ELFa( 4*4 (  (((II*JJD_DO! "&@00Q_: 0/*\@/ XX@0 6QQO @@( @0 <  B00 R<Р -L5 8 J[OJmain() returnedIO   ),@@(LQ 0/I|JO - 0LP@pr`rr`VZ -LM`P@pr@D0D 00``rrr@ -LM`p@P 0 0 0 0Yr0QrKr0  =r7rP@XP 0)r#r@TZrX 0P -LM@P`p? 0X0 S 0N 0I 0D 0?iq -LMqP00 1 U, @ T o RXt!0SK *0S\1  *0U4 E4  0@U0 S:1`8 0S0 0 ` 8 @V40`V* ,0 0*00" 0 Q! p0 \` @X eD 4`P  $0PIII0FIIPF -T1LP! M, P@ipdY4 W1 p, 0 W01R00 0UT   ,04]i 0FP, p P0S0 0P00`V  8 2 @ 0l@, 0IIIIlF 0-PL@T  0$0 0 $0 F p-LMP@D`   0 0Tp F p-LMH$,$HP0`@ 0p p-QLM0@`  `pQP* 0 P(U:p p-QLM0@`  `pQP* 0PXU:p p-QLM0@`  `pQP* 0P\U:p p-QLM0@`  `gpQP* 0 P,U:p -QLM@ 0  FF -QLM@  (F8F -(L  -(L  0-" _  P0L @ 00h p-LM@ oP` 0o00PY YR` cUpp p-LMP@`V0 pdop0H@ 0S' 000K  c 0H@ 0?' p-LM@` Po?XP 0s UP(0Sp(00PS 0U 0 0 to0P 0UPp -LM0pS 0S 00 87 No0`%`K% [)0S ) %0K Y 7o0@P&PK& [)0S ) &0K B0VS UR Z   # Z8,0X12hZ(1,@0X 0GP0 0000S 00  000 n000 0`P`PDH$ ,0K$H ,K+K*@K12h1, VU000f00fII p-LM@`fPfp -2LM PR|2   Jh0S`2`h0 0SL200l0S 2 2  inB^h 4$` ,p@dP,` 000S2022/`VOھ21  p,@`0,K  `VOZ`@0S2`VZ 00,0K,pK!0(@ *pK+KV n0< P202d 202" (P2$00$0h0 ``000P w|II L IjI DFLM p-LM4@PU @$ `00  $ 0!2c1,0  0!2c16`,pXP $ LF p-LM@Pe`@ep 0-LPe@0he p-LM$ P0S 0 $p4 `  0DPT0T $0 0$0 0$0 0P$00$0p -LM8@6@ 00S<"Z -0@S0L00ph 0PP00P=WP`U L    ( IjpFHGFF 0-L@LP m0( l0( 0hl' -0LM@p l00 ` l00 PZpd3 <# Rl00Wڀ0?3S -1LMp@+p`0((0) %0K%[R%0K P )U d0 S pWʀl0++'0K 'K$0 L0((0) &0K&[R &0KP )n -`0VLpP@ 0DPT dT0`0 6l0V D0PT -PLFd4p`V 4h;d$0( 00$ 0  $00 $00 DPT$0 0$0vFGFFFFF -#LM08 ,0 p0 P 4 )3RR 0 A= 0 0   h3 ,0S \,G0S 00g 0S@0 ŕ0őSS000@0000&2R& $ ` @0S6`V@DZX 0@00  00 `~0S6V`VZ6 `0S61`VZ0S0 00S000 @0 00   p pR00B"0P0 00    ,  R00 0B$`000 0 @0S   60S0 ` 00`(1 P0 0  0 S   50S0`00`0 P0 VE00@p x0 Pk40Sh@@j0H 00OK R,t P000/pMFI -08`P@L p0 T P0 0@e0 -08`P@L p0 T P0  0@e0 p-LM`P@2PUOp 0 @|PY00 `0 0TO2 <H20D1$@2<FFHG$F8FHF p-LM@8P@`4  00 00S p  0S > S 00p000 d `p 0 00  (000C0 \FFF -LM0`10#0P8pTP@6 00 0000  0 0, 0 004 P b`0 0  0 0@ 0 0 @0@ @0  @a#% h' L( FF -LM0p ` P_i0ST  0  PE0 @ @00$00$0 00/A#bJi i i* i 0 P(0 0S  0 Ph ,000i? fi9MbI -LM0` @2c1RP,p 00 P 00 0 (0000  udW 0 p-LM(0 @ 0P<0(0`0@000+  00    0  0 ^0 0Sph8000000 00 00 -LMh0 80 PD1< p4 4PKR0 P8_P&0KP<@40K&l P, /K3K2K1`K.K 0 !0 0 08 0< 0 0'0 ,0S ,pM(F M-L0M H0< $$H@@ @T ##(#̠H  $Č$$LL@ "D8@KH@[P T5@K@, P[3@K <@P4K@@2e80KD 0@K @2K1K7K6`KK 0l0` 0P4[, 0 0 0@ 0< 0' ,0 pS ,pM4F p-LMP0K`Pc @_ "0  0'p0@- @ 0S  4000$0 0$0$@@ 0-L@_P(@_T` r 0LM p-LM @00P _$0`0$0 @R 0$ 0 00  0 ph_\LM -LM4@0S @440S -L M$X @R0  l0@ $@* h$DFPF - L  -LM Q@ ^_ 0S@0 @U_HM -LM@L_ R000 D_hϻ 0-LP;_,0@T 0U @T/_0HM -L MPP@`x 4K5 05KP4[S09009  ,<vs $T l5%#K #K<KP5  [5\# P6K 00 Q0N@P%P5y 0~ 0y0) 4 4 w4 N4 y~ r 09$0090|3t$u 0= 0080)   0, 0& 0 0) 00) 0 0 0)  l0 0T0) 0<0) 0 00) v 0p 00) 00) 0 0b0) M 0G 0D0) 0,0)  0/ 0"0)& 00)10 1@ \`00)09Ŵ1\09009Ť1Q101 P00)09t1 P09009T1 <10)H1@ Q@1}>8910) 2R $1R0) 0) < 090090 Q09 ;pMh xFFFF4GF+ D > F H B J N R V T Z L TX ܌ HG 2I` X_e< Na'(j) -0)8 L#8 $ɐ R2 d X\ -0)8 L#8 $ɐ R4 h X\ -LM09`0 5Rɖ R2 d 0X IR4 h 2Xxrɐ R2 d 0X 9R0 ` (ɖ 0R4 h  X2Xo_  9R" D ( ɖR@4 h 0XH(9$HT@ 0  `1ɖ R4 h :X41ɖ R2 d $1X1S0ɖ R4 h 0X"0ɖ R4 h 0X ɖR4 h 0X  ɖR4 h 0X\p -40Lɐ 0R ( \ -LLMT 0 `@6 0pR,6 R Z@PP  !1 01$0  1 ZU Z@$Z$ R 1 0 +10 ,( 0C@  DP 8 4>  D0C TDtQ$[Q>K  6 8K 2 *K . 0 0D Pl00l0 # R간[>0S6[¸ D lK  0 <0 < P A8 \ <00 0lK h < H MMMFF> 0FXFFF05;505t0p000t0p0 p-0LM`a <0@5K p#YL0,0P@@YT  phIh F -LMA0P 00K  00"[80 41R; R 3[pCX#smW$`0ɕ   20K!0ɕ R8 p (K#[0 R3K#[101pW0,0 80xL@H0[W= 0   h \, -8IL@DtpP ɗ (0  @De`tTeaɗ 8R  #8X IR8  #8X 0YR8  #8Xɗ 8#8 XA ɗR0 ` (0P@D&`tT8< 0 9R  (ɗ 0R4 h  X0X  8 \(F\F p-0L M PR`0 PEu @0@0 0S PE_uU09009d`01K02K01K80 K p,p09PTh F 0-0L PR 9$)$@ ɕ<<$)0T_ ɕ@$)0T0h_0T -2L M @RP 2R 2R 200!P 80Plr9 R8 p (0 hVu 9R8 p (0 Pe`\0  R L8 p * 0? SG 1 R 1R |1R 1R P P 0 00 001R 81R0ASQ Q Q $Q < #(( -L8MP`? Q 3\ 3P [2P7  80Pp.؂ɖ R8 p 0X IR08 p X0\  R L8 p  P2 Hp0P0""K0 2K"K 2 R 10S SK[,PK1 R\1P 1P0S2K?,PK2K "Kl!@0p2PTKPK& U?G  K5K 0 Pp@W 0"K0C "K ST T T T U U U T T T U 0[,PK2KX0000000S>L0,PK0K2KT \h !(T > #< 6S-L@p6 8S `,Pɔ0S8 #8X0ɔS8  #8X|Pt0ɔ R (0  PE]uU< n `\F p-LM@80PP`0 (  R8 p t p\ -LMPp60 P a 0?  R6 l   ɕR6 l 0X IR6 l 0X 60mP@ 9R6 l (P0 S 9R6 l ( 0 S\4xV -|1LMp00  @PHQJDaɔ R0 ` (0PE]uU4 9R" D (  ɔR4 h 0X 60Po?PPl0ɔ R6 l 0XP?U<  h \F -LdM⌐Kd  108K0p8K05 -BTP @ 00`W * 0S PU Tp`@00X 8K0 5<5 d 0 h p-LM 2@RP`0 Oʔ2RH +ʈ2R ? R `ph2 `T2R L2RD2@@q @@0  1R 1R 1R111R 1R -11q /1RM !ʄ1R x1R p1Rh1>\1R T1RL1@@1 @ 01 (1$1R" 1R 1R10 0R 0R} R0`y Q0u p 0r D 0v 0 H L B F R N -%*T C> J V Z FD  -LLM]p@\ S` 09h l  0` \0P`Sx=T (l=Td=T*\=T IP=T H=T h\ lQ  `zSʺP \ h忺P\1S p Lhh  h ?0\ hP5 (=  0<T> (<T 2 = S! =@S <  8C84949  d< R ; 2KK"Kp<0K 49 < R `;2K03KK@ [ 505\ 0S ;  x;  \oh>Pi \ r \(4P^5@Y \{d:T )X:T P:T;hPB  媭h  \0*heP' hQ "\ 9. @RA\0S\$9T2 $9TP: R,\09!  d)000?K2K 9"K 0K$9TǹP \2 h役P@ | Oth  \0d)h Ph \ 8P* Y8PP  P  P I 0hP hP5 0 h0 6w7P7 Q7 P! 7R 7R 7R 7R 7R\09 } 09 y 09u 09@q 09m h7f7P 7P 66P h7Pp7 RR\7 R T7  h!87 @&0<hPB6 R> 52: 6 R8  垬h  h6)00 0 6  hP5K`@U` ~0%0 ?A1c バბ w0 2c0x%`L%08% @5Te85T]*05TV $$5T 5T \ h \GTh  h4,0@5  hP\0h  4T& 4Th &h g \$hP5@ 4 R ha P\ hd$Jk. \0 \ \ h3T 3Te *3Tr3 R{\09 u ݫh  h <03 hPTh2 R \ 101K2TG5 2 R( 嵫 h  h2,02  hP,h0 S( !㝫!l  hl  \ l! \q ! *hP !\0l l! <Pl  Q10Slq@% q]P  @X`K@&@ @d1@5KEK A%K RK  5 0 lq@  Pl0  0T C0T&pMi2i 1i iii i i i i i i i i8-%CIr gfffFi i iiiB5i i i i i i NAi86i(i|> 8171< ,Th D0Tq`LPwh0 R  T۪\h  0h,0|0  R 0  hPNh0SK >\0 d  h00iZ@\0|S<:Vp h  pPf @| 0 p0 W  pS 0@R0S@00 A %05<0 S0 S0 7S 0 nS00t0B20S 02 BB0 C 02 R0x0p  Px00x0\d | P\ 000hd0 |0 iZd0  |0R*V  |=`Bh0 W   0h20k \h ,%4h f \0D#hPh0 Sh3 RM  R 3R 3  hh 3 ᳠ᴠh s $T  h0+4R%  4R OP hD( r hD  d4Rd4 R|Dh W  0h04h 峠0㴠0h0$0h0S00h 嵩h  h5,05  hPh0\0) 'N 0-M0LM PcR  0 R 09AKA A 8 0  00 8|0|@x0 Kp ̠0KPT0K  R<0< Ca^0T Fh Igfff -LQM09 `! 0SNd 5@87য়0 3K?3K#K<K ?;'K4K DK$K 074K04KLKK `7 0%K5K?5KTK 474'5K K%K\K  7 '6K dK&K &K 6&6K 06K&KlK 6&7K 'KK 0tK09 @texvPK@&@ @qmT6@`@K KK;KKn  0@T 5 R- 0S R' UAoK@@@&@ @K  .@`  04@K3K0O  0K  4K84 R 5 pp4( K-K00QK3 09Fe%=PCP 0nK0  P+`!0()  P09`! ,)/dM5 @05%p3+%<a<0((3( K$S0BSKR/K00"2(K UK >K 0 2"r#00  2P 0S P W_KVoK l2 0d0`2(K!0p<2<"Q1 "W_K(KVoK01( KOKN/K00 0JPK&@@,1@K@ =KMKK# 0`10K8KKK 0010!8K 0(K8K 0K09|10/K7K'K 0|K09lB h > J D H F N R NoL -: I,FPF TT *X!Z -V  -LGMA0Sp!, 000Y 1 Rx10 S<0K / 8K + 1`"0C#K "K4K1p0C8#8#$0$#K@QBK* 5[9 0K 5K  >N0 B@M4$[ B4[Q04KD 0  000 0 <  N@ B0+44DPp 0 P 0! 0C 0 0 c0 R 0 R 5[ Fh F$F -LHM`09@hKp PD, ZK ,Ix 0ED 3K  %K#[ 0"K 0E00< 0PH 0S( ^h PF p-LM@0P09 `<p%=000` 5e=5h 0-@LP,, 0 t00t00pFh -LM8@@ 09 $00 Rh` 2I -L\M4@KP 03K2K [ R 0 S  R R2  2  | pb0S  V\23K@2K 2[[3K2[K3K C2qK3K0"[2[b1!1[!12āP/ 1Q# 1!1nnDF`d N`<p1Qc[S[s[ϠNP!l H 0@~["[2[v ! 1QQd@K&0 6K06KP`0[@S^0[.S[0[-SX0[S_[]0[\ [ac 1Z[1!!21Y [00:C5>C  0h DTF XQhF4GFFv'N$ -LM9`P(0Bp S? Č 0H S$  |  000NP@(@P l0l 㳀pT0 R   > H J p-LM@!0! 1P` 1 R x1  , RT BRP1   R p41 00S 괍 , 8 D P 0 8 0 \ 0 dp0 ^0 V0 t0 h0 \0  R  R40  R09 0 0 > J H Th 0-MLM@P800000|1 R9  & 0`!00SSS @1/K 4!0K(1AKA APA>K0C R00000000 K 0 K, 0AKA APA.K B00C S񟗽H X    d     p 000000000H > h D -ML M09BKI0 I| 000CSur  D 0T p0S^XPpڴ8! #  1  P`C lP`=04H8( K81BNK0!@@D(0K 1  P`# LP`8 0(K 0$!  0  P`   3P` 8L0  @ T hP`@ h p-LM09r̀@ ( 0 P `  000 0S`V@PpR 0 SP ppppM -<0(,0L0 N R h 0 0  N R p-QLMPC  R09`:09 09-:09`000 0P@ V p-0S`+s է 00b=C4`#ht0  1> 0P@8p-0 $09 `ph 8 F 0-LM09@+P"0 00> Ph0ɔ R  ( P 0,0B=C109 0000-0h \ R-L f 0 0C SE   , ` 0 00 0 0 0 0 00 0 0 00 00 x0 0d 0\ 00 P00@ 00 40B D F H J L N P R T V X Z \ 0-LM0@PShꜘ ̘ ܙ ܙ ܙ ܙ ؘ ܙ < ę ܙ ܙ h1 \1! 00,1 @ 1111 @P !1@P0 @ @0 000 000 000 000 | 00t0d0`0 @ T 0@P@0@ @PB h D F H J L N P R T V X Z \ p-LMP\` 0@S0\0S pR  d B 0000 0-P@0@@L 900000 0-LMP0!0 }0@ 0K@{0 K0 K@t00@i00@0 0S 0pM F 0-8uMLP @t0 R 0s? X0  @0p  R0Z0x0 20h3 > `8 , F -8Nn(P኏L@`p"\`0     밠 %rH F -8Nn(P኏L@`p"-`0     밠 Cd F -LM8ump `;s/000C@T 8#@0SPDU@0H09iC@T h@ 2|K@TZ*H C FHI F -LMu]C P@T # 1  00p , W00$ 0 !0*0!00 @@Z00W00S@ 1 @T 1  oUCE00 1+ 8`   1R010000 0 !0*0!00 0@@" ` 8` 101! R00:`b I F F p-LM0@u]B PR0000 0` !*!0S00@@@P2 phB0 CaIgfff p-LMC0IDPum@D `D20u? @$ R00000   R 0 0 0 @P010C1p+ -LM0@X! K1— 03,>0@*[P !1R 000! 000001S1%0 1 $ 1 0 1' 4 0'P 1<1#F$F0$FIʚ; -LMd8`@T5u],  Pp 45Q (5Q] 35Q /p,0 S ,`K #Ppm>1P@ !+K3;K#+K3 ;K:00Kp T>pᤥPp@K PpC>P@ 1 g ! 1{PpĀK Pp>P@p !P3R pôk+[03!"@ 3Qk a:3Qsp=@TP 0|S:?0 K| K K 2&K0 6K34K3U K#4V0K3f K4K:00 f0Ke K:0 f0[h K0  f0K:0 f0[h K0  f0K:0 f0[h K0  f0KK| PpL0|P00@TE  |0R*@s?K pPp K 7Pps =[ 0 K (Pp10 p=@TP! 0S:`K 3HQ@Q sp 0p0 R, 0 0 H0S H 00 lK H )@TP0 @TT000 T0   0T0Hp0ϲHpMDIx&F N -LM@1p0  0p01 p-L M@10pPt`x0p0t01880V @U 0@@pF4GD&F -PLM@D 0R@ 8pm1P堀`U UJ +<W0  p0 oT10 0& L1U*嬠`0 x p0 0RTp0x 00 h `P"U:@0a0400 T`I$5II -L M`84PP㈠ $8 ,    $g  $@\  p $0  ,p @;0  , 0-  , p0 0p0| R,0H, h0@"20S  $ 0  `0`S  0Th0!20, h0!,2P0 000 Tlp @00 0SA 00  $ 0@.0T:x t0 0Rt0x  $@l0TaV0T, 0 0 000 TD0 R ]000 0pp0 B0$5II3I -LP `500piP $  $ @$0@ 0TM -LMP`p0}N $0 @T 7,P80 T00 0 }N $0 @T 7 P|@ m/ $0@@T 7 0T 0TM N -LMP `p@/ 0Tc@0DD @T0 T 0T 0T @0T0 T $ik/ p-L M0 K `0  PP pX@ T \0\@PU HPH0 0Q S00 4 0$M|I(MIl p-LMt`t0lP P0P@HH D0 0S0b$0@p7$MMM M XI,M&F -LM℠Pp@0 `V 0 =8808 40P( (0pMISM$MM M\I 0 $MM0 0 $MM(0 R 0 R$MM 0-@L .04 00P0 T0h. -0删S@04p@@00  LT5 Qb  $  0P T  0T0  T 0TdH6 R$ R  0 T R R<X ( D d         l 0 S0 00 0 T  $0@  T@0  T0@ ,0Tğ$00 S Q0Q3 r T <  )Pl 8S080m80$04 40\XTLQ00000( Q 00 z0@ 00 ~p0 002  R m0 00_  $0`  T  $Z0P  T  $`0 @ TP@ZTU0  0#0  T  $0 0R0  T!0  T  $P  0T  0T $ 0  $ P P0 00  0P000 50 @0 0 lFdCM&F|Il ISM&F p &F&F&F'F 'F<'FX'Ft'F'FMHG'FM''F'F -LM0`4PY 0S@00 T 0T 0T 0T 0T 0T0S0'0 Tpp0 T}N $0 -@T 4d4p}N $0 @T {40S\ DpT  $0PPpT W'F Q0- L@P Q 08S0@  0-8PS@L ≱L4QK0*PP2I p-L Mh@V PK 0}P ,0"  000(^ `08 00pp80 -L MX`U(pK 0LP@),P(,0 0@00(PU 0HZ++H 080$00 + p-LMP@+` 80Hph+ -LM4 @ D 4!P< , 80 4p8  0<0CR76, 0 90>0P`*@H S : R#: , Jc0 @T9 p`B0 Xp0C$ 0P8 R <0 ,4 0 mP@ 0P0MPP`  0 0B@$B~(F -LMx`W$@K 0PP*A+p$ ,0#  0P0(0(?^ X,+++X@ 0 8p @4@ +:@ p-LM:0`SP 0:0 +@ 8 0Xph*'(F -LMp, h— lp2  h2l ,* B: @P0  TU  0\20\2 0``V $0Z0``V &0Z>❟ ($8 0P@ t2 |,P[03\P @ 090RP @ 090HP@ 0`90>0F?0P!M 0V90"$`0>V 0<`2|"`Vh—`lp2 ` h2l ,h—Plp2 ` h2l4 ,0 h—lp2 ` h2lH ,4 h—lp2 ` h2lL , \8 ,P  T81S h—lp2 ` h2l ,h—lp2@ ` hR@l0 \`h—lp2  h2l ,`cV\\hBlp2  h—l 1\UhBPlp2 P h— ,0l\dGhBlp2 P h—l 0\` 1h—lp2  h2l ,` VN @`1`z>Vuro %h—lp2  t2hB ,0 0l \h—lp2  hB$0l \h—lp2  hB$0l( \hRlp2  h—l 4\hBlp2  h2l ,PhB, _Plp2 P h—0l \hBlp2  h20l8 I,$I00#N>C 0ChR0l lp20 0, Ȅ 0   h—l004 \@3hbAlp2  h—Q0l@ \hBlp2  h—4 :lH \hBlp2  h—P 8l\<hBlp2  h—lH 40\hBlp2  h—l80L \40#` Ph—lp2 P h2lH ,` V P x1@Tp!0040`THPH0L8 Zh—lp2 P hR3l1 \hBlp2  h—l ,0\dhhBlp2 ` h—l 1\`VJA`V@DZ@ H(F4G(F((FIH(F@%I$I!2I\(F0 W -LM HTe  L0S 8$(@0@\ T  0(0@EERF(FYSUB-D0(\ 0 $0L (0 8SL0$( YSUB)FEERF 0-LMhR@ lp2  h”l 0\0 -LMPp'UU U m'teh—0P00lp2 P h2l ,PHT hBlp2 P h—0l \200C0h—Plp2 P h2l ,h—Tlp2 P h2l4 , X4$h—0`00lp2 ` t2hB x—,0 0l \h—lp2 ` hB$0l \h—lp2 ` $hB0l( \T8SP(R hB`lp2 ` h—@0 l\hBlp2 `倀 h—0l \hBlp2 ` h2l8 ,XHl"00N>C 0ChR0l lp2, ` H h—0l4 \hBlp2 ` X(!h—l36@ \hBlp2 ` h2lH ,hBlp2 ` h—l:H \hBlp2 ` h—P 8l\ hBlp2 ` h—0H l\2 0P(0C0X(T(h—lp2` h2l ,Ah—lp2 ` T(hB$00l \+=%I$ 0-PLMP 0 R0 Rt0Q0hhBlp2 h2 l,3 0|I=J -PLMP |"RpW 0``00VhB lp2  h•a0l \3` T2X"0 T2X"YPJ4@T2V0CT2hB lp2  h•l 0\303 o(N@h| ៪t1@`㟪\WhB lp2  h•l 0\C~i`\80\8P`\(.0\8h lp2  h2 l,|"`ah lp2   h2l ,`Q |"pL0)FP)F!Il)F)F)F 0- LMQP hB@lp2 h•l @0\0#hB@ # lp2  h•l 0-@L%(Pa0h% -QpL@P`08S 0 R`,8S  0$ $Rp0S`@` TP$p@p)F -L MT20T2$0H0,08,8$T $PU 0SSyZ @@Y 4P$0U,0   R00R``V ,@T"0ST20CT200绥:0SN3 : p8 @00b@0 P@p0 `倐0 `#> 00Y 3c@^Y 0P0o$`i$0S R000R4 A60S!0Pp@Tr R 00c0C20000#n2Qm`,$`&$$0Sp 04 0hB lp2  h˜0l \V0 00$`$@@ $0S )F -H0L *F -LM`@(0 S4p8PP 0$01l00@D ,0 00 00C 00$@202PP0080004 -LMlhBP p2`   h2lP ,V5 @0 D ȕ10C S1 !@3 T 0 0 mTph• lp2  h2 l,?> 0D <@0 Tp -LM`0Vp0P0 QhBlp2 h2 l,3 `VZ00h0S  -LMh@ lp2  h2 l,3 h -L$MP,, 0 0 < pD8`P, @ P@ $4D@08 8 <2 00 $0880, T4  ,K4 <0 ,0P @, k4040<0<@   i140<0,  0 0 4 0 22$p<P!,\H10P`0,0,0, ,0 , 02,0, $p"08 08hBlp2`  h˜0l \0S 0 R y"T@ᢧ` ^X0 P0 ,!Z ,(0=%!IMb0 0  Q-L 0S S 0SQ 0 0 c8*F-0#1? $ˀR 4    R 0 0 0 !1?0 P 0SP-(0,#1? &̀R, 6 0 0, R000000 !1?0 P (0S,P0@-@D 0 lPR 0@0| t0x0@ &! 0-L@!P0h! -L Mp0,"`P0U@, > ,00P Ro ePH Y4[ P0 ; 80 0$,S03( 00 0*   0S0000Y p'!'!(!(!0!<00  P x!@q!00S  X F000o000Z!, 0r00  op P 80(S"ˠ ʠ0S80 S0000  IhIPI8III -L M04@P`p$!  0) S   0tP  0RH 0 0004iT*F*F -L M@P0p14 RX<0 TZl1 R` `T 090 K 1 ` ! 0厠  P`\# $0 S ,  090'o 0, #>QS @ $0S X00 8o< `TⵥpM*F*F*F p-QLM@`PpT 00 @DRT0  0 @DRTʃ0p -LM@yP 0h -HL9R 8R8 RR 88R" 8R 8R 8RU 8U!0IPPS񟗳.!D/!$-!$-!$-!$-!$-!/!$-!$-!$-!$-!$-!$-!$-!/!/!40!p0!0!hB lp2  h—l 0\0ISh— lp2  h2l , ?hB lp2  h—l 0hB lp2  h—l `V# 0X6$0!@0D, , 00C   0"`$PP@8008`0900V(+F$0S0$0, -04@pLP<`@ 0R 1P& 0S S! 0SP 0 0 Q 0/- 0b1|# BQ|#84m +F -LMR, `4C PP0@ pW@*Q*001|#Q: Pp11^P:1" 0 0 Q *001|# Q|#:,0@p<@=+F 0-LP@T0T0 -LM, 4 04 0<00 0,2P, <0s|",00<0@0D 80D0 ,0@ ,D 8@^P@@0 zPP'z<0 << 40 < @0 S0>08 0 S`0V@ C00BK 0( <25(  `40@ ^000P@@0 <D0*Q@8p0!@ 0P`$ @ 0A,(0"A 0 P `4@  D 00p(04 0,08`090o0  o鎼,F -0L 00  R0S{ ,F -LM@P00pSS(004`090P@T 40S &p 0( 90 i : @40S i>H,Fl,F - 0p`L<0@@p~P4"w 0-0LP@>8 0:080hPP p-LM` @P080 4`0 pHG -LM`@ Ƞ Ƞ,Ā\ P 8\ \0 I -LM< @.8\ 0 I 0-@L Ƞ Ƞ,PP 0\ 8^00-Q |0Q 0 R 00L0Q  0 @T 00IRR,@R, -L M@K 0  @ sDF! Q- Lv,F -L0L\88 00S \0  A|I4D!IQ Q< 0-P0LS0hH @P0S 01(S 0 P 0ԡ (0S P P 00$ $0d@I[O,F,FJJJ 88#40 RJ -L^@& Pp` 00 0Q\*0 S\*`0l Q! P0S$0  bbJJJJp@-@^P 0S 0 0p`0^; S 0S1 0S  0 `\ 00S0  0Q   ^ 0S 0S0\@ 0^@@ @@@ ` ` 0 R 0S 0S 0\ ` 00 S0  0Q  0S0\@ 0^@@ @@p@-@`PR 0SN0RK \ ` RG R 0S 0S 0S  PP 0S 0R `S00 PS0  0^   0R 00 S00S0  0Q R0 0p0 `S00 S0  0Q  R@ R 0S7 R 0S R 0S0\ `S00 PS0  0^  0R 00 S00S0  0Q 0 `S00 S0  0Q -LM @Rp` 0S`V^ ` 0S``X  P0S P0S@@V^ ` 0S`` \RP 0SPP 0RPP^ 00S p-LM0@S`P @P00S T0 0P PPP>pp 0-@LTP aP@@T000S 0S0SQ  0PR 0P  R 0P P0 Q0Pp@-X@^P \0S 0\0p`XP0^; S \0S1 P0S T 0P\`\X\0X0TSX0  XP0QP T X PX^ \0S T0SXXP0\X@ XP0^P@T@ TX@@@\`\`\0T R \0S T0S T0\X\`\0X0 SPX0  XP0QP T XTP0SXXT0\X@ XP0^P@T@P PX@@p@-@`PR \0SN0RK P\ ` \ RG P R \0S T0S \0S X\PP \0ST P0R\`SXT0X0\PSX0  XP0^P T PPX P \0R\0T0\\SXP0X0SX0 X P0QPTXT R0\0pT0\`SXP0X0\ SX0 X P0QPTPXT T\ R@ P R \0S7T R \0S R \0ST0\\`SXP0X0\PSX0 X P0^PTTXTT \0R\0P0\\SXT0X0SX0 X P0QPTXPT P0\`SXT0X0\ SX0 X P0QPTXPT -P LRPTp T^pX@WX@T\p P0SPpTpZ  P0`S `P0STpX@WX@T\p P0SPpTpPPXX \@R` P0SP`T`T P0RX`X`T 0X0S p-LM0@S`P @PP0T0S T0P \0X@T P PPPTP;pp 0-@LTP |PP@T@T00T0S P0SP0SXQ  P0PR T0P X R T0P P0 Q0PTPp@-h@^P l0S 0l0p`h`0^; S l0S1 `0S d 0`l`\hl0h0dSh0  h`0Q` d h `h^ l0S d0Shh`0\h@ h`0^`@d@ dh@@@l`l`l0d R l0S d0S d0\hl`l0h0 S`h0  h`0Q` d hd`0Shhd0\h@ h`0^`@d@` `h@@p@-@`PR l0SN0RK `\ ` l RG ` R l0S d0S l0S hlPP l0Sd `0Rl`Shd0h0lPSh0  h`0^` d ``h ` l0Rl0d0llSh`0h0Sh0 h `0Q`dhd R0l0pd0l`Sh`0h0l Sh0 h `0Q`d`hd dl R@ ` R l0S7d R l0S R l0Sd0\l`Sh`0h0lPSh0 h `0^`ddhdd l0Rl0`0llShd0h0Sh0 h `0Q`dh`d `0l`Shd0h0l Sh0 h `0Q`dh`d -` LRPdp d^ph@Wh@Tlp `0S`pdpZ  `0`S ``0Sdph@Wh@Tlp `0S`pdp``hh \@R` `0S``d`d `0Rh`h`T 0h0S p-LM0@S`P @P`0d0S T0` l0h@d P P`PdP;pp 0-@LTP P`@d@T00d0S `0S`0ShQ  `0PR d0P h R d0P P0 Q0`dPp@-x@^P |0S 0|0p`xp0^; S |0S1 p0S t 0p|`\x|0x0tSx0  xp0Qp t x px^ |0S t0Sxxp0\x@ xp0^p@t@ tx@@@|`|`|0t R |0S t0S t0\x|`|0x0 Spx0  xp0Qp t xtp0Sxxt0\x@ xp0^p@t@p px@@p@-@`PR |0SN0RK p\ ` | RG p R |0S t0S |0S x|PP |0St p0R|`Sxt0x0|PSx0  xp0^p t ppx p |0R|0t0||Sxp0x0Sx0 x p0Qptxt R0|0pt0|`Sxp0x0| Sx0 x p0Qptpxt t| R@ p R |0S7t R |0S R |0St0\|`Sxp0x0|PSx0 x p0^pttxtt |0R|0p0||Sxt0x0Sx0 x p0Qptxpt p0|`Sxt0x0| Sx0 x p0Qptxpt -p LRPtp t^px@Wx@T|p p0SpptpZ  p0`S `p0Stpx@Wx@T|p p0Spptpppxx \@R` p0Sp`t`t p0Rx`x`T 0x0S p-LM0@S`P @Pp0t0S T0p |0x@t P PpPtP;pp 0-@LTP Pp@t@T00t0S p0Sp0SxQ  p0PR t0P x R t0P P0 Q0ptP0 00R:x x0RR R  0R: 0R : 0R: 0R*I I0RH H0RR& R !1R$4c 0R"$:@ @0R: 0R:< <0R: 0R:8 80R : 0R:4 40R*I I0RH H0RR& R $4R#3c@ @0R"$:, ,0R:< <0R:( (0R:8 80R:$ $0R :4 40R: 0R*- ^ 0R \  0R 0R#$ R00R00  00  p-$ @0`P``pMM p-LM`@0P`0 `P R P0 pD00P00 M@I,F -L@0`pP``@` Q'0PU P Tp 000PUP0PU cP Tp 000PU̯M/M,F2a 0 00 0uM p-T0LM` 0PbP0#0%*@@`@0 `?0puM0P -LM⠣0 ,0 @\0p0\0 P@0`0P 0\ P*<P@0 0"R `P @0P U4 0`"R( @0x P@@KUH000KH0S S~ 0X` tD2 Rx1S0N0 000,0 S ,k姰!@0`P``P HH0 R Px1S 劰J0S& J0S\ @ 0S <0R 80R 40R0 0Q 0N0 R  0S 0R 0R 0R0/0Ky 0/0K 0@0 sH:0 H a]pMMM0MuM6-FHGMM-F,-F -LMlŸ@PT, `  Q X0S *(2 ,0S ,ʕ@0 K 0K!3@1 x@  x` q 0 @K@P"R 2SQ*pP> |Y"`0x#@!0 00  00` P0 2>p  y00P202p@0 p|0x!R`G\唯 D卯@ G 0 @pMP-FM-M<M MuM0Md-FHG -LdM, , 0 0KPd,0 040 PP70Sm^jR@K΅@ K@8pp@0K`\D@[P`K0_`PK0@$L@K_` PK0@ H0 L`'@PK|T? &\Pp*4D@< X \0 `KP @K 0`P' nt@K(@pg_`$4 `p@0P``"P@K``!|10 P- p 00`l!, l!@0P`00`҄0#I0S O0S 0O0  O0O00O0<@x1S 0E4 OMMM-F-F0M-F .F.F.FHG$.F`\P倠KP`` @8`PO`p`K0@ 0 L$`PဠK` PO` PK'|0@PK` 0O`pp@Kd`pK&\Dt!@P"$`p* pKKOppp KD.\ K< WO0K4P <( 'dp"4`p%LP,< 6O01s.2x!R0 n4#0!H JDH DXH 4>O0x  2x!RMH )H #H 4O03 -LMPpppp`0h d`( @l(2PU* =PLI0Mt#M4.F|! -LMN0@S( S1 S 0* S$!0lP00"lR 02l1"QS R *S*0cb1D01( (0<.FH.F}`.Ft#M0MuM~.F -LM PP p. ؐuX0`S#0t RW, 0 R 20C202S2S  0p@LtpVPZ00W00S0ojUj9p`<M0MuM(I MQ I0S' X00CSX0 0 “\0“0 0t0 R R X00CSX0 0H “\<0“0 0t00000S\00C\0uMt#M -L0M Q4 0 wf}0|!Q 0N0mO0S FϠpDQ`Hp@ $p,(uM0M -p1LM @R 2SD 2SA N0SH 20CS2P< R 20CS2P. R 2CP# I㑂 R 000  0 F/Ppl@0l @lUTTT 0嶪`IMM0M<.FH.F.F -@@LMtp PP0P N0`S n0 P @Dt`WXii0W l0ipWip$IMuM(I -LM$0@S  z P   -LM$0@S  0S \z0 0 $ Q00R  R 44S 4đ  - LMRP!I R p@`0 R4Q0@T@T00T030"S  V T 0@TX(48<#i閫ꕫT0#!ያTQ g0a Sp` ` Ġ8̌#Č"̌,(,4,  0nX (48<# G F.F.F.F -LMI@0SJ AS< RH {LH uFH 4o9<Q 0S4; -0S Qt% hh \LDS :S,($.FG.FG.F/F/F/F /F(/F 0-PL@(#  @0d0h\TLߪDܪ<٪4֪,Ӫ$ЪFJHsHFXH$FpGJHG p-L$M@8`KPAPTn X"X2R 80S `@801S80 82 R 40S d@401S40 2 R 00S h@001S00 1 R ,0S l@,01S,0 , ,0RU (0S p@(01S(0 ( (0RC $0S t@$01S$0 \ \0R0 0S x@ 01S 0 X X0R 0S |@01S0 PAT1S 10`@!1S1Pp] ]0S00P - -0R P 0 Rgo!)*% -L$$0 R R'(!!Č!!!! 0R 0R 0R 0R 0R 0R 0R 0RDީ HH0P 0R 00/F-00P00(! "(bS8#8   P00^00S Ƞ  -LM@P`, @0 0p<K ḐD0  U㰐C U h,0 S X,C@0 [0 [0  [0  [0  [0  [0  [ 0 [ 0D0  ~@0C[ 0uS[ 0 nᰐ@0 0f  pML/F -LM@p$ K `$K  @$P$%(0HHX$H%X  0> -LM`Pp4K $ @!  [0$ [0  [0  [0  [0   [0  [0  [0  $0S $倎pM\/F -L000!g1 \2$00IP F>嚤0!M5/F -LMP0p`,0 Q% 1B R" P 5SW 0S 0 \0%0 HP  F. 1i 1 R , A0Z0R00S0 000\2%RW 0S ?0,0 ! RM0@- P\@ \ 00 0   0 0   0 0   0 0 00 0  0QK Q q ,$8,#$!, <4<!4"< 00q 0 ,$8,#$!, <4<!4"<00q ,$8,#$!, <4<!4"<00,$8,#$!, <4<!4"<0p@-0SP@` S p 0bl l`. ` n,nl, l`. ` n,nl l`. ` n, 0 nl l`. ` n,nl, l`. ` n,nl l`. ` n,0 nl l`. ` n,nl, l`. ` n,nl l`. ` n,0 nl l`. ` n,nl, l`. ` n,nl l`. ` n, p0 |bl l`. ` n,nl, l`. ` n,nl l`. `0 n,00py7 -LMPX ~Q, 0  张 @f0  @$P P P5 @   0Sܨ!x!!!! P5x!R50 h5 ,0S `,T廢 @嵢    0i RO X0 0SH0SE0SB 0S?X3 X 0 J 0s <4(<"4 <(0 r <4(<"4 <$0 r <4(<"4 < 0 r <4<("4 <0@A 0<@K 0$0S ,a S\ P 0QP!(,P,0K$ P; P0K ., KHpP 0@ TM 7^ X0 0S 0S 0S 0S "0  0 , KdpP@ 0,HPK0K VpP@50SX X5 0\ R5 0(00 8 50S 0X R5 000 50SK @K3@0 00  P 0 `@0P`K`P X 0 0S$0S(0S,0S  8x1S<rK (@pM-0M/F/FHG<M/F0F -LM0 0 ,  0 K 0 aq˲K  0P6PCZr `0K0 [DK/K[0 [XKW0ZZ3K; ZxK 4K5 P) 0"00S!P!P!ܯ!P!ܯ!K  0PY |0S 0S 0S 0S,0 S x,屆08#(N V? @`p'  8#f" # HT@ 0A8#HT:<C4 TxK TK:P0D 8#HP T*<C4 TxK TK'P08#HP T<C4 DxK DKP@xxKKppM-0F -L,M@ƟdxD, 4 0 @< L  TH @ 8@ D 1 2> `RYpP0`20PSp# 0@80Xv8@(6 P`@ 60S+ Sd@( 8@ T Z00T00SL<, L0EP Z 2>0 SS S 0K4K 80K@@8@X5 R Z0Rh@<5 R [0Rl@$ @R8 0\0R00S(R R R  RZQ0 0S0S0S0S  0P@,0T 8 Ux0p0@-P "D0cP8 U|0t0V) $0@S S S S SZQ0 0S0S0S0S  0P@,0T80x@VW" $0S Su Sk Sa SZQ0 0S0S0S0S  0PD V -P H0"P80|@$ 8@< R*d2S [0S A0<@ n80dpP8@8@ 42L0S,0 h2\"SRL  0K4K 80Kh8@L <,0K.P8@80A Z >vP $0 Z lP $0Z D!P $0Z P$0w Z vPf $0J Z olP^ $0@Z $!PV $06Z PN$0, Z uP $ Z OlP $ Z !P $ Z P$ Z P$ M%!)* -L$MSp, 0  Aa @ `#PP 2.00CS ꘹!! !! !! 0 D0 o0C0[Z 0 2P2x!R 冞W W$0SZ   07Z\ \ \0S8 ( X0S $0S Z0 Z\ \ \0S8 (0 X0S ʸZ@ 04P5!00S' d1Q %?"@&4 8< d#`rP @"@"8#8#$0$ 0 ? R "4 40{"Z 0,0  0@ `cPP?_@ `WPP3,0  0@ `p*0M(0F- -QLM@6 [ ,1R 0> R, R Pp Q0 PZ0@D`D@`S S0PgP @ 00@ 00@ 0 0 0gP0PfP 0`g RPp NLN p-LLM`("G T P0 S *pX K0PPP @DTD K0S @DS 0S0 @cTPUP#PpMX0F p-LTM`("G  T%K0 S pX K0PP @DTDPK0SP@D S ZK 0S0P@cTʺ[5[#$0$%KpMWIh0F -LpY$`@` $ d\0@0 K BKp00` 0,*Kt t0h@ jP  `Vd0P [0`tP yP0-0P0 0S@P <@`VT0. # 0@@0Xjr@`= P`` l=0Sp Sd`m @` @`VDK8K<K @0KH@K@YPT@`VT  0@00  R 2>PM 4 Ll0P @0 K:@? ZR 5 L d1 ""0l1C8P#h 2SH*3 L;  LK\ 0FPZQ ; M Y* 0K \ 07PD 02K@0 LQ X0St0S 0 R R X0St0S p lʟP `p!@0P04:L ` B`p!ۓ( $ʟ `p!@0P9` BL `p!ɓL YPP G㔬@  D0̠0202 R202 R202@ 3>ZM@ 00L00L 0 L 0YI0JH @` d0\04 1dZr   h03d,$8,#$!,000 00SA 00d  0/d0#$04S 0 ) 9 10CS19d 0`000 8\00N `kL R X00X00P5@0#7P@~40X SPڴ[C[F?d 00S P0S d0 @0/Q 0Z0 YS d0P `0h@ <4(<"4 <0d0 "" (\0 (`+ d@  Ġ8̌#Č"̌d iP@` \0  ,@@@$@(@P`@0  02K0P \dn7ş@0  K @R20C2 R20C2 20C2@ d0@6P 5I 0SF PKd,0K PG7P7 `x1S,7t崙<ğ@0  "K R20C2 R20C2 20C2F; t0  X00X0000d0 0""@0/QaP ,$8,#$!,d0;0P0  @\ d4` ydZ   oh01s  hlhK0K 0 P``P@ 0@ K3 q Z Yc d0P `0h cP0@`0P0 3 : d p 5 <4T<("4!<d0 <d 4(<"4!X$@@@  `X @0KBKP0\ 0,p *Kp 0d@ P \ `P 0[\@p@ p>h@  R@` <@@TP . # 0@@0Xl@@= P`@ =0S Sd@ @@ @@T@0KDK8K<K H@K@PP0@@TP$͟@00= lD < @ K0@SY < R 0S hP,0[D00^ <  q@@2>^j 2>PT L4 l0.P  @0 KB@? YR L "R 2S7*3 ;  LKX 0P'YQ ; M X 0K X 0PD T K@0 LQ X0St0S 0 R R X0St0S  Rʟ `p!@0P0: ` B`p!p @ʟp `p!@0PX:` BLd `p!^LP P` G)@  D0̐0202 R202 R202@ 3>YM@ 00L00L 0 L 0XI0JHpx @\ `0X04 1`Y`  d<9X0 00N0 L R X00X00P9@0#8P40TS`ڴ[>[F?hQ^`0 pȟ@0  "K 4R20C2 R20C2 20C2S p90  X00X0  / @X '`4\ `Y   d #!~02K 0K 0P 0`P@ 0@ "K3  Y X# `0P \0dP p h@@h W Wzd&0v  !0@@@n/0 `P X0 `0@@G50S Sh@5 Q Q  Rl@$0`S( $ 0U0R00S$0S  $0S $0S $0SW0 0S0S0S0S  pX0kP`,0Vp@-P `"0Pt@ T0`S T0S T0S T0S T0SW@0 @0SD0SH0SL0S 0@ p\04P`\0Vx@]P `%0P|@ 3 R \0R A3o0S 0S[ #0P o0S 0SG #0P 2S7< R(d2S3l0S40 h2\"SRl PD0< @00 /H0 0S PDKH@K8K<K @0K@1L 40KP@@@0A%2S@@ @@ @@P\ jP@@Y@@qP\ `P @@L0 \P @@A\ /P@@6 X wjP@@@@ X `P @@ X|P @@X P@@XP@@`X0@0 K BKP00\ 0,*Kp p 0d@ eP X R`P 0[X`xhMM'%!0M"XM-M<MM MMuM@IMM)*3 -LtMP l t T D < 0 弒K4 p 8 H @ `X D0\0 Zp P @@0 K [Qu :Qe >X$@@@  .,0,K` Xx0 0KP\x 0PRK` PP \ W W h= R@@@ <@@TP. # 0@@0Xi@@= P`@ <0S Sd@ @@ @@T<KDK8K @0KH@K@PP@@TP<@00h< `\D < @ K0@SY < R 0S t^x*0[D00^ <  m@@2> R ]L4 p0DP @0 KKlQ@? YR l L "R 2S.*3 ;  LKX 0PYN : J X  0K X 0PA K@0 LQ X0St0S 0 R R X0St0SD f@ʟ$ `p!@0P0: ` B`p!儊 Tɟ`p!@0P` BL `p!sL PP G>@  D0̐0202 R202 R202@ 3>YM@ 00L00L 0 L [0XI0JHpr @\ 2[X4 1Y\  `8X 0N0 !L R X00X00P9@0#\8P40T SPڴ[:[F?t^l0 ǟ@0  K R20C2 R20C2 20C2Z xT0  X00X0  J @X B[\4 <Y  4`  -02K 0K 0P K`P@ 0@ 02K0 J@@<60S Sh@A$6 R [0Rl@9$0PS $ 0V0R00S$0S $0S $0S $0SW0 0S0S0S0S  pX0PP,0Up@T0PS T0S T0S T0S{ T0SW@0 @0SD0SH0SL0S 0@ p\0PP\0Ux@4 R d0R A? R h0RD4 R \0R32S7< R(d2S3p0S40 h2\"SࠡRp PD0< @00 0H0 /0S DKH@K8K<K @0K@CL 40K P@@@0AW2S@@P\ gP@@|@@P\ d]P @@o0 \P @@d\ P@@Y X fP@@/@@G X C]P @@" XP @@X P@@ X P@@\x 0t P, \0., ,K` Xx 0KP\x 0RK` PPP X W Wx X0 t P, X0[@"[00[0 0d  0Ah0 TQl  d P0@ PSh PhMM'%!0M"XM-M<MM MMuM@IMM)*+3 -LdMP T X D < 0 4 d 8 H @\ D `` Zp PP @0 02K  R? 2> R dL4 d0P l @0 0R@? YR L "R 2S *3 :  LK\ 03PYL 9 H X\ 0K \ 0#P> 02K@0 LQ X0St0S 0 R R X0St0S0 ,ɟp!`@0P0 ` B`p!ˆȟp!`@0P` BL`p!廆LKPP G㆟@ x D0̐0202 R202 R202@ 3>YM@ 00L00L 0 L X[0PI0JHpd @` 4\ Y T  7\0 0 0N0 L R X00X00P1@0#X70P 40T SPڴ[6[F?~ǟ@0  Kn R20C2 R20C2 20C2d h0  X00X0  @\ 4` Y  K 0K 04P`P@ 0@ K 3  Y `KRP W W W W%0  !0@@@/0  J@@P 050S Sh@A5 R [0Rl@9$0PS $ 0V0R00S$0S $0S $0S $0SW0 0S0S0S0S @0 pPP,0Up@T0PS T0S T0Sw T0Sk T0SW@0 @0SD0SH0SL0S D00@ pPP\0Ux@d3 R \0R A32S7< R(d2S3d0S40 h2\"SRd PD0< @00 /H0 0S DKH@K8K<K @0K@L 40KZP@@@0A2S@@PD dcP@@@@PD YP @@D0 iP @@tD P@@i @ CcP@@?@@W @ YP @@2@ HP @@'@ P@@@ P@@ `h 9P, `0 00K\,`h h  `+P \ W W\P, \hMM'%!0M"XM-M<MM MMuM@IMM)*3 -L R LL0 0rP ( `P0@`bKH*[0 LP fKKYxK xK OPU N0S Y J0Y0@0 @ 0匀 S' 0 S& Q 0 R 0    @@ @ <4<("4!P  5P0S 0S P 0S 0,$,!$#<0 T000  0S K 0S00ȕQ; @ P4SPP0aS>S0S1 5 55:@ PPP 0 \0S 0S 00 @K0@T@n  P 0#2S0lS 0P2Ax*0cSTh: T 0 ^ 0^ 50S0S @|K 0` @&P0PSP1 0aSň@ 00bS0\ 000  0S00ȕ ֕ 0S00ȕ ֕ P0Sx Sq  0 )000P0S 0P 0S 0P@0SG 0N0 0R' Y 00DP Z@0 @0 ,,0 S ,wn 00@P Z@0H0S !3R|0S  $0R (0R ,0RPS 0 0 00 00 R0 R YP `V pp@0 P00CS0Sd6 l0S^0&0c RW6x!R<P0S0S |K0 ` %P0S100cSŜ 0@  00bS0P\ 000  0S00ȕ ֕ 000: T0 00 0<00SX 5x!Rp W z PT004Y$ 0 J4ğY 0·p 0,Bn bQ(4(1 PR2 T30 0T4 ßn \5 `ß` \6 塇0S 0  0 0 <4(<"4!< 0 `ßHP @Z`D @0@ $(P,`7P0 PP0|0  Z0""0 S P0 0#0 0  02@ 0C32 8#8 0 ꩢ bP < @4 , 0!N0 0RL V/ Z0S S ,0 S ,i d0&0\  Pd00@!0 Q 0\! 0Z0S S ` P`00@#0 4 0\#H0S !3R $0R (0R ,0Rh=\ \T= R0S S,= R [K`D [K뼋KᰭK^ l l0L Sh! CZ0@T20K T1[ @T 4T 20[V0KK} [KH [KL .K+KVK  K  P N0S VK 0R2 V) 0@P2P[H`!<hP @@@20[S S)0\ \p0K( 40\ \pE?K * 0@P2P[Ld!H0S !3R $0R (0R ,0R:\ \: R0S S: R [KHHL [KDKK2[|K\t 0hP:x!R 20[V0K@Kz [KH SOK [KL ἋK.KVK  K  -P N0S VG 0R. V PP<h 0`!H@ P@@ 0 \/pE?K \*\t 0<PP 0Lhd!@ H0S !3Rc $0R (0R ,0R08\ \8 R0S SF7 R [KHL [KSOKἋKKT :T2[|VK\t 0Px7x!R4]20[V0K@Ku [KHzUOK [KLu ἋK.KVK  K  Pn N0Sk VB 0R) V PP<h 0`!H@ P@@e0 \p0K( X<PP 0Lhd!@ H0S !3R $0R (0R ,0R5\ \5 R0S Sp5 R [KHL [KUOK⼋KK2[MK|\t 0#P5x!Ra20[V0K@K [KH [KL0(K;K40>KVK  K  P N0S V[ 0RB V0 P@< 0h 2P[H`!@P20[S S \t0M0\ p\0K( 0\ p\E?K P@ 0P<h2P[Ld! @`H0S !3R  $0R (0R ,0R2\ \2 R0S S2 R [KHN [LKJH2( K0K;Km2[|x \tK/K0PkP$2x!R20[V0K@K [KH' [KL#KVKK    1Q N0S V J0V@@0匠S  R K0^ (<4<("4!<P`00hSu 09C0cSo 0RU VJ K/K 0PP2`[H`!@<hP @`@x xQ\ 20[S% S \tK?KgpMuM1F1F1F2F@2Fh2F|2F2F2F1!2F2F@M0M2F0\ p\0K( 0\ p\E?K 0PP2`[Ld!@KKH0S !3R $0R (0R ,0R@x1S |!PR 00@0 0l X7Z @`l1Z DZ+&,$8,#$h(,JK0x P1\ \,1 R(0S% S" 2 R [KH% [LK!<2K( KQ0K;K2[| K\(0p BP2x!R0[10K K0K01[L0 H < t 03S 9+S (S X 2[|\tF/K0P 10[3SK,K0^0Rtt110t1 K0^10K1[p3x!RD,S|Q  @0 W<S2[|E/K\0p P3x!R!K ^40S |Q@ R0  \0R$U 1 0@d1 R \0 *1 R00 ,0S ,_aK H0KJ?0[0S S5#$0$#K?0[0S 1x!R {{dd \PK0`Kf\0SX0ST0SP0S H0K 2@P ~0x!R xL 0 00d 0-8 0Pd 5pM3F1!3F0M3F4Fʚ; -LM@TP`o gT p 0 QV 0RP1 P 0'S0  P 0T0$! 0000 T!000T 000 :T0P@  00 0T 0S0 \ R*0 f00 20  0f 0 T :Tp p@еNMhNO -LO_Mhn@,@  K ` ^ p P@ ^,0 S ,O` ` KVP@ XΟx1SP|z0X0S HQ  0 1 0S@0p P0 (K9K Ȱ00SU M0S`3> Rp X@0xp 0 \(K9KU F? Rh2S UF? @h2)8[S Q @T00[@0 "@0 @ 00@PPZW W 0S Q d< 0 K oUZ5 [\`0h0Z) Ȱ`0h0 00K0 Z[ X 0(0Z  Ȱ (0p 0@[\` `2> R 8 S @; R 8# 0@K@[T008KZ /0@ @K /0@0S  /PK0@  /0@PUO 0S  /0@0 K  /0@P0S  H 0@0K0  8 0@P0S  H 0@0@K  8 0@PJ0KZ 0@0`0@PU0P0pS` WS UN J0 SK p0KS UZL0 H0 $0S# T0S [K0PS J0 SL Z00K02.002 [S000\0 PFHU  J0 SH Z00 K002.02 [S000,0 PzFL`0KpKUp J0 S Ȱ08 H0080 Ȱp0x0[\p0x08[S10[SS0S 0S 2.0SSH0 R@ 000xP`\PKK0  PPK- 00aVZ 0 pK L0 H  0<0 0 2K1K000KD@ 48<# @K5 0S_ @T T6 @K  0KK[\PO0S O00O0P[`` 00 Lp R_PPUK şPKKK 0`P K[PK Kt 0 iPA Z$ PK@K P  0PK@PqK[\ PUKDğK@KK 0` @0@#$(,"(f 0@P @0P  㾨K Ks[Pp\pnTrK Kt 0 P Z? :[S [ !48<#8 fSS @0P  K)KAP@KK  0`PHK[\B PU/K@xŸKPKK 0`@ PrV:[S 0@!$(,"(f@1P KKP 0Pt PP Z? 0[| [ f#2!B8  R @  0PK`0{K[\ KP@K K  0`PK[\ PUK@KPKK 0`@ P0!$(,"(f@@P @0P  KᾨK@KKPKK  00P0MpMt#M<4FD4FpM"1h4F?MxMHM0M4F4F @0pP 0@8KIKuT x1SG 0d(vBL0S I8u -LM~h^@ K ^ PΟ ,@  Ѐ ̀ ` T,0 S H,Y\` K≇ `PP x1Sv0X0S H R  0 1 0'S@0 KK QPU F? R``h2S PF?  Ph2 Q9[S Q @0[P0P0" P 00P  YU X 0S Q < PK0   PQY3 [P00Y' P0000K0 Y [ P@0H0PY  P@Hp 0@ [P` `2> R P x; R?  K0 [5 僼0P09K,Y /K0@  /0@0S  /0@ K  /0@PUO 0S  /0@0K0  /0@P0S  H PK0@0  8 0@P0S  H K0@0  8 0@PJ0Y 0@0 K`0@PU0`0pS` ɟ WS UN J0 SK 0KS UY\0 X0 $0S# T0S [M0PS J0 S\ K0Y0002.0B [S000\0 PBXU  J0 SX Y00K02.00B [S000,0 PB\p0KKUp J0 SPPXPP0X0P00 [P009[A0[SS0S 0S 2.0SSX 0S0S0S !<4RP 000K  0K P-  0$1 Y0  K\0 X 0B0K0@PKLP  0PK4(0@T`  0A K 0cA [(@03SZ +S ST  Q P R U U3 PK0K   K9[SPO0S O00O0 `` 00 L s[P0SK şKKK 0@ KK K `K 0`PN Y5 0[#2 dLP0H K 0\ K9[S KPK 0 K  P K9[S 0SKğPKKK 0@P o0 $ d( `P @0辙K  x9[Su:Ugpp 0-@LTP P@@T000S 0S0SQ  0PR 0P  R 0P P0 Q0P -@ ML  0p@gf0 0`@^f0 0P@Uf  0@Mf 0@Efix 0ih 0i 0LiH H0 @0@M5FM5FM5FxM5F5FLM'P<MDM"2R 0R 0R: 0R: p-LM\Q0X!T1@"T`b !08444 017(0S 1x!R70 @TP0 @T !0 0 (0S0x!Rx0S 0 Q 0 @TpTL`0 mo Loo 4o<MuMt#MdDKF5F<.F5F0MDM6F(6F|6F -`Lp0!x/Q@Ab+ T P0 R 50T` x1P?AAc T P0 R 0TXX@oPd 0X0Q00S/Q% Q R Q0S,0Tp`T0@S S S R S@0S\0Tx`V 2> R Z? =0@0  Z?%>0PKP@K<% 0\oڲ "48<#\i3  @@8^P @o 80<S"48<#Hl [@@TL3("( D 0Z00 (P,  !  2D@S:0K., K80gPs GPLC ZL 000,0S !0x6 0S Q:3  505.  0㒾4@0P  V 5 R4 0 @  ` @C8h P@L ߮@40tS@@@0 V 85 R 40   ` 00S 3 0!0ğx1Shg,P4@0^ V p4 R 40 L0 ? kPP,  !0 2D S: _P@a ß p0x!0R0N,K 80SPo |PL5 ,0S !0Pp@0S"P3 0S Q:3  505b@70 ý3  0㻽@00 0㳽{g H@PL@Apg@ D0kg40dS@@@0 (8x1SY(Vg@SgI x1SNKgx1SEBg@g6100 0kt0@ 0GP2@0P/>P T0$P 4P T00 5P T0 PT0  0P@ >P $  V4P $  P $  P$  P$M%!)*M/PM"D|:FXM0MKF:F@MMMM:F:F:F;F;F -LDMxĐD `VpH0  # 0@X=l7 P`` \70S Sd` V47 Q Q  Rh`$@Q 0W0Q00SQ Q Q Q0S0S0S0S  0P@,0Tp`T0@Sa SW SM SC S@0SD0SH0SL0S 0@ 0YP@\0Tx`V 2> R Z? =0@0  Z ?%>00?%> 0@5PF(0@L0 T 3T +T T?  T T0S  04D0S.  (0S4^Z 0S5VH^  @0 V t4 RH0   ` OAH  R00 L, K0@P L+0[P10P0  0 K0@ P 00[SPPU,@[L  0 K0@@P /[P 00S00[S 0P 0Ē 8 K0P 6K DKn{D0,$,!$#<SD0 : (0S/[,T` 0D DPU@ K L0P Pg [L>;4 l8#( BR*H R00@0 V 1 RH0   ` PP@ L, K0P|P/ 3T+0[L+0[L 11,@[0L0 <T P <P T0P f2P T00 P T0 PT0  ;P $m  F2P~ $c Pv $Y Pn$OPg$AM%!)'/HM"PM@M -$6L$Mxē040 ` 0 V80 pZPg # 0@X;5 P`` 50S Sd` V4QL 2> RH Y? =0@0  Y?%>0040Ó?%>0  505 @a @@): !2S6R1 0 0 @ 0㈺8 @Q? R 80S0 0 㫬0 0[8P8 0 c0A80  02K@040 S 3 R*[0 0 ` ?X30S Sh`f@3 R [0Rl`^$ @R 0W0R00SR R R RU0 0S0S0S0S @0 PP@,0Tp`/-PaT0@SU SK SA S7 SU@0 @0SD0SH0SL0S D00@ P彽P@\0Tx`]Pd2S 0 03dO4Pa 4` %0P|` PD :P T0PD 0P T0D0 P T0D PT0"0Pt` @ _:P $ l @ 0P $ b@ ePw $ X@ Po$ N@ Pg$ ?M%!PM")* -LXMPL^( `p@(^ZP tZ0Su Sn 0 0#"R0S(0 S (HZ1d KPNP 0PpK#21`C V0Sp`F S  0S`c`FQp V R 101@<4(<"4 <0 hKx lKxh<4(<"4!<0h<4(<"4!< 0l<4<("4!<00  0  0`pMLM;F<.F5FW0;F -LM@Q$0Sh*[)[LM -LM `I  ^p, 0   吠  0 S` Z0SQ SC "2S40S 10S+ 1( Z"21h KPP 0TPK#21@C T0SP@D S  0S@c0@DS00P TʐQxPK^ 1 0x p cRd(@0 X(0aSL8x!Rr10 01@T 1 0x  cR7x!RS10 01Z ^  @T  1 1  0“\7“x0 b 0cP=9 B =| |0 |X'0 0c 1cLa1RQ0Sl 00cS 000cSmvx1S R00@0 6 ,0S ,WGa0 l  b 0np@Q 0c 0R d 1 S 020\ 3,vax1S  pa0K@&OCCdl0p @bax1S\a0 Wax1SQa0  Kax1S BlBap R 00cS00cST R  R 0S5 Z P 1!0S  l 00cS p R 00cS 1l 0bSR10111Z@0101#x1S0S 1 ``} ۵`Z 0S0 T R 0S Q  1 R @ Cx1S P0@0  ` `D 墵`0ST ``3`@``(` 00 0""! BT0KYZN RF  lK bvlQ P 1& pK TvpQ  R 1 & Ġ8̌ #Č!̌ b, $8 ,#$ ,,0p  <4(<"4!pp 0-@LTP GP@@T000S 0S0SQ  0PR 0P  R 0P P0 Q0Pp@-@^P 0S 00p`0^; S 0S1 0S  0`\00S0  0Q   ^ 0S 0S0\@ 0^@@ @@@``0 R 0S 0S 0\`00 S0  0Q  0S0\@ 0^@@ @@p@-@`PR 0SN0RK \ `  RG  R 0S 0S 0S PP 0S 0R`S00PS0  0^    0R00S00S0  0Q R00p0`S00 S0  0Q  R@  R 0S7 R 0S R 0S0\`S00PS0  0^ 0R00S00S0  0Q 0`S00 S0  0Q - LRPp ^p@W@Tp 0SppZ  0`S `0Sp@W@Tp 0Spp \@R` 0S`` 0R``T 00S p-LM0@S`P @^P00S T0 0@ P PPP;pp 0-@LTP :P@@T000S 0S0SQ  0PR 0P  R 0P P0 Q0P -hLhmP  P """""""""" -LMJ/@Ol0 P 8$ 0Z p-\PLM`  @2l+hr\Ppp#M -0L/S S$PF0/S @"M -L M0 S@/S P   C, l,+`r/,r`V, P V` ,+Mr@T~ /`rPo 0S` gp?P\Z hap1PU PPS !(pk0@ $0#rZh@ h@h+rl+p+pTP#Z $ PF:XU`h0 (Z=i,f h0( }ZZ,W,R0S,JF^,D,`r0/S O@"Mk0/Sc 0 0Q h0SV@0.S- 0S%+Jo/iqP@ <kP,1  @T PY \5 05+$o0.S0/S0S/ 8qP000@00 .R0.S0/S HYzh+p+p5t=Fx=FLM\2 S`@? RAN+p\h+n1 R $l1Rh+n  PjPB? @TA~/pP00+n? @Tn\ h oP \"h 0Y \hn@nT0S\2hA+nn\20ih+qpFxM >F M>FM$>F@MI0>FM I@"Mp#M%M<MhMMMQpM.M0M," - L0 !PV|!@>FH>F 88# 88# -LMPp `P@& P'W' V 0`1 ZX0`1 0`1 X P 2 S P 2 SP~0V 0`10 ZX0`1$  0`1$ @-\ @( (R,0,0,00( ,0 (@0,0 \ 0-@LTP 0ᷫ@-( R,0,0,00( ,0 QP@T0M p-PLMP@ 2SC !R11101! 0!22S2S1S p0<2S 0`00U Xx-V~TphP[Y`P %R0P`P %xM -LM@T`Pp WiP: @T0S P4S& 0WP `P@ Ph@ {nL0U0tL0  P 0@@P00 @@P08U#x 4S L00L0PP!4S P@ Fn !-L P 4 S RL00CSL0R00000 -L u 0I8#8 0I@0 R 4S RRL00L00I!0I -LM$0@S 0 P0$0S -LM$0@S 0S 0S  hm\G -L  8I8#8 b8I!m8I -P`0L@pT Q0 00  $0SO`XN0@TV 4 0000 0 M@MMM -p`0LS 0 P P0@T Q0 00  $0S KO`8N0@T00MMM@M -LMq0PS A0P %a!1@T $0S? @T0@T,  R 000  0 $ R(1 R NU00P00SPNU00P00SPAN0@Tݳ00DP.gNPU@0 RU ƳPMMMMM J@M p-L M@)5PP` 1SV1p1 0 埳 K@nM`ᗳL` p-L M@5P0 1 `R0 pLPU 0 P y K@HMPq -QLM`PP qf1$ Q A$j,0$ 0C,0Q0f10  0 4 Q-@LP"P` qe!40S 00S $0Q A$9,0$ 0C,0Q 0e14  0- @L$P$0S "x"X""" % ( * , - 0h۽ ׽  p-L MP@`0j `ώ j nᶽj ᰽< K"4 40a 㦽d `K<4(<"4!< 0 噽<4(<"4!<  0 卽<4(<"4!<  0 偽<4(<"4!<  0 u q<4(<"4!<  0 e<4(<"4!<  0 Y U<4(<"4 <  0 I2 E2 @ ; 7 2 - ( $     3 33N @ p Q-@L`CPp 0f14 R 00T 0P- 0f1P(@,0 $ (,@$PʨQ Q0fQ(P @4@(@,@( ͱXP@"M -LpM0倀K@(0 吼`pWpW8`ڐ@Kμ Ii(0 S (9(P,0P(0$0@T P"(0AAT q P(  pMMX>F -\LMP \0, @P0 (?Q ?Q ?Q ?Q? T ؞,0 S ,8  ?T ?T*$?T >T >T> T \~ ho+\> Te ;L>T >T >T U >TA *>T PP 똀X q \Οh1S ^`0 h!t 0@x1Sx RD=T Nxddd> Qt! Y, h1S   =x!R0h1t sR<T& <Th= @T $0S @TPU< ,=x!Rp SRP T<Ty#< @T $0S @TX;刐FDD(I/DTDD D |>F>F+D *D J>FND >F@"MDVDDM(DI|!ZD$DRD QD SD MWD$2DYD$M)Dx[DdDLDxPDOD-DMM@M<MDDLDLBDL(0T3 *0T7d 0S 2|  00 @0T  S*@0T S:T KmHP 0 0  P1T  :) 0S00  ( 0S<`{.P   f1TL 1T 1TIH 0|0 0 K/KQJ`% Rp \0S0S 0S R0 0S0S0S0S QQ4S 4S V6 P lKᏜ범H DKἕKቜxK| KKМ|0@SÈ ŖP@@  V H 0sCH Dm44H  fAH 0D`$$vP DKX4H XK3KRDxK| KDK\3T]tP@ph` h`Hh0PS /`P0O0pU@,4p|;8=p+P@ P`x00 P P@Zj!x` 04D P X0S0t0&P p0S0pSpP 0X05TX 5T 5T%0S DPP   ` c$0S $/P+ $6 @T  _cP$0S00 @TFP  &F00@00 P0 @Wc  Fe 㱚P@ ᇚJ0 S P4`4P `Rp H0S W@ R I0RH4 0MP Hd8H 0DP 5P!ePh0SO0S 0O0+ 24O0h0_P1&ᐧP 1#ቧP ' 80pS"P@ P@p2g10$ | ` P@= |0(YP2+| b00t S2d00p0R0cp00e0t0l0cP0#*h0ah00`h0 | 2VP ṓpP@||20g10{0:T  :T #:T _$:T  ::8:T@ ؙP@P 0UP*P@ T l:G/PXb Tc0"Q 2 00R1"0c 1 ᒞP0e011+0S@@ 4; P 0Q*P Q:P  boPP l;TJ ;Tc .b%^;TY;@@P  R ;@P jP 0S 0@R 9PH< R00 4 (@ Sc$XP T@ +P<@@P  @P .P 0S000P $*P 000P R 0R0R``V  BP Pሐ  TY!Pp' G/aP<]=0=A/@0 ```aP !@$D ㈐ XD h>T` /t>T ,$>RPP D4C.(02 y ,$>R D4(2C. ,$>R D4C.(02 , x0?T ,$@?R nD4C.(02 ] e,4S@@ `DĘC>(0$Œ0 U,4S00 PD$C" s H,$?R BD4(2C. :,4S@@ 5D$C"  -C(0$ 0RM@ P: ,4XS D4(2C.? ,4S D4(2C. ?T' :4>T,4S00 DDHC>CΈ(0$0BP@ ,4S  DĘC>(0$Œ04 ,$=R  DDC(C ͈BP@ ,4S DĘC>(0$Œ0K =T  =Tr E(-0S =0SS S   AP 0P0  AD *`00S 0P@ B@@ l$ U!P\,((,0P\I#@0  BPP Q 0`@P@ሐ C PU 0V*(P`U V:U AN@D _P#j( %@@ 0@P@ሀ  PU 000(PU (;Tl /:T:@@P0p0  ><P@@ l*0#4(SPP 0` 僡 00R T*0S  $ @P 0`0  /_04 ~_P "\BXBAPABB$0 Q2020ShPLP 0S> R> R,9 R 9 R P0P  H{ 0S@@@ s 0S@@ 30S@@ ,0S@A.@ 8P@@ @T (@PPPTP > R=,@2>0SS1 S/ 7 R1S P i -%>#O†舐$ 01$ 0`$ ,00,0$C \2S P` 40  40P7Pz w <X _86@@@ RQP G > RB EP  ;`PX8MA㈀ "\6T 6T`0LS %0SPP 0@S PPpሐ  >P űP 0j1 R 4%0#4(S P (?P 0`0  /@^~O0@  "402@0SX2ihPP 0SK> R > RX4 R L4 R P0P  DF0S@@@ >0S@@ 0S@@ 0S@A.@ 3PP@U@ (PPU > RX 2>0SS S 3 R\2S1 S  0SP@#φ -%>00000\ 0j1  P \f 0j1 PUX 2S QUQ 2SUL ^A U2 ^^!11!Q` j!000 0j1 PU QU 0j1   峜"!R 0j!1>1.> 1a jQ 01 0`  @jA00C0V PP 0j1 0PSP` 40  4O0PP m<X d8<0@@@ 3DXHDLMDL(7DXDH 1!)DHxM8MM MMM(I0D/DPDGDLFDL@DL?DLDHDHDDDWD$DTD2DYD$ZD$DL>DL R uP  PX}?PP !j!0000@1  P @  >8P0È0 ʀ1` 0R@@ 0PUD 2 S QU= 2SU8 n/\ Ppሀ !Mᙚᗚ!0`0S2 pȁp8P0S%#υ =/P@00000PP 2  )P@  >PÈ ŋʀ 0`1 00S20 0 0`1  {0`0CS tp30SS S  k@P0P0 c  0P@@@ T \& R=P P`P I AD [00S@0j+PP "@ >㈐ *\P \0 P P0UE  S*(P0U> S:U: \$ U \\ ,0(,0, (P`, ( R(0(0( ,00(0,0(`(P0(,0 `( R,0,0,00( ,0 ᥙ@H> 0OP@<>㈀  &0000,4SPP DĘC>(0$Œ 0 0x&00 R 000 R6  6T6q6T6Tp*6T6g6Ti 6c6T7Ta*7T7T[*6TV:D4 SP6T 6TL*7TI 7TDp7TB x7T=0S<97Q 777Q 7Q 777Q:7Q 77Q7Q *7Q 77Q 7%:0SD48Q88Q* 8Q(8Qp@-@^P 4S 04p`4^; S 4S1 4S $0Ēd\44āS4  đ4Q$$$^ 4S 4SĞ4\Ą@ Ğ4^DD D@@dd4$R 4S 4S Đ0\d44 Sā4  đ4Q$$4SĞ4\Ą@ Ğ4^DD D@p@-@`PR 4SN0RK đ\ ` $ RG $R 4S 4S 4S TP 4S$4RdS44TS4  4^$$đ$$ 4R44S44S4 $4QĂĂā R04p4dS44$S4 $4QĂĂđ $R@ $R 4S7$R 4S R 4S4\dS44TS4 $4^ĂĂĎ$4R44āĂS44S4 $4Q$4dS44$S4 $4Q -$LRPt ^pDWDT㴤p 4SttZ  4`S `4StDWDT㴤p 4SttJ΅JĖ$\@R` 4Sdd$4RddT 04S p-LM0@S`P @{P44S T0$4D$P PTT9pp 0-@LTP WPDDT004S 4S4SQ  4PR 4P $R 4P P0 Q0P 0-@MLP 0P8 0P@8l 0d@8TP@P0L00 0@0hST3I>FH(M>F&M>F'M&M8)M()M -|0LM@`P/"2P*PP 40 $pK ` @KTQ,fBd᳠㱠>F -LxLMP0 l3, 0xH L d0 @`  ` PP` 4 2 ,0S ,'` PT  `0LD0 SX0 ?H @pKh l p X  KPPP @ Th0S P0n -0KPS h^ XI p nKP/X plL0 RX p l D@KT Pd rUP0S`T\\ GPD@KT?h^TtHL l WP@ T5P`D0` 0D@ &-PK PT0 .0[R-K 0P  jWl?pMuM ?FT)M -Lx4ML x , H P0 @X P0X  PP 4 3 ,0S , 'DT@TPUL\L@TH`pZ@K /JP@KPU@p`@K PPL TL0 S@D0 ;H\ p ` PZl @K JPC@KP` @K\ R P-K .0[ R0L -0KP .0[R9 \\ Z/ @K aJPL@TP`p @ DKTP0SXsTT @\^fHL @K  V0S00X00X0 D00D 0S00@@K VBVikwpM?F -L\MX0 , 0x  x0 4t | H 0h T p0 @l   P PP 4 84 ,0S ,,&l ' P\  'l  RL D P `0T00 pX T@K R:  0@ .T0 0S00T-0K 0SPP T^   kHPL D0 RL p`H\P TR TpMH#L?F -LMp~p1@U   P`O PP 4Đ0\8@KO04 80 400 ,p . P` ZV 0P407>@儜` ˫P` <@K 0  n@ uMH#x?F -LD@KWPJ @K\ @R `P00\-0K6 @K AGP%TD00TL D@ ^T P`p0@P DK UP\XX @\^HL @K yS@@K rSpM?F0S S\ 0S20!R0 SR0SP \ -LPM0pK`@N4T@@Sl 0@ ,P 4PS X(00Ҫ0S( 0=˪0S )=H#?F?F 0-LM$@KPN0H $0 峪P8 ( ᬪ0S0 ==H# @F4@F -LPP 4 ET P DT 40454U p WᅀⅠ5@ K@T \X0 ,0S P,i  5 NpM(|-M$AF -?LMp`@_P@< PP30PPP@  P UPE |  ABnP`^P@U8S8Bn`LMp10P80 g P@c 3P`4 Z0P`,@ MTDP@  2PV`FX8 / !AJ^PP#X ,04,@ P@X V40070> ,K80603J^@ PM)0 %0 uM|-M`AF -OMLMl0l,0 \10  % 5 K 5 Xp'ONK@D  @D`P\!1: @P# C0SpP`'}P54 5 W@ K @T \H0 ,0S D,4㿕 XMpMuM(|-MAF -MLDM p` |,   % 5   ,0 S ,% Z B 0OKH2$5 H( , $\[ ,% |!+@P$%PTPP $ 00S4 5S@04U     ,5(%0Y,5 ( @ K@=T%R50 \20 &P DT5 5( LpMAF(|-M -}LMPp4P`. ,p P@ 4 P@ ,KY10100$1Zp?P 4p04, $,@ |-M -QMLM ` m4 , @p$5 <% 0 V  2 85 PP3P $1S !0S h,0 S X, 4H0 4U 2P( (0% 4 0%  P 0S,5 5 QKPI85Sp   +?Ph Pb  P8 ,%p R,% P(5P(QK 4@0 4@-45(%0Ĥ4$5S0<%R450QNK@D@D QK@@o <P@ vP4 54 0 E g @ QK@@QK@@Lg@@  KQK@@  W P( 5(%0 4 (5R5 _ O^KPE PEG AKL`|P(M0%]PQK@@ 54(% >#pMAF|-M -}LM`@p4=PP $1S 1T ( P@ 4 QP@@ Z(K$AZP 404( $(@ |-M -LM`00 T1|@, pKPP $1S 1T :P@4 4 ' P@`4@T 4 @%TV 0$1,0S0 R8:88 P 44 $4@ uM|-M -L,Mؑ0t,0 dPvj 4Y D@K0f0T0 L0 P0 H0 D@T @K` P㐠L00L@  0 RP000P 0T  T@ V@H@K0 6 LK-dPK  TK 4 D<0@@@@04 ,0S T,-D$4Đ$4dDć  4pMAF 0-;L@\P R|0 R IP0+0S PP 400PFPAF p-LM0@/S[ 0US I P*0S P:pp0`/S +f[If D0`/S @-L 400S 0P0 1&MM @-0L EP00 -LM@T DT -LM@HD 000$R 40S4   h|-M&M -LMP DT p-PPPLM<`  4S @P TpD@K0)[TP 40CS4  00C0p  |-M&M p-LM@`TP  DTp p-L M@K\`0P㗑@B0DE0D- I>ᄑdp , -L`pPf*P@" D IU P 1P0 1 K P  @PtH(M( 0-LPP DT0 p-QLM`PPPP $Rl}+p 10C 1r@K 0`?H(M 0- @LP HP 00hD|-M 0-L Đ0@ ^ Ğ@ R( R Q 0 S  @0  0I>P@ \ ]HPP 00,0P 0@)M8)M&M M-LM0 Đ@  ` ^ Ğ@RB R3 Z  0S  0R X-2001EB>0p`0 @PZX0 01lL0p`0 @P0` GT嘛P 0000匛P 0AF@)M8)M&M -LCM@q0CnK `F 0 `FQ@]CHK 9IU h+3I*P@ 40S4  0 S ~ 0 P@ U .CPP T qPP pM(AFuM4SC\Ā 1 BF -L4Mp@P  T0, L X T0 00 0K @[ "   @ !K[!1   ;[ 0!1 [ K0$(/K( h,0 S x,_K EX [!N 1P`K`K yE!N1 P` X!N1 K `E0S;[:;K!N1tU ;[:;K ;[$( 9+KK;Kᡪ!pM0M4GF@BF$uFDBF-MBF 0-QLMP/ P8 !:!