip6_pullexthdr: invalid nxt=%d 㿐3 <+>J!O 3 *  * H /f * ' > !E H 0  6 H /f * ' > p 2H p@  & && 6  ~  7`6 H /f * ' > !ؐE & $$Ey & $H 0 $ (  & 6 & 0& (& ,& <& 8    2 (  &  8`"   $ 0  " @   &@    y& `(   (   ,3 ((    ip6_nexthdr: m == NULL` 2 >KM "d? _3"<`<,"$`U2)"`(+=`L?9`H?5`ClA;@ > (Ѐ&@ 2 ?#@)?&#@  Ȁ&ɰ . @@  Ȁ&ɰ . @?㿐?' ?vmmapbsyvm_map_lock: failed to get lockOpenBSD-current㿘`f ?``>L *` €>Q#>K#>E#>?#>9#>3#>-#>'#>!#>#>#>K$>#>## -/P/h/00000/00////00(0@00X0x0cannot forward from %s to %s nxt %d received on %s cannot forward src %s, dst %s, nxt %d, rcvif %s, outif %s ip6_forward: outgoing interface is loopback. src %s, dst %s, nxt %d, rcvif %s, outif %s 㿐 >   c`'D  "> 2-  2)  2%  2! >> @@>cВ`B  (:@!>L#cР!D` `L@ 0   D  $> ?,D$  4   > ."`#> `4 b` `8 ?"`8> ""+bb ND> @`B :  ߘ 0ﳐ >  @   1#> ` #> `8 ?"`8> ""@   ,,b$$  $$$b D> @`B :  [ 0Db0b @,@G> !@ @ B`B ; ; @ @ > 0a> 8 > 0` *@>8`B :8>>#В@ @ "0-D>L @aP #\`Ku  I   0C @D< ">0a> 8 > 0` *@ `B : # @`<  0 4`2 02 @2 @`02 @4 @"@    Ŗ bD0  @`4 D  ? ? ? ? 24 ? ? ? ? 2 @4 @ ^D " @5DU D@' ">  @ > 0a> 8 > 0` *@"> X`B :X> @@`B ,:@!@`8B:`8 @>0a> 8 > 0` *@`H`B :H`@H`B :H  A >N!- €` ϒ0   - 0ɐ9l99999999999999999999999999999999999999999999999999999999999999999㿘 l> H@ ?* ?`%>N#*` €@ג@@@@w @@ -;;;,;<;L;\;|;l;㿘> H@      k& -0@㿘0 !k 0!j  @ @\㿘H /e * &  >  >     $  ( ,  0 ` "*` B ;`    @ ٔ  2  $ $@ Ҕ  2  2 ``B :H 0`2``  < 8`h< @`p< H>T* > h@*`  (: 0: 8 : :  > e А "@ > e   㿘V 28 - R `:`1 -"/ *` 2+ *``>$ *H > 0"`L> "H"@]$> !h@Y!> e> e#">Ua- >!X`&`-:` xH /e * & > T< `)> *#> !!!h,`2 * @*`@  ` `   / ''''   a2ؐ`* T2`@ ޢ!h@> e"#> e4T-#> " *````   W 8 2 `P 8`2``*`> "@ے$>>>2 V"`H"LH 0 register_mifx`? *` > * ah `~ 0>! >t !*    !> V?#@> h> hD>P!@ ` 4!@#D`* `""04004 V> h."0T4 @K -H /e * & > !!` `/` '''' a1ذH 0 $H /e * &   <`8,@$`<` <`(<`0H 0>T `2T x>> *@ T*`!h @  C H /e4* &  > !!` `/` '''' a2ؐ@ ``T?* @ h*`2    ?* @*`@ ` 4`TH 0 add_m6fc: %s o %s g %s p %x dbx %p multiple kernel entries㿐>  >  b    $  ( ,  0  `*B ;      @  2  $ $@  2  2 ``B :'H /e * &  848 <$< @$@ D$D H$H L$L P$P T$T X$XH 0C H /e * &  b      $  (  ,  0  , { > !h 7>Q5>Q@E  2l $$@=  2d "``*`2   ¸µ 8#\ G $  $ $ $  $ $ $ $ $  $$$ ($( ,$, 0$0 4$4 848 <$< @$@ D$D H$H L$L P$P T$T X !h   @Ĕ  2B$ $@  2;$ $ $ $  $ $ $ $ $  $$$ ($( ,$, 0$0 4$4 848 <$< @$@ D$D H$H L$L P$P T$T Xx$X`<` (`"@@  @  2  $@  2  2  $@H 8H 0  H 0 1㿘  8Z  `    ʐ?cannot forward from %s to %s nxt %d received on %s ip6_mforward: ip6_mrouter socket queue full 㿘 >  ?  ?@@ ?@̐ `,.  (  $   >> @@>cВ`B  :@!>S#cР!   `E7  H /e * &  >  >          $  *b` B ;      @)  2  $ @"  2  2 ` `B :` H 0@M`B :  8   沑H 0: 7      ' ( 2  D 8H 0 7b            $  . ` `@  2` `$@  2`` "``2`  8.    8H 0ܰ 7  (`  > 8 8H 0Ű 7  X"  >"   " L   d" l0   +`+`  ((ǒ 8q’ 8H 0 >>  Tah  >*`2  `2`LdlH +`0H c`X  >SaD  ``B :` 83 8H 0Y 7`B :@    ,`,@  $` > $`  h$` <,`,`$`# b$`$ .$`( $`, $$`x$`0  *4`8 $`# !$` 8 8B: 8GH 0   `4  ` "$$$H 0 㿘H /e * & > " 5> h @ 1 - ,>   `"!x ? $x@` 8 2@@ @B=@?-@$ 82 ˒hH 0> e#>Ua'Ҕ >!X`&`':`㿘>8 T   (> * h @" >   0B: 0p`C >p(> * h  " > e#Ѐ`"   @2   (      ' ! ( > 7 L d l" 0   +` +` ** а >T> !h `>> L L *`2  `   L2 L d l` `+`t"` " `" `2t" " ""`  HB< t   ` 7`B < ` 08( @< B`C ::@h` B#>`T`C > >`>hhZ > !@<  .`2 2 * @  * A> 8ah* @*` @ 2(8* *  @`2!8`2 ਐ`" 8਒`B >਒@`( B`C <(<8 @`>* T2`@ `  㿈`H /e * & 沔      ' ( 2  H 00j"4 `> e  //> e'x  @ H p@0P#| ` @ "`  2`` ``` ` @ɔ  2@`  ,`,@ $` $`  #|$` $@.$` < d  ,@,` $` $`  #|$` $$` 0H 0㿘> e0`B :0H /f * ' > !8 H 0 " 4 H /f * ' > p  2 H p@  $ $ 4 $$ $ $    > j 7" ( $  $ 沐    $' ``"  82 ܀  $ "  "`  ?ܒ ܐ?""@@4" ( & 700$  >> "ah &@ *`"   *  "*   * "   :  > `2**`>``HC <`  `` 7`B <``m_pulldown malfunction㿐> e `B @: @" '`!`B ;`֐ 0 /  0 @@   @:>X@U   ' 2 !`B : /!  g!  `!B:`0j<   `!B:`0[ !T '>>VB T 48 ?#/ @2@/4 !(`C B8(c804 ` ( ; `  !(BQ8(0" `0  E!0`V> *@ !h*`@`>vu '@2!ip6_output: IPv4 pcb is passedip6_output: tag of length %d (should be %dassumption failed: hdr not split''@ 'p`0 ``" ` `Ĕ@* '``" ` `Ȕ@* '``  `@֕* '`<`  `@˕* 'H /e * &  ;  `$" >Y 8?W $ Q ( ?'  #\  ( `D H 0 K?"|'0zM!    @  !@  @i  (4 2 ܔ  !H 0Ā  AȀ  ̀ Ѐ  A;'H 0Ȓ Ā     (  ('t  `   @ Β ' '?c? " @  '' '`@} '4`4`И` 2@>Y> h <"#@ ``*,`Ā 2 >Y> h *@+@"@`#@Ȁ 2 >Y>o h < *@+@"@`#@̀ 2 >Y>[ h + *@+@"#@̀ ",` `'`'` '`$'   '  $`  $` $`  $`$ * ?* " " " " ` 2 `` 2 `` 2 `` 2 `2 `> !@  -B: Y' > > !@  -B: M'ߐ *&@X`B :Xؐ@= `'p` 2`  4  `@(  " `8 ؐ?"`8& @   -`-@`%``%` ` %``$%`"L `H /e4 `* & `   > ,` #,`` `?`,`P  H 0 A'؀  \C  2 n 'H 0 v 2ఐ`2 `t> a@  AB: ' "`t4 `@0` < 2`>! 0 > 8 > 0` *@`P`B :P`3`` /` `+` 4 '` 0 "> !@`B :> 0a> 8 > 0` *@ AX`B :X AT'``?``,` ` >" 2` ,` 2`> #,``"```" ```>!*` `? ?@ +` &> j 4 "> j> !@ਔ 3`B :' 0>! > 8  > 0`*@X`B :X"` `? `,` 2 &`2 `t> a@  AB: '`@ "`t >! 0 > 8 > 0` *@ P`B :P >! 0 > 8 > 0` *@"T 4`B :T 4 @2# > !@`B :> 0a> 8 > 0` *@ 3X`B :X 3'؀` @ "`  2`` `   `@f  2    >@ є `> H` 2 ` K ` G 4 `0AӐ !p`2'@p1p ` 4` p @&   pp`8 ?"`8p"p@ p@   . .p& & & & p> 0a0* T  2  4P  "T 0a0*  4 $?` @?  'x? ? 2` ` @  @  x`>a* 'xx ?'x`'x? ? ? ? 2`4` `? ? ? ? 4`Ā`  `@3 #  `*`5  t'`"` ?2` N  A'e  x@W'$ (` >#'ll?c  "#Ȱ t& ? ?`̐ ( ^'> 0aX> 8 T> 0`P*@Lh`B G:h  Ȁ 2 Ā " `  , *> @> !@a@ ` 7B: `' ,,`t> "pH /f * ' > !2+ 'H 0`& 2`H /f * '   5 H p@  ""` $" 2" "`  ? ' #V @2> % (b@ "@t|&`& `& ` & `& `& `& `& ` & `$& $"` @@ {'t|& 2 $|` 2`t@ 6 c  "d> "`"`> "!@|* |l"`|*x`B :x>! 0 > 8 > 0` *@"p`B :pD >! 0 > 8 > 0` *@" ``B :` 'Z'  `"`  @x'F '  > !@p`B :p p؀` `8ݭ ؀``8 ?I"`8Ф܀㿘4} 7H /f * ' > !1 H 0  4 H /f * ' > p 2H p@  $ $$ 4    66`H /f * ' > !ؐ0’ $ $e0 $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8  `O  7$  & 㿐  DH /f * ' > !0 H 0  3 H /f * ' > p 2H p@  # ## 3  =    # ,`&      8 `"     $@  0 "     ?#  (4 7H /f * ' > !0 H 0  4 H /f * ' > p 2H p@  $ $$ 4  Ւ  6H /f * ' > !ؐ/ڒ $ $}/Ғ $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8    ' 7$    @& % @ ,`,@  ` *` ,` ,``'` `  "`㿘( ؒ (7  b 7&@ 2   &  &  & ``E&`H /f * ' > !/U H 0 2H /f * ' > p 2H p@ """2  2 7 " && p>  `` `  8)  `ߤ ) 2 8>c"* € @Ӱ`  2 `>c!* €!8 $  ` $ ` ?$ ` ` $ ` ?$ ` ` $ ` ?$ `@+ ` `-@# ` `% ` ` ` `  ` ` $ Ԁ ` $ ` `*@$ ` @P`" `" ` "  `  ?$ ` ?ߐ $ ` ? $ `H /``* !` ` $"`   Id  U H 0a``"^ ` 2Y `6R >750= <,08>  63,  !2 2, *,  6&,  !2y 2 , > $ 6,  !2k 2 , > ( 6 ,  !2] ",   `U" <*@ * $  *`°`;>c *` € 沔  '  '" ` `3>c D*` €,  `)  `2 % `2 ! ` `2  `2  `2  `2    `2  `  2   i '` $` `"@ @ZH /`4 * !  !   '  !'! '!'!'!'!'! ' 5/' $$` `Ŷ $H 0$ $` "  `" ` ` "  *  `ؐ (8HXhpp@X|000000000000$D0d00l    ,,,,,  ,  ,, ,,,,,,,,,,,,,,,,,,,,,,, ,,,㿘>     " $$ @ {ה $` ` `  {`  a2` " @ƒ $ p@>  'Ԓ 5  &@$> # ,,$?`3>e!t*` €,  "& >@   >!.  V4@2$ 1     a? 2,> #,    (,     2  2  2 2  !2'  'Ԁ ̐ >! @ Ɛ )>? ?@ > j""ؐ @'ؐ /ܒ , $  $  $  v$ ؀  1  @!*  V4@2 1? ? 2 6  `2 `@P  2  u 0 6 ѐ Ԁ c$ $  "`$_$ [  W  2  2  2 2  !2 >= : >! @ 4 >!*? @?@  6  `2 `@  2  2  1`"  "`  "@F 6 -' ># @     @- 5&@ԁXT㿘 ~   &&   -0! ``"` @`2`0" `` "`  ` ``"` >#"`"  -㿘  `"  "`  "@ "ܒ 6  2 Ւ 5x  ` @a @?&``"&@ɰ  "Ű  @`"  @8 ` )2@`?퀢`>f"0*` €@ $`&`  ?` ? 2`2`>!@ 8      "x@@ `  //''' B'얒 "q 1`   0@ 2g 1ऀ 2c 1 2Q@] 1@ 2Y ``!E&`R "O @`"K  ` @*F `4&` @ v` &`@ (9 ` `&`&`< @*`` " ) @ \`&` @*  @2   2   2@  *@   ?@& @   ?"@`@&  x$<㿘沔 R  5   '  ( ( '8~ 0 ? ?  ? ? 2 3  ? ? ? ?  3  h 㿘 (f H /f * ' > !)R H 0" 0H /f * ' > p  2 H p@ $  0    |k 2 ~$ 7#V @0    (     (  &  6    ؖ(& &   a& &@  2   ("("<(<(m_pulldown malfunction㿐@`      @: >g1K!   2 )>    2/   * @ r   @: >g1#!    > @!`B  :@ !0 > !@ `C : $  Ŕ  !  * @&@ 㿈 `2ǰ > !@ `C : &  Ĥ ?2  " > !@ `C : &  Ē ?*  . 1  2  2   2 "">       ?#@"> 2`  2`  2`  " `> @`B :|d?` 0> ` `  ` `$ " >  ` ` ?#@2`` 2`` 2``$  " `> @`B :|)?`?#`  ? # '` ' # '`$'# 3   &`&` &`$&`  06`ؒ ?㿐> f!> e#" 8   , , , 7 , ,  > e#?" " 㿘H /e * &  > 0`2` @E  "& $  & $& ( @ @ 2  & (& $> f" 8H 0㿘 > 0`3  >0 4  $   @     @n m_pulldown malfunctionmld6_input: src %s is not link-local (grp=%s) mld6_input: illegal type(%d)㿐 `    ז   @:>i/ P   `2  >  `B : ?? @@ !>iE hB` /{ɐ0@  >i``4 ` ` 2 `` 2`` ?` ? @? 2` `06` `   "   2  `@ Ȥ ``2 >`0 2  `o ` Ȑ@a  3 `  (/@` ``  `` `` `@G  2@2 `( @ $`($`$ ( @@ $`(> f" 8@`Ơ`1`  @7` 3?` ? 2` `06` ` ` @ "`  2`` ``` ``@  2@`"`$`$$`(`? ? "6` 0 .͐ {㿐> f`8 H H /e * & $8>  X'' ` `` '' #  (  ? $ ( @ $ $$8 2 ` `` '' 2 (H 0㿀  ' RH /f * ' > !% H 0`#'>  4`H /f * ' > p  2 H p@ `$ $`4`$@$`$`$`  x `H /f * ' %a H 0  3 H /f * ' > p 2H p@  # ## 3  x  2`y0є @` ($`$` $@$`"` ` :  `*`*0"4" 8"< """"    " " "  "$  # ,, 4 4 4  ?$  $  ?$   $ 4  (  :f4 @͒ > H> # .` @ B8 /> e'/c  䀢 m> 0a > < > 4` *@``B :`#`` 0M40JI 0ᔀD> < @> 4`<*@8`B 3: 0 0ᔀ+> < '> 4`#*@`B :  0ᔀ> < > 4` *@`B :nd6_init called more than once(ignored) 㿘>a<  >kch-  0%> f H*H * > g +  (+b("b("  #a  H>u` >!X*"@ *`@ *`㿘>!0`>>,@*" 0,   * :* "a,, |*  p@0 ]4 0E |$0 00*  `3>!*  @ <#  00* *  00*` *"  0#0*  2 * * @|$  0#0*` "` 0 * * 00*@ @"`㿘> 0!0*`  8 # %"  < <"  < < <;  @%8 % "#܀8""  @ `">@ *"@0㿘@] (&`& & &ndopts == NULL in nd6_option uninitialized ndopts in nd6_option 㿘 2 >l+#(2 >l+#H`"  2 `   `*  @ & @ ( 2  & &  ndopts == NULL in nd6_options uninitialized ndopts in nd6_options duplicated ND6 option found (type=%d) nd6_options: unsupported option %d - option ignored too many loop in nd opt 㿘  >m+   2 >m+ @ e >  `B ;@Ē (W?   뀢0> `!>m"ē*` € *  >!`>m`h+{ >& * `"& & $>!`>m`+g >!  > #@ `B :>  >m`+Q    rt=0 in nd6_timer(ln=%p) rt_llinfo(%p) is not equal to ln(%p) dst=0 in nd6_timer(ln=%p) 㿘>  H /e * & !> ">m c<>!X>3-> gА>! 1> ! ( ``@>0  * 0 ` u@`L`@ >m"* 2T >m# *`a>n#*` €>   6  $ 0#0* @@$  ? @`2"   Q 8$ 8> 40. >   4 $ #>  @ $ 4 >    $ 0#0* @t@ $  @  @a 2v ( "!4 `@:@`J`8 2@`< 2 @`@ 2@`D 2@ `8`$` 6` "` 6`P`8 2@`< 2 @`@ 2@`D "`P@@`8`P  .6``@`H 0$4p> g"(`#>'> h+>)>@`" (` @@3 2` (` a4@) a4    8   <    @   D  @+ 8@`2  0@c@E c ! >#` А@ߒ $@Ȓ @>! ` ! @`@0` `  ` 0@@ސ  ! 2`nd6_lookup: failed to add route for a neighbor(%s), errno=%d nd6_lookup: failed to lookup %s (if = %s) unspecpؐ@䓒     / /ْ'''̎'쒒 '`4$ Ԁ` `8 ?"`8'Ԁ 0Ԁ` 9+ 2 L  '> f$H > Ԣ  !>o!ؐ)( Ԁ "0  L`?2` 8" 84 $$`0 ` `"D @`>o!>o"(  ԁ㿘 ? ? 2`  `0@"& `   `2   0   ``    2R @ 㿈`    `L' ' ' r'>#`2E>#`"@H /e * & ` `@@ V  2`@ "> g`@@耤 > g6 "( "(` "`" "@$($ "@@"@ZH 0 ` `  E 㿘>    3  . 4 $$) L % 0 !  S  2   >a  #   ` 3  @> 00*`  # nd6_rtrequest: bad gateway value: %s nd6_rtrequest: malloc failed nd6_rtrequest: could not join solicited node multicast (errno=%d) 㿀`4> `@` `0`L "  e0"`40>` @2`0 `8,`04$  "`4  "$ `4!`4   >p 8 `8cP`'Đ 0,`04 ֐  f  &`L>pcx' 0> f> f D@`# D"@@ʒ  $ 4  $ ˒ 8 ?4 $ `4>$&`4a a $"a $ " ` `@ ` "'`4@  4 $  $   ` `9 `9,> `> j"`D &`@ ʐ?"   & |&`D@x 4 $ $ T`4 @p<` # '  '''7`07'/'䀢`V>p(#0RQ@7%> fT`4 @2<` #` '`  '`'`7'`0'7/'` ` @ "`  2`` `   @)  2 @0@ ?$@"` "$ `4&`L ;&`4 "s%v 㿘`4`2`@  "!` 0+a >` T `0 8* 02@># ` ` `   @ j ` `@P` > `> j"&`@default router list contains a non-linklocal address(%s) a router(%s) advertises a prefix with non-link local address `0 W 4 0!V "> h!Uܰ0ߐLN00HaPd aM&aO-00J!J1!KM0@|!(H /e4> g* &> g"( 2 /,"*  @'>r ?&` &` ?&`  &`6`ې &,( `.`  6`" &`$ `06`( ` $ H 0v@2'H /e * & >!4W1> * +@ "`$"`(" `,"X * `*!H L#@  020P \ +->r` 4# ,`, @ 4  8  < ? @4?  06$@g  %h ۢ`* * @2 2* " ,#p) ',* * $ ( , 0  H( (!8 $< (`000@02 , P("Ā $$H 0װ>!0#>!, :Ͷ 0* &` &` &` &` &`  &`$ &`( &`,>!0>!, *0 `$* " А@e $@N @İ0H /e4>* &>!4   8   < 2  @ 2 D @q 8@`2 8H 0qH /e4> g* &> g"(    @1 @,b(H 0N`?` @`?` ''''? @? € 07‘H /e * & O 2  L H 0R&`(&` R&`$&`,H 0 # &`@`ifp == NULL in nd6_cache_lladdrfrom == NULL in nd6_cache_lladdr㿘>   >t$T!x`2@>t$N! `  ` `   2  4  (2  "  4 $$" L  0`` `@ `  `` 9@W@ @    9`.`` 9ʒ@ 2 `2  `    ? 4 >`  $  @$ "$  "  0 ` 4  4  `  24   4 T   >#`>#`@I㿘H /e * & !>  H>u`> >!X *"@ *`@ g*`>a# !0>!,@ ,` ` 1 $ >!8$  #2 * * @l$ ᔢ` @>H 0nd6_output: can't allocate llinfo for %s (ln=%p, rt=%p) 㿘!>    8 "  #     :` 4 2`4o  `8`@?@$`8`4 &``0>   "`x 4   A " `0`4  `А`0B $`x " A`4$2`L    `L`2 4 4 \ > 00*`  S !>u" " i   T  >   4$T 2 T>   4$$T , ?"4 "n$ >  6@  $ 0>!0*@ `@吒#$ @И *  yD  4  `" `|    "   | 2 A`  nnd6_storelladdr: something odd happens nd6_storelladdr: sdl_alen == 0 㿘"` 8 "  3 #  30)"/0&/ / / / / /  `0` >v" `` А@  >v"H#tn_ m_pulldown malfunctionnd6_ns_input: invalid hlim (%d) from %s to %s on %s nd6_ns_input: bad DAD packet (wrong ip6 dst) nd6_ns_input: bad NS target (multicast) nd6_ns_input: invalid ND option, ignored nd6_ns_input: bad DAD packet (link-layer address option) nd6_ns_input: lladdrlen mismatch for %s (if %d, NS packet %d) nd6_ns_input: duplicate IP6 address %s nd6_ns_input: src=%s nd6_ns_input: dst=%s nd6_ns_input: tgt=%s      ' ''''' '$'@   ul  l @:>v!X#X   `2  >  `B :  `'` '`'`' >!`W!>v#p  !U H耢 (쀢 $   ?#@>܀  > >䀢  >!`!>vNcȀ  >!`>vBc? ? ??   07ʠ`ДL  >!`>w`  0`" ``*     ؀>!`Ԯ>w`8 ܐ Ȑ `? h .p@ Ȑ ̒ /p/q'x'|''  4@  0 ` *    0 `]`@' '''`   " 9 ?>!`{!>w x. 9 } p@ᗔ   !>w  k 0Z耢 U쀢 R O L@40H -쀢 * ' #> ""` '`'`'' 0` 7ꀧ "->#` @֚0  ` "->#`0@lH0-  !>w     !>w ؔ   !>w!Ȕ >  `B ;lnd6_ns_output: max_linkhdr + maxlen >= MCLBYTES (%d + %d > %d) 㿀 p' 9>  b ?  @g>y  h!(0^H /f * ' > ! H 0" 4H /f * ' > p 2H p@ $ $4$$$$  j ` 6H /f * ' > !ؐ $$jE $$H 0$ ( $4$0$($,$<$8 k/ 䀦`"@   "4/'/ @$@ $ $"@ @  :  `*@  , ` ,@$`$`$ `  $$<c4 0 4$ $ $$,$ ,   ` (`    Œ 20k0$4$ 8$<$@  ,((.`&`?&` &` ?&` &`? ?  6` 24@ِ ` 9  ?@$$ @ѐ .`< ,` 9 G`4 : (6`U6`@   䀢 1> 0a > < > 4` *@`B :䀢 >  0ᔀ> < > 4` *@"> `B :> P`B :Pnd6_na_input: invalid hlim (%d) from %s to %s on %s nd6_na_input: invalid target address %s nd6_na_input: a solicited adv is multicasted nd6_na_input: invalid ND option, ignored nd6_na_input: duplicate IP6 address %s nd6_na_input: lladdrlen mismatch for %s (if %d, NA packet %d) H    ' ' ' $'  >!`!>z"   w>   @@q   @@:>v#X  `2 `>  `B \: ?'` '`?'`'`2 2 2   ? ? 07؀ >!`.!>z"Iؔ &>  `>!`>zb > `HĐ  >!`>zcw 0` ``*   ` `@ 0 !>z#H  Z 0‥` 9 ?>!`!>z#p  9C >   ʔ L`0 T` *` 9 ` , ` 9 Ð `4``$`@> 0> 0*`    4`> > $`2    ` 9@ @  ``T` u 4`> > m$` ````2+T``  9 , ` 9q  `4``$`0>a0* > `   ` `  4`> > $`T` )2(4`  H o *@ f @@ ">@ў,#` >#`@@ H 04`4 ?$4` $` $` h0 > Ș `B ;hnd6_na_output: max_linkhdr + maxlen >= MCLBYTES (%d + %d > %d) 㿀 9>  b ?  @g '>| "H(0]H /f * ' > !s H 0" 4H /f * ' > p 2H p@ $ $4$$$$  f ; 6H /f * ' > !ؐ- $$f% $$H 0$ ( $4$0$($,$<$8 g @` "4/'/ @$@ $ $"@ @  :  `*@  ,,@  ` 2@` 2@` 2@<c4 0 4$$. $ $ $`$`$ ` $$c 20g0 $4($ 8?$<,($.`?&` &`  &` &`? ?  6` ` @y`  ` 9@ ` @  ` 9  ?@$$ @a .`< ,` 9 ג`4.4&` : (6`6`   M䀢 1> 0a > < > 4` *@`B :䀢 >  0ᔀ> < > 4` *@"> 蒂`B :> X`B :X 8"  #  2  ؁> fh"  22 㿘 > b(O㿘ː nd6_dad_start: called with non-tentative address %s(%s) ???nd6_dad_start: ifa->ifa_ifp == NULLnd6_dad_start: memory allocation failed for %s(%s) %s: starting DAD for %s 㿘>p 2  > f h" h"` "p ``>~! 0 ``>~!Xc 0 '>㸀 2 x& 2 4>~&!` oy j 8 |  2>~! 0 ``>~!X5 0S@U 8 @R $> f`h`$""`>!` #>~ a ɐ 0  `$ & $ $$$$@ >`0>0* !X$@#80@  >@zX z>X2`@ @p:`@@&@㿘>!p`  `"  "`> f" l "@Q | ?0& nd6_dad_timer: called with null parameter nd6_dad_timer: DAD structure not found nd6_dad_timer: called with duplicated address %s(%s) nd6_dad_timer: called with non-tentative address %s(%s) %s: could not run DAD, driver problem? %s: DAD complete for %s - no duplicates found 㿘H /e * &  > a 2 >a0U 0 >!X 0 `>~2>>! 0 ``>~!X6 0`!l@ >!`> aД' `2@@ @6@ǐ >`0>0* !X3@#G04@ `2   @d0(0%& >a  #> a  0 `""`> f" l"@h | ܐ?& H 0nd6_dad_duplicated: DAD structure not found %s: DAD detected duplicate IPv6 address %s: %d NS, %d NA %s: DAD complete for %s - duplicate found %s: manual intervention required 㿘Ő 2  >` 0<09 0!> `3   `&  !>! ` p  >aPj `""`> f" l"@ | Ȑ?& 㿘 `  & 4  @   `& `0  t ifa == NULL in nd6_dad_ns_inputnd6_dad_ns_input: ignoring DAD NS packet for address %s(%s) 㿘 2 >" 0I   4 (>!h`>!`!>#  0"   [0 "ifa == NULL in nd6_dad_na_input㿘 > 0  ` "`;nd6_rs_input: invalid hlim (%d) from %s to %s on %s m_pulldown malfunctionnd6_rs_input: invalid ND option, ignored nd6_rs_input: lladdrlen mismatch for %s (if %d, RS packet %d) X >   ' ''c '>#` >!`|!> -* x n>  &`2  2  2 [ @@kv   @@:>'    >  `B G:  끐  >!`+>`4 0&`` ``* ` 9 ?>!`!>!Ȑ 9  >   cE0 > И `B ;c9nd6_ra_input: invalid hlim (%d) from %s to %s on %s nd6_ra_input: src %s is not link-local nd6_ra_input: invalid ND option, ignored nd6_ra_input: invalid option len %d for prefix information option, ignored nd6_ra_input: invalid prefix len %d for prefix information option, ignored nd6_ra_input: invalid prefix %s, ignored nd6_ra_input: invalid prefixlen %d for rfc2374 prefix %s, ignored nd6_ra_input: bogus mtu option mtu=%d sent from %s, ignoring nd6_ra_input: bogus mtu mtu=%d sent from %s; exceeds maxmtu %d, ignoring nd6_ra_input: mtu option mtu=%d sent from %s; maxmtu unknown, ignoring nd6_ra_input: lladdrlen mismatch for %s (if %d, RA packet %d)  > >`0*' '0'@ # ' >!`!>#ِ֐`$ w> ? @? >!`l!> ( d>   @@j,  , @@:>̐   ` >  `B I: `骔& 6 `>!`->`Pِ 0(> 耣`''''`/` *2 @'7' "@8`   "` E%  #2 * * @؛>a8% % ` 2% ` 2- @̀` %>5>3> 2r   j> ` ` b>`Д ]   ?  ?   "N   h F  20`@ "=   VaP4 0@s d  /=/<  'D 'H 'L 'P '0 2`* *` ' * 2` `*` ' / 'x @'| 2 @@ *  ( ԀC  2@ d>!`6!>! -  @ >"%R!`!>!  >!` !>"(ؐ Ĕ ` ``*  `9 ?>!`!>"pk `9  >   +@`0 > ؘ `B ;`ܐ8ؐ@Ͽ @ϻ @Ϸ      / /''''////H /%+&  U H p@defrouter_addifreq: failed to find an ifaddr to install a route to interface %s defrouter_addifreq: failed to install a route to interface %s (errno = %d) Xؐ@` @\   ////$ 2  4>!`>b8 $ 0  >   >!`>b  㿘> g"( "  2  @  2 2  8ؐ@ @  @       / /''''////   `W |㿘>#`  >#`> g @ > gb(b(` "`" ">4  @ " @  @`@ |defrouter_select: there's no default router and no default interface pH /e * & > g"(`,(` ` " @ L "@R  $@@``"`$`@"@"("( $@(" "`$"($``2` (` А@\ $E 0>#`@O $8 > h! ">!`>a H 0㿘H /e * &      2 5 .  6  & H 00=   $H 03  |Ћ   H 0% @ $  &  &  &  &  &  & & &> g(`& ""`(>H 0 \   2㿘  |L  @; $  \ $"  \$ @z& \㿘`"  "` "@ |㿘>!4 @2  ` `2    " 㿘 d |  @ @ d d ` `` @ * $``$`\`( ``(>`   ? @" H /e * & a4a4`$``"`#a4$`H 0 `~ 㿘H /e * &  `"  "`  "@ \ я | 2H 0у |@prelist_update: failed to add a new address 㿘H /e * & Y k @" X 1, X H$ H L$ L T$ T P$ P X L` 8 2 < 2  @ 2 D 2 @ 82 H ` @ 8 2  H>!`& 1>`  !`" L"  @ ` ਀@    " L"  L" @ `>Ē 9ɒ05 H 2 8@̇  X@$ `@  2 >!` 1>` O   ` * * @ H& `" L " @H Ԓ 2H 0㿘 \    糐  " L "R  $㿘>!4  "4a4  -a4 "7# ?#% Ԑ 2   `"  $ `@9  a4 #  "   `2 @  0  #  `2 @  2 `nd6_detach_prefix: failed to delete route: %s/%d (errno = %d) Xؐ@ݒ    //ؔ S@В / (/I     >!` !> A `  8 2 < 2  @ 2 D 2  8`` "`nd6_attach_prefix: failed to find any ifaddr to add route for a prefix(%s/%d) nd6_attach_prefix: failed to add route for a prefix(%s/%d), errno = %d x  . >!`7!>" 8 `8 . 8@V  (  ,  0/ 4 /''''`@ > `  & `!` !>"h 8 `   8 2 < 2  @ 2 D 2  8  ऐ ?" `@  "in6_ifadd: wrong prefixlen for %s(prefix=%d ifid=%d) ENOBUFS in in6_ifadd %d in6_ifadd: in6_ifaddr is NULL (impossible!) in6_ifadd: failed to add an interface route for %s/%d on %s, errno = %d p.%   >!`!> H` #    6  > ϒ$ְ @ʢ `4 (`& `& & !>  X |& `& `   0 `` 2` "`> $ X  0   & & `& "%` `  &  . (. )  0 4 @  8 <  @& 0& 4& 8& <0* @ & 04*& 48*& 8<*@& <. |. } `8 >p>r H# & `@!& & $ ! >!`!>  ` 0  &  0  4& 8& <&& U`4 ؐ@   <<`0c'  7'/7ڐ'ܒT  & H /f4`* '`  a   H 0  H 0- 㿈 : 2V 4r?N @0%> @ɷ < 0c '77'`< '/ ` @ "`  2`` ``` `@ϓ  2@`"``  = ` $````"`& ``"@` ?$` X2` $X` 2`` 2 ?.  $` ?$  in6_init_prefix_ltimes: preferred lifetime(%d) is greater than valid lifetime(%d) 㿘 L>  H  >!`>c0   @ & T& T H?@& P& P > "` `"@"@ P" ` @&"@` "`"` T `&"`㿘> " H /e * & ? ? " `0H 00>6  ( aXH p@㿘 0`" ` 2 `@η  2  4      l 0 㿘 >!@> h c   "c >!.  > h"!> h"!> g"(`  㿘> h!A p '    2 ?#@    ?#@Yq!@V   //ْ  > ha a  `!"v  j 2p  $  $ (   $ ,  $ 0  $@&  2Z             @  2D  Ԁ? @  " 28 3沔 Yʖ  +`@ԔP@[8Ԑ 8p} 2 8XԀ "'X 'oy 88 "'  'Ԧ 2 `*`@@[t8Ԑ 8pK 2 8XƐԀ @!XoI 88 7!  2!;2@X%>   > 0a> 8 > 0` *@" (`B :( #   > @PB?:P!㿐`>c`C!@ ? =?     > 0 `/>  "  ? )> h 2#\!`    j `?#\#`! x/ 0'T'X 'H'L'P @ '  'إ '` R `:2   [  2  7'    ``" 8`  $"   ?ܐ" '  (?" '   ?ؒ`(& &  (X,  "    "   (&   &` `&` &`  &`$`$` D `@` $``$Ϛ 2  )  1&'&`&` &` &``@ > @`0* '`d<*@&@@ ```.@ `j.`|.` R `: `Ԁ?`:2`Ԑ '(7 u` (7j `T  'R` :ۀ@ > 0a > < > 4` *@`B : ` 0ᔀ> < > 4` *@`B :`>#*` € ` 0ᔀ> < > 4` *@``B :`l "j>  0ᔀd> < `> 4`\*@Y> `B S: "P>  0ᔀJ> < F> 4`B*@?> `B 9: "6>  0ᔀ0> < ,> 4`(*@%> `B : ">  0ᔀ> < > 4`*@ > `B : ">  0ᔀ> < > 4`*@> `B : ">  0ᔀ> < > 4`ڑ*@> Ȓ`B : ">  0ᔀ> < > 4`*@> `B : ">  0ᔀ> < > 4`*@> `B : ">  0ᔀ> < > 4`*@> `B : ">  0ᔀz> < v> 4`r*@o> В`B i: "f>  0ᔀ`> < \> 4`X*@U> ؒ`B O: "L>  0ᔀF> < B> 4`>*@;> `B 5: "2>  0ᔀ,> < (> 4`$*@!> 蒂`B : ">  0ᔀ> < > 4` *@> `B :> #,  B ;   @U@`  ```8 ?"`8Un8X9,99>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p>p:d:;4;< 㿘):$ 0'eilk  F Tv 0  wС̔ :   T]rip6_attachrip6_detachrip6_usrreqp   @ `  'Ԑ{K`?.`># €`>"0 3'ԑH /e * & >>#k   'ԑH 0> ha7  'ԑH 0 H 0 ?$`,`j  Ų  $`A 'Ԓ  * ``(* ꀦ  > !!$``` $``$` $`  ?6 i`2>>"@ H 2``؀ ] $`   @> !Ѐ`X 1 T 1    ?#@F 1     2 1"ऀ , 1$`$ $`($`,$`0  y'> !Ѐ` 1  /n'``@``$ƚԖ 2 Ԁ a 1]'Ԑ$`$$`($`, $`0$` $`$`h$` KiϐG   8>'Ԡؐ@i   //ؐ` 2 9+'Ԡ''' ''''%'   -'Ԑt- tD>"PSBԁBD\DGlEGlDFGlFDTGGdGlGlGxGGl0 8  ` `@    'ӟ '& "S     2 /  1  ܐ 8  ؐ 8  Ԑ 8 А 8'''  ''''     @ $ 2 6  1' 2`p '` 2 4  2  4  2 4 2 4 9 $ ``  ` 0`8 0```$" `?ܐ?" 0  0  `` ?В`0&`&`  0R֔ `[ 7` `` 0&`R 7`? 6 (2 (c 4 4 4 B4 D d<`* &   `.. @   @E.@&`& ` &`  (&&&&  &$* `4 <c4 > j,`",  @    ' /'R'"& R!㿘@` +>!x*`   0@-$ 2@ * $㿘@! 2>!x*`"  㿘 沔 R  2 H /` * !  8>aiW  QҐH 0 7H 0hM    㿘 & ` 2` `@ (  J  2`  S` >Rax* @ ``Q㿘    $ 8 @g H /e * &   ) H 0 2  >!"` f >`@ 4 Rx* @ 2  ĝ 㿘` >Rax* @@H /e * &     H 0 " 㿘  *`2`  >!x:` `& +`0 | H /e * & H p@PF_KEY㿘>!x  . `2  . ** *  *  J?  '>!x)>  @  !& 4@ 4  4?`>!` "$` J$`$` 4 J  > !Ē 4>!  "$  J$ $  㿘 > !>a"!@ "`㿘  V՘ &   㿘  J  " @T >>  $ $4 "$ 㿘>!!" @@@ "@ 2@@"@>b?"b>b?"b É J 㿐  ,   *  ,   J    5 4`     2 p*@* @  { `"6>``0s0 @ϒ   5,,4$Z m>!`` " @`Ҕ @`2`W0B!``  `  @`*  `@`2`O@   5,,4$ '!``  2@` @`2`O~>!` ` }@`2`Om@R¹ Jpؤ@H  "  "  $  $  // h  //ؠ  J  ' &@(`&`T&`Xـ    ( 2' 7 ( ,' 0' 4' J'7ڐԠ@ `&`D&`Hـ  0 X b' 7 X \' `' d' z'7ڐ@ |`&`X&`Tـ  0 , 4' 7 8 <' @' D' L'7ڐ@ ]`&`H&`Dـ  0 \ d' 7 h l' p' t' |'7ڐ@ >Ԑ &`P 2@ـ  "  x  ` " $ 0*` $ *` " $ H*` $* 㿐  0  @2  P  @2 P  Ԁ@"  P 2   @2    @2   ܀@"!% !%  !$  ?@!  !  ?@!A  !@  ?@!  R   ?@!  R   ?@!x  R   ?@!|  R   ?@!  R   ?@!  R   ?@ J  ' &@ &`@ &&`@ 3    @   Ԁ@  @"  &`@     @   ܀@  @" &` @  !$&`@ ^&`@ Y!!@ &`@ Q!@! &`(@ B ! &`,@ 9 !x &`h@  !| &`l@ ה ! &`p@  ! &`t@  !\ &` @ J !` &`$@ A  @ `x! 2! x |@d@'x֔t x" `   6t J  㿘@`!  >   -00  -0+>$$ 3#*@  "  2*@ " *@ ">( l*@ " - ipsec policy@'D'H'''@ |>! ' `D` 2@`>b ?  J`  ' @В  -@ -`>  45`4H%`?`R̀ '!       2 TL@  J'H@ q' `?`i>!T*` €0@! `2 /4J X'ȢT@ 8@ (  2 E'(  J  '; @a '''(@ y2 H /` * ! `` ```   l 2 3a W `$ a '@,  ` ,!! B'@ @ !$@ !@ !@@  @  @  @   @  @  @  P@ ͔ T@ ɔ X@  \@  '' 'X`$  r '`8$ D)'           ݐ @ @ U @ Q @ M H 0 H /` * ! `` ```   l 2 3   `  '@x  ` ,!!9 '@N@ !$@ !@ ߐ!@@ @ @ @   @  @ T @ P P@  T@  X@  \@  '' 'X`$  'Ȓ 'D'H 0' H /` * ! `` ```   l 2 3"  VH 0L$`   'Ȑ ' H /` * ! `` ```   l 2 3 ܐ2 'Ȓ 'H 0`> $``" 8 J+  'u @ 8 2@>`" 0 '$ J  '` H ` * @$`@~  2@>`"8  '  J  'B @h  2@>"P`ޔ 5'`' `` .>!,*` €H /` * ! >!d`!!d`H 0H /` * ! >#T`H p@D>' '"v )'Ȁ  7' H /` * ! `` ```   l 2 3  4 DH`     l 2 3   "    `" ` ""`  `"$ ` ""`$ " H 0ȸ 8 ?  `  -`      < @,`  0 g` `d ` Ȳ@ 0@ 0h@} 04 2   0////     QД 7  /' /'7 77/`''`7674/7  /' ''' ' ' ' /'7 77/`'` '`'`'' '''`77/А@ 4 0H o0  *@ a Ѐ 0 8 ?"8@ 0 2  `0@ 0 2   `    H 0  E'ȑH 0ȑH 0 98> !>   m">#h`x!#\#`#d Д   ! 2 H 0l @ $``$` 0  /h/i7j 0'l`0 08 `>!*` €",` ,` ,` ,` ,` ,`> !0אH 0+    ` ,``|Ɣ  `|@B  ,`} ,`| ``  ```@3  ,`a ,`` `     l 2 3` ,`;$`` 4$`"- n, ?? $` 2` n2`" `"```2R`"> q0!#H 0 7e` + n, ??e $` 2` n2`" `"```2R`"> D0!H 0 78` G h (n ('`" ````"`"``"@` "`` "> > !H 0`>!d!d`$`!d`"`̐`"$!d!d$`>aP "aP <`,`H 0@Ȁ"H 6'! "``" ` @2  k G[Ȁ  ``2`@  `$`  $ $`?$ 'Ȁ  7 5 73 *"@Ȁ &  -` `   *`+@ *>bؕ(@  ># @  D Ԙ ' "HR JHO J Ȑ 'ȑH 0ȁrrrrrrk(kkwwwwkwkb@ceh hl0il0kkvmml8haes3desdesblowfishskipjackcast128deflatehmac-sha1hmac-ripemd160hmac-md5>>&"`" S @  ?``  ?@ p`h`  R   ?@`  R   ?@ J  x. @e |@a'x  7 .6.&` 2 . 3 l  ."@ '2 2@   `@'2 2@   `` 'R   ? 2 3`3 ` R`` 'R   ? 2 3`3 ` R}`''tt  *2 'p >Ѐ 6` 6`` 2M l>  >a@  >  @;!a@  > # a@  > @ 6` .`36`a@ >  (!a@| > P .`6` 6`a@o  >   ( .`6` 6`  > > >!a@]  ".`> >ؠ"P@S >  a@J  > .@6`6`a@> >  6`.@6`>#>+>>>c>c#;= >ԙ=`+>cآ> ==&`&`>`>` >`(>`0>`8>`@t`Hp `@ Q'px  ! @6 J! 3 26 !  l"!P - J!$  ?  p  't@ x@ |t@ t `'t'x *@*`!>*`!4t"`2` t#!'|@t'@ t.`2 $@ @t!$'@tt!'@o    @ϐ6 J㿘#> f`p@Ē  >>>$`pbP$ $ $ 㿘> fÐ p 㿐@ |` & * 2e     〢>   `4 2T   `K  J>"X*`& `(C * @Ś * @ *`` >#*` €2"  8 "  8  8  瀢   2  `` ? 2  `  !( w`u   4` ` 2 @ `@ [ [`2Ұ ` U+ 2    4` 6`E ( `@`?: *  2 5 (  8 + (  8 ! (  8  gJ?`@   ?(   *  "Ty (v  @ H @n H @ = 8a   8]  `@ * -(Q  ԑ+ 2    +`2 ? 6 @ 4; `  ` 2/ @8* &@* &`ߤ`2   >"*` 2      0 `  0  `  LLLTTTh00TT<<TTTD0`8"0 ` ` * ` * ` *`" `*!` "`  $" $` "`  $@" $`  $" $`  $" $`  $" $ `  $" $ 2`" a*`$2* al2`` "* `"`>ԇ(      * `"`$ >(        * `$"`$ " `$@"`$ " `$"`$ " `$"`$ " `$" " "px㿘`"D`"`0"}`0 &  $  $ ?& $` >  $  $ ?& $` > >X ( $ :& $ @  ϐ` $ ?& $`  > >X @ $ :  $ ?J& $ &  $" $ =& $` >  $! $ >& $` > >X X $ :& $ @  ږ` $ ?& $` > >X p $ :& $ @  0  $ ; & $& `> `> `> ȁ@  $3"$=@"39@"$# $"$; $"$; $ "$@ $# $"$; $"$; $" @# ; ; ; @ #@㿘```  `` 0 .㿘@  ? 2 2@`&@`*@  ?@&㿘`(!!@ n*  ѐ &@`*`2 22 n & "` n"`R`` 㿘`.!x!|@ n*   &@`*`2 "   2@ 2@p n & "` n"`R`x` 㿘`/!!@ n*  s?&@`*` 2 022= n & "` n"`R`E` 㿘axa|R ` `2`2  "  2`&R $ R`  ?@&㿘aaR ` `2`2  "  2`&R  R`  ?@&㿘aaR ` `2`2 "2  " 2 22`&R ΐ R`  ?@&` ``0"2 `0" 2 㿘`  ? 2 2`*`2`&a````  ? 2 2`*`2`&a\``  ?@&vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapiommu%s at %s㿘`>   㿘> ` `@X`? unsupported cache-coherence?page-sizeiommu_attach: can't allocate memory for pagetablesbad iommu range: %d: version 0x%x/0x%x, page-size %d, range %dMB name@`> " ` >Ȑ!0 40@Y &`0>a@ 8&`D> `"&`D`D> !> ,"!>a0@ `0&`4@ 2 *@&`8 <* '' @#\#` ?FO  >c@ >!@ 4 &`@5> j%> i5 48 @  , @ `@@`4 ,@ * @BĔ >`<   ,`T    Ң ,@`@* @ `8@* ?@ 5 >#?`@`0& ,:  0$ Є&`@ :`@>`< `T  ?&`8&`< H `0" `0@* ?  "@`0 "`0" H 0 `0>@!`82`4 `23 4  >@C` 2'4 ''@ݐ %>#>@@ '`ږ @А > > > 2@ *` <b#@0 @("@ 0 p > `> < "0@("0 4@vmmapbsyvm_map_lock: failed to get lockobiovmelvmesvme㿘>    `@`?%s at %s addr %p vec 0x%x㿘  >#X& " 4> Q#h 4>M#x>`  >B# 㿘`> 9#h ph`Pinterruptcountereeprom unsupported rangesobio: PROM ranges too large: %dcould not find %s amongst obio devices namezsP> `` 4>> >8!@   ` >> x0 4  >@2b 2'4 ''> @ @m &`< )  &`8> J@i@> 8N`% 8+>)>@z `/@Ɛ  @) '#؝ N 4'>->+>)>@c8@ђ 2@ @’`耢 2 $@)s '#g @] Ԑ㿘` >> `>> c@  >>E x0B 1> i# 2 > $ &#@ $>r"@Z㿘` >> `>> c@a  >> x0 1> i# 2 > $l &#@$>E"0@-vme: PROM ranges too large: %d: version 0x%x P> `` $`> x0R0`4 @x &`0`@< @r >`&`4@ $`0@n &`< *  &`8>!K@j`0> >"!8 `a4  >@c 2'a4 ''>#!> ' 'ף>c''ך vmebus: no ranges㿘 < 2`4> "? ? -   =" @ <  8@  &`0  * * @ 2 &`0P>  ` q> `<2| > `<@"s `  '''   > $ 8. '䀢  ?@> ,@  ` '`'?'` '8` !'>@Sc  >8@Jc  2'>8@Ab 2'8 ''@'   "'耢`">@Ȑ'>(㔰 㿘l 㿘d 㿘\ vme: spurious interruptvme: spurious interrupt 㿘> L. >*``  8@6  >>  `4 "P> i>"h #*`  `" @   2vmeintr_establish: interrupt vector not allocatedvmeintr_establish: uninitialized vecvme_addirq㿘> i#`?>ѐ#`2. >̐#@ 2"@>.`!> > .`!>   2 &   >"   2  }  2>#@ "&@p& 㿘> `*> ,@ &>`(>01?`?@ @ * 2@  # ֆ 2   2    @r 㿘> ,?@> i!8@* auxreg㿘> j"`N>"8`(Ho o> `> X?8` **XH 0 01> "X?8`**"X> "X?8`**"XHo o> `> X?8` **XH 0 > `>XV(2 > g# auxiliary-ioauxioauxregmatch㿘>  "   >0>0 >#8>#H@`?ؐ#P 㿘?80 @ޖ >` ?8 > j  > j > *bX">3#> g>#ar >"8`] no aux register㿘> j"`>힐 H > "X@*@*"X*H 0 > "Xvmmapbsyvm_map_lock: failed to get lockoclockeepromclocktimer㿘> ` >`? >`@-   | 8@  delay constant %d%s [TOO SMALL?] oclock: calibration failing; clamped at %d 㿘 >" Ē   @H0>  > *`* @ *#cP@ @ > "!Ф ~g >"!cP *  cP *   #  P`* >`!>!>!v 0 ` >`&l"㿘> ` V` >`? >a @   |\ 8@  㿘>H#  0@ۖ%>>"`"㿘> `2>`? >aL@ "   |1 8@ >@q!P`?mk48t02modelno prop: %s (eeprom) mk48t08㿘> ` >   >@ؒ` 2>>  >@A`Ѐ  0 @#> !> i!8c0  c0& @ 0 @j(> c0> i!8   > > ` >> "a" > *  *`  *  > #!"ahcounter-timercounter㿘>   >`? >@!`   { 8@  >"p" >"@`?delay calibration delay constant %d 㿐!>    ?* *   @ ?   @0? ?> g> ""$"D" `   ?0 @ܖ ?` ` > g>"ah"!'> $!'$@~ d@`>뱐#8> :` @ d@!!P㿘Ho o  > f`    "` `?"``?H 0 `> ,> > h #0 > i!8  > h>g>  `* `*  `*  `*  `*  `* oclock0: cannot get %d Hz clock; using 100 Hz clock0: cannot get %d Hz clock; using 100 Hz clock0: cannot get %d Hz statclock; using 100 Hz 㿘> Ā`!!>!X`d>즐! d> "`В d$!X@"@!> >"a\#P *|` #P *`|Y #P h*`%>X"@@  >쀐! d$X@ِ>"a\#> c܀ cX$ccܐ@ >i" d$cc> " @>3  `:  d@!> :`@4:`"   >!\> gb$>  D* "+ "@   >!\?`*`  "* " `> :  #"`{  { 㿐Ho o> Ā` > #P  '{{א 0> > g"$@'? 'H 0> !؀`@`  > ` {Ӓ 0{  oldclk statintr㿐> Ā`>>\!`  >  D> gah '  > g"$ ""  "`0"  ? 'y> |>    @ >  D* "  * ?"`  ;Zx0N㿘:(;`; :9 8` / /`+* *`(@ ( `.  .` . .`D @E ` ` 43   F,  * + 2!m!n >. P?@`4 * (&@& (.`& ' . (( 㿘>  Ta@ @H @}* @? &  E& &    >`?"   ,R 4  6>"*`R $ `& & 4& Ta@ @B.& @.@: <& @ <&@1 * @ & @(*  @&  @*  @ &  @* @ג  &  @ * @͒  &  @* @’ & WARNING: preposterous time in file system WARNING: bad date in battery clockWARNING: clock %s %d dayslostgained -- CHECK AND RESET THE DATE! 㿘> Y`?!ah  >b" ư!@ > Ā`@> ;   `@- `-,> "`   >5"$ `$>@& > , " >@#># >#(Ta@q > #0x> Ā` >  -> #P`)@2>  `!> !h Ԑ  ' `,',',',',',',',' ' `,'㿈@@㿈@H'@%> PH> P  *  *@`@ cP * H > PH> P  *  @`*@ cP * H 㿘!T!@Ր!@@Β..`@.@ǒ <.`@ <.` @ .`'>2>>!m!lP`.`! "`!@   & ! "  .`.` 9 5  1 '    2mn 8  >@* (@* (* ("@㿘> Ā`z/0=H >   & & H 0 > f       >4> & "? & ?/a `&&   "㿘> ` >  : %"@8@s /1>  ! % `   , F   @   @`㿘>  6 - >!`> "!>@N* :  .@>aX@ 2`  !P« @N* :  ٴ`   㿘> ` #> %>$` !P … $` 2$` % 㿘>> `" "i power㿘> ` >@F!`? 㿘  0@ > "`<> >*!P㿘>J!`">  < `*y/"@ledleds㿘  >@!`?  `@   >  `? 㿘>&`0bܐ`<> ` >80 @4 &`4>"8>"b<@>琐"X㿘 H  8@Đ >8`& 8& 8>`  Ho o 8>"( ?c 4 2H 0 ` 8Ho o> 8"( ֪@@H 0 8  > `>Xx (2  <ʼ vmmapbsyvm_map_lock: failed to get locksun4cpu㿘`@~`?midsun4csun4mno%s @ %s MHz, %s FPU: %s%s, %s; %s  &`0>`p@  &`LX:   @2`H &`H`H  >uM 0>uI!x>   0 > x> >"bP@`H>` a0`@@S> #`" `4`8`<@a`4!