%ˠKP,ˠ.$K 0#*+#"+; R\!#;Q^ST P0x!R0p/`0x!R0P , L0<.$0x!Ru0.0MBFBFBF 0-@MLLPLLl 0P %400 P@%0@0x3ICF-MCFH.M-M 0-hPL@ T 000Q 080l'Q f'@ T00-M-MH.M -LdMDKP ?$3|}x!~0l0K/K.0KR @pK 73KGCK'#K73KP[ @L H@ ,L Ÿ 22"20(">[.["(0 0TB X2P"@@DbH2 0P0 [@ 0[P@  $@2 3[(,0!1 @/[H L0048@=. P`@4 @T 0 \   @T\j%P@ l D0+0K0k0  @ E0S,, E0SLL EPB%P`  >  70' 71'!|00}  ~0@0(%P@ 8,&0M@BFpG4G4G$uFF$CF-M-MH.M -LM@PTp `0S @T 0R 0R 0R:0cSʲ1*:R r 0R  b!1R R 0R!! X 0) A A0 S <1)1111J8 8#R Q ( AP A0P 0112c1H Q A 0RQ{ AwQs {AoQk sAg|YvP 0 S P 0R 0R 0R 0$4R\ 0  0SR0 p-LM@ P`=0 R Q T@ Q Rp170717070~0 `} l Bp-M 0-1L(M@T 0PK B2[S02K12["[K) 2[[(0"K T@T0P 0 00L0, L, @,0 ,L0 , ,2[02K-MpCFCFp@-@^P 0S 00p`0^; S 0S1 0S  0`\00S0  0Q   ^ 0S 0S0\@ 0^@@ @@@``0 R 0S 0S 0\`00 S0  0Q  0S0\@ 0^@@ @@p@-@`PR 0SN0RK \ `  RG  R 0S 0S 0S PP 0S 0R`S00PS0  0^    0R00S00S0  0Q R00p0`S00 S0  0Q  R@  R 0S7 R 0S R 0S0\`S00PS0  0^ 0R00S00S0  0Q 0`S00 S0  0Q - LRPp ^p@W@Tp 0SppZ  0`S `0Sp@W@Tp 0Spp \@R` 0S`` 0R``T 00S p-LM0@S`P @PP00S T0 0@ P PPP;pp 0-@LTP ,P@@T000S 0S0SQ  0PR 0P  R 0P P0 Q0P p-L Mx`@tP Tpd0 p``P0@ P0@  80 0 P (@I/M/Mx3ICF/M /MDXHCF -LMp0@K0P 0 ; Az@T ` 0 S h ^P@ ; xA0 0`0,pM/MCFuM Q-L Q0000<0S0 00 0d(/MCF -PLM@ Q" :Q30S0C00S 0S 0 T 0S0S x hh)0S0CS0 R0 000  0  ( DF@I/M/M0DFTDFPPP 0Q 0S Q -LPՇt (`0p0070P@P  PH@M0S0 Dh麇' 'DI#tDFDF p-LM`HPU D @000L$H`ph镇pDI 0-LP㍇< @0000S P00h}'DItDF p-LM`PU p4 0@00  ,phapDI 0-L@Z4 P000P 0hLu'DItDF -LM^0 ^ \P PH  hB8 (XP P  H -L$Md$0 SP, p@ ,0 S 0,}$P`` d7::PeLLPB PWTg LK  ?%0YQIBT0S >@ >@ `T0T!(PfP@ PH 4@0 4% La `p@00 `L0`L `= ᴆHPTLP! ᥆i | = l =%0 X =%0 D =%0 P0T0pMDF/MsFDXHDFAFDFDFDFDF 0-@LTP @TP @T 0@T0 p-PLMX`@ L0SD}&HPU $0R a0T 04ph7DIDF -pLM ^P`$ "Q @T  @Th0@? $0K @@@@8P0+ ' /M /M EF -PL Mp, `0  @T R@TPUU00U00S 5  5 U00S 0S5  00U00S0X0U00SU000  U, R R00U00S ZY Q U U 00S -LMⴡ崑0, \`qPU (o2'  mP@Q Pq!!= P@0p!Q X@V 0\　08V`, 00 V X0 0Q# 001S  0S,0P P00S S 00S/M/M /MPEFEF p-LM$0PS p R L0S H0S  0` R 0L00  @ L 0L@ H 0H@ P @ph/M$0S RL0SX 0 0 0-L@ۄ P000Z0hЄDI R< -,L$M0<@K ,0 =㿄H P@ - `7 7 D D0D僠 2]₀p001`@0 ƒ 0` 0@^pWPD  RD H凄0 ,0S , pM/MEF p-LMPu`pP@ \0S @ qP@^p7`@7 0 /MuM -LMpJwP@` MP-P  U@ 3`0R`0S`0   P/0Sp(P /MuM p-PLM@P 0Sp7Pp5;0@S` 0R00C Sp n;P000C S -LP`ۃpPP@ 0S000P@ă/M -LP`ểpPP@ 0S000P@ᤃ/M-0s  1,$,!$#< ZL R 1s <0- L0 P h(0M/MHI p-PLMU u03QP@`@ 0u, 6 0(QF%0 0 \00 0 0 X0@Z`0u <*<H s0S140A!@00pEFHI#ȁġ#X#(0M/M p-LM@P!D0`a!R111 p/M 0-L@ 1P0U 1 0 S01 10C1U Nk0 -LGkD0Q <080Q 00Q5@0@05i i i i@ -L`TMp , 0YVp t0 @ x P U00TP ,0 S , 1!qW <0S lK@52>=0l0Kp0hK jKiKk0K2:ZU š,< $4, $ < x!4,<.,PH0 D  Q:41 0 0S, S 0 !0<0 @ @0 < tp"2QP80 4 0K p0 0p0< lK 0@ q@0 0])t0(XK K;<4(<"4!< H0 D pMEF#/M"\dI Q-Lpa0 0paPT C50XAr 0rD!rrPrrBBrrrr@(#0 0 0 0 0 X00ZP1     .de<0  0M`IEF###HI#D#h##F 0-L$P@</0`I 0-L@㗁 1P0U 1 0 S01 10C1冁U i0 -LM0@S 00S dP  4LM -LM0 @4 8 p`5x!RtPPd 0 48̃| 0 48<sF U"R 2S;*l'P`5 Gb4`PP Qz vP20 2 8) (004 1 8A @0H443 8Y X044i0h jk$(,<4O00O0sP jP i@0 S T@ O00O0sp`5P@ h"`"|0K mP@ 0  Q|0  U@0Sdx1S 0@p嘀pWp  x0 S0 S0S0SSfP P"`"|0K HmP@ ~  |0Q v  @0@ SSx1S3P@ P   RZ 2SW TTB x0 S0 Sx@K &6`0 48<p0 anP  pI0S `p x0R  0R "x1Sj0PKpK`@8P`pK`K`\Kz_`Kp0[@ PK ]`$pPL`0@0%$` a?`@P0$ Ġ@K ' |K(% pT&lK@pG`$4`@&\ Ġ`@p(1̌"ČTp.̌0  P0@ E`"V00R00S p堀O0S㠀 4 / pM,0M`IPFFT0M\0MMMd0M`FFFFFFFFFFuMGF0M0M /0@h i0jk$(,<4 ?04;@ A00+ R, P`M0L NO$(,<4P0S%|%Ġ%2 V 2 pP,@s0s 0`I 0-LPs@0hs 0-LPs@0hs 0-2LS@P/0/ \0 R" 000 0| ”|P!40!!(`0 "b<4(<"4!<#,## 00h0M0MuM -PLs2`Sp=BT' O RN0S2P+@T0@2V2TT 2T KB2ShQsV0222s00x!R$ `@M0M\HF 0-2L S0@2 P""0S 0 x Q0hJ|sh0sP P 0hs0x!R0M0M|HFIHF -@L R`U <0S bbp 2Sh";[rbb 0-L@R U <0 S „„0h0 -LM1p S `, "2R| 1q  80S $00ca  >[`VR 1000P@0@0@00 儁  1#$0$ 0 4400 0@0 0<K% "1R1sχ<1" 2 200 @ P0P   0 @0 ,0S ,t0P@ S 0 B0 0  0f0f$0C0CZpM0MHF0M -L,M0 $(,<4<!4"<S 0R0R00S40  3x!R3P@ P qP0 0  , ">P, P %$ )!(0&@*P$"'`+p4#(8l|8 @` q4L, 48 =VQ- 0S,PQ%0S0P` < 0PTV0S`h00h0phXphS Q@ QVP@ ph  0e LFMF4MF<.FLFLF -L$M<Ð0\P,0 pD 5A0AS",# ,#( #30|!40 $ (4$$$0 L1 PC0S9P3p @s!1 @RP"^@C!0 @Rp PP@  n#C  >Pp  \#sPni pMi i HIpi(oi V p-LM`+j@PP  1$01010  1 jU^ 0S0000`0 `pj@D0$0i$ R 1 0 +10 ,(0T 1P@0KP00P@@T0AT  d;@ P0l F   $@n0<80kIII@BNF -LM@8hp@-(0 @S20DP`Td0$0h ( l0,0p -LMP0`P(@m0T,&b,@T (@, p[0SX 0T(40S040,0< RpW R0 00W00D 0@L0OW d00d0T 0@\/0,0TKh00h0`$P .P   6Pl0,p0l00W40p,K0ptj< ,0b<P@ʀ"`@(0#b0a!@Q{8 DFv 0-@cTPLکP#30 0-LP@_P \\T  Q: 00Q:P 0P 0 S, S  0 $(,<4 0L1L @ 0040S @`P`q 0 R!@00K0C@0 R00c 0YR00H 11 @@ 1 0000`0 @V R00 00 R l0S V00R  R0`1 0 0 0H@TV`  PYL0S Pj 0@ S l0 S00  POF -L M0Kp /cYj 0 1 `P@0SG`VPEZX  0Q000 XS 3 0L1`L @ 00Y R@P5PP? 0 R @00C@0H 0 @ 0K 10=000 @0 R l0S PX H@ 0TL0SP`@ BOF 0R0S t -LM0pW , ,0O@K`@0 @@KP`0 ` 1  P4 E84 E5X00 0R P \0a R R0=9 ==9 = 0S0"P 0= @ @P00WG t`t 0Pc P P= = x2Q(0$0,P0$E(E%Xe2A\$W(04 \$$0@Rl@JY Y000P0ShP@0 @@K`P``P0pS0 1Zp 0 S0 R 4 ll0P4@ 0SP4f0 !00A00C0i4@,0\$04@=l2 2 0Rl0=)B -BR0l00p 004@d0 S =9C =CS 0[4 $0P0S= @ @P0L?B 0-L@P0 R !@00C@00 -@L0PSp` R Q0`00Q0C0` 6B !@00C@0 p-LM0@00l| lP0 ^c R R= = 40S1Q00h0cQ00 Sl =9C =C S l 00 04 ` 00P` ʘ0P phP  v`p?BI|G$ p-LM@PxY40 S` l 4 0R0SphfY -LPF 0-LP 0 S@  d0   R0 0P0P000``0\0h RQ00000 0CQ0 A 0 S RQ00000 0C0 \0P p-LM`yP@  0SpX<< P40@P @@@X U$DM$DT$ p-LM`TPP0 1 I0 ³P@ 0I 0S 1@ 0 pN 0 0-@PT0L  P 9 0 -LLMX> 崐P0SP  5 PP 0 Q- - P'$0\0 4K` 0P@T0 0@ KX0 循4 TL0KL X0 H P\,@ `@P <` 8p D {P  -0 SL  P h p-L]M`P@P   P  0cOK]S  :4 ]/bP]? 0 p -LM@P  R 0SUP  RP  -QL   0-@LTP  0S P@0000 -L Mp?P@z ɲP` z  P  P 0T2@@ 0 0   X Z 0R 1Y 0R 1 0@@R,@ x㟕 0O0$!\0  PX 0S0S 0 |Pz J0  0  Z 0S0S 0 ^P\ ,0 I Y 0S0S 0 FPD 0 Y ~1 01   p@W@?#=?0c1 0R1`  0S` ?Q @Q P  `\` 0 R` 0S  0S`WWP% P 0 R PPP Pㄳ〳}zws0d ,P2bT0C/?2cL!b @P 0 02ʚ;ʚ;gfffQ P0-L@N 0SZV0P RPQ  R00 0S00 S  0S00 ?Q 10C1V P 0 R# 0T00 0T0 0PP P0E00S0S P0SP -LM1p@ `> RP PP 0S PU0$0( P`000101 0S 07wυu`/p P`70`e>70$(OF -LM Pp1S, N 0 KYr 00K P@,@ K YE Pv 1qϊ0C1 s B @@K ?` @0P@0K `p`0@K #,P 0 @K0@ 0S 0S 0, SR   + ov0S 00K PH  p0Rp H0S0SP ,010S D00@S@04S, PF 0-L@ 0PS R 0  R0 0P0P000$ =0$0  0h 0 S RQ00000 0C0  0P -LMp0Suw R" Q000Q0C0 @0 ` 0OS=10C1 00C00 Ho 0-0LS@P 0S1010j R< -L M@ P, 0`p0 @8 $0R AυC 0S0 , /o -LM0p` 0@0/80i -LM000`p 8` -LMP0 K0^40 " 4@T 1 R!! `4` P`Xh 0RX h0RP0S L0PS0S14  Qs pp0 H0 0@ op!1RHX 耀8  (`< pI0 c$1S4 101!Rx0p`0P`p1Q 0,  <0KYO <<'X`00K0S8p`0S@ H0S:H0S*0P 0@Ppp H0 -LMP0K\^4   ?@@K (`@K 0@R0PS1S 4 R 0CS1H 0@R4@  H0S mI0pxpW p H p0@S4@  p H0R@00S@o0SXh 0RX h0R P0PS 0SYe`p`@ K@@KX`p`00K X Q:X0S*0K@K0S@`p I0@-10Sh0 0P@PP  R:Q*01Sh000 -L 㷭 0 P@- A0 Q @D 0R@ @0R 01 !o01 !0 !Q oπD 0R@ @0RQ!!1!0R !1110!1 p@-\ P4 @@D0Q.@ @0R* a0 D0S@ @0R1o1!0P1 !01 !0 !p\ D 0R@ @0R\pU11101QoP!!1p0-P@P D0S@0SQ < <0R8 80RP0 -L  0 㔮-1 Q HL 0RH H0R 01 m!0 11QmL 0RH H0RQ!!1!R01!1!1 p@-PP6 H@L0 S1H H0R,`1 L0 SH H0R1mώ1!0101 0!pP L 0RH H0RPpU11!101QmP!!1p1P T0SP0S𠑴Pp-, 0@S`"#& <pI p-"M20S@!QP#oL`M 0pI -LM, @0 P<$T1L NQ00@,P\L, %0S;!E` `,,& %"{&`PP`@t`PY` 0S@P0@ 8000  Pu P0!%  P; !E` `,,& %"{&pG-0P@SM : 0S:0PЍ0 U(' T!0@0S@`T# 4W) c,"$L& p! P",` 0@0S@```0S@``T# 4W) c,"$L0&! p",P`p@ -LM `p0@K\ ,  0R0K|P@Y \0K, 00@K,fP@U P0K, U  0SR 0K,0, (0T0̠ 0  R0  @ K,0  0@R 4Q0@K@KQ 0@@K`@4P<08# 4`(Ly,% (0@K ",!<p",,@K(0 - ` 0L0pP  00 0 0P z000 0pP( $ g 00q$0 0]((0, 0004080< @00D0H0L P00T00\ 1d0!l t 00X00h00|0p0 `000x0 0t0q_ @ 0u 0 10 00 0S  hIQ ? 1P 0SP  0S?\ p-LM`P@  0Sp5N<< P40 @P @@@%N H|$|w$L{$ p-LM`PP0 1 T0 P@T 0 ; 0 @0 0p 0-@PT0L  P]~ 0 0-LMP@U 0SQ 1 RWP *0wP 000 -0 SL =P h p-LM` P@cP  )P  0@KS   P0 0 p p-LM 0PU` @PP@ 0Up -QL   p-LM PU` @PP@  0SU000p  -L M`@VpPV HM0P RL@M0 RC 0 ``0W2pp 0 000 0X 00@  ppRP៕ 0OO0$!\0c0 p2b0C/?2cL!b%P 0 0& @ݧP` @ ԧP0 P 0S Pa]Yʚ;ʚ;gfffQ 0-@LL0P R, 0 1 0 R L R  0S 630-R!0 BSQZ0 0Q  -LM1p@ `. HP! PP p_P0 0080`/p P`7 `PU0047 $(OF 0-@LP P 1PU 0 RPZ0Q HP 0 0C0 (0 S0000@/00hA 0-L@ 0PS R0  R0 0P0P000 O400  0h 0 S RQ00000 0C0 0P -LMp0S08 R \000\0C0  @0 ` 0O4A-0 `0 0@0 4p0P0 0 0 0 0 R AQ \ ! BP 0S\Z p-LMPK@` 10C T#J0QZ0V0T00S p -0LMSK"*K 0SB$: $ -T LM@HT00  (0R I I;M,PF 00I -Lp`P7@T@ h R(( `@ pp00 DPFTPFI -l`L@PTp P 0S `@T$h0T0 hIlPF p-T0LM@PT` P 0S @TppI -LM@h 0-pPL0S`0@T P@T00020#JII 0-XPL0S H0@T P@T000 .II p-LMP60@`TL  (`0#ppTPF -LM@ h- -LMx@0Slhd@T BLP0 @@ 0 ,@TIxPFPF$uFGPF3(HG -LM@$h 0-rL@P@ 0hP P0 ,  0PQ 0QPoI0PoI -L[ P00@-SP@  0P PR  0S0P 0P 0 -LM@Q_  0SPF -LM$0p@$0  P`y Pq P D $0S $T` PK PW PS  @T P 0@ \  0K0  D1D! <1 R41(1 !P! @KKP00  00`` P 00 0ZKPPKdx tp 0,0 `K pM4aFPFtKM;M;MI;M;MPFPFPFPF fQ~v3( fQ+3(3( fQv3( fQ(,3( fQn,3( fQv3(0 R MjG QF 3(Q0 pM3(B3(0 II -0LP4M 0X 0T@K@t0 Rh@ P`00TKLL00 R 0X  >;M;M;M;M;M|IHGH@PG&H -L@PT`p@Dt @ PDP TP@Dt0P;M;M -LM@ P2 P0( P) P0" P0 P0 P P P  P p`: P 40,P hLM;M;M;MSF;MtKMSF -LM@P P hPP  P 00c0SF -LMp KP0@ PS@6$`KzP. T $0   $PU! T T @! 0 s0@ PS@ P f 00     Z$PV PTFSF p-L M`KPpF0@S@ PKPT T K 0 K 0C0 30@S@)00'SF p-L M`KPp0@S@ PKPh `RT002320 0@S@00 SFTF 0-@QLPJ(@TZ0 0-@QLPJ(@TZ0 Q-LPp`@00eT : 0c00e000s(00eT:p00e0dKMhKM p-LM<@<`04Pc0c000pdKMhKMlKM 0@-L~S $Ԣ$Ш$H$p$$Ш$l$Ш$$$Ш$$p$Ш$$Ш$ԧ$Ш$$x$Ш$$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$Ш$l$F&0S'00C0|V|f 0R'0 0CS0@6D&0Q3*V 0@R*0'0 0S0@:E5 Q*'005%0S*cUE 0Rtet# Qle deR00 PuP0 0 S0pP0  0 0 0dؤ^% 0S  0弄Rt00Q^ 0S 0^h4 0S00$T(d0 S D0 R 00Q300 S0QB ăs0 G0Qp3#0Qpcp dcd00 R 0 H P0 R 3 0c-Rs0b0CS5005@G200 050 ̂%@G"S 00CS0050005 0S RK0 dR 0 0DbR <p00 R 0  P0 R0a 0R С p A1Q`1 bp!hA0 0R:0RR0B Be&c&0S`&0S]&Qa 0R0R S  0R0R S0 Q 0@^S}P0Q0Q0A Q 0 00+&0c0c0 0QWudKMlKMhKMdIlIhI;M`I;M0TF`KM -P@L@PpP`P0P @D@PPP%P  000clKMhKM`KMdKM -8@LMxP00  0@KMKMpKM0 00KMpKMKM8 04S00 0 0S405pIpKMKM0pI0tI -$ L0S 00 tI -L 000tIpI -L!0@]S@t T !0@]S@00D SA Da0DSR\T_T3\TS( @SA @a0@SR@0@\T 3@U@t T_P Q:P00\P0S0p P@$0?Sb$d$d$d$d$d$d$d$d$d$d$d$d$d$d$d$d$d$d$d$d$d$d$d$d$d$d$d$d$d$d$d$d$d$$$$$$d$d$$$ $ح$($0$8$\$d$d$d$d$d$d$d$d$d$d$d$d$x$$$    .P@ -`:<P@  >P@0T,1pP, a00/TU# 9T0pD UA DA Da0DSR `TWpD@T7pD0s" @00DR Sa0D_TS7ToPOPP tPTP P xPXPP@(0PtKMuKMKM4TFHTFTTFIhLMdTF -LM||`P0Ulp@e0T UPe c$PUP0U00 X$PIxII 0-@PLP J$0S7$cP  P h 00C0\@P 7$0SU00hz0 qPPTF|ITF 0-H1L0@S4!0CQF!0D]S& T T T T 00h$ 00000P@00#0 0 0n#p@x0 0 S 0CRL000 #(00  yI|IxIIII0xI 0 0 lQ 9IxIHG -LMS@ \00S SL L0L L0P 0^0?l 0l 0ITFTFTFTFTFTF p-LMP@PLU` ph8`0 ,$0-Pp JTFUF84(4GTF -L MP@0T(*$K(pK,`K$$0  $f , @Q h0( \$0T\ (0DS<0T:,0HzI|yI8UFIDUFHUFHGIO -PL`pHpAP@ 00CS 0} @TR@0Sq Sf SZ 0S 0S 00 t4 S 1!0S 2!8S  a1Q- 2!8S( 1 RT T U h1Q 2\!8S UP!000@1@I,1@@DT$@DAT_ ; 00CS0 00CS0ڸ0 R%E!00  0 00Sv h00S 0So P00S 0Sh Hpf|LMLMlLMxLMPUFxHHGtLMdUFII -LMp0@SSHP S 0S iX 0  uP{i  T`0 Q00 28 6S Q 000|LMxLM 0S00l|LMP0pQr  8 80, ,0 0tLMLMpLM;M|LMxLMLMD0<08 pQ(0 0|LMpLMLM;MxLMLM-L0H D0pQ, ,0 0|LMLMpLM;MlLMxLMLM 80cR   (0 0 0|LMpLM;MxLMLM p-LMHP@ * D T h0\ `` T` T0V D0\ P00pP 0II 0-@@L08PS0S00000II - 0L@TT xP\ lp`bXd0 4P 0S<00hp h[OIILMhUFlUFRF 0-\L@P 2S P(0P2 00IUF p-LM`P`@2S@T<phPT0"2 000pIUF -LM@ K;40S0:00A0 R0   J p-LM`@PP  0S  pP   -LM@ P0K  0 -0 SLP` :S0 `0SZ @ p2bS@TP t0`0`p0@2S @T:0T0 P0$BPILMUF -LMP`@V 0FS \oP op0S  SPUFVF -L M0PS` :S0 `0SY @0P , 0`K p R2S@TP xW0`p0@2S @T:0T0 P0(jPIVFԿ$UF -0LM pR K >TP@`2S@PT P Wp II -0L Mt`, p0 @–R\ ,0K@T00 ,0 S1051P5LMI -PLPM`\p 0K@  0SV 000LM -L1L`MD0 PP(0 `pl KpKt KpP 1l R*t0S@hK 0@@ (0S (l RW xK| K0P x| P@hK0@@ IpMIHVF(VF4VF 0-LM(P@ 0@?0LM-00 CLM -L\ LM - 0L0S LM -L\   LM -L\LM -LM$@TLM -L\ LM -0L0SLM -L@PMK!P 0Q0S8H 0 U0 RX7PT%P#H @<<0 4IOxLM8VFHVF;MMTVFVFHGVFpLMLMWF p-LM`P pP@0T:tPt@0T*d$P 0 @T:@p0P 0 @T:PWFHIIzI|yItKM -LM@KP -LM KPK -0 SL 0  -L \   00 -L MbPh^KP Z PT@K_P RP,NHEPWF4aFdWFR0 0 0  -T LM@HT 00  (0R UTIPIRMpWF 0 0TI P-PL` @T pP 0S @TP@ 0P0`0 000 $m0SWFXILIWFDPF -p`L@PTp \P 0S0W: ` @Th 00hXIlPF 0-LMl@0S`0hXPU G@P@D ,, @ PU0XIWFWF$uFGWF -LM@.h 0-LMPKP@@$ h0 0-pPL0S`00S @.0 . 0 @T0000LIXI0 LI -0LM@`TPp P 0.S 0U:R0>0>0Up1 @TW 0@XILI -LM0PhS` /S+ bS` `$pK 0S /@x $ h2$ @PX @ @0f0P,`lSWF3(XF;M;MXF p-L MQP@D00CS $$ $($0$$$0 ip-p0 R 0<p`0K0,0 LPU 0S0pD0 R< 0(`$pIIIIM3I3I\I -40LM @R  @|I 00Cs0 -@L`0 SpP 00L S0 @0V0 0S 0 S@P 0 a0CSa0RS-P@ta@0a S_R@ zThhDD$XF(XF -L4M0 sS, `@HKTK   a0@S0a SR0S 0S0S\ + a AL00lL0 V L0SZ00V00S 0S + a0BS aB0SVQ000 Qj1 V@xq 0PS`LK0 PBTU@P !0001 ,0S ,嶽$pX T KT@ |T0cP T K0T0 q0X P=U0:S000 S 0a0CS0000S _0a0B`F|00C ZSQpMRMRM,XFI@XFH$ RA0 R0#0Z RA0 R0#0Z RA0 R0#0ZRA 0P0 ZRA0 0#P0 ZRA0 0#P0 Z RA0q@ R0Z RA0q R0`Z RA0 R0Z RA0 R0Z R-D0q@0# R0Z R-D0q R0#0`Z RA0 R 0#0Z RA0 R 0#0ZRA0q@00 q\  ZRA0q@00 q\  Z RA0q@ R00Z RA0q@ R00Z R-D0q@0# R00Z R-D0q@0# R00ZR-D0q@0#00 q\  ZR-D0q@0#00 q\  ZP -LMt0`@,0 dp}V, 0S) 0S& 0S# 0S $0S`0S (0Sd0S ,0S 00S 80S @0S D0S H0S \0S L040 ,0S , d# 8@4`08d P040<h0h3  8P d040!AB_D` \  hgde-O?`#X OK0!8@t!|儑!HP0@3S X30X3 KPX3\3 @3SKPX3`3  X3 H\ \3@\X30|]`3 <3`@ SKPX31 pMHGpXFXFXFXFIFXFXFdI qGXFIQ Q 0-0@LMd1` 31P0CS1 0o2c 1嘳P,3HhE0PU 00S PU@ 0[ 0[ @0 [ 0[0DIYF|I$IYF -L3Mp @PoK0 L3 040H RKHPL L30 0 S  ںpM(YF -LMP pR, @&P00P0S7 S 0 0S ( X0`ၑ 8 ,@ 0S, (0`X 00000 1S8 0A@ 00$ 480 00 0 0S ( X0`ၑ 4 ,@ 0S, ( `X00000 1S0 04 0A@ 00$ Q440 00 0-@PLMT00 K(  @  P j0s04YFx$ Q- L 80Q 00Q( ]0QLYFhXFPYFlYFxYF -LM4@T0 \̠0pSP` L^ 0 L P   k -40 P0LS h0  -LM Ƞ` Ƞ,@\Pp/0 AT+ 1S*40S% 1 0R1 RP 10CS1oV 0PR R 0> I\p@-@P` \ 0p@p\ \pp@> 0- 8@8L#T P&0AT" 1S10P1 P P10CS10oPP PP00I 0- 8@8L#T P&0AT" 1S10P1 P P10CS10oŲPP PP00I -LM Ƞp Ƞ,d@^P-AT) \$^ ^P 10CS1o⊲ 0P^ ^ I 0- 8@8L#T P 0AT 1S10P1 P P10CS10oLPP0I 0-P@ L Č P!0AT 1S1 0P1 P P10CS10o0PP0I -P V `LPpW 0 7!; 0 0( , 0 4 8 9 : p` 0-4PL@h \ =000\ =000  C0 Px0  C0t P 0C !/B!R00 0c0lx 0C 0a 0 -PLMU@g <0b040P,X`d (, <0 0 <0 <0 0 <0U2 1S 0S 04 0,1<0=0 @K 1娐l !P`px0 0 l t p P ` p 娀 ,0 |P @@BPD|YFI 0-@L 040P4 R ,1S =000h/ 0-@L /04 $140PS0h/0 -LM0PS`Q0SN0S, 90S$ 0/00 S@dp 0R 2cd0可1dS0 @@ RT /^090p@ `@` 0pW p%/000p@ /T IYFhXFYF -P1 LQ @4}/p 0S ,1S4 40 ,0R 00000`0 0S 0S# 04 ,000W<0= 0 <0= V<0= 0 <0= @ ,AX@ 0@@K04 <0 DP`PV8 $0PS U V L1 ,0S <,Ѱ40s@0  D  0P | @KD  0@ `004 @K<0 DP`8PH P@$0  4|@KD  0@  fPH00H0 PU@H^@0lD -¢pM$ZF -L@40P`pDP 00  00040DP 000 -L,MlŸp~, H T0 D G 0@ SO 0@@K04 <0 DP`P0U<0 8 $0PS! U D0HS0T  00 T01 ,0S x,0T@`40s@0  D KH0KP | @ @KD KH0K< y004 @K<0 DP`0P<0 H D P@$8P @KL KP0K 4|@ VPDL0H P0` D H U@Z Dk 0HD0 fH pM0ZF p-LMPa0R0 P0S 0s+ 00 \) 0B0$ S0,0 @0S PT 0 S 卯pE$004 0K(0 @@0\,0 ( 0$0P( R (0S@ 0400K@pM \140 @8 < 8@>pL\FWEV -LM@P`puT1 \0%h hP0H, .Č  &T[ jtX 4W% -LMD E0(!88#@!i\1< 0R<0I -L M @ 6@s]%4W% -L M@ 0@s]%4W% -T1L0 SX p-LM`@p ?#>0PcUX PmU@D  Tp(pha`^\X\FG`\FHG -LM!N, ,0㺺 !0Ὼ!h`%`% -LMr@W@1R2p U8`40? ?㳀-Π@4/00 000E ?PP"]( 0 S0 00!00 50!0@ ⭝\ሐḝ U? ? w%f%q%4b%"h\F -L3S -0L"R"0 0 3S 0-L@PG0h -LMPRTr@` @0 /0`"0T@ 0X@ |"$0@T 2S -LM@  A000hpF - $ML0Pb8,0 0T53 /003 @  0@ /0`"0 T  0@ 3   0""H0T" 0T" 0T #0 " 0T0" T2SB0l" T0d" T/0h" T" 0T@|" 0T @ 0 /0`"A0 T @ 0 P|@d"0 PTU@4pK P@"0 PTU@ڐ!0@000|" T  0@ 0`"0 T  0@ 1   PP"0 T0" T2S  0@ 0`"0 T% @ %5;5H0 ,0S P,1" 0TJpMx\F -L M5=@Sp  3/0Q 81S1 @T 0S0! 10C1T 1 <P? —2 \$  ᯏP0/`0 =<U!<3("V0000(R0!@PS80 PPT,0 kTQ 0 =@P0  oPC 0`"0 T  0P T1- 0 0p"0 T$8t"0 $LTx"0 T  0P 0`"0 T 0/0("Q 000, 05X|$~ n(@_B5;5 0\F\F\F -L,MT"P`0 @0 0@_ 0`"B00T00 @ |"0$P24 8#R80 0 0@ 0`"00T0@ 0 < 1!–0"c\f  , K +[0[\0'p 0c "*t1/0 a0`0 A S0At^ <(1+[P?@ 4"[<0 @@ W#P+ [0R:0R* G("(@+ [ 0l"0C0Q 0և0C00T08 "S^0D ⣰000 , K\F,]Fx]F -LM`PRPTr8@ 0@婯 0`"0T 0@ |"$0|"T40  |"$0 |"T|"0T  3 RK Al00l02S7  00 0 /0`"0T00 0 |"$"$"$"$l00l0jt"$@ p"$ T@t00t0x 5 x ; %500C(0 10 /@ 4 O?T2 PP,0 _0 Rb 0 =@0,0 0C /0`"0,T0,0 0 1- 0 0p"0,T$8t"0,$LTx"0,T , 0  /0,`"0Tx 0/0("Q\ 000 %)p"$p00p00 40 \F\F -PL@`1TpT!T7*1T" 1T p %A0@S S  Pp5@05Pp505 0S8i2Sp T 884Pp5@p|8Ǚp0T d0TX0. @R\0S\<0T!.0p2i 1i i i 5i i 6i( (0-"(L8@UPP h0< 0\h0 0hȖ4l00l00 -5L,p`0 <5 00 R0 RQU@ P5<5 0S  0  U@P5 <500 R -LM(" PPp8@  1$01010  1  W: X@@P4 XEU8 T@! @™\,   0 0d8#  `$媦P@  1 01010001 T@P@  0x0 000C b b(0"H @`w$ $ R 1 01+00 (0,0}P@ 404H g 0S a  ]  Y TI^F -0LMQ@@0S  `D A p 4S``@ 8 S`1VR T/ dXTIl0@0SP0Q H0Q Rp  p0S0p0TI}f~f 0- LM0PP!0AT @0S8^d040pDFd,05,0pxTM p-LM@`d@T P dl0d0S4P0  R 0004 phdؤxTM^F -L,M`,0 cP U@ D  X1 Xc0S"pcc80SD , p40S< 0R @!T0100  T T,cT  , 00nkt00 P cPU pctc4S H00H0@ JP~ 0SZy@4 D08 S< H0`0H0 H @c , 00UcPUh D\ H  0T Ro 0H0@ 0\ R` @0H0, 820S  pW E 80SB H00H04 p#cFc14 S Q8[cPU( pc2c 80\! XhcPU pbH c@ Rc b00,0   c: 0<QE00`HHX0H\>`lT&HXd0  K: @0SQ@ 0X0@@ӷ 0~xTM<.F^F^F -p@0LP`U j`,0<,0 -p@0LP`U j`,0<,0 p-0LM PR@10S` 5R` p$P`14144S040H00H00 H0 0H0 T 0H0@0H0H0 0\ H0 0 娤I^FlD -L+h -LM8pW`P@0X0W00SP xLd_8 @U08x|(Pp -LMp8S7@`̽P L  ]P]`VL 8 !08xX|08 '_ p-LM0PS`D S p 2 R0A S*pP0@0 p7p  S1 R0S @T  0S @TT \0\ 0յ 0· 0,$ 1 R; @T  0S @TT {PP Q 0!QQ@ R00 00 0  00 @@0 0R00!   峣I^F|D _F,_FH0   01 R   -0LM pRP&P0 `@V00TX0D0 H 0L0P P && jIpM(FD -0L,M 0R@p*0S% S000 P@ `@KP0H K0P PK 4 H D 8` L` , 08 0b00  0%IpM@_FD -0LpP;cP`@`! ,#`440^`  `` 0P hP`4^ `(0 r`00 S pMM 0-$P@Ln` 0d00h`xTM -LMp_``VGN| P@V`dy`80S+<0\  @0 SPi``xTM p-LMP`P@. P@@\0 T 0?S("R' P0S TAL [ n  A wP@ PA>0 0p LI]0 0pp R@1 T S RL6] @ -LM, 00 ,q᫻ P8 < : <  0R40 0R @PU00? <  ^10 1Y@0Y<340 , P< 8  ` ያP00a0<0 -DR00P0S $0BD00D0 -LM@ P D0S  C1R$D 0L\0 0 -LM@a_`pP\__80 S,0 R< 0R p0h0m_ @0SV h0hS+p 0d0xTM -LM$p+_0PU ` !_D_D0X *@$妳P`@ D0V:Xd0S ._X  0@00h⍳PxTM -LM@T 0S @TT P p- 1LM `R@7P,0`5,0H0`'PtH0  R 0 0 0,0  0 Q0000 00C0Q,DǙp0H0~  ITMDT_F 0-0L0CS@P040L0C40 R  8R000$0 0 0h閙[0SM p-LM`PpP@\ 7 ȱ 400P`@@000, @%, pTM p-LM40P@S`80S @T 0S @TpT ޗP@( 0 R% ᅱ LY R`0 R0 400 400 0 0 @@p1 hSMIt_FD@-#AG΁t$x4^ *!?^00^0#02S @=p@- Qt4%xGN\`@ * !?\00\0#02S 01  !p@ -LM0G@ h - 0t4 0x4 p-LM5F.0 5P@00Qn `hPl400H00 H0  (  0@H00H0]PL 0P}P 00 @T H0ppp_FpM -LM`@p Pᯰ0 P 0l$h4QF  0 p( 0@@ 0P0p啟TMID_F -LM`pʖt Pxl0 dR`(pF. 0@ph4 P@ hTMID_F -LM`Pp80 , 4@KW*Ӱ8K ; t#Z < #80\0p80  < $ ,0S ,pM_F p-1`P2`L MAU \XP` XX`@PP 0D@20$ph锘phpVMI_FDUM_F - h<hL0 0MpP#0 4# \OD!1l2lqXP@)@,! ,! @10S3 0&ĊS 0' 5"6# T@ Q ,1  8Q2 R@I Y000  Y000 0@0 ::,1;,1,!IVM -LM@p`Ped<,(000 8240 㐯 00 ㊯01 0<00㺄 8 X```ᗊt0 P  0 #$,T.[  0⸈,0  `\Q`F@[FWEV,% p-L Ƞ Ƞ   8M8#0 P`,Tx 1`2`AP V0 10  V0 10 00ppIVM -LlMDE 0 4 0#((0"4X%#2c2c@5,!00 00 ;D X@p KhP<0U@08,1 %g P`K@KHpKP0H 2P <0H` 80 0DP 4P 0OK4, 4 =00F<1S20P 814 x@41S! 4A40S00;0080@0@ x1S `x1$ 0C`!x1DX@H< X0 @H< X0 P@0@ 814 ,@41S0 2pPK`4!0@p`K@`lt` T0 K4pK4@ d x HVp d @K? 0`0  PK4p`K5= 4A \KT0K`@K@CA| 4 .A|PU\0s00|0 Kp`K cPPddp`0pe'o@]g80t T`80x0Wp!@000!,1  090e >10Q K410$;01 P@,1$ R,HRH00$tPK ᚣP@ S0$!$! 0Q$010@$K4,!|1 ,!0\`p0 010,1 :,17@(d0P0,1J 0P@0!0  #0Q0 0 000P 0!0n @00o㸫L峫0 UpMIVMFmdedA`FhdFk~gd,%Fh`FHI$`F -0L,Mp_8  JS01@P kV TPK U:`\LP @0KP@404 H D 0 080 981HK 4<@ 4= TpM p-LMX`0TP!c@2c1T *,1oO0 c2c!T:pIVM -LM,41L @S0,  8! 88q_0014181pMH`F,000#((0"44 4#2!cS2c!,10IVM 0-LM,1@  P@0,18 0PwP,1 0,10\`F,1@0,1,x -LM tA/0l00p 0X0 0 @`00 @0P `p`lMXVM -0!LCM0KoK,0 N21IK AT@# sA/0萟0C0 0p@P000`   0 0 0 P0U 0|0`/@0P`0`  1D[PU0 ,0S ,~pM@XMlMhVMd`F -TL0S @0 R ,0,ah|CmM VMIVMp`F0 mM -LMX@VLHRDO@ 0-@PLT:0AT: p-LM`PU p@ { { 00 0   PPPH0   R00 VM@XM(VM(%VM,%`lM@VM`hMlM 88#PG-Ax= p0 0C`[%[0 bvb3. P+pg "+!U! ˠ  @ 0,ˠ . 0# 0# 0#0#0#0&, H!0x @XMD -3LM @RP Pb0Kp"1 00 ,*AV4 00ca bP`\lQa P P!88S Q4  40@040 4 @ 4  40@040 4  4 40葟a040  00bC2S0c0S 4 P1P@  0 R0+A"R`1 Q8 > p40L000  P:#04 0qcp=@0 8 :@0  R@@0Z<T: 0(0 @@84`p$0 Sd$d40SL P @0P<3TP ʯH(3p8@`Kl000@ R*H`0K ``K`0@P 0P0K08uPp0H0P`UD<H`0 @/0@`S:(3D S:Y<X1S% Y4 R YD3L@0c04PP` `0P ?T 40 <304? ~P-?|2 Ut< @0X@ TnDŸ 0!0Ug0_X0/<X1S@ _,㆛\0 0S# < X1 S000 d *0K!tA*0[ ,0pS ,g h`0<008 0㚓@ PH t 7P @T:pMWEVbF -LM0 0, KcA.0# @@KX  0H ,4 D09P=@8<>p:`Č?P;@Ȍ@K 0 @8#?4.A@0:0H $4圗0 ,0000?0-00 000 $0@ \* p-LM `!K$@KP0$! K@ P@ 0Sp0S$ 0 00p 0Sp 0-@MLhPh 0``PwwT 0LHPow<<0 0P@fw0x3IbFnMbF8nMbFoM -L M`$P@pg  c0K "PPP0 RV @0$(0 ,pyPPA@80SB|08! 0Q80 Q   0 {# P $U 0JPP 4@KY 0 ᝌ4ZaZ0Y 0哌4ZaP-0$0庀$xIbF0 4!S0 0Q 0bR -LTM `T X L PPp`` d` h` l` p` ]PP5 XOD k 0@  0@@ P h$U  0"PP X9X`ޑTa|0LK L T ̠$0P:$0 |0   ;P fPP$L0HPPL0HKH LZ804 0C5R\0 LP P :l0h #0)@d`\ P8PV :T $0!:$0LP 0 v"u*:@t<0 dQ08 XPPPK Pp B0P 0CLK0 pPP5L0H@P3 LpLP \+ ,0 P0 (@ 0P 0C @ @/0LKPPL0HPPL|0TLP P0( p0 傕 ;LKPPRL0H P 0  0@0呖@ <Č!0@Ȍ4 d0 |P;h L0H@P 0$ (4,l `0 0 48<0LklhLP P0\ 0SP0 : 0pMbFbFcF0cFHcFdcF|cF -LM00q` PP@   0@@0 u! @ "T |0@0TP8P9$0A:$099$9 -LM!@( 0 P <00<0--!0 0 000 -2LM080 ap 00 PP0S luH (K!@0, 0C0/0@K@PP ,r~w0P 00H@Pm0 4$ 8(,<0@ 7PDO 00 H70r 4K8 0P PP D9v4<0 0 `8 刀 0P1bD 0 S <&;&;&;&<& <&<&$<&;&,<&4<&;&<<& 408 400        v0$ }pM8nM0cFcFcF -LM@ KP 0 00 00<00 000 -L M- ,0.4p/ 8< 6PTg -0,./  2)0(L1-0,02P.`/@3 48< @ 0 0$@K/@P@ $PTd8-0, ./$$0(HT ,e$TPT@001 4PP@809 :;48<s@001 4TT08  -L M,0PnOp(0 C/0  !!4 8<W6* 0AS/@0R0R00S(Q@p@`K )0K  ֎P DP@@ (0 S T(bH ŽP5pM cFcFcF -LM0`P@pq<08 01r @T <0S @Tqq P P00qpM p-LM@d0` \@Pwq< <080!0S00``qppM p-LM@`@PZq< <80 1S R000 qpzdF 0-H0LM P0K2@T 000m|0pM$dFD- ,0./4 8<#"  $!;#0@  -LM@P 80S:SS D0 `%)$( &@*P $+'( ,0`T Ϡ2l111A0 S-3l11QQ -L0 P|dVp  0@2c! 02c2c" 002c2c# 0T0 102c2c0@T0}NV 000ż0V Ŵ000}V 000T [0``@3T0 0* 0:#:  80 CQ0"a1C0#I -LM0,0 p80D0<  *100 0P$ % $0&'4 8<s0 0)0( *$+ (,r  H(cT`8 @0H0,@8 A 000A@ED0B@FPC 4G 8 ' 0Po5A $0@0D LTp$9=8< :P>` $?;(L <,08 @0 0/9=08< :>$;P?` (<L -LM0刐Sp?D09=8< :>@ $?;(\ l0S0S*P 0@TS, 0 0K ,K4@K@Pp 0PW 4, Kp0a,0  -RLMp`Pڠzq@ pP R ?0 00 R0Js00zAsPdFnMpdF -LM@`lPpq 00P0P0Sp @ s(@nM@-@\ 0 0S 0 0S :@oK00 -LMp,`Pq0@Ëp P`oM -LM  0SPQx ,0S Pm$ &0S ` $% $00&0S0&@90lXQ J3 劋 `P@ 0 $ ?$ @@ Pp+%X#% $040 &@T  hˏ0,0,0S00h00000y0(0 & hⱏ (py00,04$ ?$ @@Ppy (pP(dFdF -LM@P ,0S 0Sh3rc4oM -LKML HL!0,0 删 p0LRP 81 Tq Dq D098:@ČȌ;@?`,0 PP@= P0 ^X%0$ KKP1&yA?( K 04 8<41  (K A/0"00(KK0M/K0H! 0 RKPp yL8!  0W0O(ppL R W<10L1T P,0 S H,^T3<.`4 K+LK.N,`NK-LRK L MK  0H oPp0  K.IK+`L(K@ p4 KK,`L-@N KMK0  IH Lxp@A 1@A T D 8;`<800<0 0ČD0 0ȌH0 0\L0  @P 4 L 00 @0< P  04P 0S DQ8 @Q Q`P8 <0GpYP`< PuLPP0 a_ H0  0 $ ( T ZM(ZJTQUPE `H   D0SS H  4 0 @< , KPHD70Q00S  008 @0U H0000 0 S @ 0060 #,040 %$ <&P\wD `0P00o0 .R`0^040 LM eF - L 0-PL@T K 0S D0S(o00010 08nM -LM`p00K4K @IpP/ P+0S4  4 S 0S8#00 @ 0 0/PP  ?ڇ@H000dvD 048< 000 0$(, 0^ l0 4 Pp ^PU \e*!l!P2@0P8 Y i400 00U \F*80!l!1@Ye0P M400 0 0 , 0 0 0>.0 N^@PT \*l81 @e00  0000  \*!l!0@0P8Y 4 00,00S0c,00, a08 c@K! \33 5 Ƞ }P!>Km kK1.0Q@ pb 00Cpp!@Dq1T#[@T; 20CS0j&j&j&j&j&j&ȑY: 01 bpnKoK  m?KPH\5 :0\*  b 0 0b$10#[1 @T0 0X .-ܡ  P PpH0!>0kK1 ̑  c. . j?K!#[ ̑ -pMeF -L,M 0@ 0 )K3S`D cP1D R <0BB:+p @0@pP@01 1PP"0PS@ U|3 41@00  `3@@0 @.P @P) [R 0 0S2 @@T 00KP00T00ST)0[@ 002PU52 0C4 < 8 @S%m&Hn&Hn&Hn&po&o&8K 40K0>01! 1s8 40 !1 4!Q80%000 0a00b 155 1%Y i ,S@D@ )K@^0 S*dZh @ 0P@) ) K}P |o$IeF$IMfF -LLM@Q@D1U d0 ` 8d0K00pW +i%Pp@ `K +zi0`0 0<X0 \ 0P0 T 0H0 L :D0 @ 080 04p < 00 0$p (p ,0 ,zpM0S -L MBpBP ,0 )` 0@ P@"@2V*0S @T:@W W+T+ 0 PP: )p  0P@0 S 0R , P -L$M (14 < @@ Pp 0S  P 0 @S@R*0 S  R:R*08 S S0  Q Q 0S4 `! S S `0S S SQ 00 Q Q Q Q Q 8 00S0 0!0;D0  @  0 0d @D 0R0 T0S$ (1,.,K P@(1, 0(100,0, $,0, (00(0,,00C,0,(04 0   (1?0(1 (@? ( `4 80S 0 @?(8 `? ((10H0 n,05f P@Z`TU00 0P0<@4!(10(1 <t h(1! 0(1,D0 001@  D0 10 0 (10(1 00(1 04gY ` P ? *0S ?*P0 0{ hmH0+z@+z@01, `Jo,tNW,fF0fF;IM\fFfF p-LM@0PSl? :T +(!d`!Մ 0P?)`pXm` 0@mfF<.FfFfF p-LMPU`% *@0 PR@ U: @0\0 ?)00@p -LM0PU`p*0 @0 W 000 0 pP00Z0#02SPlfF -LM PR@0:#:S(0:#:S#j&jV UPp  @ Ȍ qΌP00 ``P@0  -L$M`. .\@0  @,  @̠Pp@0P 0  00 Pp ,0R   . . p -LM@. .\ 0P p`@@ ȌqΌ 倠 p-1!LM1! @00> 0>0Q`P 1.*!a!00`G/ 0B!0b0!P PPP0Q*!a!00` 10G?  B0 P P0Pp\|& -d5dLDMPDU뢠LL{m|8Z{됼,Gş00S 0 0@ 0 `8 R08 P<0K < D0嬔0S0 0$@`D0|4 ,0p4 1 1d4 l`\ ` !H lP@ hPP@2 0P74 $08 0O0`V000#3@p@A Q9@Q0@0P K3PK@cFF_Pp00 0~TP@0`*1<<``(ß,3 >0H!C,T)ixz{Ɗ-0S P0S @HPKF G "@11@TlrrRhŸ0 @@ @pdP@800S P0 "@J0S>10SPQ $09$00 P@ a 0 b0 @ 0 0 \0X! @P 0Z 0000ZR1 %Pj0 Pb0 ApM,sMDjGMtMMlMpMtMpM$I.gF ''qM I,uMOuM uMDrMxLOJOIpMpM& gFtMgF2I$I gFMM4gFtMuMtuM sM9LgFXgFhgF,&pgF|gF&gFEF &gFgF9gFgF0&gFxM2I(sMP@H0H PT\0\ Php0p P KjF@;PPKPKPPK! 0@@=0@&Km -@ LHM0, X 00 TK0P0 T ( P0 S$ kkDjgF hF4hF -LpIITuMPuM I -LM@ 5 0h/tuM -L M@K0"c11  -L M@K0"c11  -L M@K0"c11  -L M@K0"c11  -L M@K40 0 a0`=R C0 tM -LM@  0huM 0-@MLLPLLX 0P\400J P@\0@0x3IGdvM,iFuM,wM@-A"@J1S RJ1S R2PP1S@P1S 0Q *0P (0   -L Mp @(`T& ,00,0#, K;PU, ,0( 0C,0 U##qE ,0P  -L M`0  P@C  0S<0S90 V5*Y/ ,0(p0,0f#0V, K PP ,0( 0C,0 U ju#r#,$E,0V0  0P00` d I4iF -L,M@ @PpL PP`f ,00,0 RIH&x&&&؟&&Ԡ&`&x&&0 S70S4,5 X0*(0P0 "D K P P  ,0( 0C,0P#,DP   D0*P",0( 0C,0 ,D,0( 0C,0,D 0000  00000 8C80C (0B8 H@K 0 0 00H0  0P0x@0H0  0P 0 00H 0  0S$0<   0H KH00c0S P0`0$P @1    0 $< 0 @ 0 Dz0S u@K $mPm2[S 2[8SS C8S S_@  @0KPV@K n@ K 0S40S00@0K@K 8Ks @K0S@0S@pK $imP(2[S "[R R0 ,0 0,0L 0 R0 0@@ K 0S40S00 8Ks 0S@PL  I~f}fwt@vt -L pq@P? 0aV,00,00000 ,0( 0C ,0'V 0V@ 00T   1 2 1 1s 0T@1 21,DC,0( 0C,0 ,9C -LM0 ! @ Q 1Psbp 1 81 U I0!'!bDiF -LM@!pPW/ ,00,0 b 0Q 1s 1 01 U 00Ui,M    1 0 1 aDiF -PpL(`0S @ @! -LtM`p됀KP@  0 ,00,0,0( 0CP,0,U 0(0S@P p lPB -LMp`PP* ,0 0R,0 R0S<``0,0( 0C,0,`B-`$@ 0  `  -L M, p0 , 0! P!4  Y !Z PP0 b Vg0EEW  c03PP yB@Dx8 X0  R@0SB4  c03P- yB@ Dr0 R U  1 2 1 1s 0U 0PZ P00P1 2104 S@ Tp@ T @02020Tp@T I -L Mp 1Qぐ2 A' 0a .xfs`  %x fs RH02 0"2 SA' S]', X0 00202a ,w,0@fs00202c0 w00Pf}s00202S,00000''' -LM@`p PK 0S Szpp1 Q$@ P 0U P1s 1 11 UC '`I1 1100XXPs0(0 R 0S00P P0 0Q 0 V 000PW 00,00,0$ 0S0_(wM Id)GdvM,wMDiF 0-L@XJPrT @00 0S 0(d3`00@2000@ 000 @2 @0uMhiF$I 202 -pL<jXP@ wP P0\2f@0 `P0 20BT0Ҩ 0 ' B'0 0<B @B`v v!Cv v00s @` V 0S 0S ` V 0008 4 < ` V@ R 0s  ` V@`cVڌ Vڦ?`cVV'  0 }xuM -pL2`0C(2BP@U R ,00,0 5PU@Z000S&0202SP P4P <PdhY=:*('2'/'+0uM -PLMP`F Q ,0 0Sb ( X 00CS 0,00C,0h,0 S( p,@0|!p?>,0Sʸ0  0S$ 0S@ R000 % Q , R |^!00C0X, @p0K$8K @㲂Kp@ 0 㴂K,0,0C,0E?p0K$8K@@㲂Kp@ 0 㴂K;^piFxiF(wMdvMiF p-LM0@rP3 R.`P(0K$``0KaK`P`01K!K 090 0 p 0 0pp`aK0 90 0-p p (("\ -LM($Ÿ@,p \`P 3 R \0R Pm U. U  00S# 0s 0P  00 0101 1s 0Wp1 21   P1 1  0Q P 10 1 1s 0 W 0pV ` 1s 1 2 1 Vʪ1 211 21 ]]pMDiF p-LMP@` T0 @ Tp) -PL(p`@R0T 0@Tkg  0-@MLDPD 0<PT, (@0P@T0x3IiF0wMiFwM -4 L014 s$ 08000.I40$ 0S00 Q0 0 0S0040$ Q  p-LMPvP` 0@ 0\ #P 14` 01! 0 00 10Q p,0  pM(04 1S01 Q0 0 0S00 p-LM,P"@000R R 0Spd,Kf 1:0$2K1,` 2K$P  P000(0!0 (0p0 0 -LM Kp$ K`PU0  0 00 0U@@o 0P@$@$  00S0P `(00(0 ,00C,0 (0,0=0wM.I -L$M`8 VP 0S ,00,0P^P$< B @ P !!@4 yfPP?4p P" @0 :0GPUp  0<S< ' 90 P f 0 0 B 0 4@ W 0l !S <Q8 P 0 4K 408P0,0( 0C,0,<0@K 'fPP@ -LM0pS,p @`PsJ ,3Y 0S8P < !4!0QU 8C(0Q PU 0v v UB 0,0 0 0$0 480` P (00(0* $  (0  (0W  {, (0` R0(0  (00(0 SPP( W`4p8 ,0( 0C,00p,0 0 p p00gP,   ,; 0,0  80  0Vq1RnU rmPp ,0 0 ,0 00R]*40QUY 0V PUR!0S (/IwM -LlM Q$P  S& 4 P,/A#bl p p@K \0 0  % >Pjp X4R P$002c2c30 xK} t0p $x0P 0p 0 =9@ =C  0p Hp\`YQ# 0#00F0:2YAp0Sl0S x@KGxp0\0 p KK| 0cPl=9 A = | |0 2R"002c2c30  Z0  h0  !! $el t0Sy #Y ` 0X\0  h0K0`0K0 @hK R 0 0 00  0T m (   ( 00C0X` R\0\0 00` \0 廹1G 0`01 ' 0 (0 0(0 00C0ZH᝹ " d 㖹Yp ` 00 0 @(  ( 00C0|800 F rp80 P(00(0  B ` X, Z ⌐ p l MbQI?BiF -LM0@$P`>A@p 0 S 1o000 p-LMP$`pTl08O*0 H0p -LM0, X$p4 1@`T 0WP`/ U@0X8Q q < 1@`T 0WP` U@80X:l9S,0$80H/SP4,00,08  4, SP0wMwM -LM0@  t h )o 90 0-@LTP 80 P (00(0 @T0 p-LM@`TP 80 K@Tp 4  -8 L0pS`( 00Q@LT H0 P!4o0`k4P 0@4P40Q000p(08\ 0< #4# 0Q80 @+8< 0-80P@Q08#4#04 < 0!0LS0  Q0 0 0S00(080 R40h_R40,  , 4a%wM 0-@L P(0000 0 @(00(0   ݷ0h  0W<.FiFiF 0-@L P˷(0  R 0 0 00  0 (  ( 00C00h鶷  0W<.FiFjFP(0 0 (0!P -L$M`"0$0( PP@8pW@ W @4LQ0  0P@T0$0!0@;00 0P@1 I 0  0mP@ 0  @p ,KjP@., 0@0b 0(1 Y#q0S  p( 0TYT$1 !S@#@3R 1$ R: 0S* @T  0 4`eQP418 (1TP#2@0T00S DM$I0$I -LM,;0 0S0\2 FL"  P H ,@`" H"`0 1   `" KRH 0p! ? p1  0l1 h! n?K J`1 \! >K/KKT1 l <@ H d 0 8 X Ppe*PT h H0TB D0PP R   R?0@SD0?H00H0 H2`Vp H0卟K`T Pd7 82 aPp?K` 4"R; 8"cP82p@ ?WpWK4H0&0Q 8PP"0pY$ P9T'㊃?l,0`6P,0 `PP0@H0 9H"0`X2 V 7  82 `Pp?K`4"R X" X" 8"cP82p@T2Pd X0 @R X"0<  P 010T0`00S82 p!P0 h  P d0>0#60`0\ 0. "& P0>0#60X  T00X!R< KPph82X"cOK " ( K T2<$PY = `PS~<#|1KS0# 82 Bm82 0K? Pp rp,0)p0 1, d  RR ,07,02 ,0<,00  0  ,0%T'㹂OP"p0xFx F<@,0S KPV<@ L2K(<PJ,0 C?l1S H R <@S <@H0 3  @0S@0[30@0S! 4A0S ,\&";0,  l40S `"R `vO`K<@$?l ,0`6P,0 `RO @:0 00000 0  0\մ\PJ ,0 7<R,0 0SP@@2` 0" 2 0 " 0<2 0S -KK<2 6pVPp H=@2S_OKPpD0PD Pp#HD",D00D0<2帠<"00<2D"<2$ <(00(0<",00C,0<(0,`VŸ5@H<D!ع0Q8P HNP"p0Z !T'㎁AN@"<bT0R 0R0R,070H,0D500C ` MH2` `#>K+aPp`P4 0q 1 q  5pM$I|I jFM@/I8jFV ;ILjF -LMp$K4 ,@P  `@_ PT4(  01 B10R,0 P@( ,K _Q'00K@8,PaP4( 0,0 B0RP,0 ( 4K  ^P@"`V@J,K ^Q'00K@,+aP0 ,0`V0P,0 Z  ^@P  -LM40HH,0i34H(!$ nR먓MMpMpMOljF 0-HP@L@H08 S800$< @d0H0 $` 0 20 Q a4pMkF -L,MPZ, p@P` $1 ,0S ,G40 2 R1#0 TK V0 H"ڨ0%0 X@1@!T@ dW0S`d TK T YP  0 dR00 PV ) 0205pMkF -LM`堐TKP  @, p0 PK0 P p d0K 00 T 0,20 Q ,3pM$kF -L4M0|@2LPK0`p $ vT0K (0 L T` Pp 0$20 Q $3pM,kF -LTM0 `@p"0V Pt0  @0pK H0 p Lp lp DP OP0 20`p 80SaVG Z P% P@ t0S  0pYW 0 0020 0pA` P @T t\ 0 p\@@T 0p#0@T `0S @T0S `0 00 M -LP`p@P U 000 d00S m00 R10 -LMPp`@0  T0`S @T L0SH@  -L0MP@UA (L0K4 Kp`^<0 , 8 ( $ L H @  $0 8 D0 , @   <K0  `VX KP0@T p0S @Tp4kFM@-0 @R 0S@0R 0R0R0S,0  -Lp$@P` ^0$ P 000 0p `pp0S 0 S  -H6LM P8f U@`p t 04 0lQ0 S J070 ' 0% RW 0AS X''X'd'l'l''0 S;  0 40p 000\! \!0  0 0S 0S 090+ 00 0 0@** 0P0Cp 0 0 Mpp000\! \!0 S0S\fJ0 0 0 0 90 0S I+0 ST  0 0S0p 30:0 R0  00 0 0@) 0P0Cp 0 Mp0S0 0W:0~0900S(  \10\1p 00 0 0@) 0P0Cp 0a 0 @000S pS0 S= 0S:  B \10C\1 0 k0Sh0* 0p:0 R0W: 00 0 0@n) 0P0Cp 0 Mp0S0Sb 0S_ *\H0S 0 SM00C0\! B\!0SC=0S 00C0\! B\!8 *0 S2  0 0S 0S 0p  090 0@)Pp 0 0S 0S090J0S 0SD 8VIpMppdkFkFkF@ kFkFlFu 000p/I,*JPoI 88 #40-LX@0PP 0S 0S 0 00(0Il/I,*J -tLM\p, ` L5Q 05VG(5V 5V> 5V , 4P,4VD00CS R  Rʠ 0@R  ?RP,  0 0S030#0 000$T0SS2S  (0c (P, @0P 8 40R*0   ,00,0< 0!kD0h<H0080  Q bjZ2Va  3Vy, KBP{  (Pl"00p2V 2V_Y넒P| R匢V000 $0 00 @ t0 V0 0 400 2 V8 ,1 2Q 0 40<@4at008 00 0, KXlAP  (P, 0$ 0 , ,  ,,,+T@00CS R Rʐ4 0@8R0 =QP,  8040S030#0 80080 M K KKK ,*JKp/ImF K K$K$PoIW 0-T0L@PT ,0, )ZP0S@T00$*J -QL,`p- Q P# Pu 0UpA ] ] Pd\`P 0 S PU<0Up P ]1@%I'2 -LMQ,@0 Q P00( -QL,Ppa Q PW0S. S p `v V|1 VphA0B0 j]0 f] `0`0W$!00S `V0Vp `v V0 V@1fA A] `0W 0S `V0V0 `S S000 ] 1f |II'xI}I -QL,`p4 Q P* Pu U0 Up@0A \ \+ PlP0W`  0S PU0Up P0 \ $I,$I0$I -, L0 S' '('0''   -6L4MQ`Pr5P z)P FE PMP? P8P, ,5!l0)4  0R@0T!H%\@ş!@$ 0R, 0> S  X<  Q Z>0nÃ``ƃ. B&0 $00 00 ğL nqP8  |ğ 80hğ0c ,C61 Vʰ2080@f<0 P*30\:8 Pf0S8 0080 (R3ßB'@ @ ^D  d@0 `H w D@ß 0(@0 f TV 3 \03505<X*0S7\:  0"0cC61 ,0R/0S 0C0@0 ,0 P`@0 V`48 20@0 h0B!0 E@ 0 E@ P000x!`#0dH P0000n0  000  4巣84峣@P  ,  P P 00,0  P ,  P  P P ࠃ ࠓ,  PPP  P00lyM0à PP PP @P@ P P   P   P  P P   P  PPP -LM 0  pZX p0!R @P0Ϡ/,K.[`";DEEU C50` @sFHsFPsF\sFhsFtsF|sFsFsFlyM/IsF -LM0@ ;PhT -<0LM   @)0ShApM -LM0@ CPhq -LM @ Pha0S00 0 S-L (0  Q  @@pMsFtF00 -0SL M00` P p(@|0 P  0S 0 @ 0 P  #pMD p-LM@P`@V0D  Ppph,! -L$M00 H3`0 P0Q&Q< , 40 0 00 @005000"@0000 0000D`404x0, 80 S 08 q Ru 00 70X@0 D @000D$;D H 0S8<0 <`VwVt00H004 iP00;400"o,㗟00  @0l!@\00  00 000僟oH4 i00  4X<  B\6\3 0l   0 l\X 0S 800S80 }S00<70Q00 00 E00500\ $c?P;pM tF(tFDtFdtFltFtF -LM8|@WR 00M!Ce -LMd0@S00hm9_6?MtF<0S8<0 p-L MQ/|A`"t1) ``@^TA?#)H1 @S0Q?# $1@)H0!S 0S>P @ 0@@6 0H@@6 0P@@6 0@@6 00@@~6t p0@`u6pIMMMM|MlMHMMvFx3IvFLMvFMvFMvF MvFMvFM -0L 0 !@PTp 0S$ @T )]@`T 0S @TQP0S00``pT )THMM -LM@ 00S 0g>vF,00P 4 RHPpM<0 40 P 40 S8PMM<0 40 P 0 SP|MlM -LMP@0T0PppW`u@ 0 Ro P# P   @@ RD0D0D0 @0S @a0S@0 @0D00PD0k40S$EP P 6T` @1 00000! R00!`00a 0 10l6@!00 p@  'U,00,000 @ U =vF$wFPwF M|MlMMpMtwF -LM@ @RD0D0D0 @0S 0@1 -LM 0@ `R x0S0x0 R000 00CS0 h7 7ꄐM M -H0P@LQ@p ` 0S T@T @Q 0S L@T100CSW00000CS0 R00000CS0 -LM@T  10S @@T@R   @@T -LM1`NP,@Kp0 @9,K4 0K? 0H | @ t2Lx p@000P<>D(GwFxF.-xFxFxFQyFHyF -LM0Sn0Hb0 R 0R  R RmPPw 2nP@g ^aPT T 10HPS 14 T *=0nS& aS @0(T00S1@TKH1 h =wS0KS! P$$@1 1U4pP,0p0 R 0SKτ 0 = 0=wP 0d 0=|=x=t=pi=lyFMpMtyFM|yF4GtFtFuFuF(uF0uFTuFduFuFuFuFuFuFuFuFuFuFuF$vFHvFtvF`400`H04H400@00 0-LQ@P 40Q P @@1 R 000@ 0-LQ@P 40Q iP @@1  Q 0 0P 40000@0000,0700 0000 0-L0\0P   0@\!:xFP@0 p-LM@14@ Q ` PU  p4$400p p-LMP`U6P1 40P. P@ Pp@@1  Q p,0  0 R U4P 40U phP @1  Q p@@p -0P` QL@p FpT  E`X  EWV  -LMPup@`S 0UP u 0U 0 U 0U P>v 0V 0 V 0V P-w 0W 0 W 0W Pu U ,)Pv 0V `w 0Wp,0<,0v 0 Vw 0W -0P`QL  @p tEpT  lE`X  eEWV  -LMPup@`D 0UA u 0U 0 U 0U fP/v 0V 0 V 0V UPw 0W 0 W 0W DP u Pv i`wp,0<,0v 0 Vw 0W -L M|   0\   Kq@ T00 0 T -L M|   0\   Kq@ T00 0 T p-LMP`@0S ( T 0T 0T P0T P T @@@,0<,0p R0Sp p-LMP@ `0S 0T 0T P @,0<,0p p-LMP`@0S ! T 0T 0T oP0T fP @@@,0<,0p R0Sp p-LMP@ `0S 0T 0T <P d@,0<,0p -Lp`@'PPUK!uCP P,0<,00 R*0SR:0 0S 000 VP -LM1P@K00M 00CS02M 0-0LSP P @P000 0-L@P PP000 0R0 @1 C 0-LP@P0 0@ E?P,0  0"R   0-L0QP)@1 Q 0P P0@ )T 0D000Q^0 0P |0 Q P 0T@P@ P ( 0@T@PP.M -LM0SP`p5 S P@ T  <@S0S0 0@T 0 0 S @TW pP@ @T   @@TpvPM 0-LP0@^ \ 0 0^ \0 0\0T@ T@@ TP 0$0 @d@ ^0. p-LM0(@KP `BP0  p0 -QLMp@G P0 S  0R`0S  0RwP,` Rڐ0V 0GSHHQ'HR'PR'PR'PR'\R'pR'L10S0S0P 0R W   Q0 PQ0ba>0>0  0r0ab0PP0<@0 /000B0 P1I1II I0S  A -L$M@ , 0 40 塖0 @@0K闖@K@0 0 @0@0 ,@4 00R000 001@K\1  0OH PKL 0S@#-Q QPn`3% J. pJ0@R/ J"M2 0S @##mSPU`!q p0奎 @K3' J J,@  J4X 8< @K@KP à ]C@TPa`~ pà &J@K( J4@@K J@BTuMI 0-LP| 0\@ IH 0hA00H@0@- @P0P=9@ =C 0 0P=9@ =C0 0 S  0 \00Z0?B p-L Mp`@PT 0X L.@ DM0 0 pPr-00*JpMyFx3I 00CS0/pM 0-PL@ ㄕ0S  000@000wp0h%\0^  00lS R00@1I1IyF p-LMP @QT0`SX 0 R0Z<00@4<0 R00T00T0ph3X R44 44^ Q4 ^<000 <0@40P<0< 0bS -LM@ ` `00CQ000 0 S0  0S00h(%1I1IyF 0-PL @T0X0CQT00X0 0 S0  0S004 <00CQ 0hǔ,0 P 0SP1I 0-L@PP XP 40S P0<0S -LM`p P@dP 0RP0 R0 0P@R 1I['(0 R0S R1I - L0 P4 \'yFyF -LM0S7 䀟` PRp@ f  P` RU@ 0PSU00000  \U@0S1IuMIF@-x0 p \ @ 0S \00  0  0@uM1I0@-P@Q9 P7 SM ,0 4 ^-x^'x^'x^'^'^'^'^'^'^'x^'^'^'^'^'x^'x^'^'x^'x^'^'^'x^'x^'^'^'^'^'^'^'^'x^'x^' Q \ 0 Q \ 00 0Q Q \ \ 0 Q \ 0@!@ 0S -L M$$@ O 0@Y+yFx3I4M 0-LP j,$O/@K08104M$0$0$ 81081 0-$0L8!PR @$@0$ 810CS810$0-4M -L M@PD^`$P T T,pKX* !, 0 $ (0 1 $ 1$00$0 1$00$0  1$0@0$0 T  0000 0=>PP =P , $00$0 $0 0$0  -LMP0 A` p$@01 0!000W8<0; 0110 010@ 1 10 0 10110 010110 01Q 0! Q 1W 01$10$1(1 0(1i餒$1 0$1 R(100,0,000,040S 0 0S ,07,0,071ID- 1B#20R00S$1 1$1R1I p-LM@($PP `0K @(1 0(1! P$1 0$1101 !(1S0 1,07,0P RPp1I p-LM 1@0P 50`S S `+p0 !8< !S08< 1 1010 0-LM$@ !1!010P8< 1 J0PP 0yF 0-LM$@P1 10 1Q#P0 K <P0 1101  !00 S 101 !01  ! 01 K 0 ! 1 0 <P 0-LM$@P1 10 1Q"P0 PK U<P0 1101  !0 S1%Fτ"0#1%( 3(F <P -@LQPp% RHP` @ 0zPT+r 0 R0 b0h -LMPS`p$ $1@T 40S@TX, Ġ T\09P V R@@T 40S@@T,  0P V 100CSPM P-Lp`P# #` P @T U 0 V  V 00V U U U @@TP@ U 0 V V 00V U U Uh} -PLM@ P h p-PLM`P @T U,0 ,0  @@TpT -LMP,A p@$`9( 6  3 P#  0<  < !@ ! 10 1!  (1W 0(1 p0!$1 0$101K@! 1K0A(,$q 1I -PALMUp@,jFp F,\" 0Q$1 1(10  "0S00ć @1 Ru `13811%711, 0Y1a , 10S: 4S ,o,   #20Y00S%10Y00S 1H01, U?p K/02S200ć101S0  ,   W V Z0S  `5,0HY101Y 0S010V 10S  /1I.8 MyF -L@ !,13P & FH`!0@$ !, ,  !> S: $0T! 1 QS S  ,11 014Q  @1 RHU?,  =P-6 0U (PH,  P 0@ !1011IyFyF, H*010, ! -1LM@P`$P  @1q 01$!0R0 ,( 010 0  t10 SD X> X 1 L/ ֎101 1 0 1   !1 (1V 0(1 0!$10$101綎0<  < $Q001$1(1,10000  0 K 01K1 1 pMzF $zF1I 0-LX, 0*00D0, !@P 0hA$0$PPV1I -$#LIM0,  ,0 Pp  006:D R @0S Ÿ,0 S ,0K  00 D@K d"01p00LK- 0 @ P WP` @JK  0ZP`80S ` 0 @xV \, $16 DCK 0 BP!H0"00.EHj0 pK|` F$t` $1|K\0 (!T` X 06P0 &L  Ơ0H '=P` 0ṒP`, 7[` pP`P`Y, F $0 RQ@pM4zF@zFV2I - LVN -LM@P`p@T0EP@Sw'x'x'x'w'x'w'w'x'x'x'x'x'x'x'x'x'x'x'x'x'x'p $ 1 01410pM4 1S01 Q0 0 0S00 0S 00 0 P -0SL`pPR0S@1 ZJW0S @PU 0 0C W0SUP!P P 0 e00 0@epe0 S8P 0 0S 8 7F,HzFpMXzF 0-LM0SP. 0SC)@ 0R0 0S S 0 B0 0@0@ 00 K` 7P 0,hzF|zF P0-LP@T*@T:tP 0S* !0S:0D00,zF -L@`p PYP0 Vp P  00 00S0@ -0LS S 0S S R0000 0 h_,zF p-LMP @T @Tpp@T ` R0000 0 V@T 0- L@PP( 0 S6002I -`L0S S 0SS R0000 0 he+2IzF -PL ͋Up ``@T @Th黋(`@T @T2I -LDM0`SP\` pw 0B Sq!XKL6P@>X00C S_X''''''''''T0儡 S P=\ dP@X'\`0 \KA0TK 0 @Q XT  Q  6@ TU\ 0>UP@ \K 5P@`\XTP-D@}P@ '2I$?9Y*PH)\'Tq<$pN* -LGM⌨\, P`p @ 0B9S9h'D'h'D'D'D'D'D'D'D'D'D'D'D'D'D'D'D'D'D'D'D'D'D'D'h'D'D'D'D'h'D'D'D'D'h'D'h'D'D'D'h'D'D'D'D'D'h'h'h'h'h'h'D'h'D'D'h',0 S T,50BESꐃ'''ȃ'Ѓ'''''''('8'8'L''\'ԅ'<'<'d''ԅ'''''' '''4'<'<'<'<'P''̆''''4'D'`'h'p'x''̇','D'L'T'\'x''''''̈''''8'L'|''' 6  66 5ş 0qşş 7긕0 0K ]PPW 0S0\40Ssp0|j4ş0 L@P00W00SP4 D0MK 4 &41P0GC ᪲>:4|4 `0`ğ0 L@P00W00SP 4 0u 0p3cßqßoßm3 ̠ße 0[0 S<0U KOKĒ 4PPh3Q X3R  09L 0@ 3  3 (2 "0L 0bd"""2^ |2R  0pL 0(\BNK 08 oPP81 CRS>L 0L 0@s!!!1 Ϡ3L 0=Q^L 0UWL 0UQL 0 JL 0C  0> 0PPzpL 0q+-) -pM{F$F,FFII IM MMMa tMMM0F7I7I;I@VM2IMa0\uMLMxM@M2I0IT/I@/I8[I@[I3I(wMMlMM<[I$I9I -LM@ \QP@ 0LS'' '('4'L'l''''''`'Ȍ'܌''''2 -1!0 1!06!0 0b6 :/P`|10St1$P`X1X!l0  $!A 0@10S (KP` (0-Ƞ0S 0 IP`0dSd00S`Wh00SX0T0P0L0|IKO$I IO2I4GM2IMM2I MMMM M 0-LMPR@@ K P0 0R 000, p-LMP@`  0STRPPP   30T0\00S p }2p p -PLM0 @ 0 SR0 \K  0 2@0@-RM@P 0-P\ \Ѝ0Ѝ0@ p-LMP@`  0STRPPP  20T0\00S p 2p p M-PL0@ 0 SR0 \  0 y2@ -LMP  -LMP -LPp` @b>U  0S*T S 0Z030#WQ$U T 0S: 420W0P00S 10 00@SC 200@C -L@`pP>T 0 S:U T  1 p-LMP@`P  0S:T\P P 1 0T0R00Sp U1 p p 0-PL@P 0 S:R 0\  1P -LMP@p`& V00P 1P P`FU@ WVX X`F 1PX@PU0h00h 0  !/ ,wM(wM -L$MR, 4 00 8 p04pS,H0 D Q ^0S`@0  P4 2< @T 10S UfȖ'D'ؖ''','@''40S$ @T< R < 82 ,0S D  0cR0  080S 4 R { D00 R= 0H0S @0WSD00D0 4X 1/#4 1P@  Bph@ BW*D B.D 8L .0P8 -0PBB~G,0 @1 R@1 0S 40,0 @1 0Sl00 Q0 Q Q0 SSPS  ``h@ 8 T0MM p-LMP@1`   @P 0<1 0BRSZ@S$A,A0A8A8\BH0S40`2@1 ?d"@, ?  R; l0l2x0S0$1p2|0t20@S@1  Q020Q70 @@?/@@) B70 @+70/@P P0p0l2 0S  $0!,8.<0\24G -LM 8  0 @( 00@ 8 $0@ @@H 0PP@X1X@ ` (@d,00h04 l H0S40p0@1 0S40t0@1 |@x 0 @ 000 00040(<0 -@11=, ! @1 R l00x0S00|0|0@t00 @ 00x ̊ |0B0 ^  .0@1 1 !$!$1(1(!,!10#03U/ M? 3 H=K NC=@1 61 0BRS01111@ 0 R`00`0@ 0 R`00`0 R P  =100CS> > 0K0 1 z_08 K10G, 84001! 