>`h@1 >湐 > g>> `!ߖ> JaH aH> 樒 >楐 ``"`H@k`H >t!xH/ /aD@ H 0㾐'pvp:   &!>  "c%s: %sphysical %s%dK instruction (%d b/l), %s%dK data (%d b/l)physical %dK combined cache (%d bytes/line)%dK byte write-%s, %d bytes/line, %cw flushthroughback%s%dK external (%d b/l) 㿘>cH>  .#P `"> `#X>#`   $ > ,#p: >c <0> D# : (>   > `#c :` > >`#c l :` > >   s   h >c T> \ : ڒ`>Ր 8Unknown CPU type: cpu: impl %d, vers %d; mmu: impl %d, vers %d㿘> D! 8 <C @  ""`l0= . 08" >&"`X"`"` "`"` "!X"!H"!L"!P+"!T "`l"   "` "`"`"`  ("`l"   "` "`"`"`  ("`!"!"`l"   "` "`"`"`  ("`㿘!>  p4  "" 6y # !?00 $}0+!@  d !& & & & \!& d!0  "_^ @ !,! & & & & d& \b@ !$ @! & l& & & d& \& `& mmu-npmgmmu-nctxclock-frequency㿘@>`P@ & h& d>`` @& \>`p@ & vac-sizevac_hwflushvac-hwflushvac-linesizebad cache line size %dbuserr-type㿘`? >`@@$`& >`@͔ >a@ǔ >a $`@$` `  * & * "@>L!  * $`l$`$`>$`a8@ ! &!cache chip bug - trap page uncached㿘!  >`4 @2 > >!HȒbPcache-physical?ncachesicache-nlinesdcache-nlinesicache-line-sizebad icache line size %dicache-associativitydcache-line-sizebad dcache line size %ddcache-associativitycache-nlinescache-line-sizecache-associativityecache-nlinesecache-line-sizebad ecache line size %decache-associativitywarning: couldn't identify cache 㿘`  >b@& >bȐ@  2&  & >"& @ > @b {> v@ & 4>b @& , `>!>%> )>`   * `2 * `"& 0>#q& 0 @͒c  4& 8tt 8& $@” & L #8@& D`  `   *@ `2 * `"& H>#PA& H @h& P Ltt P 0& < H 8  ,&  D@ 8  $& 5 >c@ & >c @{&  `> )>`   * `2 * `"& >! &  @Yc tDtB&#@ 3@H & d>cȔ @B& \ ` >`   * `2 * `"& `>#Œ& ` @!c& h dt t  h& T >+ 㿘@y Ā( Ƣ㿘@j@ [viking: PCR_TC is off]㿘 ւ>!  @ & T&!>   T &!>!Ȓa&!H&!\ T   & [viking: turn on PCR_TC]㿘 >`T  #@2 >ΐ!@, 㿘 &   Ң @㿘 H H:  < @&!\& 4& \& &! &!0&!,&!D&!4&!H&!L&!P&!T@&!X&ƀƠUnknownTI_4_4TI_4_3TI_MS2TMS390S10TMS390Z50 v1TMS390Z50 v0 or TMS390Z55RT620/625CY7C611CY7C601/605 (v.f)CY7C601/605 (v.c)CY7C601/605 (v.b)CY7C601/604MB86907MB86904W8601/8701 or MB86903CY7C601L64811MB86900/1A or L64801psr-implementationpsr-versionimplementationversionOut of CPUs㿘 H @>H` >c@?`4 ` >`@?><  > ` ` >` @?`4 ` >?`0@)>< % ?"?c@֔?>> 8`@̔?>> <` @”?>?`0@)>>!x @2  ?2  ?2  ?2   ?2 & 8& <& @& D ` 4 2 \ & 4 \ 2   & \ 2!  & ! 2   &!  ` €`"!0 2!0  > p@^ & @(@V & !0 2!,  &!0!, 2!D  &!,!D 2!4  &!D!4 2!8  &!4!8 2!H  $&!8!H 2!L  (&!H!L 2!P  ,&!L!P 2!T  0&!P!T 2!X  4&!T!X 2!\  8&!X!\ 2!`  <&!\!` 2!d  @&!`!d 2!t  D&!d!t   H&!tB5010 or B5110/20 or B5210RT602 or WTL3171TMS390C602AL64814L64812 or ACT8847L64804on-chipWTL3170/2L64802 or ACT8847MB86911 or WTL1164/5MB86910 or WTL1164/5version 0x%x㿘>#`#`2``?2`` 2` `@ 2`>aސ㿘>a  "aHo o>!x `  n"` H 0memregmemory-error㿘> `2    `>"@`?memregattach 㿘> ` >  8 2">#X`2 >  0 @ > " 8>M#h%ssync mem err: ser=%b sva=0x%x aWRITEINVALPROTTIMEOUTSBUSERRMEMERRSZERRWATCHDOGaer=%b ava=0x%x WBINVALTIMEOUTDVMAERRparity error register = %b ERRMULTITESTENABLEBYTE0BYTE1BYTE2BYTE3memory error㿘># > > >  >> `x> `8`>>@ >k memory error:sfsr=%b sfva=0x%xCSERRPARITYSYSERR UNCORR TIMEOUT BUSERRFAVOWafsr=%b afva=0x%xSYSERR UNCORR TIMEOUT BUSERRAFOhard memory error㿘>߲!>>߫!>>!ߤ`>$"(HyperSPARC async cache memory failure at phys 0x%x%x 㿐>!8€` `>"|2`>a>! " > ?"#a#!store buffer copy-back failure at 0x%x. Retrying... warning: got data fault with no faulting address. Ignoring. 㿘 + #`!>5#>a "a>#*> + >a ""aЂ$ Т@ a 㿐>!8€ ''Nzs㿘.3>` pR ` " pK  㿘.3>` p? .` p8 slave㿘``@" 2, > `2  >> `> >a@?V`@ @      ,  l& 48@ zsattach: expected 1 interrupt, got %d pri %d, softpri %d broken zs interrupt schemeintr㿘`> f-  @$@ 2 !0 "!0>">"g0 >"` > f > f> f>b,"@">b8@  > ">>ϐ"ؐ`4Dzb> 0``L&`L&`0&h&&l"0- @L& &@&@ ?c @ *`l `>>Ú Ę"X#`l#`#`Ѐ`&@##`>> #`a@#` .7 @> >"H@ >""L&`* V &dh`& @&@&@ ?c @ *`l `>>Ú Ę"X#`l#`#`Ѐ`&#$#`>>#` a@K#` @>k >"H@ >""L&`*  &dzsconsole㿘`>/"P> f>` *>`""H@ &> f`"`">#>"bt>""D>Ð!&> f" 㿘> f   H /k * ,  '>%> nÐ  L` ` J`<  `<, L*` f >"D@ > >"H@ > 2 n`2 n1 ?c* @ ` *`  $ l>Ð"X$ @#$ $ $ `>#$ >``  a  `> 8  .8.:㿘  *  @:㿘 @*Ԑ (& p㿘 k& p㿘? 2  @>" ` : 6 "*@ `* @*`@*``L L`: "` H /e4 p* & p # 5   #c %$ $ $ $ `@$ $  @ѐ{ p $ p ?$ p$ ` H 0   p   H 0 ,`=` w `= sH 0  `=] "$ p `= 2 @$ `> ``m `2 pL`6 "  p $ p  @2 `= p > `= <>ؐ !   `=    " `= p  @  p }$ p2,`= p =$ pH p@0#`2 p  @ p "H 0   h>a* @€ @ 㿘?2   * >b* .   *  L@ > h!*`  €H /e * &  @ p "  @~ >!X>А    " pH /k * ,  )   . )  . H p@ p ?$ p. =H 0 㿘?2   *>"@ .  *`@ *`@`\> h*` 㿘?2   *>"@ .  *`@ *`@`\> h*`  ? 0  >*` *  ( (\㿘>  0 q  `   28.  \  @s  d* "@  @  d* "@  @  d* "@ $ \. p Ā  h@E  ̑* "@   h@  ̑* "@  @ h  ̑* "@ $ Ā" h  `@ "`@ h 2 `> ` js jK ? 㿘> ``kА L7 > f ` *`J`  *` ,  M  L  @ , ,  S 0.@`. k  8.@``". k .   0.@`` 8k  8.@`` k  㿘N < D  <.`. <1>   8kv  8.@' `2 H (.@1>   8kf  8.@ ` k^  & D !>.`  `& HkP  8.@ ` kH  㿘> @` k;  .@`` 8k3  8.@`` k+  @  @      . Ӓ     ߔ. Ȓ  ", N 8 ` 2  0 j @ ` @ 0,  㿘>"p`@8zs%d%c: %s overrun 㿘> @ఀ@ > &@b> a) ringfifozs%d%c: bad ZRING_TYPE (0x%x) 㿘>  0ɸ `X\> ha* %@  @  >HƒP%@,$X d* @ ` 0  > y> <`` >PT`@<`@`@شy2`@հs€n 4 "? pH /k * , > ``jS ` ' ,'$gB @H 0L,4 p!2 pH$D @. `t$Hj, 0p p `% p % pH H Pܒ" `@ 5<`@  4` `€ 2 ,5@,5cXa W=_ A$X2<`㿘?2   * >b* .   *  L@ > h!*`  @ 6!Ҙ & ]@ "jN 6`y@`x@ `z@<`{@  k@ "  j@\@"S  l@ѐm@" H /k * ,  )  . )  :. H p@ǰ H /k * ,  )   . )  . H p@  #@ `2  2&!2B "    H /k* , N :  3  # ` . 6. 3  . #ڒ  3. 6 #`. 3 . # ˒   @$   3 #    . 3. # '    . '  .  @@$  3 # ߖ   . 3. # '   ߖ . '  .  @*@$ H 0" @h  @d  @  ) `    2@ 2 & 㿘 l? @2  `@ `*> * *` ` *  LH /e4 p* & pM V  H   H & pm  H /k`* ,`  p  & p % P , %  ,  >*` hY  $ D $ H %   , %  , H 0H 0l?0*`> "(( (LH4p(p" Dp"pH 㿘 l? @2  `@ `*> * *` ` * `( L `$ 2  ,@ | @, ? 4`s @& & & H /k * , <  c,`1,`%,`0"   "  @     @  `@@ ` `2 > `",`'g ,`'?,`)d D L@" @2  `4  P  ,`(,`-,`/,`2,`3 ,`.` p` `D,`4$`L $`D``$dp `@?H 0 㿘` ? ?}H /k * ,  ) 4 `. )  p`  D. 4& L & D     . H 0㿘 0.!>  g-     g&     g    "`g `Β ` ʒ ` Œ `  ` `  `  `  `  ` ` ` ` 㿘  H /k * ,   l@ " )4 m k@"  )  4@" ) 4* } . ) 4   p`  D. 4& L& D )   _. H 0fdc360KB/x720KB/x720KB360KB/PC360KB/AT1.2MB1.44MBfdSUNW,fdtwo㿘>    "     2>> p h@W@ "    c ?   drive %d㿘`>!@ 㿘@a  @2  " d@R @O w@L@I [version cmd] CFGLOCK: unexpected responseintr pri %d, softpri %d: chip 8207%c 㿈 2&`H80 @B &`H`h&`d &`h&`&`\`\&``>`x",>ϐ@|cX>ʐ!&`0 `0@&`4`H 7&`x&`|&`   7 *` @ " 2 7+ `h &`h`H&``&`|&`x@   X@  X`   X>"P`" X>\! X&`tq`h  @Β @ >K!>Ő`b>ŗ4 " @ 8 7'> `>> p h@ *>  " #`( 04    >  <@ >@  >'>ʒ`(`G>ʐ`В`B>"'5>Œ'L ``' @ fdprobe: %d stati: %x 㿘$ hg   * @* 䭒 e$ & @? @< !>` #@"Pe# x @ Ѐ 2`ae "@%   "P@ "P "P  >Ɛ!xӖ  >%>Ơ Ӎ& >ӆ!`   `? h   *@ V : %s %d cyl, %d head, %d sec : density unknown 㿘  > 0#X  V?>Q#x?&`&`ܐ L&`,`" @Ò  @ @> `0`&`&`X2&>ϒ@"!>Ƞ!<> ̐"&`@.e>Ȓaaxeaafdstrategy: b_blkno %d b_bcount %ld blkno %d cylin %ld fdstrategy: controller inactive 㿘 D> :  6) * @ #  T  "P`& @> <  ҽH /d * % 4 v!!8 2 $@0  d >Ҡ @ʐH 00 0(& 0IU㿘 $  \&!8&  ` &  `"# `@ 㿘 ` $   & &  "`  "@`$  &  `&  `"@$ `&!8 ̐&`@& `$I&! >!X*!͒@ $ dfdc reset 㿘 h " x  *@ x *@c  x* h`  *@>"P`>2#Ё㿘 h " L \  ߔ    L *` " ` + * ``*`*0  *` "` 2 ``*` ߒ 0 ے 㿘H /d * %   $ & H 0㿘 $H /d * %  ?& \@d @A H 0fdcresult: overrun fdcresult: timeout 㿘a " '> x `Ѐ``$  (O ? | , b 2 x>Ȑ ?b@?$ ?㿘 xa ``?bؐ  x @  ? $? | *㿘>  :` 6J * @   p2 ` ` *` *  >* bL  2 ,  "  Ā " # ?  $ $ 䀢$ @! `  *@"     $  $     $ >2 @  ( """ ( "( " "ࠝ㿘>>\! "h 㿘>>\! "h  fdcstart: not idle 㿘 d >ϐ!0@J%s: %s: state %d (st0 %s cyl %d) invldabnrmlseek_cmpltequ_chckdrive_notrdytop_head (st0 %b st1 %b st2 %b cyl %d head %d sec %d) end_of_cylbad_crcdata_overrunsec_not_fndwrite_protectno_amctrl_mrkbad_crcwrong_cylscn_eqscn_not_fndbad_cylno_dam fdcstatus: weird size: %d 㿈 $> ! d o`>``>%#>!#>^!0> " W 0 >  >#\ >#` >#d "`#h C"0@timeout㿘 \H /d * % >ʐ  ! "& d d & d@H p@㿘H o*@ e@ H p@㿘 "&  H /d * % @mH p@ fdc: spurious interrupt: state %d, istate=%d fdcintr: spurious interrupt can't be clearedfdcintr: block %d != blkno %d fdcintr: %s drive %d track %d head %d sec %d nblks %d readwriteseek failedread failedwrite failedblkno %d nblks %d nstat %d tc %d fdc: %d -> threshold soft errorrecalibrate failedstray interruptfdcintr: impossible㿐   d>{! d`k& >! \`2a & dʰ $````"`& ```"@$a80@2H d`>͐"*` €& l$`<a$`T$``   & d* L`ܐ * @ " ` "`! ?$ ``$` h ` & d>!X`ax`:`w ` ?$` h " `0@2`@A$`@@=}  $`w  r   & k    `e 2  `@_( [ ? h& d$` & d& `p`0B<`p>!X B*`&  $`` `@`̪`$a:` @8> ,  !: 8$`<- $`@_u%@ _q`_n`Ȓ@ >Ώ!@-`H>0@ & `&  x /*"P`>ʀ ">"8>ʒ"@ `ܘ`m#\  & d& $& ߒ M _, `ߒ@ `א X  ѐ R  ː L  Ő F >    怢 " `:  ŀ 25  `ߑ,@ ` ,  ` %   ` `               & d`0>!X q*`U   h ` & d>aX @H 2`D `0$  > 2 >` ( ^@ @>"P`>ʐH$`> X?8`* *X *0> `#> bX!?8  ,,bX_ bX ,,bX0q <`0@"  2> 2 > D 2> t @2? l>bP  0@>"X>ʔ"h  >`Ԑ"x` y    t 4 p"P ?  & t>ʐ"` w& p p  & p & d l >`>ʐ h b!; ?A >A!& l p??& p t ?>P ?  & t>ʐ"* A& p`Ѐ``Ȑ `$``Ԕ"  $` $`̀$`@q$@ \ݐ^f d>!X 2`@ & & d & s:`W    & d& & i    `c  q& d>!X* T@ 8   h ` & d>aX @+ C'   > >?  >"P`>ʐ@ @(B \$`` " h >ʐ/  +6T,186<1|-2l24506<5@56<5hard error㿈 \a & p`耊   l   6 " h`   `耊   1& d/& d-& d ">`>͐ h bИ!; ?Y  >  > > > "`#\#`#d#h I"0 ($0$4Œ l & l? fdioctl: impossible㿘>`6   bA@ "@@"  `p@Jb@G 0z ">@Se e@ 0p !@"4V  `m@`q@ 0a )"=@, e g@W  ZB!Q N L   @' " A> @(a : 7 @3 2. n) @4% İ &&& & &&&& & $&$(&(,&,0&0 & $ fdformat: blkno %x count %ld fdform㿘>`4`  `Đ |   2c 7  &, 2 @I | $D$,$0 \A\>``\:`>bP* $H$T$<>ΐ"S QH /d * % 3>#>0"aX*` * b  #H 0 # A0(24&_ floppy diskfictitious%s: %s 㿘>6 ` !@ݐ@ڒ""$ (>`$ 8Ĕ  $ 0$ , @]$ 4 4 >ϔ `@V !,4 HĘ  $  4$ < 84 J$ X[$ $   aW4 $ $, 4 >ǔa @&a >ϐ Ē㿘>    $ ۜ \  ۗ 0   h  ? *@\   *@Insert filesystem floppy and press return.㿘 1>>ʏ"@c  ʆ! `p2```   *` ( >(L /> =%/> P%P/>, 4$ 4   93   @2 $ _$ 6@iled_c_filestore.9_bootstore.10_prom0_fake_saveecho_pv_putchar_sun4_idprom.65_dtab_stringbuf.75_promdev_inuse_prom_mapin_prom_mapinfo_prom_mapinfo_cnt_prom_devmap_promvecstore.88version.ogcc2_compiled.___gnu_compiled_cufs.ostrncpy.obootparam.ocd9660.ogets.onfs.orpc.ostrerror.orarp.onet.oin_cksum.oether.oglobals.omemcmp.oexit.ocloseall.ocread.oalloc.omemcpy.omemset.oclose.olseek.oopen.oread.oprintf.oarp.osdiv.oashrdi3.ostrcmp.o__main.ostrlen.oudiv.oumul.ourem.obzero.orem.oinflate.oadler32.oinfblock.oinfcodes.oinffast.oinfutil.oinftrees.ocrc32.o ...unit mknod ss$unit c 121 $unit chown root.operator ss$unit chmod 440 ss$unit # backwards compatibility with older PINTs rm -f scan$unit ln -s ss$unit scan$unit ;; altq) mkdir -p altq chmod 755 altq unit=0 for dev in altq cbq wfq afm fifoq red rio localq hfsc \ cdnr blue priq; do rm -f altq/$dev mknod altq/$dev c 125 $unit chmod 644 altq/$dev unit=$(($unit + 1)) done ;; local) umask 0 test -s MAKEDEV.local && sh MAKEDEV.local ;; *) echo $i: unknown device ;; esac done #!/bin/sh - # # $OpenBSD: MAKEDEV.local,v 1.3 1999/11/25 20:10:57 ian Exp $ # # Copyright (c) 1991 The Regents of the University of California. # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by the University of # California, Berkeley and its contributors. # 4. Neither the name of the University nor the names of its contributors # may be used to endorse or promote products derived from this software # without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE REGENTS AND CONTRIBUTORS ``AS IS'' AND # ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE # IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE # ARE DISCLAIMED. IN NO EVENT SHALL THE REGENTS OR CONTRIBUTORS BE LIABLE # FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL # DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS # OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) # HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT # LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY # OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF # SUCH DAMAGE. # # @(#)MAKEDEV.local 5.1 (Berkeley) 3/22/91 # # Local device MAKEDEV script. PATH=/sbin:/usr/sbin:/bin:/usr/bin umask 77 for i do case $i in *) echo 'MAKEDEV.local: no such device.' ;; esac done  . .. 0 1 2! 3" 4# 5$ 6% 7& 8' 9( 10) 11* 12+ 13, 14- 15. 16/ 170 181 192 203 214 225 236 247 258 269 27: 28; 29< 30= 31> 32? 33@ 34A 35B 36C 37D 38E39F 40G 41H 42I 43J 44K 45L 46M 47N 48O 49P 50Q 51R 52S 53T 54U 55V 56W 57X 58Y 59Z 60[ 61\ 62]63#!/bin/sh - # $OpenBSD: MAKEDEV,v 1.70 2001/09/06 19:45:34 todd Exp $ # # Copyright (c) 1990 The Regents of the University of California. # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by the University of # California, Berkeley and its contributors. # 4. Neither the name of the University nor the names of its contributors # may be used to endorse or promote products derived from this software # without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE REGENTS AND CONTRIBUTORS ``AS IS'' AND # ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE # IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE # ARE DISCLAIMED. IN NO EVENT SHALL THE REGENTS OR CONTRIBUTORS BE LIABLE # FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL # DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS # OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) # HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT # LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY # OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF # SUCH DAMAGE. # # @(#)MAKEDEV 5.5 (Berkeley) 5/28/91 # # Device "make" file. Valid arguments: # all makes all known devices, including local devices. # Tries to make the ``standard'' number of each type. # std standard devices # local configuration specific devices # # Tapes: # st* SCSI tapes # # Disks: # sd* SCSI disks # cd* SCSI cdrom drives # xy* Xylogic 450/451 disks # rd* "ramdisk" pseudo-disks # xd* Xylogic 753/7053 disks # fd* Floppy disk drives (3 1/2", 5 1/4") # vnd* "file" pseudo-disks # ccd* concatenated disk devices # raid* RAIDframe disk devices # # Pseudo terminals: # pty* set of 16 master and slave pseudo terminals # # Printers: # # Terminal ports: # tty[a-d] onboard zs serial ports # cua[a-d] onboard zs serial ports # # Special purpose devices: # ch* SCSI media changer # uk* SCSI Unknown device # ses* SCSI SES/SAF-TE device # ss* SCSI scanners # audio* # openprom # bwtwo* # cgtwo* # cgthree* # cgfour* # cgsix* # cgeight* # cgfourteen* # tcx* # bpf* Berkeley Packet Filter # lkm loadable kernel modules interface # tun* network tunnel driver # *random inkernal random data source # magma* magma card (makes 16 tty and 2 bpp) # spif* spif card (makes 8 tty and 1 bpp) # bpp* bpp # xfs* XFS filesystem devices # altq ALTQ control interface PATH=/sbin:/bin:/usr/bin:/usr/sbin this=$0 umask 77 if ! [ "$os" ]; then os=OpenBSD fi # SunOS shell support functions if [ "$os" = "SunOS" ] then PATH=$PATH:/usr/etc # SunOS has chown in /usr/etc add () { expr $1 + $2 } mult () { expr $1 '*' $2 } hex () { case $1 in [0-9]) echo -n $1;; 10) echo -n a;; 11) echo -n b;; 12) echo -n c;; 13) echo -n d;; 14) echo -n e;; 15) echo -n f;; esac } trunc () { expr $1 : $2'\(.*\)' } unt() { expr $1 : '[a-z]*\([0-9]*\)[a-p]*' } fi # OpenBSD shell support functions if [ "$os" = "OpenBSD" ] then add () { tmp=0 while [ "$1" ] do tmp=$(( $1 + $tmp )) shift done echo $tmp } mult () { echo "$(( $1 * $2 ))" } hex () { case $1 in [0-9]) echo -n $1;; 10) echo -n a;; 11) echo -n b;; 12) echo -n c;; 13) echo -n d;; 14) echo -n e;; 15) echo -n f;; esac } trunc () { # XXX pdksh can't seem to deal with locally scoped variables # in ${foo#$bar} expansions arg1="$1" arg2="$2" echo ${arg1#$arg2} } unt() { # XXX pdksh can't seem to deal with locally scoped variables # in ${foo#$bar} expansions arg1="$1" tmp="${arg1#[a-z]*}" while [ "$tmp" != "$arg1" ] do arg1=$tmp tmp="${arg1#[a-z]*}" done tmp="${arg1%*[a-z]}" while [ "$tmp" != "$arg1" ] do arg1=$tmp tmp="${arg1%*[a-z]}" done echo $arg1 } fi for i do unit=`unt $i` [ "$unit" ] || unit=0 case $i in all) sh $this std fd sd0 sd1 sd2 sd3 sd4 xd0 xd1 xd2 xd3 xy0 xy1 xy2 xy3 sh $this cd0 st0 st1 rd0 sh $this fd0 fd0B fd0C fd0D fd0E fd0F fd0G fd0H sh $this uk0 uk1 sh $this ss0 ss1 sh $this ses0 sh $this pty0 vnd0 vnd1 vnd2 vnd3 audio0 pf tun0 tun1 tun2 tun3 sh $this ccd0 ccd1 ccd2 ccd3 sh $this raid0 raid1 raid2 raid3 sh $this bpf0 bpf1 bpf2 bpf3 bpf4 bpf5 bpf6 bpf7 bpf8 bpf9 sh $this bwtwo0 cgtwo0 cgthree0 cgfour0 cgsix0 sh $this cgeight0 cgfourteen0 tcx0 sh $this lkm random local sh $this xfs0 altq ;; floppy) sh $this std random sh $this fd0 sd0 sd1 ;; ramdisk) sh $this std random sh $this fd0 sd0 sd1 sd2 sd3 rd0 cd0 st0 st1 sh $this bpf0 ;; std) rm -f console drum mem kmem null zero tty klog stdin stdout stderr ksyms rm -f eeprom openprom tty[abcd] cua[abcd] fb mouse kbd mknod console c 0 0 mknod drum c 7 0 ; chmod 640 drum ; chown root.kmem drum mknod mem c 3 0 ; chmod 640 mem ; chown root.kmem mem mknod kmem c 3 1 ; chmod 640 kmem ; chown root.kmem kmem mknod null c 3 2 ; chmod 666 null mknod zero c 3 12 ; chmod 666 zero mknod tty c 2 0 ; chmod 666 tty mknod klog c 16 0 ; chmod 600 klog mknod stdin c 24 0 ; chmod 666 stdin mknod stdout c 24 1 ; chmod 666 stdout mknod stderr c 24 2 ; chmod 666 stderr mknod ksyms c 122 0 ; chmod 640 ksyms ; chown root.kmem ksyms mknod eeprom c 3 11 ; chmod 640 eeprom ; chown root.kmem eeprom mknod openprom c 70 0 ; chmod 644 openprom sh $this ttya ttyb ttyc ttyd sh $this cuaa cuab cuac cuad mknod fb c 22 0 ; chmod 666 fb mknod mouse c 13 0 ; chmod 666 mouse mknod kbd c 29 0 ; chmod 666 kbd ;; fd) rm -f fd/* mkdir fd > /dev/null 2>&1 n=0 (cd fd && while [ $n -lt 64 ]; do mknod $n c 24 $n; n=`add $n 1`; done ) chown -R root.wheel fd chmod 555 fd chmod 666 fd/* ;; bwtwo*) rm -f bwtwo$unit mknod bwtwo$unit c 27 $unit; chmod 666 bwtwo$unit ;; cgtwo*) rm -f cgtwo$unit mknod cgtwo$unit c 31 $unit; chmod 666 cgtwo$unit ;; cgthree*) rm -f cgthree$unit mknod cgthree$unit c 55 $unit; chmod 666 cgthree$unit ;; cgfour[0-9]*) rm -f cgfour$unit mknod cgfour$unit c 39 $unit; chmod 666 cgfour$unit ;; cgsix*) rm -f cgsix$unit mknod cgsix$unit c 67 $unit; chmod 666 cgsix$unit ;; cgeight*) rm -f cgeight$unit mknod cgeight$unit c 64 $unit; chmod 666 cgeight$unit ;; cgfourteen*) rm -f cgfourteen$unit mknod cgfourteen$unit c 99 $unit; chmod 666 cgfourteen$unit ;; tcx*) rm -f tcx$unit mknod tcx$unit c 109 $unit; chmod 666 tcx$unit ;; audio*) major=69 audio=audio$unit sound=sound$unit mixer=mixer$unit audioctl=audioctl$unit rm -f $sound $audio $mixer $audioctl mknod $sound c $major $unit mknod $audio c $major `add $unit 128` mknod $mixer c $major `add $unit 16` mknod $audioctl c $major `add $unit 192` chown root.wheel $audio $sound $mixer $audioioctl chmod 666 $audio $sound $mixer $audioctl [ -e audio ] || ln -s $audio audio [ -e mixer ] || ln -s $mixer mixer [ -e sound ] || ln -s $sound sound [ -e audioctl ] || ln -s $audioctl audioctl ;; xfs*) rm -f xfs$unit mknod xfs$unit c 51 $unit chmod 600 xfs$unit chown root.wheel xfs$unit ;; openprom) rm -f openprom mknod openprom c 70 0 ;chmod 600 openprom ;; bpf*) rm -f bpf$unit mknod bpf$unit c 105 $unit chmod 600 bpf$unit chown root.wheel bpf$unit ;; pf) rm -f pf mknod pf c 59 0 chown root.wheel pf chmod 600 pf ;; tun*) rm -f tun$unit mknod tun$unit c 111 $unit chmod 600 tun$unit chown root.wheel tun$unit ;; fd*) umask 2 ; typnam=`expr $i : 'fd.*\(.\)$'` unit=`expr $i : 'fd\(.\).*'` case $typnam in 0|1) typnam=; typnum=0;; # no type specified, assume A A) typnam=; typnum=0;; B) typnum=1;; C) typnum=2;; D) typnum=3;; E) typnum=4;; F) typnum=5;; G) typnum=6;; H) typnum=7;; *) echo bad type $typnam for $i; exit 1;; esac case $unit in 0|1) blk=16; chr=54;; *) echo bad unit $unit for $i; exit 1;; esac nam=fd${unit}${typnam} rm -f ${nam}? r${nam}? basenum=`expr $unit '*' 128 + $typnum '*' 16` mknod ${nam}a b $blk `expr $basenum + 0` mknod ${nam}b b $blk `expr $basenum + 1` mknod ${nam}c b $blk `expr $basenum + 2` #mknod ${nam}d b $blk `expr $basenum + 3` #mknod ${nam}e b $blk `expr $basenum + 4` #mknod ${nam}f b $blk `expr $basenum + 5` #mknod ${nam}g b $blk `expr $basenum + 6` #mknod ${nam}h b $blk `expr $basenum + 7` #mknod ${nam}i b $blk `expr $basenum + 8` #mknod ${nam}j b $blk `expr $basenum + 9` #mknod ${nam}k b $blk `expr $basenum + 10` #mknod ${nam}l b $blk `expr $basenum + 11` #mknod ${nam}m b $blk `expr $basenum + 12` #mknod ${nam}n b $blk `expr $basenum + 13` #mknod ${nam}o b $blk `expr $basenum + 14` #mknod ${nam}p b $blk `expr $basenum + 15` mknod r${nam}a c $chr `expr $basenum + 0` mknod r${nam}b c $chr `expr $basenum + 1` mknod r${nam}c c $chr `expr $basenum + 2` #mknod r${nam}d c $chr `expr $basenum + 3` #mknod r${nam}e c $chr `expr $basenum + 4` #mknod r${nam}f c $chr `expr $basenum + 5` #mknod r${nam}g c $chr `expr $basenum + 6` #mknod r${nam}h c $chr `expr $basenum + 7` #mknod r${nam}i c $chr `expr $basenum + 8` #mknod r${nam}j c $chr `expr $basenum + 9` #mknod r${nam}k c $chr `expr $basenum + 10` #mknod r${nam}l c $chr `expr $basenum + 11` #mknod r${nam}m c $chr `expr $basenum + 12` #mknod r${nam}n c $chr `expr $basenum + 13` #mknod r${nam}o c $chr `expr $basenum + 14` #mknod r${nam}p c $chr `expr $basenum + 15` chown root.operator ${nam}[a-p] r${nam}[a-p] chmod 640 ${nam}[a-p] r${nam}[a-p] umask 77 ;; ccd*|sd*|xd*|xy*|cd*|raid*) umask 2 unit=`unt $i` if [ 0$unit -gt 15 ] then echo bad disk unit: $i - $unit exit 127 fi case $i in ccd*) name=ccd; blk=9; chr=23;; raid*) name=raid; blk=25; chr=123;; sd*) name=sd; blk=7; chr=17;; xd*) name=xd; blk=10; chr=42;; xy*) name=xy; blk=3; chr=9;; cd*) name=cd; blk=18; chr=58;; *) echo bad unit for disk in: $i;; esac if [ "$unit" = "" ] then n=0 while [ $n -lt 32 ] do sh $this $name$n n=`add $n 1` done fi rm -f $name$unit? r$name$unit? minor=`mult $unit 16` for slice in a b c d e f g h i j k l m n o p do dev=$name$unit$slice mknod $dev b $blk $minor mknod r$dev c $chr $minor minor=`add $minor 1` done chown root.operator $name$unit? r$name$unit? chmod 640 $name$unit? r$name$unit? umask 77 ;; vnd*) umask 2 unit=`unt $i` if [ 0$unit -gt 15 ] then echo bad disk unit: $i - $unit exit 127 fi blk=8; chr=110; for name in vnd svnd; do case $name in vnd) off=0;; svnd) off=128;; esac if [ "$unit" = "" ] then n=0 while [ $n -lt 32 ] do sh $this $name$n n=`add $n 1` done fi rm -f $name$unit? r$name$unit? minor=`mult $unit 16` minor=`add $minor $off` for slice in a b c d e f g h i j k l m n o p do dev=$name$unit$slice mknod $dev b $blk $minor mknod r$dev c $chr $minor minor=`add $minor 1` done chown root.operator $name$unit? r$name$unit? chmod 640 $name$unit? r$name$unit? done umask 77 ;; rd*) umask 2 ; unit=`expr $i : '.*d\(.*\)'` rm -f rd${unit}* rrd${unit}* mknod rd${unit}a b 17 `expr $unit '*' 16 + 0` mknod rd${unit}c b 17 `expr $unit '*' 16 + 2` mknod rrd${unit}a c 106 `expr $unit '*' 16 + 0` mknod rrd${unit}c c 106 `expr $unit '*' 16 + 2` chown root.operator rd${unit}[ac] rrd${unit}[ac] chmod 640 rd${unit}[ac] rrd${unit}[ac] umask 77 ;; st*) umask 2 case $i in st*) name=st; blk=11; chr=18;; esac rm -f $name$unit n$name$unit e$name$unit en$name$unit \ r$name$unit nr$name$unit er$name$unit enr$name$unit sixt=`mult $unit 16` mknod $name$unit b $blk `add $sixt 0` mknod n$name$unit b $blk `add $sixt 1` mknod e$name$unit b $blk `add $sixt 2` mknod en$name$unit b $blk `add $sixt 3` mknod r$name$unit c $chr `add $sixt 0` mknod nr$name$unit c $chr `add $sixt 1` mknod er$name$unit c $chr `add $sixt 2` mknod enr$name$unit c $chr `add $sixt 3` chown root.operator $name$unit n$name$unit \ e$name$unit en$name$unit \ r$name$unit nr$name$unit \ er$name$unit enr$name$unit chmod 660 $name$unit n$name$unit \ e$name$unit en$name$unit \ r$name$unit nr$name$unit \ er$name$unit enr$name$unit umask 77 ;; ch*) umask 2 case $i in ch*) name=ch; chr=19;; esac rm -f $name$unit mknod $name$unit c $chr $unit chown root.operator $name$unit chmod 660 $name$unit umask 77 ;; lkm) rm -f lkm mknod lkm c 112 0 chown root.kmem lkm chmod 640 lkm ;; tty[a-z]) unit=`expr $i : 'tty\([a-z]\)'` rm -f tty$unit case $unit in a) n=0 ;; b) n=1 ;; c) n=4 ;; d) n=5 ;; *) echo unknown tty device $i ;; esac mknod tty$unit c 12 $n chown uucp.dialer tty$unit chmod 660 tty$unit ;; cua[a-z]) unit=`expr $i : 'cua\([a-z]\)'` rm -f cua$unit case $unit in a) n=0 ;; b) n=1 ;; c) n=4 ;; d) n=5 ;; *) echo unknown cua device $i ;; esac mknod cua$unit c 12 `add $n 128` chown uucp.dialer cua$unit chmod 660 cua$unit ;; pty*) case $unit in 0) offset=0 name=p;; 1) offset=16 name=q;; 2) offset=32 name=r;; 3) offset=48 name=s;; 4) offset=64 name=t;; 5) offset=80 name=u;; 6) offset=96 name=v;; 7) offset=112 name=w;; 8) offset=128 name=x;; 9) offset=144 name=y;; 10) offset=160 name=z;; 11) offset=176 name=P;; 12) offset=192 name=Q;; 13) offset=208 name=R;; 14) offset=224 name=S;; 15) offset=240 name=T;; *) echo bad unit for pty in: $i;; esac case $unit in 0|1|2|3|4|5|6|7|8|9|10|11|12|13|14|15) umask 0 n=0 while [ $n -lt 16 ] do nam=$name`hex $n` rm -f {tty,pty}$nam mknod tty$nam c 20 `add $offset $n` mknod pty$nam c 21 `add $offset $n` n=`add $n 1` done umask 77 ;; esac ;; spif*) case $unit in 0) nam=j;; 1) nam=k;; 2) nam=l;; *) echo "bad unit for $i: $unit"; exit 127;; esac rm -f bpps${unit}? tty${nam}? offset=`expr $unit \* 64` n=0 while [ $n -lt 8 ] do name=$nam`hex $n` mknod tty$name c 102 `add $offset $n` chown uucp.dialer tty$name chmod 660 tty$name n=`add $n 1` done mknod bpps${unit}0 c 103 `add $offset 0` ;; magma*) case $unit in 0) nam=m;; 1) nam=n;; 2) nam=o;; *) echo "bad unit for $i: $unit"; exit 127;; esac rm -f bppm${unit}? tty${nam}? offset=`expr $unit \* 64` n=0 while [ $n -lt 16 ] do name=$nam`hex $n` mknod tty$name c 100 `add $offset $n` chown uucp.dialer tty$name chmod 660 tty$name n=`add $n 1` done mknod bppm${unit}0 c 101 `add $offset 0` mknod bppm${unit}1 c 101 `add $offset 1` ;; bpp*) unit=`expr $i : 'bpp\(.*\)'` rm -f bpp${unit} mknod bpp${unit} c 104 `add $unit 0` ;; fga*) unit=`expr $i : 'fga\(.*\)'` if [ "$unit" != 0 ]; then echo "bad unit $unit for $i" exit 127 fi rm -f fga$unit mknod fga$unit c 98 $unit chmod 600 fga$unit chown root.wheel fga$unit ;; scf*) unit=`expr $i : 'scf\(.*\)'` if [ "$unit" != 0 ]; then echo "bad unit $unit for $i" exit 127 fi rm -f scf$unit mknod scf$unit c 107 $unit chmod 600 scf$unit chown root.wheel scf$unit ;; flash*) unit=`expr $i : 'flash\(.