0nO 0rϊO 0vO 0~oO Ί 0O  $0冏O !(0O ,0O 00O 40O 80O <0O @0O D0O HP00 L0T(!P=9@ =C, 0 ,0 ,00  "$20   41 !01 !0@ H1@1  00 0 1K?` `0X Q0V/@< m<00.3V6?B1-2 -QLTMQ0DSP Y 100CS,0   V 0 00  80K`0 \ H D T P0K =p`KX @P <  XKMP`T   40 T T4,0p p0 8 0px x t 1p  0APd l 0xSv*dKt .P`sxP K0@@ h0K `0 `0KH \ X0 T D <  XKMP`[h0SS  PK:#:Zc0 `KX `p \P T HP D @ <0 XKMP`@P@*0S @T:0l00S0*d -P`* d0 T h0d 0h0   `-P` pd0A0 d0 p x0t0Qx0 t lR:0l S: ` d0dKt d0 -`,0  TT070- -LM@Pw0Sz b PU ,r9PUPfP_x2p"@`@  @ D2  P@U`@ p ,0 "S0f"#>9,0 @ ` ;4 8  @ 0H $ P ,0X 4 ` <0h D p0L PTpUV00PC001 T QT 0PU ` ,0 @:4 8 0@ 0H$0P ,0X40` <0hD0p0L PT`U2IMM2I2IM4GmF -QL$M, 00 00 SP S 2`0<0 `080 ,08@S<0c# Uz:U@1@! KD 40Sf [SQ 0PU@0 <@S$@p`H0 8 U 3@ 5:0S4 'S <0YH08 `0PbH0 D`D@<00 0 00000hh2I 0-L)  01 0P Q Q0!01 P01   N`1`"0 0R  0!01 P 0 0 0@420&0K 0R  0!01 P0 0 0@8 <1 0R  0!01 P01   @@T@02I|uM@M@M@M -LMq0SA ܁a 0 00cSZSO S1"001 000 0bS9 Sl1"001 0000cS$ S<1"00! 0 00cS  S1"00! 0SoS0&0"< Ѓ!S0&!<0 Ѓ!S0&р 0!< 0Ѓ1S`0&\ 0!< 0Ѓ10 P00$0@j,@M2I@M|uM@M -LM@PT 0倐0c/a"|,K0K > >0H0\0  b,G$0(@T@M|uM\G(|F 0-L0LD@<84PK@TP0h|uM@|FP|F2I@M@M -LMP@T0@ < 000B0 02IHMd'2I2I'`M -P0LM D@R80(0 h 2I2I2IIHM -LMH@0DSK40$00 2IHM2I2I2I -L MaPQY P= P9X0 P@0S ,Q0S" PU qQ0S PQ00 wP 0Mtp K00, 0P@U4 440$-2I2I`MHM2I2II2I' -LM@P LI -Lt|F 0-8P8@L ,m $i0h'*J+J'@' 0-l0P@LT  ix0 0 0ax404 00$0Ba0hFpMI8 MgfffIO -1LM!p0W, 僀1pW\ 1@T 10 0CS0 00 | Q5|0 @T@\,@(1,o xdW|Px0`  x. t00| x0 .tx xK_`B1Q 0 T 10S x0K/w\ 0#1!S & 00&000 00TuMOPuMM2IpMIpM-<.F|F|F p- LM0 P1R@0tt00BP0 0CS0 k-P 00CS0tphO 0-P0L @w@0K/0P10u& @00@0$0hwpM- 0- `0RL PwH0 K?@1 X& D00D00hswpM-|F p-L1 M PK`nl 0PR 0  cR=9a  =  A 0  0!Q=9A =C 0P0 R0S @0S0S 000  e&d*p 0R 0R 0@ 0SpM sM?BO( 11 R00 tMdM -LM10@S'''D'L''''010%0S 00h0K/ RT0T ,0  U? R1B 11|FlM8 MIOD t0< 0 0S0#0(0 R0 .-lM8 MIO 0-t0P0$S$0#t0L v@vK01S0 Շ Ň0-@-@@@@@@0 00 00@2IxMMMM -LM0@S`p>0S,0S00S7  0PS0U 0S PPp0Si0h 0T0S <4p0M2I}F$}FdF8}F<}F -QLMp0 4 ( ,  0  Q0$ ` V P0S 0 S 0B8S$P0S`V0 R ,Q $0S PP0,`@08JC8 1!Q4K 08SVxM2Ih}F|}F Q-Lp 0  Q0`V @0S 0 S 0B8S$@0S`VP08JC8 1 !Q 08SZ00xM -LM|P04 H0( 0 `00 ,0 $0 JPp0CHAA0:)P4K 08S,PI$I -@Pp L4`V 0 h$W  03I p-LM @`PU 0 php}F -PLMp 0 Q` @@f`P 0,0 a0S00N P@@00 `pW<  Z   0P @0S S $@0SP ,00 R  0R0 S0 0R0c0 S00ꀽMlYFxM|I}F -LM`@/PpU PPN '0 S0 (0 @00B 0d! qP7$` 0\V@@Tʄ@T@ ZP fA'V 0 !R0,0  +0V|o 2S00S \0 !R Q}F}F ~F~F4~F<~FD~Fh~F -LML0P<K  ,0 )- @00C8St0Sv 0S-mP s,0 S ,lQ  $0SX  RA0S S: $@0SQ0 h10 0X 0`a P V1S RR 0 R <KH0000 `0S Q0 0Q B 0 R00T)P  pM~F~F$IM|I~F~FF 0- 0L 0PS-(@ 0 0(0P (@ 0- 0L 0PS-(@ 00(0P (@ p-LM$0@S`x tPP 0S` P $P 0@ `0  0ph( Q0FMdFF -xpL@`T 0P$ R U@U00000 ꈽM 000tM -< L0S 00C0 R htMF -tp@0L P `R $0S@0  P PT0ꀽM p-x0LM PR` $0@S T pV V $W-P :ꀽMF -QLM@0Q 0AT (00@T,00,0,00CS,0 p-LM`P@)0S `}+$00  0PPp됽MF@-$ R$ $@@0^"*$0S $@ @0S:$0S$$$X@@0^:\ 0RX X0R$P$0S$ X@@ @0R:^:\ 0RX X0R$P82P *0P ": -LMPD 88#| , `0 a@Tq LgHq00D!@1`  00,0 <X@ PX`9Z `<@? 0O@X Z 2 8`'0 0,8',@`'P' T< (0R084(D0( FG(F@FHFPFdF(G0  0 ᤽MMM P0-LP P0 RD0@T ,E%P @T000餽MM -LM@ @0z00000 -LM00@(  e9 40 Se Rdfm$j$`>H00< @0 00 0@ ,tFMMM -LM@ LR 0@00  0 $0 BR  (뤽MMMF 400Sh40 -LM40@0CsP40B ,Kh(0, 0ahS00  `=94 = B4 00 p004 0pQ=9A =Cpp 000K Z UPX8@` p@0ʏ 40K*FzH0P@ ,N?BĀF  -PLpX`@08P@H p`舫0p0t0hyp -LgMℑ 0,0 ! D!(0("4400@$04 T` 0$q$@0B*  P0 200-K0P$0*K?K "R .K 2 S0 S |x0L0 ,0S \,SL00< ?4=JpMpMFI FedA&4F^6dF8tFF -LM  P@- "0 00  '''Fv, R  00SSAπ |. 0 R$0|$0\|-  0+JMF -LM`@pPP  O" pP0D 000 0  0@ 3I+J R0 00  0 +J -LM`Pp ^H QDP?1@ T 0S2 @T0NS ''X'x' 0 -T To0Qo0 PT 0 XT 0S 0\+JM -LhQ` \ 000S S 0S0(S0 007$+J,+J܁F -L M8@4^ 0 P00(+JȽMF -(0LM@T @T,+J -LM`U`P,0 DF RE:+W00SGVUW9V, !,G@0Q 0(p$P, 0 S0 0A Q  , 0V0000 0000n 0  # ,P@( 06 F(FXFFF P0-LP @T  @T000@T R000   00h܂F -SL`P@p0 0+ 00S00C 0pQ  0S W 00CQ 00@@hW 0R 0000 0Q 0 R  B 0S00@@P -PLM@Pp`AX RN VE: T@: 0V( $P+  R 0S 0S * R 0q  000 0P  :#T`  0 04W0(R$FFPFFFFF,FLF|F -L4MPP@p Q  T2: `T 0, ( XX:S  C0dR |x Rl 0SS:P, @ilL@ P L 0P0C0@ @ 0T40 < 8 0 `:P 0S*PZ 0S:00i0P0C0 @P  0H D0 ^9*\7 Q#  @0@0  c  Ba @0BS405L :Q @ 0*R4S0#03 LR0SbD0 dR0S g|< R0#03\0S< 8@ 0  00i0P0C0 @TF:PLP>:P< 0S$ @0@0   c  Ba  @0BS01 :P @ B Q0:QS0#03 LR0S4H0d0g s  *<R0#03^0S< 8@ 0 H<0 0Q\8@0  000 0LP# ,#, 0@4  H ` XT  @< `꜄FFF0FhFFąFFFFXFFȆF F -PLMp @`PB# 0T: 0U 0 O UV:0M P \ *P @ <9  RT+ 0T! T U *0DQ 00 000 0D 0X h U*00 U R000 WP  0 t 4FPFFFFF -LM0@`p& PPpU 0W PoP  P @R000 kWP$w@kT00鰃FȽM p-LM P@* 00  00 R 0  @000ph{\k`hUk0 p0 0S0 0  @Ek` ph=kȽM -PL M@ L 0@ @T  @T J F 0R03:00S 00 0 0P000 0 0 p-LM0PS`  0R:0S00p@00@0@-,M@ 0P000^03:0S#\ 0^ *00  0S   @00 00 00 0000,Ѝ0\ 0^ : 00  0S   P0@-0(M @00 Q \ 00  0S  0000 00 0000(Ѝ \ 00  0S@0 p-LM0PS`D< 0S2 D<P0C"0%+:0aD0Q000R 0S00`` 80 0C 80 ph`h0p 5h@.hVF0+JF -LM `@V`Pp0S:000 0`0 0@0 0Wp U P@0Uz0  04 0 Ph00 `0L 8,0d$pT`DH000P0 RW 0 /">CXh05|%03h05 5P%(PB2p%|P5 `(`P<= `PlP t0RxPPPPPPPPPP 0PP00 X@@XP0\0 @x (0 Pa\\L 0 PY<8444 40x3IM0+JM 3I(F0F+J8FdF<.FFF -LMX @R\0T \0\00X \0 P PHQ"Q  Q 0S``` `00S  R0 @00  0  0EV<.FF:F 3I;܉FF 0-Lh0P|0 P 0g@Pg0+J - 3LM pRP H L0R` `V6D R`.P@  `VT  u000T PXd0` 0 d0l0000q @T`R D RR 1Rm R0000 0 D H0 B0D H0 R0S7 0C0 R000  R 0``0 00 S <0R R000 R 0` 0 `00D, 0Q0:b``"0Sd0` 0 0S0P PX`@D 0`0@kpM$FHFpFFﾯެFЊFFjGF* 0S ppM(GF -p-LM P2_ 0@``I'_,0 \0 !p`;ꐾM -<1`@P,1Pp  U00SL 10S@Pp00U00S&$10V00S VV 0 RW 0V0Q00ShT08PW  0U00M IM3I --L0LM,  @!0 \ pM,0 @1  R000@!  P 00CS0ꄐM -p-LM@!TP` 0S 0xp 5P P` --LM 0 --00LM Q0r\I -p-LM@XXP 0`@^00@ R `p53I3IM p-LM@\PX`  0PP=00@ R Pp3I3IM --0 L M@T@ K ( T0   -L M@@T ( 0 K T0   -LdMϟt  Y  0R p h P l , 0 h p H X H0 %PP p H0W0H0 X0 0  X0  pX00Y00S 2 H0 0%SSRs HT \  pH d ` H L H L  0BZSU\@(H(H(@(H(H(H(H(H(H(@(@(H(@(@(H(A(A(A(A(A(A(A(A(A(A(H(H(H(H(H(H(H(H(H(H(A(H(H(H(H(H(H(H(H(H(H(C(H(H(H(H(H(D(H(H(E(H(H(H(H(H(H(H(H(H(8(E(A(H(H(H(E(A(H(H( F(H( pX00Y00S & h  Brh T0 \ @fT@Dp PX0W0  X0  p X00Y00SP  T@Dʭ:X ,0S ,KIG\@fT@Dp 0PX0W00  X0  p X00Y00SP  T@Dm&`  !cT ` X0p 0W@0X0  p X00Y00S  XTX p X00Y00SL009L  D@K(0`xD0[Sx  p X0W0  @X0 pX00Y00S v 0S  x0@| Tx0  @ T@D 0@0` |X Qp <, W@X Q p X00Y00S F x !0B^SX00T  X0 4 pX00Y00S + x0 x0 !0B^S| x@Tx |Q X  >X p X00Y00S   ZX  Tx !0B^Sx0 x0 !0B^SFwD@K%RD@K%OTT@ 0 P`'0 0 P`!`\H 0  H0 `0 HT T 0 0 SH\0 ܥ0c\0 H0T T H+0 H*QH L  L@00L S H L1H 0 L0 RL 0@C0Tppx0 @0Tpp000 hHT0 0T0 b@HL 10L 0 B0@C RH \@ YTT T  m 0`00 Vb WT0dp 0ãT0 d00Q0S-0KP0  R0 :R x3P0 h l% >P &B`PbP P(K 0a0Ch0 1!`PP0aP T  00S000aP V0  P00cP0 0 `PV PP000lP  U- Pu`` TT @ 0 Po0  PoTT T  0` ` wT00   T@0 00  0 P`P`T00T0 T  0`  T T@ 0 P`0 0 P`l T   0`00 T 0 00S T TT @ 0 P`0  P`0DK P 0 h0 ` D KpMFF+GFFȑFIܑFFH0T @H lR H  TT0 0%T  0X0/ T 0X 0 T@ 0X 0 0 X0 00Px0L0  PuoL 0  T0P` l 0x T0 L 8H  V t0S# T   0`00 V0 S -Pu`` TT@ 0 Po0 0 PoR, T"x0 l L0  0` T000S T Vn-0Pu``0 iTT@ 0 Po0 0 PoL R D0KD KP0 h ` t0Y00S00P0 P 03R W P  P PaPh hp ` P=h l  S -LjG -@LM< H -LM @pT0TՒ0P X @ 0` 0  00嚒X00@- 0P^c: 2#80S$H *   ,0 9,00 08 M -LM,0P20#0R0Sp` 0Qc : <"K#80S $H:@@/0S 2[02KP nE-Ƞ@0Sp0 p `P@ 0@s  0R0 s$0@S$P10 R$0 @$0@S 00C0$I3I3II3I p-LMh`@qP T0T Q 0QUqU@@0p)=0@P3I3IDFTF,0, 0$ Q 0÷3I3I3IM -LM0(h h`1\@\ 0 0S<:&80 000(GM3I3IM000 Q 003I3IM3I 0 S-L< 800( S $S ah](G3IGdF -t0@LMA \L0S(O(DO(PO((O(PO(,h?$=h9$IH(GhFtF$uF -LMA0@Q!ڀ!0Qx @ ^d!00^G@HTHi0S" hPKʅh`0\b 3` KpKl 0pcPl=9 A =p p l p l0 T2RHL"002c2cs J, P@ 0S J@0,0"F0G@sJT t@,0#T@@0T,0QQ QL@0KPP| P@T| P@X| y@p\ d0S`K P@`K_P@hKR\ d0` h0P=9@ =C` \ ` \0 \D| P@Q H| P@G L| P@= @K=<0K8 KH0 40KD X0 0 K,0K@KT P0 L )@MQI$FP@,  ,<0,0 R,  1@ 1 @ 1,0( 0C,0  Z<0H0S<0 H 0@  DE 0-04PLS@ SP0 0R0000z" XPKЃXP0\Z 4PK`K\ 0`cPl=9 A =` ` \ ` \0 d1R@\!002c2c H, P@ $0S H@0,0 !F0LxHY ,0#Y@0,0 y Y pHKP d0l pd pl PL T0S0L0 P0  5p H IMb?B@MQIFW0SD00CSD0@0 (0+Q @0$Q0S WpW Q @@  81P&t 2@0@0Q@(❀0@0<@0@ < @0P <@0K*0#p@@ 80Pt @00@0 0ePp@0 p@0@0 @0@0<@0DM,F<00T0(R00  0 `<IMuMM@- @Q \ 0s 0R \\ @0 -L$M `0 Vpf fP4 Y 0  -,4P@J PP0s PPP4 0 > 0n@@R`5  >0,0 :#:S, )408Ą0 @ʌ ,Kp`@@ P@,00 0 44p " ",,00 0 v , `@ 01` 0`PP0  0PP 0`uM<I -L M @ @0$b^P %0 Ry00 Y P@X  R>0` R 0!R 000A<800 ;  8 ;0T1  0090100,04 1$  0,<0480(4"( ( 鸀`V 0 R `V0!R0Vh@ p H$8 0 j0C#0   <IMMMMMMuMF -LM0@[Q`p[ |P0 p0   01#P  -LM`pV`P@A@ c P@0(s"(P 0!R202PM -`LPp PU@ 0sP@ l U̐00 0-@MLP0@ P l0U  H0K04 60@(0( @@0<I Fx3IMMMMMM -L MQ@ 0@S0@S((l(t((\R0 PPpT 0 >0C6S0-R K00, 0ޫPp$ 0R R 鬁 K00, 0ȫPp$0P P ᛎTa @!D0$c+$ @兎Q @ .0$c@$00P K 00, 0冫Pp$  0R R TP K00, 0rPp$ 0R  ]<IMM -@LPM3p0p ` l@ <p0@3p op0t` -t LM0@S00b>|0 Q>x  0,0CS0 p||w IM -LM`lP<0 p3@"2  0@D  D \@0訠 $☀ ";p05s Q R @p 0SU 0S c )U}P ^U~P\U; A0ES P  @ P P  PUpU p 0UZm0 "0p" NU W x 㤠U Ww 0xU U U|Uu 05 0\  (0r05 UZ   ^;8p09` (0S.@20U0S 6   y0PD 0@$  $ MM DIM - Lp0ß 0@d 0 d HP X X X X D a0HS H@ > 0; `0HS|((((((((((((((((((((((((((((((('A0H\XS X X"@0`HP``d0\0d0fP "30 X00S =S  0@d 0 d HHP!0?0S(((((((QA0 0(!)^  so 0@d 0 d  0=`H PPT JO  L-0c Z0 =/PH @k0`0Od  d /-M D4G -PLlMUp`d:U *\:U rP:U *:D:0S&@| 0S , x0\ $1 1F0S )9@ P@ 9U; 9U [9US 9U |9U  0`/p0;p0|/y/0908U. 9U@ 0S 0S||^ ^^ 00CS0 @ 000@! 0|0@!x @1 ,00,0|h+P@ ;/p0;48UH (8U 8U,/ $/pm0'0p" 7U 7UH007U}/<@1| R NPxPDt,0h0.p   5,0p 6UA m6U_ '6U X6U@0 R Y 0 R @1| R,0 h T620 , H+(6U, 6U#6U6P lU*h0U .eh02 P@hPZ h0  {.Qp.0Sp0p000p0>05U $5U 5U?@1| Qc,0` P 0Sxk4U :40S=.40Sn0S_p 0   P (0$0( R|P P?4U ,<R R 20 0 0;; 0 0 2  `(p@5PKK020 㢝 0<p0 P@LP@E2U@  #P8  Tx /-t08t0 @8t0  t07t00@t08t00 t07t0P. q0S S p0(0(S" @0H0 1P pKl p0 LP D` LP@ `o0 `0q@ `s`RT 8!0X  0U 10U0 U0U 0U:0U~00Uy :00Sst}trt^t pM4Iht@nt t t t at Mt@ot f@Iwt@st@[t@bt}ft,@$5It~ft$6IZtetvtgtt, IgFtut t tt 4-0L0Œ@P,Ap`@ .H0S`VW T, L HP`0 p0긇I p- 40t 0LM"@`1Ps sP<0 p80<`,00@,0긇I5I5I 0-=0p 0"L@<P,0S00  Q0 0 0S000h,긇I p-LM= x0 2`<Pz,@J s,0 p0191p 0Sp鸇I 0-=0p 0"L@<PU,0S00  Q0 0 0S000hA,긇I -LM= 40 @2< H >P鸇I -LM0@  (0 P0SR0 p-LM@,P`H0Spp% 0  0S H0Spp 0  0S p, ,0H PP +p4I 0-L@PP 0 p-LM@P+` (Q,Q&p0 >;-p0.-ph+p0m h< p0ŒHQHPᷬHPa^([긇I &4I 0-0(  SL@P* Up0@0  (0Sژ0  P HeP 0 0S0Pp0@0p0p0@0p0p0@0p0 0-PUL E+p0@0p00h;+d(F -0LS0 -L ZI -LMp@  0 Q   m0 ̌0p"%p(Km = P@ ( P@0p 5*0p '-=`b0V``V=J`VZ0@   p0  X:p0\ DDF Q0-L@PA  UPE0 -LMPP2 ~'(`$pKs P@ $! = P@`b P@ $ , P@p0:p0T'0>0= 0-p0@ 0L50 "20#0 P0S @P 0P0PU00S P ^TU?@0hNU0 -LM@p0 0t hhnxc0s S0s-t0 A!`?̠0 S S \h\ !h3 3#2 11>gfffON -LM`{P,"0$"111;/"b111AP|0St xQo @TPi zPP@@T10KS4 S1 1R0 0l%$K0, K HAN=0S 0 $00!0 $0 q?B6c$  (N=0S(0 ,0 0 ,0 ( (0?B6c, |01c1 @R  1P2;P 0 <0/0"bT uDOQlF|FFFF̝FԝF?BHhFFF FP0@-0 1@1P0 SR0C BSRP 2P# 0DS00 ER  R R 0R0S,  ,00 4 40R0,0 R4 40R0Pt t0RS p-LMP@%p0`(0(S U  %p%p 0-LMP  0NქP>T00  MM 0- L>B㋀B@ y\P( tH p 800 @00 0@l0MMH) -t LM0@0CS0 R0 D00  0 m(kHi>hMM,F -0  L:0 Q l00  (00H >1>1=1p00|  x0S0 0h0$0(QMMM -L MQPp200CS 4)h)p)x))000 Pi餝0i t0p0l0P` T0T@ 0 P `yMMMMMM-R Rt0t0\ \t0t088Q i, -0LMȐ pP8K 0, $B T"d`"  @E-Dž"Dž ,0S T,H0H@p030K0K/@K8t0-  30K2C!DFpMPF\FpF 0-AL oP0 -LMaP嶃U􀟵 0U0P@ʄ@T0T@0p 0R !@p0!R `峃858@v00v0A堃\,6I46I(6I06I|G -P@L@M0 @h(6I,6I - ((pLM"T`P@381 APPD p .   0 Q%0S0p0`̌V 0p`(P@p h 0@  (6I`tI8#)$5I t tuttu itwt@_t tftpt -LMQ@`+P P 0 i-Ut  ph~ 0P̖P@>Q(0 QP"@~,6I06I46I 0-@LD}@0P 01S 0S 0SP}046I(6I -LMx}t0@0T`0 1S 0S 0S @T }$0$ 46I,6I(6I.J -LhMP,`x=P@P@80S C齅p 0bb@ሀKT`K ᾅTD00D0A Y,0X K0,0  0b -T0LQ@@ 00 S Q0Q 0A|I)I.JĞF -3LEMQp(  P (0 9}KI/K]PP JKK/K]PP $[ I_0H}M 88#D\PUpK2 a "LP 4 H l p Dp ^PU UP $[ _ ,[( 1 18庀 1` 1 $-``8a Lc8!KP  崀 p <PPT0$  1GoK@P@>A Q 1 @ 0aPUT c@0S<0  ,bB00 81 K@ @ 0 p PP(1(1 @(00(1$b$1,!0 4 8  !(00(0 ,00C,0 (0(!(00(0(,00C,0((0G ,FD,CoBbt(@(6I;I<6I -P@pL >xA0E/>1 `W>p 0 0P0  w( -LM0@S0S000A?>jy >dy p-LM@0`SC 0^P` a/.!0AS1l0PU00\ p -LP`Vp&0S 0\@l0% @l T@ 000S 00`d d0Vp 0SS 0 0{h0 -L@Pq`\p U/ 0 ` \L ?>1A 0S>0`QN\L0 Q` \L0 0H`F V0`b 0-@LP+ U000 0 UR 0 S cc Q0S00 aPa 0U  RR  0h p-LMP@ `R8 R0S* 0 0 0P 0 @\    ?>1 @  0 0Q00  0p?>1 @ ,u P0 pFRp@-@) 0/.PaCPL  10C00&0b 0R000 Rp0a # B0!00p?>1 A! p -QLM`PpFx R- R0S1 0 0V$ R! 0 @cR@cT@ `dPp  00S 00 0V  RC 0 A( P0F@-0@S 0 00\S Ch0P 0\Q 0 0c/.!1CQ<0 .J@- `0R   00\ La/.!0AS1@ .J p-LM@`PP 0 S0 0 0  l?>@1^!BP 0S2\0S0 0p -L Mp0S# 0S 0R p @@`KP@K  -`,0p@1P LP@U @ \ 0^ @` -LM`,0p@1P HP@U [ 0^ @_ -LM`,0p@1P HP@U [ 0^ @_ 0-LM@,P@1 P \0Q T0Q  0P^0@1 Q 0,0000at qt @-,0@@1 00S   @^@O 0- A 1 ! 0 L0 PS 0 0S-@ T* 04@S!T:PU R0 0Ո0@0@d @增ll ឞH㠞P0h霞 MTI\sI 7IOIM.JMM0J)M.JI),0 P 0SPM -LM@P  P*0S S 4P: p-PLMP@` P P* R T 4P:p0SRV`0Sp -LMQP@!P P P U \*0S 4\:*00S E 00*Am` -h0LPpU` @ T*0S4@  T:PUM p-t0LMP`U @ T*(04@S T:PU(0ph˝ MI p-|0LMP`U @ T*$04@S T:PU00(0aph馝 MIgfff p-t` M@Lh 0\P@tL 0@l,0巳 0ph鲳M`FMhF(I,I0 <0ϳ$I6IM p-LMvl0`PU @ T*,04@S T:PUa 000p MM p-LM@`OT"@@PL:H0@P  1 0a16pMM p-LM@`+T"@@PXT0@P$ 1 0 a!1pMM p-LM@`T"@@Phd0@T  1 0a1T  pMM 0-@L P 10C1( 8P<0<0< 8 0 10 x@0 (0S $0, $4;t$MMM P-LP! p!` 10C1* 8P<0<0< 8 0 10 @|۱{TP (0S $0, $4s$±MMM -LM`@TT"@@P?@T 0 0!1  1 1019T !0hZ)P$p Q0p0X0` 00 xMM -LM -LM -L M00 0p`40 JQ14 W V,i 0W:pcW`0X,0 ,KSV 00@S"ȯPP " 101岡UP 40Sx 0!0gS0! 0k \/0$00$8 18 8P!8 0 <` 0S 5`1P1l0:嘡 00c|0 S01W01R@1@! { 00 0 d dR0 0pd0 UX XP 000PX@墭P` 1 1 101V 1@  @ :)01@1 0$ 1 M|MMM Q-Lp`1; 0+0S6* R3 0S 5P1`1pl0: 0S@1@!  00 0 pd dR0 00 VW W`eP!000\` W8@&PP 1!1 101 U @ $$ R 1 0 +10 ,( 40#s:0U00SL( 0S% 00#0Z00S 3S0 @`PdPU70778K 07|cUi  X00R00SpU^ @04 p< 4p4 5 L 0P0P00S 40  70778 0|7.P 0RS04 0070778 0|7L WU @0 0S 40Zdlh 0Sl4p<  R< V14  4 40pPD @L  aL 1SS P00bP0X0,CX 1000cX00P P0P PdP0pdQ U ZlPZdhl/6宩 T & 10C1* 8Q<0<0< 8 0 10 0Td0֣Tv dP (0S $0, $4e$徣8Y D0 |P Q P8 \ tH R d0SXXx%lPWWdd0S00T%ZdhlY L00bL0!RR P00bP0X0,CX 1000cX0\ @0 Q 0 R  P0d0 dP@ 0Q 0 R8 D$@ 10C1( 8Q<0<0< 8 0 10 0d0; (0S $0, $4Ze$%7 L00bL0!RR P00bP0X0,CX 1000cX0,\ P0d0LdP"@ 10C1( 8Q<0<0< 8 0 10 0d0 (0S $0, $4e$(ˢ4S]  U+WU 1S, 1)PU 0 9E0SQ@  4 7077L?86X 0|7L#%PL0S L: 0@P4 0   @Pp Q! zpX00W00SP PU K<.FF F8FDFMMM\FhF p-LMQ@P ` Q p T  0pQ -L4MLP3 p@033@033`3033#TK@040̺2[03,0(00 00S'<003ᝈ -LMX`p,0 P \ 0 S*U ,0K0 0R ,R "R RU 0S0 R00000 \ 0S ,0K0 0 P R R@R1R8 R R  R RU 0S :G@0CT@SL))))P 7}PTPL0T@0T0T`@`00RU 0S@000 0004  ` Q!k401#8S#00Sd0W  H0WS 0S 0S S dII -LM^P@p \ 0S*p 090 T` 0 &T T T 0 00`T@T  TT  T 0 0000T8 0T  T0T 0T 0 T 0T 0T 0T0xP 0M@0T0 3 003` II -LM@@ D0<up@h鎼 0-!40r@L$ r 00LP<0<080(  3(@03 0PT7Id7It7I 0-40@$PLt0S0t0  Q0 0 0S00t0S7070h40$ L 0  191# 3S,000`0Q 0-40@$PL0S00  Q0 0 0S000S;0;0h-40$ 0@N cQ  Ŷ  191# 3S 0 ,0 0 0S 0R40$# P0 00   0-0P; 00  UL@  0S 6ULm0S 0hdL\0S 60h -LM0@00 68 '?L<0S  -LM0@00 6. "L0S  -L ML0H 2cC0Q0^, 00 m3#0 Sfʤ㳝PD A0 @0 0 @0 @D@刀 0  0#Tp`Wp@ 0  1SS 000 0, 1000 0@0S 000!RR 000 0, 1000 0 0S@ rMMġF p-RLM@P 0RP^ 0Q0`D F0aR \p0S 0  1SS 000 0, 1000 00S 000!RR 000 0, 1000 0 0S@@ @pԡF Q-L@`Pp 1 0\pW 0S0 0@TW U 101hp0S] !1R U5 1 \  00c<H  80S< \!1R U@ @ 0P00!RR 000 0, 1000 01010@0@0   00 0 0  1SS0 00$00 00a\U0F -LM3@3.0& 0S$0S 00S 00Shh| |00SLL/d0 0S((H H0> 0S<.FFF5F6,F7@FTF9lF -@`TVLP8T 0S `c c 1SS 00b0 0,C 1000c 0!p 10C1 8P<0<0< 8n 0 10 \@1VTF R5$00b0!RR 00b0 0,C 1000c 0!` 10C1; 8P<0<0< 8 0 10 x@T R T@ @T 0S @ @@ (0S $0, $4]$Ϛ (0S $0, $4\$p巚o 0f  000f0!RR00f0uZ @o jMMMF -LM0`SP: 0L0 00b0!RR 00b0 0,C 1000c 0!p 10C10 8P<0<0< 8 0 10 @^TP0S  00 (0S $0, $4t\$?QMMM -pL @M T`1rPP& T@屘$$ R 1 0 +10 ,(P@V40tu0 tF@ 00 0 00! 00$XPP@ Q% ,  0R,0  ΩP@ 4}<0?(]<8,0( 0C,0 ,,K 㰩@T0 (00(00,00C,00(0 ,PD 3 0R3( D (00(0,006 , . #@5@3Sn3Sl \ 6F 0 ~P@3S]3S Y5 50#U_4I DF -L M0P$ K(0 P@G$ $`0A?ASV (K0P@)(JP@#0A?AS6  0 3Sp6P!F0p}P@ 0 3S T0C3000$ ,00C,0$(0(Pt8,~$0,  B, $(0(*$,~,00C,0$(0%,~ D -LM `P ,KpP@  0KP@t( 8K\4K h=P@d804 D0 0040 4 弑<K, 40$  S=P@G<0 < 00<0DK<00 $ 80,0@0 P@+0SF  㘨P@!4 (00(04,00C,04(0< (00(0<,00C,0<(0 \,e~,b~%;<>000 D;4>0,0 0P \,P~0,P@ 4I -L,MP 0@ < DK< K8P 4 0 $@ D` @p ,@ ; -LdM0DK`p  㨧P@8 P%PPKP !<嘧P@ 0 , @Z6pM 0-00LP 0 RE 0a Q0S 000000 ,0 0h10h00H 0000#0 0K@E 0 00000uM}IxIpM00000T70000 0000#0 0uM0000000 p-LM@008 " 00`:00R00 _ x0S 10ST0000000d0SI8 R@.0 B6080 >0C& 0S0 0000@00h!hQ 0 0STP 41D!0Q 00ph00500q0@ 0qq00 000.0 B600 h08 . XB000000 @<08 . ,xMXMhM\MtMtMdMMlMxMdM0@-0 Lt0P@h0 P P0P S P00Sd0S00 5H4|M`M - pLM`P  4 00 !!10AT P0P S( @T, K P@,0sS4P 0S004X0@``8 G80N0Sd0S8 0000  0000008T 00L 500 0@@o08,0 ,0S 5H4|M`M8F 0-LP ~P@ 000:00 R0@0pM> 0-~pW`LpZ80S2 /*\ VPP 008:00 R 0P8 80H@bHT@!d 婿800808 <0 d8 S80< S)`80S:S<|0@PU k00000oH8 H g8000g 80< 8p0:\ 儏@FpMlMpF -LMp`M1!0PQc1!0Q ʌ1!0Q |1 QCp1@T/ &000000 H"d0S #x\0 ^X00D P0 000p`4@ r07 SRX 00S*0S$R"*r X00St0 0 0SRr 堁sus0suu0sXR0S0 uq000 0scgTF -LM 0R ) 0 `R 0 4 Pјp`0@  ( P0S@ 0R 0@ 0 R@0  0-L @\ P( ^,0,0,00(, 00a \0 -L,M,0$ `000 R Z $0 0 P 0S 0+7P@0S@@T h{0002S ,00 0 0pCW:0S/S W0g 0c #0% %0 0 R2  0 /R @@T0S @P@v i l20d"S_ 0S0 0X0SpOP0K P@KH0 @00HK00 4 ,P Pp L D 8 %P@680[c  R 0?@#*\0×000@0/S @E ՗HzpS ,zu00z0yp>@ % ;0 gzcz_zpGWa:0/S WF2?0+K$ xlFMMFF -LM$P$ 0 0#40 @ Rp8  Q R 4 00  ( @0 < V!, 0 /S L  , 5R  /R  2R0 /R, KR, ,0 lR ?Ò00b0 /R07 00S09940S009900900S 0:00  0T 4 T <0 0  0@ T0@dd 00@060 .#P R R0 j7ã000b0 0 j00 0 R090@8 Rd RR R  00l00CS<<0S;T0$ 78 R2 T0$  ,3,#0S @0SK00y $P  80S   $ap20S 0 0 j 0 ( |`V   20S  8 R|`V   Y$00K 6X$0@@ @ 0SVp< RT0$   <@@U 0.S0.S0:, 0/S  0b0j007, 0/S 0 b0b080ST0S8 0Q0R00SF@090#j~M @ԦF -LM80@0 p,0   `0Sb 0 ^ !PP 0S`Sp [00ZT0$  P0  `80S2 00CS ZT0$ ,0S T0$  ,0S 0  #UT0P 0SP I m#@ }FFԦFF -@ MLdd 0\PuP0P @L@HHH0H @@@@h x3I0nFMMpMMdMM.JM p-LM 0PS`@<P @ @@@=Pp=8FH= -0LM`@Vp -P $`VV v>8v@P~P ` 0$0 P0 00$0$(0$0p /Y 0匊@$9I -|0LM0Sh0@T 0S$@TP0 $ ~J$9I@FH- P L0S PP 0RM p-L M 0@004L0P0 S000t ` 044 P 0  PK P 0 0 0 0L0pxI.JM0S  0"S  L00 \ @0D0<0804000,0(0H0$0000 00 -L MbrR@1\.0, 00 ~ 0@S q R$q R 0S k[uPᘏ 000@8@,0400T0P@0@@PR  P XPUDh|PU @0S&X R\0\0\00X \0 H  H ,80S 0S "p@T|@<@HC|D<80lMI.JpMdMMMF\F|FFFFT0S ` Rd0d0d0 QT0` S`00d d  -PL`Mu 0Kp d @ P0@0  P8p 0P 0 P  PM -LM800CSl1l!p2?0`PQ@T | 0U @T 6| 0p P ppĎT` < +< <0;<08 80S@0S  $PT Y80S  !  40 840 ] pMM -LM@<0PX `   <<00! [H @p00Q00S0@0 PP @ 0W0 BR00S@ +L0S X R\ L0 \0\0\0 H00H0@ X X R\ 0GMdM -@0LS  @ {F 0-@L@0PSX%H0 L8H |0| QP X0\0 @0h0XSX00X \ @\jzFMdMFF -LM0P@ @0 SC \@D0S  @0SH0 h,>(zh3 7pM4FDF\FtFF 0-0P@LP$ @0S C \@D0S0Sp 0h@0SH0 00hi,(zz pMFFFԨFFF-H0 L R@0SXP^\0\ D0\0 X\ 0X0 X\ 0L 0L0MdM -`LPp @T T0S`@P T -LM 0P@  <0 D0S 80S @0S 000 800CS0 4 pMM -L M@0 K  0 @ PdE* -L M@P@U0@0<0`p48<,<0E2`<U5 V-(P#U @00CS@0L0S0t 4  @ <0, 0< <<0iZ\y 0  0F,F|MDF -L@\ 0pM -LM<0@\` <<0,"0 Y yT0S}800CS@|P< 0S00 S | 0S SHy0Q0 @!T@0\ 0   0V0P@@T@ 0004P %0401 30 R 0S  R0\7@ \ $ \`  P@d0 Rd0 0DzM -LM@0  012 p-LMP!`@4T  200`VPZpG0儀K 0_ P@00CS@ -LM0P#Q`0K  @00   ` P@| 0 p儀KT0@$  2030:#:0 00 @ -LhM0P#88S`3 K4P@ 0$p [T0S $0@ @K0:#:|0 0 @ M 0,  B, (0,F -LM` P@0K0  P P@ p T0$ @'0s* ,P0 R 0儀K 0 P@0KT@ 0x0 @ t 0 @@㄀K0s :I -LM 0PK`0 0 0 P HP@ p T0$ @'0s* q,P0 R 0儀K 0V P@0KT@W 0x0 @ t 0S @E@㄀K0s :I -LlMP` KRP@ 0 $pxT0$ @'0s6 #,P0 R* 0儀K 0 P@0KT@  0x0 @ t 0 @ R 0,  B, (0 ,E@㄀K0s :I -LMpKP`P:,@K& 0K40040  @0K0  ` P@ P  T0$ @ (0 "c1, ah $ 1d0 \ ` 0@,K nP@,0s0,0 $0s0$0  -LxMpKP`PB,@K 0K40040  KP@ 0$P T0S $0@(0 "c1, ah $ 1d0 \ ` 0V@  0,  B, (0 , E,K nP@,0s0,0 $0s0$0  -LMp P@0K  0 P P@  `@b80S @T0 匀K @T p0K 0@ -LlM`P KP@&0  X "00  @$P 80S@ bP@   ,00C,0(0,D@Kh0K0 0@ p-LMP KP@  p0$` 0 P@T0S $0  ,00C,0(0, DDf@ -LM0!P`@0 dK0< `0 d 8` 'P@ATp18!Q K0@ 0 ` P@LP`U 80S> 80S@% W@W@TU PKT@ K0@Xx2]\P0,]tJK2V U @KP(P:8580S@@KPP*(,,M p-LM0 `P0 K0 0  P P@@T|@K0|0 "0ˠˠK Kx P@ pKP p 0-LHM080 0\K4 X0 \ 0 jP@ LP80SH@ 8KHP 0HP@ <0@@T8 KU@ -LH P4F-$ 0 B$ -`0@`XL pPU0@  RP pM -@ ML̠ 0@P -LM0 @ S` @  K0 05 P@0P <0 0P 0 2 K0 P P P P@j0`S` _ 0 Sp| ᔐ`P@0K` 040 D0 0 K,0 ؠ p H 8p 0 ܀ 0KHK @0KRP@` `P 0S @ 0 0"P80 cQ ڴ Rb@0 S Q 0P PbU"@u @P @ PP0G -LM`pP@P p PPP Pt P0@0P0Y {0<0 P@ 00pM -LMP 8 , 4 0 @ U0< ,<, P@kY80,4 \v 80S@D b<0  R: T0, 2,0S@2  ,{P@F, <0,`K0pK4K 0sp@/ T,0SD(Y4 4 P!P0@/ 40  @00 0C0RS000 , 8 R4000P,P#\ 0@,, 0 < 0P@=,<0 4 RB/04 0B PU0PjI -L(M    40 KX>I -L M8 0  0 $  0 ( 40 (K>I -L,M   0 40 K>I -L(M    40 K>I -LM00 0  0 $ 40 $K?I -L M8 0  0 $  0 ( 40 (KD?I -L(M    40 Kp?I -L$M   40 K?I -L$M   40 K?I -L$M   40 K?I -L(M    40 K @I -L(M    40 KL@I -L M K40  0 $ 0 ( 40 (Kx@I -$ LM  40K@I -L(M    40 K@I -LM00 0  0 $ 40 $K@I -L$M   40 K(AI -LM d  40KPAI -LM d  40KxAI 00 -LM@P0< YLF -LwPY\F -LM@iP 0 04 0H=I 0- Pd0LS PP  00;00冹@g္00h 0-0@(P0 L 0.0S 04 0 @I 0-LMPP @0@0 - LZpF  -LhY눳F p-LM<0@ ` P`<<00 P8<0 p霳F -0 L M 00 -L MP|@Tpd  00S0R  00 0 0S`" 0S8   `V  `V  0!F `8 `rV 0  p0!F`8h` ZV0 Q90  Q 9 @|@,K 0rP`(,000K0 gP`p ,#|0000,P`  00, ,0 00f0 ,|p騳FF -L MP`@|0Tp(0 S 00<00 @@嵬 @T 0 0#T<0  0| R#@@TXF -LM0 P|R`p 0 0<0   0囪 @( 00<0%XȳF -L\M0@^ 0 0| hKD tvP0 |0hKD hvP0~f p-L\M@P A|0pK0 `|0 RL |0 `A 0pK| \L p vP vP - L>0- R000S000 -LM`|@PTp* 0 00CS0 0 00CS 0 0S PU Wp`|PE= 0-PL|@T ި0|00 -LM@X XسFHG|0 XF0S S  (00S 0 < - -L2W F@-| q  qL@H0 800@< (  3 03( 0DIDI@ 9,0@8,<00<0, 0P, 0P, 0(,  00 0( ,00C,0((0$0A:$00@K4Y 0c0ZaLi0Y $c0ZaBi,)7,00C,0((0,,7-M p-LM1 @@0SP \0 `V0 p^!,00,0!0$14@Ya0 p-LM1`P$0@ WPppM p-P@,0`LMT0 L  0``` :mTZ 6mZ 2m D ]hp -L 0KM# K0S +W F -L M `0@00 ,@ @00CSU0SJ L1T ,0KPP:,0 8  ,@D0, Sp 0S0@0c 0 00 0@l0 000,00,0  0 060,P0.S MDI p-QLM@` 0R0  PP 0@Pphv 0ם=p)pʚ; -LMpP <0 \0ST0K ԡP姥P@% P@0`$@ḴT㵴`0 3S06 \# ß01p4 0 3S ᕴ0帣Z  @0@ 㲫K7@07;0; 0   09KlP 0KT X0 0XKP0 H 0@K`P80 ` H K 04@ 0@ D L , P@n080 PᰐKⴠK`K@00 P (H K 0`巨@(TT06@SE RR 80ST PJå0 0C#A+ TP `P  @ 0 00S\` @R hx  @D UT @k@T=@P@  0@H  1EP!010 P?U@U  |L1 "  40 $,Q|  40 KuP@   | 0 @|  0@* @T ?|>1 1E  ! 0  | D`<0;<0 | !88#PpM|FIF 0-PL|0  Œ*P@0| 0| "8|8 #$ 0|40  !Ƞ40 Ƞ!$, P0긇IFpMG-p堑`aN`M\0[ xx1&V1d1后ETX1""ᓆ L"b l A N AD%X$1U`; P ! 10UPc "*0P  00U: QPc0 20\00{.L B40Zx000\ | 0Q0Sd00@a00Ѝ8IMųE.”MMnmtDDMk_k P-LPp>;T!52c~HaȀ2ca10 0\რ+ <@4TP *[O[O @@R: 0``( AP*0 P@:00@C "b"b0#l00X d2111H"c#b1 `130$OQMMDtDI(F@-0PSpU0 0 000@ S  p`U 0 0R0@0 Sb0 S .000@ S  LpL`U 0 0R0@0 S00DDE-` M@p 0 0 \0 0.\T.0V0 Ѝ.\ D\ 0 S.S\Z\RP J0 S .S RP \ZUv R0`@e@c\ 0  0S Wpp0S 00Np ^\\pPEP*0  0S Wpp0S 00Np^00P0#02SPp3^_000S00W V @V^P 6!10F000nR^`VL 0 S 0n0 lS0d~0^ 0*0^ 0:bP0u S .S PR y0.STWVMD0@-P| U@B .U@ 01 c0 C  0 R0Z  0  01 PJ0 R0Z PJ0 R0Z P J0 R0ZP0@0000  0@000|@ S .S A-@pP@  0Xx= ?0 1 C@nT0 7#30 T00SP-@T`,J 0P$0S!^Z@TJ 0P0S^Z@TJ 0P0S^Z0S0S Dp@-@?\00\0AS`P?@01 P0 0RPu2 0?0 1#0C0 R0; /R0 0S"QZ0 R0( /R" ^ 0SQZ@0 R0 /R 0SQZpp@Np00a0C0p00Np00a0C00a 0C 03  QZQ p R .RAQQ 0Ғ?AcON -,0L;0 0IMM -0LM0吐pP`,0 ࢂx 0  AT 0U @ 0V0W,0S  , (PpMMM@- @  0 201 R 0\ R R  0^0T,0S MM0S R00  -LMpxX3Qp`@` PU,0K @T = PK^08"@1,0P, @ @4@00`  ,P@ ,FT 0p 0V ,0q x0sk 4K 00K P@ \4 {b40 h 40 i 4 0464 0464 0464 0474 0474 0t4 04 8^0 Դ0@T  0 |0f -LMT00T0R@0lp 0K P 0! !TAT W 00 -LMPp` S00SRP0R0B\4K, K00K,8@K 00@P@yX8@ xxg 8@4H 0 1XZ 00 s! xP1UI %1U , @0h08@ T۴H4 0 0  H0. 8 4H008@uH@4R 048 80.H 40 80.H 40 80.H 40 H40).8@4H 0 488労YGe(F`F -QLMp`<0 0P 0CSV0 0[4K, K00K2, 008KUP@jV 4Px@<1`VpTS -1T 00U*V8, MV0h08H0 0 H  80.H 40Y 40P4P P4P t80BH 04880.H 40 80.H 40 80.H 40 40P80,H 84 H004 P8 p-LM`@P@0P @dT:p^T*\^ @T1!p ]@@ ]d@@T1!p -LMRPp@B `1 21T \ BT L0 PZpYP -L$MQ40 0`p@0 } P8 !!q*f`fPP 9Z0P@<0  0!10C r。aV L]00@C m P0E*< P@@ < PP@T@ T* 0!10C rRa1 )]00@C J P0"*< P@@ @< T:<0S 8\  40b@< 40X @ @0Kƫ,0@ Ce8 - LMQP`8 p=P0Q:0K4K0Z, K 0,W 80Sz8@K 00@αP@,pjT00T01 11x 1RN +1R P00 sPUP0U8Q, 84H 0 H0$"RP * "8 4H00x r804H 0@ 80\H40 $ 80 H 40  80H 40 804H 80TH 40 8b j,~ -LMP 0XPp, *0P p 0W:p0WT0U,0cYl@RYXP`XD$ K(0K$,@K (0@P@,,x~ H0 0^  T00T01 11,P0pW H 04 8 ,, -LMpt4 80 P0h02  q 4 RT t0,KS0,0  , 0K,4 00P@}8 004R c,04 08 t0S, t \00 00C B0 & 0AQ00 " h0@P% `X,0HC `0,0 d0 @@S@H<UZ0@0@ 00S0C00 40S#`Xd0` PP2`0X P c@YX` 0 PMP0  X0s0s), 0P@0, , t0Sg P@ <,0K@P@Y CrBMMFȷF -LlM0 p d ,0 0L X0   T 删x 0T0dp h00 | ` 0 \  0 @JP@P 8 ,0S ,x) T P@<0 0.S  8K0@P%+%+,+,+p| 0x0 SS| P Pt P 0r S .St00CSt0 0P0 h0 HK h@ KD0KP@p@0KL@KH0@勯P@H `P|LH0@\\R|0UPd \0  `V uh  h pU|0Pd Sd0exŒd PP  ,0S0x#70P00SeT    0 P@W| 0B(0d0$00\;\0 J X 060| 0 UPS 00 p\ PH L 8K TP0(0$p0 x 0qTl D0lS`P UDP `bLpx x0Us@PR `x0\0P00S1  . v* 0 7P@lt 0\0R00SpD P0KP@P0T \ 0P;0  X   1lt 0Q0R00S T 0 T   ^pD P0KzP@\0S  X  V060P0T X  J0 60pDP0KYP@\0S   X  *P0@6 P0 X P0600 ` v 0 P@Zlt 0\0R00S iTKpD P0KP@C\ P0R T0 j X 060 p$@XUPp0 0tH  LLLHPZ| 6T| . R R0.Sbl DP pMܷF -L,M$`x@ \p0:d 0a0X03 04 P@X0x 4$#x X40K<8K0 KP@$40D S\0D 00K80  QP7x0 qD0 4Ht0T$p T q! (0$. (0K$p Pp( $\ W (0SL? @0T$p@0RR>FF,F -L MQ@p`d%X` 0D 30nR\050@ 70 0/`ܫPP X 0\ H Ҭ00`X H a0N 0-LM P0@0  @0 -LM,0$P0C0`p,0 P,K0KX PE5 0P@600K4@K00@咫P@-4\0H0 R $0U  P 0 PE A\0 0S 4׫P@ 0\ 00U00Sg4d -L$M00@0 < D <0 D0PJ 4K 0 K09Pp<@00K408@K@5Pp+84H@ `0T*PU  0 @ H0 `0T: WD00D0  PP 848p 8 PD\ -LM0p`0K4K 0PP-00K408@K@ުP84H 0R *@T T 0S H0 0R:˫`ȫ ī8 -LM⤐Kp  | PGP@$  ԁ0S   @T8$0@-@T2PQ @0(0$ ,ΏP@x`80S|0" 0Qy0 Q $0 LM-0  0P@  '$0Q 0V@ Tԁ40 08  0,0005x0s/ KP@  P0@)P000@KY 0IZanO0Y IZadO M| S00 03@ K^ 0 Q10V`\ 0  05P@  s xI -L,M|0`p PP fP47 V( t0@ 0@@(P qU $0000  0PP(KP!4 4 ;偩PP, 00;000,0iH@iN  0P410 $8 !8 0 UP42 0 $" 04800 $" 042 4$ 2?S\P 048<,0 0$(,0 2S<0 \80S0 4S2 x0  048<80 0400020U 0E8  R:0B0Q 8\ 4@ ,0@0!@ x PrH 0,8<@D < 2B!?04 H @D0H00cQD80 4Qt0LP 3R3 H0 x0l3H tR880l0P0P R*l0 4p0S4 C@`\ d0Sd @0RX OP|0@@,P0 R0 Z P ;>A<9ꄩ,偩0,0 |Q-P00B PPP< P ` PP$00100P0010h0 0ԡL P |04 "!;42 >PP,0\H@ MP 0|0,40,0 y$ MP MP MP{/0  4 8<0@C;P@V0  x0H0 ?"!0 #L,4$ 8<@0H&%0@ 4| 0 04,0pMhFpFDxF00 -@L p#P`0 A|`PQ `c<n;k$0 :$0! -LM0K"@P0   p-LM@d0P0d ` L0 0T T T0Z 0,0T` FQZ BQMB| >Q D iLp p-LM80@SP0 0<l0S 0\S -`V p 0F0S0  -LMQ`0(  $0 ,` h0@Sph, K 0S8TL  0P$  $m9G+F -LM0@ 0KP0 00  0000   0-@P L@P00 4 0 0 -LM0 ,0 @pt0 `S$ x0RP#Q*0 k K &L\ KhPPC00 K0 !P0 PK  DP @P 0  < 0 0/&00  K0PP0  0  ,0 S , 3x3LKN KO0KJK00FKH KP0[ 0P0K 8pMFMF -LM 0@2ǽM p-L M@0@Sp=PP `KB0 000 0  0 00lj i0f00n`00rp Yh0 0h0 -LM 0hh0`0  0 $  10 !   04m -L M00PKp00 000 0 00000h t` Px0s@h0($200 h0 0 !1@00#!  "  000 ` 000 0PH` x0 @0S00 (8 Dh0@ 8D000Ld $ 0x0\ 00@ 800(0 /i 80*x0S1\X `H@0L aP` 1 E,$P`J lj i00r0n0j0rp |h0 0h0Zm -LMP@0S` p0s 0s0s$0sH0sL0L s0s@0s 0s0s80St 0ql  0xP(0s] 0 0R xP \00 ?P 00 (0s (n000s 0rp 0h0 0 h0 p 00 Q GPh0h000h00 00Dp 00 Q 1PDh0h0 0 0h00 00hc00s0s -LDM@P 0ST 0`|  X 0STh0ܥ0D0 TXx0 R0S*X X M00KP@\0T0d L0 x0L lQ!0`Q!H DQtp`0pX  cPO@KT0 00R: X`  b@O8@Kd0 P@*00T@08d0@ HP0bSP1TL H @8T0SUD0SPT0$  T000,0ST Xx0 pNXʶW`  bN@Kd0d 8KP 4K0T0 K0P@00K8@K40@ţ@ -LDMP@  < @80D@ 0P S8 0`H`  S8p<00T0  D< x0 @T T@0S `0Kq:070A4 p0.0 c+0\ 0@$0  g\ 000S 08< 4 Ud Kd0S 0 0\0S0 āUh Kh0 \P*U 0 P: cR 0P*0 F;0\*W \*0 RUhl K9l000| 0 RUTp Kjp0v w0P:UC 0 P: cR 0P:0 } { `0Kw `0Kqs0àpǠn0<àk<ǠigpelcaP07*0qZU 0 P: cR 0P* 00A S@-@**\ *!00S К+К+P+P+h+؛+++00@S S ST!0S * R:!0R0SS `S0SS 0@S S S 0SP`S PSpS S0  P P P00S*00S:00*S:0P @PlHI - @LM . h/J+ -LML Q@0P80 (( 0 R1S 2 R s 0R0!R0q50S 0S 0R+刑\ 000R00R00 A  `!7P:$1  1A` `7P$0`@00@s0Q!R0 1!010AA8A Q Ro髣 S; @ L; 90\0 #HIHIHIHIDXHHIMкF -LM@1SA(P:Y0Z0J0@(@`  np(@6000 (;0Y%X00` q l0R0 000  0@AV@ @@ p `F0V HI<+ p-P0LM`%QU ?@ ϛ0@1ph4pHI 0-L.,0P@T @T0h M -L`pQH6H0PU ,0SPUh@ADM p-0LM0`PS@ 00P  `0S 0 0`0S  0 0`PP $ 0`S00@ ph "HI$MMF 0-<1@ LRP$1$!0 @@ 00 @ P06 0@ P0 ,  0@P$# X0S@ 0@T X0S @TX @0P0h:T 00 @P "HIM$MF p-LMP`5";52 0"2`0$ X0S @0SL0S X0SNzL11S}CФ  R0 10  0 PA A R0000 0 0SI 5 P 0S0C 0= PQ Q0% 0S0C 0% %01t q$n0@T 0 R 01DQ@T㽡phɁꞖ꜖< R@0@ l0@0 < @0 xrmcF] +\+d+l+PIMH*OMHIM,M -PLQp` 1@`T0SV@0@S0 0C0` i000 p-LMK`L@T 0S PU  pP  p-LM@*P`% PP 0S 5IP@p3@--ppp -0LSp` 00C S `0gS0S0 C RV> PgU; 0S8 U0S6 0@T ;80S  @Tw8PT UP\ x 1`?Bc00L` S g0 U R0PC\XP0S HIgfff, ,00S0 000HIM Q00 00C0M -LM܀`0 V$0  % P"0 @PPPTU 4pK3 9 +P`PU@00T00S$0 S $pMMHIF -LM0@S  MP, F 00ahBH+IQ 00 p-0LM`PV @T 0  R @T`Vp 3P 5 0S 0 S 3PpM p-0LM`PV 5 @T 0 R @T`Vp0S `3PpM -LMX- 0pW @T 0S @TpW PU 0`\ *0 0#\:Z ᇊP  P 00 P$0  Q 0 MHIHIHIH0Q P 0 RPQM -pL W`4 @T 0S @T XR 5 2P Q 2P0PP*0 0#P:P P-L`Pp @@T Q P P@ 00 0@ 0S0C 0 @@\ $0\   <+ 0-5P0L5Ḇ @T e@T1Q 0 S01 10C1]gL0S@0S0hU዁ , -LM5@05L0S @0S5hi -LM@( h 0-@PTL @gT00000 p-LM`~p0P@T %5R0C @T~80ph(50S MI 0-@0L@PT (P2P @T00M -LtM8P4U, `@ 8U 8U 80SP7U ,0 S ,Pp 7%U wx7U l7U `7Ud X7UW \R D7@U3 <47U/ ,7,7T+ 0p  70S `+h+`+h+h+`+h+h+`+01 0,✅5 }@}0S0S0ƕ00ƕ P6ULV D6U@V<6U8V 46U0V-%P0`0 xPr%   %q< 00\5   }@}}@|} 450SfP;0S  }P+$5ATQ PUN 0SK0HX0S ;S S@r 4 4R U}5L@K05 P3K5 053K>} @T6 0S 0S @T*O#S SS@l3UN 4`3U X3UjPPK0K@ }*P@@ /@ 6\@PP0S  \0S 2U2 UO4P P "Py b1U1U.*1U 1U! 1U!1U1D X'!`001U 1U 1Um@K@ 50K@ * \0P1U H1UZ,1U  1U4& 1U.X Pe0pMi$ii$zi FFixIi i i i i i i i ?i "i i !i i #i i %i qϖHIi$i i i$Fi@Hi Gi i Jii i 5i i$~i i 6i(KiŠi$xi i$ -L,M0"P P0U,0  # 2 X 0S P @Y0 0 SPB@ PTXP0P1 ,0S ,pP0pt1XU3(LK 3 0SD U@#<1`Y <K3 0 Sc<K$ PULK 'Z 00pZ@ PETUXUP0 0eP  0 &]3LK & pU30LK 3K<K.LK &P PE p pMMi(F -LM@Q 0 S01 10C1c p-LM@ ,h`PP 0 40``0` $0$`(0P0p$M -0LSpQ`V "/PG `V  7P`6  0P4 1PU /P( $PUPP 0@00P@00 P@  0`P U@20P/S:20P9S$M p-LM@PT` .P @TpT  R0000 0 P 0S P00CS00$ R( (00(0  $(0@FCRpP R000 0 0 2 $M -LMȀ 0R$0 0@T 00@T$0 S |$@`TP 4pKV`F- 3 %PP@TpM0F -1LM@ T$ P (.P $@T$0 S $T  R0 @T 00@T@`TP 4pKV`F_- (:3 S%PP@T$MpM <5R: R1 00C B 0 !  80S$00c  _PU 1000 w. S0 0C 0 0e0e$0C0Cbna m_504 ' K4 @`v0pS! vcv 0@R 000SP0P0P0mv000^0S000 0@@0 ~v<3  $3 @`ov0pS hvc000 0@@0 _v2WU L";Gc0CSH1 C  80S$00c3  ^PUk 1LB000 - 8!4Ÿ42W ` `1 @p%v0S vx000 0@@0 v S 0 @0 00e0e$0C0C\1 $ D1 @`u0pS u4aI000 0@@0 u5"mr E)P m] ePP `q}P @T ^P`X0S HU]`=HI5(WO$WOPIM݆cIIH*O@-@@:@0\#" 00  @Z00,/JHI 0-r/0L@P0S0 Y 0X \ZP@Y 0r -01<0 0hS00@0  8000E  /s?N.0P+ -LM!@R \0700!R\@-@ *,  0!\ "0! ":D@-^p`*#!^ ",!1 #: 0D D 0-0LSP@/ S /0 , ,0S0S 0S0S0S 3000  00 00l r,d0ST j,L 0^ 0 000  0 HIHIHIHI -LM@pt@,`K4K P@I,0[ 40[A tT  '0S  @'PP0 00t7 iP@  , ,00 p1 0S!00.A 101^t4 Zt7 Vt -LM@Mt@,`K4pK 9P@A.T % '0S  @'PP00CS0 't R0700 10C1t4tt -LM5@P20SXl 0 00l S\( h1  p &K+^(`K0 '0K( K Q {Q X 0"Ġ Ƞ̌,( ,ȠA1Z "48<#( R 3R0003  G}3 `ps0S. s넣50#0Z``Vs 0R `0SP0P0P0s000sX0S |( 000 0``0 msXj 0#Ġ Ƞ̌0,Ƞ( Q^1v0#$(,P2"(Rk V!R0 82R% 2 S X000A "Ġ Ƞ̌0,Ƞ( 2020 Ƞ,Ƞ pZ2S% " 2 SuP1  |81 `p s0S s002_000 0``0 r0R 0R2S@2SX 0( #Ġ Ƞ̌0`p}] |0 0|00K002ꬻFػF5(WO$WOMF4F!!tFD##pDF -L MP@`rp0Kǭ002 =Zr2 S P 1 !1  80S $00c  $[@T 100010 0 00 P!` 2!l S2 ` 1  80S $00cs  Z@T] 10000`Y`Q 1- 0R!0S@0@0@0X t00t0.r5  2 0  "r 10 1vZX7!1R1S@1@0A1X 10 1[Z7 $15t00t0q7( \S 0 B0 0  0d0d$0C0C/Zt00t0q/SA 0 B0 0@  0d0d$0C0C \ 0S/ Q 0S! !1RQ 0^ 0#$(,"(00Q 0#$(,"(00Qr @YqT1001( \ @05uq0pqpFHIpD p-LM`P ^! 0 @ 0PX002 / Cl vph]*00)/J,5,/JpD+I p-x LM0`S S10 ~/1S0S %NPBPU@Z+ph<:/J/J -LM1@Q 0 S01 10C1SYrh , 0-@Lp1PS1S1SPPp0 p-LM@pQ`U 0 S11 10C1pp P1 QU 0 S11 10C181S1  PU 0S0! 10C1(P p-LMPpA`T pp2S 1 AT81S 1@ (@ -L`@P\p1TpC1T*1T 81T pIp\%A0J@SSPP T:5J 0 1 T00S 5!@050Z 5@0500T0T 0T 0T R2R\ p p@0T 80T\002i 1i i i pDi i@9i i :i ~i p-L$M5\P`Vp( 0KpV@T0,$,!$#,R =:R V (tp? <4<("4!<P 2 50!A0@S00V ( p@0S0  xp(?5  ha K 0K R  0( <4H 0C!SЂS220U00S 0S0 8<"4 Q V VphVT0H 4( (HGx2FpF|FpDTFUFF -5LA0@SPT pq@!0@IT2@1B 02 @!0@1T2S @`2` !0 @T3S2S h@!0@T5 ( HIlF 0-L2P @`2Hp` !0 @T 1HI -0LM@2r 3S -0LM@2b 3S p-LMhaR0 @0  QK ?!Ġ!,!0,0K* K)K(K'K+K,K ,K00  2#40-.00 ?0  Q00!$Q 00"  Ƞ0",Ƞ @PD 0S (upnRpM#!F-< 1 QHI -LM2@S0S0pD0D222 2DD 0-LMK0 K@P 0SLU( <0)00S2"0 2"DF -LM@ P2h2DD -LPBM4P 5P0  `lP4Ppo V4 00R080 @0SSV0S V  0p0PcU@XV, K 0V4 8@RP0S V0SO   0p0PcU@0SX'2", ,["Ġ"0"(V0 0L0Ƞ,Ƞ  F XX V V 0 04  Ƞ,Ƞ8 0 8<4, P 0P0R00S V202 HV P 0, "<0"[ ,0#40, [ zr( (crYV00Ƞ,Ƞ  eb8U R; Vt0 `S$ ( < !FTFFFFF̒F,FHGFFFUFHF -5Lp`@PBU@0SS W0S2020PcU@W0ha( HGUF`F -LM5p`@PBCU@ 0S S V10S 0PcU@ViUR0"8<4 V " 2 V P< ( ( iHGtFFUFF202202 p-LM`2 P ,K@ 0”P0„ (Kl 0S T-p, ,["Ġ"0"((0K&K% K$K#KP'KpM-!F -LM&p0%W,0 PU6 ,0S p,( 0X0#$(,"(0AWpSv,!,$,@%,`Y0f0S0 00 MJU-@KFn_ SnO Ln,|>,>,>,>,>,>,>,>,>,PLHD@<840,(FFFFFFF$F0FPF p-LM0 PP `@u  0#U TpT0000 0  _@ 0S 1 \1SII 0 0MJI p-LM`P 㚲P@ 03 0 (PQJ? \00%X0 0 02 0!1@  0oWLL0 R <000@sW0p ~Fa,S,0M p-LMP@a0V]W@0@ Q00,0 RWܳ0p -qLW` 00$  !$0011x3W"@ !P 01101!p1p$00!011p! pWQ# W"PA$W$0S 0!1 01;00!(p,p1<0!8 Q $0S 505MMMF -(1L@/PPh0S; 0PU aV 0PU|P, PA0d0Vp0B>p0V*VL 0pRbbV"`0H@0S029 9PP V7pM0M Q -LMP*@`Th` Vp_a`>2HSaaaaipVz9"O90Q010Xt@ p-LM PR@z!Rs p00 i 5   0S^ EV `Q 1H R9 ;V1-!1R%1SP1P0Q1PU 10 1"Vt00t0pV ܐH0S 2 Vp=j>7P $P KĐ-  0a( 00aS$0  @=9 =( $0 (0S202D>4p@>Ap<>2p(5>0/00pF -x$LQM0؀,0 0h1 H R X L00b<$SUq@W 0S1100!0 B0!0UW 3 R PUoKh! @ 7 Ph1U0h1 `@ 0S |S0S JH0SH WG  $P@T*T*0Su Ss T:TeT* d9P  P\9PS0T00:YU!2P 10C1> 8P<0<0< 8! 0 10 @L;UTp 09P0p 0 0p f C: "9x00x0] (0S $0, $4壱$nE ":`` 9P000@D0H00 8qYOK00 h1 0\5 U 0/v000L0 ,0S ,B81S1  pW 0S0! 10C1(p H 4RpMQ MMMF -LM`qT@P R@! 101!1$00!011! T1Sq, yTPAf$pT!$0S 0!1 01;00!(,1<0!8 !1@ 00$  !` <qMMM -`%LM`@0P``@eP0U(0 p0 0  101 (0S (|0%0|0  \02 020LS $^,],],],],],],],],],],],],],],],],],],],],],],],],],],Pa,\a,],1S1!R40315!5:101l00l01$  !!1011@`Tژ3 R0@\ p\O005 8#?0p\00S 'T? wP@ڴ5:5P@ 2 R) 1w  80S $00cg  /<@T 108K0000 ! }S\2 htS>h0 0h0/jSr 0R)000S@0 0 @0@ \1 @pNS0S GSESf000 0@@0 =S000l 0 00l ;0SS 0 B0 0  0`0`$0C0C? vP@j.8K B011S2Sl d2 0R022 0R20S2022SWMpMFuM M(WO$WO -PL@p`R 1T0T*0T 0T  R0 R /0 R505W 0S0T@0|00  h00p $20(" ,200" 42 08"$ <2(0@", 2i 1i i i {i@ 0 4MJI -LM`P jPp@ 03 0 (`a^0 0% \00X0 0 0 $<@Zp0 :LRD /0S2"@BR0 ~FHIlm,do,|,4M p-LM@PaV0 ,R"R222 $R㮮0p 0- L@T 1S, BT@T 1S BT0T P~? QQ,` Pzs0/p2<0LRP"xRR ""00104MuM 0-@L5 A05!!Q 0 S22 20C2$:Q 0 S22 20C 2:0Q 0 S0242 820C82:LQ 0L2:LQHPNPPxRRPP0RRRRR90H2 -L,Mhh5@T, `PA =D5T6 85T 05T ,0 S , 20㦸P40p1 4T 4T14T>Q$20c0"b4Q1~? l4Tdd4T0*\4T T4TsPp`Q1B@PL @ Q!3001VPp#]>@ 0CS~?0 S+Qx3TOOPP0PU p ˫  Pp `n P Vd2T$ 22T\0!S2Tp20_ PpO p2RU P0Pp2 R &gPp6 Z #LK CPp-K[\B0S L [0S 0S1 0 J[L [($0pS# oPPxP0LKt2 Px17p[P1:1UP4(t2KPPP0LK|2 P17p7P1:(|2 |Pp2S  PPqzpMQtSt@Nt f@FZt@Vt@Jt@uMGtFtRtYt Mt KtLtJIFF(F -PL@`pO1T!1T*1T 1T  O0 R /T1T5@05V 0S$1T. 1T0\01TP8O2S 00" 00"0 0"0$0"0(0"0,0" 000"$040@8xPP ,|24t22i 1i i i i ziHi {iH -LM`p1@SP 5@ 0S1:1\ \0,  p1:!1Y YP 1  80S $00c  7P@7P 0 0,0J$ T   0 R1 00PzPp2 "0,  lPcOYX 1 11 1.# 0R0S000S@0@0@0p 0 0 0p N000J77P Nt h2 0h2t !1R1PS@1@0A1U 1U0 1 %77P $PP2 @ PB  0(P 0 !PP}7(MkS0B0QF  0d0d$0C0C2P( 07/P 0,  #uMDFF 0-@LLP_( 0 $!Rp20Ss,u,u,u,00!00 1 1# 0R 0S000 PPR00006t0h"0 t0h"!1R1S101P 1P0 1 67 $00x6P -L@N121 "p W`0 @PN0`S MhM000 0@@0 M(WO$WO -LM0R@U 0 S0242 820C82d20d2p 0d!Vc 2V[ "x2VV& xQ#  ! 0U(0   0 P0\0t”000(K (P5 11 6(Pp`00X00S 0V0Z00S 1V 0 0 B0 0 V00S Q0 0  0 0C 05  "R 0SP  0S10#0'opP/` Pp00-``|81S1 PU 0S0! 10C1U[(P! p-LM"M0`PU 11S02S M121 M2SRUphMMBT 0 S22 20C2LT 2S4M -L M 0pS0ࠁQ  @PU0 dQ 1  0@q00CSz,z,Tz,Tz,z,z,Tz,Tz,Tz,Tz,Tz,Tz,Tz,Tz,{,1 L1=1iLV00 @R00S 00VXx^ 1t— F P L1:^ ~?1|B F$P kL1:91 XxP   t2P   |2(OL19PF -LMx2@S 2S|2 "t2 x" -`LP@+LT191002SP"R R"0p20U`0 @PL0`S  LhL000 0@@0 K(WO$WO -L$MX2!0 X2p,  QP 0PU(P ]` 0< D  @ <T  P 1 8T XP 0PU1  2SK1;1K-T /T Z1)p0< PP<8 "0<lPr!TPOP< K 0R000S000yKh0| 0 Uh0| 000hK1000 R 3l \2 0\2l ( 5 p2S 30 Ɵ 0CA 0000T6 @`2K0S +KFP00 0@@0 "K  0P| x0 Po K`PP 1 01$0  1 JUG 0 4H3 =1 —\ 4@K0KA Jp0@vnP!@@ƥ#1n ((zj1 g—\d A0K J04@K@ZnP8 J @PP 4!$ ! JU; 400S1 1 01 `<!@ 00 04  @400 08 1  lB Z  80SK PG    00 0ZJL#` 10C1- 8P<0<0< 8 0 10 00;J4080` (0S $0, $4嵦$:$00 0 0bP 00c< J @$J$P 1+ 010 ,(00pMKIjG$F -0L -<1LMp`グP@ (Ih0S5 4PP, 1S& r@? *@BC020""1 0!1BaB5@05 d P-HHPU 1SHpMl,,,p, p-LM@H` P0Uh0 01T Hp 0-@LH2PS2S 1r 0hH1;1102102 -LMP@Up`" H0#N0$*0~ #`0,0 (0S (lpM8MIjG8F0 00 ,00 < 0 4($ ' -LM@,0 P :P$0$0S"!B#1C$0  '<0Q,0:$Q(0PP#( -LM@ @ <00H  D0 08  4 00$ S"$!405R  0-@L@P0@0 -QLM@0S 0S2S` 0FSꬣ,,,,P,\,h,T,0,0 1Pp6 CVPP PTL@,00 ` BP@L۞ 000)#]Fψ -LM@LPh鿞꾞  R-L0S 0S2S 0S0S LQ,  B0RL R 10C R 0 S00 0 0T -LM@@  -LMP @ @ -L4M4  , X ,00 0 ,80 ,< ! JR  @ D H 00 AH@ `\P :! !HA0 V`@ H0 0, 0Ss0 0 0c@  80S^ T X00 0 0  ,0#40  , 0\ 004X 0BX T0 BXX 80,\*P0 1X Pp P< RHL *P0S ,UPU, Pa 1Pp < R*P0L SD@H a D H \0T0\0  H,<0 T**D H0 4RD H0 ,<0P*@010CP"@ % %<, ,1X !5 S95<   < PL00, P00c 0@@P 101 0 @`V@ \0aS 1@ 00c  80S $00 0a@ @$@$ R 1 0+10 ,(<`8`4\4  XX TT :D@H a D H \0T0\0  H,<0 T*D H0 4RD H0 ,\$ T 0D ,0\ 00$ $0,P D@ Hb<D H \T\  H!<0 T*D H0 4RD H0 D \ \T\  H L02#<0 T>*V0 0c 0 @ 02<0C\:,0\ 0502 05,\@0< T@,0 T@0< 0P ,0T4 80, 0804 n(0 00,\H0D 0 0H0D 00c 0?@P 101 0 ?`V@ \P0aS P@?@d$?$ R 1 0+10 ,P(P<`8`00c 0?@P 101 0 ?`V@H \P0aS P1@ 00c:  80S 3$00 0a-?@s$}?$ R 1 0+10 ,P(P<`8`00c 0k?@YP 101 0 S?`V@ \P0aS P1@ 00c  80S $00 0a3?@!$+?$ R 1 0+10 ,P(P<`8`$00 0a?H@`$?$ R, } 1 0+10 H<`(,8`,0 oMMM -LM, @ t0 !0G S4 < Y40 0 40 , 08 CY8 8 `0 '1P R@*P0S QPP Ql 1P R1*P0SpY,, P 4<8$0 1 $0 40814 8<@0C X4 8<@:0X 0502 050<4 X< *020CX "14 %X % !5S95L 000p -LLM0 , P  8 p 0 `CT 00  aX0 4 < pV0Q$`Fھ0R 0S 0L`002>@@ PL  L, !1L01 $   >LQ L P P0 > @P$>P$ \ 1+ 010 ,(<8P0 P   80Sq ` T 0 X 0@@0 \` H V3PU `\p\ L 00c 0\@$ 0 0$ 0P 0S\H D<@0 @ 0 @0DH <,P 0U4 0 B4 0<\0 `F:8 4000 QD 0 40 D0P0PH Q00 P00SD @ R0h0 h0 HDL0 hd  Pl @ `l Q` PJd0Z@1%!R00a尥ZhA\H P9 0Y6*0  !p P0 S *P Pl 1P R:1X !5 S95p 崐 H0L8 0<0CY0:0Y2 l28 5 5< 5DH 9L00c 0=@P  101!  t <t\1 L  t <@<t0$0t <t$Q 1+ 0100 ,0(0<81  80 S la` ` RL @]P!%00 0l0b0a`0  0l 0c0` 0 0 P 1   B0^ 0 0 0b 0 0Sڃ=LHPG-@TpPpP1^`ᶀ&^@\ ^ !000 \ \ !000000T p \pP QpP ^  Ų000t G-M 0Q  ZP C 1Z00\1 ZAl~dep@0dQ.ڰ010   !0 0c^ B Z^  Q  00 S 0Ѝ 4 010\~ \" 1. HD0nPk40($000 "$ 0 0c\à3 B J3c@0d^@ڰ3 3. 0 "$ 0 0c\à B DQ8ßJ0 10 #0#40 0bP B2 yŸ J010q2 2. Ÿ0   ZKl2Tb@0d^:@P2 02. 0 "$ 0 0c\à B  QJ0 10 !0#40 0bP Bl J01Td1 D1. D1$a@0d^:(1 1. 0 "$ 0 0c\à B  Qژ J0 10 p 0#40 0bP BV< J01Z$<0 0. t -LM@+, +&(uD01>0 R@P 0000D -LMR@ \`pڈ,A0 B<0(0#40"(0aR# A  R PtF000 0#40 0bP B Q \PڤG0<0 0#40 !0bQ B PU"<0a0 P$0 1>0 0 0"$ 0`\à @PU I& o0 1>0 ` G0<0@0F   00 "$ 0 0c\à B 3 0S:3s`P0fU\ß+050 0 "$ 0 0c^ B  3 #Ѝ+0 50 0 . 2嬢` 1+ 0nPڰ0000 "$ 0 0c\à B <2^ ,2  nPPaoڸ0000 "$ 0  0cP B pGW113<`ӗ`Ӆ!0tQ0nP?ڱ0000 "$ 0 0c\à B  1^V P1 nPpaڸ0000 "$ 0  0cP B 60 0 000   0 0 00   v6J`D7J4JD8J- 8Q Z y8Q ,8Q .\000 0A Q 0@-@0SP Sp 0 0"$0C0 00 0"$ PP0x00t S00 "$0 04 4000S 0 0 -L@`Pp0 T  0 &Ġ`00  0"$ `Fv 0 `Fv00 -PLM0 @\ K @@@ 0S0000 0-PLM@ \ $PU 0 KS(  000$P P-LP`+ (  P pp0V p 0`f 00FS0 `@P 0&SP 0- P-L@p 0S `P 0S-,---d---T - -Q 0 0A ^ 0` 2 0P0 #20S 200Q  0A  00` t2l"c0#22cP` D200  9Ws |k \_   0 S00000SL  0C00< 0 00Q: 0 A0 0 80 PQ) 0 A0 0 40 00Q 0 A0 0 00 R ` 0h00W  00000` 0000S0S 0,FHF\FBtFF 0S p-PLM`  Rp0S00 00\/ @Q Q0#S Ra\00Q00S0 d0Q0 @PW 0@P0ppSp 0-80@S<0L0 P0BSR 8P0(U 00 0$040<  (! $ -LMPp(@  P@  ( `P0@ <(` ,0080 ($ -LDM`4T 00L PP ,0%T%0`0$p PC2a \ q8 -(---0------U XU 0uPUP H@0 0R - -`-t-PE@0qPd7t00K4 K80K,KL,04 80~P   0qPE0 $p PL0 0c P  T 4 LP j07sPE) 0qPE0L $p P$p PL 0 0c L0 T4$p PL L0 0c 0P0  T4LP 8U X& 0uPUP H 8"(#8RR00Pp 00L( $p P0 0c 0P0  $p PL0 0c  T4XO Y, TP> Y @ T@! T @! T0 0dP 0ST00dT0 d0S00CT 4 P LP 40T0 0TS, %T%, 50c0C2l P Yh(0Q ST0 T%0c0C2a 00(S QT T%0a0C2a $p PL0 0c  T41 U X 0uP UP HI $IR@2P0L@TL0@(  P x 0 @0 'wPE#50Y*U XO 0uPUP H  !0#50\qPE: Y p0 S000L0  ,P0@0(" 00<0YX@ '*@U *X 0uPUP H:ğ 10!@P 0 Pd7t  @" 00<0QX@ :L@0@K0 HK@  LDK<0K < P@tL<@D H0P@W L (!L0 $D0H  @0 $p PL0 0c  T4P LPP O LLL4 T 00P R,0%T%0b0C2a 0LS$p P U0PEJ0T 4 P LP 40T0 00T S500$p PLLHjLDg$p PL0 0c P  p $p PL0 0c P@ dL (! L0$P@ P U *X8 0uPUP H:7tPd\!X@ " 00< 0RPl7| Y00PQ P  1 ^  00 L0 $p PL$p PL0 0c  pP L (L0 !$ 00$p PL L0 0c 0P0 0 FFDNIDFF 0-P@L,0  C(($(@ $0 -L M0 40`Rp<0S7,0b$0,0 0XP00  80Y @1@!S   0P00,00PU(Pde0PX,0$000 00 0c  4P<<0 S00  -WMLMh , h d ` \ X T P L H D @ < 8 4 0 l% p5 =K hUp h@K1hK0PU1h0hS0@5 B hK1S@T|E Q1 Ph K1SPU5xU S0!5 004T5 *hK1@^ JT:hK1% R% JEUK0LhK1 L@PU `E dpK 0PU@@QKA ApP @T! E0Q00hPU:|x%PPdU P ubU |Eh0K10Cst5 E| ^\t x%| j% 0@j$ P !R  t|0a CTh0K  *@T*0 R c@T:`(  0 P ` 0 0Y0K !   <$%  `5B%05 Q=K  E| ^ʘ%|hE1hW <$?0#0#% 5 % *l%QL*QE` 0 %  p5H0T *K1@T:|%0BC P%@8P%0C !0S %EbI80C !0StN~t P|xP| Cx%E0R0T00S lE0np!P  % 15 Y PP 0-LM@P 0 P @xp p 000000F $p2T h2T 1081S 1P0(1T 1T0Sv/v/00<<00Sv/v/0000\00X 50d00d1T7 %X1T P1TD1. AR \ X 0$!< 005 d `01 01 00T 0Tv?  r  v?   r00S S%P005 5, 05q]t\t @f@wt@}f~f i vt[t ? i !i - 8LM8#PP` vO 0S@00p00S @"0@ȚP`00S81S1 @T 0S0! 10C1T0  s@00" 0堚P`cT T: V00Q00S. 0S1QI!p 10C1: 8P<0<0< 8 0 10 4@T V00Q00STVl00l0 (0S $0, $4w$д  7`fb#(@z㱳@FMMM - 8LM8#` Pp9 0S v? \0 00Q(/@PP  !1 01$0  1 U} 0@S0(K0*v/0 0@D000S,0, p<Pyv?  l, 00, 00C 0, 00C0<4<("4!QU Q|CNP 0R5,0   HßR,0,0000, 0 050^#3 @P0`S h0|0h0,0  |000 @@ 000x00x0,0S 7&,/4B,  h00h0, qS1!  DPP0SX0Se,Pl00l0^@XLPP H1 !! !岁IU! 0@SB@0$:$ R 1 0+10 (,5L 5Up5UE*4U2 44U+ $4U64|P`7⬖PP P @0S) S'Z$ 0P@S ZZ K XT4U1013g|P` ₖPP P@0S SZ 0PS ZZ 00CS !0    !  P`!0X3U %L3U D3U2%|P`@PP P@0S S!"P 0PH2U0 (2UiTXi8BiT 0-P@LBT 0S @T0 R000  rp0@00 -LM@P`@Qp 0S Q  00S0S 0S0S0S0S  0 R W 0p -L MB! T, p 0  @ T2@T @ T0S`h T pnPP`` BT* 01cT0SS!(  ({ 0 0 P0$0 IT ㋾P0 `50T0C0@TT1@T( 01cTx0(SS `P (K 0< 0 P0T $0]P0 T0T0C0@T`U o 01c100`~%0D&0 ,0( $0800 ,01 00,0 4 , ,0L0#P , 3@0 R 00 00 0 0 00S 0@0 00  00 0} -3L|M 0, `FpP  @0S S 2 ,0S ,-RU 0S PUU @T @ T@T @ T 0S} @P8 1j1jKn 0mS1 ( K0 b (K0|0K zK{K  tK0n0KnKPV$n KPpA 0n0C 0@T@Q@ 1j1jKn 0mS( K 'c (K^0|0K zK{K  tK0n0KnKP$n KcPp 0n0C 0@T!  0j1j0 0Z] ]pMF -LM5@@@ %yQ 0 hI -LM@5y@#5@05 -LM@pW@ 0 SP@ P5@` P` 0z 0 ,0 HP O  0, RU `5@PU,0SVQ  0 R 1  1 !1R 10 1t  t 0S0,0    0lP 0dP 0 S  0S1 Y  0 R t00t0  25@  L ʚ; 0-0LPU 0SQU00@T 0 S01 10C1"T 0ST"#7P0:D DR ! R00^00SP P0Mb -LM0S2@#0S 00 p-LMX0PS! @@\`Q 0QphN0SQ PU @T p p-LMP`U@ 5 [ R 0  R0000S pph0S ph00 -0LM@0Ph -PL0p%@ht`]P @T @T@@T! hJ`H8FXD@BP,H>P$P:P06P.0S0C0@T0%@L0\婁XPF&I00000000000 -0L S  Q0Óĕp1V 41:`1V4#404궅ᰁP P Y @<T@4 P00P@hxX @T|{ P  @0U  P 0S PP 0 Z@A ꬖZiRiPiQiSiYiPiTiTUiT RiSi -80 L l$0 R  hx 吙HMDMOIF -LMP`  FTpP@ 0 0l (`q@9X0P0P 0L0 0|vᬃ0x Z0X 0 ~FHI- -P+ 0-L@PՃvU001 -LM5p;aP581S1 @T 0S0! 10C1T 5A0AS ! !t00t0P<P0 1P016  000! 0001$!1R1S@1@0A1P 10 1t  t 5p = @Sp  $4K 02[D!2K02Ky?068#8#$0$"KF1$  80S $00c  ,@Tt00t0r 1000 0S 0 B0 0  0d0d$0C0C Wov5;5(@Z㱑 -LM 0`SpPE "48<#8 ! 1 AT P 1U AT0PT 5A0AS @ 0 0C A 0 <Ph00h0 ᓀ 0)oP`l00l0HMDM -LMX0(Sp`"g1Sb\0\0S 5 w<05X0d 0X1Xd  1@PPP e0r@@ ^0㳀00!@R! 00{/!00a 0 11 0| 'kp 0$!kO\ (0 B(\ 08+HIHMDMh--F -@LQ`U$ s!pR111 QQc0` 1\0\ 1 ``優rၪ$j jHI[0[Sd0[d0mx -LM5@ 1 }P1011 }P10 -LMh0`$0 \3\p@ P` 8<3\0 03\ P$0 S $i~1S 505 0S R2\ 2\1S P1S 1S l2\V '`2\ X2\^PP8K nPP"[Ry? P 0\0\CQ-Q\ţʡ1\ 1\8@KͩQy?` bK( 㞯8@K㹩1S (00!k,1`bKr o]PPi8pK PPa80[S_`5@05TQ0w5wPPG "[ CKPP?5@059pM9i pMi i F1i 2i !i i i :i i H -`LMpءl4PP C QP@ P8 0PK8K  100S rP  0  gP  ☭1hS@0z?0 A PP R000 lRᅁ1i -L0M,PK4`Kp ء往P@A T  *0S  @!PQU 0S PUU N4P@T  P@  R000 RԀ2i -LFM⤠Q0NK`( (0 AT JK `  R000 QAT (0S (|pM2i F0S 0  0S -0S 0 00Sp@-0 PbUe Q@ * 0`R@ Q:Q*0SQ:?T00S eP*0SP:Tppp p-QLM`P@ 0 P @4PT P 0S P 0Sp0@- @0PS1!^d0 0S1\@ *0 0#@\:004IJ -LMPp0 S,P 0  0PP0S 0 0 ^0 R*0P  R: 0 0SP0 0S0SA^@PgU 0 9 0YPUPP`V 0 0Y`V,0U 0 Z 1!P@ 0 S @T 0ST  ]P XP @-0S<@ 00  @ 0 -pL` P@ 0\* 0S\:0000Q0\ f03 0@@ 0  P@@0P  0   P 0@@  -L MP@`0UPR` U0 V|Ք f` p@T0TS@DT0TS $P`U"0WP 2 AWkPP0DUpZZW ! 0|NPp8 |10@0ⷦ d1, K0X,0pS0@ T*0S! T 0 0P0P0P 00P Q 0`0^00 00 00LT@ T*0S |㺓O  ᥦPpgf 00 FȪaTM,IJ4OILM(OIF4IJ 0R P* 0R P: p-LM0P@S0` 0 T\ ,00 00 0P0`@pdpM@PM4F -LM0 @ pQ8 P`7p  0 0S0+p0  V W0p@00Y 1@00 04  P0S pPK@㮖 0 KL0  0R`0 0 S0S 0 SPnP 8&JP p0@S񟗎D . .h".h".`".`".`".h".0S K K0Pp R L $ l 800C800D <0500 KKP㔐p80080 00 0 00 D 6SA x | 00 <0S0  0 | @0x 50@0p0  p  % 0K0@P  =P@ ኚw?`K 04 00L$ 0 0:7p8P@K""0P0KP NK ۛd@ -p&0P /p  P@ 0 pP 0S P 80080Q 0 S00R0#S0Sl SKPp R|PixPa RUZ @ P P 0SD 0S0C 0= @ 00 0 < P20S 4 0 0 4 $L <050@0S 0S0SD0d@T bh 0L  L  0 L @Y K   K@4 P  aP'bP 0S0 xP0S Pvb 0 PEpw ^S\QS M P@  0 S:RP 00 |PP7 pMMpOI`OIPOI(FpM(F00 00 0-@PL(00  0 0 $ 0 p-0LM@`,PޔT*\0 T0#03 P00Sp@ 0B00R@@ 0@-L`SYp'.p'.(.(.pKPWP/U+ @ pp@ᣔ1P 0$ 0A0Q0  pw@ T0S0p0I@x7z$A$ R 1 0 +10 ,(P0005X05D 0⣖h00 *P000M -L$M@PPp 0AS^DK` 0`U80 D @ 0 < Q D0P0CS`2.`2.43.H3.@P0 VD K# V! @!T,P80K  X8  000hS0:  10 ?A1c0';P DKD0  W  pP-.gfff|M -LMX@ᣑP (00CP0 B9= 00 0 0 L p-qLMP`(@P =~=zU 2e1!00CQ0 B2e110 0 @0p -L,MLPD`  , @0 Q@@2U6 42UD?PD  }? /P 7P+05:5:1UD?PD 0S1 R0S 0F? R01!! P\fcT1U}? !_ <1UY<@K㹊 0;0K< K180 M0U\00H 0UC1S 1S10i '2T1X 0BT 0(S}: (X  ( ~PPq0X0(X 0$@( Tg 0S*c|1T_0S TP $PP@ Mz/0ze1:PP0S1S"U8Ԁ0 XP XAT XPX +P 5 TA X 1Ph( tPpMFi i i i 2i 1i i 5i i(i(pM6i(i i(DF -LMP`1^4P@ B -P@0 ,pK4K  ]100S 8P  0 -P Z2HB1 P@S^ 1i -L0M(PK0`Kp ]PA T  0S  @PRU 0S QUU ^4P P 52S12  Q1 0 1S11.(s2i F -LEM⸀B0TP$0 MK IoK ډ ^2S12  Q1 0 1S11.BT $0S $YpM2i F -LGM P0`OK(p ,0 変B T KK ᛉ  P 5T( AT40 ,0S $,QY0(0spMF0F -LMB`TpP ( g  P 50( $@T0(0_sF -`L@p81S01 'PU# 0S0! 10C1U <P1S pWp0t000p0t0៹ nH(Pj -LM @1SPt00t0 -LMX0@SP`p+@ TUl00l0DQ  R 1S P0  P@<Ph00h00 NH@ -0L%rjG1e  1E# = S000 0S000 0S000 "=" S000 >S0 00l.tPItF|F -LM@G H!qR1 11 vhX 0P 0P>@0C !p @#2  N=@0C40P ,0P(0PN=@ 0C! ̇ -?0LMe.S@ 0`?C0CQCD0T T(0(0 0 hocoFF P P111< 1N P PP1N  -LLMß0qP@ `,0 0 h tdKh hP,0S5UPUd0[pWTK8th R2b3c13d0<3 ,0S ,,TdK0  @T@p0d0[WctƖ 0  0 0  B0 ItGtƖDtƖAtƖ@2 1l0 07tƖ|rh _U 0pWp p00  t0 P@pp0Wl @ 0tƖ5,# d[t0Qd K0 R QQd K00 Ðh0 d K S 0h0 B0s 0sƖ 0sƖ 0sƖl B0sl0 0sƖl 0sƖl0 0sƖzpMFPD Q00S Q -LM$P8S ySp S p  Wp,0S7 B `<` ` ``VW < @R4p@TP1 R P4D7 S7D4S gV ,}. }.}. }.}.}. }.}. }.6<646<P` W@<\Ġ @Tyrpp iS Sppp 0-0 0 7PS007L@S~.T~.~..~.~. .~..<0 0XK000 00CS~.~.~.~.~.080000808070:00;0<0<0: -LM7@SC \ ǀ 0 S057A-_─pP0@T`t0 2 Q 0 0R<<0 Q@TpWPhD -,0LS1P` QY2/A Vy00S\ \g }pVT?>1 g.Q L00E\@Q0?>1 g. 1LQ 1?0@7\@Q $1g> 0@@T@@k50` 1g> 0@@T@00 0g.S L0100SFD$F 0-$7L P|000 R̠0S 000S20S@D00d0 `0Q00R0S>S "=" S R.̃.$...̃.T 1S1 RP 7S D0 1 SRD0 0000  p@-1 @^PT * ^0 0S0:W0 0CR  000 ^00S0 00p00d0bT00 R 0S00 000S00C0 ̫ -LM8@Sx&08 -L,0S,80,8'R808 0Q. 5 @X' X" Q<7@l5(!0(|i8P 1 0 4>QRXPXD80D8 X7Sꘓ..8..8.8..8.8.,0S ,80,8 7S #  ]P5  00@ 6 88088}  P<8p0<8p 8PoP@8p0@8d h0'0Rh0@ Wj <T00P00S o_O =609 0X#嵯Pt010<@t01T 1`!!1R1S@1@0A1P 1t 0 1t W000000 $ P` 9S @p y=~ P08008l$80$8,0SQ 7Sa <`# PY  PS ,0S< 7S <# P<7V 9S> 048048  P` 0 {P H8'0RH80X5 06 }P( g vP( ga0 X iP( Tg@ 80 8w㬰191 #fPIPPIFʚ;HI4FXFxFF -L$M 0pS ݰPp  @K} h3 QH  ば?0[@0 S X.. .<.<K g}6K c} 0V 0D0 D KZL K̒D@Tx`^PP 011$ 01  @@!@ @UZ 1:)01@-$0 0 `hV+D0S0    B0cc  0R `U 0L ZPLP ŭDpH0S 1@0C8#8#$0$ V@PD^$N$ R 1 01+00 (0,0 0 R!`80`86 P 7S d80d8 / @X  00 P A Pu 7SH 0 0S 6Q6  #y,@ @@)yDX0H ? 0#l0T0 7L@r@P@s804 @(7S PU00X00S 1S   7@60 t00 y 7S0Ss0P@S ,4 R 666P<7sH30#  3 R   66P 4@ >7S 90 1"0L P BT +7S\T80T8P \80\88@ U$ Uk0dS.ڈ8'0RA8 R <7Z^ 5 o K p(07c  0dS ڸ1S p8'0Rp8=0 8  ,@ 0@0dSڌ8'0RA8 R <7Z 5 K  7S 7ST8 4 0 *0S4@  BS0@ 00@T:4 R 4@0S0P 0 RR <60R0007azP*6 0@0S# <7Z , 4 80  P 0 P2S8@ a$H4GPFFFFXD -L M1PS@ pP`^  "Kyx"[9 S 5 ,K2[ (Twb9R 5 K[ 9(gbxX. 0Sx0|000  B @R0 001S5 006S6؆0܆6J( h:b5 J 4(+b5 J F,F`FFF -LM%@: 0S# $ 00DP PD -LM`4@Kp)0 , 80 w`XW@<#0# <0 yyPa T YP ,0 S ,G 8KP76 06  0W@T 8K P<hJ( Ha8K P00 < \4<#RJ( a<LJaGJa<AJ(@ a0 `a4J a8K ^P t t0T (@P@TP0PPlapWP@@ypMFF0FUFHFTFFF4GpHF -`LMPp @?w# ;w60 071wll0X0C4W B  $w`0R )TS  w353576r0b0s c t0 d0969696l0p0t:70x0rPx00x0<7Wx00x0d 0-@PL v #v0760 vB0 W0CXv535367b0r0c s d0t0696969l00p t00' 0 -:LM:, \@P` :\ :\ j:\: :\ `: ,0S ,cFx:C&P`@\ +xP6;67S 7S 6  <{# xP 4`6{;6 iv9&P`1p ȠDž \9g> 0  R! 1?0@77 7S7S<7@ l R09Q<79\ 9\ 0E`8%P`6@ 108%S84`|z8%P`t8 R 6j 6 ;g4`6d6 a ;<8\ B08\ (8\T7%P`N7!S F64`207%P`;7S8 52`4 & 06  7 S&  X'0o2cH'0=47\4 #(7\6_%P` 7S Pp x0  Pp`6\ 7S<7l7S@$6.%P`Pp <7P` 0S S S 00 0x5%P`60SKP Fp㜐Kp 0HS   0SAhP`ZpV0CZ) 11C R# r P6<6<M K6`@pG 0Sp@` 7uZZ0'RP W<4 @R\,4\ , 4\ 4\ 4\C6@3PQ><6#500#0053\ 3\.7S >1(q.  0d3\ &t3\ l3\ ?hPpK! o 7S y> P KP [OKt! *hk<607P0KP [2\U *2\6 00`8p00P0SZPp2&$`V70'gP` ,2\v`MPp 0|S:GK | g`V0|00Pp| 0S*Pp  0#P`PK! 7gP`P0[ SyN@ oP ['OKt 7S'R~ 6 { oc t`<#pMii iiiFpMlDi i ~ti8i i IFi|i|ii !i ii5i i 6i(i i i|i8i| -0h7 0LT'X7 0\'`7 0P'Q 0Pp'0 QXp@ @BAP`D  hn,]`0....PItDF -LMl'p7@Rl'p7RTPl70l7 0-LP@T 00l0ػ000ӻ0d 0@xT@ 6 0  <7l UhdA`iN @0<'00lP  -5L`@ 6 6 7r) mp003036  037Sr007{ }r(\tPF p-LM`lP1g> 0l@T@'0@@R l0S@7S,#6@ # @ 7@S 6 R @6 p{# sP @y7sP  # -L$M\5 `$  6@#<3( 4 \03vN @R6067PSs PpA 0@S \ S WTPW/  <\l200'R < R <7W R & 06 $0S $Ao=;7S6  7SVP &0S !0000o6;@$PWp 0 Rp|PP DpKl lA 0  FPPDK?> g. 0!LS2 0S2 \\ ?>1 g. 1LQ @p \pMHF FdFxFD7<'sX  7S0 -LM yP@ *l -LM0@S00 -LM@h 0-P@L q000 00-P@L p00O7 SvL' h7S07qL0h> p-LM`@<PUh80 h8p p-LM`@+PUh8 0h8 < ##p<7l l p 0-LMHP@0vN K@0 pK[ 0S l@0pMF p-LM7@SP 0 109H0 R 00@\ pph関VF op@-@^P 0S 0 0p`0^; S 0S1 0S  0 `\ 00S0  0Q   ^ 0S 0S0\@ 0^@@ @@@ ` ` 0 R 0S 0S 0\ ` 00 S0  0Q  0S0\@ 0^@@ @@p@-@`PR 0SN0RK \ ` RG R 0S 0S 0S  PP 0S 0R `S00 PS0  0^   0R 00 S00S0  0Q R0 0p0 `S00 S0  0Q  R@ R 0S7 R 0S R 0S0\ `S00 PS0  0^  0R 00 S00S0  0Q 0 `S00 S0  0Q -LM @Rp` 0S`V^ ` 0S``X  P0S P0S@@V^ ` 0S`` \RP 0SPP 0RPP^ 00S p-LM0@S`P @OP00S T0 0P PPP>pp 0-@LTP ,P@@T000S 0S0SQ  0PR 0P  R 0P P0 Q0P p-LMP7<ǐP@ S`` 0SF S p 0PQ Q 7S # mPP {mPS00S..0.0. 7SS# cmPPP00'R# 00'RPPV 0SpHI -LM@PAAP`p Q2Q oP 0iSS  0i:߳1`0!1R(1SP1P0Q1X 10 1ų(qU 000! 0005  Ჳ 7 $F -QLMp`} 001p  80S $00c`  )`VW 1000@ p  9P21) ) k~ k #k1!S-5 7S  PZ =lPyl@0*!(0T006S`6f060f50S)!0@00 S 0 B0 0  0f0f$0C0C BSPIPPI4F`F -LM`Pp ㊣P? 0iSS;0@S)0&00S!.\..\.P` 00`C20`0E*S=.8..8.8.8.8.8.8.@.8.8.8.8.8.8.8.8.8.8.@.8.8.8.8.8.8.8.8.8.8.8.8.8.8.8.8.8.8.8.8.8.@.PX`@ g@g@P -L4M, PPi `p pg@g 0 T40 8 0  P< @< S@TPPR"0`0 0`S`4  00^p T<800 oQ84 i,0<(0 0` pSFD 0-0@0PLUPP h@0 0-0LPCS  @0200Ph@ 0-0@0 LPh@0*00 40 Ƒ R  R     -`LM Vp:X"@J0PU$ 1 0 q!1UVX"@`I0$0$0S !0 ;00,(Pp 0  l0    `T@9`0W@`0`Y uPY{6 1 Pp @00 b<7"`32'R  l0   <6 7<W7`S% 00  l ,Q00   00  003 R <W `00  p 7#40l #300l` #31@r0`0Y/ Y5"㾯`HPp 2!$ ! PP!P P᦯W4  00 M9 ((0DQ㓯`HPp 1!$ ! PP!P P{W DH$H0DS0SP T00R00S Q00P00S00T00  0Q00`P00 \ S @7SP00 fT1915r 9 ' Pp 0y00'l` BO@ =OtMMFDF`F -LM("x`@GPU$ 1  !0 !1U0  @0 0K00p @yf  uf808MM -L`!xî@GPU$ 1  !0 !1᪮U~ 0 @0 0;00p=f808MM -6 pL- dPS @0P0 PPf~ f`# fQa3"`27S  l0  6004 W@0`0PPlr`Q00  0 R 0`0c0 0`00  00P006 7`HI p-LM0PS@ ` 1S 00|0SP0xP0|P0@p000Z5 U80 0(20Op0pFD D0D @0@ 0!Z0 0D'7 0!1 H* J..8. -LM@Q 0 S66 60C6Q 0 S66 60C6  -` V `PULp@0@ 0C^SPUU dDOV@PL=OPU<8OV@(h2OP.OPUFTGF< H -PL`@pP.. .P. 7O7 O7O0 . Q( O0@!T\NWLNHNV@T,hN  @NTNNN #2 7Nz7Ns7Nn7\N g7xNb7,N ]7TNX7DFFFFF FHGGTGFqFPPI,GF$F,F4F8F -L$M@0 ,  D7s 0 l,A W0< , W` R8 4 p[0 00 0D0 @ 000 0 H0 L @0Ss 0 \oP@  0R\D 0R ,0D' 0< 0P < H0S 0\  00 P0 \\3 L R- Y' 0J0 W 0 \ 00 W4 0R08 R0S0 0< 0R00S 80@8@ pY, 7S 0S40040 @ -LM 66 600|0 \@  \ L0 R 6 67 6767S6  -Q66 8861LS p-LM GP <#5( LTe. / / /4/R0\ 0R RR0 GKTH.././ 0 T9././.W0 R2507'#?5Ǖ0\ ( L<67&0l0X@@@ `vL6XX  @@00<hL44JHI@FlFxFFFF'GF4GFFD@- \Pp`@@ P0 R2u  00S  @ RJ 0 0S  ^ZW 0R* p-LM@ 0 1 1pP00 0 _`L0`V<@W`00 Ba2a3c13LL0Hp逖C -0LM4n 0@ 9`PI 0- L  @W0T* 0Q1 R0 0 PA4 e@ `0PI p-LM0@0P @0HW`|.P" 0P 1R 0S* 0^ , P0@0l, _pPI -LM`Rp @t%  P`F @pT`]] -LM4@,Kt 0@  @ P/`D -L M0@(KJ 0  @P/D-0 Ƞ 0 S sQ`D0 1 SIRD;3p@-}As8X@X`!X # 0S  0\pUQppDG-0 Ƞ 0 S sQ`D p-LM@2l0l 0` .T0P HP0@T R 0RTphPIIMuM -LxßP0@S0pH`\0 0R0H00 <-83,-4 T < X0S\0 S1P P .  b T 0@ T@d @T 00 0 "4 40i8#8#$ 0$  0!0i 00 0i0  BDG1 <1.XLx0 ,0S ,0 G 00 0wP  0 0@ꯤ, T00T0hxTz`pM,MlF4M -L M 0@p@A`0d` 0p0#!dP70 0d0  0ppI -LMKvX? B8c0@ 2c2c@2`ϠAl  8 #, E.Mb -L MQ@`*0S S 0`*xp0 p``P PU PP֨ UIUIUI 0-LM PᡣP@ 40P00 KPP吥0SL L@808 =P000UIXq/ 0- L"48<P#HP1 T P"48<#HTQ00ADT@Q<0\@| 00 T@ RL 0h麣JT:<0\ T0L0P0SSP@0(UIhUI -L$MȀp0P4`K$0 * 4P0S L00P0 $0S $_ 0@P  0pp D0<0. 10 S .pM|FMDQIF - 0L kPTITIM - LMR 40 S 0 0 Ϥ.F -(!XL"x H` P D hDU H -Lt!!Q#7011A!1 Ƞb1 ^0A0 x!0hp00 cT1(0000 c( > ! a c0#7%c!c1c X@01D08 #HT 00 0 R 900T| ?A7c%c!c1cW XEنMJMJMJMJMJyMJ&DuMUIMJUIMJ 0-P0 LR0 0Qc@0 0 0? B7c011@x0 l000!T 0)L0L " 0UI/uuMMJMJMJMJEنMJMJMJUI 0-LM0P [[@[0[ P@/0MJF -L(M(`KD 4pK;E4 7E@$Ÿ$ 0@b% tPx Q eB!2b2c621b1c \ڼ0P*0 RP 04P:1!1!@P @@8hQ@2[S@ ` B1 2P13[@S `,@"!@00Q@0 =F 9F 5F0n0\ eB!2b2c621b1c1\ 0T5-DDFMDQIMTIUIVI,MMM\MFMFMFMUIUIF p-LMxP0S `@T 0 S00 00C0܌T 1 0Sp,MF -LMX0@S,  Dh000 RP "2SX00X0 u0qW000 0W0S 0S  t 0 00t 3P0,@00 "48<#(R0,@00,@Q000 0S ,0  aw,@, K0gP,@T P0 0q6YWP,@P 0%4 0S' r. R, H6 R" ,|@9T (  hX00K ,]#00S ,(0,0(0vt,@00S 1 wP, @P 00 0@%0S4%00(5@T 0Q @T@0#$0$ g("( "4 4X0 "48<#8  `00`0Ћ|$00ˋ,@!$)-"("4 4X00S 884  Q y$Ppk 000P,0 09P@, X @00@0P "4 4q08#8#$0$ ㋋h#00冋,@ 20BlRS))RR& R00R  R{@pT (  W00K ,]Z00S,@940"040 Ÿ0 10 DL"@@d00d0;(2pjd00d0`T A 0S6 0S2 0S.1,@1>1 R 1 R)Q 0R <Q 0RQ t R 0S  R 0SR|00|0 $R(00(0 P 0S $0,@0$0uP@, P t00t0?0%p00p0#uP, @P000uP@, ,M4MVIUIMMUIUIMMDQIUIVI@-0@P H0^ 0%0S" 0 R T 0\ <P5 X0^ 80^ 00^ (0^T 1<1400 0R,M UI -L M p0 01 cQ E 0  0 R6 0Q0R  R  @, T  "48<#0!$(,"P:,@ @T, R3 0 "48 <,$#8(!8 ,"hCV ڲ "48<#V t "4 408#8#$0$  "4 40f8#8#$0$ TA 0P $(,.4,8 <"(!(#8R`c-ڲ0#$04V `9r R000@ .$#00C00f8#8#$0$  "4 408#8#$0$ ct,0S , 0S00,00 @ T,  ,@ "48<#Zk @"48<T#, `V_0@00 001SO pXP`s8`#0V0C0@  P`#00C0sV@ 8#8#$0$00 0 0 000  R000 0 0 0! 0 0 0!B W P 0P U  ! h00h0E 0S0 0 0 0z 000}qy# 00C0Q Q00 P h 00S0<0 0 0 0 0 0  00 00MUI4MM - @LTp l` P?q R0P00@ 4#0U0C0 R000 hVUIM -L`p㽈0S000 R P00C0@ T h@妈00墈P 80S0C8000h镈3 00 0MM4MM p-LMt`ㄈ0S pX@00z0Sv00phq(P0000SMM4M -LM|P0S ppp00/"?CQT`1@000`0S 00/"?CQ@TMUIUI4M -L,M@  D 0 01H pC0WL0 `@T T WOX00X0SGDT GT phW`H0S x3 R@X.PU(PE0S,C( ?P H ?000P PD @ 0D{"P00P00iP0iPT T|2 R8 PUT0 0vP, PE0S P M?T P 0 0HA?000  R H 0D0 P |P Tx D XPi4@K  ?2 [R3[Q0S 10[#0 210K[8K@  ?10[0S% S 2[0<KA <0 >20[020K@0iPpS20[3 [0Si t >dP. 20[020K20[3 [0SX0L0@ 0P H  >UIVIVI4MUI p-|@LMPP`D 0U`D 80S0C80 <`000 (P0 P@p餛MM -`0P LRPpP`@ +T >0D$ #10`(UIMJ(FVI p-0LM$0 (K0 (K'K1KPP+ 4 10 S 80S0C80pa00 R0`V @T 00 Q @T`V80S0C80p?:P80S0C80p,M -hALP4 )nP`. 0<1 0SD0 A1 P0PES.D 00 >p0U@:0S0U0* 0S8#"t'0("#'0D 8#"''VIUIMJ%}x  00 0+|1  ^ g%P  q`Bo qt0S` stP x  t0K0CP 冂 PEQ \ \0 Q0 0 S <Q 0 S|P  \00 00|PKfPK $MpM FHMUIuM  D,FUIеNhN,MUIVI4M8FLF0 0@0@ 0  F! 4 4 \0 80080tx$  -L$M0@01 cYH 40 , D  04!48< 0@  @#X< @@ 8 QqP? P@ 4"$ " 9qT @3@p` PP 40 0S1!< !@ 8 40 c"4 4:10  0:00#$(,"(Q0ձh:0ű8 `8#8#$0$ 0 0YP ` ,"4 4Q0x 0u @0Sr 00 0h2x  x XD H0 0H0 !48<#XD {0!<400 @!Dr[0@1#$0$,0 S ? ,0; @0S8 00 0x  x ,Q p,0HB?  CD\00R00S @17 H <  < ,0  pH\ 0P@ P00 PX0 R@H408 7<0H 0<0 8  @10 006@7<0H 0<0 00 0X(MMM4M -LMpP 48<`J#8, SV*0S010$ fQM*&pH P@ 8 2$020 1  1 pT0   00 @ 0 P 00P 0'p ', 00 "4 408#8#$0$  0 0  0 MMM -LM001PCUp`0 S@ S0 U@T00T0ST@ PdUp0h@C 0@0`4'xF -LM@`<PRp P X WP P0FS*4/`//////`/D/D/D/D/D/`/`/`/`/`/h/D/D/D////00uP h6 UPhP<6 UP\P6 UYPNP m R0 001 0 mm R0 002 0 mX 0S 0FPS񟗆/////X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X//0/H/mPf0EStPʕbjUh0h000oUh0h000iUh0h000cUh0h000]Uh0h0@0@0W0ESPʕ0FS5/@/x/x/x/x/x//(/(/(/(/(/@/@/@/@/@/H///////////x/x/x/ U0S 0  0$ L*T0 0hP 0PP0PT0 F 0PR?//////PP02KU2 0` V)Vm"@`$m$ R 1 0 +10 ,(<81 `0  0WvU7rUn0"[ jPP "KPPPPPP0 F 0 R񟗓X/`/h///////p/PPPPfT0 F 0Rv/$/,/8/D///////////////////////P/\/h/mPVtPTh0PQh00h0#1h03h0#3PCpMUIUIUIUIM -LPpR@W@L QG 2,00S,*0@P 0 #TQ` Q T`V00V0SQ  Q @fTP 0,SpUTV@D`F 00C 0`# D#BT?T -LMH`0V,0 P@p 0ES>X/H/l///T 0S p@T 3R ,0 S ,c5~@0 R  3Q H0S <Q H0SQ P U 5SP1pP-pT 0S0  T 0S0 R ƕT 0S00S R; 2Q5 H0S <Q/ H0SQ P) U 5S@ T  0S @T T0pT;p 1P7pw 000s 0RP@ 0 <0K; K0@K80 |@Q RPU7 1@000m0u 000 !t"4 408 Q H  0`S 0 B0 0  0e0e$0C0CQ(QQ@0P 0S "48<#8SSQ0S 0 "\00\0C  4404M p-LMR@PBkS<dS*S 0@phP`  P0 0 h000pP 0S`P (Q0 Rh0h000h0P P` O` m0CSP pP Q -LM QP@0p` 0Q0V00SAQ񟗁 0 08 0d 0 0d 0 0 0d 0 0 0T 0\ 0d 0d 0l 0| 0d 0Vm0 pXQ1 ePp(P`puPVP 1 T A 0@S p\1 R 00CS 0S804P01p 0S0 R 00CS/p0(0c0 ec9pHd0 U8p( pU0 \r-pWf iFTWIXWIMFVIMF -L,qM1d\aP0@ !0=0T紀ᶠ@. t.tQ Q Y 403074<'Y  01 (tꈴNM -L Mp|, @W`0 q P P U0  00aSPUY$ 0!0@`T0TX#,0P00 /P ,IR00d0   "000/U 0 0lQڲ!Qz @O R0000 0` TP, Y 尠ᲡpX 0S06SPU  0S00L100 @ 0Tp0000 0 V  |P h0  HP%0 0  OTTP 0 R  0Yc0 0S  c 0S00`0 a!0 Q0 X  0R X 0Q"  H ,000DOC AO R0000 0 pNеN -L1  '\ 0"O --LMϟx0 0, x0t K 1      0#2S S Nϟ,0 S , 'Q 0 0R :ZK  0lR RV ""!R00R0S` 000 bR 0 0R%0% $ :Z  A Q   0S =R `0<,4$<,!4 $,. $<%, `0 ` P P W R 0R2DX 6S+   R? 0! 0 @0P  V@eT` (  .2@0KP P70SQ' T  6Ps 0Sx1S0x!0000St1S0t!0000S1S 0!000e6 S,!Bʴ0S; R4 tK  0 Pt0S lQ P!0 b0b S0l l0 0S  P TP`L\@Xa!0lS0S0 fR 0 @P  P t0S  L!R p00bS0`cV9ڼ\ 00!R 0B 1ʁ `F0Vʧ t0 ʟ0t0`9 0O   00 0 f 1SӲј0f Ӳ1 ն0| 6Syڄ^M0 0`bV^V0009H9@_ 0 6 S0 0bSO0S 0R   * 0SMMt00t0NX |0@  t1S S ? (8A @@0 7At00t07  flO0 f t0S pL1 0cSX0`Sژ )  X1R 0R 0R60CS80)0)0)0x%0x%0)0x%0<7 R t0 =0Ɵ6 00 0V t0 6SN Sʰ6 R# @ tP  0 0bS0 GP!\P 0!8  t0$81081 10 1  t08t05$! $!0aSڴ0S ş&0RW1 0cST000X5X TP(25  pbt PşoR` l R< 0!R 410cS5b 1P 40 A$1T4 6SR? d42S 1 X |P h0  HP W0@0b0bP;t 0h!0bS5t0`1S`q5 0 0cS0L S6 0C S 0,%0p%0 0%0U 0 }  R  0bSWQJ  @ P= 6 S:"L00S. 0 0cS L0 b00CSH00 @00S]Q/0008[P0   R 6 SaK  0 6S SI8C80CS| 0 0!0 0 0!0L!00 t1S S \t0 B @l1A 0@D1  t1Pa ^H1Pa ^t0 0 t0 `pbt07t0b 0R6 M  0K bt07t0bt00t00S  {еNpMF N\NlWINpWI7IWI8N@N\WI|NH?pNWIHNNKJIWINIPNеN0S6Sbt07t0bt0 R? < 0t00 x000|0 @_X|0  |P h0  HP0  JL@ ^0S   L@M_ 0!t0L 0I   ! 0C S  0bSQ0\0S 0R @ 000 S @1 0PL000 #]p"0 ?0PuUu 2Pa ]fUd }2Pa +^,@`0P0g0  T#0?0   P@ 1'0 13 8CRڔ$1 1v$1P:Fm H&0R  P@@T  0R @10c0cSp000P F0P *0`00  6 %06 8CR 6S 1'0 1Q0 WP!n0 p0bSFȱyP R$1 t00A8t0k@0< <&$1<" !Xm0At0 8t0 \@0< < $!0, 0cS p8X& 000[0|&60&?08t0`0`S  at07t0a0K "`t07t0`00C0 7 '('R?6 #b0  0000cSL0lL10T1/ 7@_0'0 0 0\0000 0 0 e 0xH(0Od8`T!00bSL,ʼ0(0/80 \ 00cS10cSژ  ( 1 01    00cS10cSژ000 0 9 R t0a \^ =oPW Q  0 0bS c00[6S7 1t0Q0t0< 0x:! R 0SPS t0 9 t0:!  !Pd 0 0bS_ 000Z &*0+?08t0`0`SA _t07t0_ 0K_t07t0_0!R& 1'0 10000S00C0 -`afsJ0O  ; <bD<D,L,R?   0 S tQ L!p00bS `0\0R00S 0 S TP0ASQ X10cS 0T1p L!Մ^y 00cS0dS 1 S:6ST-X0t 0R0 l R  0!R 410cSڸ=bf pl= X  |P h0  HP5@^t 0h!0bS5t0`1S`q500cSwG 1R 40 ;0Sq  @[.0?0 )  0Rn0SkTPL\@X a0lS0^[ʴ0S 0SV`d p 0000|  @_X| 0 |P h0  HP50 ( GL@ Z0Std8 R  0t0u0,(t0t   0L@>IF[ 8Tt08t07(! (!t0   x'x0 ?08^ i3Pa^w R0001 0 }HPKd`K}\ \ E 0@ @KG0KH@K0\K 4Kd@KcKK0 &Q Qv " 0 S+  #0S   0% P p pDX T1  Q l5@T2 0R #3Rʌ tK 0z P \ \ 3P1010 0Sğ101 zP 0 Sh( G\  C0~H =<0H0KGK D d0KKcK0`0 K^3 /P  0Q00 Q W101O0 0wp l00 L0up3 0  `0t0 0<4(<"4!0>0@?0P<0P<0X?0P<0P<0P<0P<0P<0P<0P<0P<0P<0P<0@0U @00`eV00St  7Y;1 S' Y Q" t |0t@KP@oP  PP3P@ ,3 ,0S ,#101SHK d`K tQU U  0P(P  t 6St0; t00 H KGK 0d KD0 cK0`0 U @@K H@KGPKo0\K d@KcPKg| 0t 6Sq vKW7[#$0$'K fUd|  0` 6S]t0@0t0 d1R # T 0U0R0SM| 0I 6St0 0`SC 9R09D0 001 0 0 0Q00P0 D001  B 00C0P P 80S0C80 P=?V@0\1iDUi`= i봹NNV0F -0LSp; S* ` 1! Q@A00$U@T H0TS @TU }0Sp  vPUl0l P@  !a000 0 0#!WINXNN -LMPpT, K@P` 0 0R T  0bS@000c0CS 9R09D0ş 001 0 0ş 0Q000 040 D0401 0  B t%00C0T0OP' 00@ #  0 0 0S0 0000S0 0000S0 000h @,h00 h0s0s0030S S,L0S H0 0;Pp 0 0  P P T<00D@D0t t 0S #!000 R?"" 3` t 9t0=t0) Px 9\s00P P!00 0 01009t S)t 1 S019t0<t09 t0;t00010062 ,!0"?08000H:S?9 S7 100! 00&?0@Q  10cS1X!P@ P P 80S0C80ڴ 44 3h;7 ;P P 80S0C80 04h4j@0  h;dP- ; 0 0 Y YEh0 d H00080P00;Sp괹NNKJIIеNWI`WINV0LN -LMP@`%Sp KPPJ 0 0bSE 9R09D0 001 0 0 0Q00`0 D001  B # 00C0R 0@P P 80S0C80< sg:R鴹NN4NV0 -LMP@`Rp KPP <4<("4!<S R) 9S090Q9D00 01 000Q00`0 D001  B 00C0|Rx 0@P P 80S0C800 TVg~:괹NN0^3 RP圠0\ jjZG0P0T1!Z ô Ŕ0 TL0 \P$ E P0c3R Z  Z6 Qt` P: 0 * r0S'@1Z:S"0!0bS0SPU h=!\= a0S0b0bS ^ t`0 0bSt1S   S( 㴀t` t`00崀I 0S#   0K    \ 00 000 X 6S (P4 J? 0 l  c0ZP 0P Ƀ S Z7 r Z00R00Sh00h00!0bS+;HD 0O[DN@ PP t 2 0$2   MU 00SU 0   00c<  80S Zڔ0 06P  0Su 0  0xQ< j  0nRcIx 0 0C t0 1R0B0Z401 0,$,!$#, P ɟ <4(<"4!<00 @0 /0,$,!$#,P (0S t` ȟ@01001t`0 S   S@ 9 S T0#Q7 Q L8Lȟ 2^ࠡ`^࠱^"("("4 4 0 0CS0ՠ0 S 0!8#8 #$0$ ! t0 it1SJ [SG r0S 40: 00 t0 0t0 ᴀX P  0S  0X00S @ 1R 0'0?0 40@ 0R &0?0 400l`0S t0  Z 0!0bS r Z00R00S(`,10,1t1S[ SX Q3d1\d@00@0t` 00 0t`P1 0cS!0Xt0Q  R 崀u5 ,0S 0,0t07Q (R 02SAS6S4ŠPóPt04@| 7 1!"4 400| 0 tV|0m  0P$000|@S;00H @ S!@( B"40 0 0|rV  048<:#,## 0| 00H 0 ) F! F 1 0cS01S 3Ÿ 40!000崀 1 0cS! 00 0 8#8#$(,"8SPPKTK(0H@XK0%<0<( 㱩pMеN:WIIUIWIFFr(UI0LN -@LXAt0`0p hMA, N? , O?Ɍ LQUP1 Q 0r00r0P0,H0l <^*40  ^:00000JеN:WIDNWI p-L M@At0`V140040P,|0@ . P,ʼ0^ڰ0 ,0`0Q*80 080x0LP` `0 ?08ph@<00<<0 еN@NWIHNI, 0 S UD 0 R R/ ,>  0帙 0FVZ V ,> 0GS<p00D00D0D0D0L0P 0S 0 Rt0t000t0P &P 0S0 Rڰ7R'P 0S6S0 Rt0t0 ; ;*P 0S6St0 00S00  &0 G 0Rس00000000t0 00 7t0 ;* 0V>V 6 P m& p-LM0PS T0S0 :P@|ᾣP@ p`P Fh0 00t1@00ϥ0@070pWIWILN 0-6| SL@@Pڲ0 0S 8L< P@0(@J -LM6@S е0е0е0<0<0H0067@T 6S|0@86P S000 0ό060I@N -LM⬒X`, P P0SR9 Q㍯K"!: /^P@/D2(K0S S| K 0idP@t 0KMKadP@l=1X ( K0SZ SM X W DP @0  @Xz=,0 S x,5W @ 0  000 @ 040 Xa=/ 040 00 0(K 0 S S W R h0 <@TU3 0S h P90S&P h0`&@HKL0 8P @L7@0SD  ? 00 06 K0| K000'#0R0S~ ,0S00S40S80S , PQa 0S 0S$0S(0S  P#0RU* '0:$P" Q h x70S3 R h0( %@0LHK k8P #P  00 000 @ P0\^#@LX7@0S  K 0  Kq( R  0R8 R 0Rh0 2nQ (f 0 P@  j+P:U (  P0KG[ ``P@ 0SbQ+ @0 ' U\  q PK 0Sx1S0x!0000St1S0t!0000S1S 0!000:0P0  h 40SQ h0:%@HKL0 7P @L6@K 0a K~G[ sPk: R0001 0 $00Q$0' 0_P@d000! Q  0 ofxK0000 0@ӧ 0尥 b 0 Ϥ/@HPKLH@KG`K04K dPK7a?d@Kc`K0K +a@HK1H@KG`K04K 0dKD0 'd@Kc`K K0`0 0 0bS0K #0S Y%Pp  Ar~$T2TG0[@  @Td000`0S 00 0    (0 0(0 V0 000 I (00(00001P. T00 jR@0jT\|0K  (Pp5 | 0R0% .*0 G0K!$hNpMFtYIxYINʚ;NF -LM@0@@L5@0 \h5 @0 -LdM̂0Q@,0 p`P㰢 0S ,0S ,0SP0@ShP P T2 R Vy Pp 0t0 x U 0SYdK \KdK0_PYA p0t 0R:l@K-0 pt"@HK@PK#0 G0KHKpYV HK00 _PW [&[xdKH0K J[\K&[0Pjx0dK  dK0 c0Kd K\KpVL  dK0\KdK g_Pp` x` Z|`pM0FO/ uINVE -QLM@P(a 0S0S 0S P0@Sq`0P. W R* 0P0@ 0 P @0S t0\ h0\ \0S 0#Ġ Ƞ̌,^k 00VIO/NUItYIxYI --LMP`h0  p 0 Y(@#*X (08 S, 8@80 &P@1w  80S $00cg  `V7@R 1@0 00$08#8#$0$0 08 (00310#1|1!0S1 00 0! !48< (#( (!(!8#8!QA"A" 8#8tm#$0$ ,0H 0,0@0C>P@X , 8 007Z S 0 B0 0  0f0f$0C0C07(0S9@sLXIhNFMЍ -LM QP`@p 0Q0T00SQH0000<000h00p00\00000000000T pZ X@7œp 87W2 3Pph0 22  s t 7h0  ;Gp 75h0  0S 0S$0S(0S 8p6EHp 6W1(0S6h0  0S  0S$0S(0S9p 6h0<<,80Y 6000z2xh0   0o 0o1-h0  uI\ẞXh0  IQžM-pKh0   0 po{J 0 oNPXITXIsIUIVE,F 0-LPy6@#0hr6 -L MQ@P`\ 0 \8 0*譮 @Pi鄯XXIM -LM`pPUP@C 0S}@h00h0| 0/V |   0p4 p  p  0$pR> 5 R`0W* <P6 0@R 000SP0P0P05000U0Sᅵ 0$H0R0P 0 $ s?0 `刀50S 5`000 0``0 5 PP{7݆M>OI(WO$WOH*O -0-P0L@Q/ P0R0S/ BOI --2L PRG 7P`A 0S`h0@0h00|  | 0p  048<# #$# p  00 0R*X PP @ 048<##̠#$  0H^   1 g c 00g 0 "4 40g8#8#$0$ 00g0庠6<P5 0@R 0SP0P0P05000`0Sᐴ 0/ PPkOIM@-h0\ }O1S \!0R0S5 Mp@-QMP`@\ 0 \(Ѝp@Ŭ*ЍpOIOI-QM 0*\Ѝ䪬ЍOI -0QL0S`@? q0S6 0 *\P`?#?0 0cS 0D@P%\0@P%6 @00 p tPP%0@`0`&B=P ==P ,YI0YI(YI -L MPlY, 00 h QQ# 00U\lYR Ucppw U` =e`<4 F0$0@Xp P<P5xP.|P'pP tPPP R 0S0 0 R 0S00KphE`z` 0t10p10|10x1010100p -LL0D\!*0S 0\:  YIXIP 0 SRQ0S@0@ 0QSQ0 RUIUIUIR- Q Q^000100~/00Q Q^000200,0 -LM`P ?#?0 cD@ [`[p[ 0[, 01A4YI{JF M0-L MlP@ 4K @ 30[S S,K 4 0S $Q0K0pMFF M0-L MP@4K  @ m30[S S 0 S X,0,0S(0S$0S 0S 00SpMF -LM0@S <0CS0h!0=0$F 0-@L.P  R $09$0 0O0hr.uM 0-@Ll.P  R $09$0 0O0hX.uM -L 0 R   P -LM˟K ^Y , 0 p``K+ Q00Y00S 04S  4K|KHKE00 W0 p Wi'Z0 S 00,0 S x ,g @ 0P 0,0 0 K|0K0K{pKU|K T(0S" S "" A@T  0P 0S 80S0C80A00UB80PS0C80UA0 0S@0@0@000@000 00@0  P}0S S a0S S R $0 Q000 20  ^ ^ 0S $!\K| P(0S \` '0Sy `Q 000 2 0 0 0R# 0S RKh'|0O@ 00 PrP 00 0P 0S800@0 0 000S^K|@P`  0@P0;000S00P^K|Q`  0>00I?PK|I ;P{P |Qk mPh P xQa cP^ R Q000 2000@? P0 @00@0 @Y 0D P| [||KP@{\` tD` 0` R 0R@$0S` Q 000 20  C 0R 0S\|K#|0O 00p PKP0ST000 0 00^|K|@P`  0@P 0 $P|K,00 P0 m !^|K| iP@00P@Wh0Shl0Sep0Sbt0S \d0S@@ W0S0S0S0S  8P@00 =0S s8 5\@ @0  @0 R:.0  00 @/00Z@0 S0@ 0  @n0 i0  d 0P|0K x pK{pK0K P0 R303:0  G0 pXIpMxFtXIuMVE 0-LM0P0CS@000; Q R000 2 0 P P R0 00  0 PPPP pw0\ 00C00igec00 PPP)AP|XI|NpXI -L M@Tp` 0' P@0  00 0 0P2 0P 00P @ 0@@8YI|N|XIFG-MR0 0 1}aP`@ 06 H00h00^0,Pp`$80 Ѝ32@0 00(0X0 04|0`0800( 31@0 @P 0|`4008P[p̦8[@Ʀ !- 2V" 3V!!000 ! !\00\0 ! 2V!40040 3V!!00$00000$0 ! 2VL! 3VD!D!000 2V! 3V!!0.00 D0K HKg UJ0K a $["48<#8,$,P 1P0K R + 2Vp  3Vh h 000h0 R  mD0 R 40 R pMNNN HMuMFPYILYIHYI -L\Mp, @_0|0 h&h6P`P X X Yk 2U^ 3UX 6 0$0 1:1h0| 0h00< P| 5X# X3U 2U [ .5 ,0S ,c | XlU |  | 3U 2UlUW0t p0  tK 0l 1 ;10S1;10S1;x 0lS $ P@ B  E 0 {2U $ 3U$$0 00 0'S( P`u !( B("("48<##80x0K| \ x0SF )SK00j'S3T0K(  N d3 R T#0SS9 2U(#L00L0 3U##H0<000H0<0 PH1SL1SP1ST1S RLK P2U" 3U""000000jSh0K   P2 R @"0SSx0D!R \0S2U! 3U!!000 0 S*  P`T @1#$0$00   0Sx0 ' )S00j'ST0K(   L1 R 300<+0K +K@ 0,#<K ZP@!<0  <0#0( 0 P( $ 0"00B 0 $0 \DLkUE*@K4 [@ <0!$$ 08#8#Ġ0Č0 Kq*@K2 [@ <0!$$ 08#8#Ġ0Č0 3<+0K +KR<El7L00L0<d< 4 <( "4,<d0A<x7000<000l7 80Sb(D00D0Z .000Rp000$08@K H00<P 8 <0 0 4P <dHMN 8Nʚ;NDv1 -LMp @W`(0J   PP7 0S #S  0  oCL2j 000@ W|D$0 LjrD@  0L j< @000LjWD L00L0N 0-LP@0@T0 -LM&>H3o 0@,  0K KKp | P 0P60#?U0@AgAO@P ( (K (PKK (\ K( K 0"K !3#K (00 @0T0  <4<("4!H <4<("4Q ̃h @TX Kg (`K ㌿똠K ㄿ @T PK0 [R> R1 0 R @TX  gm(P0Pj0#?U00 ,0S ,!  P P0[0S SW 0;K0[0S\0,$,!$#,\2 5pM F -0LdM1cࠀ1?@K`Pp\ $  (B(_'@  ( (4( $0S $“pM8F -LMx0p(0 `@X2PSPR5XR5054%pLP QD"L`RH2H2H20D"H2  PBUP 0L0h L堎L0LP d {L -LML0P DBT -LMt2S_p*_@0 0@ Ġ̌.Č$̌,l,,H  @ `xB  Ġ̌.Č$̌,\,,H0 @P 00@ 0-x0LPU LPPU0X0S @T 5A0AS DBTL2SM -LpTMx0,0 |p L0St00t0! T2S0l T2 P0[0 0P0KP [&>  P KOKch2S0M0Kl0LKK0KNK庤Kl2SpPlYQ6 ,0S ,崎hK@1<@d*P` T2 02$0  1 #V !P,L00 !(PF0 `00`@Kp0 0;L0_0KsPv 0 㜾0(@ 0' PK$ 㑾 P0$(00 400(0C0Ap0 0L 줟p0 00 @P0χ 0ZP@- 7P# 4 R W ( |2t|pzX"t0r0t00 X2R 0\2Tu$ 0@X2S\20S\2<]XB7㺹t  t  0@(z @\h P` L3"$ " cV 1ᤀ8< 10@0@00 `PK  @Nx0 $$ p 0 @ 0Ạl0L_0K夆PH0@ 0d2 0PK$ Ƚ >P0$005 4000C0@p0 08 衟p0 00 @P0· 0lP@7 7P- t1 R W# ( Xih峦L屦X"t0r0t00 X2R 0\23S0C3SD03~F 0@X2S\20S\2XBpl Pd2 d2S2i3c13/"p0^l s?X0r/L0Pr?, $0$ `0s/ -LM @R 00S S Rh2Ql2P'0hl R* 0S < R$ 0SR t R 0S  R 0SR h2SlQ h505X6L0S h2Sh,M 0-L^@LP5 h2S5050$1\ R X0S 5S4<\P Q+ 0Q&uPPL R h2S R0h2505wQ 0` 04uPPL h210 400 0SP ,M01 -L\M@XhK⽴L0lKl0 eP70` . 0000A0 -0LS@PLp` 0S0S0S5 l2S505bh1`\% 1 00 0 Q^ R X0S %^00/ V `\V W1 0W,P`L R# l2S 0S l20l2R l2S505 00S P`L 1 p`*O -L$MD0@HK,0 5(#0@pK0LKG0K0 HKK10K尤KyPPo2 5#Ġ0Č4p80  04p 尤KK40K>0C PP R000 Z1i -LMLpX$ ,PK4`K DP@A T  0S  @꧱PSU 0S PUU ԉ4P@T P@  R000 Z Z2i -LFM⬠LP0U`(0 NK ( 㡵CT JK ᙵ`  R000 wZCT (0S (NpM2i F -L(Mp 0Rx 0 ` RhPD@K $hQ 0 D 1 0S  "pM,^I@^I(F -LM@220  -LM`p 4PU L4 0~XP@0$ $00`00,0  0 0`0|0 (0`  @Bl0 ($ 0oI3G4 7@00@01N -LM Pp$ W(8 K4  }P`   h0O<3 ( h0O$ 0R 0RLYޕ`P4Ww 3   0S  0Rĕ$0<$00S #S  0  4 2LYB000PLvY 0 0 0R0*Pp7P 0 K PPN 00 \) K@ 0S/:#000nm10 0 0a c 3)0K8  80fP4bM00  00n c  c 1 0 0C B 0 7100C0` P000_L Y< P000VLY T3 @00@0N -LMLS< `R p00# 00 00S S00S0.0080(0800Si0O0  i0O$ 0R  0Rޔ`{   0S  0Rʔ$0<$0XP@ 1[P@T 1  80S T !0P? UG2PP2 $ 0 0i000 LVPp 01@B @ (f0 00 (0 p012@070@0 0007 80S4@K Ϯ40<4 00 r2HMN ʚ;T1 -LM @p(0WPhz | P`g 0S #S  0  goG1LW!000@ WW72LW 0Z( 0oP1 @r<4(<"4!<8#8#$0$0 0S S .@0000l 2:@ 0l ` 7@000LW< @000LW1 @00@0N G-@0 !0P8< 40#0   0 ! 0 8<4 0#R 0 08 <40#0 (0,$ "^ X 08 <40#0 (0,$ " ^  D@Ÿ@ 1, !4  ,$< "1  . , !!8!$X!l0p $(, !0$0#0# ! 0#0#, ! $< 0048 P8A0!0$ 0#0#.,0#0# 0# !  " X0 $ 00# ., (0P 0 !x@0$ 0#0#.,0#L0# 0# ! ". X0 P,D, E -LlM, P0 0 10 1 0@ !0@0@ 00L0 0 T 0 ,PU`E00` 0p\4p 0 'L 08@ `#X&&ĠP#l#4Q'(.'D!!|0 80|P 1P!<0 0@ !qA 1@ X !lp p H@ \ t 0 4`@P`P` p8apdp Q< AP`0 aXpd A!ppDP T` lP`h p!Q1|`!`Hpa0#` `q "Lp \ph@q`p tpqxp pqD`p Tp \`pAQL``p !x`p "0# ! "0#u,,D,D,D,D,EG-M8  P< 8 4 ȠLD, P ̉H4< 0 l  $ H !D!0@,!Č(l ,l( @$.($@ `, * p(,( $P&' .h1T)̠)$$ĠƟ)$%801*(%|05 !%5 * !*  1şq|ş`ş耍@  唠 ! "   "l@嬠 !0# 0#l ll!T^T 0# d "! "`\!l!0# X1l! \X.(Xd1`. H\#d,8``.dX D@,`.Ġd l.\X h01 03 !xh| !` X0刐0\T0@H 1D4 q0@ ?0@0c80 !<\ P!TP 8PtU"\@P P<?@1p@d Zp: T@P U \:,0 l o" ,{@0 SP,0 ,0@k -L4M0!> ?P@Pe`!8P 'pmvmz0fk00 0#000c= h 0 "   b-p 0i0D  0#000c9` j 0 "   b* 0g{0| 0#0009  fk 0 "   - 0h0` 0#000c9p i 0 "   )`0j0  0#0009  g{ X0 "   , 0fk0 0#000=h 0 0| 0008pi 00 000=`j 00X 000c< g{ 00000: fk 0 0 000c9h 0 0 000c9pi 00, 000c=`j 00 000c9 g{ 000 00c= fk 0 0 000;h 0 0` 000c:pi 00 000;`j 00D 000c: g{ 00 000= fk 0 0 0008h 0 00 000c<pi 0' 0#00c<`j0&,  0#00= g{0(0#00c: fk0)X 0#00;h 0*0#00c:pi 0' 0#0 0=`j0&|P 0#00c9 g{0(0#0 0c= fk0)0#00c<h 0*` 0#009pi 0'P 0#00c=`j0&0 0#0 0= g{0(0#008 fk0) 0#009h 0*DP0#00:pt 4i 0'P 0#0 0 lPnpP  xlP : `j    -LM@ , R, p `b b$,0  O 4 P'e eTP hP!?!0@?PP@ eiٛ@Pn ӛt?0S:@Pk?0S: -Lp M0`,0 @4K  b!)@T  ~0 S@( `P 0  RS  Z @$1  b!1@T(,0 S ,JkTpMLFT EPF -@LMT $ f@( 0 X EG-(M$$ $0 ```( 5j# "< "0  0#   D 0AiP i;,  0 0  ^   `00` 0 0Q%j3 0# Ƞa,0# ,e). @ @$ 0Q." p  aƠi! " 0 @ iˠ "! 00`@P?Q  ` $0 ` `@`P@` P0` 0$` 0  @P(ЍX E -RLMp+ >?A @` R,: (, 党,!P`(` pl?W `\ @pG0@?W@W( d0@(Z0@ -PLM, pX 0 @0K- M >}. Np >.~~΍.1@QS@@`aq  ␀!N01`$P~`Pa.(LQxh ,00)&$a9%G%ᨀ.,Qq匀円(nx%Th0vP.#^PLl G )ጫ7᎛ '(P!`"p`p`P , 0 0Ll\$1l(C|@厏 ='pp*C(`~P%`&`P`Pa0#@$^.T= }` 0`lppPCq(,ΠHD@l| 0q<`^ 0@N0lQpCpa`3` P``` P%00`&! "= p P `.M.  .0@~>. N~ ~0@TO^t^0@10  a0@N~ Q0@^  0@00 ^ߍx E -RLM`pG @>0A! c RX:P !0@ R: @0S*H0P@ P p`i VHP  0@ `FRp @0 S*@0 VVP ᧖!0@ R:@0S*H0P@ Pፖ!0@ R:@0S*H0P@  -@LM, 0 0@K 408@_`pP`4%$\'&dts?s_`  0 @ #Ƞ8!(0p$HP``,4H[0@UP` !4%lT"$ K?K_`@8`p0!#^8'$Hxa ) ,0 p\P0\,@PPP~㟑,p00@ ,oA,0l P⎑ Ppl≑, PP,`pPPၑ0P0 -PL M0 , / ^0,40 P`0p  @ 0 !ĠP`#L"$40@ 0@#Ƞ8!(P40$H`0S40 `00`00 Z,o8 -@LMT@ , P"H0@ E -PL M0 , / 0,40 P`0p  @ 0 !ĠP`#L"$40@ 0@#Ƞ8!(P40$H`0S40 `00`00 Z,oېA-0PpP%%Ǡ% %,1d H!̒00# 0@0#@$$Ǡ$ $,1t h!̒0 0# 00#P%%Ǡ% %,1t h!̒0 0# 00#@$$Ǡ$ $,1t h!̒0 0# 00#P%%Ǡ% %,1t h!̒0 0# 00#@$$Ǡ$ $,1t h!̒0 0# 00#P%%Ǡ% %,1t h!̒0 0# 00#@$$Ǡ$ $,1t h!̒0 0# 00#P%%Ǡ% %,1t h!̒0$ 0# 00#@$$Ǡ$ $,1t h!̒0( 0# 00#P%%Ǡ% %,1t h!̒0, 0# 00#@$$Ǡ$ $,1t h!̒00 0# 00#P%%Ǡ% %,1t h!̒04 0# 00#@$$Ǡ$ $,1t h!̒08 0# 00#P%%Ǡ% %,1t h!̒0< 0# 00#@$$Ǡ$ $,1d Ȟ0 0#@D 00#@$P%0A-D0P@pP%%Ǡ% %,1d H!̒00# 0@0#@$$Ǡ$ $,1t h!̒0< 0# 00#P%%Ǡ% %,1t h!̒08 0# 00#@$$Ǡ$ $,1t h!̒04 0# 00#P%%Ǡ% %,1t h!̒00 0# 00#@$$Ǡ$ $,1t h!̒0, 0# 00#P%%Ǡ% %,1t h!̒0( 0# 00#@$$Ǡ$ $,1t h!̒0$ 0# 00#P%%Ǡ% %,1t h!̒0 0# 00#@$$Ǡ$ $,1t h!̒0 0# 00#P%%Ǡ% %,1t h!̒0 0# 00#@$$Ǡ$ $,1t h!̒0 0# 00#P%%Ǡ% %,1t h!̒0 0# 00#@$$Ǡ$ $,1t h!̒0 0# 00#P%%Ǡ% %,1t h!̒0 0# 00#@$$Ǡ$ $,1d Ȟ0 0# 00#@$P%0 ̒xEH0@-@P!0\#0 0(S"Ƞ0 -L0 M( @KP"h0dp 0 8#x "W 0@2K,0 (0 p,KL,0 0("x(0W0p@d;08 (#H,0T108#xW -LM((KpPj@"h8  8 08 #8 "S80 02K40 00 80 4pK z400# 40 s0 0#080 40(0"(8 R00  8 80@ U400# 40 N0 0#008 0#H40T18 08#8S80  p-LMH`P&$H ph; (-"xPUL`@:08#XU@: (-"xPUL`@:08#XU@: -pL MW@)*0K0 8(<, 4$P`  0P `b0P,`p%<%(%& &Ƞ&W0 P`@: -pL MW@)*0K0 8(<, 4$P`  0P `g0P,`p%<%(%& &Ƞ&W0 P`@: -pL MW@2*0K0 0#0P0 8(<, 4$P`  0P `0P,`p%%<%(& &Ƞ&W0 P`@: -CL0 MX4 @CpC0K20K0 8(<, 4$P`0P ` 0P,`%%<%(& &Ƞ&0 P`0 0#0QHXpG@D0 8(<, 4$P`0P ` 0P,`%%<%(& &Ƞ&0 P`40 0#0QG-08@ <4@ `|Pe%L%ȠE q%0E吕aP@8 < 4f `D0`&! 0cqS%,,E%̠ 1%E0n 00#H*j apQ% 1%Ƞ % 0 0#0a L`& apQD% 1%ȠxxD % 0#0l0P* apQ,% 1%Ƞ  % 0n 00#T`&f apQC% 1%ȠC % 0 0#0aX* apQ% 1%Ƞt % 0#0l0\`& apQ,C% 1%Ƞ  C % 0n 00# `*j apQ% 1%Ƞ % 0 0#0a$d`& apQB% 1%ȠttB % 0#0l0(h* apQ(% 1%Ƞ % 0n 00#,l`&f apQA% %Ƞ %40A1!c \p*R0 p0 0crSl% 1%``A%$ ! 0#0`04t `&! bqR%1% %$ !0l00#8x *j bqR%@%%$1  0!0#0b|< `& arQ%1%h%$  0#!0`0**<*(*& &Ƞ&`0 E#E'E+EG-0@P`p8 Ƞ<̌ W4ČP`pሕՈU< |0 0crCpş$ 1$(dT $L!0#0l08x P%e bqBş$1$$$  0!0#0b4t `&! bqBğ$1$$$ 0l!00#0p P% bqBlğ$1$`$$  0#!0`0`&, l0 f 0crCğ$ 1$ $$ ! 00#0b(h P%! bqBß$1$$$ !0l00#$d `& bqBpß$1$d$$ ! 0#0`0 ` P%e bqBß$1$$$ ! 00#0b\ `&! bqBŸ$1$$$ !0l00#X P% bqBtŸ$1$h$$ ! 0#0`0T `&f bqB Ÿ$1$$$ ! 00#0bP P%! bqB$1$$$ !0l00# L `& bqBx$1$l$$ ! 0#0`0H P%e bqB$$1$$$ ! 00#0bD `&! bqB$1$$$ !0l00#@ P% arA|$1$p$$ ! 0#0`0`&&,&8&% %Ƞ% P0`'E+EE#EG- R8M0 00 1 S`@Pp0 q 1ѷ< 1 R Ե@ 18 1 P յP 14 1 ^ ֵ` 10 1Z0 S$ Y NHV2PW2PW2PW2Y2PW2PW2PW2Y2PW2PW2PW2HV2000PTGTg#Ġ#, #<,!q 1,A.-Q0#Ga. "  "P0# "0# A !04 f"Ȇ",(1&)V0# !0#0#05 41*+|f !0#0#0# 0 Y 'W2W2W2W2|X2W2W2W2X2W2W2W2P GPe A$ <   $  (P@0 | 0-0@LP$LP <0LSL!0! ! -LMQ`&R"Q W 0\: c\pGPVWpG @lV@1  `d{VPwdtdFFFF -LMQ`&R"Q W 0\: c\pGPVWpG @lV@1  `d{VP@d=d F l `q0V  0P 3 "R @+ RTd 00 R0 0#0Qh`0l 0`0  `eV00 Q030"S@VL5 ,0S <,SJ< KY\K<K yzh0Q0 0#0QP 060#0 ?.P ?.&"(  ?.!@ b("(00/>P 0j0#0 ?.P0 ?.&"(  ?.!@ b("(0/>P 0\0#0 ?.P0pm7$r~ r|rl @@0S l? 0S 0/>1 0 ?.! s0PE00l p&Gh 0 `OkAl mP 0@ 0pT갿22T^IX^Il ]l -LMPp`@0@@T@000` 0@0DqT000@-@T`pP*000  000000 !@T:Tnp@-^@P%*`0 13R0   "7! 4<4 4! >! b1! `` ^:p p-L M``0@P$K 0 Z0$ $0K  00 Q FBppMLF  0 00 -PULMo<p` 08 d<$K4,@(< "4&< 0%$o< 0 0P(@ 0SP@7(  000 順 -LLM`V\ ` d0 LK 0 P H PP>T 0 $@&LT0 PPp,0 S T  0@ 0@hLT0 Ͳ PP7T  p`;"P)SP@ 6" "ppq&0 `L0 㡲PP"pSP@T |5 !" "QPPT0 PP`TL2PTUU<"`RP@ 4" "PPQ޹0 PL0 YPPyh 0h@ 0 fq㑡Pp0<0 l(`0P d@\`0` , Ġ \P̌$Hd, 8#$X`0$%Č\@S&,.# 4`$ 0(̌4#Y 0 84`T @ 0@`TT@  0X`0l0 ? # 0YP@T L 0hPPlT \l ՏlpWPPTP~hLPKH KT0KX@K8` , X @巭#PPpG P 80hcVW 00S 01RKSK K0Z0s \80S@ d`1l!P@P@\Kl!d1l!@d1\KTt tA\ \TT@ L0c RKZSK DxK0 0GWT L010#0HT0SZBL1 00c<6  80S* k"p4 YBPP $ 1010!1  UL1PLQ  0 0P! 0P!D0 0P1D0KP1 \j$00 @00aCSpt1M/KT RKSKK0B0sg`1S\T0$ p @~\M_Kd1\l!@0^0P00Sp  X1R3 GTA \NL0T@! ZRKSK xK0B FWLT L010#0HT0S pKSK 0PRK KSK0 T1RKNKOK SUP0@ @{KNKOK EUP0@t08Q0t0 <0  0`S0<1 <4(<"4!<0 <4<("4!<0 ]KNKOK UP0@8QKgMKNKOK UP0@7t08Q0t0  <0`S0<1 <4(<"4!<0 <4<("4!<0 KNKOK TP0@8QK/KNKOK TP0@< 00`S0<1 <4<, 4$!< , !$@,,@0KKNKOK TP0Y@8QKNKOK TP0M@8Q< 00`S0<1 0,$,!$#, KNKOK TP0/@8QKNKOK vTP0#@8Qp<@00`S0<1 0,$,!$#, UKNKOK XTP0@8QKNKOK LTP0@8Q9< 00`S0<1 0,$,!$#,*"* KNKOK ,TP0@8QKNKOK TP0@8Q8!< 00aS 0<1 S<4(<"4!(1"(R:#:0 x1 Q <4<("4!<0  Q <4<("4!<0  Q <4(<"4!<@ K Q <4(<"4!< 0  Q7 <4(<"4!<0 q<4<("4!<"c1100 "KNKOK SP0@ `NKOK TP0} XpMDNFMM'NKNKOK SP0G@YKNKOK SP0<@ -LiMiPL0@@,  ! A 8p,q p +  00dS01 80,$,!$#,R L0HpTpeKfK 0nK@RkDX L010#0HW0SN! 00`S01  lK G^L@!`H00bS01  00`S01 0,$,!$#lV?pVHpW L0TpKeKfK 0RDX ҎW L@10#0HW0S <7 ,0S ,,- q aKaKgK`@KlK 0p @` VpP \hW/ L0Tp nK^eKfKX 0@RCXW L010#0HW0SfoK_/Ke?K`PXKeoKfK 0` f@@lK@7YT0lKL0T 0$Pp BWTp L0 \ 00XDnK^eKfKX 0@RCX:W L010#0HW@@Tg_/Ke?KfoK`X_\ 1 00c<  80S 㵥"`x>P@ h !1 01!  ៥1@0A 001 0 0 01 # 01 lK  ']QB1 00c<6  80S* v"`|d>P@ l !1 01!  `1@0A 001 0!D0 0DFK X$00 @00aCSF/Ke?KfoK`rWfK_/Ke?KkW$00 @00aSr1 00c<4  80S( "` >P@ 1 01!  1@0A 001 0 0 01lK 0 1 h$00 `B00aSKeKfoK 0B `FK!1 p_K!1 L@oKeKfK 0B JbK KaK IQP0' pf KaK QP0bK KaK 2QP0bK KaK 'QP0pMFMMM -LSMXWL0@@PX \Q , @ D! H1  A ,`La 8唠KP T `Q 1  00dS0 1 Ū0,$,!$#,R L0HPTPKKHa@!KMK 0 `AL^ ᪌L L010#0HU0S#!  00`S0 1 `lK [L0 ! P(00aS0 1 Ep`#"@=PP  10 1``a "@\<0$0$ R 1 0+10 (`,`"`4 ,:PP $ 1 01!  (1P0Q 00 1 0 ad0 0( 1d0 1 (a T`0Q00U41 QS, HQ H 1 00c   80S X1P,`, X0"@9PP 7 !! !岡٠ؠ"@9$Р$ R 1 0+10 (,KKKK KP0`KK LP0KKK KP0`AoK` aBKCK!0@PKKK KP0`a?pMFMMDNM L0T-ZKa|![_KK 0`P ;Z mL010#0HY@@T ,0 S  ,l%KPM/K0^KP^O[_KZKNK|! 0PP @L^Ka|`lK]/K1` QP2 L0T!|![_KZKNK 0PP @j;Z Y L010#0HY0SKKM/K0 @OZKa[_K|!K 0`P Qjt80 S QUS Y6 YT L0# AQ[_KZKnK|!x 0p;Z ԅY L010#0HY0SeKKM/K0 ZK|![_KK 0P ax1!@3PtX1 3Z PA T  0S00  QnK`U?KQ  @1UKt`@A 0cQ=6, 0S  0S,00 H 0R,0# R (0(S 0(  0$0(@(0$S  R$0$0$0 ( R (0$($(QH0SH ,,q7F -LMpOL0`@P$  , " 2 a R Q ,8  R (R /  0@nT01 Ŭ0,$,!$#,R L0HPTPKBKK 0 @4Z ^L010#0HU0SQ!@0@`T01 b lK NL@Ya! 0@bT01 G 0@`T01 10,$,!$#lV?PVHPU L0TPKBKK 0 @Z4Z U L@10#0HU0S 0= ,0S ,  K`@  @^K zKlK 0{OKP @GPP $^ OK" 2 U7 L0TP) $\Kx KoK0P ` 4Z ~U L010#0HU0SKO/K0`GP ʻBK KoK0@K⍹$P3 ! 0@`T01 0,$,!$# P P#  ^ R00R@@T0BRS Rq  R kPP qoKvK 0K PP" x R0L0TP  BK0@KOK @3Z; =~8K01 :0zKQ 1  PP@ "01>؁UlK@HT0lKL000T 0$PP$ $\ (U00^00SK" 2 UTP L0 $$\ 00TD^xBK KoK0 `%3Z }U L010#0HU0S$\Z UD1 00c<L  80S@ ]"PK.P@  !1 01!  G2@0B 002 0$0 0'2$02  30lK  L K0`^GKO/K2`Fx$00 @00a#S1P(00c<v  80Sj "P-P@ 1 01!  2@0B 002 0 0 02lK 0 2 {L1 00c<5  80S) ͔"P-P@  !1 01!  ᷔ2@0B 002 0"D0 02D0K2 oG$00 @00aCS$00 @00aSʊtKK GPPK" 2P˹L0PTP K 0P`.qK容L0TP kڹ .qKP㝹ιvKq/K0K:PP.(P} K⎷tKK KK" 2(R Po尹x.؁P& tqK0s 1 R<" *PP `K0Kb" 20KcPPI SD0s@္a 0@`T01 Ŭڄ 0R  0@`T01 n 0RJ  0@`T01 3 0R  0@`T01 0R  0@`T01 Ų0,$,!$# P Px a 0@`T01 a0,$,!$# PU Pv| 1 |  @`T01 <4(<"4!<0 <4<("4!<0 W0}K{KK ?P@ {P!1SqK1P Pꥸ׸pMF MMDNM9I̸-ǸK"0}K{KK ?P@|0a0|0 @ @`T01 <4(<"4!<0 <4<("4!<0 h0}K{KK ?P@aKW0}K{KK ?P@@@0@`T01 <4<, 4$!< , !$@,,@0K0}K{KK a?P@ca0}K{KK T?P@Va 0@`T01 0,$,!$#, 0}K{KK 4?P@6a0}K{KK '?P@)a@0@`T01 0,$,!$#, 0}K{KK ?P@ a0}K{KK >P@a@0@`T01 0,$,!$#,*"* d0}K{KK >P@a0}K{KK >P@aEP!@0@`T01  tKI^( 0}K{KK >P@^P0}K{KK >P@!@0@aT 01 =0,$,8#$p5*"%R   <4(<"4!< :#: B0 Rf3Xf3`f3`f3Xf3Xf3`f3 0,$,!$#q 0O K 0,$,!