*\)'` if [ "$unit" != 0 ]; then echo "bad unit $unit for $i" exit 127 fi rm -f flash$unit mknod flash$unit c 108 $unit chmod 600 flash$unit chown root.wheel flash$unit ;; random|srandom|urandom|prandom|arandom) rm -f random urandom srandom prandom arandom mknod random c 119 0 mknod srandom c 119 1 mknod urandom c 119 2 mknod prandom c 119 3 mknod arandom c 119 4 chown root.wheel random srandom urandom prandom arandom chmod 644 random srandom urandom prandom arandom ;; uk*) unit=`trunc $i uk` rm -f uk$unit mknod uk$unit c 120 $unit chown root.operator uk$unit chmod 640 uk$unit ;; ses*) unit=`trunc $i ses` rm -f ses$unit mknod ses$unit c 124 $unit chown root.operator ses$unit chmod 640 ses$unit ;; ss*) unit=`trunc $i ss` rm -f ss$ . ..MAKEDEV MAKEDEV.localZconsoledrum memkmemnull zero tty klog stdin stdoutstderrksymseepromopenprom,Uttyattybttycttydcuaacuabcuaccuad fbmouse kbd fd^sd0a_rsd0a`sd0barsd0bbsd0ccrsd0cdsd0dersd0dfsd0egrsd0ehsd0firsd0fjsd0gkrsd0glsd0hmrsd0hnsd0iorsd0ipsd0jqrsd0jrsd0ksrsd0ktsd0lursd0lvsd0mwrsd0mxsd0nyrsd0nzsd0o{rsd0o|sd0p}rsd0p~sd1arsd1asd1brsd1bsd1crsd1csd1drsd1dsd1ersd1esd1frsd1fsd1grsd1gsd1hrsd1hsd1irsd1isd1jrsd1jsd1krsd1ksd1lrsd1lsd1mrsd1msd1nrsd1nsd1orsd1osd1prsd1psd2arsd2asd2brsd2bsd2crsd2csd2drsd2dsd2ersd2esd2frsd2fsd2grsd2gsd2hrsd2hsd2irsd2isd2jrsd2jsd2krsd2ksd2lrsd2lsd2mrsd2msd2nrsd2nsd2orsd2osd2prsd2psd3arsd3asd3brsd3bsd3crsd3csd3drsd3dsd3ersd3esd3frsd3fsd3grsd3gsd3hrsd3hsd3irsd3isd3jrsd3jsd3krsd3ksd3lrsd3lsd3mrsd3msd3nrsd3nsd3orsd3osd3prsd3psd4arsd4asd4brsd4bsd4crsd4csd4drsd4dsd4ersd4esd4frsd4fsd4grsd4gsd4hrsd4hsd4irsd4isd4jrsd4jsd4krsd4ksd4lrsd4lsd4mrsd4msd4nrsd4nsd4orsd4osd4prsd4pxd0arxd0a xd0b!rxd0b"xd0c#rxd0c$xd0d%rxd0d&xd0e'rxd0e(xd0f)rxd0f*xd0g+rxd0g,xd0h-rxd0h.xd0i/rxd0i0xd0j1rxd0j2xd0k3rxd0k4xd0l5rxd0l6xd0m7rxd0m8xd0n9rxd0n:xd0o;rxd0o<xd0p=rxd0p>xd1a?rxd1a@xd1bArxd1bBxd1cCrxd1cDxd1dErxd1dFxd1eGrxd1eHxd1fIrxd1fJxd1gKrxd1gLxd1hMrxd1hNxd1iOrxd1iPxd1jQrxd1jRxd1kSrxd1kTxd1lUrxd1lVxd1mWrxd1mXxd1nYrxd1nZxd1o[rxd1o\xd1p]rxd1p^xd2a_rxd2a`xd2barxd2bbxd2ccrxd2cdxd2derxd2dfxd2egrxd2ehxd2firxd2fjxd2gkrxd2glxd2hmrxd2hnxd2iorxd2ipxd2jqrxd2jrxd2ksrxd2ktxd2lurxd2lvxd2mwrxd2mxxd2nyrxd2nzxd2o{rxd2o|xd2p}rxd2p~xd3arxd3axd3brxd3bxd3crxd3cxd3drxd3dxd3erxd3exd3frxd3fxd3grxd3gxd3hrxd3hxd3irxd3ixd3jrxd3jxd3krxd3kxd3lrxd3lxd3mrxd3mxd3nrxd3nxd3orxd3oxd3prxd3pxy0arxy0axy0brxy0bxy0crxy0cxy0drxy0dxy0erxy0exy0frxy0fxy0grxy0gxy0hrxy0hxy0irxy0ixy0jrxy0jxy0krxy0kxy0lrxy0lxy0mrxy0mxy0nrxy0nxy0orxy0oxy0prxy0pxy1arxy1axy1brxy1bxy1crxy1cxy1drxy1dxy1erxy1exy1frxy1fxy1grxy1gxy1hrxy1hxy1irxy1ixy1jrxy1jxy1krxy1kxy1lrxy1lxy1mrxy1mxy1nrxy1nxy1orxy1oxy1prxy1pxy2arxy2axy2brxy2bxy2crxy2cxy2drxy2dxy2erxy2exy2frxy2fxy2grxy2gxy2hrxy2hxy2irxy2ixy2jrxy2jxy2krxy2kxy2lrxy2lxy2mrxy2mxy2nrxy2nxy2orxy2oxy2prxy2pxy3arxy3axy3brxy3bxy3crxy3cxy3drxy3d xy3e rxy3e xy3f rxy3f xy3grxy3gxy3hrxy3hxy3irxy3ixy3jrxy3jxy3krxy3kxy3lrxy3lxy3mrxy3mxy3nrxy3nxy3orxy3oxy3p rxy3p!cd0a"rcd0a#cd0b$rcd0b%cd0c&rcd0c'cd0d(rcd0d)cd0e*rcd0e+cd0f,rcd0f-cd0g.rcd0g/cd0h0rcd0h1cd0i2rcd0i3cd0j4rcd0j5cd0k6rcd0k7cd0l8rcd0l9cd0m:rcd0m;cd0n<rcd0n=cd0o>rcd0o?cd0p@rcd0pA st0Bnst0Cest0Denst0Erst0Fnrst0Gerst0Henrst0I st1Jnst1Kest1Lenst1Mrst1Nnrst1Oerst1Penrst1Qrd0aRrd0cSrrd0aTrrd0cUfd0aVfd0bWfd0cXrfd0aYrfd0bZrfd0c[fd0Ba\fd0Bb]fd0Bc^rfd0Ba_rfd0Bb`rfd0Bcafd0Cabfd0Cbcfd0Ccdrfd0Caerfd0Cbfrfd0Ccgfd0Dahfd0Dbifd0Dcjrfd0Dakrfd0Dblrfd0Dcmfd0Eanfd0Ebofd0Ecprfd0Eaqrfd0Ebrrfd0Ecsfd0Fatfd0Fbufd0Fcvrfd0Fawrfd0Fbxrfd0Fcyfd0Gazfd0Gb{fd0Gc|rfd0Ga}rfd0Gb~rfd0Gcfd0Hafd0Hbfd0Hcrfd0Harfd0Hbrfd0Hc uk0 uk1 ss0 scan0 ss1 scan1ses0ttyp0ptyp0ttyp1ptyp1ttyp2ptyp2ttyp3ptyp3ttyp4ptyp4ttyp5ptyp5ttyp6ptyp6ttyp7ptyp7ttyp8ptyp8ttyp9ptyp9ttypaptypattypbptypbttypcptypcttypdptypdttypeptypettypfptypfvnd0arvnd0avnd0brvnd0bvnd0crvnd0cvnd0drvnd0dvnd0ervnd0evnd0frvnd0fvnd0grvnd0gvnd0hrvnd0hvnd0irvnd0ivnd0jrvnd0jvnd0krvnd0kvnd0lrvnd0lvnd0mrvnd0mvnd0nrvnd0nvnd0orvnd0ovnd0prvnd0psvnd0arsvnd0asvnd0brsvnd0bsvnd0crsvnd0csvnd0drsvnd0dsvnd0ersvnd0esvnd0frsvnd0fsvnd0grsvnd0gsvnd0hrsvnd0hsvnd0irsvnd0isvnd0jrsvnd0jsvnd0krsvnd0ksvnd0lrsvnd0lsvnd0mrsvnd0msvnd0nrsvnd0nsvnd0orsvnd0osvnd0prsvnd0pvnd1arvnd1avnd1brvnd1bvnd1crvnd1cvnd1drvnd1dvnd1ervnd1evnd1frvnd1fvnd1grvnd1gvnd1hrvnd1hvnd1irvnd1ivnd1jrvnd1j vnd1k rvnd1k vnd1l rvnd1l vnd1mrvnd1mvnd1nrvnd1nvnd1orvnd1ovnd1prvnd1psvnd1arsvnd1asvnd1brsvnd1bsvnd1crsvnd1csvnd1drsvnd1dsvnd1ersvnd1esvnd1f rsvnd1f!svnd1g"rsvnd1g#svnd1h$rsvnd1h%svnd1i&rsvnd1i'svnd1j(rsvnd1j)svnd1k*rsvnd1k+svnd1l,rsvnd1l-svnd1m.rsvnd1m/svnd1n0rsvnd1n1svnd1o2rsvnd1o3svnd1p4rsvnd1p5vnd2a6rvnd2a7vnd2b8rvnd2b9vnd2c:rvnd2c;vnd2d<rvnd2d=vnd2e>rvnd2e?vnd2f@rvnd2fAvnd2gBrvnd2gCvnd2hDrvnd2hEvnd2iFrvnd2iGvnd2jHrvnd2jIvnd2kJrvnd2kKvnd2lLrvnd2lMvnd2mNrvnd2mOvnd2nPrvnd2nQvnd2oRrvnd2oSvnd2pTrvnd2pUsvnd2aVrsvnd2aWsvnd2bXrsvnd2bYsvnd2cZrsvnd2c[svnd2d\rsvnd2d]svnd2e^rsvnd2e_svnd2f`rsvnd2fasvnd2gbrsvnd2gcsvnd2hdrsvnd2hesvnd2ifrsvnd2igsvnd2jhrsvnd2jisvnd2kjrsvnd2kksvnd2llrsvnd2lmsvnd2mnrsvnd2mosvnd2nprsvnd2nqsvnd2orrsvnd2ossvnd2ptrsvnd2puvnd3avrvnd3awvnd3bxrvnd3byvnd3czrvnd3c{vnd3d|rvnd3d}vnd3e~rvnd3evnd3frvnd3fvnd3grvnd3gvnd3hrvnd3hvnd3irvnd3ivnd3jrvnd3jvnd3krvnd3kvnd3lrvnd3lvnd3mrvnd3mvnd3nrvnd3nvnd3orvnd3ovnd3prvnd3psvnd3arsvnd3asvnd3brsvnd3bsvnd3crsvnd3csvnd3drsvnd3dsvnd3ersvnd3esvnd3frsvnd3fsvnd3grsvnd3gsvnd3hrsvnd3hsvnd3irsvnd3isvnd3jrsvnd3jsvnd3krsvnd3ksvnd3lrsvnd3lsvnd3mrsvnd3msvnd3nrsvnd3nsvnd3orsvnd3osvnd3prsvnd3psound0audio0mixer0 audioctl0U audio mixer sound audioctl1Ӱ pftun0tun1tun2tun3ccd0arccd0accd0brccd0bccd0crccd0cccd0drccd0dccd0erccd0eccd0f lkmrccd0fccd0grccd0gccd0hrccd0hccd0irccd0iccd0jrccd0jccd0krccd0kccd0lrccd0lccd0mrccd0mccd0nrccd0nccd0orccd0occd0prccd0pccd1arccd1accd1brccd1bccd1crccd1cccd1drccd1dccd1erccd1eccd1frccd1fccd1grccd1gccd1hrccd1hccd1irccd1iccd1jrccd1jccd1krccd1kccd1lrccd1lccd1mrccd1mccd1nrccd1nccd1orccd1occd1prccd1p ccd2a rccd2a ccd2b rccd2b ccd2crccd2cccd2drccd2dccd2erccd2eccd2frccd2fccd2grccd2gccd2hrccd2hccd2irccd2iccd2jrccd2jccd2krccd2kccd2l rccd2l!ccd2m"rccd2m#ccd2n$rccd2n%ccd2o&rccd2o'ccd2p(rccd2p)ccd3a*rccd3a+ccd3b,rccd3b-ccd3c.rccd3c/ccd3d0rccd3d1ccd3e2rccd3e3ccd3f4rccd3f5ccd3g6rccd3g7ccd3h8rccd3h9ccd3i:rccd3i;ccd3j<rccd3j=ccd3k>rccd3k?ccd3l@rccd3lAccd3mBrccd3mCccd3nDrccd3nEccd3oFrccd3oGccd3pHrccd3pIraid0aJrraid0aKraid0bLrraid0bMraid0cNrraid0cOraid0dPrraid0dQraid0eRrraid0eSraid0fTrraid0fUraid0gVrraid0gWraid0hXrraid0hYraid0iZrraid0i[raid0j\rraid0j]raid0k^rraid0k_raid0l`rraid0laraid0mbrraid0mcraid0ndrraid0neraid0ofrraid0ograid0phrraid0piraid1ajrraid1akraid1blrraid1bmraid1cnrraid1coraid1dprraid1dqraid1errraid1esraid1f @ ;Jx   @@;Jx i@@`@@<@`bT U;JH(AH;J8C;J% ;J%  (`$ A;Jy ;Jy ;Jy  /emA;J(;J U;J U "m;J ;J$s;J$s K\ !;J98p;J98p;J98p,Pa!;J:i;J:i;J'{8.!;Jр;Jр;J ׳!;J ;J ;J߀q!;J;J;J&2!;Jܓ;Jܓ;J  *q!;J>;J>;J6!;J9;J9;Jo)!;J4΀;J4΀;JR#!;J /;J /;J!`:q!;J#*;J#*;J$[܀˘G!;J&%;J&%;J) zqy!;J*Q;J*Q;J-L P^!;J/q;J/q;J0GFEq!;JbZ;JbZ;Jw qDBu!;J ;J ;JI JBu!;Jܓ;Jܓ;Jp ȸABu!;Je;Je;J U s$C6Bu!;J-L;J-L;J0G #Bu!;J7n;J7n;J:i qVBu!;J]J;J]J;Jр y?5Bu!;JI;JI;J 3 Bu!;Jܓ;Jܓ;JWaq!;Jׄ;Jׄ;J ~'!;Jt;Jt;JvyAm;J ;JI ;Ju*+@!;J$[܀;J$[܀;Jׄ*!;J'V;J'V;Jׄ m!;J)';J)';Jׄ!;J,;J,;JׄR{!;J.};J.};JׄmT!;J05;J05;Jp!;J3%;J3%;JpuRV!;J6=;J6=;Jp""|!;J8ـ;J8ـ;Jp>;:!;J;3;J;3;Jp d6!;JÀ;JÀ;Jׄ ٣7!;J,;J,;Jׄ )^!;J';J';Jׄ B!;J h;J h;Jׄ >!;J ;J ;Jׄռ$!;JN;JN;Jׄ]!;Jv;Jv;Jׄճ!;J;J;Jׄ{:!;J ;J ;Jׄ!;Jp;Jp;Jׄ:t!;Jt;Jt;Jׄ'L־!;J4΀;J4΀;JׄdMp!;J(;J(;Jׄ.!;J!;J!;JׄNi)!;J$s;J$s;JׄVʒ!;J'V;J'V;Jׄ!;J)';J)';JׄEo!;J,;J,;Jׄf !;J.};J.};JׄIO!;J05;J05;Jׄ3 !;J3%;J3%;Jׄۑu!;J6=;J6=;Jׄi~!;J8ـ;J8ـ;Jׄ ^2 !;J;3;J;3;Jׄ!Xuf!;J;J;Jׄ"8}!;J]J;J]J;Jׄ#5!;J;J;Jׄ$\!;J ;J ;Jׄ% z!;J ;J ;Jׄ&cIU!;JI;JI;Jׄ'_NV!;J;J;Jׄ([ń!;JC;JC;Jׄ)KH!;J>;J>;Jׄ*!;JG;JG;Jׄ+X!;J;J;Jp,M!;Je;Je;Jp-CŠm!;J U;J U;Jp.!;J#F;J#F;Jp/!;J&%;J&%;Jp0<!;J(;J(;Jp1a!;J*T;J*T;Jp2!;J-L;J-L;Jp3bY!;J/;J/;Jp4Ph!;J2;J2;Jp5nҹ!;J5 R;J5 R;Jp6=D!;J7n;J7n;Jp70H!;J9;J9;Jp8g!;J;J;Jp9x-!;J;J;Jp:!;J;J;Jp; hp!;JX;;JX;;Jp<KT!;J ;J ;Jp=Mbn!;J ;J ;Jp>\!;JI;JI;Jp?|a;Je;Je;J#F!;J /;J /;J#FT[a;J";J";J#FU9!;J#F;J#F;J#F0Fa;J&6;J&6;J#FT!;J'c;J'c;J#Fz)a;J*Q;J*Q;J#F~v$!;J+;J+;J#F a;J.};J.};J#F!;J/;J/;J#FÕZa;J2b;J2b;J#FR[3!;J3B;J3B;J#FE a;J6=;J6=;J#F!;J7n;J7n;J#FkRa;J9;J9;J#F!;J;3;J;3;J#F4~a;JbZ;JbZ;J#Fkj!;J;J;J#F4na;J;J;J#F Dd!;J';J';J#F *a;J h;J h;J#F 4tU!;J S+;J S+;J#F 2˟a;J ;J ;J#F 5B!;J沀;J沀;J#F b(a;JI ;JI ;J#F cr!;J;J;J#F la;Ju*;Ju*;J#F Me!;JW;JW;J#F k$٩a;J;J;J#FO!;Jt;Jt;J#F~pa;J4΀;J4΀;J#F&!;Je;Je;J#Fxia;J*Q;J*Q;J2bgsd!;J+;J+;J2b a;J/q;J/q;J2bI9!;J1xˀ;J1xˀ;J2bKa;J3%;J3%;J2b|1!;J5 R;J5 R;J2beMa;J8C;J8C;J2b!;J98p;J98p;J2a;J;J;J2b!;JÀ;JÀ;J2"HOa;J,;J,;J2bS!;J]J;J]J;J2a;JX;;JX;;J2b7!;J h;J h;J2^va;J ;J ;J2b}M!;J ;J ;J2 Ba;J߀;J߀;J2b!;JI ;JI ;J2a!a;Jf;Jf;J2bK!;Ju*;Ju*;J22a;Jׄ;Jׄ;J2bxO??!;J;J;J2'a;J;J;J2bv:w!;J4΀;J4΀;J2}\a;J(;J(;J2b1 !;J!`;J!`;J2 a;J#F;J#F;J2b49!;J$s;J$s;J2a;J'c;J'c;J2b0>!;J) ;J) ;J2N*a;J+;J+;J2bv!;J-L;J-L;J2NX4a;J8ـ;J8ـ;J L!;J:i;J:i;J, g^a;J1-;J1-;J!V/0!;JbZ;JbZ;J,!p}a;J]J;J]J;J"qO!;Jw;Jw;J,"ya;Jр;Jр;J,#m!;J ;J ;J,#Y\*a;J ;J ;J,$R\!;JN;JN;J,$}a;JI ;JI ;J,%C| !;Jz9;Jz9;J,%]-Ba;Jܓ;Jܓ;J,&o.!;JW;JW;J,&:ٮa;J;J;J,'h?!;J9;J9;J,'`xxa;J4΀;J4΀;J,(0y!;Je;Je;J,(W>Ja;J U;J U;J,)!;J";J";J,)Z a;J$s;J$s;J,*ҳ4A!;J&%;J&%;J,*&za;J(;J(;J,+M!;J*Q;J*Q;J,+G.ta;J,;J,;J,,ǽ!;J-D;J-D;J,,.xAa;J05;J05;J,-Nz!;J2b;J2b;J,-'a;J5 R;J5 R;J,. !;J6=;J6=;J,.Mؚta;J8ـ;J8ـ;J,/rW!;J:i;J:i;J,/ckHa;J !;J !;J0!;J ;J ;J0܉]a;JN;JN;J1!;J߀;J߀;J19Ht;a;Jz9;Jz9;J2`5G!;Jf;Jf;J2{@a;J ;J ;J30!;Jׄ;Jׄ;J3h`a;J9;J9;J4 !;Jk ;Jk ;J4|a;Je;Je;J5NF!;J(;J(;J5[5ea;J!;J!;J6O[!;J#*;J#*;J6@[8a;J% ;J% ;J7π!;J'V;J'V;J7I٠a;J)';J)';J8P=!;J*T;J*T;J8a;J-L;J-L;J9)0!;J/q;J/q;J9J a;J1xˀ;J1xˀ;J:5!;J2;J2;J:a;J7n;J7n;J;X!;J8ـ;J8ـ;J;za)a;J;J;J< !;J1-;J1-;J<ha;J;J;J=!;JĴ;JĴ;J=FI'a;J;J;J>w&!;Jр;Jр;J>-Ń'a;J S+;J S+;J?l!;J X;J X;J?a;Jp;Jp;Je@R$.!;JG;JG;Je@тa;J8;J8;JeA6e!;Je;Je;JeA|9Xa;J /;J /;JeBf!;J!;J!;JeBj8\a;J$[܀;J$[܀;JeCgd!;J% ;J% ;JeC/&a;J'c;J'c;JeDQ!;J)';J)';JeD'a;J,;J,;JeE=j!;J-L;J-L;JeEa;J/;J/;JeF-G!;J1xˀ;J1xˀ;JeF[ a;J3%;J3%;JeG^G!;J5 R;J5 R;JeG]*a;J7n;J7n;JeHp~!;J98p;J98p;JeHQb-a;J;J;JeIc0!;J1-;J1-;JeIw a;J;J;JeJ3!;J]J;J]J;JeJA}$a;J;J;JeKVb!;Jр;Jр;JeK fa;J S+;J S+;JeL@A!;J ;J ;JeL"ka;JI;JI;JeM"(|!;Jv;Jv;JeMT3a;J;J;JeN ,c!;Jܓ;Jܓ;JeN4ېa;J>;J>;JeO!;Jp;Jp;JeOKa;J$[܀;J$[܀;J*Q hu-!;J% ;J% ;J*Q*Ytrraid1furaid1gvrraid1gwraid1hxrraid1hyraid1izrraid1i{raid1j|rraid1j}raid1k~rraid1kraid1lrraid1lraid1mrraid1mraid1nrraid1nraid1orraid1oraid1prraid1praid2arraid2araid2brraid2braid2crraid2craid2drraid2draid2erraid2eraid2frraid2fraid2grraid2graid2hrraid2hraid2irraid2iraid2jrraid2jraid2krraid2kraid2lrraid2lraid2mrraid2mraid2nrraid2nraid2orraid2oraid2prraid2praid3arraid3araid3brraid3braid3crraid3craid3drraid3draid3erraid3eraid3frraid3fraid3grraid3graid3hrraid3hraid3irraid3iraid3jrraid3jraid3krraid3kraid3lrraid3lraid3mrraid3mraid3nrraid3nraid3orraid3oraid3prraid3pbpf0bpf1bpf2bpf3bpf4bpf5bpf6bpf7bpf8bpf9bwtwo0cgtwo0cgthree0,Ucgfour0cgsix0cgeight0,U cgfourteen0tcx0randomsrandomurandomprandomarandomxfs0$altqvN:\ :ty#winchester:ns#83:nt#15:nc#2619:\ :pb#498000:ob#0:\ :pc#3260655:oc#0:\ :ph#2761410:oh#498000: Seagate ST1239N SWIFT:\ :ty#winchester:ns#35:nt#9:nc#1264: Seagate ST12400N 2.4GB:\ :ty#winchester:ns#82:nt#19:nc#2668:\ :pa#32718:oa#0:ba#8192:\ :pb#65436:ob#32718:\ :pc#4156744:oc#0:\ :pg#4058590:og#98154: Seagate ST12550N:\ :ty#winchester:ns#80:nt#19:nc#2747: Seagate ST1480N:\ :ty#winchester:ns#64:nt#9:nc#1456: Seagate ST15150N:\ :ty#winchester:ns#78:nt#21:nc#5119:\ :pc#8384922:oc#0: Seagate ST410800N Elite 9:\ :ty#winchester:ns#108:nt#27:nc#6087:\ :pc#17749692:oc#0: Seagate ST42100N - Wren 9:\ :ty#winchester:ns#96:nt#15:nc#2574:\ :pc#3706560:oc#0: Seagate ST42400N Elite 2:\ :ty#winchester:ns#84:nt#19:nc#2604:\ :pc#4155984:oc#0: Seagate Sabre-5 ST81236J:\ :ty#XD7053:ns#82:nt#15:nc#1633:\ :pa#99630:oa#0:ba#8192:\ :pb#261990:ob#99630:\ :pc#2008590:oc#0:\ :pd#548580:od#361620:\ :pe#1098390:oe#910200:\ :pf#361620:of#0:\ :pg#1646970:og#361620:\ :ph#1908960:oh#99630: SeagateST3283N:\ :ty#winchester:ns#57:nt#5:nc#1689: Sun1.0G:\ :ty#winchester:ns#80:nt#15:nc#1703: SyQuest SQ555:\ :ty#winchester:ns#34:nt#2:nc#1273:\ :pc#86564:oc#0: Toshiba MK 156F:\ :ty#winchester:ns#34:nt#10:nc#815: Vertex V185:\ :ty#ACB4000:ns#17:nt#7:nc#1163:  , ,2 @$ $ +>``-?8 -0-?8 - ?$ $` --00 $ 0& @-a! Ѐ2 @ , ?$ $ @-a Ѐ 2 @`  ,` @$ $ $ +>``+?P `-`0+-?P%/> @̀vmmapbsyvm_map_lock: failed to get locksbusslave-only%s at %s %s slot %d offset 0x%x㿘`> Ɛ!3>`\ @ު !<: `\>ɹ!!@>!<ɴ!ȁ 㿘> `2 2 ` D 2   & D @`? unsupported clock-frequency: clock = %s MHz burst-sizesrangessbus: PROM ranges too large: %dnameP`   ">m"0i>_^@b@N!>&`0@Π"ؒ]>Вb@A ?&`@ 2 4 H &`< L&`8*& D  >@a 2'4 ''>Ф#@  @Ӓ &`<   &`8>А#ǰ@ΐ@ 1>%>В#(@@8  @ ' @ #(relative sbus addressing not supported㿘 < 21`0`4=#  ?*@2`&a@Q&a<> `"`0>e!>* `  &`4&`0 &a<=&a@ `<"@"`   0. `4&a<` (&a@`0+  *  <    `4  8@  @ ` @  #@  8@ `# `ޑ+ sbus_establish: can't find sbus parent for %s㿘`$#>Ѐ   a>ђ`">ђ" @  2 $& 4& $ 4reset %s:㿘> H. @>ѐ#x[  4 #> `"  @ Ma  2 %s: dma card found in non-dma sbus slot %d: not supported 㿘>Д a@ a<: 2` >(# mii_attach: phyloc and offloc specified㿀 ?>ƙ   ` @&`$ &` O'%>#>`$䀢 `48 " 028  3?@/@,?2( `4 '`4 ''''Ԗa( " `$ "0`$0"`4&`$`$"4"<`( &`(  'mii_activate: phyloc and offloc specifiedmii_activate: DVACT_ACTIVATE%s: config_activate(%d) failed 㿘" >"@ / $ +#>!>Ҁ 82 0` <2 0``  0bp֐ " 0"   ۀmii_detach: phyloc and offloc specified㿘" >Ґ# ) $ % 0" 0 8@2" 0 <2 0`" 4 4"`4 4 0"@  ߀OUI 0x%06x model 0x%04x rev %d at %s phy %d㿘`"  > : *` @  2  > ȁ 㿘`  "@ @`㿘 $ & 0 & , D  " 0 2 D 㿘 $   D  0 2 D㿘 $ & 0  & , D  0 2 D㿘 $   D  0 2 D!A  !@@mii_phy_setmedia㿘 L 2  8  4 $ "@% 0>>"b*` @  $  8  8 L 8  8 $miiaut㿘 P ` L? T"`8  $: 8  L 8 $  8`  L  4 8 $ 2/ W# !$ L'  P`>!X`& P>Ӕ: P  @?`2?` d& P>ԒaN>!X2`@ z:`?㿘 ( !H /e * &  P  ? L& P`4 $ 8 D  LH p@㿘 L 4`- 2* 4 8  $ L`4  $ 8 2  ` 2 \ & ` \ `   & \@ & \[ ?? ?㿘 P !!< L  8 $  8% `cV#``c   L 4 8 $ @   P $ L 8  8 $㿘 P  ?& P5 d㿘 H@㿘 L | 0@2  <  ,@2 <`  <@ $@ 0& | ,& 㿘 L  ,` `   y 0 ;" D, ;  D@`$ D `H /e * & qhH 0㿘 P   L @*``" @  T( @*``# 6  T)  @* `#  )  T' @*``&   T%  @* `&    T#  @*``(   X<@4@   @*`& ``+   X  @*  `+ & `   X   @*`& ``0 ݖ  X  @*  `0 & ` ϖ  T  @*``  Ŗ 㿘 @ L`  -㿘 P B d   (""4# # & 0&  0 ! A !nsphy :` ( c  : %s, rev. %d DP83840 10/100 media interface㿘 >>֒` 0  (>&`@>֒`Ԑ"&`8&`H&`D&`L @ &`P`L  4`8`$? b &`T㿘`( `t "`"6`0d]0_``@2  Z 0^`@2   `L 4 `8`$`L$`8 `8`$0K` 4`A `L 4`8`$`L%b`8 `$`8G01`@2 3 0` 4`+ `L 4`8`$`L`4 `$`82 `\  $`\@$`\S ? 0 , 26 㿘 L  $`,$`0 L `4 $ 8` L`4  $ 8 " L`, $`, L  4 8 $"`0$`,S `0 $`0H 2 L`0D   4 8 $ .  L 4 8 $ L`4  8 $ "!`0) `0    @`0 `0 @$`0 `0   L  4 8 $ @`0  $`0㿘r L  4 8 $ L`4  8 $?b  L: 8 8  $qsphy :` (Q c  : %s, rev. %d QS6612 10/100 media interface㿘 >>גa Ґ!x (>&`@>גbL#&`8&`H&`D&`L @&`P`L  4`8`$? b &`T㿘 ( `G "`"*`07002` @2  - 01 @2    L 4  8 $ L$`8  8 $0` 4`0 @2   ? 0   㿘 L  $`,$`0 L `4 $ 8` L`4  $ 8 " L`, $`, L  4 8 $"`0$`,? `0 $`04 2 L`00   4 8 $ L`4  8 $ ?`*`>ؐ!, €`0 `0 `0 `0 @ $`0`0 `0 $`0`aaa`aaaaaaaaaaa`aaa`㿘@ L  8  8 $scxspl㿈> fఀ   "> >#h#Xa#\#`#d    getxscannot allocate scsi xs 㿘H /d * %  `%>؀  `6     ` > #X  ?6 $ H 0 @ >}" H 0㿘` > w#X   ` 6 ?# @6 ǐ0  `@ could not get size p@{$ b  %h/#\#d#`  @]   . * *`  @>+# 㿀@z  ##\#d/#`   @5 x@z a" @ //#\#d#`   @ 㿀@zϒ  #  ://#\#d#`  :@ 㿀@z c /#\/#d#`   @ 㿀   @z  /`//!0 ##\#d#`   @Ϛ 㿘   @ ِ1 0@  09@ 2 0@ "    ' 0 0& ,  `" $ 4 0$ 4 <($ 0$ @ ($ @ `@  7&scsi_execute_xs: NOSLEEP and POLLscsi_scsi_cmdscsi_execute_xs: invalid return codescsi_execute_xs: impossible㿘 & , $ ?& & (. X ` "A   >0<+>09   (>#H /d* %  #>ْ c v  ` H 0 0 ?@^ ?" & ,w#ȁscsi_scsi_cmd: buffer without nosleep㿘`d2>`!`! `Y N!$` \$`$`$` $`$$`$`$`0$`T  , `  * @*`  s?;0 scbusyunknown error category from scsi driver 㿘 ,`<*`>ڐ# €; @\?27 , 2  & ,  ?   Pא"@  ! > >ڐ p  ٘  ??&  & , ?& ?  ? @ >X"x jjkkk\kjkk DEFERRED ERROR, key = 0x%x Sense Error Code %d at block no. %d (decimal) 㿘 ``4@?  p q}@ >ڐ# `  ` i>ې"*` €($@"V$(U``?# @4` @%    $,c? ` ` ` P?"@W?U 05!N ` K +  )2` A?``?# @4` Ӓ` π` 0 0    ?  ` @ 0@/ >ے `  `   > *`* @ @  > @ lllndndmmn4n@ndndnLn@nX%s(%s:%d:%d): probe㿘 >ۀ`#(`>ے#8   e ReservedMiscompare ErrorVolume OverflowEqual ErrorAborted CommandCopy AbortedVendor UniqueBlank CheckWrite ProtectedUnit AttentionIllegal RequestHardware ErrorMedia ErrorNot ReadySoft ErrorNo Additional Sense0X8`H0`0h@ (       `H0xX@ 0   `@(hHh@p8pP(pH0 !!"$%`&@&(&&'p(()X*@*(*+,,,p-H/ 00001p1X2023~6~7~9~:~;~p;~@;~;};};};};};}h; }P; }0; }; |; |;|=|>|X?|(?|?{?{@{A{B{PC{@D{(E{FzGzHzIzJzxKz`Lz8NzPzPyPyQyRySyxSy`Sy@TyUyWxXxYxZxhZx@Zx Zx[w[w[w[w\w\wp\wP`w@aw(awawbvcvdvIllegal Mode For This TrackEnd Of User Area Encountered On This TrackScan Head Positioning ErrorOut Of FocusUnable To Acquire VideoVideo Acquisition ErrorLamp FailureSpindles Not SynchronizedSpindles SynchronizedRPL Status ChangeLog List Codes ExhaustedLog Counter At MaximumThreshold Condition MetLog ExceptionOperator Selected Write PermitOperator Selected Write ProtectOperator Medium Removal RequestedOperator Request or State Change Input (Unspecified)Updated Block ReadGeneration Does Not ExistUnable To Recover Table-Of-ContentsSystem Resource FailureSCSI To Host System Interface FailureMedium Removal PreventedUnload Tape FailureMedia Load or Eject FailedCartridge FaultErase FailurePosition Error Related To TimingWrite Append Position ErrorWrite Append ErrorOverlapped Commands AttemptedLogical Unit Failed Self-ConfigurationData Phase ErrorCommand Phase ErrorInvalid Message ErrorINITIATOR DETECTED ERROR Message ReceivedSCSI Parity ErrorUnsuccessful Soft ResetSelect Or Reselect FailureInternal Target FailureMessage ErrorPower-On or Self-Test FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)RAM FAILURE (Should Use 40 NN)INQUIRY Data Has ChangedChanged Operating DefinitionMicrocode Has ChangedTarget Operating Conditions Have ChangedLogical Unit Has Not Self-Configured YetInvalid Bits In IDENTFY MessageMedium Source Element EmptyMedium Destination Element FullPosition Past Beginning Of MediumPosition Past End Of MediumRead Past Begining Of MediumRead Past End Of MediumReposition ErrorFailed To Sense Bottom-Of-FormFailed To Sense Top-Of-FormPaper JamSlew FailureTape or Electronic Vertical Forms Unit Not ReadyTape Position Error At End-of-MediumTape Position Error At Beginning-of-MediumPositioning ErrorMedium Not PresentSaving Parameters Not SupportedRounded ParameterRibbon, Ink, or Toner FailureTape Length ErrorDefect List Update FailureNo Defect Spare Location AvailableFormat Command FailedMedium Format CorruptedCleaning Cartridge InstalledCannot Read Medium - Incompatible FormatCannot Read Medium - Unknown FormatIncompatible Medium InstalledCommands Cleared By Another InitiatorOverwrite Error On Update In PlaceInvalid Combination of Windows SpecifiedToo Many Windows SpecifiedCommand Sequence ErrorCopy Cannot Execute Since Host Cannot DisconnectLog Parameters ChangedMode Parameters ChangedParameters ChangedPower On, Reset, or Bus Device Reset OccurredImport Or Export Element AccessedNot Ready To Ready Transition (Medium May Have Changed)Threshold Parameters Not SupportedParameter Value InvalidParameter Not SupportedInvalid Field In Parameter ListLogical Unit Not SupportedIllegal Field in CDBIllegal Function (Should 20 00, 24 00, or 26 00)Invalid Element AddressLogical Block Address Out of RangeInvalid Command Operation CodeRecovered ID with ECCMiscompare During Verify OperationGrown Defect List Not FoundPrimary Defect List Not FoundDefect List Not FoundSynchronous Data Transfer ErrorParameter List Length ErrorDefect List Error in Grown ListDefect List Error in Primary ListDefect List Not AvailableDefect List ErrorRecovered Data - Recommend RewriteRecovered Data - Recommend ReassignmentRecovered Data With LECRecovered Data With CIRCRecovered Data - Data Auto-ReallocatedRecovered Data With Error Correction & Retries AppliedRecovered Data With Error Correction AppliedRecovered Data Without ECC - Recommend RewriteRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Using Previous Sector IDRecovered Data With Retries and/or CIRC AppliedRecovered Data With Negative Head OffsetRecovered Data With Positive Head OffsetRecovered Data With RetriesRecovered Data With No Error Correction AppliedData Synchronization Mark ErrorPositioning Error Detected By Read of MediumMechanical Positioning ErrorRandom Positioning ErrorBlock Sequence ErrorEnd-Of-Data Not FoundFilemark or Setmark Not FoundRecord Not FoundRecorded Entity Not FoundAddress Mark Not Found for Data FieldAddress Mark Not Found for ID FieldUncorrected Read Error - Recommend Rewrite the DataUncorrected Read Error - Recommend ReassignmentMiscorrected ErrorNo Gap FoundIncomplete Block FoundData Resynchronization ErrorCIRC Unrecovered ErrorL-EC Uncorrectable ErrorUnrecovered Read Error - Auto Reallocate FailedMultiple Read ErrorsError Too Long To CorrectRead Retried ExhaustedUnrecovered Read ErrorID CRC Or ECC ErrorWrite Error - Auto Reallocate FailedWrite Error Recovered with Auto ReallocationWrite ErrorError Log OverflowSpindle Servo FailureFocus Servo FailureTracking Servo FailureTrack Following ErrorLogical Unit Communication Parity ErrorLogical Unit Communication TimeoutLogical Unit Communication FailureMultiple Peripheral Devices SelectedNo Reference Position FoundLogical Unit Does Not Respond To SelectionLogical Unit Not Ready, Format In ProgressLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Initialization Command RequiredLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Cause Not ReportableExcessive Write ErrorsNo Write CurrentPeripheral Device Write FaultNo Seek CompleteNo Index/Sector SignalNo Current Audio Status To ReturnAudio Play Operation Stopped Due to ErrorAudio Play Operation Successfully CompletedAudio Play Operation PausedAudio Play Operation In ProgressI/O Process TerminatedEnd-Of-Data DetectedBeginning-Of-Partition/Medium DetectedSetmark DetectedEnd-Of-Partition/Medium DetectedFilemark DetectedNo Additional Sense InformationDiagnostic Failure on Component 0x%02xASC 0x%02x ASCQ 0x%02xCheck Condition on opcode 0x%x SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO FIELD: %u COMMAND INFO: %d (0x%x) ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s Additional Sense Information (byte %d out...): %2d: %2d: 0x%02x㿘  >  4#!># @ʐL`` >#L`` >#  , ` @>ܐ# , ` ">> Ӓ>А @` ` * *`  *  > (L` m` ` * *`  *  > @ @  > `L``> x `@p  > `B    L@     L@ "  -> z > t   o ? '>ۀ `)>%>2 @  _ @\?`   `R@%s, Error in %s, Offset %d, bit %dCDBParametersError in %s, Offset %dActual Retry Count: %dProgress Indicator: %d㿘` ```  ` `> *`1> f  @x06`> f   >ܒ(` `  @ 2 @ 2`  @  >>cP  >cx  @xp  2`> *` !> f >c   >ܒ(` `  @ 2 @ 2`   @Ζ >>@x> T R  N  J`F>#*` € > f>#` @ > >   *  ) > ` @ > >   *  1> f * > `0 1> f * >`H\\\㿘  p!@n"!H /d * % > cc &" "c& H 0 㿘H /d * % ` "` "H rS H4> (>  @2HUser command with no buf User command with no ioctl host adapter code inconsistency unknown error category from host adapter code 㿘 0`U >Ő!@0= 2!J >!`02 , [ X, Z ,`!*`>" € ( $" $ $, [ , Y X 4A ( , [( > !  , [  , [ >! , [*Kd|user_strat: No ioctl physio split the request.. cannot proceed cmdlen too big scistr㿈V  >^#Z ` <  a >Q#0M 2 G  ( `ѐ >A#`= 2(  H #d `#\#`F "H /d * %  0" #> cp z  0b H 00 0& 4(& 0)scsi_do_ioctl: impossible㿈  !"Z a avau ! "g  ![v0!pwA `& `   &&>&&&&>` `&& #x` *s &L&4&8&P&D5<@ `f0<?# @6  6   6   @6 "'   6 @+@& 'В"#\#d#`    ~  @㿘! @0!@ "@ !@ 3 09!@" `,` !@.  ! ! @0!@! ` "`"`"` 2 " `"`"` "   `    scsibusscsibus at %s㿘`>!  : %d targets scsibusattach: can't allocate target linksscsibusattach: can't allocate lun links㿘> `2`>"!H`.&`0 2`0 6`06`: $`2`: *$`:>!@`: * n  &`4>8!P`: !>  n `4."@ `4 $!@kq `: B `?@g?㿘㿘r㿘 : 6 4 4, @ " :o  : & 4 4o 㿘` @2 `  "@@"@ `㿘?>a(   a(.  @  a( @㿘  >(  6@ (. @ 2 08    ?`&- @6)   $ ?  @4  @` @ 8: 2@@ ` @ """   """% \ @_* @ 00* @ 800* @ 0*\2** * ߒ`*1.14UJDCD87301.25CD-ROM CDR-N161.70CD-ROM CDR-S11.08SANYO CRD-S54PSANYO CRD-254PSANYO CRD-256P4.21NEC CD-ROM DRIVE:2731.0gMemorex CRW-26421.02MATSHITA CR-5741.00GCD-R580Bq01FX320SAC101CREATIVECD3630E1.07CR-2801TEBCD-24XBCD-16XSW03DALPS ELECTRIC CO.,LTD. DC544CSENASUN V1.9SuperVista S-12 AT3 1.60 ULTIMA V2.9Astra 1200S UMAX 1R08IS60 RICOH 02.2Model 3200 01.7Model 2600 02.4Model 1300 WangDAT 5150ES SCSI5099ES SCSIWANGTEK Python 28454-XXX2.2GVIPER 1500 21247VIPER 150 21247ARCHIVE TDC 3600 TANDBERGSDT-5200 3.SDT-5000 2.09SDT-2000 EXB-8200 EXABYTE TK50 TZ30 CP150 CALIPER 0002ST150176LWSEAGATE4421-07MICROP0001SD120S-200 NEC FC-1TEACG0661467ZIP 250ZIP 100IOMEGAjaz 1GBiomega6027MK538FB ST34501FC ST19171FCST296N ST296 ST157N ST125N SEAGATE RO3000S RODIME PD210S SUN0207PD1225S P105S 910-10-94xLPS525S ELS85S QUANTUM 0307D3847 SnapLink MST LXT-200S LXT-213S SUN0207LXT-213S XT-8760SXT-4170S MXT-1240S XT-4380S XT-3280 MAXTOR DFRSS2FKZ-CH3171-S20664IBM0663HIBM 0662SIBMRAID CP16CP15DK515CHITACHIA00MD21/S2 ESDIEMULEX RZ55 (C) DEC1588-15MBSUN0669MICROP 3.30MOS321 DELTIS 0800M2513AFUJITSU3.08OMD-5010 EPSON CD-ROM PX-40TSPLEXTORCyberDrv1.55R2626 JVC 1.04CD-ROM DM-3x1SShinaKen1755XM-4101TASUNSLCDTOSHIBA 1.10CD-ROM DM-XX24 KTEXEL 1.0BCD-ROM CD-56S 1.06CD-ROM TEAC CD-ROM CDU-8012 CD-ROM CDU-8003ACD-ROM CDU-561 CD-ROM CDU-55S CD-ROM CDU-541 SONY 1.01CD-ROM DR-124X PIONEER CD-ROM DRIVE:841CD-ROM DRIVE:5011.0CD-ROM DRIVE:210CD-ROM DRIVE:84 CD-ROM DRIVE:83 CD-ROM DRIVE:55 NEC 1.3CDR-H93MV MEDIAVISRENO CD-ROMX2A MEDAVIS 1.0bCD-ROM CR-5XX MATSHITA2.06CDD521/10 IMS C4324/C4325 HP VDRD-25X DENON RRD42 (C) DEC DEC CD-ROM CDS-535 CD-ROM CDS-525 Chinon CD-ROM CDS-431 CHINON %s offlinescsibusprint: impossible qualifiervendor-uniquedirectsequentialprinterprocessorcdromwormscanneropticalchangercommunicationenclosure servicesscsibusprint: impossible device typeunknown targ %d lun %d: <%s, %s, %s> SCSI%d %d/%s %s%sremovablefixed`>#      ` `@2  `  >> > >> #>#>_#>#``0 `+>#(,` €>% >" (> 8> @> P> X> `> h>  p>  x> >- > ȨА    p   > `#\#`#d>!>!#h #l} , 8DP\htDECTZ30TK50 not configured 㿈 4.`@.` ( h  > f 0@$@ $`!>$` >$` !$`$`$`$` $` $!H$`$$`4`4`a,`,`@e :!H  * $*  @> f!E * $* @  2@   >c @e^ > c@eY @2 @>c @eP > c@eK @>aL v@       ` 4`  2 ` 4`  ` 4`쀢 @`` 4`@ ` @` 2  4`@ ``,@ 8 *@6 8   8,`,`` 4` @ @5  `  `0+`0 ` @    @'>#t'  . 4.`@>#  0 a >[#i 㿘 2 '5 @ 2-`2)@k]`` @k 2` @kR `  @k 2`@kG@` @j  @@'ϲ@x@d 6 U ///#\#d/.`.@#` x\@d̒ 6 Z(///#\#d/#` vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapcdNEC CD-ROM DRIVE:260㿐>`  d 㿘>&``  $``$` 4` > `0`&`&`XH@ݒ`"  `2`` &``"">>#X &a\>"@ 㿘H /d * %   $'>)> $ $ $0"4h"0!( $2$H 0  @*`>> |ch@@ 6 @ `# >> |bD@# 6 # `, 㿘  0㿘? 2  @> xS2`  0z   r ` + f ޒ! a 1! [``4` ! 2G `   4`@7 5   @   `6+ . @ `# "      *@$  *@$    @ \$  0`?# @4`   Ĕ!`?# @4`F㿘?2  >  xɓ6   0> ' ܐ05"      **@$  **@$    $  Ē 腔!@ #?c 2 `!   荔  Ēb 2 㿘 D'? @2  `@> x{2` 2  =& 4 <(@kv  4& 4  `` ,& 4". < D     @ @ $ !Hb  2x 㿘  0` `@ 0`<"@ 㿘 D? @2  `@> x|2`  "  ( <*`" 4& <`㿘>>#ܘ#ؚ i-㿘>>#ܘ#ؚ i! 㿘? .!!@i.@!@jG@i K.@j@ K. *  ( ` (("  ?jX? @2  `@ `> x2`    ` ^ !@"Q$c@"K !@"E Ec@Bc @ p@"9 c@5c@ 20.#  `m@"( #@""!  !@  # 0 @"`q@ 0!@2@2    @"2Qc@/)c@"!\c @"!\!@] `q c @c@ `h c@"E c@Cc@ `Z c@% c@ 9c@c@ `G c@ `p@`s@q `8  #@"!\2 #@ "!\# e e@ "e  r @ ` @Y #@ ` @ "!\# @j `  `m@T`q@ܐ `  e`g@`f@D  h@"8  #@q `퀢  !@ `怢 0#@"p 0#@0#@ `Հ 0 @2@Ȑ `ˀ   @ߘ 0 5!0Ȓ `& *`` & 0 ?  $   @   $ 80` € @` € #\@#!\` € @} ,@@I oˑ*   82c   @U Y  d ?# @ `*`2 @74 0F#$ b #dd 9 @+  '```"  !?#?*`@  &@  `$@   * 2` 2`*`  d ?@# @ `*`2 @6@@?82v>    b/#$   @ؚ @ , `$`?# ` * 2` 2  d ?@# @ `*`2 @6@@  ` 8`&cْ 0!\@ !\    @     !\@     !\@     u@     k!\@     `@ \@  W o R  i L d GV "A !=2 ? 8 : 3 @ 2 + 0(2?#ϒ @"2@!\`@W@    ?ATAPI CD-ROMSCSI CD-ROMfictitious㿐@^!@^"`Ƞ d &(&0&,`@fi d &4&8`Ĥ  ?b  >a@^(  >a@^!  6> a@^` !W  &&!,&<6H6J&X&&o<6 &6&.@^h    @ "@``|`,    `ڐ  @ l`Ĩ  d   *   *` *   * *`  *    @>  `   d    *   *` *   * *`  *   2+` +`""#` "  ` 00  ?`@$`Ā ?,  @] ? *  6bB ? 2  @?`6 # @ `* * >cܔ@}p(" & & h2; ̠ @]  h %/#\#d#`    2% * *` *  aa(& * *` *    c8& "&  ́x @]p Ô@6`6`6` E6////#\///#`#d   㠚 h@& 4$ А@ " 4Ҳ@ &.`.   #\  @  x\ @]$   G/#\//////#`#d   X x @]  Ē K'/#\/#`#d   C 㿈 Ē'Д"#\#d#`    4 x@\  B`/ / 7` @( //#\#d///#`  x@\Ò  C`/ / c7 (/#\#d///#`  㿘   ښ 2``#  +    ˚  㿘Β   ? `@\y В @\u@` >"*` € a0  (//#\#d/#`  ⢚   װ 2 .`` ē*``0  (///#\#d#`  ⅚  ʰ `I ` ē*``0  (///#\#d#`  i   `-``* ě2`!0 2`2` ////#\(///#d#`  F   Ԓ`2 2  2  .` .` .`Ք 0l 0{` ē*``0  (///#\#d#`    d װ _.`` *    ///ђ/`0@  a0#\#d#`    A $ ` *    ///ђ/`0   a0#\#d#`  ܚ   .@  .@ ` ĕ*?0 //#\#`#d       4ߘ(H @[a  T@[]@ Ēa0`  T(///#\#d//#`  TᏚ  M` @[> ??(*? ?(*` +`?*   ?@?+ *? `?*? @ ? ?3    ` 3@2 2`  23   ` ` .@.`.`.`.`.`.`.`.`&` &`&`.`  ` p@Z  @Z `a0@  (///#\#d//#`      .`.`p@Zɒ (@ZŐ` ē*`0@ ( (////#\/#d#` (  `/%( 㾸@Z ( @Z @a0  (///#\#d/#`  Κ  ()*  `&``.,  p@Zn (@Zj a0@  ((//#\#d//#`   *  &``.Ȑ  㿘@` >#*` €Ӓ=a  0Lcd_scsibus_get_mode: Mode page %02x request bad size: %d bytes 㿀 > (  @Y @Y B b  (/#\#d//#` & cd_scsibus_set_mode: Set mode request bad size: %d bytes 㿀>!  @Y.@ b  //#\#d/#`  P     ``/ɔ P    ////ʖ P t   Ű .@.`.`.`P  ^  ` `/`@/////˒  l<p b #\  e    //// < p b #\ ؖ K    .@.`.`.`P b #\  1  " N #\ '  ɒ@` `/` / ͔  Ę //  x @XՐ Ô@ /#\//#`#d     vmmapbsyvm_map_lock: failed to get lockch02009000SPECTRA㿐>a   y 㿘>&`0a  >"2 !"@I%s: offline %s: %d slot%s, %d drive%s, %d picker%s, %d portal%s sx?>2 `  u * @ 2 00m` j  2` 0b 2] 0 H  @ "@ `>!H@ >"8p F 0@     @"4/ 8 L>"H >!>" T >>!" H#\ H`2>>!"#` P#d P`2>>!"#h. 8 $ 4? c 2 ? 0> * @?0` 2`㿘? 2`> * c  # #  ^  #"Q#"?8#"+8H0 #"(HA0 # #40 #"-0@0 ,@~ (@ $4"  "?@$8   44" "H"L"P" T "@Cx@ 4M `4I +  H`?@4A * ` ?@ X8  @ :  81   `` ` @W=@  4, ,``4 4` 24 4`//////`/ / 0ab#\#`#d   c x@`4l `4h ` 4d +` H`?@4\ *` ?@4U + `?@ \L  @ : "G  @ :  8@ `  `` `@ @Vפ  4, ,`,`4 4`4 24 4`4///////// /`  / 0ab#\#`#d    x@ * 0  H `  '  :` @V  4, `4  +24 ////쀋 / / 0ab#\#`#d   ܻ %s: warning, READ ELEMENT STATUS avail != count 㿘H.`  S   Xސ$8 @I$ ;` ` ` *  -D Z   XĐ@0 "` ` `*  >"O  X` -@ `@(ِ`Zw `Zr x @V 0a6`67  7 (////#\///#d/#` / %s: could not sense element address page %s: could not sense capabilities page h@UȒ ؒ @UĐ#p 0` h//  //#\#`#d    >D ߧ, ,,`,  @  +((+`   @ % T% 8% H% <% L% @% P% D@U~  @U{  0`////#\#d#`  ۲  >! 0 X@U_  \@U[  ,@ , $  0 ` 2`㿐>a0& d   `& dvmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapsd㿐>a   %s: %ldMB, %d cyl, %d head, %d sec, %d bytes/sec, %ld sec totaldrive offlineunformatted mediasdattach: unknown result from get_parms%s: WARNING: unable to establish shutdown hook 㿐>&`ax `0 .a\$`$``>t&`X`&`@2`" >!(>#&a|`" > `2>` &`>א ``   >!H  a]`@ af`@ aw` @    a|>aH`Ƞ`>  ( ">  >0>0 !> 0@\9@\5#\0  p0> 0   >>" l &a> t 㿘H /d * %   $)>+> $ $ $0"4h"0 $2$H 0  "@*`>> ܤch"@`& "@ c 6!>> ܤbDc`& c ,!`>k" 㿘 0㿘? 2  @>!`;2`  0   | ` 5 p ƒ! k` 2 ` ! ```4` ! 2K `   4`!|@  Ȁ 2 4  @   `6+ . @ `# "      *@$  *@$    @ :$ 0`?# @4`   آ!`?# @4`$Ӑ㿘?2  > !`6   0H  "A"      **@$  **@$    $$  "  !| €  Ē Y!@ #?c 2 `!   a  Ēb 2͐| 㿘 D'? @2  `@>!`O2` 2  B& 4 <(@[J  9& 4    `  /& 4 ,& 4". < D     @ @R $ "+  2p 㿘  ` @ ?"` 0 `0 @ <V"@ 㿘 D? @2  `@>!`@2`  "    ( <*`" 4& < `I㿘>>  Ț X㿘>>  Ț X 㽘? @2  `@ `>!`2`    ` .  !@"! !@"8  p !   q@ " m@  0!@2      `m@"e e@ ";  `p@`s@$0 r@& !@0 !@"vV `q@i  h@0 e`g@{`f@ x0  @ 0{@ 0t%!0p `& *`` h&T 0޶ a $   @= 2  e g@2 ? @2  `@?`4`# @ `* * > `@`   $ 05"4    -$ ?*$  @  " "  !22 @   4SCSI opticalSCSI disk%s %s㿘@P!@P"`&(`&0`&,`'&4 &8 d&8 6a\` >>a@P a]a@P a]@VÐaf@V   >aȔȐ`ؒ@P `ؐ.( 6H2` 6J& &<&&X']&&  aW6&&.N? 2`  ?6  +  *6 >`@㿘  !| € x@P&  @P" 6`6`6`  //////#\#d/#`  R %s: ..is spinning up...waiting %s: removable disk stopped - not restarting %s: respinning up disk %s: respin of disk failed - %d 㿘  4`?  ` 4 ? ( ;?  7 3  >  P'H#@%?$  ` ` >> pڒ   Ԑ     > ɒ ? 㿘?2  @>!`~4   /? `*@2 `Đ  2?` `, ` `"(? &m2`    2?~ߐ㿈)> f" ?>2  !`@2`  ` $#b!`. @   (@W R @V.` @M,    @ > f? = !`7@ @O 6` *6`6`4`///////@O   @&  #  &&& &&%&(& &,%&0&$ @€  %"  _(*``  @*\%s: strange capacity descriptor byte5 0x%x @ @N Ģb  # /#d//#\#`   M  `  " `  > `> `; !0 6 *` `*  * `+ *  @ 3`  @ .&` &`&`&`&`&@ Ę#\  &頚   ѓ*`@ * ̐ &@&`&`&`㿀@NV , @NR cp   //#\/#d#`  ,Ԉ P"&`    @N2 cp  ? ///#\#d#`  ,g   ʑ* ˓*`  &` &`  @ &@&`@Uђ(&`&` %s: mode sense (%d) returned nonsense%s: could not mode sense (4/5); using fictitious geometry h.&`!\`Ȑ}  + ґ* ֓*`א ؕ*ӗ*ٔ   &``&@?&` < 2 Đ"&`  Ґ`&`@$ @UvL&` O " ґ* *`ܐ ӕ*ؐ &@ٔ &` &`  $&`$`  &`` ' "$&`   `@` >> ` >  >  F @ 6 "&`&@&`&`&`  %s: WARNING: cache synchronization failed x @  "`!@MG aba 5/#\#d#`   Ӏ  >"[ 0  @& vmmapbsyvm_map_lock: failed to get lock????5150ES SCSI FA1501 AT4000s HP 263HEXB-8200 EXABYTE Model 1300 WangDAT 5525ES SCSI REV75150ES SCSI5099ES SCSIWANGTEK VIPER 150 21531VIPER 150 21247DMT780 ANRITSU CP525 SANKYO VIPER 2525 25462ARCHIVE TDC 3800 TDC 3600 TANDBERG st㿐>b  j %s: %srogue, drive empty density code 0x%x, %d-bytevariable blocks, write-%s protectedenabled㿘>&`L"x $ $ 4 @L>"(`X>``"0>"8>! | 5>HQ`  >H@` "`d>j"@a>e"P```>>^"h`0Z"p`0>`">">"N a&a&a&a ?