$#< 2 0}K{KK A>P@C0$ 3L@KK K 0P0}K{KK #>P@%0{KK >P@a0}K{KK >P@KK K 0Pk0}K{KK =P@F -L_Mp@0P`L" , 2 Q b a 8 ,  " /  0@nT01 0,$,!$#,R L0H`T`~K}KK 0 .X yL010#0HV0SP! 0@`T01  lK HL@Q!@0@bT01  0@`T01 š0,$,!$#\U?`UH`V L0T`}KK ~K 0P}.X 1yVo L@10#0HV0S (m,0 S  ,. b RK `@zKyKKlK 0a P@9A`P=V4 L0T`%}KR K~K0  9.XxV L010#0HV0SfKM/K0~oK@AP }K~_K xK0PP! 0@`T01 0+0aFV^ V|k^K⤳Q 0@`T01  @˟0R  0@`T01 ł ˟0R]  0@`T01 F ʟ0R!  0@`T01  ʟ0R  0@`T01 0,$,!$# P P Q 0@`T01 r0,$,!$# Pf P9 Q!P(0@`T01  <4(<"4!<$04 40 1S`V` V 'P`oOKK0K P`!*0  ! K! ί`*V1VA fK"2 PVT` L0 K K}K~K0P )-XwV L010#0HV0S0~_KM/K @1 00c<C  80S7 ]"`K(P@  101!  G1@A  0 0! 0$0 0'1$01  30lK  F K~?K^A$00 `B00a#SlK@LBT0lKL0``T 0$P` WiK"2K`側K`gVxSuO)oK[9HjKo/K0KP`><):0{K zK b;P@ /wP1SoK41P P ;8)3t 1 t @@`T01 <4(<"4!<0 <4<("4!<0 0{K zK ;P@Kc0{K zK ;P@t0Q0t0 0  @`T01 <4(<"4!<0 <4<("4!<0 W0{K zK :P@{QK(F0{K zK :P@k/@0@`T01 <4<, 4$!< , !$@,,@0K0{K zK :P@@Q0{K zK :P@3Q@0@`T01 0,$,!$#, 0{K zK u:P@Q0{K zK h:P@Q@0@`T01 0,$,!$#, 0{K zK H:P@Q0{K zK ;:P@Qo@0@`T01 0,$,!$#,*"* P0{K zK :P@Q0{K zK :P@Q1pM F `I'DNMMM0{K zK 9P@MK"2 L@~K}KK 0 x0{KyKzK 9P@sQ0yKzK >:P@iQ=0{KyKzK 9P@] }KR~KK 0 P0{KyKzK 9P@D -LiM\PL@@0!  , 1 A 8 ,` !  /  00dS01 -0,$,!$#,R L0H`T`eKKfK 0 ~*X 2uL010#0HV0SM!@00`S01 lK \DL@! 00bS01  00`S0„1 0,$,!$#|W?`WH`V L0T`KPeKfK 0 2*X tV L@10#0HV0S ,0 S ,  K aKgK `@KlK 0@ <`P Yk FK!1 V@80SZ <0`QVI KP@ ᆱPY1VT` L0 YxKeKfK 0 )X|tV L010#0HV0SY_KeKfKF/K1q=_K!1F }z K`ᯖQP` iL@rbK KaK k8P03 `7t KaK 8P0bK KaK T8P0bK KaK I8P0pM,F -LM`L @@0p   , " 2 B r r p q 8,倠   s /  00dS02 0,$,!$#,R L0HpTpK.KK 0 )X sL010#0HW0SM"@00`S02 lK BL@" 00bS02 w 00`S02 c0,$,!$#\U?pUHpWG L0TpE.KK K 0P(X sW1 L@10#0HW0S ,0 S ,| K  `@ K-^K@Ġ @KlK 0@;pP ^ K 21 W7 L0Tp ^.K _KOK0P @z(X/sW L010#0HW0SK.K0P@*<K/K0P@!<P 1L0 / " 00`S02 ť0,$,!$#,R L0HpTp.KK K 0P.(X rL010#0HW0Sd" 00`S02 ]K BL0U" 00bS02 D 00`S02 -0,$,!$#,R@L@ /K  `@KOKK 0 @@ :pP ^ K 2u W,A(QT 8 R80 Q S R 3T T0Rr ^Bpp FK{Uf WTTKqwp4}`W$PHP=r4L$WTp L0 ^.K _KOK0P @'X4rW L010#0HW0S^ K.K3P@,;K/K 3P@#;K 2  /K 2 '$P #R W 0, KFOK@p0S 1R<P(po (QBpp|0S[ #R_3Spp\SO|0SL R80SD #RppN8 @Kٮ׮[ծ #qHpPP1S0S+忮h#K差嵮4岮4#꭮ꫮKK 5P0 p{qK 6P0KK 5P0K.KK 0 qKK 5P0No L@K.KK 0 K-KK b5P0-KK 5P0~K-KK N5P0c.KK K 0P?K-KK 75P0pMt0R0t0 0  0`S02 <4(<"4!<0 <4<("4!<0 KKK /P0g RKHKKK /P0X  00`S02 <4<, 4$!< , !$@,,@0KKKK /P0. RKKK /P0" R 00`S02 0,$,!$#, KKK /P0 RKKK /P0 Rq 00`S02 0,$,!$#, TKKK n/P0 RKKK b/P0 R8 00`S02 0,$,!$#,*"* KKK A/P0 RKKK 5/P0 R# L@KK 0K 0PpMXFDNMMMKKK /P0{ pKK {/P0rR]KKK .P0g AKK 0K 0PKKK .P0P  -LMp_L@0P `"  , Q b 8 , "  .  0@nT01 00,$,!$#,R L0H`}KT`~KK 0 X qjL010#0HV0SP!@0@`T01  lK 9L@Q! 0@bT01  0@`T01 0,$,!$#\U?`UH`V L0}KT`~KK 0 nX "jV L@10#0HV0S 8,0 S ( ,  R b PKR zKyK`@KlK 0a @PP*2`P \j MK "2 V6 L0T`( ~K\}K xK0B XiV L010#0HV0SfKM/K0~_K 2P ߦ }K~_KK0PK⢤bV Q 0@`T01 pk 0R  0@`T01 Ū 0R  0@`T01 o 0RK @0@`T01 4 0R  0@`T01 0,$,!$# P P Q`H0@`T01 ŝ0,$,!$# P PM A0T0 % oKNP *\`P VT` L0 }K^ X~_K xK0P gXiV L010#0HV0S\Z VD1 00c<L  80S@ 㟀"PP@  !1 01!  ቀ1@0A 001 0$0 0X(1$01  30lK  8 K~?K2fK~_KM/K2 1$00 @00a#S1 00c<v  80Sj F"Pt4P@ d1 01!  01@0A 001 0 0 01lK 0 1 71`H00c<5  80S) "PP@ 1 01!  1@0A 001 0!D0 01D0K1 2-$00 P"00aCS$00 `B00aSʊ}K K~K0fK "2  C@Ko/K0KP`AlK@2T0lKL0``T 0$P` K "2`t 1 t  @`T01 <4(<"4!<0 <4<("4!<0 0{KyKzK ,P@ gPoK1P PߤݤۤK6l0{KyKzK +P@Ut0Q0t0 0  @`T01 <4(<"4!<0 <4<("4!<0 ,0{KyKzK +P@QK0{KyKzK +P@ 0@`T01 <4<, 4$!< , !$@,,@0K0{KyKzK u+P@tQ0{KyKzK h+P@gQ 0@`T01 0,$,!$#, 0{KyKzK H+P@GQ0{KyKzK ;+P@:Q 0@`T01 0,$,!$#, e0{KyKzK +P@Q0{KyKzK +P@ QG@0@`T01 0,$,!$#,*"* (pMhFDNMM0{KyKzK *P@Q0{KyKzK *P@Q!@0@`T01 0,$,!$#,*"* H0{KyKzK *P@ꦣ L@q0{KyKzK *P@00yKzK +P@Q0{KyKzK *P@0{KyKzK *P@ -LiMPtL@@0 p!  , A q 8 , !  .  00dS01 r0,$,!$#,R L0HpTpYKeKfK 0 ZX fL010#0HW0SL!@00`S01 ,lK 85L@$! 00bS01  00`S0„1 0,$,!$#lV?pVHpW L0TpKeKfK 0B X eW L@10#0HW0S ,0 S ,X  KT aKgK `@_KlK 0@L -pP ^ K!1t W. L0Tp ^xKeKfK 0B XteW L010#0HW0SMKeKfK K0m.P }lA80ShpO VK`hl1PG ;9P9WTp L0* KQeKfKx 0B |X1eW L010#0HW0Sn^jMKfKeK K1P&.^KeKfK 0RMK!1 )'hPp <0ppWV/Kp eL@@KeKfK 0RbK KaK )P0 pd KaK s)P0bK KaK (P0KeKfK 0 bK KaK (P0pMtF -LUMpDL@@0d 0! 41 , ( , @ , 8 08KJK  80S2 v"P8P@ H1 01!  v1@0A 00 1  10 1 ?L ?  H(EC$00  00aS0\ KP(1@00c<F  80S: v"P P@ 1 01!  v1@0A 00 1 0 0 0| K0(" !# ! |@<4<("4 <0$00  00aSʺћL(PXL0T%K@,0 S 0, K)K 㥏K 0@2KT"0"2KɱP̒ZT L0 TKX)K 4K 0@  Y UZ L010#0HZ0STZ1   80S Om"`=PP  1010!1  9m2PR  0 0" T 0400 0T22400T2 h 2/Qph &67,$, $,#,% "2OSh & 6<4< ,4!<.% 02ȟ/Q2h p&67,$, $,#,%  p<4(<"4 <0(p<4(<"4!<$0@<4<("4!<0p,0 50<4(<"4!<0<4(<"4!<0<4(<"4!< 0<4<("4!<0T4R$0 00 @00c0a<\Q1/K)>K K)K⥏K 0@@K K mP0L TKK K P0wKK K P0eP@;'@0;@ p4': l0@xtp@@@|@@= h"P` 012 02!  h0  0&ah"|P` l !2 02!  h0 @, 0 a 0 R 1 /0 R 1ee/`ZP@fh04 #Rx6`00t"%" #0Z0R00S  R R?h:03@9hq< P0@00##)h"P` 1 !" "@@A h0 0 `P@Ah"P` 1 !" "@@A g0 @@ !Y@DPTg"P` t0 !" "@@Ag0 @0 H`P@ INMMFF 0-LM@P(\|x |00\0\m0@0 R 0S$0,@0$0 R0pMFN -LMP@ T0P0_hY p-SL M`PA $0: PPU@0$0\0- 0 @\ 0YP@ V  00 $0@0@$0Tt #T T@p@ @0$0OpOp 00F F -l5LDM0d0 `T R` ) zPP 0S$0PpW @ 줟0$O 0@$080$`0uPP$0@~`0Se l4dP80 ,P L0 XK\K@H K0X@ D[P\PO0V0#U00S $0C#U U0S\0SX03 U0S PPL08 0bL0 UU u O0 U0  00\PPPP 'U N00/NL0KT0 P@@0K0T K`PH d 8 P DP 4P 0 , XK 0@ H KX Z0V0#P00SP $00,h Q,2 P@0 B#U U8 R9UL<4(<"4!<!1RL 8 @@H K0X ZP#PP p Pp8Qm  L0 aL Pb 0((!PW0 b0t PpP <PP jPpW 0 0d 80 , L0 XK@ H K0X@ HZ#PP$0 NL08 0bL0 ; pMNʚ;4F\FNdFFF@B -LM`P_P@Z 0S$K( K@T Tt #T \0P0S$0 $P(0,0 0  a^0 00 Ů0"S Ÿ@0( M$0 2@T 0S 0P @TŸ@0( M$0 (0 0,  00D"00S9 440(!014 p1Sd S]h x0 B100 0 $ 411h  411x  0L0$080x1000/, 0b0p0W P:Ð0$00$0 ,B $0 40 8!h0N0h04 ^n!x0CN0x0T~ T 0S1h x 04K,K0K YP(S4 C%M4, NNNN^INh^I@BF -LM YIY@d h P,@ l @ 0| 0 dPt T0qh<@pPlY4`x   0 Yp 0D0 @ | 0PS010H0 HDL0 @pPh@TKPK|l @P DPT0S T0̧ 00lh0e0(0 1 S0$0Ř7$ , 8 @0 tGP P=d`ǟ0P0``P0 Sb T0SX .d\0OX0 XX) %d R00000 d$  $ 00l" K0 `Pw\0 X$0@0<0$  $ v@0  0Rb0801'  80 S $00c  _KY 1000  B!<4<!4"<0LS 0 B0 0  0i0i$0C0C%60@KL0 xP^DK<@KHK LK 0@K|  @Z P LhJLDKHK| 0 P NIpMNuMh^INNN'pMFFNHNFʚ; -LM@, Ob"P<=P` ,$1 01    6b5@ pT\%000X@<4(<"4 !<%00IX@0C 1. Sx5  " l%<4<("4!<0 J B 0S0` p0XX @0 4  4  L0@000 4""1b!,0 b!LPU 0S PUPPH0HS &4&4t&4'4(44030X0 1=  80S- a"PP@  !1 01!  a0@ 0p @0X 0 r<4<("4 <0 $000a S 0 0c<4014  80S$ ea"PSP@  !1 01!  Oa0@ 0p  @ 4$ =0 $000a S 0 0c<4l<0 S 0PR UT 1 3 01 00c<9  80S-  a"0P@  !1 01!  `0p 0@ 0 @ 0 000<4<("4!< @0$00 00a S1`"@x$`$ R 1 0 +10 ,(<`8`MMMMNNHNNNN =@NM -LM`3`V 0@S% `V,K]x3( P`?, Ub H R 0S0S3PU }` 3l$0< P$00$080S080  4 21SdP21 80SP0Ҕ0$0 , , 0Rr(0R @ 0@$  $ T0S 0dS,0d0,0ŔPPU 080  0C `S0S0 $0 0Ry! 0HPr 0 0   `0 0  P Pp_ #P] \003Y$  ,0 0dS,0d0,0$ 00S0<Ӑ00P@ 080> $ 0<0 <$0, 0$0Sh x0 B10d1h x ]@BNLNNh^I^INʚ;NFQ $00@R P 1$0 0 RA -QLMp`   <0@@  PUĄ 0D PF X00@ 40FI -0L htF -LM`pP@0  < @TÅ 0H @ X40P 30,FI -0L h4?8F -0LS@`p @0S`V& 000nRP1P!00c<  80S U  00 0I000 $000 0bUHF -!LM0`00$` PpU& 0& 0#pPUV D!U000 $0H $ K $0 0$0 PUF` ^"@P` 0 !! !岁^ 000S y^"@Tg$q^$ R 1 0+10 (,<`8`^I^IMMM -L4LNMMTN -LZR H R 0S0S 0T \0 000Z ,P0 0 0, 00 UF0,L0 0X0 04 P P \T0S LS: ,\1@K<0@ Poj?R5FH R 0S0S0 T0 \ #F\ RF, KPE 000\0 00\0 㙢0,0 1 R,0,_.,0<\.X,T T R\0S*,L0 D0S !D@80Kp8 R P! P@0`,P``:,<P @BXNdIGLN^INN^IMMMd^I\NdIGG,8D0Vό`@0P``,0,8@PT 0@PT0 ERSX 0R@0P P0S 00 ,0 <L00 R~,<0S6,P1 Z, P RzZ/,lE R00 p1 0 ]E4D0 00CS0 -FE,"<0@ 10C1<11<0! 8\ <0<0, <8<08, <1 01, 0<00,<{E, (0S , $04$嚡$ex5,X,T { Z-s1$  80S $00c  -@T 1000<4<("4!<0CS 0 B0 0   0`0`$0C0C3 Rڴ!,K80K \, <0S08003 00D0`,08 0 D0 0D \0!D0d  P 0T0 0S 00,0 D ,0 TT HD jh!PDH| PQ,8 KlT \ 04@00 %D0 0P0 D0  4oJD0opA00 p0p00wo p-LM00P0U`00 ,0@0,0 @@P<ᓅ0S9,$,@T  PR 0 0 0 R000 0 0  3㛠U@DH PR @T$0$0$0@剠T 0H0phCO,C0 @ 10C11,1 8 R <0<0 8<08 1 01000t (C (0S , $04$H$  %4pMMMD00CSD000 2R0 00  0 'LN -qL0dP00a a@T 00P RR0000 02 U@B P00`70 002 P@ 2P0 000 R 00000 0`7@w 000 000  00M TdNLNXN\NTNhNtG p-`LM0R0P @0 R00 0P00 L0 000D008  0S000}\0 ` c2b3c!` 00/, 0b0p|J -LM 1S  Rzc !0q0 00SXpa Q@0 `!@0SP PU  R0000 0 0  ŎPUX 0 ! 0C0d@Bl@`T 0 00S @TB㢎PTxO00T000 006 <00KQd p00p0lNdfINNG -0L{ pM p-LM`@1@STP$ 0S0#S03PaU0| x0PEדUʥ/@  P@T00SpP/p 0SlN dIԣ4G -LM@P`0p1000p!< TP0`10<0 20 . 00 0 0020Ȁp00 < %`20 P1P`0V X0220100 0  QIGG -LMPP`pX`1 2  b!@T 0S @T T !h0S Q00000 00@@at<4(<"4!<  ,K0$|l ,0Sp  p (0S 0PKl000p000p0qkLuMG -LMPP R@80 , 0 p` P@   0 0n S000 P000@,K0KP0,@0 q) 00n S 000 x<4(<"4&l<4(<"4!'|, $ ,8 fQa#$,̂KQ< ʜ1 QOPࠈ R 0 0 0 R0000 0 @@ 4 0l<0h0<xt 8e@  0PP 00 c!0S0 !0"0c0 0"0cP 00 c! 00|3 せࠈP4K,K0KP0q4|uMdIkL -LDML q@8 L 0P T  ,0KP ,00X0 ЧY\ 张 0 ǟY`@0 D P`0K`X 0CYP4  X!<00 00c<  80Ss X < 4KBP8K\T0<@K@PKX @ PhP Y X<0H @ 0aS0@0 0,$,!$#<Z<0@ Y0a 3SY400@0 0P0 0R 0Y} <0<4<, 4$!< , !$@,,@0p;P 0 <4<, 4$!< , !$@,,@0pP ;0 <4< !4"<( @@"0/, p[PP`$;0<4(<"4!<10$D<4<("4!<10LP ,0R TZ $L0PZ P LBMX L0P D A8'Xd\P<4(<"4!<0<4(<"4!< 0 <4(<"4!<0<4<("4!<0Y 4 DKP0DG S=8P R'0HK bP0HX "DK P0D1@00c<L  80S@ X  ?"XP@ H1 01!  >X40@04@ 04000 000 000000 X0 <4(<"4!< 0 X0,n$00  00aX$00 @00aX1 00c<6  80S* >"P@  !1 01!  >40@04@ 04000 00 0 000 000 X0$00 @00aSX\ T0 NMMG -L4MğP@`p,KH L0 D 0K`0` U {="0iP@ 1 01!  e=U500@0@  0 0, 0,0 0,0 0,0 <4(<"4!< 0 0,$00 @00aU$00 @00aU VNMMG -1LeM`1UK J, QOKLp 0Pg xQ@ MK0nK0 R0@@@_0 07P@F:414`PP< q@t 0 ,0S ,D鸠K 0ʊP  5oK@Q_18!0BP@!0Kh 00[H i0`!@0pM dIHG -L M$, 00  # ㊕p0q0]d1d! 0 dh0 0@0`}?`@<00~?<0 0PL @崐  p2Z MO0Z  X ,  ` 0RX0T  9 40 P@ ʖ,"IN -LMA0 pp5R`0 P0 P0S D`PP 0500 50`f"0  ㎖pMTG -LM0KL @ ~P0   Q-LP`p# @T T0S}P `@Tl0S t^\  0~0Sp _- -LMQ@P2P PF0 宱V@;-R 0S:\/P@VWV 0/h3 ?0 dIN-- -L Mp`P 0K@S$K (K,K0` Pp q$! -L0Mp0T!0, $0 80S:SFSD R? ş@0`(KP``H 0, !<00@ 0`0c<!  80S T< ,K P@,1@00c<  80S 8"@ PP 1 01!  8,0P0,P 0,0(0 0(0 0(00(0 8 <PPRk  P@ P<4(<"4%<0 00K4`K8K ` P@ -A40@p 8 0aS080 70,$,!$#<&T4 8@00aS080 0,$,!$#, R @0  T A8"D/PP 41 01!  +8T:,0P0,P 0,0(0 0(0 0(00(0 <4(<"4!< 0 0,$00  00aT$00 @00aTI DNMMG p-LlMP@8`0AQS]0 PU !0000 PH !000<!  0 ,P wB008 R 0 |K{PL0000p0  0|K{P L0R 80S 0 P GB0 + p\G -LM@`8PUp , T0   0 'G<0<0,00㨀<0 P异 -L,MT0!0 |;<HPPß@0`W D P`,K 0`W@0 !<00p  00c<  80S~ W(< 0K pPP 04K8@K T /"P`  !1 01!  /Tv00`00` 000,0 0,`0 0,0 0,0 <4(<"4`!< 0 0,`_$00  00aT$00 @00aTC1@00c<5  80S) /"@ P`  !1 01!  /00`00` 000,0 0, 0 0,0 0,0 $00  00aS -LM pT0! 0<0  ` ` T0$  00CS80S0 0 `A 0 P` 0 M00P@@T 000  pP0P60 @ 0@RsPP VP _T 00TV 0K00 0GsPT 0RT bCQL >T 00`P 0@0S H $ 0K `` P !<00@ 00c<  80S Ts< KKP@Z_ʔ 0!@ 00c<P  80SD T KK 0P@ K0圠KK  P`h ae 0娀 @ aP00 N0,$,!$#< K  K0P㨀<V& V& 0S S\ sQQ 70V00S T0$ ``Q  0;0000  0S 0SX00 A`0K K PP @  0aP00 R0,$,!$#LT@TژH`]0@ l P0 P0 , 0P0R00S   <S T 0Ki}P`x00Q0 f 0  aP00 N0,$,!$#<<0崀  aP00 %0,$,!$#<0 ;R0  Cs060K  K0P㴀 c0K K PZK  K0PQ 0K K PEK  K0 P:  Pt <S#    r060T 0K|P`0 0R0 0 @ aP00 h0,$,!$#P`F1 0 0c<G  80 S; T +" 0PP  !1 01!  +T0P0P 000 0, 0$ , 08 #$000 *,0 0 $00 @00aT$00 @00aT?`NMMNG1@00c<J  80S> T 6+" d$PP t1 01!   +T0P0P 000 00 0000 <4(<"4!< 0 0,G$00  00aT$00 @00aT,1@00c<5  80S) *"@PP 1 01!  *0P0P 000 0 0 00 00 $00  00aS%P 0@ R  0;0^  P  3p 0KnP0\ R >0 \ 80S ur80S  0 jr -L4MT0u`@0P` 0D0,KH L `  04Yp0 !<00@ 00c<  80S Tu< 0K 5@PPHH L08@K4K T )"4PP $1 01!  )Tv00P00P 000,0 0,0 0,0 0,0 <4(<"4!< 0 0,G$00  00aT$00 @00aT*1@00c<5  80S) H)"@6PP 1 01!  2)00P00P 000,0 0, 0 0,0 0,0 $00  00aS >LNMMG -LLML T0` 1\0 \T /R00Y00SX TPT 0@'Y\0, P  ^ ࠡ,0KP Y`0  !<00p 00c<  80S W.< 0K,KPp#01@00c<  80S  ("PP@ 6! !(00 @0@ 00,0 0,P 0 0,0Y 0,0 `P 0,$,!$#, L  <4<("4,!<. O0 L04K W '"P<pP@ ,2! !l'Wx00 @0@ 00,0 0,P0 0,00,0 P<4(<"4!<0000,$00  00aW$00 @00aWq1@00c<5  80S) &'"PP@ 0! !'00 @0@ 00,0 0, 0 0,0 0,0 $00  00aS TNMMG -L\MTL T0 X LL0l 0 \0 P0O T ^00  Sd P ` h \^1\ 0@*dPX0 X0U X 4 ,0Kd`\0 N !<00p 00c<?  80S3 W0K< ,KPpd0S| 01 00c<p  80Sd x&"P fP@ |9! !b&00 @0@ 00,0 ,P l 0(", # , L < 4( <"4(,<"0( PP P<4<("4!<0 L ,0KP@ LP04K8`K P < 0aP0<0 (0,$,!$#L\@ 41 U XQ LF|0 X0T 0u X ^4PK 0PP P0@K 9P@@0< bP0<0 ŷ0@K %P8@0@K P@8@XHK 0H PHX  0,$,!$# U " 咶P@  1 01!  U00@00@ 000,0 0,0 0,00,0 <4(<"4!< 0 0,$00 @00aU$00 @00aU1 00c<5  80S) H"Pd 6P@ t 1 01!  200@00@ 000,0 0, 0 0,0 0,0 $00 @00aS0NS$<0{b YB-D 3 0-LM@ 0KPP 0sRd0sB -LTMT TT X L  T0\ !\0T@0Q` `d h  \\0h  0@ Z  L ( Z<  X,0KZ`0  X!<00P@00c<  80S UH< 0K,KPP\900!0P 00c<*  80S U 0K 0,KPPZ0 01 00c<$  80S l"PTZP@ D1 01!  V00@00@ 000,0 0,0 0,0h0+,0  4001 00c<  80S 3"Pp !P@ ` 1 01!  00@00@ 000,0 0,0, 0 ,0R0,,0 H00,00000 04K8pKP@ 1 01!  :00@00@ 000,0 0,0 0P%,00,0 \ V  "p8P@ ( !1 01!  Vv00@00@ 000,0 0,0 0,00,0 <4(<"4!< 0 0,m$00  00aV$00 @00aV1@00c<5  80S) "`囬P@  !1 01!  00@00@ 000,0 0, 0 0,0 0,0 $00  00aS壳NDNMMG -LMpPT T0 R@` `U 8T88V`88T T0R@0S0 R80S  Pt Z8 @ 00 0 +x` }Zu xZ80ST 80S ~'{' p-LMP` @ 0P@ `p -LLMTP@`p X P \  p000L  H T ,0KǺX PR0  !<00`@00c<  80S V< ,K0KƿP`5Z00!`@0 0c<  80 Sw V#0KL  0,K⩿P`X R 0 V  "(P@ 1 01!  Vr00@00@ 000,0 0,0 0,00,0 <4(<"4!< 0 0,nX$00 @00aV$00 @00aV=01@0 0c<5  80 S) "`囩P@ 1 01!  00@00@ 000,0 0, 0 0,0 0,0 $00 @00aS1@00c<G  80S; V j"XP@ 1 01!  TV00@00@ 000,0 0, 0$, , 08 #$,00,0 *,0 0L $00 @00aV$00 @00aV1 00c<J  80S> V "` <P@ , !1 01!  `Vw00@00@ 000,0 0,0 0,00,0 <4(<"4!< 0 0,s$00 00aV$00 @00aV1@00c<5  80S) "`堨P@ 1 01!  00@00@ 000,0 0, 0 0,0 0,0 $00 @00aS娯NDNMMG -LAT R8 80Dp <P$ aP0<0 Ő0,$,!$# T  "学PP 1 01!  T#00P00P 000,0 0,0 0,00,0 <4(<"4!< 0 0,#u$00 P"00aT$00 P"00aTZ01@0 0c<5  80 S) b "@|PPP l1 01!  L 00P00P 000,0 0, 0 0,0 0,0 $00 P"00aS1 00c<J  80S> T  "p PP ` !1 01!  T00P00P 000,0 0,0 0,00,0 <4(<"4!< 0 0,$00 00aT$00 P"00aT1@00c<5  80S)  "@尥PP 1 01!   00P00P 000,0 0, 0 0,0 0,0 $00 P"00aS4W 12嬬NDNMMMG -LTMP pd_T@0P 0T0 PX 0@0 Z000L ( Z<   ,0K\@ h d@ ?Z`0 P !<00@ 00c<@  80S4 T< ,K0K?P@^00!0@ 0 0c<  80 S Tb 0K0,K P@pZ T 0s 01@0 0c<  80 S  "@ PP t 1 01!   00P00P 000,0 0,0 0,,00,0 T 茟<4<("4!<001@0 0c<  80 S  "@ 奤PP p 1 01!   00P00P 000,0 0,0 0,  , 0001@0 0c<{  80 So  "@ oPP 1 01!  k 00P00P 000,0 0,0 0,  , 0001@0 0c<;  80 S/ K "@ 9PP 1 01!  5 00P00P 000,0 0,0 0,  , 00T (q : Q 01@0 0c<t  80 Sh  "@ PP 1 01!   00P00P 000,0 , ,0$ 0,0 T (<4(<"4!<0T0,<4<("4!<0T 0q 8 Q 01@0 0c<  80 S  "@嫣PP 1 01!   00P00P 000,0 , ,0$ 0,0 T 0<4(<"4!<0T04<4<("4!<0X  RN0hP!0@ 0 0c<?  80 S3 TP0K ,KX0wP@Zy01 0 0c<  80 S S "@APP  !1 01!  = 00P00P 000,0 , ,0\& 0,0 T0HƟ<4(<"4!<0  00 TP(<4(<"4!<0, r  5Ba<4<("4!<0T00,$,!$#, T4 r  p5RBa<4<("4!<0 04K8`K T F"D 4PP T 1 01!  0Tw00P00P 000,0 0,0 0,00,0 <4(<"4!< 0 0,媽$00 P"00aT$00 @00aT1@00c<5  80S) "@ מPP 1 01!  00P00P 000,0 0, 0 0,0 0,0 $00 P"00aSp ߥ -LTMT pP T0 !dX @0 X0 h P\ hT0H $ P<   ,0K`P dP |h`Q0  !<00P 00c<  80S Uz< 0K,K|PPX Rk00!P 00c<]  80SQ U 0K,KX0^PPh^n 0s) 01@00c<  80S 6"P $P@ 1 01!   00@00@ 000,0 0,0 0-,00,0 <4<("4!<001@00c<  80S "P P@ 1 01!  00@00@ 000,0 0,0 0,  , 0001@00c<  80S "P 宝P@ 1 01!  00@00@ 000,0 0,0 0,  , 0001@00c<S  80SG "P xP@ 1 01!  t00@00@ 000,0 0,0 0,  , 00(q L: Q 01@00c<  80Sv M"P ;P@ 1 01!  700@00@ 000,0 , ,0$ 0,0 (<4(<"4!<0,<4<("4!<00q 9 Q 01@00c<  80S "PP@ 1 01!  00@00@ 000,0 , ,0$ 0,0 0<4(<"4!<04<4<("4!<0 04K8`K U "l ԘP@ 1 01!  lUv00@00@ 000,0 0,0 0,00,0 <4(<"4!< 0 0,J@$00  00aU$00 @00aU%1@00c<5  80S) "P xP@  1 01!  t00@00@ 000,0 0, 0 0,0 0,0 $00  00aS 借 -LU00@00@ 000,0 0,0 0,00,0 <4(<"4!< 0  ẵ"$00 @00aU$00 @00aUe?PF1 00c<J  80S> U "L `P@ P1 01!  LU00@00@ 000,0 0,0 0,00,0 <4(<"4!< 0 0,X$00 @00aU$00 @00aU1 00c<5  80S) "P冖P@ 1 01!  00@00@ 000,0 0, 0 0,0 0,0 $00 @00aS""弗兝NDNMMMG -LMp  T0 10 `P 80 S  0 0 0S  Q : PU0S3 0 S   X ß0K+0 0 0 K  `K 0KP,3UPUF 0\0R0S> 0P:* 0A00  S303  50 5):oPP%<4<, 4$!< , !$@,,@P 0 0C0 `0\0P0S 0V:0SAq -Y P  U! 00`0U 0S  0 S  00HT@0 00<Y0 K 0K0PP  f_08 00 60,  8W 0 0S 0K }@P \0RpM'N'N -L\M0P `T @d  .d` ,T P p X0 $&  h 0 , \ |͟@0P Z D   40KߣZP8  P!<00` 00c<  80S V< 8K4Kߨ`Pl` ZG 81@00c<;  80S/ "`d 委P@ T<! !80 @8@ 8040 4@ 400 040  ,000 R,0S00 h00  d V "p4剋P@ $1 01!  Vv00@00@ 000,0 0,0 0,0 0,0 <4(<"4!< 0 0,>$00  00aV$00 @00aV#1@00c<5  80S) ?"`-P@ 1 01!  )00@00@ 000,0 0, 0 0,0 0,0 $00  00aS 5 V "@0弉PP 1 01!  V500P00P 000,0 0,@0 0,0 0,0 <4(<@"4!< 0 0,2$00  00aV$00  00aV婐NMMDN1uGp@-0 S P^ T `404@%,"p p-LM@d00\ PQ` 00<0`00 /<P e<PpopMG -LM  -LMT @@| 0 0K  \ @ 匐 @!@ 040\00S lPpU 00`\ @|0T0\@@T7 VPQ T |0S! #p0Y  'P Z@3 l0@ST<㨐0 <00"5000@oY  P Z2 00  Q00R0S 00@T00\0S0000400005tlPpU `Q000S@ VPm@T^ڤ@K 0aZx1@P( `VMx KQT004000 *0`V=Ipp00p00 l@ 0 00h@6 <005T廣&00x K40000QX0h4K /0@0T0 @T0Kl0@0l/R Q0K/GIG1uG 0-LM 0P@ 0 0 -LM@40< @吐80S 劐7GHG -LM0p00`2, 0 00d6 <㈠00P 0Y0R00S 00000d0p  p 20S ,Q004004 T30#0Y00S @00000eX0hK?lP<0 4K /0K<PlM00@<MIP@00@  <M0PU 10^ 0P d0T00lP000hPRP3L@AP G/01$0K00@Pc00,40000Kd0,0 00P400T Ң> MpM1u@G -LlM0@tK T0$  80S:S S 0K2P   0d ph E -LM @<<<(0 0HP0S0( 0 0`S 0! @B0 S@᫠Dğ 0P pWP aH Wd 1`X0dʡ0 p Pz 0d 1X0輡 ?PQT0$  W  0(0Z  RP0/000W00 0 z*Pp80 WP0(0ZP R0SI 0T0S> p WP%T0$ & 0d0!3X Od 1pX0^0  P  2 R80WP髋$ d 1X0@0 %"Q000Q 0 0000 0/0 X( T 0(0Z0Sڃ01  Q 00 @`K/P @yP0H00 @A 00K/PiP0 @DH f0(寉0G6XGhfIGpfIGGGGG0 R6lfI -L M0p00 00 P0, S j V@ 0,T@#[ V L#0S 0C0Ÿ 0P 0 T 0P@q0p` 0S  0 ܊V 0Sh0 0S 0Sh0Po0`0 `Ŋ 0 R 0h0 0 0 ` 0S00d0X0 0S``l0P0S 0S' P00SP0 ` 0S P 0S``l0P0S 0Sl0P0s  0S0l0P0ll00Sl0  ,0`@ 0P2DL#0S0__@L6HGhGGGGG -LM P@,`ᯞ0 ᫞4 ᧞0<  D 卞D@/">C2"/P!008BS@ C4p?#@W8 40$tDCY8 ,0 <  004,  `tT@,oP@1@#W<gP@1T@XP2@p"S 0 S08 SL3 R2PPP2@p"S 0 S08 SL3 RPX P"00 SPPP#00@ SPDp,@PD `P"‘\00pS04pS ࠡ`P PP ‘\00@S04pS ࠡ`P  - PL\`@pP 1PBt0 0Z廝8 0 T 1P-宝@ ẝ`,@᝝`屝VP3"0 SPPP#0 SP8 0呝`80 -LMPp  P,P ,@`VPUPa 0 P` ,@V,0M`VP 0 PP`,0UPV -L$M P@P8  T 0cSP0 \08 0 B0C0 R4 0 0 !d0 0,@K/@P@,p"H`0SD0 <0  3S @2 00O TZLT@ !<?\>`0 0/ ?> 00cR#p@e T84@0aX!<?\>`0 0/ ?> 00c4R#l @T@TZ!D!400C40 h!40040T0ZCT$D ?Q>`0 0?>0 0c$0@0C$0 P B 8 T 00C 0 D 00 T0$,0,0 $,F,BHU uM -LM PP4 pP0 00W 0 0 !d0 0/,@K@Pv,"H`0S 3S Y00W "0O00W T08 WsW@!40 S@TTK 0 0PA^"?Q>`0 0ς?>00c ^$00g$0 P g 40  0W0g 0 40 g0C40!400400 T咘$$0,U, #,Y, 0 , >Მ0 8 W00 ?Q>`0 0ς?>0 0c8 ^$0g0$0 P 4  00 0 40040, 0 , U uM -L M0 H<2, Q`0@o`T p Py 0Po (@80 P(c`0ZC  0^00C0 P B 00C0\%p1R6 |0P K/@PC0 %0` !PE50 RX0  200000C0 0 RT000T00C000,0  T0呠$$ 0 ,#800c@` Z"P U T -LM `pT1S0 0 !d0 0/,@K@P+, 4 40\"H@0S80  3S 4h$% 0XP0SPU 0PH0UC0SPEUT3Q, 4 Uʼ0 00 囚PZ l?>pP1 JZ  0   R 0 S\\PU b308 R`0 PP% U000  8 `@004:*0 WPPU @,  P80PU, 4U b80` `0PU GG(G -LM `pP4 PP00 0 0 !d0 0/,@K@P, ,"HX8  3S  0S 2 U0O<  0<0 ҙLO>X!\000P/ > 00cR#= 0<08 a1 ^Ϡ\0.QA00/ BP  1@R\0/ P5PV p1 X\0`000?0Q0PO PP 5寃0T $00.X\0!00> 00c# 00 0C 0  P B 40 P00C0 ,0W L0 00 P 2 020,W" P!0 0U uM@GHGlGG -LM p`0PR 0O0  0фK8T 0A0U2Sʼ@*0 $0X: p弄 0hş R00p  L0y00 00 !d0 0/,@K@P,,$HZ 3S 4 0O И00U 80A040 ?80 d448Z`0.!48000?.a 0 bS1P4 0< T0USZ% #@?T>`0 0/ ?>1LQ 3T`0 0?>0 0cZ$00 0$0 P R  0 0 0480  34R`008008?.a 0 bS1P< 0W 2 `R4 `0RA P00,$08 0a$08P×n 0 0n 00I000 P 000\%1R |04@P6@P.0 0` PE l1 RX0  2000000 ,1 RT000T000 0噃0` Z`0PB P! 0 R`0  0000 P 0 000\%L0R|0Pk0 (d(GGG GGU uMTG<G\G -LT$0h& -LM Pp,0 Wy*Ꮧ0 0 !d0 0,@K/@MP@, ,!H`X4  3S C`1 0O R414AQ\000?00p S28 - 08X\000/ 0100 0W0p50 0 0  P 0 P00 ,00C0 P B 20C 20< ǂ=S0 97U uM|GGG -L M p0 R `0O` 0 塂$0Qd*@ 0 P0 0 !d00,@K/@P@F,0!HP`V 3S  00X& T0@XT ?V>`0 0/ ?> 00cR#@^TT zTTH0` V`0Z"+ ,@,f局GGU G4 G -RLM`, p{ @q?Q1 Q`000.,0Ae8崁/.  b  B020!͓Pp1 @R, `08P/.  b  B020!ᴓP5 00`,,08P0 eS0Y`0.!00/ > 00cR#0@g0P 0 S P Q,0` ⷁX1, 0@ ᭁ8,0, @/>QU tfIRE8REP Gd G G GG-M$PP0gl0h `Qpb?>1 E   @$?p > 1^ࠡD T! 0  S \ d@E? >j1^࠱D T!@  LP \l0 \ 1 Q0 110b1X10l1$5S!0SL\ T3Ѝ?>1 E -LM P@P 0 4=00 尖85 0 00 0 @ R@  \00Y.`P@p ` P PP P 0 4R/ 0S:0S:0 @T00 T00S Yʴp ! 0(PUP@`l P@`  0S:0S: 0S00 / @@P`UH 8%0@L00 @R  P  /0(0   xK  0;P`T0$   Q@ @ Px0 / L 0x0(    ᑗ 0S:F0SC*@5L 000 (0  @ xK 0tP` \ /0``* 0d x0X2OT0$  0P 0x0  /0<H噑 @0@`0 |0K d K;0P`0 | Rڴ0` B| 1XPt@KU@ h  0 0 pd@G 00/KP`c`0GH@ |0QT @U@ pP @00xK  P`FxPP d G 00/`` d0X3O0 00 <H20d@K@`T $0 0  PlxdK0@/T  RQ@  aP`  @t0KRT|  00"t@KTP *0  z 00TP:0S@00 U@0 0n"D 0 Jh00dh0   \0qdG 00/@K@XPa `0KH   0  0 DC !U] @`K0! 0 @ 00 xK 1P`{ xP\P 00 /`` d03XO+0 0@T0$  `K0! 0 S @00P  /0 Q`K0!0@Q I 0<H:0@` \  00 /@K@P`0 000 / d0X3O 0  xK 00  P`xPXtP 00/``g d0X3O pK <H0@`T $0 `0`  /x0` 4,` 01XP X0 0  PP` |(0 xK0   0P`T0$ q 0q0(  Q00@ @0/x0 P B@@0090x0(  \ "   S>0 @KLR-0K K00KK0 00@0S:0  E|pM G G G- M Ѝ -LM`< Tp$ 80  000    0 08 00R00S 0K  0 R 0V 000O 0 R V0D  0 R 0W( 000O 0 R W0  @ \0P@   0 R 00 0 000 O 0 R  00$ H  0 0\%1RR `p 0向0 0 0$@wx僑`0d CB_00 4@K@GP@)<T0$ @0Q{xV40 H 8 R <T0$ @ 44 48 ,@4,5Sʴ0 70W0   uW 0000fV0RV 0000CT< G -LNKeMTQ`U@|a 8 0BRS 0S pXQ0S Rs GPP >K p`4 ,0<DPT0$  TqW0͟ 0 PP  P lQ 0S 0.K0T1QSNXaqVJlT45 S:05XS*00^K01 `qS?K 0 0PP 0 R 0^K000nK v Pq L000  0LD0K0K WlX850p1  0 R 0^K000l^K000P `P৑~K@ 00@.K@`Klq8Kt 0KPSo`t0 p0UOl0 t $x! t!t1 aR00X0pPK@/0StLQt PC@KBZ 0S1( ? 0p0 \aQ  `!P 0S!0(0 0p0p`P U մp000  0P RK 0Sp1( ? p0p0 0 S0p (0P UP K 0Sp1X ? p00 p0K 0 SpA 0 X0PU 0 R! 0K0T!RH0  XK@ 0 lQt`PS/ PKlq t00QO0@H Kpt 0S t.Ka00h1dA0@@K0 R\tQPUtQ Z\a@ 0T P 0S~ 1p0.Kh1dA0 PE\!0OT`aS\Y9 0S `AK1p0`` hd, \Qla0`a 0S K0\!R|lq0Qh  @aT մpl^KT0`Q3/nK h |a pd|a Kt  0tSO 0SJ0SGt! Rt! RKP 0S3 p0S.t0S+P U 0S 0~K 0 R |i /0 00| 0F |h00hh0^K000Dx(0OQR(X0OQR`1 S~nK`lAP  0 S p0S:k0Sh*l S>RL-0`ȟ00Xp 0S:0 OK0G`! R9^K0l1P N 0S# 0S:)0S&*l LS>R-0` .K a0001 00Q0 0S:0 ` 1( >K 0S!0(0 1p0p` U lq P01R/5 p0S:0S :l0@h  | p| l S>0LR-KNK ?  K00@nKq00@p 0S:0 1( >K~` SrlQ~Kd 鳐@FP@@KtQ  0 @K |P1 qPpq R| pC 0 R 000l 0 hk|!x1 p |! -0t 1X t^K1X a0OX1S0K0 ta0R00X0p pL0.K0X Gp G GpM Gla~KP 鱎NK Ppa S?K 0` 0PPST X$0#=0" l-S>`0.K00l0L @@0O  0OT S 0 PP( 0 RY 0K0XlQ0@ 80S L1pqHg:LB뀁 L9L Wl1P Տ 0 S# p0S:0S*la LS>R-`0 .K a00@00Q@p 0S:0 0^K000 Wsq0K0XX ,P 0 @R00h 0C>K 2P#0  @@000  0T 0( S/+ 0S :0S:(0Szh0SwXT  0S 0(pS    0 R 0 000 0S:0 0TaSLpX0SD0TS -L4M0 4 0H P p80  \ < L @ t0@@@T @ 8Z @000@`40/0DD@ 00 ]2 ,00,00 <80&Q0 0OX  PL 8Hpp L 00< H0 <働t0@TLt0@TT0$ @g PL P -0`pǏ00 0S:0 A-P8@T`p T ?>00c0Q3@T TX0X  0S  R1 018ĠtfIRE8RE -1L,M x1`"bX<0q4PPC *U 00dP|PU: ,0KbP ,0^< R X0  0O0K\X08S00@K$@0K@@K 0OQPT,0@< $P@0oP`0  `vt|IDM G G G800CS8\6`\6$\6\6$\6$\6$\6$\60S0 #Q00 #LQ0 R0S800CS\6]6\60]6\6\6\6\6000 10B0  2 R0  00800CS]6]6]6]6]6]6]6]6000 10B0  2 R0  00800CS@^6X^6,^6x^6,^6,^6,^6,^60S1 S20#B1  0S 00 -h1LM`Q`!00pP@<1@0S ,@,<As@P d 1s D D00 Q 0 0P0Q0< $0' D0 qDP L5s00@ V*V@ D0 h*@4D\%R0 040@ HD0h fDh0 S4 00:004X@ X@@4@ PD D 4 D0L @ÅDX$5`S,0L !L L *D0Y@P)D80D0S0D L 40i D0L Řd0T /4KL0ZL PP@40H4TD4P 80YD0$%R,0DYTC D ,0YD$%<0@HLD 0S 0S<P0< 0 P < D$0<(%:( $0H0@ @ t0$0d @( 80@,0Y@Z|0<DP RD0LCR D<0!80K|8D `PaN@D>S΁D 0 Q/0D@$P4`P05S`P RD0D0 0 < $0D000@ <T0 PD P DPk+DLg+DP ,)D ,LDPxpOPDxrpPWX00 9004X X040 ]pMhdTETT\ G G GD GE-0 LS03R %5p00P5,5S ڬ4S9Ӭ4հ4S@0Ӱ400tA/SpPo5@"p%$\ZH0L0SO/͎ -L M$0Qp `; P@ҍ X00#000 PP@р L*|  0 0Q N@P***$0ԑ:$0  -$0L Ppԁ  6P@`@0 S@`V #P@P @ 0 0@ = -p`P\LP0d -40( 8$@<( @`@, T0C0,0VZ  OZ KMBl G D rmTt G p-LM80@SP0 0hl0S  5`V p  0N0S0 # -LMa@@ -RPp =SAT8 K8 4P , 0@  98p $0 #=0T00S<K s<0PpST 0$ @   00S  pB>@ =SPpn Gmw6@G G -LM4 Q8  18 `V4,0K` ß l@Tep+0"h0" P,0p,002 01P@ ,_T `ۂ0 0 0$@‚x΂`0d CB_00 0@K@P@ ,08  ex@គ00 H C0z,0T $000R|1| ,0K45NP@A 0S@@l0P0S 0S1 pP 0S@@l0P0S 0Sl0P0s ,0T $000\%0R ,08 0,5Sʴ 0p00t0 0S0l0P0>l,80080`NN,GfINNNT@-@1T0, T:F@? 0000 0S00l0P00 -LMP, 40@0 PPp#800 S40 g0@d0/0 H`ሃ,QD 80p W0\'d0T   c$0 h0r`00h HcL5H sP5,5S,>QS. y00P0 SHŒp011pGW00P000 uM p-L Mp@P0Td``  pH@`Yc< 80`@Pc9ph>ĈJx3IN G GN-QM  00CS<6h6t666666̀6؀666666 6,686D6 0 ЍUC-Ѝ 0 0 0 0 0 0 ЍhC     x p h ` 0X 0PH hIhIlfIhfIN4iINNNNNNNNN0LR-0K0`@K` ?  pKh00pKh00p 0S:0 p@ 0SL0H  WIHP t 圂@  0 S4 @p 0S: 0S *H H@S>0R-LPK ?`@K p0H0` 00l0 0PK0pH00l P K 0`0@00p0 0S:p@0 @0H@ p@ Pt 2U/S@P@TP( pP p 00SHi(0Su 0Spph0 0S j si GhI G G -LlM0 4 0 0H SP p PUH4@80S S OiPx  0x R0000  0S(6d  6X 0S 0x S00S 0 Sx 0S*4%R$:05S :48 0P0R00S P  x0K0K` V`@K:0S*8 T 0@ KS0000P00`0 0^L0 ` x@P 850  lX!RD LL0@L L 8 x0L,K00P`x0 Po 0 S 0S:0S* 0S x 0@ 04 R0000LH 4$, 80d S@0P` 8@ P0 #Q 0S:0S:00d eHD0X ;P`t`\nD0 0SV ,X00V0SK000PUrTP00S 0S 0;0PT R40s H@ThV P0@0K@`0@x@T x b0P@0TP`Q  0`Pl1 R 0, $R0000 ,,,0D@HzS>0@K R-p0KLp KK0pK@0@pK0@W 0S:0N Ox  0S:0 (Sg@x@ P0a x G GhI G -LMp80S 0S p`lP@ 00300@TlP@ 0 1P0S1 U@Xl 0S!0qI PDl0`S YI80S X3 0S00 00@ X T0S 0S x0S 00 00SP00300003000YlP` 0S1P  |00St $0q (m g G, GxM@ G p-LMP`,P@0$S(a@p$aNN -LM@oh000  p-LM0`S00@ QP0  `pFTPp0Q 400ppM -LM0@SC<0 40Q (f\00G00pM G - 0RLtt900S0X 0 R0 0  000 yfNNhN G -2LM0pD0 AbR@T R000 2.@T'x2 p2 W d0SX0Ss0K6D"0SI,2 W00R00SK0SS0SG8K, 408b00Pc A=9@ @ =@ < <0 W00R00S,@T R000 ?@T!0SW 1  BQ RFD00C0FD00C0{FDr0|0C0rFD0X0C0iFu< 0 S00kpMN0iIxMNNNhNlNhNPN -LPy딡a@Tp PU 0 S0!!*P 7 P @T\T 09Q000 0T) 00C0E 0BS'꬘6Ę6ܘ66660Sp0Sp%0Spj 0Sp R 0S  R 0 !-0`ȟ00@0 0S:0 20dK0 B0 S0  2 02 xGNG M-L8M0 @04 0< 8 L ` V@ t0`FV ׹d0  0` JP, | x@Ty 0S0S 徹Y0  9R0000 尹!0S00@@ 妹,0x RQ堹0@ 0 0S ,,H0 H H0H<0 8 t00 `S$D J H<P8 1pǏ0 `V iZ,00 :00,SL4\ @000 0 D000@0d FrPK 4 @ L _0T0 cLPL NPJ00@ ,@K00 @P0iIGNG -LM0@( R,0,0,0 0 # R000 P Q 090< R <0<0<0L 0S00@@ h 9R0000 N -L$M8 @K @0KP 4 9p@ 85p0dD0 Q `l 0 S  D0H X00>  @K0@@+ Z! 0000Q 0@ 0  `Q P  `嫸4 R00 `$`@0x 90D4R0x0@ x@咸 ㏸$80 ,0KP ,0 0 S  R000 #,9 0P<0S0<0P,p0iIG -LM`2( KpP@  (0P$뀂,K  0"P 0@' 00C00 000S1U0,0a0(K!00C0!0S00``  00C00 000S0,0a0۴0  0 P4B0@ ( 1  B ´0@0  0P ,sP@ 寴(o0,90@ R@0`,@`,0@00嚴000(0 @0(0 兴 {pMG0iIGNN GHGlG 0-LVM0P!`! |0[OK 0KX L d1 (@ P8 _, 0S00PP U0 GN -LM00PjFȁx@T 0p S_66 66666 6 6 6 66aW@i&0L!\Q0l<0S`00 :00 Q0)00   0S00@@  S< 0 00  H< k0HH< }k4Tٳ P 0 SG0iITNGhIqFG p-LM0,<0 1(@T H`P 0S0000  000  @T\p$phOU0坳 0 S(G0iITGpG -LM0P@p<0 00 xxi0H 〓 0SCv Oa p  k of3cS4 00D0Sl h ^@ @0S\0S 1( Q 0  000 Z, DZB P0S \ 1, ( (\3 Z, R# 0`000@0P /q40`咅#1(P0S,P!(0 BSPZ#4 OZ 01( Z000\ `/5A p$4̏0 P 1 (^0Q  0 P(01 XQ :0 0PX00廲V0嶲Q岲 ( 0R \ 1( Q0SSW \UO哲 (P割D$ 0儲4倲$R0iIGGGG,GHGtGGG -LM00`  00 J xP0U 0 + 0 9R0000 0 SP66t66h66L6t6t6t6t6d6P 090 R 0P0KP#0xPU PU x 0R90000 ) x0S0x0PxP PU$ R 00Q0000 RQ 0,0\000 00004 Q@T 0(0Q0,0 ,0,00 @T R 0$0Q0(0(0(0, RϱH!0S00PP ű000K0|-< HUi SB0@00 T p  h0T@ S090  R 0P0KP#00 d 000WRPQ000GJ F S0QNGNGhIqF8G p-LM 0 S p40S$8PD@0T0 T (0S @TpS T 0\` 0 S D @TjQdG 0-0L 0 SP 000S9$0 R000  R   000P00   H01 R000 P  P 0S00PP 0hH 0!O!QNG -LM0 `,  <0\%4R xfH0 Q Z ,,uh O^ 0 00 T$0000D0P0P# 0 p^Z 0S0Šڃ1pp 0O P 000W00#0000 0rr Zb 0SY P@0UNDP<@pT' 0R90000 0BS񟗵d6H66p66d66Wp<@TW eP P[PD0S000  Rw  0R,0S  P 0R0s`@ 0P`!0`:P00 SY1 p@_Qp ;0S80OS@0S0,!(\0(0F00 S,!( 0Q 0  0PxeH0, `@ 0P`0ppp @O0 0THP PO R@0@<OGTNGNG4G`GGGGGGhIqFG000 0 S 908 R 8080800 R000 @ R @  00@@0 0 -LM @R2 00000000 0 S  R000 bx 0S00@@ hW0 R000 @ R @  00@0@0lON,G -LM0@ pn $<Q0 R000   $Q0 @\ @\`1(\ 0@P EH ` 000  0 0 S' ^XV 00 0000  R000 p 0S00@@ خ R000 @ R @0@P NLG00`K L0R-PPK ?P@K `PKX 0PK0 0S:0  0P@0 0p@@00 0P@ 0%HԬH54 Ϭ$Pˬ$ Q 0 LpM0iI<GXGpGhIqF -LpPP4 㱬`l@T 00 Q@W h韬000000  x0S 0S 00000ꀹ凬Jㄬl~LG0iIG -L M, PT $0h뜓0 Pp0 l qP@9 xPU 0 S6X6\6t6666\6\6\6\6$604@C PU@O1 .TR00S$#0 al0SoP |0 RP| ,0 Pp 0P 00S Pp ᦺᢺ`@(0( S`@VڕPp ɫJPp @0P 幫0QPx 0 Pq0@P 夫Pp㞫t000@[@呫|00S $0八 Q0K0iIGhIqF -LMq`,Kon  0mP  ,0D@T 0= @T,0L@T 0 @TV`  0 LP ,D4PVPV T1V KPP)%|0 4P6PV TV +PP ɹ0iI -3L,M0@ < 8 D0 !Z`H T 0 PR < 0, KP`C`<D ,0 D0P`D ,0 D0P`, ƪ0 ,0=P4 x R 0 S R屪,V 㬪@ 0Z SV 㠪X20 `H0 00KPT 0 0,040 @優T 4庸P`|1@ 0ZsH0`pq`0 0 0$@X`xd``0d CB_00 4@K@(P`4冸P`H0@ 0Z@iJ496R~ L@-Ty 4c`ur,p~ 80 0P`s@ 0Zg0 pM0iI G0GPGpG-X X0T!0#H ?@c?Q00 R000NgfffNNN -2LM"@0`Tp ,R 1 21/@!bQ2W,0B?,02,0 W 㳩`1T1嬩P V= V3$$0 00 1W` P0 00 0( @U)0W0C0@ z0Qg.r\`WlI@0gXX0 00HpMNNgfffhNN0iINNNNPNlNG4iIGNNN -P0LM D@000*0(S 0Qh'.NPNlN4iI -LMp)aA0^*P 00S00#0% R $0S  R0^ :P@0 KP@ \v0  0P / 4dN0iIN8iIGG -L M֨  2\*1@ P00S0P%0S,0  \:,P. PU $0 1 X PUx0 c@0`CV ,K 0P`FVT ,K 0 P@T0冨0储00 KPp 0"T   00=P 00eL00)0S0  N0iIN뀄(0K/0$0KP;@$ Q2 0S 0000Q@ T$  T#ʸ0TPP$ 0S0000cCQ@ TP$  TP (Z00e0(SL><.F!G"G #G - LR 0S 0 SR  QJ0S RZ4 ' -@LTp`5 0S 0R00 0/"?CQh M@Ġ !1S P0S0CĠ !1S 1!r 0 0 0 1a ahF  0"><.F!GcD#G p-LM@PT` 0 R  V q    phphp ).0=<.F!GD#G 0-@LTP 0 R  $\U444 40= ? @4Q00h<.F!Gl#G -L\ ?;R 0 Q 0^0   (q(ho  0=<.F!G#G -LM^+ 0S+ @Q*?/ΌQ0S(1S0(1Q 0SX P 0S BP =h. 0i=#G$G<.F!G,$G -l1LMpQC X@ 0SL +?+;Rd0VZ=@P0\ 4  R2 R$ @ T0 Z?#?CCPC#@ 0T0R00S@lCT1 r L w000 0c0C oNT$Gx$G$G$G$G%G -LBM| H  L2|K A2q0R p-LM?Ġ\0\ 0< ? #?C1 0@CQC# 0CSP1CP#Q a0 R  Rr p0S CR R 0SS 0 CQ<.F!G{<%G -L @ ^Pp`@1 1S s 0S@$11S s 1!R 0j< y<<.F!Gl%G%G 0-0LAĠ !P01@ 1!r' N4 1s 0^0NCA$!1s 0S 0^0C 00NC0A$!1s 0SN$0!r  0<<.F!G%G@-^@n \ 0 0R S -LM$, 0, 0S1!Q5 0S4 410CS41-L@DK 0 `@P*D0S'\ P P`XW0T (Q  R 0.SR 0.SH0P 0PW -L8M0`\@ p@: \@7 P@0< K8\08 pPPP@@T0( R)0[*0[S""[0R0 0R@ R @00T@ K0P@ @P T @P郸4@..'G101 p-LMT0@S` P 0TS00p 0QP P pX0S 0X R00t 0<P P -LM`pX* v 0S P05& PUP0 PU1T@T !0 `01d 0 `!0,0 0!,0T@0T  =P X'G -LMpxP* W `0 `V1T@T !0 P01T 0 PW!0,0 S0g 03!,01012X'G`'G p-LM`0T@,$0QP:SD(0Q$:S" P* @ 000<0  0S00p  R p0T!0}3 <0Qp1   0S00p  R Ep0|T!xx0^31011  0S00p  R0T!F3uMpjI'G'G'G'G'G -LMp`* 0S P5& PUP0 PU1T@T !0 `01d 0 `!080 0!80T@0T  9P $(G -LMpP`& 0 `V1T@T !0 P01P 0 Pi!080 S0C!801011$(G`'G p-LM`0T@800QP:SD40Q$:S" P* @ 080@0  0S00p  R p0T!02 @0Qp1    0S00p  R Ep0|T!xx0q21 011   0S00p  R0T!Y2uMpjI'G,(G'GD(Gh(G 0-@L PP\ 0 RP0@0 T0S妸1(G(G(G 0-80@SLP  D04S0鋵@P@% -LTMP@ԡ\Pb @0pK p@ H0 L l D P@q `` ^80SB0S  c x @00@0$ *$ <0 0<0`0@080tKP t<0S00t@0S80t h]x P@0@0@0  (0  0v 0: i7(G 0-80PSL@D0 \0 !TTᕵ -L MPԡͲP- q`V' @@00 K0@0 ,P 0 0 4P`P@0 0 @0 0 SPUU$0:$050k7(G 0-LM@ 0K8PP @ 0$ ;P9 -L,M@K@p a:P DK 0PD@1 P010 d!P18 ,0, 80 0S<0@ (0 <0$ S , R :(0S R* 1000(0 00S 8 R :40S R* 1800$0 $,0(4 S11031180S11 0311R Q00S$0S10 101101)GuM -L(M@pDK a:P HK 0PH@ P01  0P (X. ,0S+*<Z: 000<04PU 80S*0^:l 080@0Z03811801S 031110,1b0<()GuM 0-80p SL@ 0T嫳PP01TPQ 1U<\pM -!L0 SQQ  㺴Dq7 -00 $0L90 I(N,N8N -L4M!\ 0p3W0T `X0  0@   00#G4#01P@U 0S PUl0Sd `#X0SP#000<# 0SPU 1S1 . R  02 0  0  R000 0 0T0S X 0S00$PP@@#북A`p\   000@0K  `P0K4@ D@ H0 P L` 8` 0 , 0HK 80@SPD T0S X 17T㰁 R000T d 40S (0S00S$0S010S <0S\0$! 000<0@0S\  800@00P A. DP DDP A000n0S51S  R 0 40 0   0 0PpM(N8N,N4NI|jI0)GuML)G -QLM@ !R0B11  B8#80!00 0 @!,N -1L4M0QT X0 x[ I YT T0 S P X  `01  $!0`< @5 @ BP@K 0!`0 HK PK$p , H Pp 8 0` D` L 4` 8 P00R00S@@ T0 S01 X  RT \ X R-pMD)GT)G\)G -`L@pPTQPU@Z^Tp -LMrp0GT`` UG  U PP@@T:dP  U+  U  U @s  @  0 U  U 0 U 0T 00 V -LM@ KP 0 0 0-@DP L@᏶P00 4 0 0 -, L0S 00)̈J 0-LMP@ KP  0S 0Sl0P0S F0000 0- D0@L CPP0s09I p-LMP0 @B 0  )P 0s 000Hp @_ 0S0( 0p00e0@8@@p9I0 0S00D d< X R  0S 000 p-L M0@ `Rp K0 R= 0 00 0 R  00 0 O0 0 R  00 0( O\0P@ 0 0 R 0  00O0000 00 0 00 \  0@0 0 uM -LM`P@2 80S777777777T0$ $?PV 0Sh0d `0X 0S  0S 0pSt   0g  -LMp0P$K`0 R 0 00 0 R $00 $0 O\ 0 R $00 $0( O\@0  0 R"0  "00O0000  0 * 00 0S00p00 0 0 R00t000 0 R00(0p0H0 0S0000 0 R000 0(0 0 R000D0,0 0 R000(000 0 R000@040 0 R00 00080 0 R00$0H0<0 0 R00d0X0D0 0 R00l0P0@080S; ST04 $  L 0S 00[D080T 00h/4[8$0\l0 00 $00\ $0\0@0  0 KKuM -LM@P0S` p0s 0s0s$0sH0sL0s@0sD0s3 T0$   0Sp00R rP R 0Sd0X0 x3 R 0SD0D0d0X00H00D Q  0 R00#d#X R q T0$ } 0Pt0s4  00K R000080Sp mSf 40p0PT4,0S:00 S*(qI T0$ C  0S00p  P P \0  0P(q00000(s00 000Pq T0$   0Bu  00sT0$  S0s|0sgr 0Sd0X0?D 8#8S: 0Sd0X0#8#888d0X0  0S  d0X000d0X0+M -@P 0` R00p  LQp oP,Q 80S  % 0 R00t?P   0!:0 000000<  0   O -L M`q@p  w 0 Sp00R %PP   0St 0, ,0  0, S 0pShZR0 zPP  00  s 0 R00tpp 0 R00p@@[PP00 0PP( uPPGPa,0SZ000Z 0S 0;0, R 0S 0;00 0- 0 R0, 0, t   0 R00pP J00 : . 0Sp00Tc 0St00We eP^W 0StppK 0Sp@@A7(l)GE p-LM080S 0 R00 d X R  0 R00 d X R `T *(pX 0  0<u` &t ! -"LEM0 ,0  p ` 80S T T0RW  FPwP2 Rk 0Sd X 10S W  5֬1 ,0S ,000000000T $0;$0#=0#0 P 0 0C000C0000T $0 !v w MOK  0P T G'pM)GM)G -LPMM 0 p,0 T $0D!#=0#0 P@X )0 8yX@!@8LP!0TRQ  RT ! TVH1S<y3 LDP@P0  $ OK P@E<1H SL ` 0H1 HQ[ H1L 0RD0R h DH!0SP  L 0S> L10 3  R2 0S) 0R# H!  0SH1  p00S@1 HP"L QZD!000@!8fPD0 0C0 RD  00C0D!00008T0$ DJ80: S Z@D 0 RD00L H"6T!R \  iP@ZG T1SL00C0T $0H00C0KPpP1P 0S 0 0  p   0 R  0S00t0008Pp ZPp  0 P囨 ᙨ3 ,0S , 0000@P180P1T $0 00000000T $0$0#=0#0 PpT0( 2RSOK0L1  0@! U/K  < Ppa 0 R0000 0 00 PR0000čT1H {:PT0$  T!<0Q H0,0 T!<0QPT $0#=0#0 PpHT0$ TPpMOK TP 0pW z  P10G0 0C000C0000T $00000PT0$ ȧPT T D2  0S00t00t0"pMMD*GjIjIP*G -LM@pP` V |0S Ꮷ፧00S Bt |z KP 0 R00!d!X R  0 R00!d!X R 00C0  B T0$ G 0hP.w P^T0$  00C00 0000C0000T 0$0@00 <0S 000   T0$  ^[WT1l -LM0@P 0  P`)p 8T0p( PP 0 R00(p #9 0 R0000//0000  00   0``` -LDMP0 0X ++X0U0PbPPeT T0( R| 0 YG0SD 0S0S [!0 X0 P 0f c` P` K`Xڴ 0R `pPP\X0 0fT T 0` KP `X0S2ڴ0``X p0 S0ST 0X00 0  0 Q 0S0S  0S0S0S\HK@P0K H0 4@ D@ LP \ \ 0HK P P80\c@\ * 0^0 \:\ d\"T\:d*G -LM 0ST0@@(0TS 0Sh0  0S 0 h 0S(p /  h h 0h -L M@`d80p0CS@XP0XPPP p 0|0 0D 4 -P' 0R 0 PXpH<E3X@004;00 P+ PAI*G -LMp@0#Ƞ Ƞ0,4 !0 0! 0S 0p  S 0tS00`@0`!80S h |!*G*G*GHG - L 0000 1 1@R#`@ P> jK1!0bR0S0 PP0S' P oP@?>!D\2" 0,0C 00d 0C0,嫉$0"A ,; 7+G+G -LM `,劂PBP00  0Ɩ6 ,@K@ĈP^,0UH(@ (@0>1 1@R#P  e> Aq d-P/ 0lQ0 PPl.!1E0,0C000*  R0C 0,& 101,*(0Z"p @+-P;  $= ,f@G+G,G(,G -L M Pp``$}00V:  , 6 $@K@5P$0$`H@M0?> 1@`R#  0,0 00D 00$Ȉ$; ^L,G GG`G -L M P`A \00\0SE(0,6倢0 0 6,@K@0S-,0(H`/Ap Q ;  ' 0,&0 00 00 Q,& 10C1X0,l< R,峈;  d,G,G,G -RLp`$P@ $P`/A0Qd K,P 0l1 P0PTLP @0,P; B @G,G G,G -0LM ; -G -LM0   0 Q0p  0 Q0 Pʴ A0(PU /6xK2P`x00x-(0 ^|K 0 P`  | p(0/006``Ԉ0x &|0X2Ox00x0<HO,x0@`0Kd KP` Rpڴ0` B 1XPtKU ` (  d H 6/xK͆P`Qx`@K H0QQ U   0 |K  0P`2 |PP d0H |0/06``i 6X3O d0KH<@+0@`P`\@ 0Q x߆x,x{ t@KTpO:Q" +0\ ʌ0dKAP 6/PP&x 00: 00xU0 @PW 04C0 00 0% 0QdE 6/x@K@1P`0Kx 0H x分xՆ 6Tp:U=0! 0 J|K 0 xP`0|P P00| p Q xY/6```庇 6 3XO00<H9+0@`x勆ۆ 6/@K@ɅP`M0 6/凇 6X3O 0 |K  0P`|PXP tP 6/``e0x &|0X2Ox pK H<*x0@`xP` `0| X 0X0 0  $-G G -L M@^ 0    Q -LLMPUS@T0` d0 h P`ሠԑ0U0T00S P0S h  d04[-@h pTXpKU\PK 0P@Q\ * (!(0` 1@`0  R`@0  R` V@h 0S ,!$0(0Q0` 0 A1PXPP\ pR U@s TJ Z 00d 40/垆00 U[ (003OX 0|1 ,00,0堈P@C H\@Q0U0T00S 0S $0`V * h0^1 ,1 S 0DS\0 pZ (0S0O@0`  00$ `V*h0^H,!0 0Q v45/P<*X-GpM|-G-G-G@-0 : S l0@@0p-`P : S R0V@l0 u L0S d@0  dPpVu -L1LM PR`@p @0SC R! 0S Q1pST0$ %$K$  000 0 ẻP 0S  㨜 00 p ᣝ:I-G -LM@TP$  0`Kἰ0" 00 T00 0 U00 \ 0@0D!0 000 00@(` 0@Dp+,V0R+$+664@K @lP@ 4l000$@~+40 H:00 :70 -Y 4媃4 uM -LMp`W  08 0BRSRc PU  K0 W3 V0ƙ&0F P,K 0P    W000 0%׃6P &X, K 0P  F0eH(' ƙ@0 &*, @4 6P@#!B0 6(#1D `, 6< 4|K0 @i, 4K1S01X40K!@TZ @ T 01@D T( 00 00K(< B,|K(< =,K%W0#0  @ 6 #1 c< 6#1@ a B8  0XPUM4K1S @TZ @ T!(PU@D5 T@K !X0@RTT @0K!(0@R(  Th0Sl0S o  0Q50#0l000000(06 &@0K4K"1K\4K!0SR0   0 00 0 0X0Vih Q000 0T0(Pb0OTSU0 R@PP (' Y0pM.G.G(.G<.G -L,MH L 0 40 8 \8 < @ ` @VV%1@@ T@ 4pW@)p0 0/800TDP ]2 ,00,00 <80&Q0 0OX 苹 7P4H\8 ]80< & +8& "!g! B& ᘁLP<L 8@ 6#1@CT b`Q@DU6@T`4 RP@;)QpU< R H0L00 :0080&L0,K"0XPL,0HL H  0R08&",K@H ,0LZ  L H H0D 00H0 q ΁0 PpMl.G 0-@PLB/%  0000 %000000 -LUM0 ,0 80Q p h! 0l t x&@0 B0PTo UK@eW?Kp!T1 @ P XA DA d 0Sk d;%d 0 \ P` -D1dQ0c0Ux1 $*@MKT0P`1  >K0\  ?P` l`P tAt Q`l x!U:h1d0@hP0S:0S:PP R `Ppt0l0 `x,0 S h,0 0$ l!t l 0tlp pM.G -LlM0 ` 06t0  h 0` d0 @l@ , p @4 0d `6h@h0@ PP<0 X@ \ h x  4T0$  00CS4` PPl 0@RR@0 8@ H0 D0 x\ 0 008 H0 4 l0TS1 4A0S*p@L@ pP 2t t0 BOK|  @K =& K P@`q0 0R@`Pd0S0@ 0pP@d ` P7&0V`0S(l Q(5/:>KMKl!%&d垴0P0@00S 0`P/VU 0@lU>KPá@ǡpl!pl @ > < : 8 6 4 A?(K 2pM/G/G/G/G/G0G40G -L M@0K RK/ P 0C000Kb0K/P*000.000 -LM@$K_` 0K pP$0 0 L0S, `0) 0#60C S7 7H7(7H707H787H7@7H7P700$0000000000 0  -L  |IDM G G G -LMPp@00!1S80:S S40$KS<00<0\$@  0P40(囎`V 0 $ 0040͏P`9IM p-@ MLPPP` 0DP 4 00P@phx3I0G@N0GN p-1LMt1t`/Pd1dA(P P; LL K⡌PPC OPP200 R 0000  1PK 0 FL0S  ,m0gp@@ ? 0/  00C0WTDp鄚IpM@rMJpM0G1GaFM -LtMp Kl @]PP$< ԑ< R  5PP  7P3 U < $< R $0 0 Q3 S< 032#  Q @0(0$ ,uPPc`80Sz|0" 0Qp0 Q $0x LM0 0tPP ᆎ ޮ$0J 0VP ᬎᩎUԑ0K! aLL0S`"Z @ 0KY |Za9\!0S 3PSP1 0  , @`? 0KJ@a ,P_[D K⭒` m0 0PP  k- fF0 bPP203 :$xIuM1G -L M@@TM0 A\0  0P0`@(p@D,V0Rr$~6 6,@K @Dv@T 0$@[,0 H ,7w ᦍ<1G -L,M$0H L 1  H L0圓PL@ K0 P@0,(  ?| /DK ;uPD0$H@P Dv1p+0 c@ [\0EOa.6 0`Ƈ& 6V@fS@$V( FXP(6 S DK/ uP&D,0HpDv 6PUL0H0 8 K40 0 8p , 垍hd 8T1G -L$M|0R 0p<0 0ᤐP@ &P3 W 0P@$00@0  0ᙫP@0 KT04K ;4@ 8@ IuP@40@HOP@ VSV/8  cK8c.408 H+4+v804@ @`<8 \ 3S X2# C 0 c@:[\0EOa.6 0Ɔ& 6V@%3@($6 F(  6PU,6 S 4K/tP@*&4,0H4u4@ 6PU8 0< L $ *<0P(0$ 80<p68#1$0&0,0( |0,^4P g@ 0R  f80S E8B01 upMhd -LMp=P@+Q<` R% 80 S|00'< Q0太@ɋ,$0 :$0!P303 -PL a兌P@H p 0 0@  -1Ld1#pR@R(6L 0R&H d0E PU0S: RP6SS!/ Sa, RPQ0S6 0&U  0`0f 0 , 0T c 00   TZ Z  D PQP Sl1G 0-80LS@P0 0l0S 0LS  t0S 00  卪0P0 -LMq̠PܐY@8 K`'8` 00 , 4P 儋U 8` ;  0e0S `:T 0S80 0 -P`,8uM@G G -LM4 ԁ@8  ?8 Z4,0KŸ ɈPUxpK` 0hP"Pm,0 `,0 0pP p@ ?PP ,弊U (PD 7,F0 B#$/66 0@K@rPP ,f0s80  $ 00 H@<C 0s! '0807!( 0S-0 ,0K4dPP ,580 0d0S,0 0S005050d0,T0$ 0008 PP KN@N,GNNN T0  . 0 R* 0R' P0S` ! P0ST姅XL 000DP L 0! B!L0D呅`DP0 0: S X` TL $P` \Q00S T 0! B!T0jPX 10C1 10C1X P 0` P 000HN00 0 0z DK  ᾁDPXqLP 0 PT0 XTQ ,P RD(\Q00S P` P0! B!P P000T 1@`K0C1T0    0 0 D 0˟P` .0[S L #"[3R\  04  0 `D 0媟 s$IT PP P0!RB ` X0`0 s1T0L 0R\Q00S T l2!R0 !T0 00P0 YP` L P` ; \Q00S T T0! B!T0 0:D Ϥ0 V` H`0P0Q00S,` R"0S TL\ 0 0 0 D㩤 TL0X 00 .RdD ᖤ 0`0 0` `劤 80S0 D"H RDP00 0 0H 0DK 0 ኀ D ឣD2G\2G)G)G|2G2G2G..2G -L`E8PE8E8pE8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8 h( h h} h h h hk h1 h h4G -|0`LM1@T 0 S @T0S* p 0 0ZN4G -|0`LM1@T 0 S @T0S* K 0 05N4G -L(M$K 04K( 00   -L lX M @ <\ ]P0<  < PNt5G -L M⼐@0 ကp01d1a }P  P}P00d, K 03P@00 ,0 ,0~~@dNPN5G0`0 10-LPJP@ 0t0 0\S ( X x 000t00t0dN5G -LTM@`ဠ1d PP  bT 0x0 \1}P1@BT 0L0 D 0pKpl0 H pp D w`0P@t0 ) tkP t0(0 t  80S X M xI00!l x%~1 ~LHD Dt K @ ;9@dN 6GX6G6G6G - !`@LM!`PPp* @D0S @0S 80S p00p0Pt0?0t08 R @Q  ~}00pdN -0`@0LM1 @PdN6G -@0LSD0Sh~AFF -LM PU`p*01`T僁@/P0  0PU@:_dN -LM0 0 $K0  0 !0dQ0 -L`7Gp@-P@ Pt0a0b "#11!bP x0\ Pp|0^0T0UWoD-x0 0 L00b "#11!