# @4 㿐> Laؔ   & X& h& 4@& @㿘 X  l  @K @ ,@ h@`" $ @ ,@   , @ ,@   %s: already open 㿘? 2  @>"d 2 H "d*@ 2 L0@2` ` >! 5   г $` 4`%  D`2 0 @ܔ  0(`@\$ D`   0  $ 0 @ɔ `?# @4`㿘?2  >bd6 *  0 a`  @#   " L     L @  L  `2  L @  L @  L? c 2  %s: cannot set selected mode 㿘?2  >bd6 * 6  0 h Lf ,``@$ 0*  l@ h $ 4 @ T  4`"@6 I"@~ @@ ; @  *  t, < d, < 0 ?$ 0   @J  0*  p@$ 8$ 0@ > !@ 0 h$ 0 4#h 㿐 0( L @ @ @ @ !@` @ @ 0? 7& 0  @ 4 L" P0`"0"" <T2 <0"82> p(0`"0""8""8`"04 `20`0"0`"80"8"0 < 4 0&000"0 '''&&&&&&&&&&&&&&&'%s: bad request, must be multiple of %d %s: bad request, must be between %d and %d 㿘 D? 2`  >2 d*  < @@ 0 " P 8@OK  8>  !#   T  >  # & 4H /d * % & $ `( $& (`("@"`(H 00 0(& 0 <& @%s: not queued 㿀 L` ?## `  4`l<0!  $` ("`(&! (" 0h"`` `` @4` 0$ 4 <$ 0y$ @n` 4`"" 0 0@  @̖ " 0 0 <h$ 0$ @_$ 4T`  0$ 4 < 7$ 0$ @ 0   0$ 4 <($ 0$ @ 0 E& 0:` @IT  0@  0 > /& 0% /( 0   / 8@G <2  <2 2 /// H <# #\#d#` n > !hI ` 2j`㿘? 2`  >d2 * @L> `  P7㿘? 2`  >d2 * @L> `  P  㿐? 2  >bd2* a2 8  <@   a@a@ 0 !@7  @i @H 8 6 8& <& p& |& &  &$ t&( &, &0 &4 0`" 0 6 0(" H 6 H6 J64 J4 HV`o> !0*` €@9   @_ &@  @   @O   @   0 @[  @U ~ @- v Д  0*@:$ 0 0 5$ 0@e c`2 P 0 ?`@  T  @ T  T@$ 0N  0 $ 0 0$ 8 $ 0`EC  , <  =  Lޖ6@ >#h& , <$ 8 0 %$ 0 0 ?!$ 0   V   ,`0,` 8*  p"@    <* * t  * .T.p.l....1(///8//d/x/0㿀2 @G  0 `/ 8 `/@F0: 22///66/// Lc #\#d#` Ӛ x`L  % @G| a0h /#\#d#`  ͵   * *` *  $`T$`P0 @ L @GR a0 h/#\#d/#` ͊  &*`** *@  @  & \& `. d 0  0 ?& 0 @   40 @ 4 ` L"7 @G  /@F/   03 <//// 0 "  @ 82 2 /// @ a!0#\#d#`  㿀@F͒  `/ 6/b /c  L #\#d#`   㿀"# 0 8`0B 0"0>`4 =9`     " 0I 0""' ? =  `4 ?߀`6 0 ?& 0 0  ?& 0 0"` =& 0 ` 0   ?& 0"  ?& 0` @Fe L66`6` ///#\//#d#`   ̙  㿀`( `  0!"! ?& 0 0 =ϐ =& 0 @F4 L6`6` ///#\/#d#`   i 㿘 0 %$"  %  & &` 2  N x`  ٖ 2" 4  `2 @  @E L6 /#\/#d#`    x   0 =& 0@E  L /`/!06"#\#d#`    %s: block wrong size, %d blocks residual %s: %d-byte record too big %s: bad residual %d out of %d 㿘  4 4 0   7 7 * *`  *    $  p2? 0 "L $ 8n& (  @ ` 0 $ 0 ($`@  ` 0 $ 0 ($`@   ` 0 $ 0 ($`@ "  4  2 4>!Ȕj  4 "  (  2 ( 8>$ 8 ( $@*;  0 2T  3`2L$`@M & (  @2H  `C =`<     8 >"!5 1  `   `>" ($ & ($`@   2? 4 "  0  2 0 8>$ 8&2 ?"$ 0 $`& ($`@ ?㿘$ G\  6 t '$$`8(`82`0`0    ?$`0   ٔ I  0 2`8I   vmmapbsyvm_map_lock: failed to get lockgenericFujitsu M3096GM3096Gm FUJITSU UMAX UG-630UG630 UMAX UC-630UC630 UMAX IBM 24562456-001 IBM Ricoh IS-410IS410 Ricoh IS-50IS50 RICOH Ultima A6000CA6000C PLUS Ultima AT3 AT3 1.60 ULTIMA ssC7670A C6270A C7190A C5190A C6290A C5110A C1130A C2520A C2570A C2500A C1790A C1750A HP 㿐>a  ޠMUSTEK㿘>&`4` "2 "> aP@I  2@@ d> a@I  2@% d@  d$  `&`&`<.`N.`O.`L&`86`@6`B&`D&`H.`M&`&` %s: %s %s: generic scanner 㿐>b̐  @O >`&  $ 2&  > `"@. ^@ 0  "P!>"@C^ , . ^& ܁%s: already open 㿘?2  > 6  6& *@`2`4    >#_`  !!1 ? # @4    4 㿘?2  >`6 *   `" 0@   0$ P ?$ 0 4? c 2  㿘 D? 2`  >2 * @ 4` 쀢€㿀? 2`  >2 * @`0 #>`䀢`@ "`00  @BȐ  //`4c#\#`#d    `0 $`0>>!Ș | I㿘 D? 2`  >2 * @ < P 8& < < H /d * % & $ ``( $& (`( "@"`(H 00c& @%s: not queued x 4` C?a#b`  4`d06 3 $` ("`(&  (" €` @BF  (/ <(2`2`/// H <#d#`#\ { >"V ` 2`㿘? 2`  >2 * @# : #( 5  # # *  耢` 8@ ( 8t (0# € @0 ` -@  0 ? $ 0  -   4թ0 4@AȒ  $ 0///@A/ ` `2`// (// 2 2 2 2 2 ܳ2`55`22222`2`////////////////////`   "` / `   8 ` " ` / ` @  " `/ i4/ g // %/ " / /  a  ' `"  ` * * @* @ ' $" 2`// 0  (c#\#d#` X 㿈 2 4`*2##\#d#`  3F 㿈 4 *0` h" @ i g  2 2  *1 2*2#\#d #`  6 h 4@@ϒ a" 4 (//#\#d/#` ؘ  >" * *` `<  &`<vmmapbsyvm_map_lock: failed to get lock %s: MFS-06000CXMustek 6000CX Flatbed 3-pass color scanner, 3 - 600 dpi MFS-12000CXMustek 12000CX Flatbed 3-pass color scanner, 6 - 1200 dpi 㿘> . ^"`> b@Fe 2` >. ^"`> bX@FW > >. ^z"h>  & & &  & & & & @& 㿘 0 " ` @N "`  @H`$&`  @H@$@&` @H`$&@@H $@ [&` #؀@U`S!@8Y `!,  @Hf* 2 $` 6`!,  @H[* 2 $`* 2 "U06` *`2 26 ` @E.?$? H!.`` @E$?$? .`` @H4$? P .``   i4  g6 ^   ^.`& 84 (@ 㿘 \ X`<2 @H$&`<P 4@ؐ@?   //ܐ@?  D @GX/Ȣ H@GT  8@GP @ <@GL c4`4 42 ///#\#d//В///#`  ų  2 @?d  / /@?[/ @ a,/ @G /@D d / M @=ΐ? N/@=ɒ / O @G/㈐? p//#\#d/#`  u  2B@?&  @  /,/Đ / L " h" i g   # @ H PĐ X/##\#`#d   =  2  <@v   㿀 P  4@>ߒ # /#\/#`#d      %s: not queued 㿀 4@>  \  X/`<2 @F`H #44(//#\#d/#`   >!Hǒ 0 T"& T`< P" & P mtkrdymustek: lines actual(%d) != computed(%ld) mustek: win-size actual(%d) != computed(%ld) x 4@>t   #//)>'>(#d#\#`  Ĩ  2;耢 ` >!X " ^ ($* *` * T@  >"(7 P !>"X/R 0 `  㿘 L "  i   6 \4 @ g 6 \ @ 8@EӒ$ \ & X` ?` ?& X B <@EÒ$ \& T X2 & Pvmmapbsyvm_map_lock: failed to get lock %s: C1750AHP ScanJet IIcC1790AHP ScanJet IIpC2500AHP ScanJet IIcxC2570AHP ScanJet 3pC2520AHP ScanJet 3c/4c/6100CC1130AHP ScanJet 4pC5110AHP ScanJet 5pC6290AHP ScanJet 4100CC5190AHP ScanJet 5100CC7190AHP ScanJet 5200CC6270AHP ScanJet 6200CC7670AHP ScanJet 6300C set_window failed compute_sizes failed 㿘> . ^ `> `@Cs  2` >. ^ `> a@Ce  2` >. ^!`> a@CW  2` >. ^z! `> a0@CI  2` >. ^l!8`> aH@C;  2` >. ^^!P`> ah@C-  2` >. ^P!p`> a@C  2` >. ^B!`> a@C  2` >. ^4!`> a@C  2` >. ^&!`> a@B  2` >. ^!`> a@B  2` >. ^ "`> b@Bٔ  > >. ^" >"@"@&  &   &  &  &  &  &  @$& >"80 @   >>ؐ"P0Ր"h%s: set_window failed %s: compute_sizes failed 㿘@(`  @ #؀@8< ``@ !@82 `?* 2 !,8+ ` c !8% `   " ^  ^.`& 8 (@͒ > !Ȑ@ > !  *f0S%s: trigger_scanner failed 㿀@ >!Ȑ@ ">>!# # `7'@Bt@9 > #(ؒ`%s: not queued 㿀 4@< `<a`H22b /(//#\ /#d#` I  >#$ 0`< P" & P 㿀 @; 4 a66 ///#\#d/#` " 㿀 @;Ӑ 4a66 ///#\#d/#`  *f%ldP*f%ldQ*f%ldX*f%ldY*a%dR*a%dS*a0T*a0I*a3T*a4T*a1I*a5T*u2T*a%dG*a%dL*a%dK 8x>a2 <>a2 D>a2ݐ H>a2֐ @>aА> Baʐ L`&``"   \4`"J } \6 \>  `, `,  `,  `,  `, @A, >a X a6 \>! ` !, `,  `,  `,  `, @A~, >a A a 6 \> Ȓ `, `,  `,  `,  `, @Af, >a ) a6 \> ؒ `, `,  `,  `,  `, @AO, >a  a, ,  ,  ,  , , @A>>a  a, ,  ,  ,  , , @A- \>a: M>a3 N>a,x$ ݖ%s: interrogate write failed %s: interrogate read failed %s: bad data returned *s1025E*s1024E*s1026Eh`8`<` `L   ?$`8$`< 0 > > /?@@͐ >Ob`Ƞ   E>OJ@  d2`J@   I ?А  >J+  @ *`В@  `L $`X+ $`Xaa ?@@/M > b`_  >bd`03OJ@  d2`J@   2 >bh ͒`0?А  J,  @*`В@ `\$`T`X 2 $`Puk  %s: unknown device 㿘>&`0b >"2   "> `%s: already open 㿘?>∑2 `   ∑* @`2`00  2> 2 !` ? 0> ∐* @?0` 2`㿘? @2  `>∕* 0˘vmmapbsyvm_map_lock: failed to get lockdmaledma[%s at %s] offset 0x%x㿘`"!@> "h!@>"x espdma㿘``@=  >@=ؐ" "   > , ` &`48>@ cable-selectiontpeauiburst-sizes: rev 0esc11+2unknown (0x%x) nameespP "8, 2  80 @ؔ &  >&`D @=b` 2#>>@ cX>@=~ch >@=xcp 2 `D`D* "`D "r" >`   @ " >cx@??&`T&`T`T &`T>~#`D<@ @ &`L `>@">!>$@>(@">>~ߐ#>~ې#>>~֐#>~Ґ# >~ΐ#>`L~ɐ#>~Ɛ#` >@">>>"bP>"hc&`l&`x>>>>"b&`p&`t&`|&`` I&`P 28`08 >@<b  >8@<bX 8@<ݒ` 2'8 ''@w`P %>#>@U@  | 'bdp @f 0>@<bX  >`@#؀ &`<"#%s: line %d: CSR = 0x%lx /usr/src/sys/arch/sparc/compile/GENERIC/../../../../arch/sparc/dev/dma.cR_PEND㿘 D@$!@耊d! ?  Dd ?   > D@#>c~!P>~ 8 D@ < "@ D Ȓ`"b D @ ?"@ D " L@  `  D " L@(@2)& H D* " T   D " D D@0 "& H D " T`  D@ 7@("@& H㿘 㿘``@< 2 y@ 㿘t  D  D %s: start %d@%p,%d dma_setup: dmasize = %d dma: cannot allocate DVMA address㿘 D@#>$ %>@耊d! ?Ґ  Dd ?   > D@#>c}b!>{ 8 D |` "& d& hbP  >"@@ }M  d?@@*" 8 & `'bP > `}:" 2 d ``  d @& \ & X>{" D"  L d D"` L@2 D d>@ `0 > " *@  D"  D" >! "@  D  " H%s: intr: addr %p, csr %b INTERRDR1DR2IEN WRITEENCNTTCDMAON%s: error: csr=%b dmaintr: DMA wasn't activeDRAININGdmaintr: discarded %d bytes (tcl=%d, tcm=%d) dmaintr: empty esp FIFO of %d dmaintr: tcl=%d, tcm=%d, tch=%d; trans=%d, resid=%d 㿘`D`<>"P` >>!0!P`|>`D> }"`D!` #|P ?`H 2`D>{ !@$"!`L@耊d! ? ֐ `Dd ?   >`D@#>c|f">z 8`L @`2`D`D@ @@ "@`D`  耊` ! ?  `D`  ?   `D>>#Ȓc|5">z! ="```($`HbP "%>  ȟ€ @€  * @  € @€  |   @€  bP >!{ 2,``  € @€   * `@  @€  * 2 ````@@2`` @" ``,bP  > @" € @€   @ @€   {>`d!H> `2 `h`X "`h`\@8```h ""`d@"@㿘 D > }" D>P` " !{m  l@ vmmapbsyvm_map_lock: failed to get locklebuffer[%s at %s] offset 0x%x㿘`"!@> {G#!@>{C#ȁ 㿘``@9 2 @ burst-sizes: %dK memory nameP "8, 2  80 @ &  &`H8&`L @ " >`P@??&`D&`D`D>`L ``&`D z: &`@ 28`0p8  ''@ސ %>#>p@@   'c`ז @͐ pvmmapbsyvm_map_lock: failed to get lockqec%s at %s offset 0x%x㿘`"!@> z"(!@>z"8 㿘``@8 2 d@ #channels: no channels : invalid number of channels: %d burst-sizes: %dK memory %d channel%ss nameP 0 @ &`<D&`H4&`\4 2&`L&`@@v @ " >b@9?&`P>zI"0X >zB"0Q>c@%??&`D&`D`D>`H c&`D`P: >#8>#@z$ &`@ 28`08 "' '>z#H@@ #>!>cP@@%  @c '"H_ @ cPranges%s: PROM ranges too large: %d 㿘> !X @@ 6;  & X> !` yӔ05 @;n& T X @@t T (`< * *    X`8  @2 `   " `8 X@ ` "   T&`<㿘 0"!<.` X(   \ &@("!@ 0.`( T @` 4   X   & X @` @ޅ.`%s: reset failed. 㿘`< $`    ?   2`P> #yC`0@1`H$  `P$```H@1*`$ `P *``H@1$`d$ $ `D @ 2  < $㿘` > "'> +> ` 2G`H /f * ' V`* 4`N ` ""@`8@ `<"`<`<`8"`8"`(`$p ``$`0`,`7#`4`&`0 ?6`@paؑH 0K%H /f * ' V`* 4` ` ""@`8@ `<"`<`<`8"`8"`(`$p ``$`0`,`6`4`&`0 ?6`@paؑH 0`2n` 㿐H /f * ' > !nf H 0 #+>  4 H /f * ' > p 2H p@  $ $ 4 $$ $ $  ~  2$ Ȱ * 0$ 2 ܑH /f * ' > !ؐn $ $n $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8  2(  $ '􀦠> "p rܑH /f * ' amޒ H 0  4 H /f * '   5 H p@  $ $$ 4      43H /f * ' > !ؐm $ $?m $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8  2(8  $ $&@be㿘`@5`?: expected 1 interrupt, got %d board-versionchannel#burst-sizes pri %d: rev %x address %s 㿘4``H>"wJ#`0>"c@,?&a`0  @Ֆ 4&aX<  @ϖ#`&aT H @ɖ &a\&aL <@&aP>"c@??&ad&ad>"c@??&ah D&ah D>$aha &ah&`<`<&`@@na @ua0>(>(ࠐ% @ ?( # ) ! # #  #&a4 ! #   #&a4 &  ! &   &&a4 ! &   &&a4  (   (&a4     &a4a4``\ >#>%>$?&`H#0aȔt" $$$44$ $Wa`!>"#9v8 >"c8@4Ԑ `@"&㿘 4 $@ @K# ̀  Ւ    €  "3$  & & $  ?& "'$ ( " `~ `t* @  |8  ,`" X `"a"   $ 4$6 4$㿘!T"" !Tb " !T z !T" `?"# !Tc   k !T# `?㿘H /e * & ѐ@H 0%s: device timeout 㿘>$a` t  `$ 㿘!P  !X``!T!`@}`@2``@` @%s:%s qstat=%b unexpectedRXSRXPRXLRXSMALLRXDROPRXTXSTXPTXLTXDTX BE%s: resetting 㿘2      `  `>$  "H  >$"X>$"`>$"pus >$"uoj%s:%s stat=%b RXRCNTACNTCCNTLCNTRFIFOCVCNT TX TFIFO TMAXPKT NCNT ECNTLCCNTECNTDTIME㿘 @ >$#h  >$"X>$"`>$#xu? >$ u;"6㿐!T H@DH L  X @$ X"@"D"H"L! %!!|*( '   4 P { 4 4$ P !?  &!!|*( ' " 4&!! "4 2 㿘!!|, @ # % @@  !|*  "@!`  !|@ &! 㿘 H /e * &  a2a1;a a H0!5=0 !69 = 4 6 4 ` @H H.I0; 4@  2 4k 4 ?/6 4  @`@.0$ H` H`4@ !0 HK $  H 00H 0㿘!T H!X!LH /f * ' !| &!p!| @  &!!t   !t @ &!x @ !|* !x + @" !| ("    !x !|*`   + " !|"  "   $!x&!&!&!@t&!@#ݐ!$(!%*  $c!"!#* $c! !!*`@ $c $c @oJ  $b  $bP $@!$ !($ `!d$ $ $>$  $_d  $ , ,$ ($a$ $ $ $ $b,$ 0b  $b c `$c 4 @ ;44H p@!\    ?#d ?#d#%s: rev %d PAL not supported. %s: no internal or external transceiver found. 㿐!\ِ!``>&"p s0# $   '$   '   &!l?$'0  ?&!l$'0>&"sf %s: invalid tcvr type 㿘!l      >&sP#M1? @ @ݒ @ڒ @ג ` < `@ѐ?< >@ `@ɐ?>@!l @U@S @P *?@@I@G@E@@ @ *?@@ @@㿐!l !\ $   '$   'M  2  >& $   '$   ';  2 #rג 㿐!l !\ $   '%  $   `2`'0 >& $   '  $   `2`'0#r 㿘!l     >&#r 00@. @+ @( @% `. <@ `@?<@ >@ `@?>@@ @  6 > `@?>l `\( \\( \  #d" \#d#%s: invalid packet size %d; dropping 㿘%  H>' \r;# L`$ L!t`*`   2 H L  $ L ( `$ H z_㿘 a !"  0 2  & & #&`  `   ?&`%s: bmcr reset failed %s: bmcr unisolate failed 㿘!0 X  0 ,  # + ? m   >( ;!Pb ` ``*  !Tb " b ="b ?*    ? 4 $ >(  !hq 㿐!T H 4!c  @$c 0Sc ?$c  4b?#$c@$cD$cH$cL0F?c$c@$cD$cH$cL 4=" 7777& @1,  ?;n #       @2?2 $ 22*  * @0 2  ؐ$c@$cD$cH$cL 4 =6 4qe㿘`@/n`?: no interrupt found on parent mace-versionchannel# pri %d: rev %x address %s 㿘 L`H>)p 0m>)`@ݔ?&aD0  @ 8&a<<  @ &a8&a0 <@&a4>)`@Ɣ?&a@ D>*!h&aH&`<`<&`@@4a ``\" >)>,&`H"a>*?al `"$`$`>.>.$`4`4P<   # # $`` $`}͐iaD!>) Kp8 >)`@. `@"&㿘 4 $@ @Id ̀      €  "3$d  & & $  ?& "'$d ( " `x `L*   4T8 ' ,`" < `"a" \  $\ 4$6 4$d㿘!8 !<,    ?    $@@`  ~ ? @ 㿘ڐ@%s: device timeout 㿘>* `n   & H /e * & ސH 0㿘!4 !@ *`2 2!< `#߀ @  @ @ "@8@㿐!\ H %!`!T*( '   4 P { 4 4$ P !\?  &!\!T*( ' " 4 &!`!\ "4 2 㿘!h !T,`@ 2&!h #  @ @` !T* `"@a   !T@&!h %s: excessive tx defers. %s: no carrier, link down? %s: excessive tx retries %s: late tx transmission %s: tx fifo underflow %s: jabber seen %s: babble seen %s: tx descriptor is bad %s: tx late error %s: tx dma parity error %s: tx dma sbus error ack %s: rx fifo overflow %s: rx late collision %s: rx packet dropped %s: rx buffer too small %s: rx late error %s: rx dma parity error %s: rx dma sbus error ack %s: unexpected interrupt error: %08x %s: resetting... 㿘`H@   >*`nΐ#p T `$ T@ >*`nÐ# T `$ T@ >*`n# T `$ T @ >*`n# T `$ T @@ >*`n# T `$ T  @>+ n` @>+ n` @  X  Ta!$ X$ T@>+ 8ny`  @ >+`np X T `$ T @ >+`nd p T `$ T @@ >+`nX  T `$ T @ h X  La!$ X$ Ld L !$ Lb L !$ L `>+n7  L `$ La >+`n-  L  X` $ L$ X``@ L !$ L` L !$ L `>+n  L `$ L` `>+n   L `$ L ` `>+m! L `$ L ` `>+m!0 L `$ L ` `>+m!P L `$ L  >+!pmܒ`>+`m֐!?㿘 H /e * &  a2a1;a a L0!5A0 !6= A 4 6 4 ` @L H'G0? 4@  2 4U 4 ?36 4  @J@20( H^ H`4 4  @ !l HE $  H 00H 0㿘!8 H!<!0H /f * ' !T !T @ &!X!T@' !L !L@ @ &!P!L@&@  !T* !P,  @ "   # !P !T*`   , " 4 !T"   $!P!X$`!X($` &!\&!d&!`&!h$`$`$`$`$`0$`4 `!@$`$`$ `$` `$ \ d  $`,`, "$`(` , ,,,, , ,@ ,    d. ? $!  ! ,!!,!",!#,!$,!%,@G,4 `@  {a44 , H 0%s: invalid packet size %d; dropping 㿘%  H>- \l"x L`$ L!L`*`   2 H L  $ L ( `$ H u㿐!8 H 4" , `  d ?     ,?0R 4"6 4 7777```- `@,  ;n # ? @    @2?2 $ @22*  * @5 ``ڐ , `  dq ? $   @ , $ @ #"`8 @ ` "` "`p   hmeSUNW,hmeSUNW,qfe㿘``@*& >.@* !  >.@*!  @ : expected 1 interrupt, got %d : expected 5 registers, got %d hm-revburst-sizeslocal-mac-address pri %d: address %s rev %d qfe㿘4``>.k" 0`>.k"@08  @0&atD  @<&axP  @H&a|\  @T&ah  @`&a>.&`Hb`@K? &a &aa  `!&a>.bh@8??&a @&a @a @ @&a`0>2!&`<&`@@`<ad>.bx@ޖ  !>.~C!>."Ԑak%>4>4!x`>4`L#`&`&`>4>4&`8&`h8<??? `p   " ; g "`c ``O >/>0>0?"`|D" $`$`$`4`4$`$@` $`x 8`@>#@)( >.b@)" >.a@) &㿘 4 $@ @G# ̀  !    €  "/$  & & $  ?& "#$ ( s0@ڐ8  ,`" x `"` "   $ 4$6 4$%s: stop failed 㿘!t "@!t     !t`   2 x>/#8jV  x ?& x㿘H /e * & Ӑ@ސH 0%s: device timeout 㿘>0`0 h  `$ 㿘H /f * '  {   H 00[a2@a1@9a @a@"4F 0!5@;0 !6@7 0;4 44 ` @#0-@  24h4 ?"44  @]@h0Ւ 4 @  L.H 0㿘! 2 !! @n &!! 2 !p!@! @c &!!&!((&!&! @ ! #@  `&!  ! !*  #@ # %s: burst size unknown %s: setting rxreg->cfg failed. 㿘!! !t!x@}!|?#$!`"  ?$@@!h!i*` @  $bP!d !e*`@$c !f !g*$c!h!i*  $c$b,$b$b!%`!(% ! @  $  $ >0#Hi $!$ % ,   %  %@e@">0#`i $c @&W b  $$b !`2"$@b  L`$b c $c 452`@ {54㿘!  !?#"`` Ȕ "`! -&!%s: reset tx failed 㿘! $b0 ? b  >1!h %s: reset rx failed 㿘! $c0 ? c  >1"Ph %s: link status changed 㿘>1 h" 㿐! HLD @ `X @$`X"H"L"D"@! `P { 4`4 $`P !?&!!  , !(@  6`4&!! "4`2 㿐! @L $L@<!, ! '   " !, @ `2 &! %s: stat=%b, resetting. RXRCNTACNTCCNTLCNTRFIFOCVCNTSTST TX TFIFO MAXPKT NCNT ECNTLCCNTFCNTDTIMERXHOSTNORXDRXEEXLATERXPRXTEOPMIFTXHOSTTXALLTXETXLTXPTXTSLV SLVP㿘?? ؐ & ??" >2>2ࠐ g  㿘at?a" ߒ >@@@o㿘.`* * !* @  > "'> )>  `2GH /f * ' V* 4ْ  ""8@ <"`<<8"`8"($_ $0,%4&0 ?6_n!ؑH 0K@H /f * ' V* 4  ""8@ <"`<<8"`8"($_8 $0,%d4&0 ?6_$!ؑH 02n %s: invalid packet size %d; dropping 㿘%  >3 f  L`$ L!.` @ 6  L $ Lv  H ( `$ H ox{㿐!  4!c  @$c 0]c ?$c  4b?c$c@$cD$cH$cLc ($c 0M?#$c@$cD$cH$cLc h$c  4"A6 4 7777& @&{  ;n # ?      @2?2 $ 22*  * @0 2  ؐ$c@$cD$cH$cLc ($c  4 }6 4! ` !  ! 㿘!" ``!  a2!!  b   &@ %s: mii_write failed 㿘!  #!*? .`c   $` ` @@  ` ?  3>3#f 0. $`       >@ `>@ > `> > `>$`%s: mii_read failed 㿘! ! % *`@ .` $` ` @@ . ` ?  >4 eĐ!`B ` 1?#=  $` J ?E B ? <  >@ `7?>@ > `/?>$`2 .*? &# 㿘 4  㿘 L |&` x&` |!b b "b vmmapbsyvm_map_lock: failed to get lock㿘``@# "  > , `J&`48@ dma: expected 1 interrupt, got %d pri %dinitiator-idclock-frequency espattach: no dma foundintresp㿘>5 `8 @(T >`4&`4`?`>5e @0 >5 ` d&c$ 2&c80 @ &c&c  [ >5`h@yӔ &b>5c `x@y͔?&b" &b&bb耢 6`$ 0&bb@0b@ &b&c& <`@}`8 &c" <>5d >5cG b  ` .`.`.`   `@€ _ "`-&b .``  `.`   ` .``  `@€   `.` @`.``   &bb#@Ւb`&b``>e#>e#@&b &b@&b@$&b@&b>e#&c` >w c`$͐c>wɒ>wcc$&c c @&c>5`M`0 "8 6>>5`@" /> <@   #> `@2> @s > >>5`@"e > ? > `@2> @s >>`/9$b `&b@r #*` #*`( 㿘# t@㿘# l@㿘# x@㿘# |@㿘# @#D"#Haudioamd|QEB;632*+,%#"""-+2LCBCA;;=43422$1*{*+#+,B.#%$+$#""A"#"3J!2,b2q"4R#z5& *c  # 3   > L!|"3"B2'"R:31,#"bQB;32*,%#"!  C3@DA1U BA` Br!" audio㿘> `>7@!u X`? : expected 1 interrupt, got %d pri %d, softpri %d intr㿘!0`>7 c05 >7  b 2  N 0 @  N.`| .`&`.`~.`.`@ `> ""0>:@Œ`>9"&`<`<&`@@< >7`LE`> @X !* *  E** *  C*  *  H2   " H" " L" " " " "  㿘@ʐ@& H?    @" mulaw@ >7؄"`  2`"`"`"`   ~>6*(@P2 (@2& * ((0 >7*(a2$2"(@>7*2"2$  -*-H( i+ , c+ + ! f+   d0+ + ' e+ & j0+ + #+ "0+ + %+ $0+ + -+ H  `L @ ` !* *  #`L@ #`#`#`#` `L @ ` !* *  #`L@ #`#`#`#`   !*@ *`" L   !*@ *`" L 㿘>`) 0 @``& `" @>8( ` *~ ` * ` *`    `  ` * $00<H`@`` ` @>8@( ~ *`  *` *` "` "`   $, micvolumespeakerheadphonesmonitorsourceoutputinputsoutputsrecord  >9ȇ( # ? # $# # >8` # 8# < # ? # # $# >8p(p # ? # # $# >8x # x>8# ch3  # <+ ch# (3 , + . # ? # # # $>8#  # # <>8hh# (3 ,m+ . # ? # $# # >8>8# 3 # (+ c`# @X# , # ? # $# # >8 # >83 >8+ # (pp# ,# @# 0#x#x# D # H 3 L # X4+ N # ?# # # $>8 ?# # # # $>8 # ?# # # $>8# 3 +  ?# # # # $>8# #   @dD思㿘  H /d * %   @(  H 0  @ H /d * %     H 0  @ 0H 0 />%0/> P%P/> 0 %   ,%+>``+?P `-`0+-?P%  ,% +>``+?P `-`0+-?P%/>0@̀audiocsSUNW,CS4231㿘``@D >:@>!(   : expected 1 interrupt, got %d : expected 1 register set, got %d burst-sizes pri %d, softpri %d intr㿘4`>:_!x0? >:!_068  @K0&`T>:&`pa@t??&`t @&`t @`0`t &`t>:#&`<&`@@`<>: _!>:`XHa>!8B  .`.`.`.`㿘 T     * ` * * ***("2   Ĕ  `  &  8    & "8"< ` @    ` @ `  T *  * *   *  * * * %s: can't find speed 㿘>@"" ? `p8  `@@    "@ " ? `  &@">; ^  "*  & &  &@ %s: waited too long to reset iar %s: waited too long to reset errinit 㿘 T& d ,@ @W` #? d @  ??  >;!^  ,@ `W`  #? d `  ?? >;!^ %s: unknown CS version: %d %s: unknown CS chip/version: %d/%d 㿘 x  TU  & x& |& & & & $`А  $`` ` $`` $` @`@,@ L,@ @,` ,@ `` `    `>;" ^F   `>; `"  ^<  ,@l I,@ `,@ `,`,@b@ T *@ ` *`*@ `@*` "J  0 J" *@ `J  *@0 *@ `*` *@ ` *` `0?*`*@ `*` `0?*`㿘@@p& xmulawalawslinear_leulinearslinear_beslinearulinear_leulinear_beadpcm e ><(><"R ><"  K*>< ><Ȅ"  ="><Д " "2  "*"2">< "  """%">< >< " "2   "*""><"  2"""  <X|(<㿘 ` ` `"" > 8  >   >  `>=!T*` €     "        ? 8  2 &' $  $ $$ %s: timeout committing fspb %s: timeout committing cdf 㿐 a TH /d * %    *  @ ` H,,  a/ /  "  \>=!\ H p@0*,,  a/ /  ">=I H 0 & !\x H p@ T?`"` *@ ` *@*`"|T?ۄ"` *@ ` *`"|㿘>aꠔ 0 㿘@`ݘ >>#t*` €`2԰ `   T *(` 2ɰ  T*@`  T * T*@` ` 2 `   T *` 2  T *`   T `*  T*`  T *` `  `   ` 2 `   T *`   T `*  2  T *`   T `*  T *`  T *`q ` 2m ` 2i  T *`   T*`* _ ` 2[ `  ` . ` 2Q ` . ` . G`? (` D =. ` 2= ` @ 6. ` 23 ` @ ,. ` 2) ` @ ". ` 2 ` @ . ` 2 ` @ . ` 2  ` @ . F  xp8hhHInvalid kind! 㿘@`ؠ >?#@*` €``` ` T * T ` 9.`  T* T ` .`  T*@ T  *.` ` `   T * T ` .`   T*@ T   .`  T*@ T   .` ` `  ` `   T *@ T  {.` y  T*@ T   .`  T*@ T  j.` ` f` b  T*@ T 2 Z.` ` V`   .` M .`  .` ` DN ` >N ` 8N ` 2 N ` ,N ` &N  @  &`` `  .` .` ` &``    &`>>Zw#h 8Ph micvolumedaclinecdmonitoroutputmuteonoffrecordsourcespeakerheadphonesinputsoutputs G >A<( #  ? # $# # >? # @# < #  ? # $# # >? # 2# < #  ? # # $# >?#  !+  #  ? # # $# >?3  +  #  ? # # $# >?#  # # <>?# (3 ,+ . #  ? # # # $>? # H  ?# # $# #   ?# # # # $              ?# # # $# >?#  + # (>?3 ,>?+ .# @Ȅ # X# D #  ? # # # $>?В # 3 >?+ # <### ( 3 , + . #   ?# $# # >?ؔ # >?3 # (+ >?3 ,# @+ .c>?# D# X# # \# p>?# t# a+ x # ? # # $# >? # >?3 # (+  # ,>?# @# 0 # D>?# X+ H # \# `3 d # p3+ f # ?# # # $>?" ?# # # # $>@  ?# # # # $>?# #  # ?# # # $>?Є# 3 +   l4$ 0p㿘 =  @ $ ` $ $$`̐  %s: attempt to free rogue pointer 㿘 ̀   2 @ @ $@0 @ 2 >A!X   cs4231_trigger_output: already running cs4231_trigger_output: bad addr: %x 㿘 |  T>AX"=  ̐ & |& &  2& >AXl") & & Ѐ@& Ȳ&  "8"<  ?# @"D " * * ** * * *  vmmapbsyvm_map_lock: failed to get lockbwtwo㿘> `V` 25 ``@s 2. ` &``2 %  ?  2  2 @T[  E"`4 @" `4  ?倢  `@ &` bwtwo/p4model: %s, %d x %d (console) cgfourcgeightunknown%s: %s overlay plane 㿘>`<" $`$`$$`(` @     $`,0  @~U $`0 &`0 @~K &`$`0 &`   64>B />:02/>60> `+`,@@  `0>B2  EaP2   E @ E"  &a&`&`&a>B  H H  />>Ba`@lG0 &`4$&`8#&`&`$`@Rh ` /`>B` `!h$`WN$``>`,` * J  > @ ?  >  Ѐ  > @   $` `@} $`@  ">B>BW!x`,@@a  `@Rݐ`W !``0`,@@a   >B!>B!>B!>B!V` >  Ѐ `,@@ a @QJ 0@QG>? 0    (    㿘?2 > . "@@"@ 0 "@ 0@&D&H&L& P&T &@> &@T   㿘@K bwtwommap㿘?2 > b>. 0@>CT#`? T@>   @  * @  @ 㿘> `2  2  h@@"1@R <@6  6  㿘> `` ` h@@ <@R0`Њ@@ Ъ@@0 Њ@@ ?Ъ@@0  ` ` ` *`vmmapbsyvm_map_lock: failed to get lockcgtwo㿘` &`` ``@N  > `V` f> , 0@|?@ 8@ cgtwoattach: impossible bustype: %s, %d x %d (console) 㿘>" ` &`T&`4&`X&`\` >D >DTC! &`@`0 #$@P !&`D> b A"* &`H>D`<`8U!>`  > ">J   > @ 0 &`4&`8&`&`&` ` &`L``ܒ @| &`L0  $ @| &`  @@|#` &`>DUh!@Q5> >DUa!>  Ѐ  @Oƒ>? 0    ؇(    㿘?2 > ر. "@+@ "@F"@ 0O "@ "8 " "@: 0B@( 0>4&8&<&@& D&H1&4?&&4&8& <&@&D&H& &4&(&$4&L&H @@h `  &  `  *   (㼘@` ( B , @  @+  ` b@  @+  ` d@  @+  ``5 ` -  `%  㼘@`aC `  2< ` @ 23` " ), @ 2@ ` " @ 2@ ` $@ 2@ ` cgtwommap㿘?2 > b>. 0@>FR H`? H@>  ` ܑ*   ܐ vmmapbsyvm_map_lock: failed to get lockcgthreecgRDI㿘` `&``@A  >F@;!( "   > ,  & 48@  model: %s, %d x %d setting video ctrl (console) 㿘>#,` &``&`d` &`h&`@     6>F    &`L  &`L> ` >F>Fa@hx  !   >Fa@hl &`L`< $#@N>F!(@Ғ 2`D &``D `\N> b! * &`P>F`H!ȖSi&`T> `Ѐ > @  0  &`X  @y &`X @y `a )&` ` 2&0> #@  >F  p S6!> #A  @*    , 0`  0&`4 &`8&``&`$* " @  $ s$  $ $   >F>FR!@Nː`R"`q`0Ѐ@M]>? 0    (    㿘?2 > . "@+@ "@O"@ 0S "@ "9" "@B 0F@( 0B @& D& H& L&  P& T5& @?&& @& D&  H& L& P& T& & @&(&$ @&L&H!@ !!@ 6! @&  @&@   㿘@ ` @( 2  @ :`:(* * # #  cgthreemmap㿘?2 > c>. 0@>HP 0`#@? @#@?@  T@ >?`  @@ * @  @ vmmapbsyvm_map_lock: failed to get lockcgfour㿘``@: 2 `>` &` 2   ?"  @N&  @"` @ &` %s: ignoring; not a pfour : cgfour/p4, %d x %d 㿘>`0# $`$$`($``  $`, >H@@0>H!Q`0P   @x3$`0$`$# @L !$`` >H`$`Q"> ` > ">J   > @  ? @x &`0 &`4&`8&`&`"2 *`"""?">HQT"0@K>x? 0    x(    㿘?2 > x. "@+@ "@O"@ 0S "@ "9" "@B 0F@( 0B 4& 8& <& @&  D& H5& 4?&& 4& 8&  <& @& D& H& & 4&(&$ 4&L&H @ k! @ ! @p  @a&@a  cgfourmap㿘?2 > cx>. 0@>IO?!耦`'#@'>?@`<``8`&@{@@#@ #@ `H@ ?`ܲ@`'> @,@ @ 㿘@  㿘@L 0㿘 0@L@ :`:(*  *`* # # (# (# (# vmmapbsyvm_map_lock: failed to get lockcgsix㿘``@ * ` &`>!  ` `P> , 0@v?@& ?"  @Lj ` `@ &` cgsix/p4modelcgsix on mainbus? : %s, %d x %d, rev %d (console) 㿘>`<#̒ $`($`$$`` 0 $`,0 &`4 &`8 &`@vr&`&`   @vk&`  *@ve&a @v_ &a  `* >K *` €`,@@  >J >J > `2 >J    >J`@dy>JO 0| $`$`0$#@J ` c`!$`>J` `!O$`>`  `,@> `  `>J`  > @  ? 8 `>  Ѐ  > @ `>J@! :  OR6a@$ 2 *b$a h$"h">J>JO=!0>c  0 @u &`X@K`<O-!@`0  >  Ѐ `<@I**,*t*t*>? 0    (   㿘?2  >c. @: 㿐?2 > . @ b@""@"0 @ b@^b@ 0"@-b@"V   @";"$ b@@8  "@0 "@S  & D& H& L&  P& T& @?&& @& D&  H& L& P& T& & @&(&$ @&L&H@ !ʰ"$@ >! 2İ@ V! & "V! @8 2  6! !>"<` " 6! 6!6!6!6!6 !6 !$6"V! * ! 2(! 2   "@  w0v &r& V   "'" '@ߔ  2e  8^ "* 2 ` : V $m (m   G    6!  6!6!6! 6!@T &"@&" `&! 6!"6!V"!@*(.$*!@L !6! 66!@*6!  66 ?? "" " R 4 @ @"@" " R R?R#RR (??#(R!?28!!!  @ # @#@ `@ :`:(*  *`* $# # (# (# (#  @"@""` *"` *"` "@*"` " *"` "` R! !2!  cgsixmmap㿘?2 > c>. 0@>MK H>#` ">  @* `&@ T ` @ * @   @  *?vmmapbsyvm_map_lock: failed to get lockcgeight㿘``@ 2 2 `>` &` 2  ڒ ?"  @I  E"` @ &` %s: ignoring; not a pfour : cgeight/p4, %d x %d 㿘>`0 t $`$$`$`(`  $`, >M@@0>M"L`0Q   @s+ $`0$` $@G#!&`D&`H` >M`L"8> ` > ">J  > @  ?@s &`0`&`4`0&`8 &`&`"*#  " s" " ">MLK"P@F>`? 0    `(    㿘?2 > `. "@+@ "@O"@ 0S "@ "9" "@B 0F@( 0B 4& 8& <& @&  D& H5& 4?&& 4& 8&  <& @& D& H& & 4&(&$ 4&L&H @b! @! @  @&@  cgeightmap㿘?2 > ``>. 0@>NJ7"`c?#@?@<'>8u* @&@ o* @@ >@#@4@#@ ,@H@%@#@  @ >? , @ *  @ @?!@@&@ "  ܒ '>  ,@ @ 㿘@  㿘@G 0㿘 0@G@ :`:(* * # #  vmmapbsyvm_map_lock: failed to get locktcxSUNW,tcx㿘>O@ X`؀   ` &`` `?tcx: oopsTCX on bus 0x%x? tcx-24-bittcx-8-bit: %s, %d x %d, id %d, rev %d, sense %d (console) 㿘>`< $ $$ (`   $ $ , >OIN!( 0?"4"8"  a@ aX""p&a@&aX  @qE &a  @q>*&a  >O>OJ!80\>OaP@` 2 >Oa`@`  $ $#@E  Y $  ! >O>O$ `Jw!p> `Ѐ@ > @ a>O!2`22 Jb @ϐ$ 2  "*aah$"h">O>OJM! JI!  `0 Ѐ@`<@D>? 0    (   㿘?2  >`. @ 㿘?2 > . "@+@ "@Q"@ 0l "@ ";" "@C 0_@* 0[ @& D& H& L&  P& TN& @?&& @ & D&  H& L& P& T& & @&(&$ @&P&H4&L!@I!/!@x! )@0# T!& "T!@D  ! 4! ;"!@ "!h "h  !"@`"`@ :`:(*!  *`* # # (# (# (# R2h("h@(("( tcxmmap㿘?2 > `>. 0@>PGʐ#`*> Ȓ %>  @ *  &@  T`* @*`@ ` `*   `  *?vmmapbsyvm_map_lock: failed to get lockcgfourteen㿘`` &``@M   > `   warning: can't find all cgfourteen registers... cgfourteen with only one register set; can't find framebuffer: cgthree emulated at %dx%dx8bpp (console) 㿘>` !&`T&`X` &`\&`4 &`@`0$#@C `Pف`8> b! * &`D&`H8?#@48>QH!`@&88  @o*0 <    "0&k&k &k&k&k&k&k &k 4<>QF!>Q&`@!&`D#> `<&`Hk`8 @k`  @ "@ ``Ѐ > @ ">Q>QHQ"`HM"`Ѐ`0@B㿘>?a2  a`.  ` H >ᰘ `"ᰑH 0   @  㿘?2 > . @H >? "" H 0 `@  㿐?2 > . @ b@""@"0 4 b@^b@ 0"@-b@"W  @";  b@@8  "@v0 "@A  & 8& <& @&  D& H& && 4?& 8&  <& @& D& H& & 4&(&$ 4&L&H@\! @! 2@ @G&@( 6$6$6$6$6$6 $6 $$6"V$ * %x 2($ 2   %@  {0z &v& V   %'%'@=  2i  8b "* 2 ` : Z $f# (f  K    6$ 6$6$6$ 6$@J &%@k&%`*$ 6$"6$V" @ų*%x@ (<$8@: $6$ 66$@6$  66 㿘@z cgfourteenmmap㿘?2 > a>. 0@>SE8"`#@? @#@?@  Ht @ & : @ >?  ` ܑ*   ܐ *  * @ @ + `` A(+* +& A*+ + *a++@ # @ *  ` +  A  @   *+2  㿘@ @( ( e#  e  e ,`  @` * ` * ` *  ` 㿘@ @( ) d  d  d ,`  @  .` .`  .@.` ` *`+` "@ `R$耠+` *a$$+ 2a$$+ 0R$򀠠?38+%x$  @ " @#@ `%+ %+ vmmapbsyvm_map_lock: failed to get lock㿘@ @( ) dp  dj  dd ,`  @@ * ` * ` *  ` 㿘@ @( ) d<  d6  d0 ,`  @  .@ .`  .` ` vmmapbsyvm_map_lock: failed to get lockpnozzp9100㿘>U@Q `?cmsize: rev %x, %d x %d, depth %d (console) 㿘>` !&``&`d`  &`h&`@H0&`L &`P &`8@km &`D <@kg &`> `Ѐ@ > @ ,  &`X" ``X 2 `PH @kK &`X` &c <  ``"   ``"    &`L`<`L"X# @?|`0>U!a(@Yv&`P`\a`D&`T>U`H `D!0`LD `*`*``P.` ` *`*`*@`P ` @ϔ!@ "!>U>UDb!P`T  `XJ`*"*`T &`X @ @@DD!`Ѐ@@>>? 0    Ї(    㿘?2 > б. "@+@ "@O"@ 0S "@ "9" "@B 0F@( 0B @& D& H& L&  P& T5& @?&& @& D&  H& L& P& T& & @&(&$ @&L&H X! ! @+  @"&@   㿘@ 㿘 `a&#a8" ߔ  "a8@ 82  `*`ᄐ #cᄅ*#c *`#c  "@` !#c!#c"#c @(""`p9100mmap㿘?2 > a>. 0@>VA#0`?@ #>  쀢`  *  ?㿘!D > "a 0>!`   ԑ  ?! D@ -#>!2 23f#!0㿘 #%! D@"f! D@?2!㿘?# %#! D @"N! D@?2!㿘!H `  `1  " >  >' >#  `2 -! " -  `2 -!    - `2  ! "  !>! 2  %D # %"`㿘> `!!``D `l@ !?!D "` ! p@! D@ @" "㿘> `! !L  `` ``0 Z0A0>%s: lost carrier on UTP port, switching to AUI portAUI port, switching to UTP port %s: lost carrier 㿘> `2>X! ->W B!#!D@ ">X>WB#!H``2>X>XB >XB !H``>X>XA (>XA @0>X HA 㿘``@> " "` 8y@ sbuslebufferledma: expected 1 interrupt, got %d pri %dbusmaster-regvalif_le: Lance buffer crosses 16MB boundary㿘 >Xa @>X a`? @>X`?a@ 4`? ">X!A0>XA!&a@&a0  @h" &a  7>aaDa7>aaDa 4 a`@  2 `P 2   H&ahL>X&ap&al$Pa@VD %6ad    ah   ah @?* @ @* >X?Ɛ"&al&ap6ad&a& @&a '8>"t&aax xa &>"@p   <@    ` >"@X ` @$ T>#>>c>W>Wଔ x>W>XcP\&a(&a,>W&a0&a8>W>Wⴔ!xb`&a &a$&a<&a4&a&ax   # x  x7 #0# a   #w  % w   w x 0  % w x %&>` &aa ">V#&a@`&avmmapbsyvm_map_lock: failed to get lockUnknown3e/vmeonboardmultibus/vmeie㿘``@ 2 4 6  2  t ? 0n ?  㿘 H 4(@ѵ d4(@ Hh@?Ȅ2h@h@(2h@ Hh@2h@㿘 H d,њ , H ( ( H(ie_mapie kmem_allocunaligned dvmamalloc breaksie pmap_extractunknown : RAM CONFIG FAILED! pri %d address %s, type %s 㿐`L􀠠"s>Y>Z>Z>Z>Z>( `0Td>T h@&a4&a8&a<&a@  &aH&aD&`D0@f{ `D> ia8&`H!?hP > ̀"!>Z>Y p`D c͔ &`@>Z>O x> (  `D%>@2@ ,`@  @ "`D>Z>= &`<aD`@>  &a\ &aX > >Z>) "> j8 ᠒  @ ,?`@&aT`D@ " &a`&adKa$>Y>Y>#c|> 0 $@&a4&a8&a<&a@  &aD&`D&aH(H@f &`Hh@?4  @ * " `D@e &`<&`@hD?! 4hDa$* 4@ * 4gaD`@€`D`@`D$|# &aT&a\&a`&ad&aX?C 0URU@ `>Z?8 0J͊ >_">d>[?`|"$$$44$LJT!>Z TɐaH>b*@ ?  >["&`0&`4@_l`08 4 8>["&`0&`4N`08  >Yc@G ` @"$ %s: device timeout 㿘>[ah =  `@$ %s: parity error (ctrl 0x%x @ 0x%02x%04x) %s: receiver not ready 㿘!\!H` ` H(@""!\(D>[(D (F!> (Da4(D!\ ` @ @є `P``@``@` >[ >! `@w& !\ `` ` 㿘"8!\ X@`!h,` @ ; >T`?& -#T $ 2` ( @ 2 +    2 +` *`*2(2`2* 2 @ @* 2@  & 4  4  4  4 #T@ @ B&" *!h*2 3 !j  B #@+`3 +` 4 @Jietint: command still busy! %s: send aborted %s: no carrier %s: lost CTS %s: DMA underrun %s: too many collisions 㿘# bl {bH6 6 ~*    >\=  4   @& +& >\  >\   ؀ >\  而  >\  = `&  >\ =!  ` & & !L  "l "X* @&!Ll d` 2`@ ?"@& `& & @ L%s: receive descriptors out of sync at %d x!h.`)''2"<+  2?*` `X 2 "8@ &`@ u&"@`\ &*@@@>\,`@` 2*` @d ` H?bؐ ; @?"@`(* @ !@ !P""  t#!"0 t t" t t@ %耊`є !$@!$ @  @  @   @ 퀢   @   x "% %!$@!$ @  @  @   @ 퀢       x  %耊q  T 6q "p    @  @  @  @   @  @   " 2@%D  ؔ?    x "% %耊`2 !$@!$ @  @  @   @ 퀢      x   %   @ %  @u ??F& H /f * ' > !2 $H 0`)->  2`H /f * ' > p 2H p@  "@" $"2`" "`  ) $  0@!? L$  $ $ > "p'ܦ܀ >`ܑH /f * ' 1 H 0  4 H /f * '   5 H p@  $ $$ 4  z   $ `(7 H /f * ' > !ؐ1{ $ $1s $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8  (8$ @ ܀ 2 $ > "@ @ 8$   $ $  $&@`u@ܪ `U  ( `\D- @  2 *`  !""@  @!@&@ 1  !@@&@ @ @!@&@  2@ `2@*"@&*` ?c 2@ &`-  `  #& 䀢 !> f" "$"    t'''Co $" LO㿘 ?"D`\"@&+>\*@`@bؐ 9h @0  `2 * @2@@ǐ &*`@  2@  &%s: tbuf overflow 㿐 4`@%d 8Pd6 4` lt`XP*  2*` *@ B͕2* <# 2H*` 2 $* < "@ 'X  h I   $$$ ?$耤 = *  e ȃ   @  *  2  %(  >_":,2  @*+ *` 3  2`2`@ ?"@$$%d`h` dlt`XP*  2*` *@ BD2* <# 2H*` 2 $* < "@ ' +  ( ( +  3`+  3`+  3@( B#+ + 3`@ 0+  B#@+`3 +`\ 0@  $4~㿐H /e * & !T !D€!X !D€!\ !D€, <$@' ,  * *,@ B`$ , 2 , 4` < @"@ ' `,` `* `*!4@!8€ʨ d @ !\  @l `H p@  H 0 %s: reset %s: abort commands timed out %s: disable commands timed out 㿘H /e * &  >a9  X  L ;6 '  @` @& >a h8 ` @ >a 8 `6 @ H p@ "x!\`' 4 !!8@>aa >aX @* 4 {0@   %s: TDR command failed %s: transceiver problem %s: TDR detected an open %d clocks away %s: TDR detected a short %d clocks away %s: TDR returned unknown status 0x%x 㿘<%6`6`6@ B&@ *!\*2`@ 26`  23@@ 2`3@!\  ~ ``$@@>a"x`@>a"8E 0` ?>a@ "`>a@ "84 0>a# 8.ie: bogus buffer calc㿐!`# !d!D€`X!d 3@t#< &>b6 h!,!,&*@ `\"H&  !h&, "     X 6  , "    ?  X 6 ,  @*   B" *2 * 4` ,   X*`@ P  2 , "      \ 6  , "    ?  \ 6 ,  @*   B" *2 * 4` ,   \*` X  2 , "     \bd & blbh& b` & &  (  2` < $' `* `* `*    B \!j X" !\b<&bD?&*b8&*b@2&  3 B&"@ *`2 *`!h 2%s: multicast address setup command failed 㿘6@#6`<#! 6` T*` !@"p`** ** 2`@ 6` B &@ **2!\ 3  >c@ 2 >c 6  %s: configure command failed %s: individual address setup command failed 㿘!`< B#$ *`!\*`2  4`4"4 4 !P ,  ,  @,  ., ,  `, ,  , @ , , ,  ,  ϖ >c 2 B>c 6!0J!$ *`*`2  4`44 4 !@!$    >c >c 6y!0*!\   `J B!j " * @*!\2 6 3`  !\ ` !<`@ 㿘  r 㿘 H /e * &  a@" 4a @"  4C a2@>a1@ ; (!1 6 4 ` L LĒ0,@ #$!P 4 @ @2 4 4 ?6 4  @00@L LLؒ L`4@   H 0㿘!,  T&   +"p  4   @  "   "6 a L~  *@ *`@     &  2 &!Lvmmapbsyvm_map_lock: failed to get lockxdcxdxddummystrat㿘 <""> f>d4"b" H 0"& 0 0 & 0%s: %s %s: WARNING: no `pcyl' in disk label. %s: WARNING: guessing pcyl=%d (ncyl+acyl) 㿘`> f""""(`?*   *  `>d`b@ >d#5N`+ `6"@`4`>d5>#`>d`F#@`6 *2534``  64` F4` 3,` / ,`4`Ґ"$ (㿘``@l 2# 2   ` ?  .