^00b!000WoD@-x0 0 X00b "#11!b0 S00@@ WoD -@Lp`PU0 PU0 x0 -0LMp 0 zPU  %`f 0x`@l 0pPtPlPPAPPPJP@, b|00O7GdN -LMPp`-P@  {P 0H80 t h @(K P(0p @ 00 0 p-LM0 `TR@Q 00C 0 `P 0SphG/`,`2|` | -LM@PT`p PVPVp0S P 4}p0}p7G 0-@PL0 0s000  0s000  0 sN 000 0s000  0s000  (0s0 00(  00s0@000  80s0008  0s0<0 $ 0ST8T8T8U8U8U8U8 U8(U80(000000000 00s77G p-RLMP`V0000000 0@L 00 00000 0 , (00@0 4 000 0 80< 0 $000  (00CS"lV8V8V8V8V8V8V8V8V800: $0D p00000000x 8G 0 100011ЈJ p-<@LMP `. `P0 1P !pЈJ 0-x@L0SP 00 Q P0 P Q!P0R0ЈJ -LM@0PS$K `U 0 p90fgp  $p h(8G -P@L$p`b@i 000 R 000 R `0p0 p-L,M<@K`P  0 p 0-P@900L gP0 -LM`\P@p$ 0   P咚 y p`~WP0S %zW  wypy p-LMP@`P0 S  +0s  pph -4 LM0@S 0S hiЈJ -LM@hi 0 SR 0-PLP@000@0 0-PLP@000@0޻0 S-L S Iz0S 0 S: S P: P  -LM@P!0 -@LPp`P00S᫻0@CQ!0AQ0 B00p`@ᓻ@ 0-P@PP0 L00P0 S < 0 0XmITmI -EMLM⠀BNK@DPp`+G>K$ U0PFK @U@  H4 0h4 lD @d D$ rP\40 $0S $7pM8G -L Mp00S? 0,0 ( WK0N/`PH $0S $pM GO -LM$ LLP :#:S H0#3J$JT,tlx#x3p"&`Q $0Ss0 0S$Pp W a\0!011` g0g$!$0 Ss, ,00@ Ab Jb Eb @Y00X0S@0 jPh 0S` 4 ,0@ !@d  < !< A@ 0 80 !8 @ 0$\  !00 @ 00W$0aP0000!0011, ` 4b㇣8bㄣ<bっXxby g0 0X bgY bbZ b] Ab 㶡P0 d$bP0$0^=G<.F5,>G6d>G>G -LM$ 0CP*"*RL`1#6H SpQ@ 01@ST0S K  R@0!@R00R0S TH 0!P 1   0<.F=G>G 0-0PUL@0 !P!R 0SC Q 0U0000hqt>G -LML`\p0+S# $ 0l#6S <$HH0#X TXU:U : lH PL 40040 /$  $ 0S $0 CZ%ZUU P@ Lp0SB U H0  0! ! !R&\  l!00CS0 $0Ss40 040H L@$0  CH"&0000000 0 ! 0 0040040  B i  0<.F=G,>G -LMLX30 1,0 Q@T< 0S%0 R"2`)pW0  ```^4YW  10 0C0,0 q2A020XW8:020 ,>G?G ?G p-:#:LMS@`"Vt  00b0eS $0S 000  pZ 0B@?Gd?G<.F=GmC@0OOJ -`L|0x 0@bT|000 r0cPP( b ž@0S0 P jx 0 0Q0x P `0Q0`  ZOPoIJpO?G@G |00`|0O-8`0P0 0C`  0  pOO 0-@LTP 00S!T 0S 0 R B000   hh`  0`P0002 0203 @ 0npOO<.F@G0@G -LM 0@SED0 S p00Cp0OP0 R0S2B "0 -0L@pT` PU  PR00R00SU@TPJ p-LM` PP P L@ C P202-pPD@G -(0AL0$1@TPop 0S @TP \0@S000@`p@ Z0SO p-LM0@P R-p0@S 0a!p R P 01T`@ V000V00C00S R000< T  W/0Oh@G@G<.F@G@G -LM @R)(0 Z$$ aV p@P0S@PUZ0`V$ Zcɞ|o4Cp00Cp0@T  @ $0 b0a"R`1`!0CA S0 0 p 0S  K H a 0 0P 0V0R00S0 Q PU PPU0S 0, 0 0cp @_0 P P   fp XP@ĐKT D0 KP0 1@ TZ0(Q00S  0S^0(\00S0 7 0000̠ ,00 @0K40`K b 000P0@ 0 0 0@S@ TP!rR@ TZD0X aDK P@ P00 0R0 P 0P  0S U 0SF| 000 R   04 D0 Œ0@P 8 :p h0R\ \)  / 9\  &8@ D0_%202J`)@101P` 0f) 0SVV8 ⺏ȟp h0R< <(ŽV R0000 00& 2A020@ 0Hc0}00C0| 0*)P  %^ 000C000@ 202%2"0A 2"`D8 ejP  P@`@  @tt't7] ` 004 ``T4 D7 H01001V0 10140   00S 0 UD04 0 Œ@0P 2C028 8p h0RXL& 2 R %2 C028@ D0ƺ2`$2  0!6T 0```j(P # *%2H029@22020 M)0 H) ~ᆺ@@2202$8 喎T000n@ Ru P` @| 0@@( \00VPPU- @t 2#$ 2028 ]pp h0PRŔ#_V R 0t00P0 00"@p 10 1 "101$0@22P 02C$0@ 0 cH0@p2 H410418"0000 ,00 P0K0@0@0l4 p000P0 0 0K P@ P!1 Pv 0!c{880P00 @t 840 S000  ᴍ P0R0 P00 PSFUc@22  p000 $0S 0 7# 2020b@PoIO(oI|CGCGCGCGCG2DGpMDG(DGQ4DG@DG[dCGpDGpM$CG|DG<.FDCGDGOODG0@ 0HcP UP8 N2 tt/x0QT  `#0 00040 D04 0Q 00!202@0  00ĐK p 0DK P@+ P 0S 1S0tT01p aP 00S2! D0a#000D0 00RD4 \ 00\@T 2 00S 2SK"`@  pŌ8 ⼌Z |72D@KPU @ L0R:P0R:PUk7US  P Q-Lp@`: 0"PPJT: T    -LM@0Pp` r  iiT$CG -L M0P`@pddd!d1 L0Q:P0R<4@!@1&$ K PD T *(K PJT:$ 0T55u.305:$0T :, Q# $ 0S$ $0T*D0S (0#&R :0R*0a!,0 P !R, ,0(DCG<.F7DGEEGDEGOSXEGEG -LM0 P 0 XU @p`6  P 0$  cR 540 X(@ 0  @ȋ  00U X 0  㰋  t 0 l ᡋP000 `( 0 ጋvUE"$CG -Ԡ00L>R@0^pn `Pn0 @ cT 0T0Q00S 40U( 08V@3:PoILoI@ M|I$CG- ^  0>0>0 S   -L MRP`HA   } v 0o0 0 -LM@ \0H*0H1PoI0 00@- @58 0  0 @2(  0P 6OO -LM 0 _EG,sM -0P@LT`p ,0"  @TV 0 R@X 0m@U10S SL0 Q* Q 0`0SpPMO`oI -|0LM\ d \0+ KK!>뿒&8E# VOpOOEG -L$M8 04 S8p0CP~:wp 0`ZC%Z0>0>0S1#  ~0Z@ p<0  40,K@ P<   X00 P00S 0 X3ZP<@e, T @!8 堧< P d0p` @000 `叴0  P0000,h 00K K L00  0P<\  ՉPoIUE" -1LM ,0 0`gp,@p娐PLA P 0,p^,K 0  n TP@ 0 P00(~OOpOJJ4JOxLO'PoIEG -LM>\0ǠȠŇ@`P'0 ` p P`P000U 0 0 00 0LP(: cPP FGTFGFG -@1`LPpE0a #6RQP: P@ 2% " ZU:0$@T  P PU@  0S:P 0S*2 "!6u $ 0nI<.FFG=FG -0PspLxxx!x1%0a #6R%Q@: (PJ 2$!2! !#T:000 R P`$@\T  0S:\ 0S*22#((H -, <.FFGFGGG,GGLGG -LM0 \]0>0L ^ (ǨP !@# 0p` @@qPD ,1, UL0`pc!  0 !@T  ~0 04 jzZEUp,4\0 h p0S (,0 0o 0xLOPoIhGGO<.FFGtGG 0.  0X -LM0@`p P000 `r0 ؇P0000 . . (0KPP* ᤳ0  (P 㷇UE" -L$Mp\00 a>L 0┡~(K0p !|@ `P `@PJT1, WL04 c P` 0P@! 9 ` W300S,,4P `0 @@@ @T40 44 4 zGE',,/(0$,xLOpO'PoIGGGG<.FFGtGGGG -LM0\>0 @KP` TL0L$ p`1P$ 0xLOpO'<.FFGtGG -LM@Pp`P&>0^P0  CPUL刐,K, p0   \< 0,gL 0xLOpO'GG<.FFGtGG0 -L`@P}1T@@0p*;@p1 p-LM@Pg1`*ph^1 -`L0S 0 !,B$ R; 00S000@T `p`P 00@0 T0,  S(<@0hO IPoIOO80 Ṃ8GG -LMĀĐp@T 0R 0ܰ@ 0TP`P @TPPU 0 0P0000S  OOPoIOGG -LMP0x`xp@0Th `U @墰0D 0S0 0C 0OO`GO -LM@0  0@00h0OO -LMp00P` ㇋ 0@ p-`@LM,P00LP (@DH@@P@T 0@唅 @@@pn0( 00S0` phb0GGO -L M@`p0 P000 `0t ~P000 ,0K 0  ,PeUE"000 -LM 0 BR@ LP jh隌 -LMPU 0S 0 0`0UpU @S 0SK 0S' @0 R 0` 0S0@  0V@@@`PUPU 0S v0SP0n0S0  0UP_@T@PU 0@T 0S 0S  0R ` 0 <0@S0@  0V@@p`,@T &0SP00S0  0UP@T@pP -LpR 0Sc0R` @T` PRd R 0S 0S 0S p0 0Q 0S!@ T0 0R0 0P 0S0@  0U@@@PPU*@ P 0R 00  Sp00S0@  0W@@@pPU R0 00Q 0p 0S0@  0W@@p`p@T@P{gP `R[ R 0SR@Tu 0Sr T 0S  X0 0R0 0P C0S0  0UP4@T%P@` 0 00T Sp0!0S0`  0W```p@Tx  t@0Q 0p 0S0P  0WPPpP@TP` -LM `R 0SPXPU  0SY   @pT p@TPXPU  0S@\PTp 0Spp 0RppU @@T p-LM`@PP  0@Q : RP T0 0P \PP_pP  0 Q: RP0S 0S0SQ  0PR 0P  R 0P P0 Q0P - ,0RL R $0cP  0k<.FGGQF0S  0R 1P 0R 1 0-LP@@T0 0-L@P(0M0S  ,0R 0h0?HG p-LMP@(`,0QV php p-LM00PU* ,`Ph@T T10T1h,0T0pP  X0,P0 0tt? @LP `yX0 P L@TP80@$|IpOO KToI8HGPoI$OOhHG -LM@T0<<h,((h  T1h@0CT1h,O$OpOO -< 0S;: R 0S, %*0S05,0 5:$@pK0 00K PP`X0 0@ @  0 Q,0W QU:Dp RK 0SD 5$50 5:D,D 0@88H H0,0\D $0  <.FGGPIGlIGIG -L MLP`p V `1Wp!V`!, K00 P;P,0@ 0, R0%0%0 0 T0,0 P 0SM*$Wi: 0Yc` (0S .0 "6C0D0SQ40I (0 RD1P`q1 $ 1 $ L0( cc40 040( 0S0000C0  00, 0h V0 ,@ @ 0S:,00 0 R0 $ L0( cc+ $ 0 $ D0 $,@ 0V0S00t  0xLOPoI<.FGGtGG P0-L@P D 0R!L R40 ( 00S0@T0(d$ BH"&;  0<.FGG5IG -LMpL`\8`5@P0 0 P  -LMP( K`p@=PF ( 0S $0S(0SL0SV Q\5L:$ QMRK RD 0S,?RZ9V# 0 S `0 0((0P U` 0@00C0(U@PTU0 S 0000C00( 0(, 0S 0IGIGIGJG$JGXJG -!L  &wP6000.0X.T 0S*D00CD0@T 0S:,@T D00CSD0 @T00   v $ ΢L0@ 000  v⻢ vP000 ⭢$ 80'P T4 $0S1D00CD0@T+ $0S' S GK00  v 0uUE"JGKG<.FGG @KG -LM0` Pp @000#P 0 svP0000XHP,@U pD0S PU0 00 Uv $ Dp000@ 0  @vHP,pU 80S D0S$  0CPU2 H &RZ 46 S\ P 80SkPU000 @vHPUE D0SO PUZ<  uP1000-0T(U@ 80SD00CD0PUHPU 80S PU0  uD00CSD0 0 $ D0c⥡000 u ◡ $ 80P D^4   0(\ $@@D0D0y0  u  0`UE"OKG`KG<.FGG @KG -L,M00 0 S@0 @lll#l3 0 `D euP L0X!Z1Z!, K  P ,P 0S*,40 $ XQ 0\ 0PS:  QP< b*L0Z80 ( t54 p5|"5|25x:80S+ @ R( `2 R$ $0 paS`j`jV H0H0 HP @T 0 00CSWX.9X.9/9/9/9X.900S3 jVz $0S`j`j 0`4, Pp 0 , <0 404 00@ @4<P< P Q:D t<Q20S 0 0 S7 0.㎿埿80Sʼ2SH00CS0 DtD t<.FGG KG$CG KG\oI KGKGLG -LMp KP`@3PT  *,R 0T :800S$@ T: -LM`p$@ 0P@O -LpP @`00S0 tW 0p0p 0 0 000 p-LM `P0S @ @ph{p -LM P`0S   @ @ma0SY`p0 @0004!`僞0  sP0000 01 LP 0:`p0 @000 `[0 sP000D,0QLP40  mspsUE" -LM0@0CS0)0S40`p P000 `0 ~sP00000S00H厸LP P 0KP P xUE"O -L M `Pp @00#0Pٝ  \?sP 0 00P L( HP, U0 4 p 0S @0SL "S ?@T zLDpP-(P 00S#0D00D0  @0@P U0 0  0S& r$0  CH"&05 0ppM@T 2LPU(P 00SK40p 040Dp0D00D0  @0@@L R 0D0S  0ppL D0S R R 4 <004080$ 0+D4 <0 80 $ 0 z$0  CH"&0 WUE" LGTLG -LM`LpP0 P@@$U, H@,PT( ( $0,L H8040<  @0FT0D  PF T F0T0(@TLGLGLGLG(MG -LM@0`p P0S+W@T   ?C00cSP @TP ?C00cS <$lMGMGMGMGVUUUMGHGMG -LEM00,0  pKŸ2"KoKd2!]4@P2 0 000 0P  X( " @ Q  Q6 T "0&! 4!00B@@T  R R R 0 ,0S ,吣R0  "0"2@@ @T   R R  RXRPpMMGUEMGUEMG(NG`NGNGONGNGNG OGOpO(OGDOG\OGOG -X0X L1?0c1Q< 8 80 ?RhuMgfffO`oI,sM0@-0 @R K100CS ?9?9>9>9>9>9?90S RHP  +a51"% !\00SMdoI -LDM\=T P`p@ Q0L S'?9?9?9?9@9@98@9@9(A9A9A982 єP@K 00 T0K1 VϠ-!0 ዓ餁XXK 0X TPX\0` 00_S \X! 4?2cL0X(\XK 0X 5PX0X` 00_S\ 4?2cP0\鴀`XK 0X PX 0X 0_S\h 4?2cT0`H  : ApVOOx/IQ`oI -LM0 @~1P ,0  P , 0Bl 0 0l0   0B0 (  $10S0B9 C9 C9B9B90B90B9 C9K? R0ԑ00đ00 R010201000MO`oINN -L$M0 0 4 S@P` 0QT, KXP`>,0 $@0\A 0 S:2\7*Z`!>20K0  0 @P 00 >2Q2^:40`, R ,00C,0,(0,QZ ``0K 0 0,0 @p` -L$M8 `4 :#:S @>0. 0S<0 "&0@ PD d0D H 7o0 KP D J 0,@QL@  D 0<S@*40I/2v 0V55!515o:$<0P*0L Sh 0Se$04 <S1+ ( 00ST0$ R"0V)0K*)K jVp:00L00 S  0<S: Hn8 4@ DVL(*0Y)0K 00 HatP 0S)KZ )0[ S  )KjpV:0 , 000c P ) K((4 40倹 0D0 匹<.FOGOG%OG6OG$CG -LM 0  S 0` p @ 40S0@0S0 (X 0WPU`pW >0~pW  0h:#:S 0Q0S:SQ::J q   `PS7 5  0 &P 0SR  R ,0( 0C,0  ,  0 @`` 0K \P000 3TP q ,0 0R,0 $ 80SS SPS P9 QS@@S- 0   000  : 0K  0\PH 10S     0@ |0 P80 J,0( 0C,0 : O,v VʦU^  R  1 0R-*  ( -LM`P @>< 0S9 *S"*`R 0T0@PbT >0N@T& 0U#T p0  Im, KP,0$ @D  P:mX  00 $CG -L Mp P  0RP p`R >0. RF 0WCZ@:SW<: @0` P000 `勗0 lP0000 0\P ,0KB0  ,Pl0  lUE" -LM0S  *"*R 0Q bQ >0Q 0\  0 P P  -LM@ʠ,ʠ\  0R lR >0. R 0^  0P P -L *"*R 0Q& bQ >0Q 0\^ @Q9@Q9@Q9`Q9hQ9Q9Q9 0    0   0 p-LM*"*R 0\-b\ >0\# 0^ 0 H,&R `0d$&@PQ:`0S*#p  0P ppO -LM ʠ,ʠ\ 0R lR >0. R 0^  0P  -0LS   0 ` -P P # -L  -L,M00 R0, P4 8 0@00 0S ,0>0>000  #20#0 Y030"8S8 p`004 $&80! 0 0, < }P@<X0Q9 `p0 @000x"`ܕ0d BkP000@- 42 H)&R R 46S  @ ,  0k,0 0P@, k\ 0 80S 0 @ WT 0 < i <\ Tlj 80S   |0@ 0 P 4 00 T|0 0 , :#:S 0$UE"Ojh -p| '6JX0@@P`LAY@HVT 0 S @TL 0S0SpO2S,2 R 000  0 " "00C02 0 R l0 000 202  B 00 0202 R  0OOOO2-0C22HSD000   202  B OO -LM2@ P0 00  202  B 2Q0 |0|0   @@2H02   " @002 0OOOO<.F$PGDPG2 03 R 0+ 000 202  B 2S2 R00|00 0h 00  0<02 0   R  0OOOO202y202 -LT40 #Q:0 Q: 10br!  0VO<.F$PG;XPG -LM , 0 "X00 ZY"0@0ŸT0T0\ XPx ^ `Y0  a0<"6AB4  8 0YCQ< <0 b40Zi8 1P0@8 04j Xf4 "*p@0&04`  8pj0>00 00>0 0 0P  P00( ,0d 0 @\00`T@004PXL@L  00 0 c8#4坳pOOpoI0KdPGOB}(KO,KOtoIPGPG -PL R: 00B 0 0 P wOPG -LM,a> 0R^PA0 pW 0gS*^@`0S:>0 N@ T *$PK0S J $UT:|Ph5*DD@0>0>0 0xoI(K,KPG OxLO(QGLQG -LM␢0^@xRxŸ00ShD 0pnS`nL> 0^ 0 ^@ 0R:0^@60 0 R   0S 0C^P0@P0UTò 0R( 0R0S*0B60 0 B0CR0  R  B0^P @P0U 0R*60 0 0R0  R  B@0^P @P0UpoIpOO|QGQG -LKP -LM@P\# ^/T%*p`V ^ 0S\\ 1`1 @0 0X2T崳 0@P<0謳4m驳("OQGQGpoIOORGLRGRGRGRG -2L M0Z ! 0CZ pWpWaT1Ό 00 PJPP00 T Z !0Z00G Z, PPX0Tp3qPU,  Q 0 0 00   #&X:P !0 0X P01 P#&:XP P!UDF Z,p<0X ,00 oopoIOpOPoI0KRG - LM 0\ , 0` @,pP 000 p8 00\,(޲$0$ToٲpoI U00R0S 0̠ W0U0V00S 2T 0  TV U0P0UA , V  0!6 rP0 U00R0S  0 0l  0 0 -p0@LT`PP P V2 2,"  2 021G0@T0 $PVP "C02 !202Ќ2  0 `   0!6  0尫<.FTGDUG000 `0 0,A0 0 0夌h9O -L M800Cf!  , b P 4Z00@#:0#Tp0@ ]H 2@0RS@T20Y  0 Y00 S(((!(150Z002 02 @TFW 00 dP句,q6W 2@ Z00S !2022@02LLX X0*2@uH@T<.FTG;\UGMMxUG$P,,9L9L9L9L949L9L9L9L9L9L9L9L9L9L9<9L9L9L9L9L9D9L9L9L9L9L9L9L9L9L9L9L9L9T9\9 -LM` `@`0< pQPP 8ы@ 00}h W0 QpOpMUG(OIpp 0@-d@0/C2b,S03S0#S<0<<0bQ/BR@ H@0OVUUU -0LM @`P< t  `@p@ 0Gp91 0V1`0 p @ ?CSD00D SD0\ ,0,R0ScpMpOOUGVUUU(O -䐟LMp 6 0`S' PS00+ U 008 0B6C0@ `` TP,0XH/`8*(,J ԉ0OO(OOOgF -LM pW     L W̠  ({@{0@0S0  S  R P U 4 pWp 10 1 @0b"0QTQ %5D S 00Shhp%p5; 0C 00"2$10$1 01001 @pTR 20p00p0L1 0R1 0S".4  0@@0@ 0St4h p0Sddx$x4ʾ0  S lh0P0 P 0020X00 Q P@T 0K\q 0 0 PPP X㈓~ Wz \0KQ0  @jL41X0P41 0P@ ` K0K0PXPP@P @ Wp  P 402"  Q  y  Q RT 2Q0 M0K$ T  TC20208! W8!  2  0a h0K @0 0@0!6 i K ; P 202 PP R 0 0I 0 !6SB 0 P  % 0!6B 0 tt 0厨P PP 2(10(1,10,10刨O<.FUGxVGUGVGBCGUVG@VG -|RL101@@0T1A d0S8>P1d0Sw@D 0 ^pc@dlh0P_ 1@T ZW ڸ X@ ZW"0S0Sxxx!x1? P00S0C 00"2 `Zھ" 0 P  W<1pG0<1 0!6 /P 2J02 J `2"02tt| |0ܧp T00R00 S nPDPu101"iOOO<.FUGtVGUGO -LM @00 8 -븡4 ( 0 S< * TP'*0%Q :c0!Qr*`, @2Z U:< R0 < R@0RD 0S傈4<Q<0@ 2#40 0Q!00@00 00C0" $0 0C$0"82Q08 200  00@@80<0 OOOpO -LPM0C`00 ,3pI UZ3P >0n`&&@<  0<S U#Y YY:20 (0  0p S8p 4 | \yx$&R:0Ra0, 53:q 0,&R:0R03:0S @,< 10ap1P12" Q4 0*R0# Y 8P, P\ , 4`ABPG2#40H!0Q!0000 !00C0" $00C$0" b```" 000 PP,00S ,0 4 0 < Rp@0RD 0S\|04 0  0 e<.FVGVGOOpOOVG -L`@pT* 2*Q0000 0002|P000@T 0$0Q@080 4 @Th[/0!pOOtoI<.FVGVG -@0LM@T 0( T  堧@oIWG p-DB MLP8  $ `  0`\TP`PXL `0`0<Ta 0`|t`` 0`<( a`($a! 1`<0!,148!t0dx |0hxph0L!`pO(WG@WGtWGWGWGXGTXGXGXGXGYGLYGYGYGYGZGTZG|ZGZGZGpO[G 0- LM0PS0P 0PdP0B)P!\0PPP?x@Tp 0@ \ PP L0 P0h!05@rMODKOI[GL[G@KOT[G\[GOd[G p-X0LM`V P@T 4S DDT `VpDK p-PRLMQ`@ \_CA As\ _ k04p -LM`pP0 , fR@@JT TP 0PPPP @TTO p-@LMT`Pp@TPp@-@P (4Rc`U$$  1 100^ 1pP0 ($ b2 0200 p-LM@`TP 0U- @T0P\@00 0S 0  00 00 @0D4P H$l Q0`Dd`d00d0p0<S 0  00@T 0S\`DKO@-0\ P p@@4S DP \Q DQH4H40H4H4DSDd00Cd0DKO -X0LM\  0R \ @ TT000@b`DK p-d0ML` @P0 K@ @$P0,d(4pߣ@K[G-X0^ P ($\,40\DP ^DK -EMLPM0,0 |$ pb0S S jP@,P `V FK@0D @P4 L$ p t H "P@dd00C@S񟗔`99D9D99D9 980S|0# @(b3 ,0S |,巊p,PP@ @ \N'^ P\"^N.ӵ00@d80S|00 0080S+  x\ ^BK@$@0pPP@ 80S \_\_qj8!0jPP@ 0 X@\ p]PP@  uTz @vB~KpGpGG>K0C+4P@F jP1` b'P@a0SIBKAG>KA0C+P= 0` Y( PU! WpG 4 O#J6; 0ἭP@An4$崭P`@,DTU WpG Y|@80@d |4 pMoIJ[G[GpM`\G[GDKO -L|M @0XpP 0 0cFP@80S S @0X 0 0bF%$ 2!b10S pP 0OP$K8 4#RZ 0`E` 0 VP @RCN@ 0 !0P C@\0PP@ 0R<0X ' 1 R  0l!000dh00h0 8!T0,0 $4>0CFT0 0ɓP`dwt0 幓P 0K 0EP@jp KT$;, PP@\T04 L0L$4 R00P4jpM}IoI[GoIOM[G\G(\GD\Gl\GN p-LM0@( +($00PDP(0; (FP` 0 00p $$4R,@80S$ &0@ P 0 0}E岽$h00bh0@8P ^`0(,$00Ē\]ph@  0M^pMO@K<.F\Gh\G\G -L M @ 6@aT1'L9 -L M@ 0@`T1'L9 -LMXp$K4#&:@IP`! ($@Đ@b0O&#J86$;\ @ \@P{-0OiF0 0+400 Pi \G -L,M< @@ `d嬙D @D< 0RL 0 @_<00H@ 夛H 億 <L$@D? 8 4K 8K,0KHFP40s Z<Ld  ?k80P@f"pdy`TgPq@ 0K0 @Dl`,X0L 2Wp`0"H0V@0, x A08K 0 80 , 4P 804@)<0 @ 00,YD0 H pp` `P|P @ @0< 0#@ "D !HY 0  0^$ P0l$ R(: 0S$:06>0. U$ & @0 b$Kp @@P$0 0c#& $ a8w  e$0 0e#&B<^GA- p0Q:>a?1 &#l!b0QPop*H00p "F!V: U p -LP(d0K`P$1 00 00`P0 80S(0 (0,0@0,<0  {0 00{|0 !b  K0 P0 (0S|0 h0!b1Q L~0D 000@y mHKpMoI}Ihd^G^G000 0-LM0@C^1<0 0P<0 0 0h000  0S 00000  ( R,0,0,0  R0  z0墙^G 0-LM0P. 00@H000 a0S @0000t P&y0S0 Sj0    (Q,0,0,00 000hYzd(_G4_G p-LM2@ P`% V00y  0Sp0S  ( R,0,0,0 @T0 @p&z0p`_G_G_G M-LM pt KP00K @@ P P P *9>K0 @P` `@00S @t#&: 堀KPo`DFᤐ#oYQ P  t 0 R 0S t@PU `V$ xRPU Rt0P `` l` 0U0R00S@`R  T圐 X0B X+ Y$ x RPP P 0|S:R 0 S*  "/ 0S@@ `V   YP0Kt  2Q\ 2 02  2 @002"02"10# 02׼BpK@ ` p 倐KhKtl l K 0P@ p _G$`GX`Gd`GP| p`0V` 0uXUl0P` TI 2B022 602/  2Q p0Q 0NႼ T T v  $d,b눠 2 02vnPx20tSꐐ`Y 2 S t  0Rʚ圐 XKt Y 2 St  Q0@SPKt"+2 K@:U PQ0Kt\ t0S @t0#00tP0Pw0St`0 t=0Bx0@K0`K0PKtPu 0| Sh: Rd 0S`*202\K0K0 RV@PTR`KtP2K02@: P?Q;l p-LM P 0R 0Rp@8 @0`<P` P0Sp`G -LM -LM@8 000 p S0`P40 1 s @:Pp` W400SP,  W 0 040 2! "0,00 1p P`P 1S @:Pp` W0W 0   \0  ,  0!,0 @1\ B,u\, # \ ,K 0P@,0"@ ",޺,01,2202,Z w,9`G`G -L4M@00# T p` Ẁ"0 @u0 0S 0S RT P00SX 0X 0R0t T 0 SX0pP0 0 0S*pe0嬡@@0K`P KH  4 Lp D 0 8p , `PI 0S>0HK 0 90P@/ U8 W00W00SbP R00Q0#02SXT0 0C0 S UvX0 a ;0HK 0 9 <6PP T4X `GpM -0 `VL@0 P UDp06000 :m  6 pM -L M0 p` 0S 0S0000P p-L MP?T1a@0TH U( T0S% (@T@T 01 P0S &0@Tph?T0  (Q,0,0, 0<00 R   0000S0@ l OHKPK 0 st OoI p-LMP` OP@ 0. ϧ0 (`凖0 <\00% 00  0X @qp 0<gly@ }0S1!@o0p ~FHI9x99t O p-LM@P^!`R111 Uq P 1 SaaPpPP -LM$ %2p0S !R 1S 0S S($ 5;5"!$ @81S1PU 00S$0$ 10C1 Us  P@ $`K g0Sg  uP@ 3P@R  $K⃫;1<1 $""R@0RS$<0Sp00p0$ 000!0S S  $ $W 0j$ -P@ $ @0S  P@$$ 5;5X$  10 1(Pt׌`G p-LM5@P; !R8 1S5 0S S0e1`#!1R1SP1P0Q1PU 10 1Kp5  7P $Pt020t0p -4LMQP@` /4Q4Q *4Q 44Q ` R R/`t4Q l4Q  K`P⯞ ` 84K40[S2 Kd@KxK 1P 0 1\@0[d 0@0K@["tp0  K@ KT0 P lP 0S \00\0m _K K!lPpQ嬋d5T T5T5` (K`PM ` K0[ pS (K@K K  1 0 1\KkPp 0P WY 'l\00CS\0`4T? !T4T L4T8 r 10aR001#0p 10bP001#0003T 3TV @1.SmVy @ܝ1 qP#0000q4#0000O|g!3R/W2TO 2TZ1Z2T 2T2T |2TW Z p d2  R): p @2  R*0S 7 00SP 5#$0$  R 5R00%"48<#P g1T X1\1^d1Tt1T*81Vd1T T:X10SPW  0ln$1T3e DXaWu 0T0 T 0T0T*00T 03FpMku$juPliHLi0UiViiileiHgildiHfiHii"i !i i ixFixi %i i bGbGRi Ii Qi Si Ti uMi Gi Mi >ibGNi0WiHPi Oi Ji(Ki -9LAMpWP0, ` 1 & 5 -0S S/cH0SVG Q@ HPTPP ,蜠K E 0[S -0S h@ 0 SR8 RV5 H0S |0SH|0[Sk q8(0000q(00 00 0PP  Ld00d 7P 0 0Y0  ǟ,0 S ,ppP0005S Y eP d0 EcKO5$#Ġ0Č$7K7K4x@Kl p0 lK0.KK0KtP P 0S0 0F0$ dK(\K0HKd0KcK|Ɵ@K.44HKHK GK3K0P P@  P 80S0C80ž@T 80S0C80ŝ .KaPL 00S 00$105 H0K| Ph ۛ|şP.DD0HK CKH0KGK0P P@7  ӡP 80S0C80A@T( 80S0C80 .K P 0S0 00$10Cx4 R*) i(0  h؈GOK@㊛HK dK  ,ğ(P0Q Q P   .KP 00S 00$3 R /  (0垈x^@K@PXß HK( dK0 P  I =2 R (0 Y hK `P 000 ` xP0 82 R 0L NPa 1 R0 1 0 ; 4CVD  BP`7q 00( 0 )0 X1(  5 0`00|00 R` 0S  0S`00 0`C U 0 R 0 R 0[S0[0S[Q5#$0$)K%"48<#Q PSpMXvIuMcGtVEDVE MM4VEcGPcGcGcG`*OdG`dG p-LM@ Pa0 `0S R Q0000S ph P0`00 0(0 `僇dG p-LM@P R0000 0P @`U00 0S S @0S SS00午0S0@ R \00C\0 0@ 0 Gi 0S0C 0 ph 6`*OeG0eG 0- LQP 0 @R T0h@ c -LMM$0YZ,0 0P X1  4Q x4Q -`4 ,0S X,m0S^0S[F/0SSV0SSRQO3XS O3X0P p@/`Kx㐙   KU00  3  R0TK\0KhP 0@ X, !xK ֝U0h0  d  P` 0@QP@0pS0S 12XKOKF0)v2Xq  SK 㥝0T1 `V OK0 S `VT\ T< PU p ` 0S0C 0 00 R 0PV PpP0ST PU p ` 0S0C 0 00 0@0S00PVPpP܄KeG@-|0\ 0S \ Q @ 0 0R 0 0^@0 0K p-LMp`@PT 0S @T 6h?@ᩗ0 0P0 S00@@ pK -p0LM@T 0S @T P P R0600 h@K -LIMp`0,0 =00 P 0SvP,6 ?P`g 0 0 PU 0SPU6@ 100,0 S ,zk0SU P 0 0 0R 0OK`0`0(MK@0K<0A1T (K 000S!J  R0600 c@ 0S0C 0 S/K 700SP` V P 00 0 `pMeG1i -LJMp0P 0 0`0CS 0  0S jI R000  R 0CS  NKᩖJK00<0 K 0-K 6?:pMeG2i -pL@P 6 A>`V70 0 @T6@ ? -LM@P6? P RP0S0S 00S0 0- @LTP 0S@T00S kP@-`p000 @0:P^0) S^0S \PP\00A000P0#" 00  0#" 00  P0S\pIXKoI -LM0@S S  PP P 0P P P0P P$VE -LM@PPP  0-P0L@T P0 ؕP0@T00`*O-P* 003P: 00 ? >-RALQBp`L㴂 ᢕPUe 0 S\D@ @\P0 S pMVEfG8fG -L M`4 X, 0 2PU8 S@OT1 PU0 R) 0 P@ 0X0Ÿ,Ÿ 0 0>> Y 0 0>>P@ 0 0 0>P@ 01 @T p0S @T00 R YDJ P?J8 $1 R 0 0 \ P00Q00Si"QPW,p 0@ 000, PʿP, p0bSʳX0 0 R PZ0MO'OsILfG -LM{, @pT`P 0S$ @TW  @T 0 R @TU0 0 R`0 h0 RP:,0SW y  Pp0sI -LM@ @0T0  0 R @T0K Z%X0SA  AR 0 RQ R\0500S\ \S:00S S* S00S S:00S S* PMpI 0- LP  d; @ᥓ ];垓 V;嗓CI0 -LM@_I < < h< -LpMpxPK0@X 0 ux0 p`K&[ җ0 00   00#0 Q  gpMM MfG p-LM P\ 0S \pQ  R X00G\`@` \^ %P QP ;PTTP YP < SP T# T 00#0  p  ?P00 0  00  0 00   Z#PT0S 000   P GPP PT@# pIpI -LM@pPrPT T kPD P1@T T `P, @T'Pa0S( 0S 0 @ `( PpP@ P`p(0 h`0S h(0( @`0S(0( < `0S(   MXvIfGfGgG(gGTgG|gG -LMℒP0夀K@(x,0 N  5%#000K42 8K4 KK 0 p rT`K@@0  \0K[ K@ 0@ 4@  4PKP@b #P 5X0S0 000AK` Q @K@KKKK 1 !0 1\ڸ0[00K [ K  {_P ,0 S ,f _P/P |0 R0 \  KP 40 R $~~pMVEgGXvIgGhG,hG -L|MPK0`x@(p$0 埑 7LKhKK8@0 @P 0KKT0KSKp0KoK,P (P 8@ P $0S D$e80 0\0~pMVE$VEThGXvIlhG -LM⸁QR Q$ p`]\ 0 l R .R Q 0ll RL .RJ Q?QDKPK [ ΐ [000[S  A0BS 000S |@KXK [PK 00l0 0 %"4 4  0 h$0 S $1elpMhG p-LM(aX 0R@0 P 0BS \0 S*0 R(  0S ep~X0S 58J0 R (  x0 R OPNH,KZPPpMXvIhGiGiGpI$VE -L0Mܢ0p(0 ([H PU 0` RP U PU `0S6 VPDPKXB>Hj;0S( *4P'WZ'08 HQ 1 0@80HP1؈0  0@: P E,0K8 P<080 } , 0RH5:0tKKOKiGiGjGsI O OsI O(OOF -0L pR0 PU `MX !@@( 0 {1Z PbPD 00b014 00C0镽/vZuK O O$jGiG@jG -@0L R 0 0  /v @uK$jGiG@jG -<0L R 0   0/v )uK$jGiG@jG -@0L R 80<808 8< vuK$jGiG@jG -<0L R <08 8 8<0/v tK$jGiG@jG -LM40S !gvta008PU U p00C08P<0 R% UȠp 0R`<0S P<@0  0hR<0S00 o~ 0@<KiGiGjG OO OsIO -造Lf0S a`P00\80S Hp`80@80SL00mGK OO -Ld:(0 0 0sIsItItIQ0-4 $Q Q(0 `0P@ 0R ]:<]:D]:L]:T]: 0@000 0Q QX0RH0 R@0RP0R00 R80 0-pP@LP 0S P  .P @0 S00 0s tIPjG -4L M0p`@A P0`P 0'S1@ 0S 0S 0S0S0S 0S (0K  #) P,0:S @0 40 1P0MS1~  80S $00cn 0 !XX 10000 00SZ:XN p4    R= R1  R) R < 4( <"4)<(#,(` ## 0P `@0P`(` 00S S00000S 00S S0 0 0 00S1 Rt]/s00S: 00 B00 0  0h0h$0C0CMcᮽq1P@ U 0R0% :P 0 SR0M0P@ 00K ]P 0 0R0% * V UV (㾽Pr OXvIpjG O OOF -L$M8 4 8 p0Qg ! 0@40X<0 9 0 S<%D ` ":V :4 0@ PP0,!!- 0 @0S ʀS S eS) X< R4@  @0P84K  < ^<0@Z40 0S0r4P 1   0 @@0Sd:d:e: e:0e:4`;P@ 40S 1 0@4 @ 440@0 4 S S4P 1 (  0 @@\ \40@P4P 1  0 @@\ \404 40S 1 0  0 @40S=ʂS400S 1 @0@@ RW X&S 40S 1 x  0 @4H)0㑺P <8<488 4 940S1 p 8^400S 1  0 @X400S 1 8  0 @@\Al(4 0YP@@44 f 1 0D S`*`@PNjP 1(1$ 101@ EZ< 1:)011@01$ <L ( Έ ʈ00 0g(0 0Dл(@0~ Z0  ǟA.L` BP`0@ `4Pic@ 44 0DS : 00K xP 0 0R0% *S! ʇSf DS! Sj400S 1 h  0 @@\'X;%4 0㳹P  ^4 @ 400S 1 `  0 @@0S}XP%40㓹P  OG=4 JG400S 1 P  0 @@P\X$4@0rP  EM4 @M400S 1 X  0 @@ R;XL$4@0QP  C4 CS 0CS40S X X#401P Z ß `LP`0@ (` @0S)@@<iP 40(#1140$ 101@  Z 1@ p 0g ̐  80 S- p32( < Y  ጇ04\ ᅇ4 @1P:)014P 4z$004 s0 (0P$00 p00g4C@0S@PX:400S 1 H  0 @@\~XX!4 0㔸P  K>4 K1 R$!4`P0@0S 1  0@4<  0o0P@ ,0K P`4  , 0R0%` *P `P@o OXvIjGOʚ;OMMOsIM MOjGOF -LM/R, 0 p^ 00 S0% I:X 0 ` P0 3V <+V V2 0R0% :P 3V0000`QQ@0 4 ,0S ,wV 0KⅽPp  0R0% * 0 S0% :X dK0\ d0Kc K\@Kl R dK0L PS@@KHK0 H0KGKj9 HK 00 P@: 048 <:R0D0 00 H K\p 倠 |P p x 儀 h`K ,3 (3!10S dK K0 $(,<4<!4"< K0 l 2 Rضfn\@K   0K0 Ppr  00R0% k*,Vc 0@S0% :P9 0!4 R`P Q 0KǼPp  0R0% *_ 0R0%@ /:T 0 0Ra% 0S" 0S0% :P 00020C0 `P 0K⓼Pp  0R0% *+ 0K⁼Pp@  0R0%@ *<V0K0 pPp  00R0% *$0P@ \ npMOjGOpIXvIjGF -L M@0(  $( ,<4<,4"|P@lU110SPHDPK؀0 C0KD K<`K0SG G P, 40" L0P0SS<1 R \0R:1  R' \0R$*W*0P@ PpP 80S0C80ڔ0@T @T (0S `(T\0W00S0%" KpMtItItIO tI$kG -&LDM0PTP ,0 0S80\0 `P dP @p` :Y  HK@h@ W0@K hG0KHK廄HKLP@0[S rUo5 ,0S ,wT?0[0S 00f@CZ #y:y:~:~:0ST 0S SZ T @0Kȶ@ [R R h@K EH0KPd0 Z Z Z 񟗳Xz:Pz:,}:8}:<0\0 @ePP !!$ 1$010 1UF 1:)01``@\ $0R0 R@e$$ R 1 0+10 ,`(`SKA @a0@RSD0SA La0LRS00L S:XA @a0@RS `A@0@ \-P+^H`PP@X Y @*0.S@,0U* T:0 0, S*00S0C00  00 S000C00 00c 0W2000 , v0 `  co@`c0$0$ R 1 0 +10 ,(0S:0 S6?Q3 ?R0Q0E\) R0FP$ Q$ @R" Q 00S00S }P0pi0\0jS\ 0jSg }P -L Mp, 0p  4p 0SAR0 > 0`V @ T 0 R @T40S` pV,0 `Y0P AP P  0   P  000P K}P040 M -LPRM40 020 pP 0$< 0 W8 `x U @T 0 R @TWPU0X0`P`80#2   X0#00 PK EP<  0 <  4 R- R0' 0R0"00c,$,!$#,,  ,K  00S 48 A 4 8 100S00,0 08 04<#$ 0P<0 <  <0 MuM -#L4M0P,0 0pT0 Pp 0R0% :Z. HK]|0H0KT0 0G Kc HKX0 F@T9 h0 @@TW1 h 20S'ṳ@HKLP0 :P`PP x2 ,0S p,ePR@L(@0S  P KF >2P@ r0:S,0S00S40S80S T , /|P0S 0S$0S(0S X |PQ 0"0 # W $!0㈱P h 00S! A@P0LHK P  PP0P0 pi@L@0S   P K L0K PP7 L 0R0% 0*hpMhIOHkGOʚ;F -$(LM0'Q,0   (\ 00S:p:00(L00 (( 0@℠K 0  K\{P` K`KPK KE 0K@KG{K`KPK  3 0 6@T 0  j{P0 @T0[Sp RE  ` 0: 0000@S1\6   0:( @@3 401K<1 0P Q 1 0@Q 1 0C0@\ 񟗗:::đ:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:<:ܑ:: :$:<:T:l::::0S 1 0@\ 3 ,0S ,wN0S1  0@0S10S10S10S10S10S10S1 0S1B0S10S10S10S10S 1t@K yKK0  tP 80S0C80 R01 R|K0 f"0[0S1@  TȠ }0kP+^TPK(@L0( O 00@S*XPL ( }@0 R 4@40(0@fpM`*OsI\kGXvIlkGkGkG- -LM@P;`8p5 @0 hKkG -&LAM0p,0 `@0PK }Z - L6 R @6 R 0R0%P s:Ui  K}K }0[SU 0[SI 0[S 5 Rş@0 @5 ,0S ,IMK| Kf0[0S0S @5 R K0 08fH@Kx0@K KG0KHKQ} P` 0P 0S 4 R80S0C80ű9K KKU  f@K xP80S0C80ž0[`S 0[@S KK xP00  3 R K KK)NK(H( ..Pz!R0 ! 僑Q Y0 00 S T3 R` KLK@ KKY0PI 0PeO !@! 0K@5 !R3삟! 20SPAdPK@KQx`KMxJx0KxK c0KdK0K0KKK|\KK |KK |FK !0@P@K(xKK0 0KK|ի 1 R K KK Oe0[0S@@RT1 R K KKdb= 1 R K@ KKw 0 +e0 R K KKi0[0S5#$0$.K0[0S5#$0$-K0P@ E?K P p P  0R0%P {*LdpMsIsIXvIOlG,lGllGlGmGDmGtI tIx:mGmGnGPnGOF -&L4M0 P`,0 (6 R VU 40 <0SL0  H@Kxw0 @KG0KHK{ LL000 +0Pj 0Sg  Pp`(@]P 5"$ " pp!p pXE  @h\$$Q 1+ 010 (p,p<81 p0p0c,  80S00 0 b L R,#Y0T 0000R:P  0 0R 40 0 SP  P p`0@0: 00 @ @@Z{  V{(v0(0@@@@@40 PQ 0P D{@ @{P L  /P(` L gY0 0@T0 R4 30 S T  Q@a@ 0DS:?>0R@v!0 0 g 000 խPUū0Sn 0Sd 0SZ 0SP !@( B("("48<##80@@ 0:4( 40 0@@:P L0S 1 0@LQ 1`P 0@L  0@1P@ p1 ,0S |,yJ00S000 00S0 0 000S000 00S0 0 0aᗭ kbAᑭg00SR\P 0SM 1 0( LY *mz`g?X'U #0  P \zP00S0P0 pM OsIMMM8OnG -LM`@PT :Rp/U U S*` T  \(`P Q` z`S*`0S`  @ z`0T0U00Sဪ - 0L GPsItIK 0-LM PsP@ 40P00 KPPb0SL L@808 P000tI: - LMR 40 S L00P00 0 ,,bnG - LMR 40 S 0 0 bnG p-L MQPPP 0@S0 `ph4P 0<P:p*p 0 ph;p(tI O -LM@00K p" 0@ 00 "@0P ,` U0@K!!  v0K  ?@0@K v p0 -LM`osw4k0@!0c48e0!0c4<_0 0c4 DY0 0c4 D@!390Q 00R D @CwpZP, @09wPP A0 R ~p0H, 00 S0 L 0C # 0 0 R wYp@ꫪuM -LM, 0PR* L0Qڂ, 0S*@Dp`@40x v@T4<@0 ,0H 4 800 _,uM|tI -LtI -LM [P4 @ dB!2b2c621b1c00Sڜ0P*0 R 04P:l0l  Z)h\ dB!2b2c621b1c1\ 0`pIO\sIuIH*OoG -4@LMs pE0hpEHOW;I p-LMdP0S `p@T 0 S00 00C0bT 0SpH*O --L @ 0X  # 0@05S1#=#=p ]pMOXOoGhOl*O8*Op*Ox*Oh*OsIOsIpIO'OsIuIOOHOXvIoG0*OpOO,MF -L MPp 0)S0`(4P 0 0A( Q0%(":P `@D 02P`P @0 00K( PP 0 0R0% *,0K( PP , 0R0% *\OF -RL M`p40 @0S SP V g* }pP P`eV@1P@ 蝤SN SVZAP 0/0K s00(<4<"4!<^00 S: 00g0 @P,0  0:0g0 @P,0  0g0 @P*0  0g+0 V R*Ks"[P"48<4 #8V0PˆʎOHO -0L0@Sp S %S S 0@ 0S 1   0 @0`P``0HO -L$Mh0L ,0 @ /  DK)0D 娻L PhhL  0Q^ 7 0(@3T TT +T-  PPA p3T0000aa 0V43T !T +Th0 3  )0kL PL @圣ᙣ(2 ,0S ,B<Th0 2  )0KL0P~1P@ <T (eP@  00Qh0 1  )0&0LS0L  L Vh 048<,Ơ0ŒHK)0= H L0PhhL b@PK wr@ [R! R Z 0Sh0.  )00 L0PhhL .?0[0S S #K?0[0SpMLoGO -3RLM@p nR +R I\$0K {3T#0[#0[00aa@d{SPP T011 01!  wUV#U !0 00l<  80S Ⴂ$00 00lV* 0 ; `O@t=S$G$ R 1 0 +10 ,(@; 0P  (<(XW'<P1  R \0R:1  R \0R*P%\ 1 0@X <!0 R \0R:1  R \0R*0 \040T 0`\R 5 R 0@50X0 5 P0@@R R  R R <P K0PP R <0(PL k <0S 1 X0@4P@ XL L0ASJ:,:,:,:,:,:,:,:,:,:,:,:,:,:,:,:,:,:,:,:,:,:,:,:,:,:,:,:,:,:,:,:,:,:,:,:,:,:,:,::,:,:,:,:,:,:,:,:,:,:,:,:,:,::,:,:,:,:,:,:,:,:,:,:X0S   X  0{Dß0@<0S 1 H 0@X R  0@XP募00S S[000W00SQ 00S SG0 0 0C 00S= ,#P<, 0 \0PHK`  \0PP P0  P0㖚0`L0 `PA0L0 7|A,Y ( @ @jPF P 80S0C80,!00i0 0  P^n b0\)P@0  ^ jPp`Bo`圶L0Sp sLP ;PL0K( @@GPH$ VpMOsIsIuMoGoGp*Oh*Ol*OPOsIoGsIOx*O,pGlP- 1 Q d0LS6:4:<:\:|:::::^ 0S0 ^ 0S^ 0S5^ 0[S{^ 0[S-^ 0SuI 0-0HL@ S 0PkT0h/-00uI$0 P 0R\ku$juP -LM`  0 $0#(0#0#,0 0#0#0#0Q@0 Up# @ Bi0S$$ PUW ɵW \008 0d00@0l0H @0P@ iP0SpTCOCO\COC-`0 p\ 01a!P0$,@`P4 uIT,O0 (K0P 00(K 0-0LS-P 0 :R 0Qt0*@hT0T0PhLhD0DD @=:80,/"A;:uICOuIGO(K,K:I -LIM┑0,0 610SxqpqP0S`a01e1 @T 0<MK> 0 8#XRFh 1@@@;:paV PU @!8TP`8VpWڔ#h0 0@ @@ ,0S \,N<K;L<S/KpMVIuIT,OVE(K,KCOuIuIuIXpG2i p-LMP0 R@!K*` 1l1 KR! 01K![R:xxP 0S\p Q R 0S RQ[uIT,OGOCO -LJMⰡ 0?R`(0 301b!QQ0+PX l1 PT`1 qWO 01 DAD1 R 8q_0 $,p4@p0P 0S00‘(0 S (; Pm 505 5S-/@Kp0 $K dR/KXpMT,OHIHIuI*OuIlpG*OxpGVE1i -LJM q01b`AR( P3*0S0 0 \g\ 01l1D LR!Ȱܳ(0 S X(D;LK@<0 $K R/K(uIpMT,OpGVE2i -L$M` 0  $0#0#(,0#0 0#0#0#0Q@0 U   g0S$$  PUZ ㉳0 #<#<0}ğ@0 s0  @0#0#$0#(,0#0 0#0#0#S0Z,0    fP{ ZX=, L3Z   f0S$$ 5 Z8 'P'  @<cc|0cH0K@K0  G0K1h0dS | lSq00<34#P 0LPS 08#P\ 0LPS0dS lS2 | FP|2"@0`P``@P| c  @Pg| $@PgT t 00010h q LhPTd@@,bP!@0`hP``8 dz8 T7L8h dn8 T @P0P 0h8 d\gcP|@0S= W> 0S Q0 Rh00 @0`hP`8`h d6Tկ hdP 0'S7cP|0Sp{}00S SpMsIsIOuMpGoGTCOCO\COʚ;uIuIT,OuIdCOGOpGCOCO -LM㣯 , 0SX,嗯 40/"Ao~4 1`pV PU t0S 0CSt0 p`V@ї8 TP@0 @008 GO,K:ICOCO -L4MsD$0 L , SP $01g L0R ğ`Pl 0@tD R 01g`t1 R T4 R 1@ $4 ,0S $,6( 0P`i 1h  80Sc (`V[ ȃP0pdSP lSP00pFß儓 @RY 0LS  \(00"HQ00S 0L SHK za0 dQH0KG K lQ r02@ P 0PP 70 @@@K@ p00P7 0'S0PpKS$4,0O`@0 P@KP``\@0 dP@K`P``q圑0pSU4\ 21< 02 01g\`0S @0 8#xR\ \\ \ 83 1c 0 \0$`4S@0 P@KP\`` P  P  )P0L@PU l0P@ PL@PUpMuIT,OCO(KqGuIdCOuIhO -LMp`0"0P@? 1}  80Sx (@T1 1P<U1^ 弑P 0S;P00S\  \ S:00S) S'*  Q0#03R\81 R 0  ᵭ0 0Le 00SPP U aPP 0p0,eP 0KD 4K04` /KPw 0'Sʚ; KsIKK -L,MlrPPK`bPK`@0P`, L `V@DFPp PQ2 0$2  Q >Wb 1 (0 0!0P] 1R  80S0$ 0bc  Q Pp? (00 HK_0 @KH0KGKdL`! bB!112b3b21c12c!b`Ԁ0 0`0 @0 PH K0Pp,0 S |,Q4P 7 0 @7000c0c,COpMMMMʚ;T,OdCOuI qG -L MŸp0@0 04 `cV/VP0P 0R0% P :Ux "2Sr0S000g P$Ÿ_0^5Ÿ"p 0@R/*1R, 0<A /V800`S*0S 0 00UPP 0p1 p1!b100X!Q0P 0K 4 2@ 0寔 00@ 00@蠔;PL 00@@0 0@0  ,0K ᠚PP0 s , 0R0%P l* ,6LCOCOCOuIuIT,OuICOCOF -LMϟ`p, ` p p P0 0  xK 1 cK_Xp P ,Q0Q4QXQѫ NP@ $Q ( wPP00 U |P@ Bo0SS 0Ru nP@K >cl> pPP 噫0@S @0S 0@0S 0@0(S 0@TWF0 P  0(@CT2:Y KP  %KPP  R @ Yu 00 0 0 <000S Ye 0 0   00@0S YT 0< 0   00@P% YC 0+ 0 0  P `0S0d@ b " BbxK B@D 0S 0S0S0S 0S @00 S X  40S8  X q \\0 $( ;0S00 0S 0 :#,8#$ " "4"0 XO 0s0K 0W= 㵪K vPP 1 <100S0K0 0 坪 ,0 S  ,2 ᑪA00 L0K\ ^LP 80S0C80LPh@K`]0 `Kg0KbhKKK 0P  R X00X0p 0S 1 P0@ R \L X 0S 400  \? 1<1!KRx0K @K@P 0 S&0!X `0S \ 5@p  R R R R p R R R R 0S 1@01 0  0K!K wP00 Q 1@010 K0P?\ @? XP r d0o Q !0 RV \0RS*0S(00 "0SQ 0S  0  Q0: 04, < Ɵ4(<"4 Q   0b0C0 S 0 0 0R0  00 0S   0S,0 0  ,00 `Zb@<PBP ,5"$ " J R 1 :)01$0(@000  `0 @ 0K=P   0a8#8#00!$ S j0ѵ ѵ 4<#$0  @ 0D8#8#$(,""(  0Pj 0S  0S0  0#00 ..<0 0,0 0 @ R 1 p 0 @ Z_0S 1 `0@0 0\ ` 0`0 R0   V` 0S ,2P@  0@7  1P@  (0R0  1h 0@ (0R0 1  R \0R*^\0 R00S SU000Q00SK 00S SA0 0 0= 00S700S S,0 4qW%#00S 00S S 0 00S pMOqGMMM8O0O OHIsIuIPOsIhO(qGTqGX `0S   1<<1P 1 0@5S `P0@P 1 X 0@30 P 0S#P1 R 1 R W 0S 50S00S{ P 0SP@ T [P@Q 0S    R$&1P AP 0S1XH2P@ 0S0Sx2   0LK  Zo@0 -0寏孏嫏婏Ȑ 8#8#$(,""( K P  D3  ^ ZPp |Bo !0Sp sP 0K( P@xPT K !#P 4  K !P (  K !P   K !P  `$ GhG - RLM`pAܦ@?PP 1010!1  ƦU( V W `  Z^P㷦@l?0$0宦$ R 1 0 +10 ,(P@ P0 !! !ppqT `0 0p@MMM (R-LPp;0@S @0S10  0b<S 0 0 0 ť`>PP | 1010!1  ᯥU 000P 07( B(0㋎PMM -LMP@Pp ,  ` P 40V80S0C80O00PX0 0 ᇹP& U;`>;T2.^2 Q.^ U 0S(0S%0S" 0SP4 Q*Q 84 Q Q{ P  QT70S 0S0S0S0S 0ST0S`0U0/^00ST0 S*RI T0 T T0S S /R0S 0S0S0S 0S S 0S0{ <P  00S(2 R2 Q <4<("4 <0R T1 Ty00Tu1{ P, R Tw Ta00QT\#^ ^ { P 40S0X2^T T= 0T80S5R3 10S.3`{ P436T0 S\7TQ 0Sd00d00d0 f= HIHIqG 0-0LP@!㓄P= 1 0'S(㗆P2 0'S- P$ P P P  00hA00S S00000S 00S S0 0 0 00S0hǃ0ʚ; -LMP 0(SpPX@F4`V$ 2 0 !!2@V (@ 1:)01000 (0( B0  P @PR}7MMP,0 S00!00S00!40XS00!P00! -LM`P 0R@ N:T 0S50 0Rq 0R0%@ :T   MP000 @0 ,0K HP@` , 0R0%@ *#0S00q 0j0 @P0 0(0K #P@` ( 0R0%@ * :OHOF -LMᤢ 0\(0 ` 6 0p00 S0l B 0@S 0S0S0S 0S 0S  R0s RS 0S S 1P@ 訂(0 S (!0S  R0S 0S$0S R R  0s RS$0S S8PKp Q0S  Q0S 00S !48<#,#8 000S00\0a0 @P0 0(0a0 @P0 pMHOqG p-T0T@LMK`` 00P`dQ 0,@pKDKLK p-LMP㹙 @5`#Ġ0Č MP 00S q둢D #211@,0($ph鑙$(vIQK 0-0|%L"4 40`P%@"4 40$0S 0LP 00S 0h7vI(vI -LM 0R @`P :U  0S ᰁ 00S0S9 S1@0S 00S$ P 0S P0S 00S0 0 00SP` V LP`$(5#$(,""( 50S 0S0S0Sn 0S 00S^ P 0SP0SP  ā,448!#8?As\5#$0$ `V pp :LP`V 00S0S 0S0S0S  LPX (0S SN0 (  n0$0(5#$(,""( 0Sd0P@ $0K P@P$ $ 0R0%P *8QvIKOF -pL0P@Se0 @TP  0`@VPTV ( R  BR(  U` PV m@T 0`@VT$K`*O -LM`8 P 0@ 1PP  2$020 1  1 U @0Pp  1010!1  W @@0( 0 p@ Z  0: `000  pOXm  jO0@ 080`0``````` XO0SN ( :0 4K 40 J80HH!p`P0@ Y0 K/K4  1 0@80S ʂS Z00 |Y1   0@80SY 1 B/Y1 , 00S ` ` NtMMVE OuILK -LMP 0 0 0 RT@00 DD<00aah h7vIKHOIO,p;IqG 0- LP|88@FJ00T0@  00?040: "# ? 0 00uMb|! -LMX0@S #S\ t0 \00h0QQT0 Qh#( 00K7R 0\ 0@pI$rGv p-LM`@(PI0V00@ 0`p -PLM \ Q @T0 S *01 0 S00@ 0(I6drGrG p-PLM@PdW 0SS 0SLapP: 0BS(S;S;T;S;S; 1S 0S0P U 0S p@0 \ 660S |  1S$0SL `@0P`(`\Ip P6rGXvIrGPvIOrG sGODsG p-LM@P0U`$L0 L@ $0 00 ph 00)IuM -LM@ 0 S  iPUq <`Vm H1Q p QgWh 1SLV;V;W;4W;W;1 Q Q 0 0<   0041 ,1Ba  0 0S 01 00 0S \ 00001 0 x0Baa0 L0 Q0005 (5 5hsGDvIIMbLvI@vI|sGsGsG p-LMZP `HBD1D!00 @01@T Q 1 Q::@T0Q P@| 0 0b S&p 0 0bS00000T0@T 8| `0H  a R@Tph @Bȭ@'W;HO8vIIHOuM`*OvI p-LMxaPP $0@SQ TP $0@SBT$1 R `0S@2 T  5Q' 0 R0 R@0S S P 0 R 0S \ 0 \p 5R`H\` 0S 0SHOvI,IOsIsI\vI -L0M졟0D`KPp(0 G0@15SQ CSd0PUh,@0  00 ?0#3 0,p;IOIMvIMb -L M0pS, P@ ` P W 40 40T 40 PTZ751 %  h5 P , 0 ,  0a` `Y .wP 0  0ī 0 (@4/`5E 1!S8R) 8C8Ss P0 S @T 00!1 1 Bar  0@v00018!<1 0 ^! !1!0 S! P@r Hp0`WP5rA`AP`\0S @40N@0 p\@PF h P@p 80< 0CR801puGIMbxK@K0 H0KGKqP@ 40  00 R TٟV_ P` 0  p0S  0 R +w0[0S5#$0$'K p0S0P@ 0K yPĀ@  0R0%@ z*H+pMsIXvIO(vG8vGPvGhvGvGvGvGDVE(wGPwGwGwGOF -L|MPK 0 , >0S Y0帅 00@@  R`Ċ`#Pp | !1 01$0  1 ᫊W 00S"W U 0S @00 0     0@00 :0` d`K0HK@==0U H0KcKGKd0K\PK  B R0S R 0(S@@K A 0KK9P @@K A(` x0(0     0 A Rt Rh ^H 0@#$(,""( :( @@ር K0R0 $  K@Z 1`P 0@ 0@@0 \ 80S0C80h2 ,0S h,b ᎞ P Y@ 0 @@ 0P 0=1 0 Y @ @ qA 00S S0 0 0 00S1 R P 80S0C80rQᲦ0 P#*TE  ᎦPN>@@@K<H5 #$0$<5K4P XP %KT0 P@K\PK1 <1 KK吠 ぉ@o"$y$ R 1 0 +10 ,(PK >K 0K P @K  >(pw0(0P 0> R R  R 0Sy 0Sm QY N0@#$(,"̠*"(** :( @@- 40K K0@\ 1`P 0@ 0@\@0 \ 80S0C80,0 S , 4  0Y@ @@ 0P 091 0 0@Y  @ > Y0R00` 00S Su0 0 0q 00Sk$1 R P 80S0C80nO0 &1 <1 K K < @*$4$ R 1 0+10 (,<`8`1An ` 0;'(E&pMMMM0OyGXvIyGM$zGdzGX05S S Sr#SS GSS S,0 P 0SPK 0- @ PL 0h ;  -LMŸP@Q2  0 n 䁟0S00 0Sl 5Pp8| P`H 88 8hl1 p ` `R0 0U0 0 p @ppp 0S 1;iw0x;03 0 0 0Ba0o 0( x%0f `P\0(0i%0[ <P00(0(y%vIKsIXvIIMbzGzGqFzG{G 0-|0L PR0@P@ X R 0<00  0| 0 CS 0hvIK p-LMPU`r P@k bU !0SF 0R20 S0 S R&0`!00S R0 <10  0| r 0S0C 0 phۄᲙ0١ 0( I%; 0 0 0Ba|0 R ( t,%0ⳡ \PX0(0!%0⨡ 84%<{GvIXvIKh{GIMb{G{GqF{G4|G p-L MP0`@T6 ᆡ 0( $0000r 0( |$ ( l$ R 0T00  0| 0S C pph'ph$\|G|G|G}GK -LM00 0 0 @0@ @@O -PLM@ -|0 0R h0 R 0P (0h$Q 0Shy000 0$vIXvI$}Gd}G -PLM@ R000h_$}G -LpLM0P,0 `@ <K;T2 l Rl@2 Rh 0S# (2 RŸ@0 "l1 ,0S ,+ ỠP⸠ @(0&$<0S80S40S00S5 0R0% A:P7 d@KH P%` R 0 l 僡 Y0 00 S 0 R <K~Y0 J#@ <Kl  0@J0 R #0P@ h0K qPp h 0R0% *(r#pMsIsIXvIO}G}G}G,~GOF -LpM0@,0 `1PK :6 R 0 0S# 6 RƟ@0 qkdƟ,0 S `,z  P @(0,u#0[S 6 R K g#0[0S 0R0%` Y:VO @KPE QP= 0 4 TPK8( L5KLK0T<0K0 43K[T 8 4  <4(<"4%$Q0S !Eᜋ0$?0D@$#3 000  04 8 <4<("4!<0PPP @ P,d0Si A TQ 0S& @Q  0 A Y0 00S 3 RF KcY0 D"<0K@ @090 $(,<4<!4"L T:0S\  \ SP1:PT0@S z2 R * 0P"2 R  0" R 0S " R0S\ 0SX SR 0 SB K`&50 K0KK90h [0  /h K0h [2 00h0K1\K 0$(,<40@S;;;;;;;;;0 R \300 -|0 R \2000R00 00R0 0(0 R l0\0 LYIHYIPYI -LMO0K∟p  s ,0 Ps s s *"`V  0#S\ `Vps W. W00W0S7W P1P!Uڰ3S0c0# 0sp P JT> ,0S x,,JHp`P1 SP '`p!U .0 0S@T=@PP0SV M0S8  J uP !0 0 x=  40 0&/K Pp @T 0 @T\V !J03  y Pp b 00CSW;;;; ;;;;;;;H<<<4<lK!c!3K ?K A Pp ;wOKt~_K p ;H#(K;K 09P  J P 7!3KHs 3 3 s p4#p3R`S<3S 83S03SD3S@3S R <3S 83S 03S D3S @3S 3S : R 0Sm3 R3  R2  R  R l 9P` $0,l3Sh3S d3S`3S\3SXCT ps m O   x   |  "=K0 3 CS A? /K$Pp  i " It Bp  l  x  | h ? d ; `| \ x  B  >     0@8C<4#D3fr @  Q_s hs ds 0 0 i7p@9;00x5;00q` [|PW* iq>070503010/ idd 0@p0K0 Pp0 0>~WP  p3S`i R3  R2  R  R l 5P@ <3,S (3R`3  R2  R  R l 5Pj Rg  RQ 0S  R 0S00 @$3AP -KP p # YI -LlM0p00P7\`P 0R0`0h000p00  0S 0 00000 0S 0 00000 0S 0 00000 0S 0 00000 J PP P K 1 P  00P002S 3S0u lSr V P 010 Pc P 010  `V 0PS>0S(0S HP   010 0PS S H  7 0S @P   010 0PS S @   0|P `0 00@P #E\$0S03E02S lSv 88 !P0@0E0;3E3E$0 004( , #0O30H`/#0O3/#0O3/0HPX0K YP  ^ J Du!P0@0E #E#E i!P0@0E0  `!P0@0E,  W!P0@0E= M!P0@0E, C!P0?0EEE}lp 8!Pw0XX 0!P 0?0E <#E3Eh$( #!P 0?0E > !P0?0E #E#EQ !P0?0E@03E  !P0( ?0E#E=p P0?0EP H` P+0?0E(03E 0 00P 010   PP 010   P 00PwITwIUIMFUIUIUIUIUIUIUIUI G0G S 0 00 00@ 0  y y 000, 0( `bᲀ异0@貐, 庒RP0R(0 y y 00 ,0 ,S0 0` aᲀ ᴁ00 岐ᲑPQ p@-`P@@0S S p000RR000RRP0 00p00000RR00 000QQP00 -L@`pP0P0Q;+<+<+<+<+<,<000S- S+ 000L0000S S 000T0 0D0 0X0 0 H0h(00000000000 Q0-PL 0@S0@S S@ 0 @ 0-0 00010@P L0 00  000 Q0-LP& RaOM n 0 10CR0 R n㜼0000 00n00 0h0 Q0-LP* R]ON nۺ0 10CR0 R nn0000 00n00 0hl0 0 Q0-LP4 R^O_O n@⩺0 10C B0R.</<(/<4/<0 00n00 0h<n)0000 0 0 0 0-R]ON0P    ! 0L0S S   000 0000 0-RaOM0P    ! 0L0S S   000 00 0-R^O_O P000010 L00CS0<(1<01<81<00  000 0000Q-R001100 0-R@LP?00010/! `/? 00 0?00010/! \/q?Qe? e?0000000 -0LMQ@ 0 p-LMPH0@`៩  0100000p -LMh0`S0p PU G kPG@ᘠ 0`0 T 0 唐 @@0PU ؀ pMIOG$5I -P@`Lh`p5Һ$ `00C0 0IO$5I p-LM PP`@  P 1S!PR01P0p !R1 40 1$Pޘt0 Q00Q0c0cS1S 010 11L0LA1!S!00A$5IIOĆGG -LDMQ`V@h p4hK 0*S> ,S5 `&^00Q00S^ 0S 0 AA0AS RAP@0@\  0 P0C U7B0S\ HhjP h K0 W,`&pG -p 0CLMSP`0KP8K$ P0KA  R1 S*1Sit0f @@K ? !Q A@PK,@@K R 0 0@a00x|0S? W 0 AR VR 1S000000 F 0R  0A0CSL90~n0`pf&PP 0f0V@0*` VT( K,0K JTZ:0x P, 0L00 PoIxLO -LG -L0G00-@P 6 0 -0L P -LM`pEPQ 0 0S @QP|%> p02SN H%%>!D @A0AS= R ;%4 0 , %00 #0BWS lOH|FGHF4HjG&H^EH^E\Hx^E^EGxGG^EGHGGG GG$G4G `Sl h0 $$ à 0 < 0 $00xGPG^EXGdG -pL`@Pu$ T 4 Z DU pP@TXD4(4PpGtG|GGxGG -L0 Z\@`%Z' !00St 0t  rW\PD  e/G4GGPGXGpH -O8@LMpOSP!b$ $00S 0 hdX@@  f鄍G@4GGPGGxGpH -@$40$&S !PL$pdxl dVHꔍGGGG4GPGpHXG\H!ꨈG )^E -LMpH`@PL 8P$1( <0D $00HH!000wwww -LMY  `Q00SpP @ZJ $0 0T@TZ S@* $0 0@T T: -LM\  Q@@Tp` PYJ@ ( 08@#8 XPUZ TP*@ (0@8#8 PX U: -LM\  Q@@Tp` PYJA , 0@ \PUZ TP*A ,0@ P\ U: -LM@!R ,0  10 Q 0K/ 0-lM -LM t0@ ,0 ) L0 Rh0,  00OpMIO p-LM0@S`P: S S00 S S R/ !R0 R R R =R 0 R R R =R=S Q ` P0  R R R 0  R R R0Spp p-LM0OThaT `!0X!00,SH1  !00(!3PP 00B!30P0 !300 30$6!@0`3PP 00B 30\0 `!`t0t @ n@4`P0P @08 0C0plJOXJOxJOpJOdJOJOhJOJO`JOKK KtJO p-LM?0Pdd0K`TTXx T`P H0T* <0`u00`p !iAi\JO{IIO !i|JOIOG -PLM`@P Q pK 0P 0S00S 0P S 0P0S 0-T@LP H0HP @rJL00@0?00?00|IIOIOJO 0-H1L@4 TP 8 4 <080H < @00S 0 0) :<.FHGtGG -Ld  0-H1P@TL4  40808 < <H@02 R 0 0 <.FHGtGGQ -H10LS H  0<.FHGtG -LMp$`H Q@G 1 G1F?(P8PPEP 01 ! q 00  00  00  00 $00 ( ,00 0 400 8 <00 D H00 1 00 !01BK Pp10! 8PHD1X <04Y 10 1`K 0 pMIO 0-LPMQ@$P> P dKP8\00S 0H!X0T  P L  HD  @<  8$4 ( 0,, 0 (4$ 8 < D H\  d 1 100 1`08< 100 -L,M0!00H!p4Y  Y Y0Yቡ0僡0#a VP@VO AHPK T k T@ l8!s@0"2S7 T0P@ L0 , P`K(  0MpH0@0CH0 p 0@200B2S   P00P0P 20    0ợ 0OpM<.FGG 0-H@ P0@20L BQ0 0,B0h p-`VLM PHHR D0 U 7@P p 0S T<.F(GPGtG$ 0S00JO \000岭 -` LMT ^LL @Q Q\ 0 @~pM,sM (1 R 00JOKh< -LM0P 0 !H1pAHp!Z5 `000F4 0 QH1P0AT  0P @T` H 0)V mD[T`  0ppM,sMOJOG -`,1LM 080@0K(XPUK  sPU Kp0(  PP  莐PU K0@ @ P_0yP00P0GH 0-tPtL0n@Q011!!P0S JJ 4ZU\Qp0W:0f8!,`K0pKP 5PP1@@ K9PPP0@~\0!0 01&l0xH! PH1>LP@0H!0*4  40L0C0hP`MJOIJO,sMIOJOQOxLOF IGPoIG|I@ MDG|I|I|I\JOxGGȐGG -L MQ@@@00C S0q눑G00$0(000 0-LMP@ t$ TV*^ 0SP0H0S?Q'z0LMn<`p4 P@B 40 R08 &8 P00U* Vؠ 0.    0Z UJjF:804 0S80 d@X00K@, KP00L00  PoIIOxLOG:#:S>0 .- L0hPoIG M-Lp0W`!p0@0%@ :#:S  :#:S R  0 PU`WQ @0#&:DFВGGG -LM8 \p 0 0 0c@0 < 唒W`D h 0x"Y, K00K f, 0S 00 Rr .: #:L4  0808@0S @4^ P>0. U:00R ^ RG 0 0c4 :#: cQ!P4 4@ 000lQ0S@@ < \ D 0 RD ,040pW0<0 `D@0W@< 00 ^P @,0<@0 S0h (8(#8Q4 "*4*64 00S 4 KcyxLO  -LMp`$ .P0$@K PP @ PjCP#$:4 \ @4*Q030#Q03SQ0 : @:00\  0 TGG@-P@P`p. ^  R00\:\*R:^ >00 0 bS0!>0>00>000 0S0l0l -L@㬀TPp`  (0@T -L@, TPp` ,@ T -L@㬀TPp` 0  @XT -L@, TPp`1 @\ T@-^@>0.  Q:00R^  -LM@`TSp R a :@TVPbUP!W W `e L 0D@WHIOtJO -LM`0VPp R a :VP@bT@!W W `d L 0D@WHIOtJO 0-h@Ld0P 00  ,0R 00S0hJOIODG -LM `PV r @0S  2S @2S2S lphd0JS ꠉ<<<<8<<8<8<8<0  00@0 P1`VAA0S 1 R$ 1 ?#+0AB%@s Z 11@T !mgtd h`81\ ?# $1H1@Q1@!+B%0@ PC@0:0 0X ru" 0|  ccmbEKOmGGGG GG(G0GHGpJOhJOXJO`JOxJO\eEJO8GdE`G$FGGJOdJOG4GPG`GlG|GGGG -L$MCp< #@ 000 0, !@ t3p#Ph3UPQ\HaZpH0< ZN@t T* 3 R0S0"0S :S8 D H0&R{ 20Sw 6St 2"0S00D0 D  0 Pl2 RQ00 D0 PH  ZLZ /ZX H0H0H  D0l@< 0pH  R 0 H80 \0040 < @00 ,0 08, 400K/S4  0S00,C 0X 00 H 7@< 0;0 080  <0@4 00 , H 0R6BSa eZ080  @< 0A80K0@< 0 P IOOpMeE,sMIOPoI< MtGGȜGG p-LM( \@SP`8 0   ($400S8@< D Hx h,dH T L4G<'GeE0S@ Tǟ#&R:0R*0a00  1@W2 0@0 HQ`  @0 `6W  T  8 4S44SSD0 SH0H0S S L6!X@0`0ó @0` &U  @0`00@080@ 0`D0 00Q00S D 0S D0 10#R0 S 5D8 0`tTU X5 Y @ R4000$ $@ ZW 5Uh 5 Rd 0R0` <S 4 YZ  4$0 ) 2Q D 0S? D0 0S4W+ 4S44SSD0 SH0H0S S 4!AT@0`0ó @0` U  @0`00@0  300S p3 0 P3@q 0Sn ,3Ph ?P8 ]  "U 48  0 `D 0SK `I@0F HQC h2H=H0HSU @2 Y(2 T.  8 4S44SSD0 SH0H0S S 1!aV@0`0ó @0` x!U:  |@0`00@080@ 0`D0 00Q00S D 0S D0 10#R0 S 0D8 0@ 0S 0P O0 |eg)*(":1"(Q 001 0R@LOOxLOPLOfEIOIOdLOKG0G -L0? =#& R6:0R3*0l$0  1"R 8\ 0P \0T\ 0 @00@0   $0 2R @ ` #& R:0R*0l(0  1"R 8\ 0P \0T\ @00@0  OIO -,0L ^  08pMIO -!*(L":M1Q"( 001 0R  0`* " !Q:0Q *0b!0 P 0O -LM 0HQp@+0 T ?= ?0S% -:` 00#! @R00  00#!H0S  S 0 0i:0QpMIOdLO 0-0LS@P 0SP200T* 00S 0 R 0T 0 R 0S 0S  R00h00 0T   0 0 0P00IOxLOpM< MpL -LM 0@S000L00IO -PLM` 0S 0Sz0000CS0. V( 10S 0 R V 1 R 0S 0S  R00x00 0d   0 0 040s1$!VHq& 10S 0 R *(I0  0 $R$4$4$4 i@00#!0 hP0 0  "!0000~xLOpM< MpLIO,sM\JPKIOP-0 R0P  0S 0S  R00L00 08   0 000< MxLOpL 0-<04 [ 0P L$@00hdLlLIO p-0LM 40 x`pP0\\@ 0 S@R0Tp@PLOdLlLIOhM p-LM 084P4@EX0K@ P0@ H`[PP@P@@00ph`LdLhLlLIO0 0 LO$LO -PL0@P$ c80pS*`|u\ 0 $>"*01\06S0:0@<,?8,LO|LxLOIO 0-0 L"*("1"(P  \@! 0 SP!0!;   @00IOxLOIO@- 0 0 0 21 0 0s#0@$ ! 0#:8#*!#800Q! 0 S@ 020000IO@-`Pp !:H$$X 00S | $:1P 001P:#50 000!S$010 0-0@P$L 00 0S0ڀ0 R pGP ` `000@0  0@0$0)$@LOxLO|LpL\G -3堓LMp00P 0, 0 p0S P U:YZ @:4s4C<,c00#S 0" "0 "0"00a3C?6C#Z!"00#Rea!\"0T2@P"@L2  @@Z4Ÿ4 0,,P0 "R@ŸP 0$T D@ 0@0!@0 @0!@< hPJT:kmo`P@) E1? P 0 01  @`P 1 000R ;P= D9W 0pĀ $KxLOIOLO`L$LOhLdLlLhLOJO,LOXLTL|LpLxLGx3IK(PK$00 +.  