` ` Ѐ` "@` ? $  `     pri %dxdc malloc: couldn't read controller params : %s: : doesn't identify as a 753/7053 : Xylogics 753/7053, PROM=0x%x.%02x.%02x %s: controller config error: %s intrx  0@[S & &`T> L*` &`h>e!@4&`l `d"??`t  @o#&`x&`t@u#`t &`x&L   &`p>e3!H@e&L`` =  `t+ `p "@ ( `t  `4 *`t @ *``t`o * $`t .a6&`.a7.a8.a;.a:.a9&`&` 0#\#`    @ `2`t>e4V!X0Г,` S,,`* `p* @` " >e!>e@!4?>e4<!a9 ` .a9a9a6`.a6 `, `p" a6`a60>e ! 4a9 ` .a9{a9a6,`.a6 , * `p* @"`a6 2#`ha6#`#\    @ `2a9 ? `.a9Ra9,`@*``p@*`a6  .a6 , `p " a6`<a6 !>e!`@3̒0F>k#&`0&`4`0Cs>e`<-b  "@ 8 0 ?耦'?2 '`@2' @B 'a<  ``'@" @B >rbє>!X*@ `    xdattach%s at %s drive %d: off-line : ERROR 0x%02x (%s) drive %d: ready %s: write format parameters failed: %s %s: read drive parameters failed: %s %s: write drive parameters failed: %s %s: reading disk label failed: %s %s: <%s>, pcyl %d, hw_spt %d %s: %dMB, %d cyl, %d head, %d sec, %d bytes/sec %s: write real drive parameters failed: %s %s: reading bad144 failed: %s %s: warning: invalid bad144 sector! 㿐`0@Ԓ >"`&`&`X  6`6`&` X&` * "`2%`ȑH /d4`Ɛ* %`ƀ  !>f`ƒ #8  ;  `ƀ ``>f#H2Ò``Ȑ 6`#\#`   @X   ! !9? `.!9!9, @*` p@*`!6 .!6 +  p " !6``B!6`B`>f2#X6`!>f#p>f2#`Ȑ#\#`   @  2!9  ? `.!9А!9, @*` p@*`!6 .!6 +  p " !6``!6`!>f#`Ȑ#\#`   @  ,  t  2!9  ? `.!9!9, @*` p@*`!6 .!6 +  p " !6``!6`!>fz#Ȑ 6`6`6`.`.`Ր<#6`Ζ``  }2 2 ? `Ȑ#\#`   @  2!9  ? `.!9R!9, @*` p@*`!6 .!6 +  p " !6``;!6`!>f5#`Ȓ #` #\ @f  2!9  ? `.!9!9, @*` p@*`!6 .!6 +  p " !6``!6` !>g `@ S16`Ɛ`08.`%  `>g`И 1 @``V`ԒS &`̒"`>g`Օ: #\1n ``Ȑ#\#`   @  2!9  ? `.!9 !9, @*` p@*`!6 .!6 +  p " !6`` !6`!>gF `ή ``Ԡ`ՠ? `Ȓ #\#` @  2!9  ? `.!9 x!9, @*` p@*`!6 .!6 +  p " !6`` a!6` !>g @ 0O6`?#   2 " `̀@ ~`ԑ2  `Հ  ~  } ~>g 0ȒH 00)`"  @?  >d"@ ` @"$ @6`   `ƑH 0? 0 > 2 * " ` `` ( ("` ( ("`` `"`%s%c: crash dump not supported (yet) 㿘?2  > 6   * >i#P`0Ra 㿘? 2  @> 2@  ,`@  e`f@"N  m@"We e@3 0  h@3 0  n@"`g@O 00 e@t 0}| H /d4 * %  Y"H 0e  M!_  & *`` &!  @ M ƀ I G4 E  "  Đ 4 ?# @4 Ā2 3  @˔ , ƀ ,` 4 ?`4# @ `*  *  >k ax @$   @ $  !2 @ɔ㿀?2  > 6  6M ✑*@"G ƀ  Ȣ'  @B" ?'p@`"ƀ  )  `6! . @ ` "   *@$ *@$  $㿘>k>\!x"h ;㿘>k>\!x"h / 㿘?2  @>" 2 60?"*@    *@2   r " ?,` `?( Γ2` 2  Z ?㿀 D? @2 > `@"2` "*@   T &   (@ <  u& 4ƀ  Ȣ'  @" ?'@"ƀ  "  < D  " < O& 4 O @ $H ` > ` .` 0t.` 0r 02 .`  k.`  `Ր?.``.` .`  `А?6`   `Ԑ?.` 0Y 02 .`  k.` .` .`  .`  .` "6` .` .`0B` .`  ``0   k` `  .` &6`   2 6` .` ` .`  (@ː.`  @( @ô.`  @ Դ6`  (@`  &` $@`*   = .`xdnfreexdsubwaitxdcmd nfree㿘` \ 02r !6 = @  2g !6 1 `!6  ` 2!9!>l!6 #h  2Q !6 !6!9 (!6!>l!9 #p  2? !9 !9!6  `א ` ` >l+#.!6 ` J , *  p* @@. X     #`#` #`$#`(#`#` #`#`,#`#`#`#`0@xdc_startbuf freexdc_startbuf bp%s: warning: out of DVMA space 㿘!6 2?>m+U!x.!6 J@  ,`*  p* @@ 2$>m+?!("(& (?"D X 2`  2 * D T`*    H @W< 2#<>m ,!!6,`.!6 , *  p* @"`!6  |!6 |&$($&(( "@%"(&:   $ $ $$ $ $ ($ $ $ $ $ $ ,$ 00@   &l`0@  xdc_submit_iorq addingxdc_submit_iorq wrap upxdc_submit_iorq㿘.` T*  p * `)P2!;[ !* !; @G !8.!;`  .!805>m0?>m0   `@; *# * T2 *` T2 * T2 *` T =*  T * !7  .!70>n0P>n W  `@  @ *Y 㿘!8 @ T B B  a ?  B   `  ? @Ҙ ? ``?  @Ø 2!8- @ʐ!7 8!8" @{ !8 !7 .`*  p* @`!6 "    "!6%s: off-line: %s xdc_resetx t   t@2  t @@  *@ t =  `ː ` * x T*  T2`* T2`*  T2`* T*  T*`   T ? $  t T `  t @ "% T `!>n#`@ܢ + T *`  T ` "@q ?  T ` 4 t>n)#x *`  tU %s: soft reset %s: diag: xdc_reset miscount (%d should be %d)! %s: diag: lots of done jobs (%d) RESET DONE 㿘!6` >o! *Ւ  T *`  T ` "@' ` T `` ? V   p` ``0` `2j !7?.!7"V!:&` t/   + 2`*`  +  p  `` 8`0`"`0G "2!9C  "`4`00("0`$`0*` " @`0`,<@!H p@`0`@ 0<"@ -`0!6 `.!6 `*  p" !6`2 !6 !9 .!9` `@ &` ?  .!:!*@ !8 .!8   4@+ `2 !8!6 "!8!6!8!7!6 !9  ` >o!0 *%  >o >o!h* >o*!xdc_start㿘`)!8 % T ` #>p!:!J@ @$ !8.!:.!8 P "(|` !8  T `"!:%s: fatal error 0x%02x: %s %s: soft reset failed! xdc_remove_iorq: controller DEAD㿘 T ` @ ` !>p !x@}) ?ݘ >p!)>p(8! `  *`     p  Đ @-  t @ !7?.!7 2  ` `$ $  @ "   "    @  N2M  H  $  (`"$ $ ($ <$ $,`$ $  @ ,@ @ @*` `  ,@ &$ 4`  @ 4`   @  @h ,`  ` a >"@,`  (@$`!: ?  `.!:!*@!8.!8 J   ` "6 ?`0`> 6 ?:   0`0 ($`4$`0 $*` $`@$`@ ,`H@`<`< `@ 0B" !6 `.!6 `*  p" !6`W!6  @$ !9`L.!9  @$ !9`.!9 4 5`4 %s%c: %s %d/%d/%d: readwrite [still trying, new error=%s] [recovered in %d tries] 㿘 >q `!`  (  0  D>q `!(`a@  @  @>q  a>q!>q!`  ` ` (@@(a !>q @7!({ >q  2>q>q (q">q(n" 㿘` ``?` ?`@&`!9 .!9`?}&`!9?.!9? X` V `$ + ` `("  @ &`$&` &`(``   @ զ@@W Ԡ@S@j?- ` &`  `.2 *  `@.2  .6```̐ ?6 ` Ԡ" @e. `@& . !: 0?. `  `` 7 `&`@2( ``4$ `&` .2`*`  .2  .&`!: ? .!: !* !8`.!8  %s: diag: IOPB miscount (got w/f/r/d %d/%d/%d/%d, wanted %d) FREE: %d WAIT: MARK: running %d: mode %d done %d errs %d errno 0x%x ttl %d buf %p %s: watchdog timeout 0  H /d4 * % !8!7!!6 !9 є H 0@ Zؒ #\>r 'd"@7 >r']"H`!<7>?)>r  'R"P - ?>r'I"X`)>r  @'A"P @- @_ ? >q'5"   %>r  2  t,  @@ @2 p   3 #\0`#`'  `40 !<7>>o!h'  H /d * %    p `  @" ?` ?"`  p@ ` " ?4` >r &" ?  H 0X* L@ 㿈 ` {'>t"(*` €     Q Ұ  Α* R  ǰ     `ְ 6?`!?>t!*` € ` @ `Հ   * @ %6   @ `Հ 2   0  @ `Հ y  2s   @ ``   @,0X `H /d * % `Ȑ #`#\`,`0 *  p* @ `. p . !9? `,!9j!9 !6 `,!6 `*  p"  !6`2[!6   H 0 @~ԔHϔϔHHtSoftware fatal errorSuccessful completionIllegal cylinder addressIllegal head addressIllgal sector addressCount zeroUnimplemented commandIllegal field length 1Illegal field length 2Illegal field length 3Illegal field length 4Illegal field length 5Illegal field length 6Illegal field length 7Illegal scatter/gather lengthNot enough sectors per trackNext IOPB address alignment errorScatter/gather address alignment errorScatter/gather with auto-ECCSoft ECC correctedECC ignoredAuto-seek retry recoveredSoft retry recoveredHard data ECCHeader not foundDrive not readyOperation timeoutVMEDMA timeoutDisk sequencer errorHeader ECC errorRead verifyFatail VMEDMA errorVMEbus errorDrive faultedHeader error/cylinerHeader error/headDrive not on-cylinderSeek errorIllegal sector sizeSoft ECCWrite-protect errorIRAM self test failureMaintenance test 3 failure (DSKCEL RAM)Maintenance test 4 failure (header shift reg)Maintenance test 5 failure (VMEDMA regs)Maintenance test 6 failure (REGCEL chip)Maintenance test 7 failure (buffer parity)Maintenance test 8 failure (disk FIFO)IOPB checksum miscompareIOPB DMA fatalIOPB address alignment errorFirmware errorIllegal maintenance mode test numberACFAIL assertedUnknown error >v* >t"P>t"h>t">t">t">t">t">t">t#>t#(>t#@>t#X>t#p>t|#>ty#>tv#>ts#>up >um 0>uj P>ug h>ud x>ua >u^ >u[ >uX >uU >uR!>uO!>uL!(>uI!@>uF!P>uC!h>u@!x>u=!>u:!>u7!>u4!>u1!>u.!>u+">u(" >u%"8>u""`>u">u">u">u# >u#H>u#h>u #x>u #>u#>u#>u#ژژژژژژژژژژژژژژژ(4@LXdp|؈ؔؠجظژژژژژژژژژژژژژژژ ژژژژژژژژژژژژ$0<HT`ژژlxلِژژژژژژژژژژژژژژژژژژژژٜ٨ٴژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژژ ,8DژژژژژژژP\htژڀڌژژژژژژژژ㿘\ `& & 0& & & & & $& (& & & & ,vmmapbsyvm_map_lock: failed to get lockxycxyxydummystrat㿘 <""> f>w #0b" H 0"& 0 0 & 0%s: %s %s: WARNING: no `pcyl' in disk label. %s: WARNING: guessing pcyl=%d (ncyl+acyl) 㿘`> f""""(`?*   *  `>w`c@@}˘ >w#".`+ `6"@`4`>w"#`>w`F#`6 *2"4``  64` F4` 3,` / ,`4`֐"$ (㿘``@L 2 2    ? А@b@ @   pri %d%s: can't alloc IOPB mem in 64K xyc malloc: %s: : doesn't identify as a 450/451 : Xylogics 450/451 [OLS disabled] %s: error: %s %s: 24 bit addressing turned off please set hardware jumpers JM1-JM2=in, JM3-JM4=out to enable 24 bit mode and this driver intrp  0@H% & &`T> L*` &``>x!!&`d&` `\"??  H@z? #?ܒ H @  'ؒ  @z0 H H@zTؐ H  @>x!!V`0@) H&`p&`l  ݪ  &`h>x̐!@ `   +  `l `h@ " `l`4  * `l @  *@ `l  * `l@ ` *``l  @*`l@ `  *`ڑ+ `h&`|`l`h 0&`t&`x 0 #\#`   @Q `x `2  `t " ]`t !>x!@ k >x !0m>x !``">x>x ߐ">x ܐ" " `T!>x"(`@ O В0S ` >~>x` ǐ"8>x Đ"`>x "0D ,&`0&`4`00i>x`< #b " @yz 8''쀦'?2 '`@2' @/ '`  ``'@y" @/ >aHȔ>!X*@ `    xyattach%s at %s drive %d: off-line : ERROR 0x%02x (%s) drive %d: ready %s: reading disk label failed: %s (drive type %d) %s: <%s>, pcyl %d %s: %dMB, %d cyl, %d head, %d sec, %d bytes/sec %s: %s and %s must be the same size! xy drive size mismatch%s: write drive size failed: %s %s: reading bad144 failed: %s %s: warning: invalid bad144 sector! 㿐`0@ؒ >#`&`&`X  a&a6`6`&`&a&a* *  h * @&` X&` * "`$ H /d4`Ɛ* %`ƀ  !>y`ƒ #X 3 :`ƀ ``>y#h``Ƞ 6`#\#`   @   t "   t``>y#x76`"!>y#8>y#<#adaf6`6`6`6`.`.`ِ  }2 2 ? &`̐ &``̀  `#` #\ @  2` t "  t`2`̀` !>y#`@ ]6``>yW#`0 .`  `>z`Ԧ F ```ؒ &`ؒ"`>z`ٕ: #\ 2>z + @`Ԁ``ـ" `̀@2  ـ PԀ@P ؀ P `>z x  ݑ+  ݐ,`2?֒Ԓ`Ș@#\#`  @@  t " P t`!>z) `Ҭ ``٠`ؠ? `Ȕ #\#`@   t"` t(`` !>z @ 8O6`?#   2 " `Ѐ@ ~`ؑ2  `ـ  ~  } ~>z H 00)a\ؔ"  @-|  >w#(@ǒ ` @"$ @y6`  ɐ`ƑH 0? 0 > 2 * " ` `` ( ("` ( ("`` `"`%s%c: crash dump not supported (yet) 㿘?2  > 6   * >| 8`a 㿘? 2  @> 2@  ,`@  e`f@"N  m@"We e@3 0  h@3 0  n@"`g@O 00 e@t 0}| H /d4 * % !\"H 0e  !_  & *`` &!  @y M ƀ I G4 E  "  Đ 4 ?# @4 Ā2 3  @y , ƀ ,` 4 ?`4# @ `*  *  >} b` @y$   @ $  !2 @㿀?2  > 6  6M *@"G ƀ  Ȣ'  @v" ?'2@v&"ƀ  )  `6! . @ ` "   *@$ *@$  $㿘>}>\"`"h 㿘>}>\"`"h  㿘?2  @>" 2 60?"*@    *@2   r " ?,` `?( 2` 2  Y ?㿀 D? @2 > `@"2` "*@   T &   (@ <  K& 4ƀ  Ȣ'  @uK" ?'u@ui"ƀ  "  < D  " < %& 4 % @x $ ~    ` *  "@>~"($  . X   $ $ $ $ $$ ($ $ ,$ $ $ $ N$ 0@~ xyc_startbuf null buf%s: warning: out of DVMA space 㿘`܀>~#HD T`*    H @t< 2<>~ F#`! &:   $ $ $$ $ $ $ ($ $ $ $ $ ,$ 00@   ?`0 xyc_submit_iorq: stuck xyc%s: stole controller xyc_submit_iorq addingxyc_submit_iorq: xyc_chain failed!xyc_submit_iorq wrap upxyc_submit_iorq㿘 T  ,P d "@0K>0 >0[ @ `P` А  b@ >>Z  ϒ S @= 2  T#P"3 >E @* T2 *` T2 * T2 *@ T * "@0>0P>  @ ` `@d!㿘 @` ` hx 0 ` l 3`"h`"  |& @ ` *`>@ @ُ & |  ?, *@ h*`  !  l*  ,` "@ `  *" @@ ` *2    ` @^ Ѡ` @㿘@ `4  TBXa     ? @ '   ?  @ 2@ @;@ ` 2@@@ `" T`@ %s: off-line: %s xyc_reset㿀 x 8  x @ *  2`  *   `*` ߐ * x ` *` x   * x`   `@* x T *` T2 * T2 *` T2 * T*`  T ? $ x T ` $ x x `" T x!> ` @!P T b@ 2 x> !h *` xՔ %s: soft reset 㿘` ># q  T b@  ? }     h` ``0` `2J4"E4&` l  *  2`  *` `` -`0`"`0-4"'`)4 "`4`00("0`$`0*` " @`0`,<@rH`0` $"a h0@ 0<X"@ `0&`v` ? @&`4`? 4@ 㿘`  X, @" "   `2    ,  P%s: DOUBLE ERROR! %s: soft reset failed! xyc_remove_iorq: controller DEAD㿘 T `  >! ? E >!>;! ` @ @*` `  *`  ``  @" @  "   2`  $`$` @ " ` " `` @ `B2A` < `$` `(`"$` $`($`0$`$, $`$`  ,    `*`  , `&$`4 ` @Ы` 4 ` @Ц` `@i , ` ` a >"@, `(2 `4 4 9 ` ` "+ ?`0`- ( ?)  `0 0 ($ 4$ 0`$*` $ @$ @`, H@q <` $"a` < 0 @L" $`ː   @$`g  @$`  - @`2V` %s%c: %s %d/%d/%d: readwrite [still trying, new error=%s] [recovered in %d tries]㿘 > `!H`  ʐ  0  D> `!P`a`  `  `>  aX>!h>!p` ``@aH !> @!x >x  2>x> !>x" 㿘`@_``` ?`@&`` ?&` R` P  `$ + ` `("  @ &`$&` &`(`` !\ @ϸ ٦@ϳ@w ؠ@s@u?' ` &`  `. 2  `@. .6 ```А ?6` ؠ" @φ.`@G .0'`  ``` A ``&``@ `` `&` .2 `@ . .&`%s: watchdog timeout 㿘 H /d * %     h `  @" ` ?"`  h@ ` " 4  > Ȑ!0 ? K H 0>!X*.@ 㿈  ' 6  0{&  v r  j  0d b  ^*  Z  T   @oC `   @o^0= H /d * % Ȑ #`#\ 2 t   . t . t"  t  H 0@o!Software fatal errorDOUBLE ERRORSuccessful completionInterrupt pendingBusy conflictOperation timeoutHeader not foundHard ECC errorIllegal cylinder addressIllegal sector addressLast sector too smallSlave ACK error (non-existent memory)Cylinder and head/header errorAuto-seek retry successfulWrite-protect errorUnimplemented commandDrive not readySector count zeroDrive faultedIllegal sector sizeSelf test ASelf test BSelf test CSoft ECC errorSoft ECC error recoveredIllegal headDisk sequencer errorSeek errorUnknown error [>x* >U p>R >O >L >I >F >C >@!>=!>:!8>7!P>4!h>1!>.!>+!>(!>%">"">"(>"8>"P>"`>"p>"> "> ">">">"0<hHT`lxhhhhhhh h,8DPhhh\hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh$ "F   "A   "< 4: @ 4 5   &/ . ", 04* " 0%"$ @ ! " `    " ` %   "  @ $   @ 0 㿘\ `& & 0& & & & & $& (& & & & ,vmmapbsyvm_map_lock: failed to get locksisw㿘``@ 2E > `2@  ?2 &   24 >@b 2- > `2 & >@b 2 > `2    ?2` >@̒b 2    ~(?   si_attach: impossible bus type 0x%xsi: dma handle malloc failed pri %d %s: options=%b RESELECTDMA_INTRDMAsi: Set TheSoftC=%p TheRegs=%p 㿘` `   2>>#$# &e   (@9ɐ ,>>>>>>>c@#,|"ؚ`L  6`6&`L&`D6`:&`\&``&`d&`h&`l&`p&`t&`x&`|&`&`&`&`P&`X``'>>>>e!b&`&`&`&`>>!a&`&`>>>>>#D aDh&`&`&`&`&`&`b#`e &` &`e  ` &` &`&et!@&e $  &e>F#`0  e" &et> l&e&ex&e|  "    @3ex  ex"O  !@&e >#e>>#`>#`>#># `>@ @6`>ww8!4 >@ > ?  `@2 @!b >b  @!Y si_minphys len = 0x%x. 㿘 #`>D#@p& <Ԗsi_intr: DMA conflict si_intr: DMA bus error si_intr: spurious from SBC 㿘% %t  `` ">   >@  8` #  & ! # v֐  > P>c @psi_reset_adapter 㿘>#`%t>!H%``2" t 4 8 4 4 4 4 4 4 4 %4 4  t $ &$ $  $    $  t si_dma_alloc: already have DMA handlesi_dma_alloc: misaligned. si_dma_alloc: xlen=0x%xsi: no free DMA handles.si_dma_alloc: can't remap %p/0x%x, doing PIO 㿘  >"(% ? `  >x"P034%>"p   @  `>" &  $ $ $ /@   &   @j  $  > H"&$ si_dma_free: no DMA handlesi_dma_free: free while in progress㿘 ` 2 >  "> ( " $`   @j $$ $` %s: DMA timeout (while polling) si_dma_poll: done, csr=0x%x 㿘  '%t0#cP+>T d% `` c>  `$c > ڒ㿘@%t  4 %t? 0%t?`#2``#2``2`` 2`2`2` 2` 2`2` 2`si_dma_start: bad pa=0x%lxsi_dma_start: dh=%p, pa=0x%lx, xlen=%d si_dma_start: Fifo_count=0x%x, xlen=0x%x si_dma_start: started, flags=0x%x 㿘 `  %t>"X> # `&%>"xm ? @4   4 `    4   4 4 ?#ߒ @4 44 4 <`4 4 4 4  "  ><"@n   d*@ t \ *@ `  * l d * t \ @* `  * t*@  4  #` & >"Ёsi_dma_stop: dma not running si: DMA error, csr=0x%x, reset si_dma_stop: resid=0x%x ntrans=0x%x si: fifo count: 0x%x si_dma_stop: excess transfersi_dma_stop: ntrans=0x%x si: Got Left-over bytes! 㿘   %t>̐ 0 ?& `?# @4``" `>! ", `&  o``%  & '> ">! 4  >!H `O& $ >!`"@& & >!~ :` 5> r!`` `'?`  @0`? 2 ,?`,?` 2 ,?`?c 2 ,?`,?`?# @2`,?4`4` 4` 4`4` 4` ` `* \*㿘@ %t  $ %t %t   si_dma_start: adjusted up %d bytes %s: bad outgoing adj, %d != %d %s: bad incoming adj, %d != %d 㿘 `  %t>"X ~> # `&%>"x     ?%   c  > Ӓ <$ % $% `` d* r > Ȗ  t  @ \* `  * l d *@` rْ >   t \ *@ `  * t*@  %  c` & >"Ёsw: DMA error, csr=0x%x, reset sw: short transfer 㿘   ` `%t>i 0 &   ?$  @ "  >Z#@ ", `f&  W)>#  $@ >!D4  >>#0 `C& $ > !`"& &  5 `   ">)c&> ?2 + 2+` > @ 2`+` " >2`+ 2 +`` " >2 +`"c "c$ $  ` * \*@# >! vmmapbsyvm_map_lock: failed to get lockPolled Mailbox Command (0x%x) Timeoutisp_mboxcmdInterrupting Mailbox Command (0x%x) Timeout%s index %d=> %s %02x%s:0x%08x:%sPTI,ptispptispSUNW,ispQLGC,isp㿘`` @ >@"H >@"X >@ސ"` >@ؐ"p ` `2  > ,  & 48@  : expected 1 interrupt, got %d clock-frequencyispPTI,isp㿘4` > U#X0> Q#x>&b0&b4&b8&b< &b@&bD&bH&bL&bP &bT$&bX(&b\ 2&b(80 @3Ɣ &b(>&b, @"c ! А@{b@6b^8 *> <@%> @@ >>#@[ " >"p@T " >#@M "  >"X@F 2> >@>"H >@8"X 2`&bX`@b4aP &`&`.` &`@ƭ >b  "$b0&b6bb6bdb6bf6b`6bh@-(&b `?? 0 &`c` @ &`&`H /d * % `  &`&`H 0 ``a&`a2   "``?`Z&``&`H 0 0P  `ؐ` 0`   ga2   `7`?`1&``&`H 0 0' >#  @V Ja2   `` @G `?` &``&`H 0 ISR 0x%x SEMA 0x%x㿘"(>V"`8      ` `   `26@  6@ 6"(V"b 6 2` "`P `"(  2` "`P `"( 0 %s: cannot allocate request queue %s: could not mapin request queue %s: cannot allocate result queue %s: could not mapin result queue 㿘!D 2E   * ' &!8@Ś  *  @Ő&"l!   &!<> #!0@dl &!D> !X!   &!@>  !@dV &!H > !  %s: kdma handle already allocated %s: Request Queue Overflow++ 㿘`$``  h6>   @d'` 2&`,q e` "l?* `"`>" ڒ  /  !< `2* @ 6>  A# ` ` @d`$ &`,G f "l?* "`h   @ 6   @6&$@&  , ,`$$ $  2 2 ,  ,, , `$ &$& 6 2 "  .... 2  g .. %s: kdma handle not already allocated 㿘`(>!H`$`(` " .2 "l?@2"@>!` T > ` `$@dp` 㿐!B :,`!0 俘 9@` ` !`" H 0` 2 4`*@.@@ ``$#$@  `0H 0 #H 00 4`ԓ.$@㿘H /e`* &` `0 @ H 0   0 H 0  H 0 > g"stdin-pathconsinit: increase buffer size and recompile consinit: bogus stdin path %s. keyboarddevice_typeserialstdout-pathconsinit: bogus stdout path %s. displayunknown console input source %d; using rom unknown console output sink %d; using rom > g"> >"( > >a""\%%%l%` (`L`@'?>aР € ?`> b!.'>x  @ " >`@ >>" J'> b0€ >  b@@>@NJbP Ox?'>5> f '>5> f`J@ 2`J@ :J` ` z$?@ӤX € > !Jx  @ " >@ >>"h0ݤ"@@А>@Cb > " $ @Đ>@7bP ?Ox `J@ 2`J@ :?J` ` z$?5> f`HJ@J >  >     +  `@`>"aؐ"` ``>>    * 0>> a>%&  " ">ba%& 㿘#>`> g`#"$ I $ I ($ I HD> >!8ax몔> `" $`@>@"`>"`$` p  $"% h`" h% < #c %˘ ( $ $ $ $  $ p@B5>> `4 4 h>a* @€㿘!> g" h>!*`   €3㿘> g" h>a*`@ 㿘>   p ( (" h> g" h>a* ` @ 㿘  b@> g1>     3 2 &  > g" h>!*`  @ 6 7&  㿘6  * :㿘6  . >* "bD*  $@ @  ( €. 㿐 H /e4 p* & p!  H 00;> "(`$`T`` H   H͐ HHo o /@ 0@ H 0 H  p  ?& p㷐 HH 0㿘> f" € 㿘H /%4 p*& p H 00)V  H   & pㄐ He  H   p  & pH 0!@(0> !8ꀒ H 0H( p" pH  㿘H /e4 p* & p   ?& pH 0 0 h ?& pH p@  P H H?  @  *@`> "( `    `€H h` >! *` €0V㿐>`  > "( `      0  X  &  㿘H /i * * >?"H 0  ,> g"` c">@@ ># J `@   ?# J `@  ?> `h!*`   € 㿐> "(` Ho o b(    b(H 0% H/` /1>  b(>"`$ *b(`P `>"`$*H 0 " 㿐  Ho o> "( ` /   0 T@H 0㿘> f"0  $@ (%s: /dev/fb already full %s: forcefully replacing %s %s: replacing %s %s: attached to /dev/fb 㿘> f",`!> f"0 20 ($b, , "0 "   ( (>"x`x > f$b,$"0,"b(` " > f ( (>"`f> f "b(> fb(  "0 ""b( (>"XU`0"0 " $"0 ( (>"`I$"0"0>("B`㿘> f"0``$` 㿘> f"0`$㿘> f"0`$ @㿘> f"0`$ ?widthheightlinebytesfb_setsize: inappropriate bustype㿐```s>>> `k`& &  (\ `2Y > @ , 4 0`"N @'2  E"G 2  E"A 2  E2  `"6 2  `/>#*` €$!##$%$"!" J "$   $   %  #&@%& & %& &  Y & : & >a@`& >a@Z& >! C &@M:& >! VVdVpVxVVJ   J* (J А 㿘   @8 screen-#columnsscreen-#rows㿘  4$` $`   & 4$` $` 4Ԓc 4>>""$`\`\@@t$` @p`>` $`> 􀢠 P P 2` 8 $` " Q 2` 8 $`  !> j>#$@Ē`( P` 8 #$>`8@$` "` 8 $`  " $`$` @`$ ">$`$$` > $`@pe>#>"bt> f0 H> f0 L@#``#dd"@@d`?"@0 d0E Ed0# 02   0`#dd2 #>    "! mouse input parity or framing error (0x%x) ms_rint㿘#> b   > c@ ?4b? 2   4b4b * : `1*`>" €8  8  , 4 . : @ $ 4 . : @ $ 4 . :  4 $  . : ?4$ >#p   8*L @L ) >>#> "c0`  ?"FI*`@ `@ 3# `#  #   8     "   ?"!#3 > #  #   #   8  $     ?"#3 > #   #  #   $  $, $ L 4 "L 5, 4 L 5  0 ^\\$\<\\\|\㿘> " 0`  $ 0> `2  $"`"`  @  $ 㿘!> " $   @ $ 0㿘> " - ~@-  @}@" "  v@ @ 0> @ *" >   @  "  㿘> "> j keyboard-click?true㿘> > j`$ $ $ > jc$>@ے` >@L`Ѐ  , ,kbdattachkbd: reset failed kbd: type = %d, layout = 0x%x 㿘'>X @:> "b @5> j``> ">b>  %"`T@ 0 & >C!@@X>8! >!P@> 2!h 1Unknown keyboard type %d 㿘 2 >>>>Ȑ#HcȔH& & & & &. 6   " N   >" >" 2.  N   @g . h `. kbd_translate`2  - >T(*`*`2`*` *` *` *`*`?<2`R`"@`"`J`"J`` }?`"`2 `u?& '>Ȁ? 2  ? 2  耠 ?*``F?> !H    2    2`! ? !H  2 "2` 2  2 `2` d ccdccddddddd㿘H /e4 X* & X   T  `,;>  \H 0keyboard input parity or framing error (0x%x) keyboard event queue overflow 㿘>  T#> j`}` X $ X$ \>T#    0   , 0, 1    .  ̟@\ܡ0U?, 2 ܚ, 00N 8 J, 0  ʒ  A``>+ > $ X$ T㒐 \032 8 P*@ ? 4" 6 >cP 0 `3@ `# >   #  #  <$ 8=L L "L M, LS 4L M  HJ (0 > *`05 ~1 (0, ' #     * 0       * 2 * 01#-!)!%!!#! $$$ $$$"# * 2 㿘> j H`; "H @ H /e* &`$  - ̟@>!X>`8!١  #" H 0 > j 8 " H㿘!> j  4&   2& H @ & H 㿘> j 8 -㿘 ~> j@ R  c @" 1 Z#@Րc@A 0 Z#@" 1c@ 0Ր}@ư 0  v@" H #@ "s8# #@ 0@m 00#@" # @ 00# @8 0  -  & v - . "> 0  0 "  0> "#H> H>#?c 6 t.@ "> 0  0i "  0d> "#H> H># @ U6@] Q  M$  2 I& ", 3 H /e4 H* & H x  > >   ئ H 0 ,v 6  ., 3: ,n &  @ 3 . @ , Ma @ 㿘> j 8㿘> j `  F " `1 4?  `0" `17     *`, "/ *`,+ `H /e4 H* & H x  > >   5 H 0,   ̟@ fpu_cleanup 1 fpu ieee trap, but no exceptionfpu_cleanup 2fpu sequence errorfpu hardware error (%s[%d]) %s[%d]: fpu hardware error fsr=0x%x fpu errorbogus fpu queuefpu_cleanup 3 `!$: ``> >!X*` €>p"8:`2>>"H"> "' q(`` % >ݐ"h>ڐ"x!  4> b 4>"Ғ' ? RN&`>"9 >" @B'>>"bȑ,``@2`>2` ??̀ >"'@5 " `  >0>0 ?*  '  `'   `#``@Ǒ,`&`sHs\ssss㿈@>6` !pJ6``86`  ` ?`< @ & 4& >!8, €, @,@  ,@ * - %@  %` @A@ @9 ,@4 @. ,@) 0`& 0@i @ ,@@3\ @ ,@ @O @ ,@@P   @ ,@@B   `  p. %`W "S%``O  @Ӕ@Β ,@`6` 6` 6`  @ @ ` >  @ >"J p. @ %` *`@%`- `%@ * ` %@ * %@ *`%@  uvvwwwwwwwv<wwwwwv`vvww8wpwwwwwwwwwwwwwwwwwwwwwwwwwwwx0x<xHx0fpu_add㿘  ,@,``2   @@t ` 2    z&   v&  r "L   L$`$` 6  $`  @" $`  $`  @2    $`  @$`   $`  B #@$` @``9$`?  @    @  b #   `?$`$@  @>` `" "$`@ @ @ b@ #$`$`$`$`@` ` `,`,` #`< 2"7 2 - ) &`` b`     `   `( #`㿘  `,, `,@80`2  @@   $ ,  " 2  " "        @`    " $     ?" $  @ @@`&1  @1  $  @ @@`&1  @1  $  @ @@`&1  @1  $  @ @@`&1  @1     $ $ 㿘`   &  & & & @&  㿘?.@6`2 `*  ?  & & & & @x&  `2  2&  & & &  ?& & & & &  㿘?.@*626`@.g<  & & & & @G&  g 2&  & & &  ?|& & & & &  㿘?#@#6*@6/ 6`..7 @ ?#  & & & & & @  @ ?2&  & & &  ? @ & & & & &  fpu_explode㿘.2`&`&` >0 >0:Hp  ϐ#@2 &@` 2&@  &`& ?&@㿘````) `+` (`1 36`@20```0+"`"` "  ` `'`  '``2'` @ @@'`'`'`'` '`'`'`'`  0    `?㿘@ ` "`` 4` r"@@ "`` $``  2 0`1 ? #$`fpu_ftos㿘@`* @ǒ [N E2`M`4 Y Z"@@V  `@2 9   @& `,@`@2>"h4 @`@"` ` & q "11 #`,`1?*@㿘@`* @h >M'@2`&J  ="@@S  `@2 @ 5&  @& ! @8 <ؒ `@"' ` &  ?1@&1 & 4@`, &`1?@*㿘@`*  @Qc@2`&<#@  "@@ @`@2 %@   @& $ y `@" # ` &  1@&& &?1 &4@& &`?&`, &`& `@ fpu_implode㿘 >>& &&u&#㿘   ,@ ,    2 @   " 2  $          `   *`2` (`) 30` @ 1 @@A*`   *`2` (`) 30` @ 1 @@A*`    *`2` (`) 30` @ 1 @@A*` *`2` (`) 30` @ 1 @@A(*`#*`2` (`) 30` @ 1 `$ $ $ $ $ $ $ 㿘 `   `@]       B : "! 1 B  (" @ B 0!    b`    B @ b`(  @@ B 0@!    b`  ` B  b`(  @ B 0!    b B `&    b`(  @ B 0  ! ! fpu_rightshift 1fpu_rightshift 2㿘`  & >U! `r     >G!! ! ! ! ! 1 `_  @   `?@   `$`  ` "2@+(@*@0@(0  3! ! ! ! ! 㿘`      8"  @ 0`  6` (@+32*@@(` .   132+*@)"@"""""?   LL     vmmapbsyvm_map_lock: failed to get lockWARNING: matchbyname not valid on sun4!%s 㿘> ` >`@Q `? `>     9F (fɀ  ( 4("@/obio/interruptinterruptbootstrap: could not get interrupt node from prombootstrap: could not get interrupt propertiesbootstrap: less than 2 interrupt regs. availablebootstrap: cannot support capability of > 4 CPUsbootstrap: PROM has invalid mapping for processor interrupt register %dbootstrap: PROM has invalid mapping for system interrupt register/obio/countercounterbootstrap: could not find counter in OPENPROMbootstrap: could not find counter properties`>` ) !> j @#!>"> ("b($ H,$ L$ T\$ `$ X$ $ P`$ d$ l$! $ $ tऀ`>А""@>@!x!> $ H  \ d@* `@Sj5= v >@ t!  !>@@ !Ȕ 2>!ؐ@$!Ȁ 2>"  >}"@$?>x"x )>'>#?P,  p҂@` ` f@V`? @ ,  p҂@` ` `>R"@B?p ?p ">@ "#@  @s@Ȓ#P 2>;#X@Ԓ#P 2>3#> ?* > g""$"`D  > j!=@> i?P!8 @ ?P*@㿘!>  @@b!> "(` `@ @@R"( @ L -~#> V ` @`@L /<`@'>  L @`  L` @ / 2*@*@L @? X`L , : P`L :  L?$` $`  $L /ˠ `@@,@"( @ ` .L - #>  L c"a d a"a4aȀ  L sa  $aȐ $aȐ$$a@Q L $aȁtwas brillig.. vmelvmesx%cc%c%cobiosiswespbootpath_fake: unknown system type %dfdsbuslecd㿀> `>Ð!P0N`' (''Ȑ`J@ , `J@ , `  N@ x>@N` d2>>!`> &!`!h> &!h  . ?& & & `" N`>ap@?& & &  $N@>N` ax@& & & .  i l&`sN` e"`s>!#> &! ?. `& & &  $`N`>N@ axu@Ӑ`& & `& $`N` d t r> ">  >U 7 2P>>!h> &!h ?. >& & & !`" 6!>!> &! ?. >& & & !`" 6!  . &  & & "! >!> &! ?.  >& & & !#  && & & #    >Y!>"`LJ 1 :  : N`>N@ax@J& & & |  f@N` d`l>!> 6! .   & & & e# `l#`sN` e`s>!> &! ?. >& & & aؐ " 6a `. & `& & A"?N` d t r7>!> &! ?.  >& & & !#  && & & # N` r  >az N@>axr@ϐ& &  & $bootpath: /%s%x/%s@%x,%x:%c 㿘>& 8N`>%>#>!> 2  H `P ``a  ` N 2 > h> f 8 8WARNING: %s map is bogus, using default 㿘> `,> "(`'> jc$@ ">@  >!(֒ `"?@` &` &@L *?Ѐ &@ $L 0` &@sd-targets㿘#>b䀢 !> f>"8"< $b"<. @st-targets㿘#>b耢 !> f>""\ $b"\. @cpu_configure: no memreg found!cpu_configure: ROM hasn't mapped memreg!device_typecpuPROM root device type = %s (need CPU)mainbusmainbus not configured@ > j""> !Ȁd>R> -> `)>+>/>[1>> ,` `=>!!<`/`$` *> @$ @`$``$R >> 0c*: * @*` " R    2`2 >"' >`,' '> "`8>{"  @>@Ēc(>@6c8 >#@f (@(" xch"@'' 2>P#p    H o@@@%H/ / @' @?+H 0PROM sync command㿘>"%d㿘#@> f>"b#@ﲐ@#耢  #@縷 .,%s at %s %saddr 0x%xio㿘`> a#H 4  0>`#X>#h>#pQ  no PROM root device㿘> f" 2 &"@? 2&">Ð#؁name㿘 " !> 0@ @~ @&  0 reghierarchical%s "reg" %s = %d (need multiple of %d) warning: %s "reg" %s %d > %d, excess ignored address%s "address" %s = %d (need multiple of 4) intr%s "intr" %s = %d (need multiple of 8) WARNING: %s interrupt %d has nonzero vector 㾘@!>`@!?>#(@F  @>@` " @  >>  ]  >> Д & &@@ &  ,|>a @A ? &   >>! <  & (>a8@( @?"  >>!@p <  &!0>> ,   2? " ? @ ahV 㿘`@`?`hledpxp`XH8virtual-memorypackagesoptionsopenprommemoryinterrupt-enablealiasesauxiliary-iocounter-timereeprommemory-errorp8p`XHeccmemctlSUNW,sxSUN-4/%d series: %s obio missingfbno options in OPENPROMcould not find %s in OPENPROM audiozsP> ` > !> >a  >>@`0!> @ >!(ǒ  8 @!D!>>#8'#t Ӻ@!D> > @a'''ӫ >'!0>#쀤 #''tә  2'0>> Ъ  )@v 9> -> 1>77> j>#8)>'>#(@N@’  @C!D''''ti @_ #(( 9> -> 1>7> j@)!D>#8>''t''L ( ` >a@@% > "`@- X &$>뷐!H @'L &)>'> !`뢐'8  t 2두L `Q'> >>#(@s  @͐>@@c8 8>`0@Ð @1 2 & >a@!>a@ >c "cc  H 0+'tҼ @ findzs: unknown zs device %dfindzs: no obio nodeslavefindzs: cannot find zs%d㿈> `$ "<  "<@ >"8> '''"X> , ' 'h耢 26 ? )>!@\ ` >+a >"x@N #>b@;?>@Ka >  "ɒa@& pre_panic: makememarrmakememarrmakememarr: hope version %d PROM is like version 2 makememarr: limited to %d makememarr: cannot find "memory" nodeavailablemakememarr: no memory foundmakememarr: WARNING: lost some memory 8> `>0 >"$>"$$ ߐ 0r > "(  " & 4%> !`0$" > J HM O> $$  @ > X뭒`> 맒 Ȳ \@>j`p >! >0> >  H )`@3@%   >  $$   > m!WARNING: getprop not valid on sun4! %s node 0x%x property %s length %d > %d 㿘> `>#hM > "(` €> 0#4 㿘> "(`€㿘> f"ʖ ?" ,㿈  㿘> "(`€㿘> "(@€search_prom: null nodeiommu㿘 >!> c(Ð@6  Ր >>b!( 0'>%>@# #>#(@G @  @@ ƒ 2 ے WARNING: opennode not valid on sun4! %s 㿘!> "(` >ꖐ"h `@ "(@ 㿘> "(`€8@ 㿘> "(  8 |@ |€0@' line# >body >user %lx ! ' column# >body >user %lx !stdout @ is my-self addr line# %lx ! addr column# %lx !0> "(` `  @ >cxf >c^&@&  @  PROM exit failed㿘>`? > ( x"@( t@PROM boot failed㿘>`? > ( x"@(`d€> 㿘> "(`l€㿘> "D$"D>#| *`" * @`@?" > `@$>$ > ( :@ *@ $  ?2 @rdstxdsdxy㿘'>  0@@0@ ``?use one of: %s[a-p] %s㿘@(  >鏐"> b >5>3>  遒  2 bz   2>s hparsedisk㿘`A   ,`: ?.2&> " -?#3>  @  2  ʐcP*   `*` @*@ & 2  @  Ԑ?  2,no memory for mountroot_hook㿘  z  2>眐 x@ $ $ > jb̔b̀ $" $ "b́root device (default %s%c): swap device root on %s%c can't figure root, hope your kernel is right >  ? 'p> *  @ 'p/> 1> )>    > "8`> Ȑ "Ȁ "8>辐!>>`!  a 诐 >諐! x@  @.@ t?L *  ,  t    > /> 1> G)> #> ۖp @ :?8'pha( >`!  b\Za @ɒ ߒݐ`>"*` €?'pt? @2  `@?`v# @* ` * 'pt%<p&"@ 7%"D 2/> p #? ,` # ** ? 2`   2 *+  > > ""<'p "b@> ?'p "b@p> ""DJ> j  >>#> h%8O"`!> "<? 2  >a`2 %8 >!8`a2ؒԐ!H06@03?"D> j2 2? 2`  2 @2"D%"D"?"@b"D&"@b̀  2<2` `  @ DDDD %c㿘 '>_ "+  @   #@ @"   #  @ @fh, >"?]0ҤYh0> >>P"0Ő"L,config_attach: device name too longx> ">ba@L@I >寐  @@```@i 2`㿐cache enabled 㿘> <x> i""@>   > h "a Т@ Њ@@ Ъ@@ >"> 㿘> >`0?* > i> h"b"ᰐ Ԃ Ң  Ң Ң> >" "㿘!> @ Ģ @ ܖ*> 0* > i""> h" ւ   Ң  Ԣ   Ң  Ԣ Ң>T "`"  pК@ `к@>  "">v cache_enable: can't handle 4M with hw-flush cache㿘>   @> 0?*@ > h> i> """"b(!#> @   ֢A@ ֢AЂA   @\ :>! `!$ >` "`>亐#H  .`㿘!> @ Ģ @ ܖ*> 0* > i""> h" ԂԢ>`Ā` > @ 6>ТA@ @ > ܀  @   آA@ آAЂA    >"`㿘> > 0> i*@ > h"""ᰐ ւ  > @6 آA@ آAЂA    ֢ >"`徐DVMA coherent 㿘%>@@ *> 0* > i""> h" Ԃ̘ !> @ 6>ТA@ @> ܄  @   ֢A@ ֢AЂA    Ģ&҂@@" >q"( >"`l >  >`  >`(>: `, Т0 ``8 ` Т> b`>"`* * 8>8  Ģ@@ > >"* *`* 8*`>`"`>`(>: `, Т0 `8 ` Т> >ਆ ` Ģ0 >,఑:? ଆ Ƣ?㿘#>a >> 0>  — '>%>( `2 ,@&"@`  . #, Ң0(`" .@ ` Ң0c  2 `6 6 y `?06> >"ఖ  ࠄଓ:@  "  Ģ` > b`>"`* * 8>8  ĢB@@ > >"* *`* 8*`>8  ĢB @ >,> >`:`? " Ģ? 㿘㿘> 0 >>  ("  >#>``,2@~# @`.$.@ "` ԢB@0c  2 `?6 6  `?0c  2 `t6 0]  Ơ  Ơ Р㿘Lt>>ࠇ8   > f⸀2>no ⸄ o ??  Ģvmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map>2`  ? @0 `( >2`  ? @0 ` `?>*  >2`6?o>(? @ `2 ?@ (@* @?>@2`?0 @ `2 ?@  (@* @> *"?n*?㿘@2  ?`" ` @&s&` <* & 2` fp align without being the FP owning process㿀`o   2` 2`> ?a  @` o 2  ' 4`H*   '* ?@ oq  2` *`: '2`  ` '쀢 4`H*   '* ?@ oN   4   '>! >( ȀWr !(`2 !( * ='* 8$  2  ' 4`H*   '* ?@o   `` 2    $  4`H*   $ * ?@ n  m`  na`nؔ  W"7 *  6 7?7nǔ E`2 !( | "2    * !("@q!(002   * *  " `H  n ` 2    * *   " `H  n  㿈 nx  2 2  2| n2   ' 4`H*   '* ?@ nX` 2` *`: '2` `  '쀢 4`H*   '* ?@ n3  `7 2  ?`; *> H€( % H  2   * *  " `H  n `  㿘    `? @ &@6   . ??'  $(,048< ?ݶ@        6 .  `2j ?6 . ?6 8&vmmapbsyvm_map_lock: failed to get lockstray interrupt ipl 0x%x pc=0x%x npc=0x%x psr=%b EC EFSPSETcrazy interrupts㿘 > > "xb> > f"  > fbĐ   "b>" > f""ā㿘> !؀` >  > > ` 9 L / H > `"`H 0 ,  @@"$ fD J` *` Async registers (mid %d): afsr=%b; afva=0x%x%x SYSERR UNCORR TIMEOUT BUSERRAFONMI: system interrupts: %b fVMEfSBUSbKbSbEbAbSCbTbVIbMIbFbVbMbIbMEbMAnmi㿐!>!8''€ 2  H>>  L ͙3  H  ?p>>!Ô8>H!intr_establish: level %d interrupt tied to fast vectorintr_establish(%d, %p) 0x%x 0x%x 0x%x != 0x%x 0x%x 0x%x㿈H > fbȑ:  >"   >> `6>`4. !`>"!,>"!X" : ?.) 2   @2  (R@"> ?) .   >(R#\#`#d"Xٔ>. !@@2"&`H 0 intr_fasttrap: already handling level %d interruptsintr_fasttrap(%d, %p) 0x%x 0x%x 0x%x != 0x%x 0x%x 0x%xx>`4. !6` cH > fbȑ:  >>!.  > (݉> `2>">"!,!X" : # )@ 2   @2  (R"  ?) .   >(R#\#`#d `X  q8  '''  N@/   `H 0setrunqueue㿘! `2 >1"@>  * > `ؑ+ " & & " "@remrunqueue㿘!> 2 8 2 >"> `"  +` "&   * ( vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapreal mem = %d startup: no room for tablesstartup: table size inconsistencycpu_startup: cannot allocate VM for bufferscpu_startup: not enough RAM for buffer cacheunable to create DVMA mapunable to allocate from DVMA mapdvmamapunable to allocate extent for dvmaavail mem = %ld using %d buffers containing %d bytes of memory 㿀> j!?H> i!8  @ >` ?H?L Љ> > > "c!> j`'>(>* #> b @ >@ *@ Ԕ >W#@Ґ"">>N#"0>* >  * #\ a ?t? ">7#>'b4"0@>`0@( : nv >"b4>4 "0@@'3> .5> `ḑ,䀤@  nS "0)> '>#\     $| 2 4 "䠤@"0*>c#\ @ >>"b ??&`?0> i8 & >`""(> H `Ԓ" `@>۴ h> #\  8 > "`>ۦ >#\  >"b$>*@   >!>4mޠ "0M㿘>!>*"@ ᜘ᜠ>  "!*` > " **  > "c*  >  m">a ?a`> ` ""` > "#*+` > +  "" *@  >*`"@ > h4"",*`  > j`@ $4>b0  4 $0 $00  $00 ̓*`#3@(0$3$00> b* @4@@$4>,  02  :  ?!",!",0> g* &. "a㿘!,!$ ?&!,!(` `%>k$ *&!(@: P$a= #$ H$ $ $ $ ,&㿘`    ->"<3>b8ݘb8  b8 k >b<>  $$  `H @` *@   $  'H'L> ?Pa   'P'L'T'X'\'`` 'd`*'h@'l`'p`0't @   0'L'DxODh?@0= Hh{ ?i ' , *@ >&>&`TT=" #" $``$`H$`$`㿘hn@0  @`23   ", ` ` !$$ `< @ * #` # `# `# `# 0`# H@  $a  a ?"a `?" @& ?halted WARNING: not updating battery clock attempting to power down... WARNING: powerdown failed! rebooting 㿘> `>T# 8՗> "!>D > ` > "h"`j"D(>18#0H/` /! >"" >>%#XE@>#x># !">@>">#  > fА s*`  @А d*@  -*В*@ *Н㿘> "@"2 >* "@h*` `@ @*>`(> j *@  * $ $>>"bP"L> f  dumping to dev(%d,%d), at offset %ld blocks dump area unavailable mmu memory @%p:%d device bad device not ready area improper i/o error succeeded error %d 㿘>h`@> b@?>"L`%>P > "@? 2 2 > ` q!> b@>2  *h"@ *`` >`"(?> >Z"00@`2` `*`" * P>M"H@*,@*>(>* @P> c> ? H!Ȁ`F`` > ,< >*"X? /#-> f7>5> i"@ 8>,  `4@ؖ @> @؟@ت8@ݔ@`2 4  ڨ `>!̓-` €>"h0>"x0>"0 >ݐ"0 >ِ"0>"ԒdtFrame pointer is at %p Call traceback: pc = 0x%x args = (0x%x, 0x%x, 0x%x, 0x%x, 0x%x, 0x%x, 0x%x) fp = %p 㿈e>ٕ"(>ْ"@`'>%> 0X <  $ ( ,#\ 4#` 8#d 8~#h 8 (4@4 " 0mapdev: zero sizemapiodev㿘> fԀ > ?x"Ԧ b`8 `>ߐ#H @ ? ">Ԑ#`> 0 >   * . #> j3> iaa8 @ &   㿘@o  curproc = %p, pid %d no curproc uvm: swtch %d, trap %d, sys %d, intr %d, soft %d, faults %d stack trace with sp = 0x%lx stop at 0x%lx 0x%x(0x%x, 0x%x, 0x%x, 0x%x, 0x%x, 0x%x, 0x%x) fp %p end of stack trace 㿈>  `">>`4ސ !> ڐ !> " h> x  l#> t d p#\e}>Ɛ  > *@ !ؿ  * @> 0a( <  $ ( ,#\ 4#` 8#d 8ة#h 8 2>آ!`g0 panicw: case 4 w: unknown case %ld w: arg not allowed 㿘N@  t>0``>0>">w"0 t"0 0n"Ёwarning: ldcontrolb called in sun4m 㿘> `>Y#h H/` /> ``2a > ` fq$` H p@` * ( 22$  *@ `   `" *`0*@2@  `  *@vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map㿘!$f< P 㿘!$!<@ P*f2@<!$ " `  !$ !$`  㿘!(>"h f! 㿘!(`f !  vmmapbsyvm_map_lock: failed to get lock? 0        mmrwmmrw: out of space in kernel_map㿘? 2  @- > fb  #>""`$"!bؖ ֘ " "!> # `$>c>,$## 2`>ڐ" `    ?` ?&@ &`>ǐ"ؐ 2 ` >Ð"*` €` @3 > "#> > i, `!8c> j  ! @ > 0!>`  , `"@ @ 8 c Քc ,@@ g`` ?G#@> ,?H@ @   8 %>  @ `> #@  2   "@ @8  @ 8  @?  E (` > &`; > `" ` %> 0  #> b  b@$0 b䀢@80m `  "Q@? 2  !> f" " $" D   ? ->   㿘> "( `"  @ " @  㿘#   &bޒ, ?㿐#@2> j#$ &`> fb耤@ > j#$@ > Ho oH p@  $> "(0`''@   #@N@ܰ 0c@c@m 0Ҁ` Ho o€H 0 @` &  0 'Ho o H p@Um`o^  W xHo o H 0 @2_ ^A`C2 2SHo o€H 0@ @ $&  b2"< Ho o€H 0> f`% ! Ho o€H 0> f""& "n  h vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map㿘> !\@㿘>c> ᄠ-  >!`@"ߔ> " @#B4 㿘>c|VA2PA: Asked to translate unmapped VA %p㿘 `#҂@   ?.  %$Ң` ` `? 1?` `?1?** ` `>Ű?.  !(  2( $(@2  ?(:  㿘> i!80 Ҧ`z㿘 @*`   `  6"@ @:"@  *c $ @$> t> ""@pmap_page_upload: no memory?㿘!> > " !Ȕ  K> " !Ȁ  >ҽ#> j@ ">>   0`( ,` ` 2 @  㨢 @> > "a* @  2@2X 㨢`@ > @ 7 > >2@#d > ``08*`@* 0@ " "`080?>   `*`d (  #mmu_reservemon4_4c called on Sun4M machine㿘>   >/"> %?> /?"`"#2 > %?> /?"`"#K> i!81> h4*` $* ``⌀`@Д`>b\ @&> \?  +> j)> "(a? 4"(`@2 4  ,  2 @ *` Р? > ,Є Ф? *4&'mmu_reservemon4m: no existing L0 mapping! (How are we running?mmu_reservemon4m: can't handle ROM 4G page sizemmu_reservemon4m: unknown pagetable entry type㿘 !Ђ* >`<  `T   Т@Ђ ```>0 >0> p>"@~ >{ @@>u p`< `T  mmu_setup4m_L1: unknown pagetable entry type㿘?. # , `$* @҆ ` (  .  )>? @ ` `*@*    * ` `+` {?  ?*  @   ! Ǒ, mmu_setup4m_L2: unknown pagetable entry type㿘?.  #>@,  ҆ `   "  ? @ ` `*   `+  z?  @&   ސbР ?$@mmu_setup4m_L3: PTD found in L3 page tablemmu_setup4m_L3: unknown pagetable entry type㿘?.  >>ֆ     + `@`.`z ХУ`  ? me_alloc: all pmegs goneme_alloc: LRU entry has no pmapme_alloc: stealing from kernelme_alloc: LRU entry's pmap has no segmentsme_alloc: LRU entry's pmap has no ptes㿈>   8'P` "`" "@$ $  "@& $ ` $ `"&`> h!,> "؀",0 "04 "4.`$* P*  @ 2`P$ )4 > #Ȁ #>*  2> i># !82>!` "`" "@$ $  "@> "؀ & > h! 4 0`" 0" 4 * @$*` `2 >! * @'@`1 >!P@ ) >^ >` 2"Ң>Ю@>!P € > 2   *`* #@ * : *` >]>`   "Ң>Ю@>   Ҫ`  Ҳ` > hc?? жc> P"|.*` ''/>+> jƆ#  7`>#` > "`2`@: * *2`@`# #@  2`@: `2`??*  *` 8 @" $@,  >    * : *` `Ԫ```  *`* @  * : *` Բ`` 2  ` "` $  "@ 誀@$ `$ `"@&``$@*  @ 2`P$ 4 4 me_free: no segments in pmap㿐> h.`Ȑ"* @ *  $* `> `2  ** @*: *` > `  Ҫ`  Ҳ` > ,> h> Шc"|%> h-> ހ@#  7># ` > "``2`@: *@@ *2`@#@   2`@: `2`??*  *` ; @" Â@ ` "` &   "@@2> j>z#   *`> i !82``"  "`> "" "@0?"0`"  "`> "# "@4?"4# ## "@"`, "`,㿘 0 6`+   $* 6` `?*> `> j  `6 І@ "1?0/?@H /f * ' >  # > `Ԯ@`> hԶ@`> h> ,`Ц@`@ H 0 㿘> `   0 4H /f>* '>x`  t @#@"x+: |@\@"|??""|`> ""|>`|`t,` "a  @ `   `0&`44#@& F&  @@H 0 >!X@>   $  >   ?> j`   Ъ`  в``? 12 >,,: $*` *  Ӱ0 !>!`@ ,,` p:   z"@ >!X@ "Ԣ@`H 0ctx_free㿘#>>*"`` &"#>a` "aX[D"aX "Ң` Ԣ6>% @>! `  "!X[+` ">@>!X@   "Ң> Ҫ@>>[`   "Ң>Ь@>`x$"`xpv_changepte: pm == NULLpv_changepte: no segmentspv_changepte: pte == NULL㿘ZH /f4 * '    H 00 @  -> 2>̖#4`*` $* 4`  `?>̉ *` > j `@  2>{ ( 2<` <`  | *e$ % > ͐!  l@ * p@ T2 ?#@?#@(I Ҫ@@>!L@  @ >`Э```е`` ><`  ( `<`  ( `?*@ @  <  @& *@  2<` <`  | "@    $ " ?$ 2m @@H 0pv_syncflags: no segments㿘ZH /f4* '   H 0b  @@ S??#  +>4`*` $* 4` `?>Ð#@*  > j`"4 Э@@@>!L@歀@>`  Ԭ`Դ` 2<` <` `( `( ?* @ 6<   @2%  @@H 0pv_unlink0pv_unlink㿘  >l!H, )> ha   " &  # &   & &   & )  "&  " &  ??& !> h!`  "` >3!X 2  2  "ߒ #     > i"    2 !`"`  & I㿘 ` ` > ha` "` & & B& ?& > h a` "` 2%! " " ! #! `&   #> ib ! # "! #  "`"@"` "` "` &pv_changepte4m: pmap == NULLpv_changepte: invalid PTE for 0x%x㿘XH /f4 * '    H 00[" O??#c``>s L  > ͐!  l ` p*/@`((@"Ԣ>aL€ 0Ң`  " >ΐ F: ` & *|``  $` "@` ?$` @`2`"@H 0pv_syncflags4m: no pte pmap: 0x%x, va: 0x%x 㿘XAH /f4* '   H 0B " 3 3>ϒ 2db " Т@ pꢀ`  2 `<    @>!L@ p` ?|2% "@H 0㿘  >ɶ!H, )> ha   " &  # &   & &   Q& )  "&  " &  ??& !> h!`  "` >}!X 2  2  ") #     > i"    2 !`"`  &  pv_link4m: pv changed during sleep! 㿘` %> h   ` "` & & H& E&  #   2 >ʘ"֒ #  `"  ` 2" `  $ `&  l > ib " 2 $ $$  $ $ &㿘WH /f4 * ' * >`  "" @"' %>  ` ХLЬ@L@  2 `  "0@H 0㿘> ,>  "b> (>`: > h"`@@pmap_bootstrap: unsuitable number of segments (%d) 㿈> 'D'H`'L`2 L>  ""D> `>  "bDL>"b\>a7> &>> "`!> (> "`#>a(> "b%>P> "`D'>> "b)>٨ T> "a+>ڪa|> "a->> "b\/>ۮ> "c01>հ!> "bP3>ֲc> L"a> i@>>>>> i"a@# bЄH9> ;> > j > > j?'!'b a! " " 'L " "> > Dcp#X`kHL*+> -> /> 3> "$ ,` ,`@* @ # ?2 ,` > > π aL> h*" * "`Ȥ@-!>$ t> i"8`" %`" %Ȑ" %> " > * `, &aPaP'"`j> "at> ?"!> i!8% \  @  $ x  % \`@ & c? > @ "(>%>?""|a'@ 2`<  < ? > i> hАa8 $>  bب'>   `? D4   D @  `'D`@$ $ "@& $`$ `"@&`> h`0> i "`08$44``? ?%@4* @ 2` > h  *  ` - >`(> hБ*L  >"@  , Ҥ@ >> > h a4$$"@",L ", > \ @ 60 > "D + @@ > j>`  ` <   '8   ?Ь` д`  怠 @  Ԫ@>j>`p 4+  c> , Є Ф rp->rg_segmap == NULL! 㿐> i!@>c`5> >&!@3> &b>9> ja>'!;>  '`>> bH> ` >  h'>! `> )>"a!<> +>""\al> ->"c0> />""P> >>!>#>%>"a>  ` > > > b> i7>  D#!& #b"!@ " > c1> #p "$","( `@!> #X@>    ;> i)> 9> 5> * * * @#&a ?"?*> > π a#>`\$`t* 'a8%@> "$ `\* > ja8 "" , @8Xo$`pUߒ <%#̮@b%' @]%& @W% * #̔ > "b' $(: $,``pz(  $` -@-*``$k`(-@ 2 @ cz@% @ 2 ->P H> - X@$@-  , - o 2 ,@  z@$@?a a8>`,> "PP"`X> "at?> "!>&\  "x  &\ & &>?#>"`@>"`|> i>j!8`p4`* `$@*` 4` ! >`*@2 ` > jb@ > b@ >> 4@ @ >> `<`  |<` z>,@@ ˑ4`#>a  > j"> b> j"" @n㿘 "Ң!,   $Ң` p2  ?!Т@ $Ԣ`㿘> `  > i!\>`$+ T+ 2   #  Tڔ! 2   @ Tє! 2  ,"@  & & ppmap_init: no memory for pv_listL1 pagetableL2/L3 pagetable㿈>#`  > "` "@  > " >+ @ *@ B  #>Đ#X > "`"" *  >  >""X!>#>Š!a|> f>Ӑ#c$$  #\;`Q#h> f>;`#c#\#h!! E 㿘> `> j" Ԃ@`>!`  > "> "@ 2@ @L 㿘> @"%> j#> ia8@ @@ 㿘  "7 @@ @@㿘  "+++T& >  & & $&  & & > f #& ( ( & ,   z@`> c @z` & 4㿘   ? & @͒ "pmap_release: segment list not emptypmap_release: releasing kernel㿘H /f * ' >`    ">"    >ސ#H 0 "` "`   > f  >#> f (<#& ,& (  " 㿘 V> i!8> "PQ> !>`  "0 @H /f@* '@'  6` ?`6` * ** :`* @ **  $* @ ` @@  H 0   "0@㿐. $* @@ ` / ` ` ' Ԫ@>`(&2  >!P €@>a  @ @]> #b|@ >P ,)>G 2>>!L@>#  `)>> "`2`@: * *2``# #@  2`@: `2`??*  *`  <  @"  f Ц@ ,@ @ `(,> `../ @: /  > \ > > j` Ԫ@@Ю@`ж@` ` ?-` 㿐. $* @@ / `   "Ԣ>`(&2  >a   aP€@a  @ @g> "| >`  ?* `>U ,<+>?Fp>!L@>#?6 `+>p> "`2`@: * *2``# #@  2`@: `2`??*  *`  > @"  g` ?* z`,@ @ >` ,pmap_rmu: no segmentspmap_rmu: no pages㿈. $*  ` T /`>" `H > j>#`2h> `2>` >`  | @K> #b| =>7># ` > "`2`@: * *2``# #@  2`@: `2`??*  *` ''$`,@@ `-D "% ` ? -` @; "%@ > (&2@   ֪@` >!P €>a  @   Ԫ@>`  `>`>` > (>`  ` (>` `?*@ e ^>L  2>>!L@>#?,  >> "`2: * *2`# #@  2: 2??>  * |*`  <  @"  ' Ф> `2< <  | "`,@@ `9-> `./`.: /`   >` > j> jЮ@``ж@` "%Œ ` ? -` @s "%@>   0@"& 0 4"& 4㿐'P.$*  ɺ / >" ` `2># "Т@> > ('@2@ ` PP€@  @f` >`  ?* @  V/><G  >!L@>#4  `/>> "`2`@: * *2``# #@  2`@: `2`??>  * |*`  <  @"  ` p` ?* z,@@ >` `4.> `/ /  P* ! Ң`/   z> fq& ? ,  " Ң`P(*@z@ "X$pmap_remove_all: empty vregpmap_remove_all: empty vsegpmap_page_protect !PG_V: ctx %d, va 0x%x, pte 0x%x㿈> > 4" 4 > "`2: * * 2` #  #@2: 2?>   b`*`@ *    `M` 0H /f4'* ''   H 0쁊 0Ԋ@' 7> ? '4- $*  4  `?>F#*`@ ``2>< ,`> j`@2`  @< O |L< @~ "&@ ? - ~ג "$    Ԫ@>aL€0@ >`Я@```з@`` > (<  ` (< `?*@ ֆ>  : @`'@`W 2> >  | @M"> i!82> \ `> > j` Ԫ@@Ь`д`’ ?,-   > j> jЮ`@`ж`@~d "`$@ ? - ~X "%   0@"$ 0 4"$ 4~D # 3  ' ' 'Ъ@@H 0쁊 pmap_protect: last segment㿘 0L @H /f@* '@ +> -/6`+ @  $*``6`  ?`+ + `:`* @ >5!`8 "p+` ` 2`g> j` `  >`  |>` @V> ",@ @K@ #  Ҫ@@B@> h!Ш'%@`$ @ $`$`(>aL $`(€Ц@> ,@ @쀦@0%@``+`2 Э``2 е`` > (>`  ` (>` `?@ *@ > ,Ђ@ Т@@ @@ @ s6`H 0 @pmap_changeprot: no segments in %d pmap_changeprot: no segments in %d! 㿘K> "> ia8 .@  !!`  @6` ?6`H /f * ' +   $*  `2 > h> h>ې  0y +` " > j`   > ` >`  |>` @ R*G"@@@   Ъ@@@ @>А 2,>!L@&Ъ@@>`    Ҫ`  Ҳ` >>`  ( `>`  ( `?*@ @ @А.@ @H 00  `" H pmap_page_protect4m: empty vregpmap_page_protect4m: empty vsegpmap_page_protect4m: !TEPTE㿈> b> 4㘙2` > "`2`@: * * 2`` #  #@2`@: `2`?>   b`*`@ * `J`  0H /f4'* ''` "H 0 0҂'쀦u  6 -``$*  6 ` ?>h#x,`  2?>^#, @` "`Ԣ>aL€0`>    ":>F# @@ z@ 1> i!8@,@ -`,` !`,` z> fc % ? , @ "`("``(-`@z@{̒ "%{’ # 2` ?& &&"Т@H 0 㿘 }=0vJ"H /f@* '@^ > h!>6``+   $* 6`@ ?+ + :`* @ >!`8 ` *@ 21 " Ң> ($:@ @%' $<> h aШ >`  @ >( $(`>!L@p`@z> ,@ @>` @ >H 0"㿘I> "> ia8 .@     > h` "`H /f * ' ( " Ң<  2p>!L@p Ң`"⢀  ?` "`~H 0㿐> "D7 `  >`  >j >bX*   =: > b>  6  `#> i> "`2`@: * * 2`@` #  #@2`@: `2`?>  b`*`@ *  !> #> i" ?6 *@   @a8   @ @ؚ @ 㿐6`, $* 6` `?-  H /f * ' > j  ^@`6[ #@ @  H 0֔0@I >#?,@ 􀢠 > "`2: * * 2` #  #@2: 2?>   b`*`@ *  ǔ@   Ԫ@>aL€  ,  @ "@  (> 驐" >4  ` > -` \ `?Ԫ@` Ю@`ж@`> ,?> h А@  Ң @H 0pmap_enter: segment filled during sleep pmap_enter: pte filled during sleep 㿐G6`+  $ * 6` `?H /f * ' > *`-> j 0 4" 2  :  & & 4    & 0 2  ""wt ` > #yK "IR"> j $,  ?4  2 > h В "*wN ` >#y% "I, , $  ,     2>` >`  | '    Ҫ@@>a  @   Ъ@@ 2 ֪` ֲ`  > (>`  ` (>` `?*@ `6b #@ @ H 0z < & <?& <@L >#?,@ 􀢠 > "`2: * * 2` #  #@2: 2?>   b`*`@ *  c@ >!L@  ,  < & < @ @ "    Ҫ@0  Ъ@@ 2 ֪` ֲ`  >>`  ( `>`  ( `?*@ @  2>` >`  | $H 0㿘> i!8_ 㿘 %> i#> , @48 O b  㿘>  6@ `  #> i" a8"䲆㿐@?x*  `@7 ` <@`=>"X`8> b>  6  `%> i> "`2`@: * * 2` #  2`@: `2`?>  b`*`@ *  #> %> ib` 6* @`"8  `@? @     $ "  $ " pmap_enk4m: can't enter va 0x%lx below KERNBASEpmap_enk4m: missing region table for va 0x%lxpmap_enk4m: missing segment table for va 0x%lx㿐=#@6`>#* @ $*` 6` ! H /f4 * '   > `>` > @ ?* @ `2W  <H 00_Fp>#2 ` > "`2`@: * * 2`` #  #@2`@: `2`?>   b`*`@ *  v  "Ԣ>aL€ p ,   7`ܖ /@ Ц` ?*`@z@H 0pmap_enu4m: segment filled during sleep 㿐E(6`, $* 6` `?H /f * ' - >` @ 2` ""t @` >R#v "@F"$@,` $`` 2!@> f# 0` ",@`$`   ? zZ  (2   z@@ 2+ ?> f#  ` ># ,$ ` -  ,`   ? z@`-`2   z@l *  `2^  ?<H 0 < m& <?j& <J >#2` > "`2`@: * * 2`` #  #@2`@: `2`?>   b`*`@ *  k  >!L@  , < & <  7` ͔/@ " Ңp Т` ?*`@z@H 0㿐`x* `  ``> ">6@ #.`@ 􀢠 > "`2: *@ * 2@  &@  #2: 2?>   b`*`@ * "> i!8 > ` "0@㿐" J>%> > "|)> i+ @ `4>` x2㘑+  *`  > "`2: *` *2 # $  `2: 2??*  *` !8  > ` "0@㿘> i!8@> h  㿘 q6`*`  $* 6`h `?*` > j  @ C# @@  CF> `2  "Ң0Ь@@؆@( 1>C5    "Ң Ь@@    Ҫ`  Ҳ`  > (>`  ` (>` `?*@ ؂@ @  > `2>` >`  | @  > (>0?+ + @@&     $ 3 ((  3 ;  >  > 2( ?+ /" > $Ơ`㿐> >" c2  ` > "`2`@: * * 2`` #  #@2`@: `2`?>   b`*`@ * ` ] $ `㿐> > 4" 6 > "`2: * * 2` #  #@2: 2?>   b`*`@ *  2 "       㿐> > 4" 0@  > "`2: * * 2` #  #@2: 2?>   b`*`@ * ` Ր $ `㿐> > 4" 6 > "`2: * * 2` #  #@2: 2?>   b`*`@ *  2 "    珐   㿐> > 4" 0@  > "`2: * * 2` #  #@2: 2?>   b`*`@ * `{ * $ `㿐> > 4" 6 > "`2: * * 2` #  #@2: 2?>   b`*`@ *  {2 "       㿐> > 4" 0@  > "`2: * * 2` #  #@2: 2?>   b`*`@ * `{ 袐 $ `㿐> > 4" 6 > "`2: * * 2` #  #@2: 2?>   b`*`@ *  {2 "    \   㿐> "> c6 ` > "`2`@: * * 2`` #  #@2`@: `2`?>   b`*`@ *   "䀢" `>"X`"G "`?6* <>  !PԤ> ,A Ф㿐> > " 6  %> > "`2: * * 2` #  #@2: 2?>   b`*`@ * >! `  ?6@ 6 *@ c(  > "`3 : *@ * 3 @  #@  $?3 :  3 ?>   b`*`@ *  >! `赐 `?6@* <P  PԤ@> ,AE>!L@ Ф Ҥ@㿐> f"` #> f> !P> i!8 L$b$> "> c6  ` {> "`2`@: * * 2`` #  #@2`@: `2`?>   b`*`@ *  䀢 >! `>"X`F `>6* `  b 0Ԣ`z@!> f"@" 0Ԣ`> fb z㿐> f"`%> f+> f'> f!> !P#> ia8$!PԐ % $%b> " >6   `> "`2`@: * * 2`` #  #@2`@: `2`?>   b`*`@ * >! `bΐ b` 6@6#*  > "``2: *@ * 2  #  $2: 2?>   b`*`@ * >! `b璐 b`>6@* `   0Ԣ`z@ 0Ԣ`bz@> f#!> fb@#>!L@## 0Ԣ`> fb z> fc 0Ԣ`> fb zkvm_uncache: table entry not ptekvm_uncache !pg_v㿐> `2j" Ң `> "|> i!8@  ">>"8#4  `0'>> "`2`@: * *2``# #@  2`@: `2`??*  @*`   F  A " ?  Ф`|@<2,>!L@,`"0^ ]> #b|# &>>"`#  `'>> "`2`@: * *2``# #@  2`@: `2`??*  *`    ⽔ ,2,>!L@,`kvm_iocache: 4m iocache not implementedkvm_iocache !pg_v㿘> `2>K!  > >І  @!Ц`,> i82$$  ` *` (`"8> D@:88> h" "@㿘>   > 0 >Ң㿘 H /f * ' >  =  >0!`@> ` "Ң0 Ҫ@H 0㿘> #>` * > j`> hA * > 0>`(>㽀> `  "Ң"  Ҫ@"#ʠ'>`(> * >`?$ 㨴 ' # # > j `  * # # > #X#'> $  @" ``4  ?'> ' @$  `@" `4@  ?2' (>> !/>    ?? @$  `@" Y`4@ >` A> j  1>`  `> h`> h Ю7> Є' @$  `@" &`4@> ,?  `>>` ` Ҫ` Ҳ`> b@"㿘H /f * ' > 0>. H >`  " @  "Ң Ҫ@ > i!8n   H 00/ 0Ң`{. 0Ң`{ 8>ք H 00Ф.֤>!H €  "0@H 0 vmmapbsyvm_map_lock: failed to get locksvr4 gethrestimesvr4 gethrvtimesvr4 gethrtimesvr4 setpsrsvr4 getpsrsvr4 setccsvr4 getcckgdb exec4.4 syscallsvr4 syscallinteger overflowfix alignrange checkclean windowsflush windowszero dividebreakpointsyscallv8 store errorv8 idiv by zerov8 data errorv8 cp exceptionv8 unimp flushv8 cp disabledv8 text errorv8 r-reg errorlevel 15 intlevel 14 intlevel 13 intlevel 12 intlevel 11 intlevel 10 intlevel 9 intlevel 8 intlevel 7 intlevel 6 intlevel 5 intlevel 4 intlevel 3 intlevel 2 intlevel 1 inttag overflowdata faultfp exceptionalignment faultwindow underflowwindow overflowfp disabledprivileged instructionillegal instructiontext faultasttrap type 0x%x: pc=0x%x npc=0x%x psr=%b EC EFSPSET%s[%d]: unimplemented software trap 0x%x trap T_RWRET 1trap T_RWRET 2trap T_WINUFfpe without being the FP usercoprocessor instruction T_CLEANWIN T_RANGECHECK T_INTOF 㿐> b`h`@ 3"`h  ? @  逦  > 2 > `"`&&>>!pax >#x.  >#p>  2 > "h $!$ ! #  "t' e 0; q  05 "' ؀ 倦 0+ $ * 0% (> >   0   0 0  0(??"q` 8 4> "`>>!p a'   4>! !' ږ @CN #> 1>   Ԑ'  Ȗ   Ö !(  >  * i:!>bh;(!$!(> #`2 '    q#>a  >` >+!H` 96 @ { ` "$`>!9D@  H` 9 @ {ג `X``9 @ {Β ` ?>"k$`!, f "Q'  C #>a>";!($a!(֐N#>   / >א"0'  & '     `'&&  8"P>"` `'&&  y2#> !, $!,`&&"p `'&&  y#> 1> 3> z 耢`  ,( @ z  ! ,!b`   ,@ $b*@ $ ,Ԑ 쀢 " ,n  z 耢`  ,( @ y  ,  Ԕ"{ !.a >!@*&㿘! ` ` 2 x  x88 @ 2??  @$` 㿘8@! " text fault: pc=0x%x ser=%b WRITEINVALPROTTIMEOUTSBUSERRMEMERRSZERRWATCHDOGkernel faultdata fault: pc=0x%x addr=0x%x ser=%b 㿐> "h>  ` "h> "h  д> "D`>  p @ @   @.1 2! H/` />>"0>#P "> >'#܀@M> `2J! =# >cÆ ;! $!$  @   O &*`Q`l    > 0>> (@ "@ 2@ @8&  "   `' ,`` !   ``H/` />>#`Ø#>H#P'`j'`@'    wƘ`]1> #> %> yn 耢`  ,( @ x  ! ,!"`   ,@ &"*@ $ ,ԐI`쀢 " ,  y@ 耢`  ,( @ x  ,  Ԕ"$ !,@ >!@*'@text fault: pc=0x%x sfsr=%b sfva=0x%x CSERRPARITYSYSERR UNCORR TIMEOUT BUSERRFAVOWdata fault: pc=0x%x sfva=0x%x sfsr=%b 㿐> " h> ` " h> "h Ѐ + `` `>!t @ @`  `  {` > b q @"b $Ђ`  j`#Ђ` `@.  @`  @`2[! `3 2! H/` />>#Ȓ̘>Q#P "> >'#܀@9> `26! =# >c" '! $!$     > 0>> (@ "@ 2@ @8&  "  (``"'!   ``H/` />> (s#>#P&f&  vz`]#> %> '> x" 耢`  ,( @ wu  ! ,!b`   ,@ $b*@ $ ,Ԑ쀢 " ,ː  w 耢`  ,( @ wG  ,  Ԕ"ؐ !, >!@*&syscall cpcb/ppcbsyscall trapframesyscall nargsp> b`x>  "`x@ @>p#8> ! ">g #@" >_!$!$, `0 Ъ 3   0`0`4  >!  `8  .  `* )T2`؀$`H>/!("-`@  \58*    @`2D TYr= *6ɒ   @`2`4TY_`4''Ш??, 2 Ѐ&`0 &`4  `    @*@`&@&`  `- @`@@&@&`&`0&`#> %> '> w 耢`  ,( @ vX  ! ,!b`   ,@ $b*@ $ ,Ԑ쀢 " ,  v 耢`  ,( @ v*  ,  Ԕ" !, ` 2@ВX@>!@*&@㿘!$ !> #> '> v 耢`  ,( @ u ! .!"`   ,@ $"*@ & ,Ԑs`쀢 " ,A  vj 耢`  ,( @ u  ,  O!, `   ,   B X vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mappagemove 2㿐+> )> !> %> i'>#> `8 "א"€b "@㿘>c@N 㿘> "` . c  > !`2&@`4 z &@>c @- "eQ  㿘> "`@ .@ @> !``6@ R e6 dvma_mapin: null page frame㿀> "(`)> "#b("  @ >0@ 8 > ( :@ @ Ho o b(> ? @ #\ #`#`#d ?0>  ? @#\ #`#`#d 2H 0`; ??-'> %> j9> 7>5> i "H >* `'  8 @ ?"䀤? 'ܲ@ >a 2aH€dvma_mapout: extent_free failed 㿘> 0> b.  >  `. 0> i!8H/` /> `> >.#H 0>a aH€vmapbufvallocwaitvmapbuf: null page frame㿈 0@2 ,> > `  H& L"8 @ "@ %>  ]  0c''#\  Х >`&& H)> 1> j'> %>#> i  >W!` 'a8! @   @ 'vunmapbuf㿘 0@2> >3"8"> H8 " @  cH  L>& H& L   @ <H"@ cpu_fork: curproc㿘>  ! a 26H $`> "h" >"Д" 3ʒ!(>!  *4  * aƐ!&a(!(3!%&a(% @ &a$3 P& H $  & >& 4& 0P!$  " >'#| $ $ $$ ! P" >'#|  """"㿘!(  #>a24$ac\ *1ڐ"!G 8 !X&66&(!$ P3Z!(>! 2!(4 !(3L!@^˒!"(H ''   '#\#`#d#h#l I !X #\ #`#d#l#hI   &sdcd㿘  ?`>"@g   >"@g  0> `$```N` s  4@     2 4N` s24ِ 4*,   "$`disk label read errordisk label corruptedno disk label㿘< 2 #&< 6   " "    #" @&& K&(' D' T' @( ' 0' <@Đ 2 H2" ' 0 "1>+#(6"@2@@ؒ! !W@@ 1>#@2`! (u @]ْ"1>#X 㿘`8 "; `( !25 @, !W@2- ` 2)  "  `* @ .*  @   2  @   4% ?2! 㿘@  ( H2"$ D$ T$ @($ <$ 0@-㿘D <*  a@c`8 *: `( 4b4 T @`2 0@22 $$44 4L4G`< $@,`  $4$<`(  452` T`8@d$@0?($0SunOS disk label, bad checksum㿘"  @`@ *  1>#А!W&`&@"&`  &` &`  &`(&`$!&`,!&`0!&`4!3!&`83!&`<!6`B! &`D!> 6`H!06`J6`&`&`!`3ߒ$ @ $ ,  , $  $ , 4 ` a " "*   gG#ꀢ@216`   @  @`@  2#6`> "0  a?3$  $,  @ `, $  $ , 4   6`6` 㿘 ("2  , "  0 x  &@ &` &` $&`  H6a F 6 6a B6a J6a 66a F6a 26a .*`*2 2`3Y6aa `@d O@d$@$`6"6a    `     `@ @ "4(&`gG#&`! ` @d @cޒ$@$` ```Ȗ @ b@`@ &` b``  " "  &` @ 6a@`@ 6a 㿘 @- @"+ >?  @29?@[В &  66  F6  26  .6   J6   B6  H6 F6 6@[   8 . ` @d  " 8 "@ch&& **`@ @   }4??(@  ?vmmapbsyvm_map_lock: failed to get lock`   * 㿘`=>j#`p :NE.   i7i6i5i4i3i2i1i0l7l6l5l4l3l2l1l0o7o6o5o4o3o2o1o0g7g6g5g4g3g2g1g0wimynpcpcpsr kernel: keyboard interrupt 㿘>  ` > !Ȁ`@> @?kernel: %s trapFaulted in DDB; continuing... 㿘C? #> >"l` 3 >#x* > > ` #> > #> ΢b` P/.`H`P `/)!>   `$    `H$ / `/ P 㿘> "(`l€prom㿘> ֐ vmmapbsyvm_map_lock: failed to get lock?%s(0x%x, 0x%x) at 㿐N `?#> " ? <=#9 85>"+> Ge  "'\b #> %>)>.``Qb`.`K oF"  <=# 8Ҕvmmapbsyvm_map_lock: failed to get locki7fpi5i4i3i2i1i0l7l6l5l4l3l2l1l0o7spo5o4o3o2o1o0g7g6g5g4g3g2g1g0fqwstateotherwincleanwincanrestorecansavecwppiltlpstatetbaticktttstatetnpctpcillegalasrfprspcasiccryxcciccfcc3fcc2fcc1fcc0pageone_writen_writesone_readn_readsfqtoifdtoifstoifdtoqfstoqfitoqfqtodfstodfitodfqtosfdtosfitosfxtoqfxtodfxtosfqtoxfdtoxfstoxfdmulqfsmuldfdivqfdivdfdivsfmulqfmuldfmulsfsubqfsubdfsubsfaddqfaddd34efaddsfsqrtqfsqrtdfsqrtsfabsqfabsdfabssfnegqfnegdfnegsfmovqfmovd4efmovsswapaswapcasxastwa8r7rprefetchaqrprprefetchldstubaldstubt2ds2dcasaldxaldshaldshldsbaldsbldswaldswstdastdstqastqsthasth6q6pstx5q5pstbastbe8e7eqepd8d7stadqdpstlddalddldqaldqlduhalduhq6p6ldxq5p5ldubaldub8e7eldfaqepeldf8d7dldaldmovrgezmovrgzmovrnzmovrlzmovrlez1jdmovrzsdivccsdivretrydoneid2dpopcudivccudivrestoresdivxudivxsavemovomovulemovugemovuemovlgmovulmovugmovuojdmovvsmovvcmovnegmovposmovcsmovccmovleumovgumovlmovgemovlemovgmovemovnemovn0jdmovasubcccsubcflushTdsmulccsmultvstvctnegtpostcstcctleutgutgetletgtetnetn0F12FtaWdumulccumulqpreturnPdUNDEFINEDmulxqdpdjmplYdrdaddcccaddcimpdep2sraxsraxornccxornimpdep1srlxsrlornccornFPop21Edsllx1DdsllandnccandnFPop1mulsccsubccsub1iT12Ttsubcctvxorccxor1iW12Wtaddcctvorccor1iP12Ptsubccandccand1iY12Ywrtaddccaddcc1id12daddfbofbulefblefbugefbgefbuefbefbnefblgfbulfblfbugfbgfbufbnap,mfbabrgezbrgzbrnzbrlzbrlexap,1lbrzap,ubvsbvcbnegbposbcsbccbleubgublbgeblebgbebnebna,mbaCdsethimilltrapncallnop undefined %s,a,pt,pn %%%s%%f%ld0x%lx%%asi0x%-2.2lx%%fcc%ld[%%%s + %%%s] %ld[%%%s + 0x%lx] %%asi%%fsr0x%lxl#%s%%hi(0x%lx)%%psr%%tbr%%wim%%y(UNKNOWN), 㿘> ! ; @ >#` ` , 0~#0p70~@2 8   2  2 @  @ 2 @ 2 ? 42 @ @  2` @" ` ` 2@2`>*#>#`L .L@ ,2&`!/->+)>'>L a p " #*LL@ ؀ ,>#L` Б* : `Eٓ*`>" €> 4  (>   (*> 4  (>4 > >4  a `>? Z, > T '?4 , >@ J ??,* g , a >5 >4  >4  (* `>  (* 4 | > 8L`72x>4  H `q> 4 ( |>? P, L`82c> `^> hY4  `>   pP> 4 !- > 4 !̔ | > xA> 4  > 4 > ד, 4> ђ .> ˒ ?(> 4  > 4 !( | >#> > >  > > L > L  > ,8<@@@@@@@Tdp@@@@@@@@@@@@@,@@@@@@@@@@D@@@`|@ <,ĝ㿈\`d @>  `!(*` 66  4"@ 4"@`    @ 4"@  4"@& $#\#`#d@&"`?  @ 4"@  4"@  @J㿀\` ` d  ; +  * @ + & : *  + * @ +``` `;`+` ; ":`+ *`" "" #\#d#h#`#l#p ?` " ,`,`@,` @@ +x  * @ +r  : * +h * +b * @+\ & : * ˦> 9>  ``0` `?K?k/`ah"+`? 8+ ` * @  `   +`H G/`ah"+`  + ` * @  `   +`$ $/`ah"+`  + ` * @  `   +`  /`,  F   " @?*Ő  * @ * & : *  * * @ * &``.( *`;`+` ; ":`+ *`" "" #\#d#h#`#l#p @ 㿘  Ǣ` * * @ *y   `@ : /`"@"@< ,  `*g * `.> !.` > .bh@ e8 `"``"\?" X?  *   $ * 値`F > > .`bh.@ 898 /```"``"(?" $?  *   $ `"@``@?@ ?#@`@2#@@8#@`@2@  ?#@`@2#@`"@``"@?" @߰?  + @#@ #@ * /`̰  ) * @ ) & : * ?``" `..`  : , , /` " , "  )* `-> !.` > .bh@ 8 `"``"?" ?  *   * 怤`u > > .`bh.@ 8h8 /``"``"W?" S?  *  `"@``@??@;?#@`@2#@@8#@`@2@`@2#@`"@``"@?" @?  #@ + @#@ * /` 㿘`'L &l \'Pdp(` * @(ݐ*   / @ @@ h*@ @%h/ *? ?@   @@ @ @,?&@(* @(*   `Bh 3> !-` > bh.@ @޸8 --" ?0?0@ / @  @ @$@   $@ @  > !bh-`. @ 8 8@ h*`?`!" "@?"@? / @  @ @$   $` "@ @w?@s?8#@`@@ #@`@ #@`@2"@ ?0J?0G@ ,    @ #@@  @#@-@-@ . @+ h*$` !" "@?"@? , @   @ $  @$?"@ @?@?`8#@@``@ #@@ `#@@2`"@ ?0?0@ /   @ @#@@   #@-@-@   c"h `> > a-`@> .h L@*8 @--" ?0?0@* @  /@ *@* @ @$@ @ q @m--" ?0c?0`@2 @  /@ 2@2 @ @$@ @ I > > !bh-`. @ 8 8@: h*L@`* 2?`)" "?"?0 @  /0  @ @ $0  $( "@ @?(@?'08#@`(@@0 #@`(@ 0#@`(@2$" ?0?0@2, @ #@@2 @2  @ #@-@-@i  @ hP*`$@2 `2 +" "?"|?(, @ $(   @  $(  $0?"@ @V?(@R?'`(8#@0@``@( #@0@ `(#@0@2`"" ?0 ?0@* @ /@* @* @ @#@-@-@i  㿐@T#\@㿈   \%`@ 8%`,= ` % 45    0 .  +@*` *   `, `,  4    $`  ` `  ܦ 0@*` *    ``  #\#` #d 6`? #\#`f#d & ?` `  Ԧ  㿐 > ga >@`c0a/@Z 0H /e * &  pa `H 00=& pH 0 Hզ d> ga@/H /e * &  p H ?`& p & p wr V  H   p  ?& ppS4 H 0㿈 (   P   #\#`#dz ?< PH/` / 0`` & 0` & 0H 0 0& ,H 0  € >aX `@L w 㿘H/` / ,`  0& , & 0H 0  @ >aX@K v `0& ,H 0  € >aX@KҒ v `rcons_init: linebytes assumption botched (0x%x) 㿘> g& P" > g" "" `:`>O#X0i"  " \& X @K  @4&  \@K @4& >  `2` 2 2 2 \ $$2  :  ?& H #  "@2`@:`& L# & @  ?@$& @ \  # `& D $ 2 (> g> g& & $""@ @> & (>b| `v/ > 0"`́㿘 ( 2.    @ "   "? `   &  ( @ې@`,H (@   ( # 3& (& 88& < @Ő2` ?@? ^ $ $ "@ @4  6` 6 @ ^( 8 @?&@@M`<@ ( @㿐 $ \@#5 H  #/    (  L2   "  P " P  P  \s#\ $@"@ $  & " @ "@   @Ӓ 㿘`;>!*` € $3" $ .?,&  '?%&  $"@@f"0  "  @@ 00  $` "  $ & !@ !L ! 㿘`[`; ( 73$2 ( ;-(   ($! >& (& 8 8*` * ?А& 8(" =& (& < <*` * ?А & < @ΐ@ ( ?& (㿘`3>  Г*` €@ 80  8" "  $ 8 "  $ $ 8" " $ &i&0g $"  8 "   [Y& < $?"@ $@6 "@?"@ 8 ?"@ @6 ?"@<?:"@@06@֐03@ 80/@Y 80+@ 80' (!2& 8 8  ( & ( ?& (@l 0@h 0 (!2& 8 8 & 4 (& 4 `& (@W  " " #8 " # #0 $ $ #l $ # # $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ #l $ $ $ $ $ $ $0 $ $ $h $x $ $㿈 \ $@! H   ! L P  #\#`#dj  (` & (㿈 ( `2 P0` P   #\#`#dO  X (8 ` & (& X㿈 $` `   P  X #\#`1#d0@  \@!Y  L D  X  P H @#\#`#d㿈 $ \@!D@ ` H!; P L  @ X"#\#`#d㿈 @4 "@" @ &"@ \! L P  H  @ D#d##\#` D L#\ X" P H @#`#d㿈 $ @" @4 \@@  $@  `@   H L  P@ @#` " #d#\ \ @ H"@ L@ X@  P#\#`#d㿈  @" @4 \`  @   L H  P@  @ D #d##`h#\ D L" X P H @#\#`[#d㿈 $ @" @4 \@@ } $@ x `@ r H L  P@ @#`"  #\0#d H \ L@  X P \` X#\#`#d㿈  @" @4 \` > @ 9 L P  H@  @#d D ##\#` \ L  P H  @ X#\#`#dvmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map㿘Ԗ  㿐N > @ @S $ MB >  L&a&   /vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map > *            ? - - - - - - - - - - - - - - - ` ` ` ``  @2 `@2 `2 @2 a2"b2$d2(h2  ` `2 @2 2!2"2$ 2(R "  "2@?? 2@ 2` "` "` "` "`S  " 2 ??2  2 2  ::  :: "R "  "2@?? 2@ 2` "` 2` "` 2`S  " 2 ??2  2 2  ::  ::S "( `@.`@@ 2T <  (< 2 3  @5, 2+V    "  "    B@ B  B4 2?@ (? '.㿀@SA '`" '> @@@Rt  `> @@@Rj `@''&Ҕ " @2 ! `2  , 2  @* R `2   `a   㿘㿀@R '@> @@R( `&@'''&㿘㿀``  8`  @ @ '?'*X㿈@R '@> @@Q `@''*㿀` ``: @'?''0~㿀```@'?''0o㿀` ``: @'?''0㿀```@'?''0@`' ` '>!*` €`''`'(   & '(4 4` `@'44'''4'` 1@R$'00@R( `  |h  r @?''ْ谒 h  b6`0 @Q',,@Q `' $ L  B'谒 <쀢 9̔  3͒` $*`   N0"`@'|'xx'K | &P` $  8@ N 8p 6 6 6 68 6p 9 9 6 7 7vmmapbsyvm_map_lock: failed to get lock㿐  `b{&& bbb 0:" 5 b~1b| .  @ '*@ @ ?"*@ L  2 "| "{  :  vmmapbsyvm_map_lock: failed to get lock㿘 @`@ `@+`@"F  ?@ # b@ +>@"">,<#@>$, @  0&"@ ">!@> @2 >-#P " #T!x!$  `@vmmapbsyvm_map_lock: failed to get lock "`"` "`  "@ "` 2` 2` "` "@ "`"` "`  "` "`㿘 &`, 6`0 &`4 $&`8 (&`< ,&`@㿘Β 06` 4&`  8&`$ <&`( @&`,@P ` 'L``` 'r'>#d*` €` `"b'``]`XU'` "O'` "H'` "A' ' @@PRL"@]耢 9P@ @6 20`1 T& ''L@P/ @"` T 2P @ 2 &  = = = > = = >, > > >H㿈` `'`''|㿈` `'`''㿘@ 0  0 M 㿘  &`, &`0 &`4 $&`8 (&`< ,&`@ 0&`D 4&`H 8&`L <&`P @&`T D&`X H&`\ L6`` N6`b㿘ڒ ,&` 0&` 4&`  8&`$ <&`( @&`, D&`0 H&`4 L&`8 P&`< T&`@ X&`D \&`H `6`L b6`N㿈``'`'` ''7㿀``'`'` '`''t㿐``''[㾰@OQ `'`'' \@OQ`` *'C` ` 2@  '耢 7, \ 2/xe` ' p%`  x' p`  px' 2n  \ 2 n 㿘@ 0 o z 㿘# 6`4&`, &`8 &`< 4&`0V $&`D&`@ (&`L&`H ,&`T&`P 0&`\&`X㿘 ,&` 8&` <&`  0&`4 B6`$ H&`( P&`, X&`0㿈` `'`''㿐`'̒㿈` `'`''@N `'<` &' 8@N<`` '`` 4`` &`@` g p 2Rb 8 "`E'`?` >>#(*` € '0耢 0` * 8 8 #@[` 3 p '쀢" ' "'  2  '  F F G G G G G F F FD㿘@ N0   N0O X ]fvmmapbsyvm_map_lock: failed to get lock㿈 "``h耢 //77”  vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map㿀@'` '@M '@M ''?'4  㿀@M '@> @@L `@'''0㿀@Mp @'> @@L `'`@''0㿐Đ@` Q &㽈` ` ?@ @`''7@@"@5  @ `@"$`$@㽀` ` ?@ @`  ??7@@"@  @ `@"$`$@㿈 *@ `>` ''X @O ` " &㿈 *@ `>` '' @O͘ ` " &x`2) `2`#  `  `: ( @> ?'''''`@*@ `@*'ؐSذx`?2' ``2` ! >   `( `@'"'''?'`@*@ *'ؐ'ذ㿐 !2 M *@*4 $ (`-@`<`   @- @/  ` "$` e$`  x @L7'L'> Lܔ@L@Ko < @ L'''!0''"o㿘`?* `@֒㿘` 2`# @ `+  * ``Ò @!<>( 6">l2">t."„*">,&" #" < " ">">">""  "> "> "   Pl O O O O P P$ P P P$ P0 P0 P Pl Pl Pl Pl P< Pl Pl PL P\ Pl Pl Pl P P P P P P Pt P P㿐@   2@ &@@ 2` &@`@''@Tn㿐@   2@ &@@ 2` &@`@''@Ttsbrk: grow failed, return = %d sbrk: shrink failed, return = %d 㿈>  b` @   * #@  >  9'3>$>  "`(*    * #@ '##\ ?<? ">>"  0`(  :@  6   >"@  > 0`(  :@ " $  (@J '@J H''N_ [ה H T#>'aXaX@=@@='aXaX@=@@=?''N6 2 H ,aXaX@=k@@=h'aXaX@=_@@=\'aXaX@=Q@@=N&@ x@    0D7 = 0?   . aF . 6`  &3 @Jf 'ܒ @Jj`*   :? ?V  2 ''Lp   `&   $` &  `&㿘G >  "   4  2 4 㿈@`B> (*` €''I "&!3` "! "* !   `4#&I^ ` " ! 2! !`  &``''IZ  W W0 W\ W W W㿀` "`   N0!2  NА"@&  ` !`@'''  N㿘@ 0   0 Nx@=  'x 'N 1 4`'!4  ''``>` ''|2 > >`> `* @'     *` `'  '|T svr4_wait㿘@ " !  " T ? ` &`&` T ^ `" L 1 4  ! @ 2N LL 1 + 1` '&!0` 2g` 2c  X " `Fx H ` $ `@ 8 & `4!0 !4L H 00H*`:  2 L , 2 L(` ` " L`2& $ ,&!0*``U`+ 2`2` # @2&>@!  ] " T0$ XP _  ` .  㿘  D&@ &` `$&`  &`  &` &` &` &` S&` &`4  &`4  `4 &`4&`8`<A `\@< @㿘  D&@ &` `<  >`    >`  :>`   >`   >`(   >`0 &`8&`L  &`L  `L &`L&`P`T `t@< @@@HD '!@HG@>  @@Gw@''| H"!  r` @@H '!@H@'' H!  O` (@G '!@G@''g Hܔ!  [`ؔ p@G 'Ԓ @GՐ@Gђ @''''  2'ܐ''c      ' &㿐@   @ 㿘"` N 0  0`}  㿘 㿈`'`@''㿈@'''H 2 H  㿘G㿘 0  Qvmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map 㿈\ ?N  2`  ?倢` > \*` €                   ' - L  찒 2 2` 2 >  "` "(@&&\0  c cx c c c c c c ch cX cx c c c㿘 (@c ?Y 1㿘  R` "`(0 >  "` 1 =`  ?`" "" $ vmmapbsyvm_map_lock: failed to get lock㿘@: >  !( ?: *` + +@   `+@@ &@ ?㿘@: >    ?+ +@@   :` `* +@ @  &@ ?㿘 `&@ &`  &`  ` &` "` &`@"` &`@@"` &` "` &` ` @&`㿘`&` &@   &@   @ &@  " @ &@  " @ &@  @ &@  @@ &@  @@ &@"@ "`"`  "` `"`"@ "`"`  "` `"`P@ P @E `` '@E  @E آ  25ȐD  "@( @> a(* @'''J 2 Ȑ d ؐW _  h@EU `@ '̐@EU  `@EM  : 2/ؐe 5 "'" 'А'KcЀ 2ؐ  W   H@E  @  '! ?& > ,!( b"Q  h`a"` NVdFv N@"i q N   *@';' @Dؐ@DԒ `'А'''@8 'ؐ  2N I_ ?&D   = а 9&*@'' *@ ''J)@D  ''''@8Ē '  2 I&     *@* 'J㿀`  `` `  :` 4  N  .˒H/` /@`"```  ?`b  $`*@$`?" @$`H o@㿀@   0'` 2 "   '`@8B   : * +@& `  x@    dܐ'J㿐``> !(*` @''JG  &@   N $a  @` !x` !x "@J㿐 'Ivmmapbsyvm_map_lock: failed to get locksvr4 socket cookie mismatch㿘`(>    > g!"!"` ""> g! " > 2 | t2 | x2  |   "& |KH&   2 㿘`(>   > g!"!"` "!!2| 2||`"`"|"@ ;Ԓ 02㿐>    > g!"!"` "  9ݐ $ x$ t$$   h ǖ ; 0 ` , , > g!!`$ | |"` |"$ " 㿘`?`> P*` € &`  &`  &` &` &` ⵔ s s t, t t t vmmapbsyvm_map_lock: failed to get lock 2 2 2  2 @2 @2 2!2" 2(H 0 a G&!W  0P0!J > !'  2``2 '  ` 2*ؒ @6.@ W7Ȑ  N A  2 @  vmmapbsyvm_map_lock: failed to get lockunknown㿘@6` ?  2`  ?**&@ <&` 0   &` ?&` ?&` >&`  bؖ  2  * *`@ &`$ 4&`0 &`8 &`< &`@ $&`D (&`H ,&`L @&`P <&`Tb&`X&`\㿘@6 ?  2`  ?**&@ < >` 0 @  &` ?&` ?&`  >&`$   2  * * &`( 0>`8 &`@ &`D &`H $&`L (&`P ,&`T @&`X 8>``b>`h㿈` @'''@㿈` @'''@M㿈` @'''@|㾠@Ar ' `@Au`> ' ` @@@`' 2" Q ` '< 0 2```@  㾠@A6 ' `@A9`> ' ` @@@i`'o 2"  ` < 0 2```  㾠@@ `''@@ `' В   ` 2`ݔ  㾐@@ @''@@Ւ `' 2" ` ؒ< 0 2`@`  㾐@@ @''@@ `' 2" ` < 0 2`@S`w  㾐@@m @''@@o `'C U ` 2s`P  㿀@4 `A   㺐%@4p> a!@4> ja/@3!> a!/@3> J!/!>J(2  J J* ) * JJ#2 J J* :  b@*@3!@/%0unsupported㿈@ 2`! "'>   +  N0n"!>4>> "<  ! "> !"! \ N"> E" N0T> j9!7!5!3"@> 0 > -!+">("P& !2@N 29` '#\  M. -!2@< 2'` '#\  M @9 `& ( ``Ȓ 6` _㿐` N@' `@'' Np@?; 'Ԓ @?>'> @@@>n `@`'ؐ   ''''  "0'ܐ؁㿐@?  '@>  @>A@? >!(             ?   㿐@> '@>  @@>`?&` & & "㿘`?&` & & vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map @> '@8 @>' `@>|'p $ 2 Z ` 2 <  2 2  '耢    `2`2`" ` ` 2  (*  2 㿘` @@2_ .`. `6 `& 㿘` i@@2N j` `. @* *``2@".㿘P  (&@R@ "      &`   &` &`&` &`&`&`h  0   ʔ 2(˒Ȁ   N '؀ 'ܐ  '' @''' ' ''''㿈  㾈 "8    2.  ( ''ݟ쀢 " &  '   N  ( ''x'|'tb  h ,0   K , 2)L耢    N ''̀'Ȑ '' 'В @''''' '''( ,㿈     2'-㿘?"@` &># *` €"ՔZI   hȐ@1  ,,8(  Œ "  2   ?  ?'' ,''''&''''' ,     x  2Ux "O   J N耢 1 Z0x ( jaOz !z 20'@% *` €fQJ ' '䀢 2?` @ ?'@ ` '' 2)`  `4''  &Ag j  | ȝ @`*@@ 2`   "`z?'`   m?'ܐ ܀a y 2[  2U N܀ 2Q NȒE ܀ &C @@ א 2 jX> j@9S '$$@9WK 2'؀ $ "`  N@'L'H'P+HH '0'4'L@?('H'8'@(&㽨@ *@`@-K!@ *@`2`c  "`0Y?''`  0L?''< C ?Ȁ?= N@  7  j@8 ' @8Ր@8ђ 'Ô  ``"@4 ``  @ P @B߰   ? '''''$`'''ݯ       '''''@  2ݰ N'6 ('8 (?'''$`   ?'''''$`@''ؐ'ܒ؉ $`K    ( ''''''@  2 N' '=6@" '''''Ȑ (?''̒`']$` $ #! $'!!' o@  i NÒАǒДȐ ''''@'''' L F '@  2? N' '0 N''$`)$`` "` ` ``  ` `  &vmmapbsyvm_map_lock: failed to get lock!,"^ ! n"Z  2"V  S`Q K< L` "H  5 C` 2 >`)`": $"6 "X' 1`'$ ,` "&  `% `           * `2`` 2``2  (>((# ! 2 K n   !,"X$' )` "#%" !    ( 0 8 @ H P X ` l x㿘  " .`  " .`  " .`  " .` !   " .`  " .`.`  .`!  " .`  " .`  " .`  " .`  " .`  " .`  " .`  " .`  " .`  " .`"  " .` @  ?&@ @  ?&@ @  ?&@ @  ?&@ @  ?&@ @ ?&@ @@ @ ?&@ @ ?&@!@! >&@$@" =&@(@( 7&@@@$ ;&@ "@@ *@&@  `  ?&`  `  ?&`  `  ?&`  `&`( |&`  0 " a  0c b&`  @`$ ;&`  `( 7&` !` `*@&` "` `*@&` $` `*@&` ("``   *@&` n&`$ `  ?&`  ` ! >&`  `   ?&`  `   ?&`  `   ?&`  @`   ?&`   `  `  *@&`  !`  ` *@&`  "`  @ ?&`  $`  ?&`  (`   ?&`  @ `  `  *@&`  @`  ` *@&`   @` $ ;&` 㿘  ` 2.`.`  ` 2.`.`  ` 2.`.`  ` 2.`.` !"   ` 2.`.`  ` 2.`.`.` !.`  ` 2.`.`  ` 2.`.`  ` 2.`.`  ` 2.`.`  ` 2.`.`  ` 2.`.`  ` 2.`.`  ` 2.`.`  ` 2.`.` @  ?&@ @  ?&@ @  ?&@ @  ?&@ @  ?&@ @ ?&@ @@ @ ?&@ @ ?&@!@! >&@"@$ ;&@(@( 7&@$@ @*@&@ "@@ *@&@  `  ?&`  `  ?&`  ` `*@&``  ?&` (`@ &`  #!" ` "#`0 ` &` $` @ ?&` (` ?&` @`! >&` @`" =&` @`$ ;&`  @`( 7&``*@&` $H`@&` `   ?&`  !`   ?