0;>0 0  0}I<.FȠGG,G -L M,0 >0^P`0Pl Sc SW 0 4 U,  @4U 3 #6SppW 0&*000 00^>>fVE1U,&: R, P% 8#8US#&6?N00^ U.Q !hXE&14 0 0!1jZEP*H0H 000 <0040 000 000 $0 LGxG4LOLODLOLOXLOPLOG0 LO -``LM0pS P0  @P@^00 R LOP0P0S  \:00Q0S LO0@-l0@P 0S P  T :00U0S000 LO@-0@ @0L 0  0 000 00 0| |0t t0@l l00?00?X0 lLO PLO8LO LODLO0LOHLOLO`LOU#&R :0R*0a!B 0 T H4$4DL8@T V 0 *$@T@LOGԣG -!LM!:1`PV!& 0 01 pRPJ$JT 000P帠00 0+; 00帐 .P p@:#:S `@*:#:"*S:*21@`P0 P ,0 P XL\LDLOTLPLO -0LM@0pPP% K5PU$: 8 #! R#8 001 R00*"5* `  0@( P4 pOxLO -LM@p qP 0SPTT0 R0 00b81Q00@RDJ}I I}IG -LM*B2< r R0S tRP "88 #$0LH2`(P 0S@ th P0Up7*!A06T&*46!SAQ  x1 :P/p`UJ1 16T:0U00 pW0#02S0ESd0L ^| P%U@`H@ $@K,0  W$ 00UZUzj|IxLOG p-LM`00l H0N@0d0>0^P U0v,0 L 0L0H pxLO|IG40 ( 40(S"4SယI40 ( 40(S"4SယI 0ယI - 1LM @R)% 6/B? S 0  "!   /6Vv|6(vLآ\00 S 40($68v|I2IG(GLG[\GxG@ -pLM0`S" @0  2 Bl0PU *   00VU:`2 0S0IG -LM`T^@PƄ ?p 0p 0,`e0@@鐜IIO-??!0S0q1!1 R  P 000$0$ P 000d@d -LMP  , ?x ,(0(;S(8* /8( f K8(ȟ00 0 XI)à@xxȟxtȟt bpx@ 3`X`P0@ a,Ơ 0 0,H000 )P@ 9#9S*00 S0)\:00 0C0 000b1,0 PUZ0Q I$IT T0 C\@g:0 0C0P7*ǟ0 C\W:00C *0r0 L0b1\0嬆y:0 0C06*[l0 L0b1\0c:0 0C0d6*EP0 L0b1\0M:0 0C06*/ş5  `! Q P0 C\3:0 0C05*0|0l10d%xX5l Lş` 0 C^ :85L*00$A `P PUE `Zd1CP PUE `Z4$ T 0^DP`&@0@N @@e 0@@< :@ :@ :@ :@|,0 9@u@C(P `:@kPU @Z, P3 @0@!"0>0>03 al2"& Ÿ H 0U0R+ !01 t2p"Hh9>X4}!x1s#"2 2" 2  d,! 0 @! 5#1,z1 @1 YR0C ^:00C00 0b10 @4,,,!,1B밥G@IO\JOAi` QOMp@It<ПIĥGTOGQOTOQO IQOG4GQOLGRO|GQOQOQOTOJO }IQOGЦGGGQO0GTO,LOTG(I? dGIOTJUUUUGG ,sMJOGGGLS  400S Y00 R  048 @00 R 08< 40@Y00 R  048 @00 R  0480@P  0@P@RP0 N -L M,`K@P0p0(0K([pZ,K0 +KP pP -L$MP @4KD@` p``$U-Kz4K 0 3KP `p,@K -L M0pK@` $P_0K*K[0$t$h .K)`K(pK@ P'@K -0L@ p60S hgPu,0P# P 0`V U004P< (0;4P00@ @0$0 0SeV h9P 0,0,hP -LM@$0 pR(0Xp,4 0S0 ,0P0=L=X=h=`=`V &00 P0 P實0 &V 00S]p 40,0`#$GLGlGtGG -LMY`p 6 PP Y@ ` Bp 0$0  0@00000P 0ҕ20•U@ xpP &#U`}& īG -LM,0@S$=P====0=P=`=|=00Cs0 0 00, 0S P;p  ,0S G 0-LM0@0S S T@D P0`` PP0@DS000Sa`-pMG - `L$0p04@S0P0p0CS0ԕ PK== === =<========$0( R0(0P 0  0@0PS 0 x$R l1Rd1Rh:  R50ˠʌ ʌ00ɌH0 @P`j#00P  phb#0 `-00  004`;00S#P458``` G(G8GF -L"M\P@`p p2\ ,@0S p  0 2\V  2\ 7@}̠ 0@ @A1\묠 `  Q 0S(   0000 0  0p0#00, 00 6徂@ ` kL@D04p80P0%<@1011011 011@01101`0\ \0\w0T Q1 <0000  0 0 Q@Q QdGQ`=vE Q- L0xG -0 PP0L000 1S010 130S003q I}P4| 00#`Vq 4@9}40!`R u3VhTe|I,IGGGq p-LM`IP##PP441S 0@0T1!@R0T~#4PU ~p~40 p-LM P@| 0`\ p| 0`\0` p-LM0P@1`Tp1@T -LM `0PdP 40!pWW 1 L60P!0Q0@T JP@ 0T |P 00 P$08 <40!\@ P^ @TP  ~ 0 S 40 40!p }wE,I'0@-Q0P 1OQ1Q00S0R00@ -0`@1LTpP 1@T -LMQP`0p%1Q"1Q 4 1S @X1 \@ 0T4 X P -LMQ@P`0'1T$!?T0S0V40P X 1 (弬Pp i}4 1q-\0 S S S S SL\ 0 0S S S S S SL\ 0 S" SS 0B_S \00 "#0  0801000  0  L\00 ^ 00 \S00  SS -LMDŸ Q, @4! / 0@\0 | w\3 \p 聟X- P`K PK@K ~  zP@0!0 1R 0t <1 ,0S D,垧Z 7P-=X-=`-=h-=p-=x-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=ꨀ꤀ꠀ꜀ꘀꔀꐀꌀꈀꄀꀀ|xt`\hdpMH4G,GwE0 P 0 0R ,@ -LMK 0zE -P`P0 S00Ł0@p$ (00L\pN1t  0d 0Q000FW @偣8划0S(t1 h6\IXIHGwE$<=4b=G -@Lx`$P P00$ ;004P$ P0$PԀe0 PUb p@0SP 0@ 0UP0U hpp@0SP 00@ 0UtP0EEExI4=}I|II - 8L8#Č M R00,p \, xP@| 00 ԀrP`pPU< 1*Z`  Y  Y 0  101PU 0Zn-1 010, 100, 10, R ,8Q2 RP`1Z0-.1`P` V Z`-P`101P1`0 0`].`DI - 0!4LM#`pP@7 0PP- V0 70  V0 700(PUP Ҭ-Q 1 011 W⇢ e 1<1˪DI -D@!88#L!ឪPP<`09 0!<`03 p<`($P+V D00S 0 00P `ⷪᎪh<`@` `.U h}04000;00DI -L,MԀ0Sc 1 @ $PU[ $0$0御y pX0(@$0*D0`0S2 `<@ @2 46SG 4pK 00&((*&<&$4K20K1 K0K/`K-K,@K p0`ᳫ<H0<  P0 ($!  P@ #P  ᠫ =0S@0 $P咫WtW⬡0S06U $6UV 0k5U 5UHQ #  ISP 0;5U=5U"*x5U l5U"8P$<5UQ Qc00 "  d 0@P 0 ;|000ܩ4U 4UP 4U PTu@0ESv 0P0S 0" 0#$0$   BR !lv0 0bJ10000 2 0,$,!$#, \@Z@T uPE 0@@@P02 <4(<"4!<002 0#$0$ 0 S0S000l2U d2UZ b ^@0D,Sw 0\PKP@nP$Z0[Y [$ R !EOP@ 0P@4`@K P 0 qP0"  6[#$0$&K 50U 010SU0U 0U 00U00U 00U 0pMDI Q@c Q Gc@c c c c c c c c c c c c c pd sd ccedA c@rdAc c cmdqdgdfdhdcmc ccddQQ` -L M0`e@,0 j g tp`0d (08 , 0x!2 040 1 O T  D 04*KϠ<0  <0P00PP8 P0 0bP 0 PruZ ((0("4400$ 0 ,@ 0 oy$ 00QG@[FWEVT8=(G -L,M` 0 ؀"4pKP@ .%4K@(0K P P@P# [$['0[(["[(,&[!P[8<%@[$ 40 RQ  0cP  N -L$M@4 ` ,@ p[sPP ,0K ) 0K@@@ pP@,0S@@T,4 ,0 , 0^ @@t0 k N -LMP`p $P sP@ $0K   pPPPPP $\00S 00  00  t -L$M@`p 0@ rPPb 0KN 0@@@@ p~P@0\@@T dt 0,0K 0+ K  *K)K4K@@@ p\P@0Q@@T, [00 0+0[ 0  * [000 0)0[ 0  40S T 0 @$t 0  N -L$M,`KP @pY0,K0 (K$pKP @@@  -L$MP $ 1`L  JrPp8 (K$0K @@@ `P@$ R@@T00$000$ 0S (0S T0 @s 0 Y  N -L M0pK@` D$PE.KD$h$t*0K0 -`K,pK+@K)K(K P PP=@  -SL M@`> Q: qp PP0 0@T@b@b`V!J! @0L\ 0 @POs0N^J0D@T;P -L M0`KP pG0KP*K @(K8)K0 -K,pK+K@ @@ N -L M(`KPp @K}(K0 pKP @@ -LM@}̠ 0@ @ -L M0@KP `pBU0K/[@/K&.K)K4 Π0 -pK*K`(`Kx -L Mp0@KP` YVCV0K/['Ġ/K)K8'KP 0 *Kp (pKM - ML`0 PpPP@0nT `:PP` -L P -LZ0  i S S  S S S  D 40PS@P  0`440 0 S@   048` 04D0 4@ 4K 00K @ @0^ 0?0S0S,P K0@p K` KHP<L0XP#HP T@ 4PPK0pK@P0\@$<T`0 dP `@Kp@K40S0 440 Q -L$MP 60@0pQ2,Kl  5,KX0L @` `0S0@00 cwE`GR0S 0 Qq -LM`P8@0F@ 1 \0!0@4<T 14 `PD 0< 4 w3 < S 0+0 0\ 0 0 0<0 `0 $pK @啾00X $ P0 40 Q (aከHGII\#=a - 0L0P岀 p1"b!X`,uRP@m 00 000 0 0 ` 0<0$ 1 !,00  0X0S 0P7  00CS1\===============\=\========\==\=0<0  048 0\0 0X0ت0   @@ 0<00,0==|=Ę=G<0S8<0ŧk0@-0@Pl UM,Ѝ0@Ѝ0- 4.0,04   0S 00 0 000@00 0S,0 -LMp0P@`& 0K  KK`Kc@T0 T0q= p-LMPY 4`@T P0< phM 0<0v$00$0 R 0-PJ@Le0  000>0 80 -L M@` p4PK 0g1`V00 0TT0S 4 00rcp`S00"c1a ' {E -L M1@Ϡ PNlpa4PKV8\0p  h!8 n /T40s 4!,!?L3cS 08T0S$ ,0S0\ 1W< ᜎ0<0  ?B3cS!3$0J0$008 b0 Ῡᆣ<Ⳏ5U U080SIgfff{E|uMMb 0-LM0@(()0K[ S 0K )W(^ PU 00++ 0KKC$0 0(()KP[\0K  )P*( 0- @L aP,00 0dS0@00@00נ 0 T0 0L= -0P2c1RL@,p ` (H媪D 0,0T (0 0S0T00T0G=== -LM` @\ Ƞ!$C"a,Ƞ@Qp 0 @ @ܧ0,P@000$0T0 0`0 S00= -L 0!0 0T  00 #(0 0 00   厤0000@00 `d 00 (00000d(0Qc(00@0I\0SdX D(0XS 000< $2StHH=H=HHHH0@- @,PU @0T00\0#(# 0$ 0 T0PXP0,== -LM `,Pp 0K NĠ@ KKPK000  0T0 p-LMP`!"a,@  \40T0pʤ 0 0 00 T0}.? p,=(= -PL0 aR@,p `  4p0,0D 0T0E(00T0H,= -LX  0 P0$0B(0P S 0室VO0=$WO4GH$H p- LMQ0`00@0  "!\ R0000 0  000  "! 0  "!pVOO p-LM0@P`SH=======@ 6_D0P!!00P ` p@@@_VO@H-0!! R R0000 0  0!! ` -LM p 0@0 hRͶxCv\(WO 0-1L!M@4 0800 0P0< *00S P/Cb1ϠN3l"c11A}S c•ϠN3l"cT!!A0D])8 0h銍(У,WOОII0A@pHMbXOH=H -L$M400 ,0  00K(0  $ 0 0 @0@ )造= -L$M04@pK< 0( `8 4 0 0\  0@4Pp8 4 0 <@ (P 0\L P 0@4P8 4 0 <@ (P P o@=H@H0H -LM@q0sߤ`HlH -0LP<`  "!0>0 ,p00 ,P@ ~00 ,T 0 !!g -LMPp`0 1 1\ 6ܡ=ܡ=l=l=\ \ %1C 0 0c30 00C = 2  1\ \ \ %9 K  ݢxH p-T0LMP`00@8 ,T00 8\p,WO p-0LM@ P0`<0 \00< ,T0000 0<< \pho,WO - 0L 0<,,WO - 0L 0<,,WO -(0L 00< \,WOtuM -X0LM@ 00<,0 0S(000ܣ @,WOtuMH -LMQ@0>0~n0`pfPP 0f0V@0*` =VT( K,0K JTZ:0 P, 0L00 PoIxLOQ0"PoI0 -LH -LH 0Q 0RL@ -0L@Mt@il0d@ \@ A!0\@0 0  "!L0HlWOLL0lWO -1LM ?ops)J`0Y10  "!QU PP  0@PU 00#!?o0cSp 008 401olWOhWOLL0WOpWO -LM@X0DS 00#!40 0$ !!HHlWOG-0M  "!āġđ!R  80 QPR Q R  101 R R1<1 R\ p0x 0P `0P @4`$0 0  @(09)0 40 ( pP` @$!R 80 QR \@0@ 0 0!!ЍLL0WOhWOlWO -@@LM8 G( 8 0 0WO -LM0,"0S{ 0`  "!r@P0   080 Rn0  "!`00#! 0    090 RR0  "!`00#! 0   000 R60  "!`00#! 0   000 R0  "!`00#!  1 L0 0!!|yvs8IhWOpWO0WOx -LMP@Pp*  0 0#!0,  R <Z0@Ta4 t0 Yp 84P@@,0 0!!|ILM\HH -LM4 0@!!H0\!000001\v 0!!LM  0Ѝ0 00WOlWOhWO -LM0@  "!@0!!$ $0 1hhWOpWO0WO 0-L0LP 0P0@  "!@0  "!hWO 0-< L0P@!!@0  "!0hWOH- P00 01 0 00!pWOhWO0WO0 S- L( ( 40   HLH P- L 004,0P &LH P-0L  04\00S LH,0Q0 Rp0 0L@ p-LM0l00P`w\!0@0T!;Sy0 U0 @2@2D"4 0@TT0y/ phYL0 4 8  < @ D O H L P R }$08@8Bp07PP_T2307 PL -(1L`P 0R 6 R0 r+ _U21F (_U21 C   _U21%B CAT@  0br   _U21$IR   0RL -2LM( _P0@L21 _P00F L21 _P$00I L -d 2p_P1@L CϠ0`P  21 _T ChL21 _PH00R L -1LM@ 0_T r21<O l_T21P0 dX$п=H=(=H=H=4=@=0`P_T21<O e_T21 0 ] oT`P`P`tLH0Q0SጟI -LM000P` 0@0 ;S 0 0 <0@ <0@ 4{| 0\pp 0 h`0SH80 @0P鳜004 PH\JOAi8H=HHdHI -PP?UP1L`@ Q<0Q剜 R!p%*99 PP PJ\F A\ 4 0q4 1\00 0D !40,\0PB4,0\04/0\0P4/0\0`O4 0\04 1\ \ꌟIHHHH(H -PP?UP1L`@ Q<0Q  R!p%*99PP PJ\F A\ 4 0q4 1\00 0D !40,\0PB4,0\04/0\0P4/0\0`O4 0\04 1\ \ꌟILHxHHHH -004LP ,P` p0A p W00V00S004`,080 0 4\ D0S | -LM@4P0ab0400P 0Pp0 604\0 04?0\0 040\0 0@4A0\ 0@804\ 0@<04\ 004@ \哙HGI(H -L쀟M004 0\08p0L DL `0pP80SL@Hp@cL@` 8p10@ 04,gP P0p40 \鐟II p-LMP0`04 0\0<@ @0@<@030@ 04,dP P0@40 \p鐟I 0-L PP@ @@004, @0<004\0鐟I p-d0LM` 004,@P pPXPꐟI -LQLMD1 @<8q<@0 㿮@iDᡮ@pH0Lp D080宮@<0 0 04,0`04 ?0\0 0@400\ 0@8040\0 <0@ `40\鐟IPuMTuMIDH= -LM̀0pS00 Q0`04@ , 0P8@@ PdD0PP1'8D PG0= @ @P00@BItuM?B p-P\!7LM!I@1<2a112N!!1c#!!?aL6c@T d00  R00C0  R` R^ d 0S00C0  R^pp004@ ,Pd00  R00C0  R0@ 04,ePCYѭhI p-L M0PQ`0 )0Q p0S 0 R 0K0 0P@0 TP @pp,0Q0S0S @ПI@Mp@ 0-LtM4@P8 0 0 00 0e0hUkПI = -P0L@4P`8 Sʴ8S 0 h@78pS p0 T0  .7 0T00 P\JOAi -LMT0P`0@F.0PP h鹘F>X0p嵘PpTX0 p |4! 0P\ 團P0TX XP0) vP` 刘\P0TX XPTPj04 0004 d80*0x0 0PbUP#U@U0 PT0,PE\U@U5SP0T,,P0T0,\PT0,TPU0x0hWz -0L`Px0 0  ^Of Pq0T @,000SNP0T,,@C 0`S0 P 0T,\0@00P:P  ƩP 1 P0LT ,P0T0 \P0,TT0 P: PT \ ᖩPp0S00my1 P1LT ,@ P0T ,P0T0 \p$H -LM@0S 5 -P0PLT ,P0@T ,P0`T ,00pPT0 \P@T0 \PT0 \|0 0 |0  -`D0@0V|pLPD0@@|@ @0 T736"  @TD00CD02 Tx@rP0T ,P0T0 \P T,0   P0T,"5 0 0 0-0LS@P P10S -w00h0h0\ H10S0S 0-P0T@,L,Ps0S  x0S  R Q 0hI0S00#0Q00S 0h -P0L0@v`V%jpvP =t=l=t=x0V00 ?s 0 1 PL/@ 0?ĠI HؠI0 ww -LMh@Te Th $0Sh0TTT M@h0$ $0Sh0 h -LM@xP 0h -0P ,@L0`@$@T@p@| 0-L@00P8wPx0h -LM@wP 0h -LM0P 0`0v@LOTp00 P\JOAi -LMPh0d8p2/ p P` Lh4h•p0p2@ l@  h•l 1\p 0plP h2lp"pb dSP@ dhP9ePH < 0{ TH@!dHG@ H`=pG@\ H 0-LPP@H8S8S fp2 S0h2lpBQHeHH p-LMP@| 0U0`0  UD 00C0ph% 31= -LMh2@ld ,P1h” 0l0d \,h2ld ,h” 1 l0d \h2ld ,0 h”0l0d \h”ld ,0 xh2ld ,h”d0 l0d \h2ld ,h”,0 0ld \' -LMh2@ld ,h0h” 0l0d \D0 00PB0C@0 0`0 0R 0,0  @  0B0  00 00X,P0 p D0D 0SD0@D@ @00@0b 00 # 0c$0, X n|I|WO2H H -`,0L(0(@dϠ>1 0(P\ p 0S @  D00 $  0/00-.p10,p0p -LM`00p@0".PP0   pi ( PD@U40 0(0K00  ($ 0 SI|WOОID0, S0D0D D @00H @0WO 0-PH0LS@ S 04G04 HP0 -LMp\ GPU  ( i@T4` I P$0< 0:000 `@0@|I 0-@P LR000 @ H0 BT@  $Q  R8000hUI80 8004H00QH  0Q 0Q0 Q 000D0T0QL0Q#!@0<0 <0 0 AW@_W@@W@DW@CWBWEW -@0p`LM @H ^ W@ D0/RQ80 0@p0 < -H0LS40uh -LMH 00R@4< 0BH 04h괢=P0 S p-LM0P40t 0p0 P`0@804 uvp080p0@ -LM80@ S K04080 -LM@h 5 0-L0@4@ 9\0P4$ 0\ 0h -4`0PL၀ p"9\"0\"0\"`0\0"\",00`"\T",000"\$",00"\B!,0@@D t OWpG!9\!0\|!0\\!`0\@0@!\,!,00!\ ,00 \ ,00 \@ ,0@Dt 0\ \T ,0 ,00 \' -4`0PL⁀ p4#9\ #0\#@0\"`0\0"\",00"\",00h"\\",008"\4>>4>4><>T>4>>4>>` 000 H -L MⰀ尠尐@4p,`KP :0S,P 0S0S B^ PPP:  0PgeXOXOXO HpM-0S! 8 8#0 R 0 S  \00\00S\00PIl (0(S-"$  0Q 0\00 S\00 \0PI 0-4L@P PC A0P= 0Q7 0Q 0Q P0 000 P 0Q 0Q Q Q\09 P\0Q\099\0990PIA @A A XOXOAA -\0L8  8!8X|X 6,L< X0S0X0 Q0 0 0S00Q 0S \ 0S 0!R 1s 0< 80X00XPIhI -LHM`l0h40i/0PU4!0  h8 P9Y60h@00 0\p 0  hhp@T0p h@tpp\T0 0hl\I@ HD H>HGXO0AXOL Hh HXO@ H -$"LM0Sh0PUd pp`j|z` z@`l ` ` @` ` k k t yugqQ6 `0h0`0l ,h0@l ,h0lP ,p`hl0P \h@l 0\hl 0\h@l0 \`0h0`0l ,h0@l ,h0lP ,p`PI 0- L0S0PU0h0l ,@@ @  @ @ Ih0HIlPT G,@@@ @LL@KK J J @H0PI -LMh00 K $ PP@0  "!0 h0 ,h0 @ ,h0  ,h0  ,h0  ,h0  ,h0  ,h0  ,h0  ,h0  ,h0  ,+ 0+;S{ tthl 0\h@0T l\#4Zl hw##h0 ,h0  ,h0  ,h0 C/,h0 0 ,h0 4 ,h0 8 ,h0 .,h0 < ,h0 @ ,h0 D ,h0 O/,h0 T ,h0 \ ,h0 d ,h0| l ,h0x X ,h0t ` ,h0p h ,h0l p ,h0h  ,h0d  ,h0`  ,h0\ ,,l8X p0 T0 P 0L0 ph0,h0H ( ,h0D , ,h0@ 0 ,h0< 4 ,h08 8 ,h04 < ,h0'0  ,`0hx7,  57\h0l4 ,h@0l64 \hl0 0\6h@ 6+R00l \hl 6\h@l$ 8\hl( h6\h@l, 6\hl ,6\h@l$ 8\hl( 9\h@l, 6\h( 5l\0EJh 5\hP 5\h h5\hPC/P5\hl 85\h 0l\ hH 0\hPL 0\hP 0\hP0 \h0 \hP0 \h00 \hP04 \h08 \hP0< \h0@ \hP0D \h0T \hP0\ \h|0d \hPt0X \hp0` \hPl0h \h d00 \hP `00 \h \00 \hPd 00$ \h` 00( \hP\ 00, \h0C/\hP0.\h0O/\hPx0l \hh0p \ hPX00F/\X h`00I/\hH0 \h@D0( \h@0, \h@<00 \h804 \h@408 \h00< \h@ ,0 \P0 T00@ L00P00 0@\JOAiXOXO lWO@!D! uD2IXOxI  H %!h0 \h@0 \h0 \h@0 \h0 \h@0 \h0 \h@0 \h0 \h@0@ \h0 \l hP`!lx1 !0S P h 0l\0 0 !qQh0$ hl 0\sh0P" ,d2Py  t"xRr! 0- @LP,0@0 \ ,0; \0 0h* 0-.@LP9\0.\  ,0= \0h -LP`ႀ p.9\.0\.`0\0b/\.,00.\.,00.\.,00.\Bf/,0@@D t f/@0\WpG.9\.0\.`0\@0f/\.,00.\.,00.\.,00.\@f/,0@Dt Yf/00f/\b/,.,00.\' -LP`₀ p.9\.0\!.`0\0b/\.,00.\.,00.\.,00.\DBf/,0@@D&t f/@0\f/@0\WpG.9\.0\.`0\f/,@0f/\.,00.\.,00.\ 0b/\.,00.\@f/,0@@Dt zf/,@@0f/\.,00.\' p-LM@P`0 K@!p p-LM@P`0 @pA-`@0 S pP  0R 18S8Pp  0T0 T  R1 0 TR蠡II -42LM @`PP~ 0  "![Uh UQ U: U" 'U 0!!q0S'S  !BPAl h 70Pq0SڂSL8Al hn( !0p0SS@l hY 0p0S S @ lh =0P@0[SΎLҎlh .P,0 $D~zPIXOxI I H 0 XO R[040R0(0R>ӂ?00 L2II -LM,@0D 0  $ -LM?@00,D 0 T -0LP 0-DL@P}0000 4 0h1 0`1l!0h!PHG<> 0-XAPPPTL 0S@T0$0S Uhh -L MP00 4X1,0040 U? VR (1 RBXaV' @Vp 0 P$0(0T0X0@TXAT 8`,KΠK 0$@ K(` rf$@PpTWd 6P@ d0  `0```0 @Xa {IR@>?>, H p-LMXA`TP 0S@Tp$0S hg0S $0 $000}@ H -LMXAT 0S@T$0S h 0- 0L@t P0T 00P -LM0Q p8P9 @1@S  xaT0!l@d|!T01STJF04aS ,0S T<|Q 0S |Q||T%|0|W 1@S  0!p0T@`|1T 01ST (|P|D||FG܌Gl H4G H HGG$H H HGX!R0S`0(0S0S -`0L(zp H -LM(0@S d10Sd1 `0_Y `Xp\ `0 D 0`R:@P0Qw\,P400 P] 0D40H0 P0P `H(0X P?@ 0S 0 T0S (0     0X1S 0S`00`0)L  M  N O P0  C 040  d10CSd1  040 000, H0n\, 0@PD0H} 040 ,\5z H 0-(0LS@: `0- 0 `0# 0`0XPP `0 0D  bQ:@00\P4H00 ,400 d10CSd1 0 040 0Py H p-L M @0@P4@P p 0X1S3 0S0 0 -  0PP0C P0L L QL5 1SP0  5M  1N -O )P0  C# p -L M `XPQpT 0SQ  T0S Q\ \0^࠱ RQ)`1S5T @TXp\`400  ` C 0`AT   V`1S ) `400$HIyTXp\`40 0 @ HJ> H -L M pX!RL 0SI `@V T0S T\ \0X@`VT`Q. 400$r } 0T@X@`A\0S`1S  P`400$ @\040 P `X`T`i(x400$(HJ>\H - 0L40 ( 0-XAPTL T0S 0@T0  XTU00P00 SP  -LpM`K@p p08GF/V_ 8 PX( $ p$ 000`Z> -LM 4`0p " @ KP! X@0KLK~K0";P@0< H0 0 D P0 P  L0P R0X0 SH0D$PL0X L PD PK "D$X0NT S񟗶N>hP>hP>hP>hP>hP>hP>hP>hP>hP>P>M>M>hP>TR>T\L 0PK 0D^PP$PK 0@D$PK 0 D@ D$PK 0 D H$LT02 T\4&L#11@QPK 0D$1T0\$ T B  R{K(B (L0H0P0D$ 2P.K(PK 00D$(L0H0P0@D$("L0P00H0 D@ D$L0(P00H H0D H$L A("$ P  (" XK2PLTQ  @KT\APK 0D$PK 0@D$@D,KHLOBP0D$PK 0@D$L0P0H0@ D $K?QL@#@T 0S R" " :"0P !xP0H"DB"$20 S2  :LT XK"PL0L  QV U㉐@ KL0K~K ;UL0 L  P P LHP0D$PX PK "D$PT PK 0D$CPPK 0D$IPPK 0D$SPL0T 00L0 ; "RX#NKLKQ{K1{K01@0K!Q0~?K ;1SL0L 1S0 0P0  02 @K! wHHH -LM@dw88Q   L HջwDw` P0Q V`wVP wF? 0w qWZ  w0 SV>X>Y>Y>Y>Y> Y>(Y>0Y>8Y>@Y>HY>PY>w  wPU8 0 pzw0S` SXXrwPow 0S80S`TQZ(dw0QKE?9 3@-' !   IwXPUpWG? Rm:w8wx5w0l1w0`-w0T)w0H%w0<!w00w0$w0w0 w0 w0 ww80`V@D!1P<@00\ 0D 0Cv80`V @v 0`Vv@X\ 0D!0C Lv 0`V@e0vH(E$C A?=;9 7531/v0S SvH,HDHdHGHHGtHHFHHHHH(H8H<HdHlHxHHHHHHHHHHHH4GHpHHHHHHHGHHHHH H@HLH`HlHHH -LDM0`SU S S00S0S 0$<0 #1p 0 3R:l@T#d /Pl dÇ0l 00 l0l @l000l @h0l$!l0h0$1l l@ 0$ l0RP !: l0 RP :@\\ d@ 0 00l@$0!P2 U0: 000l@$ 0!P2U 0:0Su 0h@$ 0h@$Pp@ 00$PO h0P0h0  1P!pU0@?S0Th 0 1h .  l0 00Sl@T 0s0@l0T!d .Pl d㾆0l 00 l00l @l000l @h0l$!l0h 0$1l@ 0$0S 0$d?PQp〠@@ 0UT \ =.PV d\ 0X0l TXl0PdZ 000$ 00 `p4 80 < @  R, :0Q4 R 0S` 000$0 00000@0p 00 00 80S! 0S< 000$0=0@00@0p00 0<00 23j<Q  0S QB < @R 000$00S80phG/000`02 H0 0!L0 D hG/00080Q, D <0d h0 DQD<: h QP  D0S DQ  00$*00@$*00 @ D$*00H $D P0p<0ShG/000H RH @ : @0RT0 4 HQ H R  00$*00@$*00 @ D$*00H $H0TpL0SL0D0: dSX L R L0Sn  00$*00@$*00 @ D$*00H $LX p,80h Qd0 0, h d0 +@Q 0S 000$0 <0<00p;00;00T0 000$p 00$ 00@$*00@D $D  00$ 00@$@D 00$w 00$ 00@$*00@D $D  00$ 00@$@D 00$ 00$ 00@$*00@D $D  00$ 00@$@Do 00$d I H 8  00$ 00@$@DD<@ 0p00$ 000@$@DDpD@@@ 8  00$ 000@$@D0Dp<@D0@0 00$ 000@$@DpCz 000$00S 0pQ, A 0` \ \0 S S,p `QR @Q 0 , ,  , R# 000$p 0` R 00$*00@$*00 @ D$ 00P0  H$ 0L@p 00$ 000@$@D 0p@ 000$,⁡ 0p}\ 0R,0x 00$*00@$*00 @ D$ 00P0  H$,0Lს 0@pD 00$ 000@$, @₡D 0p@' 000$0Sp0pS0pSp$ 000$pP@54@T,00 S,0 : 000$p 0$00000@0p00 00000000T@\ 㙆d@@o -V/L Mr` , 0 4 >d2 Q  Xp@2 0S0"Qv St , R2 RVXZ PU X@M+PT@ G+T0X140 0, 00 R( d )P d @D00@\ )PP \ 7 X 0X P0 04 0 40  0 \ n)PP \ 0X00X P p,P@@Q UPpU@t p p@P1sw@Pt #PpDPm PixIRIPHGHHG -쐟LM`ࠟ @pF? R 0R$ Q PU P 1S`SV$p$@P0 P0 RT  0 R 0R{E -LM `<#0PU 0S0 S oXPUo0830 0 S o2>40 40@40PU Ö$P†TÆ ?00 P P 2>φ40 40Pφ 40P@( BoPSU&11@F? 3R x0R Q pW P 1SpW Q0 K\P TU Z 0R P 0R 0R 0 P@2"32 #"22""30#3P–T 0TP2T $PP> 30CS <2<"3 #424"2",2,"3#0<"@<h0S P, <34 400<38 400<#4 040 xnP2T $pPL1L!3 #D1D!2#8nPSU$$@Mn0KiꢀPZ0 圀PT0 RpNN0 l0R< 0R9fncn`n2.4 [n24 HHH$H@H{E  L t 0 m%PH${%<{%|%H}%XH|HHHH 0-83Ls@   PP 0<#4 040 <38 400<#2 00 4 p-LMP@^T`8  T@ Tp5@E @3S<><9@C;<< 0@sm% 0-LMP<0@4 @0P @3 <0h`m0m%H -LM@@<<h -QL,M@P`p?<38K 400 P0<3 <0K40@ K0  0P@80<  4$@T<3@ p400 <# 040 xmtmH8H -@LPp`3 $@T`V@3 $@T3 $PP003 -L0M<34pK P00 4\ 0`2<8K 40@P> y  PHH 0-L@ሓPP 0( 040 8 400 0-LM@0P4 P0S8 0h k0 H p-LMX`hP@ (P0 L 05SS =S p  Rb -LM@h p-LM0@!SP! "S 0p R0S 0$`V 0$0000 -L M 0@  K @ qP鄅> -PL⨠ U` *p R 0S P U: R 0S@!0@Q 00!RTX ^}P ꌩI 0-LPP 0S 0 @004,00P40U -L M h%0`V 0S~0CSpX`Vk0\50 P 400@pP ]Q0 P 4Ř8Hň0 P   040 V W`P ]PS~UΈ@5 p GP 0S0`5 ͈T5VN @6Pt<@%j 0ST%Rf004E8UHLŘ0 pt<@P00x@P4p8 |#P" 00<00h 0p!Ldh0S Hmjl5 0l5b el50l5_j \j`q h% 040 h5\ 400hh% 040  0S>h5 4005Pp4jh1j`.jX+jS~p   40@P?H$H HG[FHHH0HH 0-@\5Lst ) b PP%5S#h%\ 040 h5S 400`%r h5 400h% 400 0$ -LMP@'Tp` T dh h Na`hRt\@hh 0 i`h@0S8d5ih`bPH xH -`LGNF@DTPp *0P 0S@T:W@ * R 0R @T:Q 0Q{P0 P 0S {PEtE -LP -L Mp0("p`P} 0M@ ,@40@0Pn ͆ @0P`1 'i0)Q1,0) @0RɆ Ɇ$92 d 0X IR4 h 01X !@0@QP* 00\ hiP + =400Y 4,00Yo\hThLhDh t x $H\p `> 8G4GHIHHHH p-LM09t`@0Pp}009 = 400  0,40 QyD -LM@PU`p0  U 5@ 090Q09l0\0 }< 00$0n0  8`> h 0-P@L 9y0 0 0-0>0LM>0@lP0 l @0ŒQΌÌ QÌ  0P  0 0f0H -0L* -LM@P`p x0 ` p 0 @ @0 -0L MЍ p-LMP $0$00. $0$0  $0  $0|x`@$ @0S}Tp$0$  N' -LM@$0 $0 -L -L$MX1PT!@  HVg00 0P@ Gg0S00 \0pS1J1 Q`0@4p0@@0à, < 0<K8 4@ 0 P8 - *X0 L0H082pW`F(PEZ4GFHh H$ H>\I>D>t> -LM$0@ aF -LM$0P@Plpl`@ \0 D0S0  R  hfSF|>H$>LH p-LMPQ$`@  0@D0 !?C1 @D$00 0R0#S 0S @ @FIxHH -LM$0@P 0h#0h 0-0L P@0,00 \0hdH -LM0 @Q@ 0( Q0 ,00 \00 -LMxpxP@#f` `0`TT@0KL 0, ( 0@ $P ` O R8霜IHGIEEEA?> EI -LLM \Pp@` 0}!Pꧨ? Q-LhWR 0-LM@PP0  00 0-P LR@ R 00Q |0Q v@@ @l R@80Q 00Q 00@YW ZW $ 0s 0s@0E0I -LM@T@T@9P $0 R T0@II -鐠L0pP`Vʆ0lQ@`H|V Pp(0@A@sI0E0I -PLM@ 00h0@I R-L 0 h0 I P0-L@P T00hz0h| -l2@LM`l@|@P97P@d828"00080 0Q0_04 4 0< 4"a04`0 4 `8<0H Qv8 <0 8<0L Fv< `T400A`tVV8 `Vp p00A`t>V (1 1 1}0 w00S@,0 0$0 (@ P d,K 0pMT0x G Gl@ r<0{ \0K8 r< XO>HEE E>ب>>I@I(IHG?>>4Il> 0-@L Px= 0@0Ba0hxGIgfff -L -<$L4M0`,0 tX < XP 40APt < U 9<p W41sp WP U 40APt j< U8PU00Pp 8UL0P] RT  P Q28<Ulrl 1 S RP6 PU^|0SX x2Tp2aFXD2 ,0S D,eIT GxTK $=Y㰐 22BaF GL0^@| %| R$ THH0S 0 0TK0TKT  0<< 0 \ 000@l| RH0S T^ptP @<8lx ><H<8AP i8U00!r PU Y<%P P0S Q0W880LW"pMXO܎EIgfffHMb 0-L@nPPPU P0S  \ 0 0x@0S dhEP \ 0S 00D0P1,EP$ 000HILEJOpMEXO 0-PL1@.0@T@S00@P@P0S 00 R000KOXO0 Q-L h0Q 00H0Q @0Q0S00|0F0 W@W@ WW -TP@0Lpl0p`tM(t r 0l0 p00XO'00 R 0S0SQO 0-LM0@00q. 040,R, 300PP 0 S  Q 2l0h4b0S 0 S  ? (0h!b 0RBQOH H@ -LM400HA$ ($H  -L0P48@1` $ #x(0 (V040$ X -L0P481@`  #x(@T 80 T004 X 0-T@L0PS0 R0\  0 0hdI0 0S0 R\  dI p-LMh@`\P 0P  \ p0phdI 0-@L0PS0 \00 U  0`0 0hZ0 U0 dI@-80@S 0\0@>dI$0S0 \2dI 0-P@L0PS0 \0!0U  0hdI$0S0 \ dI 0-PL0S 0S0@004( ,d0 0 @04( ,4004X04XdI 0-QL0S0$ @T(0S0$ @T0004(0#004$ X004$ (008 84#8$ X004(#0 004$ XdI -LMx@0S0$ Q0S0$ Q034X034XdI0 0 RRQO` l00d S S P0i 0^0 0j ]0 000 0 0QO` > -LM Rp@B R࡟t^(0KP0*0P`c( 0e(  0X( <X( 0X( 0X( 0X( 0X( 0X( 0X0S( 0 X( 0X 0(X0 S0 0(0p 0$ ( X0X( 0X($0 $ @^@I HHH p-LM0 @P` (V  V (pp^`H -LM0 @P `p߽T TU00Xiν (08U#80 U0 ]H -LM0@ P` 尽Up $ U᥽L]0S i靽(085#8$ XH 0-0 P@L 0X 0X 0X0 -LtM@4000\0@ 0SD h_8 _0R1P$ h_IpAHHG>H 0- L0S0PUttb p0R]뇺04 X0\0@ 04\00500h꼫I<.F H8H -0LMS @h p-!LM0PS`0@T 0]0 40\UU5U U" U pphU p04 d0\040 \004 , p5꼫I<.F H8H - LM0S0@T 0\PPP @5004 , 004 ,@꼫I<.F H8H P-L P 4.^hPhlH -0"L M0`S0PU 2w\ ^0 04\0@4 1\5omx#040 \004 , 004 , 004 ,`(pK04 0\004 , 004 , 004 ,A`V5" 0 04\( 0? 0(0 (!C3 0 ( 꼫I<.F H8H -$1L R`P>U< ϻ0 04p\0@4 0\5޿040 \004 , 004 , 004 ,@㺿ᕻ@]鼫IH -h1LM \1+R pW`Vp`@Px,  0  4 08 )&# }5㈿ 3@ t ,p (y $@TPZr5c 04 8,o1_\JOAi 0-LM@seZ޾ 0s譼0 Z覼0 t0x 0 P|0 P ?.0S jOH0H H D00{8H>H,>>T>>>>M8>L;>M -L -L -sLپP5 -2aLMqP@4`KT01@T4 @1R@ T$ @1R @TZ@TT1@T0(@VUUU -P0 0S  0S 0S01I 0-0L 0S 0 S 0SQ0@A0@ c cdp PD00l/"b0IQ0 0`IQ -LM@h5 -LM0@S eRR)P0 00S 00 Rڴ0: -LMP Z0PS @@^p`V@@ Th W^ PpUZ 0V 0pS0`帀0V oʹVP0Ӽ09P000W0X0A2>P 0S W rmB0V QW 00%00Ba>QJUPpW@:p@@p帀LE:Igfff p-LM@P_0`S 0S 00RPpN00 -@LpC`P@>PUPV0P0  0-@PLPR>000!0h -Lpa%0`@S@ P`PPZ0S d@ VbT_@D0Sd T` -p LM0S0@TLLL L0X-@fP h,PI<.FH}H - LM0S0 @T0Yw\hh0p,@ 8 #8~4P6 hp\PI@B 0-LM@ P0|=fa\WD0D0 @ $Z8 K0d00h CX0>TEHGEл? 0-LM@PP0U=M,0StL0  H\0\  @ڹH 0P0T 0 ᣼Y >$H,> -LM@0X=L0S0P02,0L0 -0LMS@  S00P0<=Ht~ 0hǻƻHjtHh0P0P>0 -L@Pp`P PTU@ p-LM`\P=׻P ӻP@0dS:ph0dS: p-LM`j@ TPPU $   00 00 @ Td 0m 0PPPp:A-,rM@`TR"00c@L0l01@Ѝ؁A0~0Ll1p@ A0c!10bS c 1 !\0 !R 0\ , 2q@?C0c ` 1 p0?00B0c !00aS c 1 !\0 !R 0\ \ q?C@0c ` !00?00 IXOLVUUU 0-LPڶ@0hӶ -LM`PP ɶP ֺP@@TX,K TpB ᶶW!X10SW ppWT0\ `S, ( X, (0@@:, (0Tp`0\ 0 R@,0d 0lll(0h 0lPl,P l( Hh00`0aBa];D0@Hͺ(00(0aP;XOXOIIMb IQ0Q00 W@ -LM\@P;*PDhW00p00 0< 80oP@0 !LP|0 P4<,`8V d0K 0  `:tϹ0 t螷JhWd h#TWwh*4W,W4>HX>@H0>HH|IdHHH -LM0@SL0W)00 -PLM0@0 S:hLh 0-L@LP,d㉽3, +< xu0h  - L  0-0LPS >>>T>t㋹P0 0 0?#A0h`:t|P000S00tpP  00 :0S0L@cJ0ha0S00tSP00 00I -LML@F3, + Th< 00-SLP@L S 0 -  -0h Q,  S, -LM@0 S=f?R`0 +Lh -L`|PLp h0@R 0 ,$("(@1 0Rh`E -0L003 -LM0@S>>$>T>x>>>> @m 0 0  m 0 0  m0 0 00 m00  m00  tm0 00  Lzm0  0rm00 HHHHHHHH -L 0 0C S>>>>>>x>>> 0S S0100 l!00 0S SH1 0 8!00 0S S 0S S 0 0S S00 0S S 0S S0 0S S 0S S0 0S S0l0h 0S S 0S S@008 ؊%(%%̏%$`$X$$$$`$ $$$$ -LM@ -L 0 QkLI -LMLpP@ᣳ0`S >l>>>0S Ᏻ0S 00``0S00S00x0S0S 00  S 00 0S00S000 S$>P>t>>0S 0S0  00S0 0S000S0S0 0 S0 0 0S0 0-0LPS>P>>>>00@0  $0 @ &l( "l<@0000 0 $0  l0(0 , l0@0D l0X00 0$ t kX0(<0 k0 0 00 $ 0 TXF H HXF F\XF H -LMP\@`p 0 0@Tr00000 PQO 0-LM@0 x7 Qhh0  PHXP@0T<<$K8 0  $P @ =\00> H> HII? -LM@Hζi 00LT P 00@aI7IQ -LM@RP Rt>t>t>>D>D>h>L0S T 0 LP0T 000ah"70P00X70P0Hh鎶LQT00T00PP0 P 0XT0 40L0SRT00T00XQ  "0X0IQ -LMT @0S  0$@P0S00I -LMP@`ӱ`0VSp K \0 0 0KV 0<< 0\ ,ᳱ\T,Et0Q h0Q 00D0Q 80Q0S00`00 W@W@ WW0 PQO p-LM @0~\hAʠ[o P`@T|0  phShlTT @\1D Q 80Q p0pAt1p0 p1t!p8 H8Is p-LMP`@@Tphy Q- L0 Q   DRh1l$h1l$T H -LM@0Qp>p>p>p>>>p>>hl T hRS h1l $h00l0 h1l $h0l0S h1l $h00h1l $h0l0S h1l $h00h1l $h0l0S h1l $h00h1l $h0l0x H -RLM@ \1 \ ݖږ0000000 R-LP@` \1 \ 0S0S R0S0S0S0Shl 0T\!p0W:h1l $h1l $h1l $h1l $0Zh lT\1 WF:h1l $h1l $h1l $h1l $\!p 0P:0000000 d\!p 0W:Q0000000 N\!p0W:DvQ0000 ;\!p0W:n H H 0-0\L0\P@# 0\ 0e01e$YeA$ 08 =  !>.48(As=0ee$s -LMD, "P 00;004,D0\0 @8 ,X4 1x1DP00 0 b@ K0 6b00P@ @P00Q``V <0 .Q:00 ;004 00$ 000 A t 04$#@8V* H0 ,0\0P: <00b@0,0 @0,@, -L M\Pp<Q`, 03:0  P \1 0 00 P 0 1s40 x  cP@^\1, H咡!df0 fa  `@tQ \l 0 XP 0 X0S $ HP 0̕0 A40 s0<0 4 0 4幕P@ \1<  a@  o 4 pP4@00X;00  Z 4 P040 ` 0 H H!H8!H -L@LM<0!p ,0 x1Sv\ 0@S 0(r8d`&dP  PP Wa@%d\! 2R 2R xO@d@0 0P`  `Pt  @T*0@T:0@T* !@T:0Z @* p\1l K P O 0@Tp:˔Z p0xQ,1 ,0S ,,-5 gOlK R \OlKp 0P 0P *1s HO0A<0 >O0<l7O  0@0e0@pMsl!H!H!H!H!H!H "H("H 0-00QxALT0   0x1@-@Q* 0 R Q:Q* 0 R Q:00P 0 RQ 0-p1LP@P 0t1P-  ^% \ P 0R  0 00("8H0PD00 0 R  0 0 R 0\- \p1t!\p1t!p!00t00?+(""8  (0#$0 00 0 R R | 0\q 0 Q  -LdM030 | |3| , R_ |0_40|#0 02  9P/XK  @0S S P@0'\00t N|WH|I\2\0S0P1P!|MC>  505(2  5@055Z@C 2/@=H_00%0PMx@K ]_!| 0/x0Kl KIP |M100|0\0:0hT1d! 0P Z D0 1 ,0S ,,o3|M!0`9.͊_0@@%0MEΠP0`@#Hh P 8`p@=0Pl0%|\rMpMI4^FH"H\"Hx"HxI2IP??"HG"HRNL"H#H -@L㣫`$P P00$ ;004P$ {$P؀ᐫ0 PUb p@0SP 0@! 0UP0U lpt@0SP 00@ 0UQ0E:( xI?}I|II2I -LMD@!88#0!8Pp0 , 80M_040|Õ 0s 0 0 pl\ \< 0H .0$X0 00$8 70#H#HWEV -LMP@p`B\$(|(0"4 40\0$L0@ Dt 0= \T 0 | \. P | 0S000$? - XX%tLM' `4 $)6 P@0  Ő0s 1Vm (1V 1V | 0J0 '60 001V ,0Ke/ 6`P1V8 :D10S  0p7P0 % %0 0 9 P0 |# 0S0000V 50574  %44000 0|o 0 00 "   000 0S005dImdedAsd rdAhdk~gd$? - 88@#DLM$`5Pp 0*H0 P(TBĠ*0 5|PP!PP dI -LBCMB\`, p 8 8#T % N5P@ |# 0 SȀ(P]P]p]P`  0S ,0 S ,6/0`QP!ء00 |3 WNSⴡ0 S_ Xa0%S0000|00@0000( S0!lhtC0PA P( p1S??$?,?`?3I0 S 00+I4! 'I4!G0(S 1 !pbS0!W㑓)`h@00,K0,0B]/|K/K<[KKXIPLH~||IpMdI#HII#H#H HHG#H$H$H($H<$H -L`|PzP@ P WGP0pW U ,^KZ( 6HY@00;00000Evv|#00d$H$H p-L$M|#@0PSp8`K %Z5 @0 U00K10K002K8 KT0|,0 DP <H2[2[  H~H0u$H$H$H p-LMP@8`FP+ 00 00000 0 0 S0$0@00 @ 00 40 ,0, ,00 40F0ppL??@? 0- 0@ JLP 0h0j+I -L$M`12l1,0,0 p ^8` 6^X5 00!>@l5 AP ;F,  0$00$0$  o) 0(+@ğ@G,NP0$0 o0@ ,@0S000 2080 080 00S 0 00(\0 0 C,P4#8@P4 00 0@b 0  W 0 5`%`@ 0D80HP0 (0$ =@l3 AP0) @ Ƞ_,Ƞ0  :ED L$0 0$00q 㙭$0   0  "9A$0 0$04@  00PPD0 ``0 S 0!0(S Tڰ0Q0I 0 9`)`G=@2 @P90-40 0 0S\0#1 00 {D0 1 @P ,vP( 0 ,SB 0(+@@ @ Ƞ_,Ƞ0  D0 ``0 0 4`$`0 0` `` P,@[0040 '[0P@[0P[ 0 @T0([T00ş  0 F*E?'%HHH%H%H%H -LMP12l1, p ^ `0@yR420 @Pc 00 [ 0@@= 0T R P0$0@(0 T- 0 jF0$0@T  0 0 0 000 bQڰ0 '0$0c zT 0  (00 5F00  AdX @ 0p@F0@0$0/ E  0 FD'H%H%H&HH&Ht&H p-LMPJ `@r)vD0 00$ 0 ( p(ph p-LM`J@ PW)00YD000  ph>( -LM02ct$Y1 pP,` 0 S ?? ? ?L ? ?X?!??h!? ?!D0$00$0@ 0?PCt00 k(0!L00 0@ 0S 000@  @B @0 000C000,   0S\0#10 B0 00S  0  B 0" 0 00 0 @;E(0  p6E0$00 0L+D*E+ 0$0( dY 0  0@E@0$0 @*z@ 0>PA00 (0! 0} 00   NB0000@d@ 0Y>P@00 (0!T d@ 0E>P@00 (0!] d@ 0 1>P\@00 (0!Y d'&H&H?&H&H&HH&HH(HحH-08$0"R(00  0$0+ (  2( S0<0( 0@000$0 -LMđ0勯Kp _K,0 @ U U0S @ ?(K ?Kd1 @2 Xa0( K\0< 8R J@P(K0m ,0 S ,)  Z09 S 0#" 'P0!" P0"" P3XX SS  ?K^  ?( K @" pM $HNEFX' -L M<`Kp@ PcU0<0K0 60K@?4 K7@KSK00 5 K?P3[= -LM 00 0 @R 0S ?0 0 0S -LMp\W`pP @WĠeT 0@T8CYP CꜭII4GHG H'H p-LMDP`@Y EYP @Tp1pI0 0 QPI -LM#P@ `IC\0@T 0SD S8 @T(7C5C3C0'HM'H,GHG Q-LP8 `Pp@aFQ00`V00S00@0@T 0S S @T`$UP00UP0zP 02$04 4dA뀽M'H -L$+0 h( G(?$I|I -LM@@0 , $ R "4"@ !$"bPPpK0$`BP@& 0O묤@T T+X 0Kk@P xB0 pK`K`B XR R a B8B ϠPWT@àT0 ST0S *Q0  0P |0S) SB xR R b IBXGB 㗠PƅT@ዠT 0K\WP 0SM  r 0 0 R R Bx2 ,0S ,'2"|,88 #Č`2P a X,b@A(Ÿ00 !((!4q"$0 T "V0s0 0 0 S00 0S񟗩+?+?,?,?+?+?[,((0 "4400$04 @DeP S Y?W@D 1 RP# *P@0 开"4  0$ 020$0  ppeh000 p?hA000pMpMJܭI ~F(HI (H4(HD(H8GT(HJJd(H(Hܸ4JN'(H(H(H -LdM(0p Stp xp l p p P<3(05<0S2<080S`< (x0 \0Z 0S<00(| 婯l0pD08UV00 S q X t0 Z1 0O4( 00< 8 oU@p0 P Hh@Ko@ Vx00 Zx- S 0S 0S \x x 0 01 0 | 0 |0R00000,0S0?0,080S00, 8V 0SEO < Q\VV00 S 0S(: ` 0(H0 4S S 0 4C Q ˠˠ\2"0"4S] 0S:| 0OX 0D"@0(00 <0p ᏰP,2DH@(0e?CT 2R$ x R1x0 0@e?CTx0S  lpx P Rx  lp Px W 00:00}x0S8`!Sx ,P`(He//Vx` x0  > 0ShQf S 00 0S S S` 0 0`S 0QS St 0Rt0 E`0S  0CSS`0(0(HU)HWEV)H()H@)H -80LSP`p (0S KKT r> 1R0S ,PV# V(@2@R0`! 0R 0R: 0S  P 0 0 V08+e/Ue/UWEV -LLM(0@pPD@8X p Sp @0l 1( < 00@ ᄯ P@`JHhKo@ [U 0S 0S`Pv v 0 01l0 p 0Ol0 @0(0<00  TP@H( @0e?C\ 0R 0e?C@T e/#U000 6@00:00O0SX+P (HWEV -LM(p< P`DD8/\",0 ĠB X 0OT SX0c\@. 4<0(p,4 0O RQ /RQ00,0S0 4 8 00 `P0@4000;0000 -L Mp0 `P@  W Q0 00 PAw0 00 00,0 PP 0S0 &P U RO 0 0 @ 0P `$YO -L M0@S K K 0 )&!w - LRPpQ 0S0@T 0a SP@ 0T Y/0<<.F)H)H p-PLM@` < >TA,!<0 ph==*H*H*H - QL MpPH<0SB8P@; 00K4 K400 ,0K( KP` (04@KP  @P@ <p0S }04`0 0lpp@4(00  0- PRL R1<@T  0N0  N0p0Sl0 0 0-0LS@P0P 00 S P <0 T  \ \ 0 0hh $02;|IE?I$5I4*H Q-L`P?q0<@T8 0R 0S 0 p0S 0pRp QL0Hp0  0 yp0W 0  0,0 t II -LM@㝕p0  0p00$ (0  -PLM 0 0 P$W P-L`@ 0PU R@B $ph02T@D$5I p-LMP!3 pP/ PU,  \ h 0 \2px0,R 0 K P@@ @`0h "0 T@Dp 035$5I<.F)H@+H -LMP@p0T``Tp 2S 0V0P 0  00<0 K0P@bW -2L@`p-  Q.1 J 8 ꎓ@YOP\? P- L p0S Q R h0 $  03<.F)HU@+H p-LM0@S`PP`pP 0 S00 0S Q00   Q 1<0 S 00  p0 Sl  -qLMP`! Qq<@T p0T 0 0 00`<0`T 0`0 0p0S @H 0@p P00R00S`,HQp 00 0-4PL0@S\00P008YO -dLM \L@0KK <P <P   YO$YO8YO 0-d0L \0R@P 00$\ 800S04 8YO@YO0 XW 0Ra R R, P-L P ?#?00cSf?f?f?f?hP Q h!Q h - PLM@`PL TD T@XqP+ 00<@\ 0 ?02  <2200< R00< R00< R00< R00< ,PT02o@ 0(@("P00R00S0P 0200 RpP0 b`I,HYO -LM0Pp 0専p@"G`6G@D0S0ץ0CS`` p0  00CP0ҥ0CP0p 0l""0pP ,0 od (0 p ,00,0o`I -\1LM p0 04`@0pFP F0K  0E4p0P E0K 00S 0 x0[0p 4`d 0p  @EP E 0 P000[!0X0`IE -H!LM00p 0 @A8#xA P2: p0A!0@p A! p0""  p0""`I -LMp @,0p ,00,0 -LMA0p ,00,00p 2S0a0c8#0p 2S0a0c8#8P * p202 p0""p0, p0, @p0"Rh(e00 p0"" p0"`I -LMp @,0,p p ,00,0p,00,0 -h1LM p0 "4  崂40X#8#8B0CZ80 >1 p04`0p0@ AP@ 00KPȠ% 00 [ 0 P 0 S0(p"0, @@@D0P8# 0 0 (40" X8 Z0 0 0`IYO -h0h LQ@A X 0 40K P\2T T2T < 0000000 0<00S00qS0 S0<0 <0K10S0qS S1TI 1T 1TlP8 0SSS41T  1Tq1T0S JP8 @0 8K@P 7 P08 01010! p 0<0 0<0 <0\p0<0 <00BK K K K W4K@AK@WĴLWCK v v@ W@vW@ W -LM@ 0 S  $h6)000r h:@-H -LM@ 0$Sh!)0 0d-H -LM0S@PMa0pQ- 0S0%\a2Pa T0 0#r UP 0`00Spe00P0W0SPUUP  `PP0U\\ PP`0Q #(-H -LMP@pA@` 0R `= 00000 Q- L(-H 00sS0S  -LMp1 ` | 00 0SXt(0S1l0R  l0 ` lp 0 t0 0 x 0 U PJl08 P0,A00S 1 R!1# 0S`:(\Q3(X hP i%("(ll 0& $X$l9l 00lhH&묮I*HLP?IIL<.F-H-HL-HHG-H*H .H,.H -`p`@0`SLP  D888 P`00  0E&LLT?h?ħ?<.F-H@.H 0-@P@0LS0  @@@@0 0(&LL<.F-H-H p-LM@ `R 0S \P PUl000PU\\ph00 (0 ,!  IMbQ p-LM`0PS^0SV|0S x!0S00TX@T 0SL1P<   P`0R P 0$ $ G00LLĮILL -@0L R 000 0S 0S 0LLL -4L,\ \ LL 0- 0P @@ @  @ @RL x0T tp  0x@0R  Q 00# 0Q 0 000 -L M; S, # Rr Re R n T PPM P `@0`0VA` Ƞ ;,HnP; S) 0 @0D T  8:S00S@ 2T@ 30D8S0D8#H8T@ 008#HA0A12,R0V0 R00T2T; 00 2R 2R R;00A Rx!t Ha[00f80 0-0 0(0 0#0 00 00 @00 00 < 0 <T 0 ; IT 0S 0 R R0V&0V#0 9,pK T 0S 0<0 0 ✀  -p!LM04 S\q1Tq080 0K  ]68P`@`V@DPEAJ3[ S"[00b0cS G6 0K@6X8@ @08@ 040`၀?000 R # 3 R?H0`?À 4@ 0R # 3бIȮI 4S @08#<@8oS: S>; S P 0 R0,R$E -LM@Q |???ܴ??<0000000000000000000000 -<00000@ L `+ p\&0S \\ 0PP*; Sh!,\1R 0P: R: S:#:A >; S= ^; x   Sp , d0R P0 R:U  hK P0S   /H p-LM0`PP@ SP _0\  00  00  0 \p -L,M@  `^Q 0S `^ \ ^PK aQLXPpPKa @0T*<@8oS: S >; S|p2Q} @ T:XZ WePKa @p0T[* ; S1QO: Sʠ,ʠ >; S<@8oS: S <= S= 1P: 1P7 |1P4 TP*00@ ;   S 1Q P0 R:U 1 c0 @0Tp:XZ  10 p@: S:#: >; S Pw: SZ%Zr >; SPPm0S H/Hp/H0Q 0`c Q- L/H 0-0@l0P0 p00 LPU 70S0hI/H*HHGQ p-LM`0PSMX@T 0S 1P!00 S P0 ᆣp|0`0CS0000 R0020S0S0| 2c1P{L0@ E00+|I?II/H/H -LM ,0 0(0#0#@0p0 40 fXZ 0S  4@ |0t@0|04 @0,004  D 00x000P @ <0 R"8 ` 0S P?#<00cS} 00uU -L@M0 4,8 mQ`( G QMQLQCQ _AQN -@Q (0S ( 0XPR35 nQ@1@!pg\ Š%5 XP85%H 0 0aRT 0CS00P0 0S 0 0CR0X00X0 H0R 0cS0!TcP0HQ DQ0S0 0Q01 c0 JQ KQD0( 0LSH 0Q   B T R 0 R 0 BS X 0X S0>"R ! B000 `0X00 S0R !0 XS2 a0 BRHpLP0S 0 l gR@1@!aL^LH LPHp34fQ @XQ- "PQ(0XPpS>0 gR@1@! b\ Š%5 XP>%d85%.cQ0S$ X 0Q3 0/S5?D???L?T??\???????????????d??l?t??|?????????????????????0@TPp @TTK 0X@K@IPsT0X Dp408 J?2H2Hi?h?l?p$? -LM@P`p 0@0 00P+ 0@`@ 0@@`@ 0@ 00@p@`00 0 0-PLU@ U'PP000  ^0 /R 19R00C P^P0 0 C^P00C L3HAQ$??p?????????????????!R000 ,R 0000000 p-LM0@AP0CQK?$@,@,@,@4@P@@@@@@@@@@@@@@@@@@l@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@!R@ ,R@0@p!R@ ,R@!R @ ,R @ !R@@ ,R@@T@` @` 0V!R@ ,R@ p-LMt0PS@ !0@Tt0x R`@ 0!0@Tx | RD`@ 0!0@T| phLELE -0LS@` QP!0PU0PPPp01 0 !0P U"|ELE 4S!3=8S>08S0 >8 ST3T#1 $t2Q h2Q `2Q L2L2H2@2Q 82Q,2,2$2$2222Q 2Q 2Q111Q 1Q1111Q 1Q ʼ1Q 1Q1Q 1Q1Q ʈ1Q 1Qx18 h1Q `1QX1T1<1< @1}<1{81y41w01u,1s1k n1!10 101;C ̲I@7L4HP4HT4HX4H\4Hd4Hh4Hl4Hp4Ht4Hx4H|4H4H4H4H4HlI4H4H4H4H4H4H4H4HLI53 -LM@PTp`^ 0 S  0| P(0  0 P 00  P@ < Kl  0T P 4H4H -L M` P@Si, p 00CS0(S0  \00 0T@ U P4$0Q44P8 8@  T8 @  0hB 4P00  $@$ D1c!HL <0$ 001T0$ X0($0P @0\`0d0 <0 1c80@ a00 2 Pld` Z<2<"082 4"002 ,"0$2 "0Q0 0(02 0 1 00A S- @@ @@ @@ @4 @@ @@ @@ @@ @@ @@ @\ @\ @=(  0t!0p1 0h1h!0d1( 0<(0,h(0,<(0hg \0  c#8@PU  \0$!0" a<0 05  a 8@PU (0 0(0W [D$W@5<y @ @@@X@\@(@D@ @ @@@`@8@@5H 0-@LPP 0S 0\ 0cS 0000 PG@5H@-@0P 10RS<8 00蜛E 000<8  0 E-<p$@RL1P̂+X 0`5%7,@Dt" X P P 00  0 0  00  0 0 Z 0P0@DtA A"0pBP@%,`c -LMX$`$pT`FvC%B$  -`F0v@P -L(@pP`0S P$` W(00(0(00(0G-@MT> T2 ,P E-./0p1` U0ޕ0ޅ  eS22 R0ޕ0ޅ b BS22 R0ޕ0ޅ b BS22T T 1\hЍ 4 8 <\h0 48<\h0ꜘE-! !^p@-C7@<00RP`h@$ 0<$ XL1H!!0"PEu R ^@@@ @@@@@ S ^@PEup(0  \B1 P0"A-(0@ @0 $00bT0C$ X>" P00c R b00$AL| 0 ^P 0 R00L|L| p`0VP0 00X000 ^ 0 R00Q0 00W0L00|G-T`p@X 2,0 1 TPh$4L|DA 0TP PL|L|@ 0TP PL|L| 0TP PL| b0c 0@cLD1|b@  X0YVP P  T PRLZ| p-LM`@PT 0S @T  P@ p  00@p00pI -LMX@$p@% bT0 apGL Bw &R$  YpG0w`@T0 -LM@p aPL `@  @0T0d0CX # $ ';<0A0q& 0Aq -LMpR@P`  0@T -QL M, `XD0@T , Pp0 @D0@T XSJD0@T ,0Pp0 @gD0@TXZ -LMRp`P@T0  @IT@XJ0  =@TZ -LMQ`PpD0@T`V 0pD0@Tp@-a0Sq@0!0 0!#1 0"#2 0$#44(< 0@#8 T0P@0,,!0 0!#1 0"#2 0$#44(< 0@#8 T0P@0 0 0 #1 0ll"#2 0$#44(< 0@#8T000pIIUUUU3333|II -LM@v 0 ST0 S D@00 0 000 0,0 0S0x@d5H@"@!@#@ @@-A;A'<0<  0hh0@|  4 4006 600 0000@2 2T0 LL -LHM`\@p oT X !4.0 X@$P嬐 W& 0P 8PEpbu ( 0PE#200u0   @ \0 AD! 1000C0PE00u0 PEu00@LLL -LhM`\@p oeT X $!4.0 X@$P嬐W W- 0P 8PEpbu ( 0PE#200u0   0#2000 @ h0 AD! ! 1000C0PE40u0 PEu000 @LLL -L∡M`\@p oT X D!4.0 X@$P嬐 W4 0P 8PEpbu ( 0PE#200u0   0#2000   @ t0 AD! ! ! 1000C0PE80u0 PEu0000 @LLLA-` p!PX0!1, 1!0 P@$h 2L|` 0 0L0|0 0 Q0!L 0@RR|` 0Q@00000U0CSR0L000|I|IIp@-@P$0 X0a<.1 0 R$@@D0"t 0 @D0#t0pph0h  @D1t 0p 00#0q0@D0#0tI|IIG-0M, 0P@,P00X0PPP` U$p@,!0pG0 wP( 0b@U0S T eR0 APd 1Z * 0! j\8%1^<,pG0w0Ѝ%0Z:$P 00Q( 0e 0 0 0A22V$00S,P`00`  `VpG! a `Bw  02 0,Z0 @ V0S 0 S fR0 J\Vڬ3 00003 !@@D\ V0S Q fR0\@D(\% U0 S0 S eR0 0 @CTŸ 1Q !2 0 c\ 1^<  pGw] "0A\<X"0  000, 0pG!0 w> 020,P(0\ @ P* Z 0`S V jR0 P 0 PCUT| 1\ ,d1 0 c\ H1^<  VP@ PF\ U0S Q eR0\@$ R U0S 0 S eR0 A\ڈ0P 0000 !pGwT 0  000 , 0Q0 S3|III0 0 S$0 S000S 0.@,@*@x/@E-M pTJ<h@J+X< ,$P ` @h0 P- 08 PPEcu $(  04 8V@   ? R0PEu 0`FvL0 `Fv0ЍPEu 0V    RPEu@-A;A'<00<  |hx0h@  0011 @01 (01 0 RL<L -L<M@\`Pp mj1 WT0X(# U$% 08 P@Pcp!!( P0@#1<0 p 01<0  0 \ 0<L00C0@p (P0@00 p@L<LL -LXM@\`Pp m 1 WgT0X(# U$+ 0P8 @Pcp!!(P 0@#1<0 p 01<0  0#1<0  0 d 0<L00C0@p ,0@000 p@L<LL -LlM@\`Pp m41 W T0X(# U$1 0P8 @Pcp!!(P 0@#1<0 p 01<0  0#1<0  01<0 0 d 0<L 00C0@p (0@p0 000@L<LL0 0 Sh0 S\0\00,0S R/0,0R.000 0 0-10S 085@3@1@6@G-M(T) <h@pX)'< ,$P ` @h0 P@ / 0P8 PEcu .  04( 8V  @ ?10 R0PEup 0`Fv @D `Fv ЍPEu 0V @  RPEuA-!;!'<0< 0 P0h x@ 0011D  00!0000P0@DLL -L`MP\p@` md(1 XT0X'#@v$, 0P8 N`c~& (p @`0N0x0~  01x0  0 0  p 0L 00C0N80~   0N~LLDL`L -L⌡M`\p@P mT1 XZT0X'#@u$5 0P8 NPc~% (p P@0N0x0~  01x0   00x0  00  0L 00C0N@0~     0N~LLDL`L -L⸡M`\p@P m1 XT0X'#@u$> 0P8 NPc~% (p# $Q@0N0x0~  01x0   00x0  01x0  00  0L00000 00000C0NH0~       0N~LLDL`L(0$8 Q!0  Q:ᬛE0@-P(P  $08@Dt @\ 0 0 A\(@Dt0 p-LMP \80`@T  @Tph\L -L4M, <ͷP4 ,4< v,@$0 0⣡ , 0 404@巷P8 u ,  ,  0@ T,0D $0L0 L,0,$0, L0 (P 8 T@ H X@ L0pWLX0H ##,*,T  80@ 0<0 P*?< >1G0c @ @P`?>1 1@V3 0Q00AP :L pP0W:0D QX0T 0 P 0X0 T L 4 ,4  0($080804P4844 4۸8 0-L@ E\P%@>\TP 0h(0-LQ@0 0R, 0 S LIL,0 P 0SPL -Lp `P\0@T U 0$ R @T [V 0 RX 0( RW P [L -LMp P[ $ (0 0S 1㱶U0@0`00 <@开p1 `[闶< G$0( @剶8088 7밁[L8I -LM@ P`[pdP@& U ,0U 0SE0,PV 00V 0S I00`00("X0\[X[P -LP p`M[@-PU10  A[U 0-@L 8[PP@ 0C(S"H ([0O5H@-0S4 S/0!0@Ġ\@(00\$ 0nQ T00T 0@bS 0 S00T0P00SS0I -LcMq0P@$0 ?0@@R00}/#\B1TTT w0P0 $0S h$/XjTa0S0D!0000iK1 D0@00 JV`0`2SO@4 0oP$@X0S 008 R 0  0S0 00C0tT00X 80P0H! 80P0pMI5H5H5HHG|I=5HD@6H86H p-LM0P\^ @L p0p@Q```P`` `0 ^ pPЫP (_$]IHE@I@ZOF@IX6H`6H6H 0-L@#Z0PS0000 0@@020hZ@ZO -LM@ Z0S R 0 00  0  hY@ZO p-LM0P\2S `0S @ 0 @0\2S 0S ? 00\"R P0Sx@002c1 T P0S , 00C0@L@pI`HI6H -LMY`Pp@ 0Tp  R0000 0  Y YP@Y@T@ZO6H Q- L+6H 88#$R\\ 0R01SP0SQ 00IITZO - 8LbMؠ8#P( `P0 SCY@jKq0S|||  0#@P@ ,YT (0 S 0( @pMI6H6H 88#P0 ITZO -L Ƞ Ƞ,4MP@p <2 QPPy(2Q 2Q 0ό1Q 0B~S001<P  1 0 d0T N  VS00< R V P0KH0 @0KP T TD 0 ,p L` 8` 4 嘳00S 00<1 P0T0 V 00S X TH KST H KNPT H0Q @0QQ(0$0pIUU@Ut}f~fTZO0 0 4 S-L@PUXA`p <0 RpIXQ IHZO -LM@7XH 0S00  Q0 0 0S00h"XLZO0 R=  0I p-LM1@s 88 #4 pS0P`$0<`80X00@W LZOI 0-0 _0LS@ P0S 0000 8X00 0S P0S ?  0 ? p-LMt` QhP@-T ^ 1fS0PB0 0C0pZ @II6H 0-LbM`P0PP@0  cK T fK' 0S 0 pM7H 0-LbMPP0 @ bK0 E fK 0S 0pM7H -LcM䀟0k_K`$0 @. faH-p`QW @0iK0cS0x 0͇1p]X T0P 6W $0S ,$_pMIIHZOTZO(7H p-x0LM R 00p`B PW0`S ph W000 0@@0 W= p-LMQ@@P Q pTP P0S \ R 0`S }\ `1PS 0-LbMP@0 @S0 4P0-L0S600`"R 0fK1 Y0 S t+0R0 0`20H0@ 2c 1yP RpM87HID7HL7H 000$I 00C0$I -LM  -LMPp^@`   0S & 0S ^ 0S K0& P  0R 0 0 0 0 0 00  -LMp $0K`PP@0 PP @ @` $*$0 $P$0( <$ P@0 $$0($0 P0-L@" 00CS 0 0PU R 0 0 0 00C00  $Pex000l7H -LM0p$0 PR@jH `20#0V00S 0@Y00  P@<H00H010#0V00S H00,0 00S3 00P@H01 T U$0@S 00 0\ U$0S U 00 H00H00    =7H7H7H101| -H0< 0@@pLTP`00  PH0@ 0H0 07H - H0L0@0(h<0H 007HH0 0@0D 0 0-PL00@TT0  P`I   0Č   pPm 0R@0T 9}0 p 0K4K0K/PK.PK-PK,PK+PK*pK)PKp PPJP40[ X0 0pK/K.K-K,K+K*K)K 0 <:H -LMPp@P`\0  @DD@  @T  Xe@ -@LMT Th:H -0L 00 -Q  DL0000C00 0 R00=-00\  0 S\(I0@-Q8#@L 8P0 SL0 Q0SS -LM@0 4 -LM0 S*@LT0 S080 0 0 R :H:H:H -LM`P@Ct$K $K#K"PK!`K@KpK @K0K -LM@ 0 @P0S -LM  -LM 0 -L M@ 0K0KK@K@K@K@K@K@Kz -L M@ _0K0KK@K@K@K@K@K@Kg -L M@A0K 0KKK@KKKKKS -\0L M@A0KK0K0KKKKK@K? 0-L@MAT 0K 0KKPKK@K@K@K@K*0 0-L@MAT 0K 0KKPKK@K@K@K@K0 -L@MpBTAd#0$K $0K#K!PK`K"K pK@K@K -L@MpBTAd#0$K $0K#K!PK`K"K pK@K@K p-L M`@PU$K 0 V@^0 0K K@K@K$K K @KK@K0p p-L M`@PU$K 0 4!0F 0K KK`K$ K KKKK0p -LM`@pPU0K 0 !0 ,0K+ K*pK)`K0J0,K '0K(K%K&K0 -LM`@pjPU0K 0 !0 ,0K+ K*pK)`K0J0,K '0K(K%K&K0 -LM`@pEPU0K 0 ^0 ,0K+ K*pK)`K0J0,K '0K(K%K&K60 -LM`@p"PU(K 0 !0 $0K# K"pK!`K($K KKKK0 p-L@Bd M ~0AT 0KK0" K0KKPK`KK@Kp 0-LMPP@ Kk 04 R *0S0҅0!S S  R:00 -LM@`$KpFPU P   0Č .0P  $P@ 彫00 -0L M@ 0K0KK0K@K@K@K@K@K3 -LMȠ,Ƞ @0 pP@ O`\ 0$  N$@NT0 $K0$\ v$^ q@ -LMȠ,Ƞ @0 pP@N`\ 0$  N$|@NT0 $K$\ 3$,r@ -LLM02c10 @S0@Sh(ID7H ;H -LM@ 04 P*0S 0P: -LMPpP`t SN1@T 0SX (@TFN0SN 0e .P@E 0 P` p0  0,P/ 04P00 0 P 0P@ 8 0e㇪d0S: 0S:(Q,0,0, 00C0MpM0I4I0;Hd;H -LM@M4 40((0S0,@, 000hM0I4I -LM@R@\dbp MP 0`$0MP@T 0 R1 @T$0K@ 2P`#$0$@$0 @00@S00  Q@ @00  Q 0 0 0nMjMT8I -LM$0S h 0@0QM$ 0S00 @ hEM8I P-0L 0 '(GLE -LM0K0K㸐@`BT/K -Kp4K0.@K)K+PK*K,`K@P4\ 0 @)K*@KP4 0  -LCMT0Q0@`O P51!sJKKK1 (B(0P&,1?0@CP I_KPE00 $("8  00X00",S ?00^0 0JKKK 0xP,1S QK% Q&0Q41!P0 S0 S0 0 SR 000 S P-L@1 1DQ@T XcXCXT#00LßQD   0S 00B0S S3  X 0f P` 2X  0S00S 0S  ` KP ` `IP L 00S 8 pV fK0X0f840` pdPPO 00B0S Sf ㇟Pd P010  P 0S}?d0000dB0S0 S`\ X @ 0T4`090 P@ T 0   01 0CĠ UKV0KpMHGHȖHH4GFsFtGhHHHH@ȕHH H 0S P0@ 0S@PU0 DPfß0 0X0f㼟AR R0H4 -LM 0@S P 0S 0S(0 @ -LPph@t0SPe P < 0`80, P(0P4`Vp\l# 0S# \h#0B$z02t00`SQ0 t3 0t3ki0 0  mZP pC\  l#0 S( 10pC\Z( 01, $m7mGH4HLHHGhI`HH Q0- L@P Q 03S?@ 0-@P<0L P@0 01@ 0-? LR@tSgp3USa 0Sꌤ@̤@@ @D@t@@@ XJ%10#0 0 0000 :%20#00  /10#0  %0%0  0 0 0 0 00  \0  @00 00HHHHHHHH@- R@ 000 R R0S0S p-L M`@`<f 㡜PPb 3SV|S 0 S  0= S; L\0  L\0  00cS 0L0 0\0 P `kS|ÖBePSp"c|!|fܝph갘H - @LM0  /LԘH 0-LMP@K!01S 00CS@`@|@@@@@0K00K K 00K K0@K  0!\0 00!0!0 0ؘH -LdMx @a x01, |0  R t lPK| 0x |0 Q | t 3x 4| hK@ 5K!00 | U0K0Q  h| 0pK x cp[` VP\ 0 ?>1!B bQ\^P` VZ U5` V 4\p0 ?>1!B bQ 0h B0P` V0x t |0CKh P PUH@`8@PPUJ1e1D@}PU8@DZ 0-LD@PqPU8@Z0 -LM!?@QI<0 a 1c1R< @p< P 0Pڐ!@t3 0^PZ S( 0B,S`1`! ,0( 0S,0$0%,0%U P 0 khOPf, ,00,0@ 0-LMRP@  0Kb Q h40 04064 00PR500c404 00R개H -L M!?Q"<0  1c1R@@< < 0Q0 Z $ 0 hl@ -L MR@5  ,0K#,Q@ p (0  B`2RP1P! ,E,0(0S,0$0%e,0%V XpZ, 40 04054 00PR50c404 00R2,,0 0,0ܜH0@-8P@ \0Q0"#000"#b!1C00 00Mb<( ,00$4G-M(p,`\P@Q ^Ѝ 0S 0S 0S 00Z0S 0 48S05 0 48S0Q0 00$8 S055 5 5 48S00 RE-PP@`pQ P 0S 0S 0S 00V0S0 48S 0 48WQ0 48S X -LMP`pP(K 0,@K@I,\/ 0@ T(S :0 P,000 P(0 0@zP0, T@ -S``LM0pPP 0@ T S0 0 0i @ 0P@ T 0 -LM`4 ,0 \tp0 8  D0S <  1S 8 R t rl3!b1<0S "rl3!b1x3@p@ 2T00s@$8Q t rl3!b1< R "rl3!b14l3!