&`  `   ?&`  `   ?&`  `  ?&`  `  @ ?&`  `  ?&`  @` ! >&`  @` " =&`  ` $ ;&`  ` ( 7&`   @`  ` *@&`  @`  ` *@&`  $ `  `  *@&`  "@ `"`  ("` "` * $   2@ ` 2`  2` *`2` * $   ` " ` ` `gx`,Ȑ`hx `@ @'9 $   { $v  `@ 2m` %``` Ȕ $ 2X   2Na C Ȓ?#`>-!*` €      @&`h@    2 `g@X          vmmapbsyvm_map_lock: failed to get lock *@ *` *` *` *` *` *@ *` *` *` *` *` *@ *` *` *` 2` *@ *` *` *`R "` *@ *` *` *` *` *` *@ *` *` *` *` *`  ?`#`w&>."*` €`w@ 2ð  2  2 `vu`c`@ l ؐ  2     {`@ vȐ[B   2f> `X`t@ Sh r  2CK `u5@ 1 ^* Q  ~ " 8  }    }   ~@   ` `   L   vmmapbsyvm_map_lock: failed to get lock㿘!$`(`'La :X @$ؒ!x?&`( $` L$` `$`  $` $` $` $` $$`  ($`$ ,$`( 0$`, 4$`0 8$`4 <$`8 @$`< D$`@ H$`D L $`H&`$ $ &@pc or npc are not multiples of 4! 㿐 $`(!q` :  @ 9!$   >/j!@ `(< @ * # #  #  #  #  #  #  #  # $ $# ( (# , ,# 0 0# 4 4# 8 8# < <# @ @# D D# H H# L@ @@  `銒?" @& ?> *` "@"` "`"`@"`>0*5 "` . "`  0%   0 "`"`>0(   "` "`    "`"` ` h p  < 㽐>  `$a$a aH @  a*@ aa#a  = ?xՖx! ?'''l2 ?p"  ? >&9 >&>&!TX="c"@ `$H$$$T_SVR4_GETCC T_SVR4_SETCC T_SVR4_SETPSR 㿈> ` L@a$5 ?``81 >0#`*` €>0i!"8" >0i"H $ 0>0i"X $ 0*`" *  * $ 4$ 0$ 4  `$ $  ´ „ ,(sparc) svr4_sysarch(%d) 㿘@>0iY# vmmapbsyvm_map_lock: failed to get lock㿘vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map㿘` `   `!" ! ! 0  <  3 > !&avmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map       @  " $ "@  2 "` 0"! @0 0@0 "#@2$2(  @ > "`H("`$"`( (!   2 @2 2 2 @2 2  "` " *` " *` " *` " *` " *` " *` " *` " *` " *` " *` " *` " *` " *` " *` " *` ! " ` *`"  `*`   `*`!㿘       @     &@  &`  !"   0 "#0   02@2222 2@ &` 2  2 2@&2@2 22 &` >  (oc & ` &`  `   .`  `   .`  `   .`  `   .`  `   .`  `   .`  `   .`.`  `   .`  `   .`  `   .`  `   .`  `   .`  `   .`  `   .`  `   .`  " `   .`! !2.` .` !.`.`㿘 6@  6` ` 6`  6` C.`㿘&@  &` `&`  &`  2.`X`@` @*@  2 '  ` -v!!">`Q`a "a` a5A0e >`$0]`d"` !% 0O "*`0D  0># `%"Ƞ  # ` "l  !0"`0(`e"``!g0`Ԑ0` ``&010! ,, -"Ӡ x0)( `  `  21  -0 !ۀ#0a"aҐ a $a50Ȑa"R8a0a[0a/ a-aa00 !0!!0 &``m  ܀ "'܀  `Y 'Y  ' `bw`h n`;  h77`g^`hఒ U'`'$ L`vE&`̒`w  >(`;`< 7` `"2 00` +%&`'  ` L` @2 `hO`  ݔ $h`Д  8 ` #>3`` ` $ ٠``  ̰`  Ű`f`  `_`y  `r x`e  `^ X`Q ~x`D qa~ j`= e`0 ]a# V`) Q` IC` <a 5` 0` )#` a ` x`ڔ `͔   `Ɣ a  'h'l'p't'x '|''' '$'(','0'4'8''X'<'D''HL'P''`h\''//'''''''} `q ?'h'l'p't'x'|'''' ''''' ''$''(','0''4'8'<'''@`D'H'L'' `/2   /H`O `/2   /0"ah O"09a 3` ' +`` '``"' 2 ' `   ' - b}wCR "  "2@?? 2@ 2` "` "` 2`2` S  " 2 ??2  2 2  ::  ::S "X`?` O>7"*` €>  ` 0 @ ?*@ @9&`@(}'`@''@(} `'Ȓi  :Аe  01 *Ā 'P  !}`M  -``>   0  ?.  H d d ݈ ݈ ݈ \ \ \ \vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map㿘@ ?"@ 㿀@( '@> @'< `&@'''㿐@' '@>  @'$̔㿐@' '@>  @'@+㿐@' '@>  @'@+㿀@' @'> @& `'`@'' H㿀@' '@> @&֚ `@''' 1㿐@''4.2ffsnfs`@'v '4    ` @@&`@  2~>8a@$  >84@'Z  &@>8!L  "ega@$  \` 6 8 2Y.  2Q8  4/8 X@'-&`  'H @''  > `  ?P'L'X'\'``p'd d 'd'hd`'l@'d'pĐ't'xL'  2` H X 2g㿐 ''qǒ㿐    @'㾈`` ?@ @ '7`'7@<!@  @ `@"$`$@㿈 r@ ( <`  `>9`\' ' @) ` " &x`?2H ` ` B @*@'䀊`'؀  > b ฒ@*@ *'` :``?`' ''`+ @@`R` `(`< `}`  ?''ذ㿘`  㿐 @ =`2` E   "$ (`( 2 ``> !8*` &``  `  % `  ` "`0 $ `(``*㿐 !2 & *@ $ (``<`   @d @   ` "$` $`   10@ܒ e> !V > j!Q > /!K >: F >"@A @섔 e㿘`  @ 4$ِ0$㿐@%i '> @@$ `    K`2`2` 2`&`  ! ` ,  @* R `  `a   N㿀@[ `    㿘!  ` ` `|`x  ,` g   " & Q   "& &  X @@$ $ ' ' ' ' '  @' ''В'H@$ '@>  @$@ @'''''ថ  X  D    <>*@$ D`㿐 q@ `( X  D`   <>*@& D` 㿐@$ '> @@# `< @@ K0@>;|(">l" <" ">t " "„"     $ 0 < L L X㿘@   "@@-"㿘@   "@@-4㿈@> ! 6 > !L* " ` '`'`''z 㿘 !2$ > a @  a@@"```@ @ 㿈@`> $` ;`"B ` ',`  '@ $ $  !* 2$ ! "!  $ ! "   $  * `$ ꬔ 2` Ꝕ " ?!   $ (  @&j % * @,`@@>,`@*` ,  ', @3 '`H* , `H`@&, '`* , ` @, @'U Magma P2 SpMAGMA,P2_SpMagma P1 SpMAGMA,P1_SpMagma 8+2 SpMAGMA,82_SpMagma 4+1 SpMAGMA,41_SpMagma 2+1 SpMAGMA,21HS_SpMagma LC 2+1 SpMAGMA,21_SpMagma Fast 16 SpMAGMA,16HS_SpMAGMA,16_Sp_2Magma 16 SpMAGMA,16_SpMagma 12 SpMAGMA,12_SpMagma 8 Sp - 422MAGMA,_8SP_422Magma Fast 8 SpMAGMA,_8HS_SpMagma 8 SpMAGMA,8_SpMagma 4 SpMAGMA,4_Spmagmamttymbpp㿘!?΀@.`  && "@*`" * *   2 @@ ,`h H( h(  * H MAGMA_Sp㿘>=@Da(`?magma_prom pri %d softpri %d: %s (unsupported) %s 㿘> >=qaX%>=@`"@ 2`<h\Ɣ @`2`>=!\0>=\!&``,&`0`0 &`4H ` &`t` &`x`` &`|`I` @ K ~` +  + 4 &@ @  $ @   `@$ @ *@@    @ܐ  `@  *"@ *`" *  *  &!: !@ɒ#,` " ``0 2` * $ `` `0 >?`4`+   "`0>?c BI >Cb BC >>``&`&`|>?!<&`&`| 㿘0    4 g@ ` `d `t %3 *` *  4 `??P `? b?*`?"@" 2  8"*` *  4@ @  b? ? `$ `  `* `b* " 2 ?"  " `  "$  `*@ `! | 2`*` *  4 `m    "" "  `*@  x `(2`* *  4`  c *@  "`b"  ] *   T"* *  4@ 8@   c*  *    ?#     c*  *  ` ?#  ,` 4 , c (   # ,`# (`*`* ,` $ ( , "  "     *   ? #  `*@  > `  0ΐ %s%x: fifo overflow %s%x: ring buffer overflow 㿘  u 0q >!4,*  4 `p _  $@)>!,)>?     @    $ @   !Yr `h*`@ €  $@ݖ Ho o ?$ H 0   `h*`@ €   >?a  YG  `H (`P" `p `h $`p* @ 0,$ 0 4  "0Ho o ?$ H 0  "06Ð 0 P >?    `? : %d tty%s s㿘&    +>?>B>B! c$ $ $`$   &$`$$``  ?@"    ,- * 4 4 &@ `@" $` &`0c>@ >@  Ymttydcd㿘>   `2`  `ሑ* @` `0, *  4@` p b$ l"$ pu#  c$ $ $ `  $ ` @  $ `   $  !%$ $ $ `$`$$` H /e * & @ h `,`*  @   @  *@@D  * ` `2 p`  p &$ p ?#$ p$`I H /e `H 0 p =8$ p* & ``   p " #>@$ p !a8Θ   p "H 0 h>!*` €㿘> !  *`6  . *  4@ > h!*`  €H /e * &  @ p  @: H 0 㿘  > !6 . *@ *`@`<> h*` 㿘  > !6 . *@ *`@`<> h*`   > 2 * *` (<㿘> !  *`6  . *  4 > `h!*`  @ i a ]@ P `y@3`x@0P `z@!`{@" G  k@ "+  j@*\@"0 8 l@m@"/    $ ; 0%    @ 0@ 0@ 0 @~ &  &!2 "  $ l> * 0(@(4H4p(p 2 "p " H 㿘 l> `! `*2` *` *  4H /e4 p* & p V  H   & p4; Hn  H    H$ , P$ ( p & p H 0 H(  h(";`"' 0TDQ l2 m2`@2` 2` "a`@6 "2`@00@22` m*2` l(0! @ ` m *` l *0` @ ` m(` l(H  㿈 l> a *2 @ * *``4`(       2 `$   耢  H /e * & `(    S`(`  v r* * `$   | x* * @J   @G `@ @ @ @ "`$2 #!"  " "" *@`@  " *@  * @   @  N *@ *`@@2  "`` *@ * ! * H 0 >C    `? : %d port%s 㿘 &   !>C`l`T `4->E+>E  4$ $99b   P P` P>C&`0 # >@ >@  VF㿘>   6  ` ᴑ* @ "[  06W * *  4H /e4 * &    H 0<  & H p@$& @C?& @@  '& H /e * &  h*@@H    @D  * H 0 &   > 2 * *` ( < 㿘@f㿘@`㿘>  ! *`6  . * ` 4@ #  @&=   @28 #83  &/ $$ + @$ @$$  &@ &@ &H /e * &  h@* @ o&H 0  mbppdelay㿘>  ! *`6  . * ` 4@   @ 8     `$ $ 8   S5>D @@` 2  % PK  G  $$`H /e * &   8 8|$ !x /i H 0 "` 2 `% ` @8` %   2`H /e4 * &   8   ?$   8 8  ?$ H 0`  %` &` 㿘  1& 㿘  0& mbpp_send㿘& & H /e * & 3>E h*@ r * @ʒ   @ǔ   * bȐ! .Θ  h*@ *@   @ @   @ H 0 &mbpp_recv㿐& & H /e * & 13>F h*@a"  | x* `  * *@ @d   @a H@Z   @W   * ` ! .^  h*@ *@>   @; H 0 &㿘  . "* >X@ )* 㿘  1>!X@ #耢 !X@ #㿘@   `@  ( spifsttysbppSUNW,spif㿘``@ >F@"   : expected 2 interrupts, got %d : expected %d registers, got %d revlevverosc: rev %x chiprev %x osc %sMhz stcpri %d ppcpri %d softpri %d 㿐4`>FSZ"0􀢠>F#SP 080 y &`x>F&`h c@h+ &``>F`hcHh% &`d 2%&%"%&`d`x  &`p&`l k &`t*@`x@(`x`H`t`<`T`0 h@  hk  *p`x *hq`x *(a`x *hb`x*(c`x*h@`x*(A`x*hB`x*(Ccm`d`` `t#\>FR#P>Gaؔ 8 >L  8c>M`&`H&`LsC>L &`<s<&`@>L!0&`T s5&`XO>G؀ |`?: %d tty%s s㿘& | )>G_>J>I#c,$ $ &@$`$`$   $` $$` l,* *  4@,`0 x $*o &`0">G">G"  Rsttycd㿘>   2`  `> a  6  *a @ 0+   *  *  4 p W$ l"$ p#  c$ $ $ `$  $ `$ @  $ `$   $  !%$ $ $ ` $`$`H /e * & x ` *dx@ ( `  x*d@x P*`$`2 p`(  p %$ p ?"$ p$`H H /e `H 0 p =7$ p* & `   p " #>G$ p !cY   p "H 0 h>!*` €㿘  , > b * 6 . *  4@@ h>!*`  `€H /e * &  @  p   @x *hdx*(H 0} 㿘  * > b * 6  . *  4@@ `h>!*`   @ e ] ]@ L `y@4`x@1L `z@`{@" ,C  `\@ "4  j@'7 `k@`l@".   , $ ,x *(dx  *0   @ 0@ 0 @ & $ &!2F "  $ $ H(x (d"5``0O?LK 0  x(2a@2`@ 2` 29`07  + 0x ( `+ 0x  (`#x("`+ 0x (`@ x(` + 0x (`x(((H  㿐 l> ` `*  * 2` *` *  4`(    d@ 2 `$   d@  H /e * & `(    X x  *hd`@ @ @ @ "`$2 #!"  "  x"" x B*( x@ (`@@  " x D*( x@( x *h x H@( x *(  x *h  x *(  x G*h  x @* x*( x*h x*(`(` x*h9 x*:`$ "  x x*h1 x*2 x @ʐ( x h( @$ (H p@ 㿘  *@ > " *`6 @ . *``4 > h*` 㿘  *@ > " *`6 @ . *``4 > h*`   *`> (2 *  (4l> * b (0((4H4p(p 2 ,"p , " ,H 㿘 l> ` `*  * 2` *` *  4 H /e4 p* & p" V  H   & p+ Hew  H   H$  P$  p & px *(dx  *H 0 x A0(( |( z4* xx*" 2  x ",", x`( "@" `x A0(((`|46`x*`xzx*" 2  ",",`x ( "@"  x (A0(( |(4, .  *({ x *({, ",,  x({ x({,",? `" " x({ x({ $ " x, "  x x  (*(,߆",#@ x (x A0(( (|4 @ , " ,"@x (x(㿐'   x ,w ```P@2?@?< x  x lv  2?o@? x  lu  2?@?< x  > `  0ɐ %s-%x: ring overflow 㿘`|   0 >!4,* *  4`p` n  @!>!,    @ $  $  @  `h *` €  @ Ho o , $ ,H 0  H /e * & `x*(d`x (H 0  `@$ ( `h* € >La L9  `H `P" `p `h $`p*@ @  0,CCR: timeout 㿘.`@. 2 2?#@2..  >LЀ `?: %d port%s 㿘 p @& >M&`0` >G">G" M*    㿘@ 㿘@   㿘a"  ``>LM#`. bppSUNW,bpp㿘>M@ Da(`?: Zebra : DMA2 : Unknown type 㿘8 0sw &`@@% `@< @ @ (@>M0 >ML̐!X0>MLȐ!h0LŐ!p@;%s: draining still active (0x%08x) 㿐 @'    @`@'   >M"L !` @ " @@ ?"@ @ ( @ *`㿘?> h2 `   h* @ 2N <  2  ɐ$& 4 . <& 0 㿘?2 >  h. @ 0 @Ɛݩ d ݤ d 4( , <㿘 0 "B   @ `  ` ݊#   @ ` 2-  ` " 8'   & 8*` @ ` *` @ `2  @l#  $ @ @ ` "  `` *`2 0? & 0㿘?2 >  h. @ H $ 8$ 0 ` 0@&` $ 0`$8$ 2 4  xboxSUNW,xbox㿘>N@ ! 2 @ model: model %schild-presentfalse: no devices write0-key P>Nb(`z>NK0>Nb@`r>N@ bP 0>NK"X0  r! &`P<  r &`TH  r &`XT  r &`\`  r  &``l  r &`dx  q &`h  q &`l  q &`p  q &`t  q &`x  qߖ &`|  qٖ &`a4 " '>N@ a 2'8 '>N?bh`@`P* `&`@&`< "`<@`P`8*  "z d@)`0>NK"xb!D8 `'` ''>O|1 ranges%s: PROM ranges too large: %d 㿘>O!  @_ I  & L>O!( J05 @ |& H L @_ H (`< * *    L`8  @2 `   " `8 L@ ` "   H&`<%s at %s㿘`>O J"p vmmapbsyvm_map_lock: failed to get lockexternal battery discharginginternal battery dischargingexternal battery charginginternal battery charginglid downexternal mouse attachedexternal keyboard attachedexternal VGA attachedexternal battery attachedinternal battery attachedmain power availabletctrluctrl㿘>P@ `?: expected 1 interrupt, got %d : expected 1 register, got %d pri %d intr%s: %s%s, 㿘4`>PJ @0m >P `J0d8  p0&`0>P&`@I `0.`u  `4`|#`    * >P`0  >P#0&`4 j<&`8>P`3E`L &`L@Z`P``H `>PIƐ `H>P  > "%>P#>P"6, I`6 >PI `L &`L@1`P` D`0*@%s: (op=0x%02x): unexpected data (0x%02x) %s: (op=0x%02x): unexpected ack value (0x%02x) %s: (op=0x%02x): unexpected data (0x%02x) in state %d 㿘  0 *  w x@  ? ?   L " P  H @  P "  >P5 v ">P0 v>P L & L v"IB  0" z>P v"I9  z. y? . z  & P y d . y * y z@2 0& P@ 0" PI  0 P 28 w L. w  . x ? & L. T. x!. z   ?    ? & L. T. z. x   ?& L@@   x ?& L@8  x "  w 0 `"* 0  w x `:f 0 b`. w T @  w x2 P z ` & P T. v 0 @ *@J 0 2G 0 T . vA& P`  !   *z*T*U*x*VH@  u2*V *V !   *z*T*U*x%s: SHUTDOWN REQUEST! %s: VERY LOW POWER WARNING! %s: LOW POWER WARNING! %s: main power %s removedrestored㿘 v "  d ! "  d0="7 d0: e*  6& H e*  >Q"HX  >Q"HR  >Q#HL >Q L H c& L >Q#0>Q#8H9   L & L U V @. t㿘> ###  `Ho oL  c"L`j ?H 0㿘> #1#  -) Ho o u  "H  H @ *uH 00 L `\"LH 0 0 c 0" 0(㿘 0a b      0 `  * @@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"&   &    "    (+  2 2 " 2+J " ?  $*0 ` + +    "* 2"* @(*`  *02 @"@ @b 㿐  `   ` @`> b    ?2    *2@ 2  &  4 @     `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*㿘  `   `  @   ` " @ ` ?  2  H;j&. cv" "" " " " 㿘 . 2  ?&   &  6 @"@   & @@7  ?@3 @ ? @  &@l@㿐 @6``2  ?7 x 8" > c    @   @V XP    @'@"'5ک/@ @  x@@ 0`(` @/@:1@ #V@@ 7`/`  @)@@   ے@  7 /  Ĕ(@0os@ "@ 1 )  /@ @ =_#@ @ 0`(` @̔/@@ "*@@ 7`/`  @Д)@* @ "@ 7 /  Ԕ(@?Q@ !@ 1 )  ؔ/@ `&@  ؐ@@ 0`(` @ܔ/@"=@ #@@ 7`/`  @)@?֒@ #@ 7 /  (@"W5@ #@ 1 )  /@ @ !"@@ 0`(` @/@?f@ !@@ 7`/`  @8 @)P@ #@  7 /  8 m@  !@ 1 )    =@ !b@@ 0`(` @ @0,@ #@@@ 7`/`  @(@@ @ "Q@ 7 /  /@:m@ #@ 1 )  / 5Ē@  ]@@ 0`(` @)@@  S@@ 7`/`  @(@@6(y@ "@ 7 /  /@@ 9#Ȓ@  1 )  / xs@ !@@ 0`(` @)@0@ #֐@@  7`/`  @(@@=5C@ !@ 7 /  /@V@  @ 1 )  / *x@ !@@ 0`(` @)@@ ?;#@ @ 7`/`  @(@@@ "ِ@ 7 /  /@#J@  @ 1 )  ?@!B@@ 0`(` @@!}@"@@ 7`/`  @@gX@!"@ 7 /  ?yN@ @  1 )  )/@"D@@ 0`(` @Ȓ@@#@ @ 7`/`  @@=Ғ@#`@ 7 /  /@ p@ 1 )   &ߒ@"Ɛ@@ 0`(` @@:I@#@@ 7`/`  @@5;̒@ @ 7 /  "@!@ 1 )  6u4@ 9@@ 0`(` @@9@!@@ 7`/`  @@蟒@ @ 7 /  1+@"e@  1 )  1= H "D@@ 0`(` @0@ʿ #@@ 7`/`  @7@*@ #@  7 /  7?$@  9@ 1 )  1V֒ !Ð@@ 0`(` @0@#3  @@ 7`/`  @7@?@  }@ 7 /  7!a@ !ѐ@ 1 )  1 "O@@ 0`(` @0@?9 "@@ 7`/`  @7@(P@ #@ 7 /  7@ !@ 1 )  Ȓ1=ߒ "@ @ 0`(` @0@/N "5@@ 7`/`  @7@ "@ @  7 /  :ᴐ7c@ @1 )     @& & & & @> @  `*@ 0* @*  @* `      +` *`  (*  ! `   @* * @ * ** 8  %c㿘 '>X;    &&@"  @ @Aِ.$>XAѐ!?٤!>XAʐ!?0Р @>X >X>XA! 0Ő!(A. J@   J@J`  ?*  8 B  ?*@    2@* *@ 㿘  `  `  @/# @*   & &@&&`#`"   ` 㿘?#@6 6` ` @ & $ @$@&@ 2   *  , "@@ 4 "  "  , @@ 4    -`@@ 5`  @@*  @@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   & &  'D'H'L'P'T'X2J  J@ `2J 㿐@Q㿘 J J 2" 2N@@  @` *N &* J " "  `  ?2  㿘@  H 'T> #`@\ T ;9?T2 7耦(7耢 2: - 4`44`44`4`ؤ45 5 ȕ4'5 5  A'7' `@$`@`*  @@`*  @@`*  @T  @T :-`-2 ,`- ֓2`    `" ` '``? '8  đ. ?2@ Đ"  * c'Ā@ '.` @ '   @ @?  7 /`@  `7@', @@9`'*̑2 -2, @  ?#   * ?9@#.  ?ϰ$$6`6'  @"6``4@  * . ?  @26`@4@2@@ /`T$   . " @?* :@ @2. 4@*  *`@ T:@̑* Τ Г*`@  +    ?( 8 2 + ( 2@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &" @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  ?* J" @ J2  @(*`   * 4 ?: :  *2@ :    4  * *  @    2J@ "J`  2J@   88 @@ @   `@ @ "`"  ?*@    2@* *@  @( *` @ (* + @ @ ` ``z  @Z( 2 "" 2 @  &vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapH/ / ?"@  " H  H/ / ?"@" H  㿐 $!'! ` `'{  @  j  !  $!$!$!! @$! 㿈@` $` `2`C  .,`  '@ $ $  !* 2$ ! "!  $ ! " ,  $  , "   $  * `$ & 2`  "  `$ $ 㿘``@  vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map㿀@ '?'''@ ' Ҕ vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map@  $'*`  , `*` ,@$@$`" LJV |L@ /w `@J?`/?N /2 @ '''. '\' ] /3. @ '''''M N''l'h''Ch A 7 x /@ `@`$ `'@ "@@B  ' ?2 'ϒ N` Ix0FxD    @ 2  *@  22"  0= 4 > ` 0= 4   8 # CLGET: returning %x 0 t@ ݔ )c@ "O |  b@ ":  @"? N?@ "" hI?@ .!>  |@ >?@ 9? ` @` @5 `@"  (`@%`}@*%? `@y`u@"?  s ?" . s֒ ?" .`.`@.6  ' ' ' ' ' ' ' ' ' N'쀢'> !4* 'N4 '> !4* '/@/V?c?  & t@;  @     . . . . . . ** * * . *N  * * * **** . . . . . y. ' ' ' ' ' ' ' ' ' '@i'  ~@ "8  }@ @ ?# *` * * *& t@4 `#@=: &>  `/>_#9 +  $& '`& `bhS &     2 40&? getflags: %x 㿘` @ ````  "  @ ! 2  $2 "   " `t # ` 2@@` 2 `2, @ @  @(0(0>  ` >a!8e t@``` ` `" ? `"  l" `@ @** ߀` * , :`$ >! `@"    * * @?  @#  @" <" @ "`"@"`"`  t@`` ` " "*@*" " @2 wh @@` (0*   `  @`*  `` ` @@"`"@"`"` vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapreaddir_with_callback: bad reclen'H`@ 'P'l'd'h `(<  > ` `ީp v@8*  ਒` V`ਖ ''''''''?ؖlh߹d ;蠤7d 2  )$3>b"@5c@ @ P  "  @$  ``‎  l "` H:ਐ d "   vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map 2@ "` 2` 2`  2`  2` 2` 0? 4"`"` "` "`  ("`( @"`0 <"`4 D"`8 H"`<㾰@ D'8''4''<  M  X’` @㾰@ '8''4''<  +  X` @@`*@@`2`   X `ڔ @㿈`@: '?k㿈`@: '?%x`ؖ`: @?''E &㿈`&@'''P N g@ 'x` 2`( '|| <  `` '''`' '''[' |?X`@ 't ؖ X 'x@: `%@8؄????'''  ' | 5 'x :` Ȕ$    *  'xP'xƒ | ރx E`@ > `ؐ????|@x 2y|x (`@2` | @ "`  X`< "` ` M'| | "(:` X| ݐt`'x"@ &㿈@ `  '`?''㿈@ `  '`?'i'vmmapbsyvm_map_lock: failed to get lockh@``` 0& 0#``'`'` ''Y` `'`''Z ` `'`''[`@``` 0-`  0(` `'`'']` `'`''^`']f ` `'`''_QX@``` 05`$ 00` `'`''Tu&``''U``'`'` ''U``'`'` '`''V㿈@ '''㿈` @'''rbvmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map㿘`  6`>!26&& & &&&& T  &$&  N (D&(,<&,0 D&0TL@ Z< ZP@ @'''''W  X``D`  `^!㾐 (@ `( X``D`  `?!㾘> `!`!Ȥ@2` 9 />   `(!6  D ` V! aȀΐ` $ &&0& vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map>  "x`> ! `J `@'` ''''`  '`   '` ! '` ( '``: '?pP؁vmmapbsyvm_map_lock: failed to get lock㿈` ''@#\  $ 㿈 @0!2   ` '@#\  sparcX> a 3> jax. > a )> J!ז!>gJ(2  J J* ) * JJ#2 J J* :  a* @ 㿈E `    `7   㿈  `  2 `7   㿈 `̔  2 `7ɔ   p` ` `'''@''Ԙ'''ږ 㿘`  "` q8`   7#3 (`*` Q ` @'*z `@'쀢`   ``i  p`` ` ''@''Ԙ''''B؁8` ?  (#$ (`*`  (*  ` '@' vmmapbsyvm_map_lock: failed to get lock㿐@`$  *`  '#'@ * @` '#'` 㿀`    : :`?@? vmmapbsyvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map >t8" > А "㿈` ''@#\  I p`   @?# @c"?`ea"` b`+ -0% -0"4`fd, -07!@? -03`` ` ` ''''#\' ܘ x o` ` `` ?'#\  `  '#\ ܘ lH R` '#\ ܘ ޚ F#> bn `>  i P `& > a  `& $> a $ `$b>b@ `$` `' ܀8'ܐ ܀ ````?  &`` 㿘 @!2 @> "!а 㿈 @!2   ` '@#\ l " sun4c compatible0 0 f8000000 15c6a0 map-pages" spurlev1lev2lev3lev4lev5lev6lev7lev8lev9clocklev11lev12lev13profd'(4B"  <<d d@@((1v@E@HFGHID @-|5wu  0 0   D<=>?@mnoABCDefgh&'(234#$&'jk2367+;68w5ps"j\"jt"A"C##"A"C"׈"נ"A"D"X"p"A"D"״""A"D"""A"D"ؐ"ب"A"D"ؐ"ب"Bp"C"0"H"A"D"0"H"Bp"C"0"H"B"C"""C "C"""Bh"C"\"t"A"D"\"t"Bp"C"\"t"Bx"C"""B"C"""B"C"""Bp"C"""A"D"""Bp"C"T"l"A"D"""A"D"""Bp"C"""B"C"""B"C"""A"D"""Bp"C"""B"C"""B"C"""A"D"""Bp"C"""B"C"""B"C"""B"C"T"l"A"D"T"l"Bp"C"""A"C"0"H"A"D"0"H"A"D"0"H"A"D"`"x"C$"D"""C$"D""("A"C"`"x"Bp"C"""Bp"C"H"`"Bp"C"L"d"Bp"C"""Bp"C"p""Bp"C"""B"C"""Bp"C """Bp"C """Bp"C "" "Bp"C "" "Bp"C "8"P"Bp"C "|"h"A"D """A"D """Bp"C ""bX"B"C""bX"Bp"C ""bX"A"C""bX"Bp"C ""bX"A"C"`"x"A"D"`"x"Bp"C"`"x"Bp"C """Bp"C """Bp"C """B"C"""B"C"""C"C"""Bp"C """A"D"""Bp"C """Bp"C "`"x"B"C"`"x"C"C"""Bp"C """C"C"""C"C"""Bp"C #H#`"B"C#H#`"C"C##"Bp"C ##"Bp"C #p#"Bp"C##"Bp"C #"b"A"D#"b"A"D#"b"Bp"C #"b"B"C#"b"A"C#"b"Bp"C #(#@"B"C#(#@"B"C#(#@"B\"D#(#@"A"D#(#@"BP"D#(#@"BD"D#X#p"B,"D #X#p"A"D #X#p"B"D #X#p"B"D ##"C$"C##"A"D##"B "D##"C$"C"#P#h"B8"D#|#"C"C#"b("Bp"C $1D$1\"Bp"C $1p$1"A"D$%$1$1"A"D$%$1$1"Bp"C $1$2 "A"D(%$2 $28"A"D(%$2P$2h"Bp"C $2$2"Bp"C $2$3"Bp"Cxh`XPH@80( 7 /p < |D Jh bP Ƞ V( -P l ¸ 1Z@#laWARNING- cannot determine Expanded LUN capability- limiting to one LUNTarget %d Loop ID 0x%x (Port 0x%x) => Loop 0x%x (Port 0x%x)Target %d duplicates Target %d- killing off bothRetaining Loop ID 0x%x for Target %d (Port 0x%x)Retained login of Target %d (Loop ID 0x%x) Port 0x%xLogging out Target %d at Loop ID 0x%x (Port 0x%x)Command Error in PLOGI for Port 0x%x (0x%x)Could not get PDB for Device @ Port 0x%xPDB Loop ID info for Device @ Port 0x%x does not match up (0x%x)PDB Port info for Device @ Port 0x%x does not match up (0x%x)Target %d (Loop ID 0x%x) Port 0x%x dumped after login info mismatchNot RESPONSE in RESPONSE Queue (type 0x%x) @ idx %d (next %d) nlooked %dHBA attempted queued transaction with disconnect not set for %d.%d.%dHBA attempted queued transaction to target routine %d on target %d bus %dHBA attempted queued cmd for %d.%d.%d when queueing disabledSCSI phase skipped for target %d.%d.%dLoop ID %d, AL_PA 0x%x, Port ID 0x%x, Loop State 0x%x, Topology '%s'(%d.%d.%d): FIN dl%d resid %d STS 0x%x SKEY %c XS_ERR=0x%x%s CHAN %d FTHRSH %d IID %d RESETD %d RETRYC %d RETRYD %d ASD 0x%x%s RAAN 0x%x DLAN 0x%x DDMAB 0x%x CDMAB 0x%x SELTIME %d MQD %d%s CHAN %d TGT %d FLAGS 0x%x 0x%x/0x%xGeneratedNVRAMbus %d is in %s Mode ??O???OOOO?DDDxDhDXDHD0D DDCCCCCCCCCpC`CPC8C(CBBBBBBBxBXBHB0BBAAAAAAA`AHA0AA@@@@@@x@`@H@0@ @??????h?H?8?(/!OO1OODDDxDhDXDHD0D DDDhDCCCCCCCCCpC`CPC8C(CBG0BGGAFFFFFFhFH?F8F(FEEEEEEEEExEhEXE@E0E EDDDDDDp@80 xQ-Z<<  "b"b"b"b"b"b"b"b"b"b"b"b"b``` x  `````````@H``````````````````  ,-./x002D3t&x?@?8?"dd?xhl?p:?h<?`>?X>?P?$?H>?CL?CX?Cd?Cp@@H@xC@pC@hJ@`|@X @P @H9@@9@89@0@(@ k@k@l@l?l?lh?lh??B??8?"d?"e$?@?xx'%0'%0P"d0'={"g{"i`z"gz"gz"g"i&x 88888 9 7 6 97 5 9 423 9 2 9 1 0 9 9 \/|\/O|/-|2@Pph`XPH@8-Pa'&Nh&NhPX_`XTFefPNgRRgCEh SThNMbdCLe0PLe0REex@RRgCEh SThSL`RRgCEh SThERhCEh SThr|d|l|},}4}~}V" a0"xM"""\"(d"Tl""h"""0`"\""^" "<"l"""","X"$"_"X"YX"4"` "L"h"t"L"""_&5"l" a0"x X" " " h"( "Tl""h" 8" "0"\ " "^" "< "l " " " ", "X " " "X"YX"4"` " |" "t"L" " p"_&"m" a0"x & " .L" .L" &0"( ,"Tl""h" )" *H"0"\ *" +"^" "< .L"l .L" .L" .L" .L", .L"X .L" .L" .L"X"YX"4"` " ,H" .L"t"L" -" .0"_&s"n@ 4 ,nativeX"q@$TTCopyright (c) 1982, 1986, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. Copyright (c) 1995-2001 OpenBSD. All rights reserved. http://www.OpenBSD.org nativeX"q$TT h  @ @!ټˬ    ! !zP~||0|  8   @  0Tl|X!z!Lp|z0t  |p,h (   ,!!!0!( ZZ!DcH d e [ |{}t P!{!!! !    P ! !!|  !z !x!y!yh ! !XXl    T!!!8x!`!,(@\ !!!!P!!{L}H! ! <!!!@ DPQDߔ  ^Pfg {IIIIIIIIII  ,     L $ eL  H|H { a  $  ȰtXLh h @,T`"z"z"z"z"}"zYPYHY@Y8Y0Y YYYYXXXXXXXXXXXXXXxXhXXXHX@X8X0X XXXWWWWWWWWWWpWhWXWHW8W(W WWVVVVVVVVVVxVhVXVPV@V8V(V VVVUUUUUUUUUUxUhU`UPU@U0U(U UUUTTTTTTTTTTTxTp?? 0 \"}"~"~"~B@"D, "~P Q xph`XPH@80(  AP|40\\l Hp@X`ttyclsttyopnttybgttyinttyout@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@6h7$78h=`?G4Y=8=````Y``>=`?G4Y=8=zl{${X`|{=8> N( O`` P [ S> ` 8 < $ =````Y``> }@zhz` }@zXzPzHz@|l z8z0 @}zXz(zHz@ ~pzXz(zHz@ @}z z ~pz z  "" $H)H""DPnetionetconnetcls"ffs "Ȱmfsu4"ʘext2fsQ "lPcd9660ql"msdos"nfsߨ"procfs "null "Hunion"umap "`portal"fdesc"kernfs "X""Ő""""""""8"p"""T"<""0"m"n"p""""("X``2lockf@`  " a0"(" "x""4`"``""L`@&6"P     0 8"D "p  "  "  h"  "  "L  X"x  "  " H" "(  "T @" " " " p"0  "`  "  X"  "  "$  @"P  "|  " 0" x" ",  "X  P"  " " 0" "4 "` " `"" """L"x""""("T"""""0"\"""" "<"l"""","X"""""4"`"""""<"h" a0"x " L" L" "("T 0" 0" 0"  " t"\ " " "< L"l L" L" L" L", L"X 0" 0" L"""4 P"``" " " "L`@" 0" 0"&8"       `" a0"x """ p"("T" " " #0" #l"\ #"^" #" "<"l %\"""", %"X " ""_" $(" $L"4`"``" %" %" %D"L`@" $""&;" `  p     h" a0"x & " .L" .L" &0"( ,"T .(" .(" .(" )" *H"0"\ *" +" .\"^" "< .L"l .L" .L" .L" .L", .L"X .L" .L" .L" ,(""4`"``" ,H" .L" -D"L`@" -" .0" . /@ / /&="@fifo 1 2 2 34 3t 0 a  5xm 5pm 5`&$ 5P"$ 5@"p$ 50/ 5 _ 5"AX$ 55$ 5"@$ 5%$ 4Y$ 4"$ 4$5$ 4$5$ 4"$ 4&6$ 4%$ 4"$ 4$6" >"4`"``" @X" @X" ?"L`@" ? ""&=" EH F F Gd G G H H H H @" IT" K@" K" K" L" K|"4 M"` MT"L Mx"x M" L" L&<" N P P( P P" a0"x R """ T4"("T" Xh" YL"""\p""^" "<"l Z"""", Z"X Y""_" Y" Y"4`"``" [(" [(" Z"L`@" Y""&3" _8 _0 _( _  _ `8 `0 `( `  ` ` ` ` _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _x _p _h _` _X _P _H _@ x z y z z( r { {x {p  {h {` k {X e {P {H  {@  {8  {0  {( $  { $ { $" a0"x " ~" ~" {"( |h"T L" " D" ux" ux"\ }" ~" ~"< ~"l ~" ~" ~" ~", ~"X h" "_" }@" }"4"`" }" ~" ~l"L" }" ~%" devopndeviodevwaitdevindevoutdeviocdevcls" a0"x X" " " h"( "T " " " 8" "0"\ " " 0"^" "< "l " " " ", "X " " " \""4`"``" |" " "L`@" " p"_&;"p  ( (" (" " 4" " " ,"4 T"` " " 4&3" @ | ˄ t x " a0"x `" "h " <" "( "T l" \" ۘ" ܔ" "0 ޼"\ " D" ߈"< `"l " " `" h", "X H" " " l" 4" |"4 "` " L" " T"L " " &I("!#$%&'()-0123456789@ABCDEFGHIJKLMNOPQRSTUVWXYZ^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{}~Ͼ󨷵ǎԐѥ噞᷵ǎԐѥ???????????????????????????????? !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ = J J K| K Lh M N  N$. .. " a0"x '" N" P" P"( P"T Q" R(" T" W" Z8"0`"\ `(" `0" `8"< `x"l `" a" hx" lL", m$"X m\" s"_" |" "4 s"` t " tT" t" vT"L t8" w$" v"< t"_%"X 20123456789abcdef^^3333 ǐ  \#$%&'()*+;,-.;/;0;1B@C= D$E= F$cdeB@LK@B@"`""0123456789abcdef#2F$We6tHZl~3"VG,ud>ɍ@ۮRdv!0g&vD4UJÎXn|1 wf.TE<ˬBُPftBSap '26L^׈hzRC q`(7&:DV`rcr@Q%"40N\թjxsbPA5$*8FTbp,ӥ>@+R:Nd_mv|ҭ$6 H;*Z^Ol}l~ .<ѵ)B8 Pof~Lt]&н49(J Xnn\M| ׅ(:JD[iVx `/r>֍ 2ZKLyh^ h?.zՕ*8kFzHTY-b<pԝ"0{jNXI\=,jxiiiiiiiiiiiiiiii0123456789abcdef  d ,  DŽ ,  \ P p T p ܔ $ p \ P p T p ܔ $ p                S T S S S S S S S "h   !h ("4"h,2"$ L 4 Ř "$ tT"$,mHy^qpr<jh"$  t"$   t "$'  t"$)' t"$ \  t [h e f`"$3  t"$2X"  t"$a   t8"$l  td"$/t  t"$7  t0"$  t ""$ t d}E#(D<8Q @X,2(@AAA==(A* d8@8@ @@@@@@@@@$"d"l08DxGPGXHNV@//242<^ ^(^^c" H!x-ML.RN8D( `hz=Skc|j9{Б/Uڅ?AZX_f ؐ53eiEVmv° GJBnI[#Q")yq~ ruo7ӎbwO$26󦻬^lW%㽨:Y*Fu  ##%%&&))**,,//1122447788;;==>>@@CCEEFFIIJJLLOOQQRRTTWWXX[[]]^^aabbddgghhkkmmnnppssuuvvyyzz|| (06666666666666666666666666666666666666666666666666666666666666666\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\@(H€H¨PP8xÔð` <XĘp 0  ŘŴ,  X!Qt!R \Ɣ  `T X!Qt!R \Ɣ Zƴ' @#LD(9Z r$DDp |$d$d$d$d@      ?BEFF'' EF''' ?F''F'' F''' F'' EF'' ?EF''' ?EF''' ?EF''' ?EF'''' ?F'' ?BF''' ?BEF''' ?EF''' F'''' F'''''F''FF''FF''F''"Z"^"j"""""""""4"R"h""""""""@ h8" a0"x$0"w "v""("T""L"3""0"\p""`l"^" T"<"l"""",̄"XD"4"_"h"T"4`"``"S "S|"[L"L`@"Z"Z"<"[&8"" a0"x X" " " h"(_\"T]""L"^|"^"0"\ " "^" T"< "l " " " ", "X " " "h"T"4`"``" |" "[L"L`@" " p"< "_&q"" a0"x & " .L" .L" &0"(a"T]""L"`0"`"0"\ *" +"^" T"< .L"l .L" .L" .L" .L", .L"X .L" .L" .L"h"T"4`"``" ,H" .L"[L"L`@" -" .0"< .L"_&q "@?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@""""$4DHhPPrTp" a0"x""hѼ"`" "(d"Tl"L"<"","0`"\ "("P"^" "<@"l"Ӵ"$"","X""_"X""40"`X"`"","L"T""<k"_% "P" a0"x X" " " h"(T"Tl"L"<"""0"\ " " 0"^" "< "l " " " ", "X " " "X""40"`X" |" ","L" " p"< "_%"Ř" a0"x & " .L" .L" &0"("Tl"L"<"""0"\ *" +" .\"^" "< .L"l .L" .L" .L" .L", .L"X .L" .L" .L"X""40"`X" ,H" .L","L" -" .0"< .L"_%l";E8tpX&E8"@&5&= &10&C@%P&C`'8p&4%&T@wy${ DHh{d{\ " a0"x"""{"(~"T"""""\|""^" "<"l"""","X""""h"4`"``"}"|(""L`@"""_&6"phX ... ...d""("XR^$`XbDcffPg" a0"x."k8"kt"l4"(d"Tlp"l"nx"F"I"0`"\ "("`l" "<s"lt"v""",,"X,""_""@"40"`X" "","L"T"h"_&="" a0"x X" " " h"(T"Tlp"l"nx"""0"\ " " 0" "< "l " " " ", "X " " ""@"40"`X" |" ","L" " p"_&5"" a0"x & " .L" .L" &0"("Tlp"l"nx"""0"\ *" +" .\" "< .L"l .L" .L" .L" .L", .L"X .L" .L" .L""@"40"`X" ,H" .L","L" -" .0"_%"0TT 4CLEANBUSYWANTEDTABLED FAKE FILLED DIRTY RELEASEDFAULTINGCLEANCHKFREEINACTIVEACTIVELAUNDRYANONAOBJ\"`"Θ" 8<x0123456789abcdef"l)/"ldlT"l,kxjh"l.|32A@B\"l:3A@B\` "l<("l+"l,P"l3#"l2%d"ll&d"l),$"l),$"lga3A@B\"l.|3A@B\.`"`"l t@@2Xx Xd$`2(@AAA==(A*gQ " "  Q0 t0"՘ M PP@@@@@(@(@PP @`H ?????????p?X??H@ L8M?p?0?? @ L8M?>?>@ L8M>>?>.L>>?>. L>x>`?>PA$AX?FA A A A A A A@A A@A A@A A@A A@A A@A A@hA A@PA A@8A A@ A A@A A?A OQQUXT]_D`e@e`e4hhhjkjXr,kj`T||x{h~X~ 8< (Դrh8L`|٘ٴ` amd7930xaudioamdXx(0dXtT4 SUNW,CS4231aonboard1@%+>IV"k}3 3 D P H  T0 th <@+ + + + !X"4!P' #$($0%$()D(4,- -D4Tp`ppppp p@0pP 0p`$5x6T5p;78L8T:<=<Ch@(@x@C (08pp p@ p p p $EFDMHHIDNUUdTZ0X$XtX|[<aHb<gfff(`gigTx `((`H$$ 8L89 9;@=p2|3 # pp  #lPPP #p  #@`@@ #PpppHpPH #p@`@@ #`` #4  #@@@x #P  #  #d  #<  # < #H  # # # , # x #  #  <  # \  #  #  # @  #  @  # @  @ # $PPP # p  # 0H@  #   # T #  # PPP #8PPPPP # pp((p  #HP @P #@@h #h0 @ # @@@  #@  @ #L p  #  #0 @ #0 #| p  # @@ # PP  #` `  #p @ # pp #D0PP #p #pp #( @@@ #tppp #pxp # p p  #X p 0 @ # @@  # #<@  @ #p  #px # P #lHHHpHHH #pp #HHHHHHH #P # #pp #4 #p p #8` # #d # # #Hpp # #pp #, #xppp #  #p #\PPP  # #PP PP #@PP  # @@ #p@@@@@@@p #$@@  #ppp # P #  # T0 # pxx #  #!8pp #!xx #!pp #"0H@@@@@@ #"hpxp #" ## ` p ##L0` ## ##` p #$0 #$| #$pp #% #%`xx #% #%p`p #&D@@@@@H0 #&h #&PP  #'(P #'tP P #'hp #(  @ #(X  #(  #(   #)<H #)PPPPPP #) #*  #*l pp  #*0H@@@@ #+PP #+PPP  #+  #+pppp #,4P #,pp #,`p #-(PP( #-d #-x #-pp #.Hp #.`` #.  #/,` @ #/x` ` #/` #0 #0\xh((((( #0 p  #00 #1@ ` p #1pp #1P(P #2$@@H88h #2p@@H8$H #2` p88h #3 @p #3T0p #3`p #3 Pp #48h P #4P P #4 P p #5<P #5hpp0 #50 #6` #6L P #6P #60p p #70`p p #7| Pp p #7Pp p #8HHHHHH #8`h #80pp #8`pp #9D Ppp #9hpp #9Ppp #:(P P #:txp #:0p #; `p #;X Pp #;Pp #;`PP  #<< #<` #<0pxx #= `pxx #=l Ppxx #=hpxx #>Ppxx #>P P pxx #>(xx #>pp0 #?40pp #?`pp #? Ppp #@Ppp #@d0` p #@0` p #@ P` p #AHP` p #A xp #Ah #B,0pp #Bx`pp #B Ppp #Chpp #C\Ppp #C  #Cxp #D@0h #D`h #D Ph #E$Ph #Ep`hp #E #FPhp #FT #T###8####h###L###0#|## # `# # # D# # # (# t# # # X# # # <# # # #l###P###4####d###H###,#x###\###@###$#p###T###8####h###L###0#|###`###D###(#t## #X### <# # #! #!l#!#"#"P#"#"##4#####$#$d#$#$#%H#%#%#&,#&x#&#'#'\#'#'#(@#(#(#)$#)p#)#*#*T#*#*#+8#+#+#,#,h#,#-#-L#-#-#.0#.|#.#/#/`#/#/#0D#0#0#1(#1t#1#2 #2X#2#2#3<#3#3#4 #4l#4#5#5P#5#5#64#6#6#7#7d#7#7#8H#8#8#9,#9x#9#:#:\#:#:#;@#;#;#<$#8#>#>#?#?h#?#@#@L#@#@#A0#A|#A#B#B`#B#B#CD#C#C#D(#Dt#D#E #EX#E#E#F<#F #Z?? #[ U@*U@*U@*U@*U@*U@ #[DDD|DDD #\|@@x@@@ #\p8D@@@D8  @ #\@@@@@@| #]P#aaq: #] #^0DddTLLD #^DDD(( #_ #_ #_ #`` #` #a@ #a #b #b #c #cp #c #dP #d #e0 #exx #fpp #f?111` #f@ 0`@ #g` 000>|? ?1 #g #h@ #h #i  #i000` 3ff #j?ff`f>``f`? #jp8`DDE9  2 2 a #j>wc`aaa?` #kP   #k #l00  0 #lf`vvf` #m #m   #m #n`  #n` 00` #o@00000000 #o6? #p ?a@ 0  #p @````@``@? #q !? #qp ?1```@```0 #q 00`gop``````p@? #rP?`@@ #r000  000 #s0 ``````p?```< #s   #t    #t`xx` #t #u``88` #u9  #v@?0```g ollg`0? #v ? @@`@` #w ````a`````````` #w` `````` 0 @ #xa``````````````````@a #xp0@0@000?00000 0  #x0@0@000?000000x #yP` ````a`` `0`` #y`````````````````````` #z0 #z80 #{acflxx|ngca`p #{x00000000000 0  #{p`pppY`Y`Y`M`N`N`D`D` #|`p` p x X L F G C A@@@`0 #| ````````````` @0@ #}@00`0`0`07000000x #} `````````````0@8@# #~ a````|ngca`p #~0`` ` p<@`@`` #F  #pp` ` ` ` ` ` ` ` ` ` p@? #`@000  #Pf f f v w@3@7@;; #p` 0@8   @` #0p` 0@  #?   ? # #``00  #|| || #`1` # #@ #0009 # ```gop````````p`xO #1 ````p@0 #`````1 ````````p9`p #p0``````0` #   #P 1```1?`? `@ @ ? #0p00790000000y #0 # 08 #````acf|x|ngc # #nf`f`f`f`f`f`f`p #`'y0000000y # ````````p@8 #@q``````````@p```` #  ````````p`8```` # s48000000x #00@8 0? #  @ #py00000009` #p` 0@0@  #Ppf f f 7@;@;@ #p@8  #0` 0@0@  xp #`A8 p` # # #8    8 #` >`6gC #UPUPUPUPUPUPUPUPUPUPUP #@ # # # # #p # #P # #0 # # # # #` # #@ # # # # #p # #P # #0 # # # # #` # #@ # # 7%dlhx90 # 000>|? ?1 #` w@;008.@` #pp` 0@ ?? # #P`0 8 1`p`8A@a # #0 @/@YYX X YY/@ @ #1?? # @3 ` #```` # #` @?@YY_[ [ Y9 @ #?? #@#aaq: # #   # # #py00000009>`0000` #>~~~> #P #  #0 # 008? #f3 "D #88 `?@ 2dG #0pp0 0`013`2``A #`8|L  `L};@ 2dG # 000@9 #@ ? @@`@` # ? @@`@` #  ? @@`@` # 3 ? @@`@` # ? @@`@` #p ? @@`@` #  @'&@>&FFF #P` `````` 0 @  #0@0@000?00000 0  #00@0@000?00000 0  #0@0@000?00000 0  #0@0@000?00000 0  # # #` # #@a````````````````@a # 3p` p x X L F G C A@@@`0 #  ````````````` @0@ # ````````````` @0@ # ````````````` @0@ #p 3 ````````````` @0@ # ````````````` @0@ #P``00`` #`!!c`c`f`l`l`x`8@0@8o #0p` ` ` ` ` ` ` ` ` ` p@? #p` ` ` ` ` ` ` ` ` ` p@? #p` ` ` ` ` ` ` ` ` ` p@? #p` ` ` ` ` ` ` ` ` ` p@? #p` 0@  #`x00?00`0`0`0`0?00x #1136663104`6`w #@0009 #0009 # 0009 # 30009 #0009 #p0009 #6@&``?fffg`? #P1 ````p@0  #0``````0` #00``````0` #0``````0` #0``````0` # # #` # #@01 ``````p@8 #ð 3'y0000000y #  ````````p@8 #Đ ````````p@8 # ````````p@8 #p 3 ````````p@8 # ````````p@8 #P #!c`f`f`l`x@8 #0y00000009` #Ǡy00000009` #y00000009` #Ȁy00000009` #` 0@0@  xp #`````oq``````````@p```` #` 0@0@  xp #@ #[ #[x #[ #\X #\ #]8 #] #^ #^ #^ #_h #_ #`H #` #a( #a #b #bx #b #cX #c #d8 #d #e #e #e #fh #f #gH #g #h( #h #i #ix #i #jX #j #k8 #k #l #l #l #mh #m #nH #n #o( #o #p #px #p #qX #q #r8 #r #s #s #s #th #t #uH #u #v( #v #w #wx #w #xX #x #y8 #y #z #z #z #{h #{ #|H #| #}( #} #~ #~x #~ #X # #8 # # # # #h # #H # #( # # #x # #X # #8 # # # # #h # #H # #( # # #x # #X # #8 # # # # #h # #H # #( # # #x # #X # #8 # # # # #h # #H # #( # # #x # #X # #8 # # # # #h # #H # #( # # #x # #X # #8 # # # # #h # #H # #( # # #x # #X # #8 # # # # #h # #H # #( # # #x # #X # #8 # # # # #h # #H # #( # # #x # #X # #8 # # # # #h # #H # #( # # #x # #X # #8 # # # # #h # #H #¸ #( #Ø # #x # #X # #8 #ƨ # #Lj # #h # #H #ɸ #( #ʘ 1234567890-=` qwertyuiop[]asdfghjkl;'\ zxcvbnm,./ !@#$%^&*()_+~ QWERTYUIOP{}ASDFGHJKL:"| ZXCVBNM<>?   13457890=   ;'  ,. AEIOUaeiouy ^AEIOUaeiou ~ANOano Cc AEIOUYaeiouy `AEIOUaeiou !!""+-,,-,-:Aa|/u0Xx12434<<>>??A"*E^`~ôC,/OD-E"^`ȴI"^`̴L-N~O"/X^`~մP!|ROSOTHU"^`ٴY-\\^*-.0123_Ooa"*^`e~c,/od-e"^`i"^`l-n~o"/^`x~p!|rososthu"^`xxy"-||property length0h(   `````````````````l``````````````, #x&8'/876<xX|xx!"l(,>````````````````````#l$ 8L8,8$hhhhh|¤LtlI````I````I````I````I````I````hhhhhGHHHI\KJ `JD```````P<\`5     ``````````````````````XΈ``````````` <````````````````8 4t`5^_h___````````````````44<4``6`5`, T  ``!"l,,d,```````ZL[\t^hT_h$4t`5`a\achTh$fT`5TTX``T``T<x(``````````````````````` ```` ```````kllllp````````````T`````````````````````````````````````````````````#$(``$0``%``````````````$T`` c````````````````````````````````````````````````````````````````````````````#l$%D%t8L``h```` <``````````````|¤\ȌL``9:``:P```````````````````````````````78L``8T``:``````````````,- ``-D``4T```````$tl`(H`````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````hh``h`HH``ID``N!@!!h!!\!t!(4t`5!!!!!!p`! !"X!)!*P!#X!*!*4t`5!4t!4|!4!4!4!4`!7 !7`!94!9` | }H } < ` `hhhhh``hh``h`hhhhh`@(@x``@``C#x&8. ./8`` WX W a e ^` j`@@CL``C```I``````I``````I``````I``````I``````I``````!>!@!@!@  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abc  !"#$%&'()0123456789@ABCDEFGHIPQRSTUVWXY`abcdefghipqrstuvwxy0123456789abcdefghijklmnopqrstuvwxyzK%  `   X,nK22Kn,X `%KOpenBSD3.0GENERIC#37 @(#)OpenBSD 3.0-beta (GENERIC) #37: Tue Oct 2 11:50:29 MDT 2001 deraadt@sun4m.openbsd.org:/usr/src/sys/arch/sparc/compile/GENERIC `4@! 4c9hA JiYtj Oud}h %" |j!C0"< %("T1. :$1pCQ"\cp<x"lP#,!u#P %h %l ;8 $1"b("@!0 ? \K"~8Q$b!ui$z %p.lf|:^|X"~ $ 8#"i\/ Ƞ;"H[Dix  %t %x  "8D  %|diD.|_\* 6pB" O %T_(jLs{ !, %  % %~Hx!@1 ? |N %[ g m$x ~6!b % "~L#$4#L %.$:`%h3dtILU"ӼiM@{ %RLk % "D | t"z _D1QI~T0h x"b,Px"!`# %$)6!R4AGQ b &pTDGĘ %(3t  !, ! * < %0 D ? R  ` % l  {N @H "X   Q !@  @ @ ` % &@ ) % : D@ P \ g % w % 0  #h   ", " "V|  % " )h !! + % 8 KĤ Z"\ j!a, qpD } %  qd  pX  %  " H ! "4 K " *g 7 FCX Y i { !e f $ 8 i cD   % p  !h &| 3N C( ^ f  z"` % < 5d X| % !  '   T   %0'|6 >!bHWƴi dt S}lb %YX %`! P0-!HCOZ,Ph!rn %{ ("P %"@ <,"lP"dT)|8 SHVd .vHhl"״ %xQ#p0"`+|l;|D(MV$c"q"|"$L % # <"`"}NZ% 4J!+VXa p!!HJ % KhSDr|2X%"Θ4E %Wt_s}  (#$`"$"zJH" %0 8 1$0@ %GmpU j$rH{%tP %qd %H"<m XN&@/" B @ R[ %dpԴ{ δ7Ǥ$" %:x % ,*!5dD %(R'` ? q %,y` - %0"z| % 6  p&8  ~*?<3CV % f %w  %!{"qp"~lp  l <D#[ 0P?K ^h]`i_TiD"zL!J"A"d |=`-8 !Q8%"6 qG Q#@Z6\d>y!|`p L n(h $5 (.8<A %K[ Xj y Pp8< D"(R0  %!"5 %L"`"p{`!!xE8" ,h %X# !d"-d:H`S ,s h ""<<, d  P-;LLc,Y"bj h~ 0    ao@  (&-3lA8S"g]qOPy"t H  %8R %x)?$+!c@5>4P!f vth^L`0lp@ e _  pt H (%D 0b E < Q K@ _! m I ~dT % X % % !| !    |!b!@(!"!# t!0 T!=!F:!S %!a!!n#<!! P! @!!X!! %! `! L!"%"@""WD"5"D "Q %"_"h"q P""i"`"" """" %" M" %" h#"# |D#("D#9#H #S 4#f #x8(#"z`## %### y#8$# #(# $*@$t$$*ox$6"D,$>!t$HJ $R$kӴ$wu$ %$ %$ %$$$"V$$>% 4%!=H%(_%0U%B%K Ü%] 8%p%Ȑ%%P% \% o%%,%%c%%&<&&"AX&,"x&7N&I &W!4&b"&jҸ&s&{ %&&&& &Ep&&ڠ& 'h' ''& t'0 bP';'Q %'^4'p'{ ' 'h$'C'h'D'' %''>("(!0(|(&D(5#,(D %(R (` %(k (yN((?("( %(( %(("b) ")0)()5h)C p)O )`"@)k)zA)")")6h)3p) a)!()/*%**  h*-"*>*I*R"b*i" *y*l*"j*l***"*"** t+ |+ %+!10++!@+5 %+> %+RT+\+v %+!o+ 5$++#x++ %++!+ ,, L, .,& ,4 |,C `,Tˌ,^ +H,p,| H,,S ,1X,(,H,:P, %x,d,,=--|--$ l-2 %-?\-P"8-ax-o-}g<- <`- /- t-"X---!up."ܔ.".eH.2"D.? T.M".Uش.g.t p.. . . T. 4/ `/ /+"/D"/\"|/u"$/"/"`/"//$(/"/ Z0 l0 \0  0+06d0?0M %0W# 0c 0s D0 ˄0#0݀0`0 %0"t0 0 %0!yh1 _1b11"d1?1L *L1^$1fx1z"x11 1 1 %11 1 %1 %1"22Y02"€20 %2:]d2Nk2]c|2k!2 %2|22 G2 22\2"2 3 %33f3, 3<3J3T t3l,3u %3"Ӱ33"~3"~x3833BP3 %3 %4 %4(4* 49 %4DO4Q#4]4g %4u 4`@4]H4 %444,D4l4 44l5 "5]85  d5C5Qd5b"A5n %5x>555 %5`5 %5"5i|5(566"6#˨6.6=6J;6f"l6z!v66 /p6Z6D6D6p66Y86bL7 %77! %707>]L7M07c=7n7}7 %77S777"7 ;87#7@8 ¤88!"Ӹ80t8C %8L@8\l8f8u8s8t8 8K8 m8 %8!88 % 9`09Ř9* P95 )9@"V9P09^i9m %$9zUD9{9S9 %(9 %h9 `x99 &19:99,:  4:h:#28:0:>"`:W":l":"x:":"D:":3::,;";g;" H;-";9X;M &1;b"@;rz;^,;"~;";;"8;_\; ;0;(< &1<Z<!<,:<=#X>  >>)">= &1>K >W >hX>s"8>\>>.p>"b>> M?"x? D? &2?%+?3#p?;!\?Fi?OJp?k?y? &2? d? a? &3? &3? &3?Xt??@@"@$0@5 @B<@K P@U|@_/8@i@r"P@} @$@!t@X@@@"@0@!4@@4@!R@SA HA@A 4A* &4A7"AC!O AM"LA^LAm (A} A'8A $AwAdAVXA &4AlAABδB2LB @B)B3B?"BK!oBR|Bd Bp B B 8B &4B"0BHBHDB<B CrC 44CDC3[C>XCJ &4CYCj:CylC &4C TC &4CC &4C#CC }CC<DrTD!pD4"TDD DQ @D^Df KD{PLDTDtD*D7D!bPDD |D t8D?DEE E- ED<ES En"E"E"XE",E"E"LE"F &5F!(F)w`F=tFO0Ff &5FsFPF wF F pF F[FF(FGXG &5G G%R G1"GCGLGd0G}"0GGGSlG GGGHG.`GH "H H)H8HI#HV HaHkTH|l4HHH.HG|H%HHHHHKH I"HII! I5"C,I@IO &5IcIoDI$(IՔI &5I"I `0I,I K|I!ixI^LJ|JJ3%dJ?dJIJX`JkO,J!wHJJ\J &5J <J ;J"dJJJJ &5K"A`KK"xK2 &5K;"ztKG<KS Kh &5Kp (K||K!lKXKK"ӠK K pKLK &5K^KhL  L _L/#(LA",LTC$Li5tLt"xLL@L~L0L .L L L@M%M &6M%M3MG >MQ MYMimMs.@M~MS M &6M M M"~PM!MŐMVN`N"N$ "N5 4NE *HNQTN^vNitNs &6N| `N!*N,dNNXNN &6 N &6N &6NtN m\O hO"OO3O?@OHlOP!',O\#DOfOqOz &6OO O &6O"ȰOODOiOO XP &6PP! &6P+" P3 PE aPS"PPk"P"P"P"TP,P"P!Q!PQ#gQ2Q<QQQ_QlQx &6Q &6QQRQ.PQ QVhQ Q FQQDR R  cR0R:RM"ARW"ATRa*0RmR8RRRR &6R!)RZHR]XR TSSS'"S2!SEXSQS_ Si .SySShS NTS!z S4SS"S:S "S4PTtT"gT "T+T9# TD &8TSHTa>Tv"`TXTTTjT3TT T &8TT!U"U"وU%$3hU0"U="UJ"UY.Uk &8U{"U$5UU &8U U 4UUhU &9U :V V"bPV)"xV4uxVAeVMVYPVjVV V Q<VW<VM|V V VW!PW<W,iW5 WIWXWq,W"ϜW"W WKWIW &9W W(WPX &;XYLX% &; X16XEXM$XYJXjXv X EHX 8X"XPXC$X"X XXXx$YQY!uY! Y+?Y;YJ"gDY["cYd &;(Yn"YxY;YɨY@YXYY &;YxY"bY#ZZ Z1 &;Z:`ZJ"0Za"Zu HZ"nZZɠZ &;Z &;ZZ"ZZZ &;Z &;[ !w[ &;[&9[1!7 [:,[E1[S"[g e[q"q[y$$[@[!,[ [ [ &;["["(\ " \#ZL\,\5dl\E֤\al\|\ &;\ D\ $\ \"`\\\!\l]] ]" ]* &<8]7^]G`l]]]l ]~"T] &<<]eL] &<@]P]]]]]D]^ ^"^ ^)!r^0T^<^F|^U^] &jj-Lj9"zXjEjVjc\jo"j| &>jcj Zjjj<jDj z(jtj^pkXk""bk:"bkQ"bkhknkk!<kѼkkkπk>kPk hkQlLl(l'Xl8"LlGlT"l_tlo܌l}Pl^ltl!*l Dl l"l!ul@lLmm z mm*m6PmHmR &Bm[ &BmgdmwRm"bm<mm m R(m m mmn Jhn Qn Ttn+8nF8<n^A@nncHny &CnԤn n"znݨn!-|nk8n &Cn &Coo &Co)$5o45oA oKoW0od ,ox o!o8Lo o &Coiodoo p(pp1 pC"bpUpb"A|pkpu(pp ap >p p|pI0ppprp"0q,qzqq+q8 qG"~Xq[,qhqs &Cq}IPqTqqXdqq_Pqqq 8q r7rr*n r8$rErPfrZ{rf rr"4r"r"0r"lrWrrr s Qss"Өs1$sBΈsK#s[ &Csest!s!.Ls8sLs0ss 's ; s$6@t &Ct,t3 2tC"tT#t]r,tiL(t} uxt1t &Dt &DPt! t tXt t tu  u!7u"$0u/Su; 8uJ &E8uX ui"\uu|u u#HuBLu> uu"u &E@uu!vpxv Lv/v+ ~lv9vH vTv^vo|v#v #v7vXv vDvLvxv v w &I(wFw( w< [(wJwV"wfwxwٌwpw,wTw vwXwx!,xgx, (x;xH x`&pxv x Tx Hx &I0xx &I`xlxxxx y  .\y6dy0"byAyVPyb yr &Idy} &Ihy &IpyyXy"8y &Iyy!0y$yDz "zz# z4zDZzQV@z\tzg &IzrHzHz(z 9xz zLzzz{ &I{UX{%{-{>"({M &K{]"D{n"@{l{"{! {{W{{{XX{,|"|,|6ި|B"$|K|Vd|ae|n &K| &K| Kx|L||| &K|"|}} !x}p}. `}<@}H!N}Q}] 4}n"}} <} &L}"}"}}}0}}w~ vP~:0~&WP~2~D RP~T X~f &L~p '~~t~ Ř~ ~ ep~<~~p~~DL"- :XHY4k fhulX#ʰ$"pJH &LZ+a7"ϨDvO [Pe 1p%, &L$4pQT!*Pz Idtx#"3"CPU"<d"8s t"j"bHDCL &L@ P \tr !("5tB$6DJ"X3cn{$1"# &L"t" &LaH !M J<*9 &LC9PZ iF$w$2 "|  YL &L9!,5(9 P ):WK$Tg &Lr"b"@4 &M"֘ &M &N8  &N< 0 &N@*S: {G `P"@Yckth . K|"~p< $X~-8NX4>,-E|< &NDJ֤W ev &NH"H  h L("<KY hw &NLCd<N@F0T  3`L &NP ,L/ &Nd8 &NhI"Y'nw'Dtݐ" 0 gP &Rh"P Ð"iP*3; &RlJ"0T ] u$nS8|T Y &R}j  < &R"gل\  "$ &R.>lG0R"a q ،} vT$ƸlUL"$ ""@ &R "h:L7AMT|_ \k \w4,l4h3 &R\ &S NLɜ,~P?!vH"4RS_o@l z &S|p"\ 8 wB70" !h$1K.Z"0fr6 &SH${ "78+#bM( "$(6 x0B N"dXbl &S x5P &S$ &S( &S,#  / h)L5TALV4a0n@tԤ &S0P &S8"""` 8 cx& P3I<IG &SHZPd p &SL}D5"g" &SP@w  "x)!%l=! Qd`rTT, Xڜ &SXk &T@ v"#"4 &TDGPSaez K<d"" "" |! "1"<B"8Sm  "e$  ! @X^  D %E47"zD!O8T]hf\t'ÔpC F3p0D48h  &TH'5:" >G EU lf &TLs""@_0 SP4HQ TY ht"g( \ Z8H|t0 &TPa &TT/"@>$PM WXVshq M$% &TX8 &T` a!9 Y&%98G &TpQ(e 2q &Tt} C"0D &Tx"0 &T| + ;QK &TU],o ݰ \ &T jhD"H &T /24 h0,:"4D 4@Wi -v h 6qx"~XX {X ~l, &T;"Qh0{y(P $  r< 4`"zH T"#^ 2 &T< HT^n"8x  `^"  &T &T "H ,% 6`>`Zlu &T h~%PH||]D !( 7BlR]<mxo`"Pql%,!"X &T  &U $,;]H0PwX\h!{L~"ddO4< &U &U I D<  &U%$4D &UOYh Fpq"` ( s # p""X"0" z3<F(Sߴa q  &U 3\^p N`#L.;.W"4[Pj"x Lˬ &Uڠ H<$(F &V$w6vxF2D[0o","p~h 0"j,#4 @cHL#@Uir" |hpj &V"AX &V"t 5Y ټ#  &V!-N8 U k"v` "[+PlOp"i"g& b5tBK"W `"Xx""p~4l<"{9$"8 &V &V*N\4?NqZ$h &Vu &W &W!4t1x &W |= "P 0 n%n5 4T (r @ P0[DqE %7 W@%1$4< eP-D\pq~D8="H0a N( zl &W!/ =0K"d7$r0t~ &XO"lp Tl ""( 6COh` "mw""C|d܌ d$ZlGP &X &X4 &X $ j/B#Klhh"Adltv(Ը$"d"CT &Yl p\ )6CTdjLw &YLD L`,,^PB &Yߨ# 2`@"z\ML\jxw,p9 &Y@t\! &Y.$1D8A#P]$0i y &Y}:" &Z h"L"H$1\!FD # \14>Jet /c &Z$"~4hz  L OTҸ/ &Z(8OC"P _ &Z,h;v#R7pH 4$2!B\VP t`'p$2> LW#_ 2tn8x@ &Z0NL <$2"Ap`dH aH&X:E$S"[pt x, &Z8t" _ h"g#  f -u|5 ?ARc`w LL hl[<40HR(8' &[ 5"z@"zpO W id pk{""HN &[( "`  P l% -P0; &[0F xP#_Ln y &[4x h U@@XT$1 &[8"Ax?0"/ &`8;*I0T &`<anxq|"gH|-,t" )  $18?\1"gB &`@Nm\n P}  | &`H &a0 L "X "$ ^."p@ &a8H"zXbj"u!O~"X2P &e8 B  Ȱ""( "$">"V"0o""<"T"""p"8"5"K"b"y"""Ő"P"n"m7$Z3٘AM"pW\`"Ӝs &f ~ &f?d"j &f$WP& &g1:$FsU g y !p r "(0% L T $ D4C%lO\˜i ,qPy &gX - &gCl"n"#b. 9 8H R &gZh .0v|\ &g9%p"H" "" #0.6SE YUIHa"j &hsT"ؐQ  { T! vF"p *=G"بR{XZhsX"i ht h"g &h 5H(+6>((J"PUe w‚‹  &h© Ġ¹ h\l |0  &h'h7DEM"(]fToÀitÉ"Ð"× h|ðHü c 4 &h &h 0  &h#"x1 7E rU"\"c`u"HĄ`Ę Ĥ!4İ & &hi"X (qX$"b%7`E"S]Zk f`z"Ň!œ`ť!#XŰż"x" "~WP"/X6E!DV `b&j &huƇƖ &hƥƺ ܔZ"`Lk,5ڸ<I[ |m y ljլǙVǯ &h @WYh  &h".;N_!| OȐ 'LȡȪȸ["!J l "X%3"<IdUb 8ohw &i Ʉ QXɓ ɠ &i$ɪ'ɷ " t &i(  h*= &i,LDYiՐ| `8ʋ"ʔ{ʡ"ʴ"08GX  }$@ -|7 &i0DTb &jn" y &k˅ &k ˑ˛`˥"˽@ppP P &l 0hT)82<F!JLbDY5q { <R"blj8zH΋ &l8Η#Πpβ xξ  z Y"t (#4"dTI &l`_lx`τϕ €ϦY϶zLP"0  =8!8$D JV %\bۨl(wЇДjС%бA$кe}"x I "H 8(L9 K Z hh Lv ф Xhє &ldѤѱѾJD &\  hx 8! P(1<= &lhK{TXHj"`q\҅ &mPҌdҚ &mXҥҳ ҿ"[Dx &m\ | &m`'1^;IT`b"nBhӃ{Ӎr8ӚXӥ"ӯӸ "0" t"pp & !^2 )xAX_l (Ԅ wLԑ"qlԞ"pԥԬ$%Խ X t E yx#<+5VB &mdZm0bn"@zՌՠ \ի"ղ^`8a !4 c%8@SR b -r|քl֌ &mh֕"֨"ʘַ־(l7, L  &nh#,5F!\<j k|o$בndצ!jױrh׾  &oH"~"i`ܬ 0 8< ~IdR$@[ &oe &ot؆ ؓ pء &pت &pصQ  d &p@ Dx"0C(@/ h@ j$V$_X0l.`wHً PٚX٥٬hٽ" &pL "@ &p& r,:QJ &q_[Lj K|xg<ځ#Pڈ#ڗ"ڪ ڸs@$!Hh- " 2r@ $JVVi'4t ۉȼۛ#hۢT۰ۿD &q(#" V$#hT-"4EzR"ih["c pt &q܈ &q ܜ ܬ!eܲ &ql "Al, "j")"bX1#P9B"ϘOec<p | &qݏݛ &qݥfݰ\ݽ S, &r$68"A x"^h' &r0b<:I"dWVfPz`ވ 0ޘ"ޥ޲P"Xδ H .X vPd) h;ENhV"@ ^LyFߌ &rhߖ &r|ߥ p߱ &r߽%"lɔ &r @X)"L<@HXHgtrh}: &r} `(Z|L`  " &r$x1 Sl> H[hq,pM~ ( " "G &r >D* =ZER"Ӵd tv "ݤ "Hx"ϸ &rD("~\9 &rAGN"X ͬiMs &rP I\!$)<  W lH&3t6"@K V d &sn{ &s &s (7+4" j8"9, 7T "d."8 &sM &spX &stf Ils~^m|" P &sG""2  ) &s2 FA xN@V!0c Ou &s &s4` &t!N lD f@0* &t6 TA(Q\nd Tr(  Rd"|H tTu4c jr &X| ` &`P &H\N" < $%- &\? &`KktYWeLr (e\ H@ <0h",!%"<6 &`N &dd &hx &l" 8[x"۰"" Lh &p { &X0ٴ?ldT"eRq &X{@d"d &x &h(P7gJS"k Ou R l`0^X&" &0  %D & $24 &BM y|]{\k#w< wP P &XZ0 =d 9  :0AWn\f(^m\xl5"h""""|'r1d;HB,M ' \"~hfrq} &$1#H@8PX+$/`9 &O &dgpn !  Xj `$1#` $"1|>JM"T!4``p"P~0Q & p0 } & Il0l9 <F-[ g ra\|""@ &   &@"  2()0 p;|G &@Ul^ t &HѼTB x &p { "h #~ E(<HHR(^"(j<s, 8p,yR# &t 8424!0mH> &xG Q;L[e &nw"0  Zt!@ 4v0 & L / (E"Q_ &n!wT-x }"},"@"`R " " /:G RP_cj &x &T &" 0lڀ"t!0/-A"AJ 5]dk wt &4(H"xs"D $ H="LD OPU3bnz |^{$ ZH &Ed & "h2"BDK"dR &[Lilxz &  i V / &"ό"@('"9 O Q_ i"z!i" &!9 tT"}#|t"  ޼ #l$CL.Kd]k|  &!>|@  &#8 l:| '9"ӬMpXߔg"p`u"0~ P!O8 `^.0 ; "zP X !Qe %d2C$dO [dg"Hp X#x@p \* $L9|\K!GDc`\pȌy- &T $T & & &&-`80AL &S x\!f7s" L & H |,| 0} "C &!G, &6 &X@ P"~a o`<|$L` &h `  & L-K= &FQ &] TnU|R"h@@"d`}D '();M"4X fs"z!X!},t s $(   &  & #x ,t 4 C5 Nu$ U- g" o"    "l " /     1 < D & "  8 & -" < & M a  l!I ~r  p    ]x   $  " .sx ;" E4 O< \ & o# w, p   + " \ P "  i Q " % r 20 C@ T 9| _  n!  ! _x h @ !` !4| 0 #8 gh   x -  B$@ R _ mX {<  @ x "P a     G * 4 |xL8' :x8|0E"M!Y e &s90P !t """LEL Mx")!AN &V!pb &t"{ T 0@"gf|L 0"c,%H4%@ T c֠pyTX &`"h D)HѴ"  &Z0!h.wH? & Qlir &}WD` "zh/ Tx" t & ߈*"X5}J!vpT yHd$m{`X@ U M'!@  + .L"1"C0;^K PVPn"{5 & &"X$$"pX"g" &/!h:rFU"ijLq|8| Pup !* BdO~\ g[t ~ g$ &! &"/"G *pU c!vj9x &_ðd4<h &jTC0 ;p(9$GVEPds4pX   )H &|$  # IT0(8(D2SD$c & r &pzD|(d  `K :X2da4tkxw .(`aC8!v`p@x c Pr,"`: &BhRXj4f$2 o!pvMx !  88 dJx H g a/ &@8 ,D PD[$28dr5pXl"<,|" ʹTt * P &$"`.Z8<" H` &m"u &l,o4l & &}t~p &%"x/)L"\n^({   H` "d oP|#F+":,KVahw#X W  s &߀!3#0 H <0(7$@"TH!PhO!OY \l#x"ψ" ܄ `fT"r`"p L  1  & $ & -@ = L  T"l \: iܴ z"  k !4 I\ 8L "D &   ~, "z H ĸ! "L!! |!1 }@!Bn!J"Ȕ!S"T!\ y@!l !w &!!8!_!!d!s!!"Ȝ!"\!!" @"" a0"20"@$2P"H"\b<"il"q"d"z""ΰ""j\""l"""Š""f""t"D# #,#" #98#KP#Z$2h#b#k"|#t,#Z#"jt#ID#"Ȅ# ip##"~##\$"~$ ZL$%"Ȍ$.$= &x$J x$X Z$h$z"T$ &|$$D$$|$f`$$#$"$s$"%% &% 5%' &%.%9 l%E"jD%T%\%h &%w ,%"% [%{%\%ب%"}%!%%%d%,&/8&C&!x&6 &I"H&X&d '&q & e& ¸&[&<&&t' P|' O'!"') `0'9ȼ'BE'R"P'f7't#' $'@':'"'''`' &'!MH'B( &( ( &(!(/(AL(VP(j"(r$((xW("("<((y((("`( (( &))  )P)' &)-[)7()E")R)d$)n"x)u ) 5)XH))a) &)) ) 9) &** **&mH*:D*G &*W*j!*wN* H*c*Č* &*$5*4T* <$* =* >* ,(+4L+ &+)+< &+N"|+U+j++uϼ+(+R+ .+ P+ + +8h+LD+E,, N$,+ ?,9 &,? V(,Jk,Y"h,` ?,q1p,z, 0, ,€,"A,," ,(,,R- --#$-/"i-9-F"@-P"-b"-p"g- &-w(-x- (- &--\- &p- &x-"A\-.p.".$h.+.:8.Sp.i|.(.͘..@. &."P./`|/!i/ p///=/H/T t/`/k &/t O/"/h/T/`/\/,l/*x/ /τ0 !|0 &0!\0+h0@l0P)80[ ,0fQ0r$6<0{,00U0 &0 0 \0"0X15H1 &1- &1@1K H1[1mv1t<1Ud11 {1p1b11Q1%1@x1Q2H2",2"2"29 2HRh2U2c2q &2x!2"ڀ2 &2"2`22¨2vl2,22!43TX3"(32"$3S" 3r"3 3 &3}3"Ә3J03 /@3"~ 3np3p3 4 & 44""zx4-"44 d4E"4RT4Y"4g+4q 444"<4 `4#4 484 j4 (4"4 bx4Z5 &$5 5>5, &(59 &,5E5P!3p5cH5m5v `5h55 &05:855lD5_5X6h6"06$62,6:!6O"j6W#46a6p"6"ʈ6S|6 d6"h6`6T666 &47 }H7  ?7 O7"{$7+"~76 7Dl7Q7]"7ox7{ &87 d777 &@7P7 M7>p>,>6 >I '>]">o|>(> a>>T>%> > > ?|? X? '?,@?3"@?9`?Q?_:?o"@?u ?? '0?  ? ?|?"~?"~?V?@ (@R@,)H@<(@Mp@X|(@f@t"@ @@ u(@mh@U@x@w@tX@ '@/xA $2A"@,A>0A(tA0JAAp@AGAP@A\ 'Am_A~A"AAmA AAAB BB *B*"jBCOBTʹB_$3Bi@ByBB/BBBB"B B MB 0C ' CC/ '(C:CHDCTCa; Cw"CZCSC '%(C!P0CTCCCC C CCoD !uDjD"@D+D9pDC!DDWvDf '%0DrD{"D 4D"D]DD $D6pD!$D '4DtDEE\E '4E)E6E? EJ"EQ '4E_$Ew?XE 8E"E"E 3tE|EE '4E"etE"F!M(F !F kPF(`F4(FB FM '5FW '5 F\uFdFpFz"FDF!F '5FFmF '5FƔG_G G8 GL}dGU GbGo"GwG}$(G_hGGGNG" GwPGݴGG#(GG#(G"tH HH]H*$HH;IHG HU '5HcŴHx Hm`H8H#@H"AtH '5H 34HH^H<HHIlI  tIbITI$ '5I, '5I2 vI= NIMDIY60Ie\Ir '5I%I I I #I '5I"I^I"d0J '6J '7xJ?J+J8idJH '8`JT Jb\JuJ}J WJJJ"J AJ JJ",J4K &KK DK' K7XKCKK hKU"~`Kc '8xKpK~ '8Ks`K"ӤKKTKK lK '8L"\L !tLWL# L/ ,L? LR hL]tLqL '8LL L# LlLHLlL0L%XM~M"jM"tM&M1"M? MO`MadMo"dM '8MM LM '8M\M!xHM#`MGM#lM$M(N N "0N#N5N? LNR HNcNl '8N}N|HNDNgNNDNN"xN"N"}`O2O POLO&O2"O>oOT O^$Oh!OsOnOO '9O3lOhO$6hOO"O '9OO,OPPpXP+HP6yxP?!hPF'dPXjpPd !TPr `P{ 0P '9P '9P P,P xP\P"lP P b\PQQsQ Q/QE"QQHQZ$QcQp"<Q Q aUN U[Ug$Ux F8U`UU$5U(UPU"qhU"gU$UHVIV '9V V+V6 '9VAVFCVOVd"Vl (Vx0V ':DV"VtVVV VVpVV@V WdW"W5PWH ':HWY@Wf Ws"W}0W ':PWgW ':TWmWW WWW W  X X8XOX,X5޴XHdXS X_"XdjXrX JX(XX4XcXnlXXX<YYY*"4Y3 ,HY>! YTYfE8Yv"YYsY"@Y Y YYLxY Y!Z"Z"C(Z*<Z: sZKZ^ ZoIZ}"Z ':XZZZDZZZ Z!OZ [Ԉ[([#D[& ':`[0 ';[=![I 8[Z8[e"X[mh[{[[!tx[h[[ [ ["T[!9[ ';[R[ [.p\\ &0\\))\:"$\H\Vt\\\e\m7@\l\y\ ';\ 2\\"l\!b\Ԁ\,\ '; \ '> OpenBSD BOOT %s bsddevice[%s]: boot: open: %s: %s Booting %s @ 0x%x 㿘@T@- @ 3!`L@ 3!313%3/+3)3-'3 5@a(@ $ `@{!@ M! 2%`@r h@ Lh 2@b  8@a@@gBad format %d+%d+[%d+%d]=0x%x boot: short read x@ ;%?@ ?# @!2?3܀a"0?@ ?# @!2?%܀a""?@ ?# @! 2?܀a "?@ ?# @ 2 ܀`@"0@"?@ ?# @!  a ܤ` ܐ@;܀?@@ ?# @! a "?@ a?# @!"  @ .@`@ 2.@"@@ k@@ 䀤 .@?`耣 C.@ .`".`.`@`@耢@F#2@ b@ٔ  < b.@ .` .` .`b  ?`@Ĕ2'@"@m`? ? @3"X@a"@,c 2#3!X b1  Ā 0@K", ? Ċ`Ī@` Ē`IJ@` @ dvma_mapin㿘? #@(1?@,#(1?dvma_mapout㿘 #@(1@#p1㿘@ " ْ㿘 @㿘1#`` @, "c3  @/ #` $#`㿘1c` ? "c`,@}cboot: client IP address: %s boot: client name: %s rootroot addr=%s path=%s 㿐',@j㈀?73"@!' @@@㈀ )32 @a- 12㈒`#p@ 23#p!' @n@#p'@  3 3  2 3 㿘3` 231"#h"`"`"`"` "`"`" @`  "`? 3  ?3 㿘  ; < 㿘 , @@H   @="&  ?  promprom0㿘,# `2@2c  $  31 cx"3"!JJ`  -2*@3!@ (*`J@ @ *`  1c3" J  *@J` )*@c 3`"!``*J@ -& @33 *:  c` d a  J@ s  J@   $ #a\ @ # J@  @Can't open device `%s' Can't open network device `%s' 㿘@ ,# `  @aܔP$` $`%32# `( $ 3`€  !a\$` $`$@ @Z!02@ $`&` 2!22,ch @ "0P @@!0"0,c0 @,cL @ , "c# ,`# $$ 㿘#2c`   ``*  `c   '@`2`0`,6 * '@ 㿘  ʒ& `& $& (   €͒ " '@ 㿘 ` @ 2# `( ( @0@ 㿘   2  @! $ ?2`$ *㿘2#` `0`4 㿘2#` `?`8 ? xmit: not a network device 㿘  ,`@|!?K@ S`?㿘 ,5`€>㿐2 c` (`P#    #O/O O /O㿘㿐2# `      O ? X/O O /O㿐2#/  0T@㿘  㿘2#`t€㿘@,@㿐2c    #X# p@%x mac-address drop swap 6 cmoveX,# ` #21 ##` 1   Њ@+`  .@ .` .` .` .` .`c` `€0 `@c|@ielefdxyxdstsddevice_typeblocknetworkbyte㿘2#` !,`@@Xa@a ' b@  @b   #`#N@J@2J`N` " 2 node %x property %s length %d > %d 㿘2#` € 0#@ 㿘1#ޖ ??" ,Invalid controller number prom_iopen: "%s" error=%d 㿘)2! ?N  @ 3"``$` $`$`$`$`$`$` $`$$`($`,$`0$`4$` $`  $` $` @ΐ#+  " * @F $`0 "$`4 " @D$` @ 2!&  %! @# 㿘#2a  @ 4 "$a & 4$aprom_mapin: length=%dprom_mapin: invalid maptype %d㿘,#$*`@ -!@| x --         !@e` `,#,@ ,#$8 <?*  | آ&@  ` ,#(|@㿘?(1,12\&# H L` T ` X P d l$ p  t @2 .@2.1㿐``@ 0@ `@`@[ @ * @S   @@ x ` *  d,  0 2 0 0@" x @s*  @`?``"? 6"?%` 0@㿘 `  .` 8@ ^&  @   @`&@``@@6``,`G D& h`?  ,` @@!  @!0$@r     d ,  0 2 0 2 %@` ,`@L@Ԑ,`& 㿐   e<`P @@ܔ 4`0*:  8  2`0 @8e<`0e<eD `L  Ȁ)n 2; @`0$  " @   `d  *  0 @$ $  $&@&    b 8   @   " & 㿐`@  <@`@-5 2& :@ "   2  @l  " *@B<@@` ڐ2 ``@Ӑ 㻀@@ Ц @ &`@9@$`   `  @2 %\F!T@  0@@eg0   @ t,   $@  '` L@  @5<`/2L@`L@ /"`L@"y   נ  / ``4k `L@  /`,@P谒 \,@+ W(  2LL@@ $H  E;@%( 8@"@ 0 K䰒 *@`  d*  0` @O / ' 'ܒ L@  @   0@ @@ Ё㿘 &     . @ "  @0  .  "  @z0 @w@t а 㿐 @j@&B<@@`@@ ``@0 2&     ":?"   ? @ : ` :?  2`"` "`:`0㿐`  8 `@@2.@``@.@+?) @ " " ""@@C <@  @ @ @ B <@   @(*`  bootparamd: 'whoami' call failed bp_whoami: short reply, %d < %d p k3"@1a"'А $  $ $ ''X@ג 2W?-`??"`4` $@!#`"#@ #\ @  !2 @Ő#<?#3!a@!*`4a' @2 6` @##?2'ܢ ܔ"(""(2a@ ?3"`2bp`@w  ?2@a ? ?  P2"(2a''@H 2C?@!@? 2:?-`2?"`6 "&#`a#@b#\ @'   3 H"`''@( 2?@J 2?#'@ ? ?㿘`&"@  &@  㿘`&@   ? & @ Ԕ.@&  @""#d d " e" f" g"#" ?  +d +e +f +gd"@# @ ` J@(8(8    `J/`? `2A ` `!J@(8(8  . ` J J#   J@;..2J`;2 , `J@; @Є 8 <` CD001㿐@ ( ( @V`  -``( (  !@ R     2` * @h * *` * +  *+`  h  @ (g 8@ @`-`  ` ΀ǰ    *` *   *  M `N JL *  2D     !*  *` * @*@  @  @ L  *  "M  !   L  *  2 M  : L  *    g2 @ ``  `-`( U(  gh 8  *   *` * ƒ  @ @@ ˀg@+ @    >>>&`>  * *`   * & +` * +   :>@ 0  @  @ 㿘  @ &  㷐 R@ N`@4 @H``@C@2 *@ `  @ ,  ( )􀢨$ 2@` ' 8'" w@ '@@ @ B <@&hhB <@2&     ":?"   ? @ : ` :?  $2`"`"`  :`0 㿘c  ,  ". /.".+."&  "!".. 0  ? 0 @͠L *L0} 0z 0pؒ  @ S@ 8 'pt@ ( ,  $ #`a#\b` @' ? 3 H "`؀`3@   " ?㽠P  x@   'P $` $` $`  $$` ($` ,$`@ $` 8 t@  $`   h #`ab`$#\ @ ? 3  x 0  &,& &&& D& &(&$@ 㺈 ` ($a b ????#\#`  @ ? 3  `  dh@ d .@  ?nfsread: short packet, %d < %ld 0  '  $  $  (  ,     $$L#`a $b (#\  @b ,? L `" H3" ?@T@ B0  @ y3 H"`?㿘@ -3 "` 2" 6 & 2 ?  " $?!$ "  ?nfs_open: must mount first. 㷈2""` @ :" N  m `/2N N /" N a  0 ] @ x  <$N O  N  /  .ɔ A.0 0 2;@ @  $+  (@;@O`/ @ x@ x  @ x N  &`  @x x@s x㿘  "& @i x&  nfs_read: hit EOF unexpectantly㿘' #3!3%@ {   ݖ? `2  !\ @ P  ; B& > @ 2&     D  "; ?  ?  @ ;   `; ?  -0( 4 2`:2` <"` @"`D :`0 callrpc: error = %d 㿐\@?<6   '?'?@?2 '?` '?`@""?'?Đ #`#` #`#`#\ #`a $  p@X? 3` @``2"@#3 H"`?recvrpc: reject, astat=%d, errno=%d 㿘!3$ @ 2"@ 2?`2 ?`` $  H@’ ??"@?232x( 2  2 2 *?3 Ȁ #  2(x"# " " " getport: %s㾐a"@3 o'?(' "p #\#` ""   6   p'0 #3!`@f!Ȓ@Q H$`?bad adaptor numberbad controller numberbad drive numberbad partitioncan't read disk labelunlabeledDevice not configuredOperation not permittedNo such file or directoryStale NFS file handleInappropriate file type or formatExec format errorInput/output errorInvalid argumentUnknown error: code %d㿘`W1!(*` €10"1-"1*"1'#1$#1!#01#@1#X1#p1#1#1#1 #1  12!` @8D8D8E8E8D8D8E8D8E8E8E8E8E8E8E8E8E8E8E8E8E8D8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8D8E8E8E8E8E8E8E8E8D8E8E8E8D\8Dh8Dt8D8D8Drarp: bad socket. %d No response for RARP request Ӑ @B"J?  .@  7Ɛ(   , 4 , 4 ` 44 `~4 `4 `4 ``4 `4 #\ D .@q @"? 32b@ b@2  b@ @ 0- ? @ -??"aP@ $`㿘- @ 5㿐@3!"   5@2?@ 2?`(2?`&2?` 2 ? `@  ??sendudp: bad write (%d != %d)x&$`$` $`$`$`$`<* @ *@@ &  ,`,` 4` $`  $`@4`  6 4 4 `'`'` '`'&$`,` '@4` 4 쀣?&$`$`$`  $` -!P    2`'!'ܐ@_ܖ@( @?!@Qreadudp: huge packet, udp len %ld x@ް zހ( (  t?@͒o?2m?<@ 2f? 2b?6` <`\@u 2X? &T?``  2L?` &@  "@4  ` 2=?` 5` %@"0? ,  $ $ ' '`'''4 @8  ?$$ $ $ $ $$ $ $ $ ` ??sendrecv: short write! (%d < %d)㿘\   )3 <+`% (?@ @a @,`4 2    $$@Ӧ` l J` Є * (Ж  (8. 53 ".?" 8" ?#  0 `(?`d((  `d(h(*  ?#㿘@㿘2!Y,@  .  @ 0,@@ "@  0,@@  0,@,@6 ` "@(* 8("@ Є (@ 㿐 "= N -N`$* `.! גN*`? @ . Ȓ?N*`# @ .   J `   `&     ,` ` `   ( `߀` ܗ(2 ?# : :* 㿘 3` 3` 3`  .+`+`+`+`3`  +` ??㿘   @,   -`Ȑ@%  "` ?` ?72-` :  0 *@ `  *@`*@`2*!`" @ ` ?  2   㿘2ax'H'L'P'T 'X @"ax@H@ exit㿘 `㿘3"H , @` @ , 㿘@@V㿘@~ 㿘 < " ? 2  @13 D& @[  $   `$ <?$ 8 D$ ?$  @`$㿘אԐ* А* ̐?. ?$`8㿘-!X  , @     & &"   & L`?& & S`?   2?  ?B& 8     `* ??w?2? o  e  "  < Z   <  ?& 81.1.3㿘@\?.`,@ P2!. `"  P @ՐȐ?@/ 8 `@v &`D&@a&`@0 @`@ P@Ő?㿘 3 "`?3"H. @ 2. ! @ D@y@v P@㿘2!.  8?? ?2$  ?$8$ L "88 @P  "@"$ $$$$ @' 43 `$<" $& @$$$<S < D!3$ @ $ $<D$@ #$8 H@" $H H ?$88 @=$$  @ $H8 2  < 2  2L H@" $H&㾘 3 3"H- @2@9!-  `L @?2+$`)'$`" ` 3f c3b @F ` 42$`@   @ ?L @`D P @Ȑ?@ 8$@$`D$`@.` 4@ 1@ /@ f )`' a !ڒ: @3  Yd 4 `0 Y"`??-`` ? * `:```? -ad "ad"    -`?"  `@ @   @ *0   @ *`(㿘3. "H @  @  3 $"`2  " @      @ $3" `3 " ?㿘3. "H@ @  3 "  3  Y :@B: Y"`? ?   ` 㿐3"H @  `  ` 3 D"`$@$`$` ' 83@`` / "`J ,`)$@&$` #@  2"0 € ` `# `" ` @3" $@?㿐3. "H @@  3 ,"`" @% * 2`      3 "` B< ' 3 "`&?2( ᔝ㿘!2#'L'P'T'X$!@L!*㿘'H'L'P'T'X#@ H㿘#@8N@`N@`%` N@`|`"*` € @L` L   ?,@` < ,L L  LL 4 L  ` >0 `L` L` N@ ` - @L N@ @C N@ @: N@ 0 x  @, N@ % w ls8d8eh8e8fl8fl8fl8fl8fl8fl8fl8d8fl8fl8e8f48fl8fl8ex8fl8f8fl8fl8fH0123456789abcdef㿈"@ǒ @,@  ?L?|/-\㿘-!h` 2! cpJ@ #! arpwhohas: overflowed arp_list! arp: no response for %s-!Ф@ -!p@  'h@@C`@ ` Ѐ  $#ƒ  . 7Ɛ(  , 4 , 4  ~4   44  4  4  4 hax4 j4 h!$@#\ .? h!'l#l ` `4` 4`  $4`㿘-2(㿐H3-" (2*?@ 2&?`(2"?`&2?`  @??-!-*@ p*`@ `V  ??㿘@ /`(+`&'` # `:   `6`6`` ` 6``6``6`6` 6` 6`   .6`  `6` (6`@@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"&   ?: :  *2@ : J@   J@J`   J " @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"  /)# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@&@# # # # # # # # # # # # #@+ 3`@@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &   `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   & &  㿘 ?`2"`0"`"`   "` @ߔ 㿘 ? ` $ 2`0 " $@ $  (€ $ 㿘"M?N 12I?8 D?2 @? &  & & ( $ 2  & $   (  )& "  `"   "`  ( ?"  `   "( *@  "` ?㿘 unknown compression methodinvalid window sizeincorrect header checkneed dictionaryincorrect data check㿘 "@?  "<? 7` ?? ` .#*` € %  $ $  @  " `$  "b` 2    "b " `  $ $    $`*   &@ݒb`   &@&@  ސ? `$ $    * "` $" `˒  $ $    *` " $" `  $ $    *` " $"    $ $  @ ` " $ $ 0" "b $ " @?   " F"" s @u `  5"@ "@  a? `$ $    * "` $" `N  $ $   *` " $" `9  $ $   *` " $" `$   $ $   " $@  "b $  " " ??8{D8{8|`8|8}8}T8}8}8~T8~8~8H88ԝ㿘    "#? ? @s 0  ? & 06 * ?$@ @  "@ 㿘 A?`2@0;  "@"` 20?  -!ؚ  @`#@  ?( "$$$ "` $$ "@?㿘 " ?   ?  @i㿘?6  ` W R !6& @`@ `@`@ `@`@ `@`@ `@` @ ` @` @ ` @` @ `@`@ @β` @`@##񀦠,`     㿘" <&? 8`$`(€  2 ( @A (& 8& 0& & & 4   & <&`0㿘`  `( @ 2` *  `(% $ $`(`$€ 0`  `(  $ ($ ,$ 8$  `( `$€ $`(`$€invalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid bit length repeath 0 4@`  "? ,"` '$# *` €̨?  *`` 4  `&  `-`0  `4 $@&إ4@ @5耢 & & & @&``$  &`&@& 4?  &4!&!p&`4& & @&``$  &`&@& 4֔??  *`` ?#4* @! &!&`& & @&``$  &`&@& 4?`&  m p  `& & @&``$  &`&@& 42D  , ` 0 ( @ "?"`22 & 4@! 0 4 "@ ,? ," ` 0 ( @ "?"`2 & & @&``$  &`&@& 4U 8I "@`%%@ &     &?  *``  ?, & 4   ! !&!&`& & @&``$  &`&@& 4? `  `( & & & @&``$  &`&@& 4? &4&   2  @  #?  *``   *@ *`"  & 2  4     #* *`"  &  &   $ @  `$`(€ 2&  && & @&``$  &`&@& 4&&  4   ! @  -!!a @,  ]?  *`@ ,   *`    $@ * "  & T4    @  A?  *`@ + 4$@  4 @ ! @$@ 4 2!  `$€`( &&`& & @&``$  &`&@& 4'?  ( ? + "@ &  4   ! @     4  $ `#\#`&    `''#d@1!`$`(€ ?"&& & @&``$  &`&@& 4@؀ 2& & & @&``$  &`&@& 4ʔ?&& & @&``$  &`&@& 4@   @E 0 4@`  "? ,"   g&&& 4@8 4 0 0 4@& & @&``$  &`&@& 4 && & @&``$  &`&@& 4q & & @&``$  &`&@& 4c?& & @&``$  &`&@& 4U& & @&``$  &`&@& 4G& & @&``$  &`&@& 49& & @&``$  &`&@& 4+& & @&``$  &`&@& 4& & @&``$  &`&@& 4& & @&``$  &`&@& 4?@8h88\8<8,88888@㿘. `( `$€ (`(`$€ $`(`$€㿘 (ٔ (@& 0& 4`?㿘 (    * * " " "invalid literal/length codeinvalid distance code㿘 0 4 @`  "? ,"@` '!(*` €)` '& & @&``$@&@&`& 4 ` ``@.` 0 4@ `  "@? ,": $@ ` `$` $`$@` -`  *  -a+`@ ` * @  @$ 4  $`$@  @ $` $`$@_   $@%$@ &`& & @&``$  &`&@& 4?` -``  *  -!+`  ` ` `$`$ $` $`$@4 ` -`O  *  -a+`@ ` * @  @$  4 $` $` A$@ @ $` * 8$`%$@ (&`& & @&``$  &`&@& 4M?` -`  *  -!+`  `  $` $ $@4  ( `   ," "@` "$@27  ,  0 ( @ "?"2% & 4@% 0 4 "@ ,? ,"  0 ( @ "?""&  ( ,   (`? $`$@2D `  ,  0 ( @ "?"22 ` & 4@ݐ 0 4 "@ ,? ,"  0 ( @ "?"2 ` & & @&``$  &`&@& 4 (k$@ & 4?`@ 4 0 0 4@& & @&``$  &`&@& 4r $@& & @&``$  &`&@& 4b & & @&``$  &`&@& 4T?& & @&``$  &`&@& 4F& & @&``$  &`&@& 48& & @&``$  &`&@& 4*& & @&``$  &`&@& 4& @&``$  &`&@& 4& & @&``$  &`&@& 4?@88`8t888X888`8㿘`(`$€invalid distance codeinvalid literal/length code㿘04@`  , -. .`( ` (@( @ @'!` !h6 . !`  6@(  ` (' @p@!` !96` ( &@(  `. '!@ 6'/ / , @ &@?/ (/ X @2 `. `(. @@@1  3"` @ . `. @(@@ 2```!/6/ 1 ` @8.`!" "@'@`'@"@"`"`"42 ` "`@8.`!" "@'@`'@"@"`"`"4? C `1  @8.`!" "@'@`'@"@"`"`"4 㿘 4 0@`  ,"` " `"&`&` 8 <& <&`0< ,@@ ' 4  (& 4 4`"   " `"&`&` 8 <& <&`0@&` & 0 #+3;CScspp !1Aa  0@` 'H'X\H'L'P'T''''''''''''''''@(@`&@H X&#1 @  .@"@ * 􀠠  (`@"@8 # (.@@  ,`(`@??&@0 '48' - @ `  @ `.@(&@h H`@*@ @ h'H'0?'p  '(+ '$??Hh((+`', M+`$   % ` d#,@   @&@ .`@8, . ``dp&@&#//! $0@8 '.@&@&X& 4#/,@  /@L   `/@`'LT (P/@ P(@`'0@ (?  ?..`& &   (@" @6@2@ .@@? '  .@+`@?2[  H+ ` 2?oversubscribed dynamic bit lengths treeincomplete dynamic bit lengths tree㿀   ( ' #?#d#`#\#h   z ??*"( ' *@ 2 (*"P' ? ( $€oversubscribed literal/length treeincomplete literal/length treeoversubscribed distance treeincomplete distance treeempty distance tree with lengths㿀d !  ( `' R?((Ș#D#\#`#d#h! ?  ,??*#0-$ +*'#X()\#`#d 8#\#h  ? 2 (??*#x $ ?*#*#$ ? ( $€0 ( $€ -X-""\-"@`1"`" w0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-+!`Y G8+ @0(` @(` @0(` @0(` @0(` @0(` @0(` @0(0` + @0(`88! 8$8%$8%8%8&X8-828284L84T848:8=(8=p8>,8>48>8 88 88 8 8X8 8l8 8888888   8@` 0123456789abcdef/8?? inflate 1.1.3 Copyright 1995-1998 Mark Adler `PTsRp0 P ` @ PX S;x8 Qh( H PTUS+t4 Q d$ D P\ TS|< Rl,  L PRUS#r2 Q b" B PZ TCz: Rj*  J PVS3v6 Qf& F P ^ Tc~> Rn. N `QURq1 P a! A PY S;y9 Qi)  I PUPS+u5 Q e% E P] TS}= Rm-  M PSUS#s3 Q c# C P[ TC{; Rk+  K PWS3w7 Qg' G P _ Tc? Ro/ O `PTsRp0 P ` @ PX S;x8 Qh( H PTUS+t4 Q d$ D P\ TS|< Rl,  L PRUS#r2 Q b" B PZ TCz: Rj*  J PVS3v6 Qf& F P ^ Tc~> Rn. N `QURq1 P a! A PY S;y9 Qi)  I PUPS+u5 Q e% E P] TS}= Rm-  M PSUS#s3 Q c# C P[ TC{; Rk+  K PWS3w7 Qg' G P _ Tc? Ro/ O PWS[QYUA]@PXT!\ R ZV`PWS[QYUa]`PXT1\0R Z V`8, 8@8W!84- 8ɘ58u:8(C8r@I8I R8,[8 f86u8kXz8 8 8l8)8 8ɜ 8ɠ8P8q@8n 8ɨ88+08t+8? 88QB8(K 8(X8n_8hj8nXr8|}88N08n88ST8J8 8:8Ot8z 8c 8,!8`+8 88B8=(M8r@T8c\8RXg 80t828` 8h8A|8n89 8p8+l8&88(8j8T&8'/8<86J 8S88@a8=pk 8v8P|8X8>48 88:$84L88l8>8gx8F88" 8p*8 9 8xH8 T8@c8Tl8v88%$ 88%8\8D088h888Tx 88d8&X88-8, @84U8kX[8! e8u8x8P8x088?08808u88 8̀ 8̈8 8'8_x/8>,:8D8-Q8`Y8+l8^t8 88_88( 8 848, 88S888T 828 ,8 &84T38(=8 D8hR 8Z8aHa8th8Lr8R}8 8x8888|8Y$88p8A8%8P 8 8" 8X(8O/8$58<8ThB8LH8^N8MDX8[_ 8\f8Xm8 8`88^(8`8 8h 888858n8 88b 8͸ 8L 8z< $8 0 8ͼ @ 8 F8$ Q8 a84 q 8@ w 8H ~8 8 8 8 8 8 8 8 8 8 8 8 8 8 +8` 78  C8  R8  d8h p8 z8 8 8x 8Lj 8 8 8 8ǘ 8 8Ǹ 8 8 8 %8x 78| D8 U8 _8 n8 8 8' 8' 8,` 85 86 8? 8B 8F 8I 8Q 8RX 8S 8S 8T 8Tx 8T 8^( 8^ !8_x *8_ 28` :8aH A8b H8c Q8g W8kX ^8n h8nX q8n z8n 8n 8q@ 8r@ 8t 8u 8x0 8( 8 8 8p 8 8 8 _getsecs_rpc_fromaddr_open_dvma_mapin_gateip.rem_adler32.urem_sendudp_getprop_netif_put_nfs_getrootfh.div_devopen_socktodesc_obp_close_bp_getfile_inflate_codes_new_bp_server_addr_strtab_inflate_codes_free.umul.udiv_hostname_getchar_xdr_string_encode_inflate_trees_bits_nfs_readdir_in_cksum_pgofset_hostnamelen__udiv_arpwhohas_strcmp_net_close_inflate_trees_dynamic_inet_addr_strlen_inflate_set_dictionary_ether_sprintf_readudp_inflateSetDictionary_nfs_open_inet_ntoa_inflate_sprintf_netif_debug_freelist_netif_close_net_open_nfs_close__urem_printf_sendether_file_system_cd9660_close_inflate_trees_fixed_swapip_rpc_pmap_putcache___ashrdi3_nfs_readdata_domainname_xdr_string_decode_ufs_readdir_putchar_inflate_copyright_arp_reply_zcfree_strncpy_netdev_sock_nfs_lookupfh_rpc_xid_nfs_readlink_nfs_read_strtablen_ip_convertaddr_obp_strategy_nfs_seekstart_nfs_root_node_nfs_mount_cd9660_write_inflateSyncPoint_prom0_iclose_nfs_stat_twiddle_rarp_getipaddress_hz_getdevtype_rootip_net_mountroot_rpc_pmap_list_prom_ioctl_inflate_codes_zcalloc_rpc_port_obp_xmit_ufs_read_promvec_ufs_seek_obp_recv_strerror_prom0_close_file_system_nfs_inflate_flush_arp_num_closeall_bootfile_vprintf_ufs_stat_prom0_strategy_prom_getether_xdr_inaddr_decode_inflate_blocks_free__div_ufs_open_nfs_stat_types_inflateEnd_netmask_inflateReset__rtt_rpc_call_inflate_blocks_sync_point_file_system_ufs__rem_dvma_init_dvma_free_prom_boothow_prom_si_getpropstring_prom_bootdevice_memset_nfs_write_rootpath_cd9660_open_olseek_xdr_inaddr_encode_memcpy_get_crc_table_nameip_oclose_inflate_mask_bp_whoami_cputyp_cd9660_stat_pgshift_rpc_pmap_num_memcmp_prom0_iopen_inflate_fast_panic_cd9660_read_netif_open_prom_open_cd9660_seek_peekchar_etext_donottwiddle_ifname_oopen_bzero_getticks_readether_prom_init_inflateInit2__inflateSync_ndevs_loadfile_dvma_mapout_read_inflate_blocks_reset_arp_list_rpc_pmap_getcache_ufs_write_prom0_recv_errno_sockets_esym_intoa_nbpg_nfsys_exit_main_free_sendrecv_lseek_debug_close_inflate_blocks_new_domainnamelen_crc32_alloc_edata_cngetc_fbuf_end_dvma_alloc_bcea_gets___main_netif_get_version_oread_prom_bootfile_file_system_cd9660_inflateInit__prom0_xmit_bp_server_port_dbuf_ufs_close_inflate_blocks_cd9660_readdir_myip_files_devswsrt0.oboot.ogcc2_compiled.___gnu_compiled_cconf.ogcc2_compiled.___gnu_compiled_cdvma.ogcc2_compiled.___gnu_compiled_cnet.ogcc2_compiled.___gnu_compiled_c_open_countnetif_sun.ogcc2_compiled.___gnu_compiled_c_netif_prompromdev.ogcc2_compiled.___gnu_comp