`1  044 W<0, 0Q,PTP0AS@@(@(@(@@@T@T@Q0% S pl 0D GPDT0 4 @ Rl\ \1\!T000S\0 \ 1!T 0@P 0 TT  0@Q 0\ 0S S@0S4\d0d \ \0Qd$$`$$$%؊%h%%%%L%Ȍ%t%%%$ $$$ -L M"00pAd"@,T(0K(K0, K%K#`K"0K!@K+PK*K'K&@K$pK,Kx -LM 0@S  0P [P 0S 0S -L`@EpP $O 040 0   8u8+P.KP(@ H0fPPd0PU0 h @hPd0t@U=0<0HKFH0H Q-L Q < -0LM@<0j0  p-LM@PP ` 0S<0S00 P 0 Pp ppp 0-@L42 P 0S  0S000h"2 0R0S0 P0S 0 0S00@H p-LMP`l00lPhPdP`P@0P P0  4UPP p  -LM@X h -LM80pS 0)%P`\ d0l@PU PPE`Ut@lT t@DlTf,lh`! p-LMd0\ `0V@ Pl`d0\ tP0VlP0l0h0`0pf -PL8 @ H pf\ 1`dNPl} \ dR00Q`01b1Xh`@=Xh@ 0a4 ^ @ # 00S0 SP000 40  0H0Hd0t@X 0 lf㡍0l00a4 ^ @ 00S0 SP0 40000@0@\0t@Xd0 PHpH -LM0`H0@04<0P@S J4D0p0S @TZ0P $R0S 0 4aPP Q00Q0S P00$R00S 0S@00@0e S` aP P@ HR0@0 Q0H00X0R00S0@0\00Z0Q00S0d0d \H01`f ZP@l1 \0S`0d0Sh0\0l!c11 h `h h0Hh@ h0h `` 0@4 @ 0 H00H00 0e Z00R00S 0Y -LxM4@fd P`l 0\0H0@0d00b 0PĂ\:^00 ^0S1 \00R00S 00S 0Pt \00%R00Sd ub TPp00@DP\0@0\0 @t` n\\d l`@1d1QV)*KtpW@* 0 0+  0P$ tQ:T t  At = t 90W0`:\d Ql00R`0l 1a110h0\@d0H0d0 HP 0-P@ HL1f TPP[ @ HR00\D010 ^LD     ( $ @0^,H ^L     ( H0^,\@^D`0P 0P,\@^td@^Lh0P 0P,d@^t00 0-@L .D0PSf0h.P僋0P0D0L0Q 0S R 0S 0SP Q00R00   -LM0@ P P  R00 R000 00{o0 p-LM@XP T0`VPT0`VPXp -@0HLQ1PP@ T0`Pp@0VD0 H0VL0` X0,0P@,pT0V 0-@PLU (   000 0-\0(0 000 000S  00C00S  00C0 0-P0UL@ 0+% 0J 0-0LS@ P 0S <P0 00 - LR00 R00卺 0-@ATLPf ؈P X 0X 0RfT0f p-LMX@Q T0`VP P`T0PVXp -@XLPp T0`VP P`T0PVX p-LM@XP T0`VP P`T0PVXp000 -LM@0 (  | P @ 0-LM@`0 4P  Pd {P0`00(@ -PL0@< `RQ0SL F-` 0pR/ 00 P# `0 0S`0:$ R0 $0l0 @ h00h0d0S -0d0|-$$ R0 $0l0 @ h00h0-#鐝HH 0-@L0< R0S0,`0PS0h,d0S0d0h -L M0`<@\  $0K T$PP' 0"Q1 @T 0S 0S (\ \0 pW 0p W($0@S$0 PE p-LM0@<0S'hP`0U l`lQ 0S`l0h00Ch0 0R$0 (0S PU`0Sd0pphpܝH p-LM\`2 ,2 0 p\6\- \00 p\0SPU0P000 0 " 0S R00 00 p20 0 K@T00DST@@@@PU0P 00R20 0΅PU2 00 P 0R0ޅ 0΅20 00 0TPU2 $20  P0$(0!P:00p@J-0S S s 0S0S s0S sP   R 0B30 R J P0-L@ T? @0S @P80P4 4 20S000h*l HJG:F܌GHP 0S S0S0 00 㝀 -LM@ 㔀00CS0h p-LM 0`S@P*$000( 8 0T0 < 040 L 0P0 d 0h0, t 00x0 | H0H 0 @`, 05`pPHHGDA8A4H -`@0PL0p<XP7*0@0CS0 W p0 0B)p0 "Z*0PU|| 00S PU@ 0@?R 0:RW R00NL|IAIQ Q -LM0 @  0 xI4I -L*\ 0S 0Sp pp#3gP` p  0Sp0 p 'ppa@0S=.H0SMH0S2 HP` P + p00p0d0P 0 t0S2 0Kx|` 00\P$ X@T `0@  @\P t& p`0L @ 8` 0Hp0$JAHH\H 0-LMR@P( 0S%@^( R0K h0  c &p @0p00p0 h \02&0Hw ^&p00p00K $5I 0-LMPD0P @0 S00H0L@( @DP0A -L MP@\1h RR2p 0S g&` >]&R @P:$`K(K0  t0\&I&(0`S0C(0 @&P|$0$0 p (0 R0C(0 ( 0x| 0 $5ItHH 0-0LPCU@P 0P@PXPDP 40S DP\P 40S 0\0\vXXPq@@P -QLM@0s頞HH -L~ 00s S0 00$P -L`@pP^ Z&@ 0@0Sh L`0  @0S ,0 h6HGHHHH -L M0pP`@04 @RLT0S  EP@$!KPP@ D,!0[`T(K IP@%"K('P@"0[P!0[`V( @01#R1  20DDP(00" [T -L$Mß0 "R, 0qW 3 R4 4 RZ0 40 1,120 D 00SP PR 0S 00 0S00 0 0Q, : 0 11!!21DP `L 00S)0A@AA4A0Q00 3  0- f < p P<0 Ÿ @ @fP 0  R0 4040<f- P 1L00 R  0 BiAAf o@<@HD@0 P5@PP0180 NP` T  P 8 0X1 R⼕0ZP \0oX@ڞXJ11T@7X@DZ<fʀ0 ,0JQ38JH'A (A - 88L# ML1 " a40, SE P04 1p100 W7,  0 2 @DP PpWȐ040|00  R R <P ft0<0X@@X@Z,0 {08JH -IMLMD`\, PCOp^  R 0S 0P eP 3 ,0S , #@ HP1 P$ W00Q00SP ^ lQP1P! GPpH0D 0SH0<0%@H0%H\  PQ f#D00lUP!P0U"  P%d2p RpWH@ P 0H@ 0 0 @##P<#0SP0U!  P1p RpW+0S # RW00Q00S JnK`F`FQP1P!UP# Z ЕPp RQ 00 00P M 0 SP1[#U! BnKJK`FI`FIT L0  @0S 堕Pp4S:0 SP1[#U ]Sp Sp1 e!\:0> 0C0 n>S -LhM ` PPpK P@ < R RXp0 SD0Sl -LM 0@S  P 0S0  0S   -LBM p0004p`P@"0 t 0@0X0 @T@0s (3@R CKA A Bf0 R  0S T @ hi Q0- L@P Q 0|1S>@ꨡ p-LM1 S@P\`|P50pР`꡶̎ 0 LHXZO -0 RL`p@ @*PX@ P 0p000 @WP:!mE? R 1S 1S 1S m$>FO\ ᝙m鞙>FOә 叙00Ba [AIQ -LTM0`HS p, f @LT P X*0P 0S S <00|@0 U:!PP PU*0P\PU:PU*0\xPU:L0X( !Rg1SO RP@TK TKb0|0C 0S ,PU. `|_YO%QY,0 S ,剛ᄑC hd1\1Ba0 @  0<<0S @PU` 0|0C|  P∎Uj |K~뤁@T*0P @\~ T:0|0Cw@T*0 @\d T:0,|0C \pM4EhHL_AIMb -LM> R`1S  K` T!R\13 0K <\ 0[D!2 0K HQ 0[P!2 0K K0 p-LMP!b`|嶎YO|ᨘ $d 00Baph`L_AIgfff0 Q-L t0Q 00T0Q L0Q0YS001z`1 W@W@ WW -0PLPp@0S' p+0\1j?@L`j a 00@W0@m0049\嶴00LLtH 0-LM00P@K4U 4 000!0 00CL 0 XZO -L|M`K0 K pK@X)PP< @0S<6[S4 t0S 8\X 80Kp[Ƞ 80S4^00 1S80KḀ@40Oφh P\40RφL PT40Uφ0 PLHH$H@H`HtH -L M@K K 0P -t2L0M<00P00 @4 0p0[4K(18 K0(1(1<`K0(1j08@!4`Pt < 0S ˳0L!48`P` < 0S 0!48X`PC <00SXp7 `0Kp0 (48pP `VF 1(Q! 0,厳,1`Vdp0 (48p,1`V pڤ DK0D @@ h4(1Z0(10#(10d 48`P @\gA0ȣHH1H24GHFH4Eл?8H Q0- L@P Q 041SN?@ -40PLX0 -LMp`@L, 00cX00 y(1,1`XPd@kP0E S e,1PU @,0 0 001X 410S@@4, 00Yo4N? R$1S010$1g $1S ϲ0$1,H0Q00 W@ -LM$0 nP TE -L D0s; 4DH0 P60w00Ls0LP0P SP PP@vH@s딐HqPnLT`pH@@P 00 puPH0 0 pnL具00@R00@0-zLJIH`JXuA -LM080@# 0 <@   ( 髭H,H@H 0-0 LA0S 0@0PSH0S00ꝸHLHPPP0S PPLP@PLJ -LM@0`ܷPp- 㙷PP& 0 S9#S$0 ߷ $p0W D@$K P追Pp0 S9#S$0 ᾷ TH 0-`0LA0S 0000P0CS0 04LJ 0- LP@0&PP 0 P 0S 000CSPPP 00 -LMP`@! 000 4 080P@XY\` 0X0 Y 0\0 ` 0S4強Pp X0S0S S0 X0Y R 00CS񟗩4ALALADALA|A0 Y0X0S S0BSAAA}A A#0ȭT 0S0@T<0S~ =Q{ X Ru R00e 4D0 nP i!4<@0 dPX0SI 00p@ʶPp @TZX 0S/ 6S, 0S' S|2Y T00BSP~A~A~AP~A~AP0 i;,m ha1PP X S4>H0 P P= Q i@>0S4P 0 S00S=  X0S 0@Tf 00S> 00S<  iPJ a > < : 8 6S(0Y0 00S PS 00HGHdHhHtGtHxHEHHԥHEHHDH=HHHH -L`p@P@P,PU@Z 0@0CS0徬| AT Pg0X1 "0 p ͖v@p,H -QL1  Q S 0S p -L`p@PPPU@Z@P`@PPU@Z鲴@`걵p -LM0@S  1S01 1SĴP P1 010C1P1 嶪DH -LM`pP @ 0TP@@ Ƞ,Ƞ v0000 R P@@= -LM@PP`  h0!T` 0`0040 R PࠁࠓT=Y0S 0r0Ss 0Rr0 R0S0w00ZR0S 0{ z0 0$S$0 -LMP@U`1p @ѵ0<0L00MQ0PNPOPRPSP L0 -L ML0Xp 0 8@8P`DD!LMNORPPQ@S`j -L MP0pN=U``GGGL0 0 10S U0d0e B0C f0g 0S0)0K h 0C4i0 j k000nmo@lp)PK)0[s@p0qr彼  ) 0P00p000 0 0PPEDd 0 P@00 0S AxxJ= p-L M0PS@- 0BSXAԉA|A܉AA܉AA A\AT 0R0P RA R*R# T00CS000@  0PPpph9ܻ0\# Ǫ 0 [T T 0Q0ph D 0@@@ 0@ T R 0\`@ `@48" <S^  hi0jk 48#3@@3#3#ß0K4K0@,*?C2P0 @@pbX h0l@ Lp PPp)TP lP0,A 66Xp0,p 0(6W'TppL0))NH 6.(*=6,*6% w RHD   p0P u S^r0Y0\00Sk pl10!}>S<3K0h1=``\h P@XPRdLpT 1!-K@0 0K*0K)K+ K.K-< 8K =<@C1Q<08@1- 8@!0a b0c#AQ d0c?Q< 0<帆@ ªP`7 H00H0  R@1J#T ,K,@ < >@0S ,rP,0S:0 S:#S@H00CSH0 tS S<֪ JH -@1LM (("AL0`SA0媪Pp: hPP3 H00H0  R*#R$ ᫪H00CSH06 $urX >hD$K P臰P0 S:#S$0 P P<ဪ JH -L8AI p-AMLAO0P `0 P 0 C400|\\  嵡̠P202p^ N`sp'\AH 0-@? LRP1? R- 5 *81S;11Q!  P 5;5081S1 Q 0S0! 10C1<P5 ;%50 Km(㩏(⟏ -? LRP0p₏5@@ 5~o @CTڴ5 H  77P9 7P3 H '   ᭃx2S 5O@05% +%{ XzT0mzP m(⍗ H8AI,H p-LM@? ?d9PP? 3'd0PP = τ%dd @g*nPP ̠x ` P姠徟pU 4EpN J hATAHHhHH 0-? LR_? ( R $@T ፄ0@T0 0-@LOP<000,  0 -P?pLP@`wS1TZ1TD*1T4 1T ` B%# = S =@S @ 8C8`2%2   92  @ o5050 R0(P 0L4P`5@`g0ៀl0T `0TT0P\բڠD0T/0Z`2i 1i i i 5i i 6i( p-L Mt0@0t0P`uO0 K`  o1SpꨬH -LM@nh -00%P-@%LU  XyxPS|P:P!`PpPP`PpP P ? drb^rbP RP02  ԟP |<P0|2 x d꾟P x&PxR ,ٕ ӕHHH H@H`H2,02 SI -LM@  JI20CS2h錥 -L MϠ ^`Pp  @0?0(0K:HCʠHC6 GD(K!K%K#@K"0K'PK&K$pKU@T -LM?`pPP 00S S @ @K@K 0@ K l0 PT0@U0[ [0ppM+ H -LMϠ P`UCĠp@ K 0Kih 0P} K L0v @40Po[T p! H -LM82/ 6S00@ RA?< R 0, G0ShH 0- 0$3_(0LS $@T K0@Tۀ0 0-@LOP000,  0 -LM?D 0Rp( 00 ,0  (0S (xz 04K4 [30[ d1R`hU&h@ P0K< 50 0 "0S}0KΠ =0!U @P`pMԭH 0/Q 0-@MLP 0@Kl 0X 0@0@ @H(C1[#4S4  <0@H6 0@HK- <0@@yH# 0@pH H0@gH 0@^0 04@WH  0   0-LMP@ 0P@H(Ϡ  ^0  0P/H ٦ H0P&HЦ 0 0PH Ħ 0PH<㻦 H0PH㲦 0P (0" -LM 0S0 0QP 00E -LM`PpG刓0p2 ᯧP@"0 .#?㕯@@"0Rh#F`3@/2RᦝP@ p0X$Hb3!L p%.p  `G0< H" 0S;9830@TLP 0 S00S\" 0@Ts υ0De?0m$  /0@  0`K0`K0`L υ0E!?@@{~ ۨ  X0PJ10p!51 |!0x1o l!40d18  <0 L!L1p8 0}$ R "02"[Iny{ u0  H r900S`"u00SX"p fp咒HGEAHAHRH H(H``0+h\FAAXAAAAtAA4H@H -h1L PR0`u ? e{hPFdPAlP<H◖H┖2p0CS2 5@'O }ᡘ@{&nh2Sd2Sl2S h02X 0CS2vH HHQ Q? 0-L[@IPU$ 1  !0 !1BU0 >@,0$05$0 S !0 0,(ܫH p-AMLAO0P `0d P  0/"-C4? 0@ 8\X  m儌P|20|2p ph"BH 0-P? LR@-5 *81S;11Q!  P 5;5081S1 Q 0S0! 10C1<P5 ;%50 Y(f{(\{ -L M0p5P@` @~υ 0@/ 005  00 @ }7Pp U7P _42S %@ %5;5i P  jH,H p-LM@? ? PP?  &nPP ̠4 L P坌崋pK ;pD x BhHH -P?LP@p`q1 Rj r1T[1TE*1T5 1T ` a%$ = S =@S @ 8C8`@2J%@2  ?  @2 ?  @ `505*0 R0F< 0jl4P`5@`0lD0T80P\եڣ$崂pM2i 1i i i i H -LMP0/@|To t00t0嘂0 K p. 1SꨬH -0 5P=5U@4LPP8P7<Pl`PpPdPX`PpPPP韋PrXbꙋdrlb%P <半P0<2O ?I 9P 8wP0829 x)3 d#P 4aP4R$ , HHH H@H`H 0-LM @P0黋PP 0@  媎PP 0S 08E -LM`Pᘔ@<؁ 0ԁ᠔0 2  "0 ~P'>'.0@ 22 P᷁spb9PUA2s 2sx l2~OP$K0` ㈗~ D僗? 82 =j $剁 2 "0@5 2"0 X 0`ߘ101 ]9j1   6P4@ ""0pTP U!P 0 S00S" (C0@T00S00S" us$ ]Pl ,Tc(0!R@T[֊Pp 0 S ,(0!0"(1HGH8EرHHH*|uM H|4B0B5BrHHdH8H -PLBPp`00@S 5@ i\00/r 0-P? LR@-5 *81S;11Q!  6P 5;5081S1 Q 0S0! 10C1<P5 ;%50 U(@x(6x - !LMOPp `0'>  P  ||  ‰و0Sd20d20K# p ?';B -0 5P=5U@LP7 P8`PpP0PP`PpPHPnHrPbh0r8bP  \P0 2 p \މP FPR  $ H H@H`H -P?`LP@pD2 1T51T&*0T 0T p ! @ p>@ s50530 R0%90Ii4Pp0i40T(0P\2i 1i i i i -? Rt00t0ꨬH -LM0`5P@ 7P: 7P4 ?? *Pp q ai?"> Pp ` tpO0\  p坈崇%@ %5;57HHhH9B,H -RLM`pP P$ ; 0 0 Pj@XvPP 0 !!$ !0``1` `RU! O@=v$G$ R 1 0+10 ,`(` (00C(0 ( R 3(0 Sl00l0h00h0( `  7Pl00l0 <P d n \STH9BtH -LM@?PU`0p W5V;U5 VV t00t0 }V ? (K 0僇 P(0St0p000t0p01S $~ `ܫH 0-LP@u 04 P*0S 0P:00SQ Q?Aq- $0A0 0!q "J -LM 0S4 0 0>P 00E -LMP`4p@`t} Tp}< ᗑP@0,#?@#0S#@03/@3S0 KᚇP@000400 4 2>080@0<0 `Tn80sh <0se @0sb ~,`K 0P@Me}  tPv1tp!51 !01o !4018  <0 !1pd  0@g$ R "0]"ㆂtXe P`0 2( 㞃| 02|4ⓆP  0S 0S 0@T0S@0S80S0S<d|꫍PHGHHXBH,VBEyGMBSBUBYBZB[BWB,XBHزHHH -2LSPt`P_0⸀0ⵀ2p0CS2,5@)O  h‚aeGXH0SD0SL0S020 4H|(D|@|,HTHxH -PL M@`P P`^EtF(K ”?00(0K%K#pK!K'K&K„$PK"`Kއ2P0CS2 -PLM@p` R`pUFG,K @00,0K)PK*PK+K'K%K(`K&pK屇2P0CS2꺋 -PLMK B KT0  P00[ -PLM@p` R`UGF,K @00,0K&PK+K)K'K*pK(`K%PKm2P0CS2v -LMP`B哏Tjp 0/y 0 5 T  7PE 7P = w} u m FgH0S D0SP5P@@05%+%^ Tm^P0n^w#{$< ,HXBIH p-LMBPT p+ >$ 64`0@  #Tph'Q Q -LM┡2 S`( tp5 U  <5   (0S (`0K ᯋ)[ 0)KDRU@ P5<5  0 ,0S c?0 00U@P5 pMH p-LM2`SP4"8 "4D0 +P&4<H0 $POD0|  `孃Ă20CS2p#S ,Cz`L pTQBhHH -RLM`pP P$ ; 0 0# Pq@_qPP 0 !!$ !0``1` `YU! V@Dq$N$ R 1 0+10 ,`(`` 5X0p !1Pd 0ZYXPAQcP0P o|$nP 0 S00S " 0@T00S$"00S"  4}uHGH τ$ @p'{oPP ˠ( ` Pg|~{ 4s  \hBaBHHhHH p-0LM@PQ00 5@ R R00R``V p|20|20SU(ph|ڃp"0 r|bmH -0`@LQPp+ 0T 0T p 505-h0T  R\  @ p@ "mi i i 0-P@P0L HR 0t00t0wr 1S 0hmH -0 5P=5U@(LPP,P70PT`PpPLP@`PpP8P{8r@b{LrTb|P 0xzP002: *r4 $r{P ,bzP0,2$ xr dr{P (LzP(R ,q  qHHH H@H`H -@LPp<1`(!1R 1SP1P0Q1PU 10 1"0%0 0 o7P $P -!L000p0 @`P0S$  0R000Sp0p00ph0|0h0 |000000000 0@@0 (WO$WOM -LM 0S4 0 0~P 00E -LMP`p@Hq tDq kP@LH#?@#0S,#@$$3/@3S4 Km{P@400400 }4 2>z080@0<0 `Ts80sl <0si @0sf Q0`K$.0P@NY (p ׆ tPF2tp!51 !01o !4018  <0 !1p4v  0@[$ R "0-v"VvDLtY PS0 2 nw p 02p4azP  0S 0S 0@Tz0S@0S80S0S<l npx THGH j [H0S D0SP5P@@05%+%LxR p4Rl05R>n@$  /,H.@BIH p-LMBPT pLD <` 00@  T ph.'Q Q -LM2`Sp`t5 X  <5  o$  DRU@ P  0S-W P  0@pU@P5<5 Y   H@ o 5 &* p-LM2`SP4"8 "4D0 uP&4<H0 uPO̠D0x  `rwv20CS2p} (n` pBhHH -RLM`pP P$ ; 0 0 P7@%ePP 0 !!$ !0``1` `U! @ e$$ R 1 0+10 ,`(`gDeHfAD` Q0- L@P Q 0X0S\@4H 0-LM?0@/PK0 K0K0@K@K@K@K@KK0KhP@0ʖQ: 1ʖQ- KQ 0     008#(< S SwP0 LP0 S  S08#(00KQ Q Q ʖ Q K Q Q $0Q   -LM\0@S@0s D0S V0pP `K0 &:V0PEUU V0P fL-LH4@DD0d @cP @ [IܷHBH 0-\PLU@ 0D0S ePDdPHfDPl [l [ܶHH -LM\0@SHR RRl [DheS R 0XV0 0R0R00R0 S00S0S0 0S0S0<<S0h HRR00QS00 -LM 0S4  0 0hP 00E -L4MpP n@PJ[ DF[n0<@00pLM L P oP@y0dPr 4 teP@f4d0`80 T*<0s! P0s L0s 004@DT0 h1 @ (0 4 8 0p ,@ $P a04@b P L 0pT P0s L0s 0P4@0̠ @ (0 4 D < 8 ,@ 0P $` _ 0A84bP 0 S00SL 0@T00SP   $XHGHHиHJA$AHH 0-8 @0RL>0P0 l_0B0P80 Q0- L@P Q 080S>@oC -L M> \AD0KA000K00K@KKKKKK5dP00 -L M> \ADK 0A00K@KKKKKKKd -RLMp R `S`l@0FGTA0$K $0K#K!KPK"`K pK@K@KcR  }S``l -LMP( R` Qʀ1R IʖR KR A0 ,0K+ Kpl,K0@DĠ0 Ft )K*@K(`K'pK&0K%0KcP)  PP   P P, R\ R\@0EA0  ,0K+K)K(`K'pK*PK&@K%@KcP R\  R[R K R R K R R 0R 0R RS<00R=00 -LMR@0pAdNTA0$K $0K#K!PK`K"K pK@K@K]c -LM 0S4 0 0:dP 008E -L4MTK@`4h000+jP@kW gW3j0 kP`4 0aP  DSW0>04@ a P L 0pT P0s L0s 0P4@0̠ @ (0 4 D < 8 ,@ 0P $` ] 0@84`P 0 S00SL 0@T00SP   $WHGHHиHLJA$AHH 0-8 @0RL>0P0 ]0A0P80 Q0- L@P Q 080S>@A R \\b 0-@( LK RP BKR :KR R 0 M(k F(k$"(> : ;@@   @@, R@  R@  R@ #("(0@0R R R ʖ R K R R 0R-S<00R=00 -LM@0"p`!T@0$K $0K#K!KPK"`K pK@K@KbP -LM 0S4 0 0bP 00PE -L@Mp` VjPPs\ Ki`PPgh@V Vh0 b\0@_\`140p0 T` ,0 X@ D 8 H @ 8 UP0\_P 0 S00SP 0@T00ST  X  U0@0f 8 f (HGHPEJHA$A0HPHTH|H p-QL M@P !0Q 0K" 00 K33< #4K0K K K K K `K0 GaP PUp p-QL M@P !0Q 0K" 00 K33< #4K0K K K K K `K0 aP PUp p-!0LQ M 0K00Q# 0K0 K`@K0K0K0K0K PK0 `P @TpR R "U~RXH Q0- L@P Q 080S@@? 0-8 @0RL@0P0 [0!?0P80 -LM 0S4N 0 0aP 00E -LM` Pgp@T Tg0N va080 0h P@ PH mT04 ^P@4P?U00TQ10@QXZ00@0 X  mT[4T^P 0 S 00SZX@0T00S 4 0mdT!^PHGHE0x0f    Hf z <0+S`d L ! T0S4XT0 [P0Y]PD 0T]P\ 03 0X TT+0@ 4<0[P@  00JH$H - D0"L !$!(x0 SJLH 0-@DLP-\P&80P<PTPHP `Px00x00f0`0f0H0]T\TP]<[[P`l ZPdX T10L1L!000@K80 7hpqct!00 :0p XQ~, 0 S00SP %0[@T}00S8   00S@  L HGH 0 S200S1+ $0@T!00P P P 0  p0 9V00S0 00Sp0   XZO < ( -L@M`83? Q@ (3\ 3Q d3QA  ] C0?p0P% W@-00 00 Rhe^2  mŸ ` p,V 6l2P@ @    Bb%-(L 0""K0 2K"K 1 R 10S SK,`K1 R\1Q 1Q0S2K?,`K2K "Kd!P0p2`TKPK&]V?G K5K`b]PpPW 0"K0C "K SCCCC CCCCCC$C0,`K2KT0000000S:T0,`K@KBKd T 'C'DH(T > < -t0tPL @`T0 0 q @ S40P 0(00C ` 0@ d ''' p-QLMd@ P L0L 0 S `a`p0` \d ''' p-LM\@`P+  \$ \ 0 \0 P 0S|0 \p0 d 0 S app=P 0Pd '''' p-LM 0@0 0`SP Pt0)PZn[ L^J`g[ 4c[ ( C h CHHhHHQ Q Q Q0 ' -LM`0p 0 0S"R; RR0 R. R 1QA 0%͠  @fS000zR00CS0Y,A$!000T00CS0Y Z0 I 0K S R0 Q# Q 9CS񟗹 C C C$ C C C0 C< C<K@I8   h CHHH 0-l0@LQR RR R@P 0 40  S00CS00hhY - 80,?0 Q B$0  ('' 0-@]L\ # 0S 0  00 S:0 S B<0   0h(>_ 000'-0 ,B$= (' 0-0@P00LqN000' p-LMP@rT` 0 S0  Qphbn0  y('' -@LPRmpP^L00hG0 tC p-LM p0@P8`0SH  0000Sph$A(0 d 'I 0-(P@L00h/d I 0-L0 L@8P 0000S0h(d ' 0-L0 L@8P 0000S0hݦ'd ' -LMP0*0K"Kp0 0 )0Kd0@) K&0K4 >07!0K$K#@K(@K'@K%@K, 0S  ,pMn DH -LMh:@SP `Ktp >W0 S K U0 0KP  [PPs -"L|M0PK ,0 \ϊ  0 P@0 2 ,0S ,+阐Kl V`2 Qh00KP2 K@K@K 0@ K K0K@K[00K!*0 0K0+ KKK0KK@K7S@K S000K> m Kp`P4@'p[W @P`y'K[y>d@ 0.K K0K-@K/@K l vP@  P@ HP@P  0PP@}  0P@s|  0P@i  0PP@`  50Pw@XpMXFTHn * + -L[36 00& K*0Kl0/00 )K(0K0'K%0K0SU K $0 S ,$*PU0[SpMhH -LM@K0 PP[ -L M@03 @ -L M,Ÿ(R`ph  0 4 2 PPR0K4 KᚈP@ 0 D0 00S RW TR5  dW 0R0W00S0,@K 0 @PBP@ 0A @@@6P@ 0   WD K4 8 RP1[#Ƞ,Ƞ#8! P@p40U0ep40 0YR,K 0TP@  JtHHl H -LM\`XAhʖp $ 2 \@R K$ KP;$ ^P  ^@1K#Ƞ,Ƞ.0@ PPPPp $00dS$0   Ƞ@,Ƞ|0@ @@PX0 ] y W 0  DJtHl H p-LM`0h*0P0 R!t$Ct$Ct$C$C$Ct$Ct$C03 _|Kw0NK~ S 0 S \)pY@0@K3 (P@[0S~ pM ̾H @- @PL 0\0  1P 0S TJ -LM@y4P 5A0AS b 0-0L @R0P 0p00S S 0<0h0S Z0S¡@90h黡 -QL`@pP 7 Q  ig CYD0 `pG gQS0   cG -L MP!00`Up@(C $CU KWPdS. ]MPJ0@@AH9 0S 5 1P!K! [RR B0Q0  9R 0 h:S "K 0-P t0Qp 0n 0S0h:0BHGHX0) is@S0@ |*@S0 @000:00S8)y wrHh\FT n r Jd0PID5C9C;C&C%C%C%Cz  0-l00@ PRL 'D P @9S (F0KKQ Q  0S00 R-L`pP P$ ; 0 0 P@9PP 0 !!$ !0``1` `U @l8$$ R 1 0+10 ,`(`PV0L@0~  JP@74 cJ0S70  7P6 0- ^!L p@`Vp X yJP0 `6JP10A7T . p-PLMU`@P0S 0`S 0SPU@peJ`̇ ` -LKMt`@h2, PX0p ,0S @,&5A0AS R RR MU @A   @BJYI@ J>K J01S >8 < 6 /C,HH -PL@`p10&S^9C:C:C:C<:C:C:C:C:C:C:C:C:C:C:C:C:C:C:C:C:C:C:C:C:C:C:C:C:C:C:C:C:C:C:C:C:C;C;C505Y0 R ՜ 0%@  Q @Q @ A5L98L9 L9  @H 4P5A0AS  -L M5 A0AS@%P 0 Rㅜt00t0`d P 0~ `VPZ1Sp]T $KGT $  -LM@PY5`=5e@9S~D9S   i 9  e=070 71 6GMS &GS N>Y0ڐ1!51 0!10  (p+SL1!1D1(188! X0b@0!:; 1 1!1* :oC  FP 0 S00S)0Ye00S)   oK rD0!#R00<1  S0C⠐81  @p2PP `$ 1 01 U  @ 10$0$ R 1 0+10 (,PP}   P@?P@ 90/. 0b98,0 S 4,@@ <7KKl  .4 0 <ǚl0$ .4 00 \  V 0-0 @L$8P0 $  0$0h   0-0 @L$8P0 $  0$0h 0-8L@0P 5 ( "(  0hDP|hChChChChChChChChChChChChChChChChC840,($ HHHHHHtGH p-LMPK 0@#![>  01[8#Y#h #͠##: 0P`/ʄ|:Zj0.  0)- <0p -L`@0@⼘cTdTDP@p  @~TP z2FH p-LM`PV@ V@@|0 L\R@ ZT@  8 , @ ph  0-L@PUT T 00CS 0h) -LMPc0@1 @T@0>S @;cTdT  "bP<@7l0<'~OlV.0 NH p@ 0G}@pm !0@T`p:P S 1 > 0 ~9PU1 >0 t9PEPX8CP@1. 4A\ 0 @:\ :P Q 5QN n   =5;5%@ %7 S  o1  uB `e1oB LD]1F"VSH  @@ lPɅTI 0 ph6 H2 4 I -LM 0S4* 0 00=P 00F -L M@K K\#t\0D D c0  P 7U0\HhHH -LM0P8Cp@pC0 d?0 C fDP08 m10 ,v:P  `9 ) )0@V9s 9s3#@09@ 4YK0 @)<9 B댣`V@' TT  P3x @~> 0(/ 3Q#0 0'#70 7&0SSN  E E`&Nb`N>V0@ڌ2"52 0|"|20  (PE9 CH2!1@2(144"\+  X0@0";H; 2  2"1* ;mL6 pE"`O`=.V0@$`O `=@V0@d`O`=V0@ڕ`KN`=V0@zj- 9P 0 S00S )0`V00S)  m'/HGHHиHHh|C8 P|CC HpMdrC2I0PI@PI0CC@CxCC}C|C}. H  PIHXH p-LMP0@M`, 23o l9S P9S ;/ 5p8 78 7809 p-0LMP99`@hY7P`l  7Pp @ 7@Vp. pꄿHH p-LM@`Pl PPUti@Zp7li -Lp `Xy7P\ Z w70SS ό@L% R@d) 101d)d9d$00d)01d9d) 尌d9S. PdI%$ᣌd)$0S 0d)1 01d;00d)(d,d9<0d)8 d)1 0Z`9`80.  MMMȿHHH4H -@\ `PLPpd9StdyS7\i -LM@4P 5A0AS 8 00 'R p-LM 0P@ 7Q|C|C}C}C$}CS $)p$ <7lQ00a <7lE<7lA' xj-V t00t0 k7겋 @ `) B)p00p0 j5;5i靋H -L`IML0R,0 4 0p RR ,0 S ,R ˠB04  @|645 '7>K 601'S0@081 a8@tO$PP d$ 1 01018 HU E8@ 3$0$0<$ R 1 0+10 80S  S . T0 -LM0HP,@p ,`P XP(8`` :SR :S 0 P`1  `  h  :S  :S K V X # a b0 0   * -LMp0$2P00P^~1 1 BR@ P`  0@ Sa1 0\E,0BBPCJR0CT9 Q  [@A   X0a 0 %     0 %    0 % /nD 00CS FY  ^o? FFL  0-0@7LSPH HD<7'42R 887 0hh0d0 0-(7L$P@ @0 0h$0 0- 0L@4 8,$P 04(0h00 0- 0L@4 8,$P 04(0h0 0 0-L@0P{5 & &0h@PꈞCCCxC HtGHHH 0-LMPK 0@1[>/0) 0$1[$!8#ɠ###  =0ʄ  "01[8#*#;0 :* 0[\[ ʄ0[\[ ʄ^0[)-\ H0  F 5. & 00  -L`@c 00R00S@cTdT|P@p  @-TP^P@QQ@TPZ  $pFH -LM`R0@1 @T  @0 @ŊTTd Pp@7<'l09E. 0@~O0 f: -P X 1 > 0 ,PpZ1 >0 ,PpJPpT=Pp<6. ˠ\ 0p -\ ,Pp"(7("(S( S5'& &D5;5%@ %7 S  h $5 D$ 5 0F000HH  P` 0 @ $r70@0(L2LD p-LMH@PT0`Q4& U 000SHPp@T 0 R @Tp000SH@ pPp p-LM0PR `@$0 $R Z RR 9R3 4P 00 K`V 8m@8Ÿ<8N0 @@4<Vp0$  ^``00 @8Č0`` `@<u1R 1RH 0\$  e 04 < Z(1R0  R 1R KL   R # 00S0##400R R   R  00S0C4H\0`H 0\$q  j0C pH nJpJlJ P-0L 0  (G2M\ F -PUp`L e P@ U 1R@PC60SPP) -LMP4@ pKT` 1 0 P * P4 g 0<.FHH P0-PL@ 0P LL H040S 80S0e00hK6 <.FHH -LMpP@Use 7P`@ v1<08S 00@s s0l0PLMP@P \00l m0n@o@P80X q@r@pPP@'\0<0X0<@0P Sd8e 8N0@@<P@ <N@L8e{ 1` GP@^ 00C<.FHH -L MP `0 Ƞ(,@0 , @P`p0Z ,)( < 0R)< 0 Q0  "< 00S RP K R D -LhMؠ0@(0 PPK` (0xK(0 4@4@ @e `Pp0T  @@Q (0 S (pMHHPe Q-L@`' 0S$ 0S! }4PP#p wP 0e0  0 S 000 0S 00 Q 0S3 : AQ0A Q0A <0<  $0 0 7 M7M 0-LP@T 0P 0T0C?0D RR1*00 RR1:000 - L`ePU e 0* p@T e$ /0`0p/ 00 ?0 0ppppP0Z00P00 -Lp` PU030#\Z0 @pT0 4%4X0P 0p -LM `Vpe @ 1BPU @e ) :@Te% v/ 0@ p`0 `m/ 0 0 0 0``P@000 P@ -L M p0 0W`e , 00 (.PUe & @Te" )/`@$/ 00,0(000  0pP000 Pd -LM 0`Sp(PU! $K 6P`eK @$0T0  'P`e<$00@TPU0 0sP 0AQP0000 p-L M`@P{P 0 KP  0R 0  0$0  $00 p -LM0`P4 ep= P@0 0P 0,p` ( 0  0 00PU0e@0 0-@L%{P0 P(0  00P000h{ -LM@00  0e0C 0h P 0 RP\ P 0 RP\ -LM("HP0 T 00 -LM("HP0 T 00 0-P0L00@T80  (P00 -LM,0@0(00 00; 0-L'M@PL@ K @ ,0 PS 0pM,H- -,0( @00p`LT0P00 P,00 0,0 0(4 -LMx@P`w5p;5utPVt0p000t0p01\Siw`tp 0-Lx@wPa0hw -0LMR@P(0 x`, RRP2S S0P2͠\AHX0  @@vP@* & P2\2P"S0\2(0K@J(0S Sl00l0\w5@ Uw Pl0p0l0 (00 0X( .`h0<0Ph0  )CHTHtH 0-L.w@PU$ 1  !0 !1wU0 w@0$0w$0 S !0 0,($0 ,0S ,pM 8$0P 8#l0 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 0 00000$8P0 4% 8P0 $4P0@8$ 4@ 000 006 0060@006  0060P08$ 4@00000000006 0-@L8P0$ 48P0P $4$0 S8P0 80 -LP H F p-LM@P`  t&(0lH0 L8 P`0T0 $8P4 00 X0pphH FH< F 0-(0PL@ 7 0ES CC\CC H0"S 00 H0"Sp H0"S 8P0 $408$;P 80% `0 -LMPp@ 0`,@00 8P0$4 P8P0$4P08 $ P4,0 0,0P0@8$4 00 0,   00300 0 0000000000000000066 -LP  F p-LM@P`  t`(0lH0 L8 P`0T0 $8P4 00 X0pph7 FHx F 0-(0PL@ 7 0ES CCtC,C H0"S 00 H0"SPp H0"S 8P0 $408$;P 80% Q0 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 0 000008P0 $48@P0$ 4@@@DTCCCCCCCCCCCCCCCCCCCCC00600060000006006 -LM@8$P 08 -L"P  F p-LM@P`  tg (0lH0 L8 P`0T0 $8P4 00 X0pph> FH F 0-(0PL@ 7 0ES CCXCD H0"S 00 H0"SWp H0"S 8P0 $408$;P 80% X0 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 0 000008$P0 4  00000000000000066 -LXP  F p-LM@P`I  t (0lH0 L8 P`0T0 $8P4 00 X0ppht FH F 0-(0PL@ 7 0ES DDD8D H0"S 0 0 H0"Sp H0"S 8P0 $408$;P 80% 0 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 0 00000P08$ 4000  00000000000066 -LP  F p-LMPL`@  0 (0H0 28L0 0P@?>C2<0 S T Q P0$8 40 X>8 $P04<+Q0  T0` `  Q' (Q$ P$80 88P0$ 4 p P$80 88P0$ 4*98$P 8p, Q$8P0 4\   $4P@8$0 88P0 $4 -0$8 P8$08P 8L0 FH F 0-@L8P0 $408$9P 8P_q$8P0 4 P }U0 p-LM(0@`PH 0BS D<DDD H0"S pp H0"S3p H0"S 8P0 $408$;P 80% 40 8P0$ 408$9P 8lp p-LMP`0 P0 ,08P0 $4P0@8$ 4 ,00,0 00300 00000pT000 0 000 00000000 00600000S p8P0 $4P0@8$ 4@ 00<00<0006 -LM 0T@P  @%#,00R0S ? `HZ p-LM@P`R (0H0 L8 P@00T0( `R phA  $8P4 00 X0pph!dH FH 0-(0L@P0  H0"S0ES D D D$ D0%0X:p00zH -LM@a8$P 1<8 0- 0@ L|PP  0?.C5BBT@ 00S$ P F$H H p-LM@P`b0S   ( |H 0LP`8000T0 $8P4 00 X0pph FH FH -(0L@pPA H0 S?0BSDLDDD0% ` V j80P$ 8 0$8P 88$P0 4  5$H -$0Pp @0 `0 ,@L8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 0 000008P0 $48@P0$ 4@  0060 006 0060@006  0060 P x P8$P0X 4000000060008$P0 4 H$H -LYP 4F p-LM PL5 3S@`* L5 3S? =  (0H0 P`8 0L T0 $8P4 00 X0pphi\,0L0? 0L0 4FH(FF 0-(0PL@ 7 0ES D4DDD H0"S 00 H0"Sup H0"S 8P0 $408$;P 80% v0 -LMP` 0P00,P08 $@4 ,0 0,0P0p8$4 00 0,  00300 0008P0 $48@P0$ 4@ 000 00000000 000066 -LM@=8P0$ 408$0P 8 -LeP dF p-LM@P`V  t(0lH0 L8 P`0T0 $8P4 00 X0pphdFHXF 0-(0PL@ 7 0ES DDLDD H0"S 00 H0"Sp H0"S 8P0 $408$;P 80% 0 -LP F p-LM@P`  t.(0lH0 L8 P`0T0 $8P4 00 X0pphFH|F 0-(0PL@ 7 0ES pDD<DD H0"S 00 H0"Sp H0"S 8P0 $408$;P 80% h0 -PP0 @0 ,0L8 P0$p4P08 $4,0 0,0P0`8$4 00 0,   00300 0 00000 00000000 000066 -LM@$8P 088$P 1<8 -LP F p-LM@P`  t](0lH0 L8 P`0T0 $8P4 00 X0pph4FHF 0-(0PL@ 7 0ES DDD8D H0"S 00 H0"SMp H0"S 8P0 $408$;P 80% N0 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 0 00000P08$ 400000000@000066 -LTP F p-LM@P`E  x(0pH0 L8 P`00T0 $8P4 00 X0pphoFHF 0-(0PL@ 7 0ES DDDLD H0"S 00 H0"Sp H0"S 8P0 $408$;P 80% 0 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 0 00000P08$ 4 00000000 000066 p-LM 0`0@P 0?.AB"(0H0 L8 PP00T0P0 $840  X X0 \0  ph,ph$8P04\PHHFH 0-(0PL@ 7 0ES "D0"D!D"D H0"S 0/30 H0"Sp H0"S 8P0 $408$;P 80% 0 -LP 0F p-LM@P`  J 0?>C2<0( H 0L80P` 0d0T  $8P4 00 X0pph0FH$F 0-(0PL@ 7 0ES $D8$D#D$D H0"S 00 H0"S4p H0"S 8P0 $408$;P 80% 5~0 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 0 00000P08$ 400000000000066 -LM@<0 S 8P0$485P$8#8 88P0 $486P$8#8 88P0 $487P$8#8 88P0 $4 0 08$P 8 -LP F p-LM@P`  x8(0pH0 L8 P`00T0 $8P4 00 X0pphFHF 0-0BPL@ S <(D\(D (D(D H0"S 0 H0"S+p H0"S 8P0 $408$;P 80% ,u -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 000C 00000$8P0 4' 8P0 $4P0@8$ 4@ 0060  @006  006000600068$P0 4     -LP F p-LMP@`  K(0H0 L8 P`0 T0d 8P0 $4T   0XX0 pphH'H' 0FHF 0-0BPL@ S D,Dd,D,D,D H0"S 0 H0"S)p H0"S 8P0 $408$;P 80% *s -LMPp@ 0`,@00 8P0$4 P8P0$4$08PP 4,0 0,0P0@8$4 00 0,   00300 0 00000 00000000 000066 -L0P 8F p-LMP`@!  u(0H0 L8 P@0 T0d P0 $840  XP0 8$4 0X ; X @0X : X X0 \0  ph2p$8P04\8FH,F 0-(0PL@ 7 0ES /D/D/D`0D H0"S 00 H0"SCp H0"S 8P0 $408$;P 80% D0 -LMPp@ 0`,@00 8P0$4 P8P0$4P08 $ P4,0@0,0$8P0 4  00300 0 000000S S000 00 0, 00000066S00 000P08$4 00<000 - LN5 Ó0 ?0 0 P 00H p-LM`@Pq0 R %( H 0L80PP0 0d T0( Rp phW $8P4 00 X0pph7C|HJHhF\FH -1`LQPp@V(0Q 0GS 3D4D3D4D H0"S H0,S 5 `8 P0$48@P0$ 4@@ `0d 0S`0L0`@p H0"S0% .v J7xFH -LMT0P`SPJ 000,8(!P0$4P0@8$!4p,00,00S ,0 00 P0$8 4 0008P0 $4P0@8$ 4@ 000 00000000000066 wJ7FHHFH -0LPH -LM0@400>@ 0@0 S hvHGT>D 0-LM< @0RH0P0hH 0  XHQ  QH -QLMp GQx tXP`#$<$DT XD`P GHHH0L p@@ T1@@1L0T` 0 SB @TY4K 0K 4K 04p `P@  [P @ 0`0@0 Z@@T @`0SP U@( R0000 0 з0S00|7DAq  0A0"q F0 P 0S0SF@-^P@0`p0OP ^Q F -04P00pL  0p0@X h#$<4$DP`<p`Nh8HHG -LQ Q F -0p00040`L0D 00

dZAY6H 0S4 h3jHHHHCDHHG 0-j_L@᳹<]ҹ0 -LM<0jp ,0 垹00P400D80 P00.0PPt00#0 0PPf00008K %8K00[Pj 0PPN0m0N000P>0]00PP30R000PP%0D0008K 8K00[P 0PP 0,0N0000 - ,0S ,.4[50[S4"c112O7[6 [4P[50[2[3[Œ4l`c1aDP1P2oO/Bχ`spM H0G mF -LM0P0040@` 0Lp0 0S<, iZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0  0-LBP|@ 0S L| 0SPeT 0S \00LS `00000S  0SbQ1QR0@-P@ 0bàR? B0QQ000-P@P@0Q0-P@P%@ 0Q1Q3:P: R0P0QcP  R0-P@P@0! !Q@-: R (2 R R -PPPP RrPP B PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R- RP1P P1P RrP1P  B P1P B  R010 1  B R0q0`0q0`0q0`\0q0`0q0`0q0` R 0\6 R B0-81, Ġ%̌T$\D#L0P  R0 Ġ01#̌  R R B0-81, Ƞ%ȌX$XH#H0P  R0 Ƞ01#Ȍ  R R B0-81, ̠%Č\$TL#D0P  R0 ̠01#Č  R@-@08#8S  0   ,F` `! R0-P@ 0bR03 B00J``0 B`3`1`1c11c!0"b2c3c0acP@J_ NR- R 0S0 \R000Sa@\0S S0S0S  S 0S R  0R P0Qc\R0@-P@0 A@P `R00\00Sa@ 0zR @R00Q00S ZR 0 PP ^0b0Q p-LM@ `PqF ! 0 !8< !gFp p-LM` P@]F ! 08< 1UFp p-L M$@1P 0 1 `K0P 0 0S  pP1 01 !00 XP -L M@` T00D^\P$:T8 p,KW" 1!,0 $ ( 1.$ 1$00$0 1$00$0 ,0$00$0 (00 (0 PP P00# 0 R0 z 0-LMP@0 (0 (K0 $0   0$K 0 従@P 0 ` -LYM   ᐠ0p0`S0  0S00g\Kc  a?K PP0/SP 0S< 10 S@C/R 0t/S0@ L0 H l D pK0pp ~dP/0P0\0p 10@glP?P  ~P0Pա`j\jpK@@LP H@ l pp D LdPP0KP @ 0 帀 匠 AdPP0` GK 0hPP0 K 0_PP!l1R!h1RPj`j a?K av@-@\  0S0  0ST 0Aq00 -L@dMPL, Tp` l,T` # T 4T 3 ,0S ,,0903Th0S003T 3T3@ R xGp3T00  00  00  ,zp@P0000  gp|P P402Tg2T9*2T- :20SPKT2T H2T D4 0 8#88t0 2T08080 S  K XK PU1!4P 4 PU10P !0  0E0KC K]0 t  !@1T( (1T 1T,  0 0  00  00+  0 0 0 0 00 R00 00  00  00 0S@@ {` 0 -LM`pDy딀KP@  0 ,00,0,0( 0CPK,,0U 0 0S DP I ` PȾ -LM䀟0p$0 `P@ $0 S $@PK @P@`PF 08KE/K P@PK T~@bTNK` pMH00S0 I 0M 0-LM@P@ K0K  0@,0 -L$M0pSPl V > V) V - @<K@0K< 8 4@ @`P@00Q@K I V <K@0K@ < @ ` @NP<K@0K< 4 0P ,` 8@ @# VY  V <K@0K< S! VA e Vtt \\PhP@P  h0L 0` f0($0`@f0 0`Q0@0  @@ T@ @0 P\T\ D\ <K@0K@ @ <K@0K< @ <K@0K@{@K :PhG\ZOZO$F,F|I -LM@ΣP 0 M p-LMP`ὣ PK0 p .@`@=FFFFF0FHF`FxFF F F F F FFFFFFFFFFFFF<F<F<F<FFF F!PF"PF#PF$PF%hF&hF'hF0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-| @| @  pf_purge_expired_fragmentspf_flush_fragmentspf_reassemblepf_fragcachepf_normalize_ippf_normalize_tcp_stateful 88888 9 7 6 97 5 9 423 9 2 9 1 0 9 9 \/|\/O|/-||[Fs[F [F@@ "&*.26:>ACEGIKMOQSUWY[]_abcdefghijklmnoppqDqrDrsDstDtuDuvDvwDwxDxxy$ydyyz$zdzz{${d{{|$|d||||}}4}T}t}}}}~~4~T~t~~~~~~~~ ,<L\l|||||||||||||||||||||||||||||||||<<<<<<<<\܆\܅\܄\܃lL, ̂lL, ́tdTD4$ԀĀxph`XPH@80(   !"#$%&'()*+,-./02468:<>AEIMS[gjkhinolmbc`afgdeu@ut@tw@wv@vq@qp@ps@sr@r*."&:>26 UWQS]_Y[EGACMOIK~~~~~~~~~(~8~~~h~x~H~X(8hxHXzzz z`{{{ {`xxx x`yyy y`}P}p}}0}}}}|P|p||0||||@@@@@@@@XHxh8(؁ȁ聘XHxh8(؀Ȁ耘` ` ` ` Ђ0pPЃ0pP****++++(((())))....////,,,,----""""#### !!!!&&&&''''$$$$%%%%::;;8899>>??<<==2233001166774455   jnbfzrJZ镗systracef_ioctlsystrace_answersystrace_policysystrace_getcwdsystrace_iosystrace_detachsystrace_newpolicysystrace_msg_childsystrace_msg_policyfree n;AvXaM ְdx \&P&X&&@&H&&T&&&h%Hr(&l/&d/&7&8&D9&L9&9&9&<&<&.&<&<&Copyright (c) 1982, 1986, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. Copyright (c) 1995-2007 OpenBSD. All rights reserved. http://www.OpenBSD.org ?? $wFGGwFwFwFwFmtx_entermtx_leave@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@netconnetclsnetionetlckP***\*Hr(*Pr(Hr(Hr(Hr(Pr(Hr(Hr(!#$%&'()-0123456789@ABCDEFGHIJKLMNOPQRSTUVWXYZ^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{}~Ͼ󨷵ǎԐѥ噞᷵ǎԐѥ???????????????????????????????? !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~U9+pE+xE+$F+Hr(lF+G+Hr(|H+H+*Hr(H+d n;0&AvQkkXaMq//^SShѹ,` @ȱy[[jjFˍپgK99rJJLLXXJυkл*媪OCCMMU33fEEPPD<KKܽa ppB>>|ĵqffHHaa_55jWWйiX':'8볘+3"iip٩3-"< I·UUx((PzߥY  ڿe1BBhhAA)w--Z˰{TTֻm:,ccƥ||ww{{ kkֽooޱőT00`PggΩ++V}׵bMvvʏEɉ@}}YYGG AԳg_Eꜜ#Srr[u=&&Lj66lZ??~ÃO44h\Q4qqثs11bS*? ǕR##FeÝ^0(7 / $6=&''Niuu ,,Xt4.6-nnܲZZ[RR;;vMַa}))R{>//^qSSѹh, @`y[[jjԾˍFg99rKJJLLXXυJлk*OCCMM33fUEEPP<!KKݽa܋ pp>>|Bqff̪HHaa£55j_WWiІX:''8+"3iiһ٩p3-<" ·IUU((PxߥzY e1BBhhиAAÙ)--Zw{TTm,:cƥc||ww{{ kֽkoޱoőT0`P0gΩg+V}+׵b׫MvvʏEʂɉ@}}YYGG AԳgԢ_Eꯜ#Srr[u·=&Lj&6lZ6?~A?̃O4h\4Q4qqثs1bS1*? ǕR#Fe#Ý^0(7 / $6=&'Ni'Ͳuu  ,Xt,4.6-nܲnZZ[RR;vM;ַaֳ}γ)R{)>/^q/SSѹh, @` yȱ[[jԾjˍF˾gپ9rK9JJLLXXυJлk*OCCMM3fU3EEPP!KKaܽ pp>|B>qĵf̪fHHa£a5j_5WWiйX:''8+"3iһi٩pَ3-<" ·IUU(Px(ߥzߌY  eڿ1BBhиhAA)-Zw-{˰TTmֻ,:ƥcc||ww{{ ֽkkޱooT`P00ΩggV}++bM櫫vvE@}}YYGG A쭭g_E꯯#Srr[u·=Lj&&lZ66~A??Oh\44Q4qqsbS11*? RFe##^0(7 / $6=&Ni''Ͳuu Xt,,4.6-ܲnnZZ[RRvM;;a}γR{))>^q//SSh,@` yȱ[[ԾjjFgپrK99JJLLXXJϻk*O媪CCMMfU33EEPPxD<<%K㨨QQ]@@?!pH88c߼wuBc!! 0mҁL &5/__5DD.9WU~~zG==Ȭdd]]2+ss``OODf""T~**; FF)kӸ(<y޼^^ v;dV22tN:: II Hl$$\\]½nCשּׁĦbb917yy2CnY77ڷmmd՜NNI੩شllVV%ʯeezzG鮮oպxxJo%%\r..8$WsǴQ#|tt>!KKaܽ pp|B>>qĵ̪ffHH£aaj_55WWiйX:''8+"3һiip3-<" IΪUUPx((zY  eڿ1BBиhhAA)Zw--{˰TTmֻ,:cccc||||wwww{{{{kkkkoooo0000gggg++++׫vvvvʂ}}}}YYYYGGGG𭭭Ԣrrrr&&&&6666????4444qqqq1111####''''uuuu ,,,,nnnnZZZZRRRR;;;;ֳ))))////SSSS [[[[jjjj˾9999JJJJLLLLXXXX着CCCCMMMM3333EEEEPPPP<<<>>>ffffHHHHaaaa5555WWWWiiiiَUUUU((((ߌ BBBBhhhhAAAA----TTTTPQSeA~ä^':k;EXKU0 mvv̈%LO*ŀD5&bIZg%E]u/LFk_zmYR-!tX)iIDɎjuxyk>Xq'Of ɴ:}Jc1`3QESbwdk+XhHpElޔ{R#sKrW*Uf(µ/{ņ7(0#j\+ϊyiNeվb4ъĝS.4U2u9 `@q^Qn!>=ݖ>FMT]qoP`$C@wgB谈8[yG |B| H+2pNrZlV8ծ='9-6d !\hT[:.6$g WҖO aiKwZ *C"< Nj򹨶-ȩWLuݙ`&r\;fD4~[v)C#hc1cB@" Ƅ}$J=2m)K/0R wl+pH"dGČ?,}V3"NI8ʌ6 Ԙρ(z&ڤ?:, xP_jbF~Tؐ^9.Â]|i-o%;ȧ}nc{; x&Yn쨚Oen~ϼ!ٛ6oJ |)11#?*0f57NtʂАا3JAP/MvMCTMўjL,QeF^]5st.A ZgRے3VGmaךz 7Y<'5ah,4$8_@r %⼋I<(A q9޳ ؐVda{p2t\lHBWЧQPeA~S^':k;EXK0 Umvv̈L%O*D5&bZI%gE]u/LFk_眒zmYRڃ-!tXiI)ɎDujyx>Xkq'Oᾶ f:}Jc13Q`SbEwdk+hHpXElޔ{Rs#KrWUf*(µ/{ņ7ӥ(0#j\ϊ+yiNe;b4ĊS.4U2u 9`@q^nQ!>ݖ=>ݮMFT]qoP`$֗C@̞gwB谽[8y |GB| +2HprZlN8Vծ=9-6' d\h!T[.6$:g WґO aKwZi *"4$8,@_r% I<( A9q ؜Vd{a2p\lHtWBQPA~Seä':^;kEXK0 Uvm̈v%LO*5&DbIZ%gE]/uLFk_mzRY-tX!I)iɎDujxyXk>'qᾶO f}:cJ1Q`3SbEdwk+HpXhEޔl{Rs#KrWUf*(/ņ{7ӥ(0#j\ϊ+yiNeվ4bĊ.4SU2u 9`@q^nQ!>ݖ=>ݮMFTq]oP`$֗@Cgw谽B8[y|G B| +2HpZlNrV8=-6'9 d\h![T6$:. gWҖOa wZiK *"$8,4_@r %<(I A9q ޳؜Vd{a2plHt\BWQP~SeAä:^';kEXK U0mvv%LO*&D5bIZ%gE]u/LFk_zmYR-X!tI)iDujxyk>X'qOf }:cJ1`3QbESwdk+pXhHElR{#srKWf*U(/µ{ӥ70(#j\+ϧyNieվb4Ċ4S.U2ኤu 9@`^qQn>!=ݮ>MF摵Tq]o`P$֗齉C@gwٰB8[yȡG ||B 2H+plNrZV8=ծ6'9- dh!\T[$:.6 g WҖOa ZiKw *h8,4$_@r %(I>>>KKKKyyyy xxxxZZZZݨ33331111YYYY''''____````QQQQJJJJ ----zzzzɜ;;;;MMMM****뻻<<<m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxqg jgrn<:ORQhك["(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDl؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHGɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~[ 1Ѭߘr/Ḗ~&jE|,G$l iciNWqX~=t XrX͋qJT{YZ90`*#`(yA8۸y:`l>w'K1/x`\`U%U攫UbHW@cj9U*4\̴ATr|*oc]ũ+1t>\3֯\$lS2zw(H;Kkē!(f a!`|H2]]]u#&܈e>#Ŭom9BD . Ji^Bh!la gӫҠQjh/T(3Ql n;zP;*~ev9>YfCoEå}^;uos D@jVbNw?6r=B$7H ۛIrS{y%P;LylO`@ž\^c$johSl>9oR;Qm,0DE ^J3(fK.WtE9_ ӹyU 2`yr,@%g̣饎"2u<kaP/R=2`#H{1S>W\o.ViB~(2gsUO'[iXʻ]=!lJ[-ySeEIҐK3~ˤAb Lw6~д+MەqՓkю%ǯ/[{AI~-%^q h"W6d$ cUYCxSZ٢[} Źv&ϕbhAJsN-GJ{RQ)S?Wƛv`+t恵oWk *!ec.4dV]-SGjnpzKD). u#&İn}ߧI`fqilRdVឱ¥6)L u@Y>:䚘T?eB[k?ҡ08-M]% L&pc^?kh >\D}W7: P tAu8/;21>8TNmO Bo ,y|$ryVw.?rU$qk.P̈́GXzt}K:zfC cdG27;C$CMQe*P:qUN1w_V5kǣ;< $Y,n<pEㆱo ^*>Zw=Ne)։>%fRxL.jxS<- N=+6&9`y#RnfE{7(2åZl!Xeh;/ۭ}*/n[(!pa)uGa0a4c\s9pL ު˼,b`\ndi#PZe2Zh@*<1! T_~}=b7w-_h)5ǡޖXxWcr"ÃF T0.SHُ(1mX4a(s<|J]d]B> EꫪOlOBBǵj;Oe!AyMjGKPb=bF&[$ti GV[ Htb#*BXU >ap?#r3A~_;"lY7|`t˧@n2w΄PU5ai Z .zD4Egɞs͈Uy_g@Cge48>q(= m!>J=+hZ=@&L4)i Av.khq$j 3ԷCaP.9FE$tO!@MpE/f m1'A9UG%ښ ʫ%xP()Sچ, mbhiHפh'?Oz|Ϊ_7әxB*k@5 ٫9N;VmK1f&tn:2C[Ah xN جV@E'H::SU kKмgUXc)3VJ*%1?~^|1)p/'\,(H"m?H܆AyG@n]Q_2Տd5A4x{%`*`lc´2Of#k>3b $;" r(-Exb}doITH}'>AcG t.no:7`L knU{7,gm;e' )̒9 i{f} ϑ^و/$[Qy{;v.97yY̗&-1.Bh;+jLu.x7BjQ满PcKkؽ%=YBD n *Ngd_ڈ鿾dW{x`M``FѰ8Ew63kBqA_^;Z4ٷ,Q+:Ֆ}}>(-}|%rZLZq)GW;()f(.y_xU`uD^mm%adâW<'*:m?!cf&(3uU4V<wQ( gQ̫_QM08bX7 z{>d!Q2Ow~㶨F=)iSHd$m-if! FEdlX [@X̻k~jEY:D 5>ʹrdfGof,ҏ"W##v215VbuZ6ns҈bIPLVq z2E{Sb%ҽ5iq"|˶+v>S@`8G% 8vFšw``u N˅؍芰z~L\HjiԐ\-% ?2aN[wߏWr:j?$.Dsp"8 1).lN!(Ew8fTl 4)P|ɵՄ? Gy@0 /kz%?/?!M@`Iɟ'Կ@uИcnafŽ"o;h(Yy#P_w@CV/|-ҢɡHl4ma/T"2*kT:V"AӢ@f/9/Mҹ-?JDvR7,YQoz Zh{.T"5Y/mKdPIf-徐"3;䎴]4K@E?1.eUʱծ-mԢP @"8On ׿r[O/LVSTIiFXEŅc]ՊSW9j7=T*_}x:vbj Bz)^'rgP8ƌDŽZ*'JkѢ*V`C u\B&Ʉq-ls5&5 M{n0f&%HVV^c ϲc|E pPr(pH# yM;-AB G&LjMG\^ |Y#јr8S#/nqFnEV 9q +A|iCHy}B{BIZݿe\ [ ~iC?9zaz UQry吝5rNcZպ60ę _}֡{/6Y DYD̃Aѱ* ;{ B[A%zzӤ0XޘN?wiy{$[Ĭ%5P_aT1bcKU !h]Yfsc=4·~!+g\ab906;Wd/`:5F- 'zy㠌l0^7%oo;j tE'4:NiOM>dY58EfCr3c%N? (Υ'R¦սTUdpfM w&ۄgC!`X0TroSUGڿ]bVhkʃ;n-Ӧ\= wL3{9+^S_aodC x^c"&gI{ڷ"%-U^7rRyL H[k0 cq/޹ S E!5(T<)c)A|-nRPf4,0P1`sY&D\dwR3A+ٺ|o!PaH?ek«dv&4{^% ;MM1$~I,;jx`]sVz\/1Co0TyXR^/2zj0>՚1B°I #ڸ(0q_`ɣaM/Ǚ."płNؼ40y;'ƸaiH?;(ZC/v7ܱӧßn>ƼB7Q(heRwj-K'5.n\ )^XOX{iT̨g&H`K`8# ~8lI `s5GƱVL>#8d^BFzk Od^AE#\;]>rC|m~ll9`qpsv#E@]%=`GK6DήPQH<p}}d^(O= &g.yr?U+HԼ?^!@WNFRWs3NɷdŸW1O g_?@k{C=K۵cUȗn-J(JqoCCl< _P/~׿PZG.Q>pX.0_|r *,]I鎸P'WIoyR}}Yr@EEt]>uOiVA#. '`vteyvvwHNma}/ 4H<0(Ow Vܒ M"7)}V'|@|硴f^aÝ <є`AFv\;x,WGl"}NC~8<=Q8d{h'فI]j~vh]9K9 ;#Im<Eub'z\aBΒ~Brrp }ȡ[(Ob<51)BSjO[}m(Ki\j#MŌ?,-ҖXRg[HJI \EkӉ7`:SRqDIK @sg4|~q6UO/Т`?mPьGnU?墼38Wg} =3{r3O̫]ňv{{uWBdBc+ri/n+_mazgaq%9̸L!gуb>ܷν8\ =Dmn`I:T`H'W+8$ ږ%Eh;}E `P/(b4 ٠m+1+dZ0RXBA\1>26F3S75 {s{OJWdCQz(~c5_ yCdcdJ$_(͸O@C " 0 O7-{$MgQLq_-_d !S^>'_aB%rqK=;&o~~TLmDl߫I&Ǡ36~?Pa w8Pr.PwWFgOT3ɏ1 i5M\=fȦ[]oڑo/"F}F9mOCCN!и  ?X(>nH&p׋wt|% - y#;(8itb߷@!{7Ȋ@ YVvO@/{U MVi35'#WȯVeka^u˅nwU2?-ɿ[%;з$;mc fÀ(82 Tɪס2Zb,gTzuw11&o6F HjyZVLj~CRv/ t,t* M|k .TA5B=!&|,aRe1i%& !\1cr ^Iy p1 d>>̶Ոî 0rlqn/kءDVÈ9/ű1(x⤣2}o~X$Ū{s0a!-!)۳*)e\,0?Б\,ԩT _w:^VxV޾\!uQųåҶw#)Ei/z毲p[v F98/gsD)k)/Ifingӛ/~p%Q^$Slj>!DYܷ)eyCy9A+MWN )zkS< ~U3rŅ?~  ~tn,fy3jXDD1Zs"*ˁc8:$zi HIĀ@8HުL H_%A@N$A UeQr% 9jyMc@hV 틕Z Vqק)N-fcqw*7 5Wa"ɠBր[t!h!hl iwW~@PճMװx QV$AV ʔUWnྵa$ XK'aU{whkldMDfd~i/IO70j5,s@IvM;B(HDLns) _ɋ}oaOw.+rץ<}+FYYEEهTNoHm| ǥcs_DVj͈prͳ]ny` E`1©\1BN"r\,rN@%/N2g@#x\n܃"ukMxnXO DH?{vw#Vu*F_( +8=6 JRft;QZylu eX&hJpFS(l\v0k)h76*g$ k%ֿh,DUueI40" WIbuU~bڨv^FESGml,gHL|3ەCh\SU2` ߝWc9^28aI37~^b<#NygCHKJf-ۄoH Ja)Yfc(` 0qt&@3/C~A^ l( ؒ0~of˜os*`ژ46K-%#= %IH6Jo8C@TzWOpA:Z„TU|5YŗZ:G:%Sj~=eI&TwQ[P]vlDȨ!帊iX`[ŗY)L;]J5ULkD$5鰽bעT/I18T(q)9H[/u@g+3-fVo*ɛ`( ')dMP˲,\26K_A !PNhذy\CPIMAC8wn\e0Rԋ@+>`xT7}02m-yyS"wuXȃoxkcZ\3]ùzv٣Byqj3ƚ`'PC=+mvN%ύHf6AN( aϩI=߹_d: }+p?PO+Zbbyj.H@,Z@"ғ-ES4n)olIIBr~V>olbfLTq*+9)XLVRf.S9v.i硦>iFt+LVvuOx39]O#2]2=&K/~~<O^?vf)o=E4ӷ+4grN=U"g`k8=ü0}8QcÐӝXyTGָaYwSW-XVcNx.F~eyUڑ0@5㶼P?!@=LXI6QpӱڍyKoqK 0ݻ맕d5w$,ϩ/ tцB*v:-7ޚ, )p@ :$7ѴyN] h1 HZ޻Bf1畏?r 3uQB}\cmd!@ WS1zݨ]3CoFq"8ԚέiGb[UgfN G[oLĎnrWxzdD]Ջ` l_9 ]c2֋~ pIPӻߘ)* mS~H~X.t;/RG'~[!<8zvOB9`55'{ɸ6g {pqT3^-ZId, =4pBwbO&Ҹ$d%FN`7>͕xE_{ ۫v"{.1ן%$r_m L=mPO%os#(ĴyI%4aĘnzn|l6AT޾'VAJJ{` ,8I%vK$%Gv XY f 0NndQ& #Phꃢ H!x-ML.RN8D( `hz=Skc|j9{Б/Uڅ?AZX_f ؐ53eiEVmv° GJBnI[#Q")yq~ ruo7ӎbwO$26󦻬^lW%㽨:Y*F                              A@@@A@@A@@@@A@@@A@@@@@@AAA@@@@@@@@@@@@@A@@A@@A@@@A@A@@A@@A@@A@@@@A@A@@A@AA@AA@@AA@@@AAA@A@A@A@A@                              @@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@                                  ##%%&&))**,,//1122447788;;==>>@@CCEEFFIIJJLLOOQQRRTTWWXX[[]]^^aabbddgghhkkmmnnppssuuvvyyzz||        0 0 0  0 0  0 0  0           0  0 0 0 0  0  0  0          $$  $ $ $$  $ $             $$  $ $ $$  $ $                  0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0                            ((  ((  ((  ((  ((  ((  ((  ((          """"   " " " " ((((((((    """" ( ( ( ("("("("(222P244444p44444f444?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@0`6z7s6z7H0>H xG0>HkF|G GGGGGGGGGGp GGp 0ĊGGp `̊GGp pԊGGP ܊GGP GGP @GGP PGG GGGGGGGGGGGG GGGGGG$GG  4G4H4G4H,G0G@4G0GlG>G>G>G>G?G?@G?XG?xG?G?G?G?G?G? ,G? \===؜>>C(.} 1! 2" q wW^ a z '3#&4$eE=sdD`x5%rR+tT[fF\c--@  6&!yY]"gG;#v$bB_% & (7')8(*uU{+hH:,n-,/<.09)1iI}2jJ*3m4.?>680~9o:k;lL|=>@ApD FPQSTXY] <;=>,8 -!. "/09 #13? $24 %&6*E ["$&'X4gklrdK2E<>$>>"%iJ* -mb+fpsȏE   !"#$%&'()*+,-./0000000000:;<=>?@00000000000000000000000000[\]^0`00000000000000000000000000{|}~00000000000000000000000000000000000000000000000000000000000000x????ABCDEFGHIJKLMNOPQRSTUVWXYZvt100???x@??@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^%% $ $ $ $ $%% %%<%%$%4%,%%d"e"`"  " %" #!#%# # # # ""*#d"`"e"+"4"""""<"C"!!a"""")"*"'"(""!!!!#@[\]^_`{|}~@[\]^_`{|}~|^_`#@_^_`#_#^_`^_#@^_`~#@^_`~^_``#_888@ `P0pH(hX8xD$dT4t L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}C#cS3s K+k[;{G'gW7wO/o_?TA@A@Q@tQ@;H;H;H ;H;H!0;HF;H'h Hha>Hhv4>H <>HSL>HT`>HTl>H >H $BH1>H>H >H>H>H>H>H >H43dcH x>H?H?H$?Ha ?H 4?H D?H T?H d?H t?H ?H=?H?HJ?H)?H?H ?Hf(<@H@H@H@Hr8@HD@HpP@H`@H hvHp@H@H@H@H!@H"@H#@H$@H1@H2@HG KHG1!@HG '@He@HaH@H@H@HAHGe2 AH 0AH'aH @AH!TAH!\AH lAH AH wAH AH AH #=H $=H AH BAH AH!(3AHW AHW AHW AHW KHW BHW@BH H >H XHXHh(XH}8XH}HXH} TXH}^;H}PlXH|XHXHXHXHXHXHXHXH XH XH XH XH XHXH|XH YHXHXH YH YH0YH@YH@YHPYHPYH`YHxYHQ aHQ YH YH YH YH YH  ZH 0ZH P4ZH HXHZHXTZHXlZHX ZHZH ZHZHZH!ZHZHZH= ZH79[Hk [Hk [Hk"$[Hk"4[Hk"H[Hk"`[Hk"t[Hk"[Hk"[H{&"lAH{"[H{"[H3"[H6"[Hk @[Hm[Hm[Hm\Hm\Hm \Hm@0\HmPHHHmD\HmX\Hmp\Hm\Hm\Hm\Hm\Hm \Hm0\Hm\Hm \Hm]Hm]Hm<]HmL]Hm`]Hmp]Hmŀ]HmŔ]Hm \Hm]H@]H~]H\H@@H]H]H0 ^H^H$^H$^H4^H D^HX^Hl^Hx^H^H'^H=^HD^H^^Hf^Hg _H _H0_H@_H>P_HpX_Hcd_Hc|_H hvH g;H ahAH ehAH ihAH th=H wh=H a=H t=H9_H^_H^ _H^ _H^_H^_H^$`H^%,`H^+@`H^nX`H^z EHh`Ht`H`H`H`H`H`H`H`H`H`Hc`Hz `H@ aH @aH @$aH@0aH@0@@ Q@c@c@<X@@@|@@d@У@x@uaudio_identify_acpt@@@\@DALADAtALxAAp&AP&At>A`?ADADAJAJAKAKA0. !"#$%&21/-, 9 ++'()345:;<=>?@ABCDWXFE7JNOPQKLMGHIRSVY]^_~sp}y{\xwv*8۝6      x`AtaAtXA^A_AUA0VA8/?9:;<=>?@ABC D E FG HIJK,L!MN-OPQRS T/U*V-W+X Y1Z2[3\4]5^6_7`8a9b0c.e mMqQ@zy2" 3#6&$7/{%8([&9)]'0=}-?\./0+*1#'2#'345 6,;7.:8-_d<>| .'`0+*~5^2"@ 3#!4$#6&$7/{%8([&9)]'0=}-+?.|/01'*2'*3456,;7.:8-_d<>\ .'`|0^~-+?\0345d<>| .'`|0^~.\0345|d<>.\`0^~q,?azw&12~ "3#!'4{"(5[#-6|$7`%_8\&9^'0@-)].=+}/0$1*2*3m4%56;.7:/8!d<> bBeE hH iI jJkKlL|,?nN~aArR,sSzZyY2 "3!'4"(5{[#6$7%!8&9%!8'0-)}].-_/0$*2`@#3mM4%5@#7:/\8=+g= 2" 3"5%#6&$7/%8(&9)'0=-'?.^/{[0+*}]123@4#5\|6,;7.:8-_d<> 1!2" 3!4$"5%#6^$7&%8*&9('0)--_.=+1#~2#~4'@5``d\|2"#6&$7'%8(&9)'0--=.^~/@`0[{1]}2]}3;+4:*5\_\|1!|2"@ 3#!4$~#6&$7/%8(&9)'0=-'?./[0+*]1}2}34{5\6,;7.:8-_d<> eE !1@-2_ /3#!;4$":5#,6^$.7&%=8*&[9(']0), -?+'.xX%/{0wW}1qQ|2qQ|34"5`~67fF8\ q,?azw&1|2@ "3#!'4"(5#6^$7%!8&9{'0}-).-_/[0$*]1`2`3m4%56;.7:/8=+~d<>\ xje.> u i d c htnbrl'"poygk,<qf;:-[{.]}//?0=+3s4-_6w7v8z9: ;<=>?@ABCD E aAbBcCdDeE fF gG hH iI jJkKlLmMnNoOpPqQrRsStTuUvVwWxXyYzZ#6^6,$7&7./[{0]}3;:4'"6,<7.>8/? aAbBcCdDeE fF gG hH iI jJkKlLmMnNoOpPqQrRsStTuUvVwWxXyYzZ#6^6,$7&7.--_.=+/[{0]}1\|2\|3;:4'"5`~6,<7.>8/? eEzy1+|2"@ 3*#!4#6&$7/%8(&9)'0=-'?./[0!]1$}2$}34{5 6,;7.:8-_d<>\ -'?.^`~0!]/[34{2"@ 3##6&$7/{%8([&9)]'0=}-'?.<>/+*012345\|6,;7.:8-_d<> .+*/2\|4qQ@1!2" 3##6&$7/%8(&9)'0=-'?\./0+*~1}]2}]34{[5|6,;7.:8-_d<> 1!2@ 3#!4$"5%#6.=+/0[{1]}2]}345'"8;:c.d\|/? IqQ@2' 3^#!4+$"5%#6&$7/{%8([&9)]'0=}-*?\.-_/0~1,;2,;34i5"678.:d<>| /1,;`2,;`3'aAcCeElLnNoOsSxXzZ bB{cC& fF[ gG] iI jJnN}qQ\vV@wW|xX#zZyY>1'~2" 3+^!4!"5%#6/$7=`%8(&9)'-./QP01qp2qp3$4506,?;7.:8-_*d< bB{ fF[ gG]kKlLmMnN}qQ\vV@wW|zZyY1!~2" 3#^!4$"5%#6&$7/`%8(&9)'0=-'?.+*/0123456,;7.:8-_d<> mMoOpP1!2"@ 3/!4$"5%#6?$7&%8*&9('0)--_.=+/[0']1<>}2<>}3;:~4{5#|\6,'7..8d /^^[0]4``{8aAcCeE gG iIkKlLnNoOsSuUzZ cCmMrRsSxXzZ1!2" 3#!4$"5%#6&$7_%8({&9)}'0'-/?\.'/0*|1<>2<>3+45@6,;7.:8-=d][ .~/"^4'` hERzE E]DEEI2EEJ4ERE7lE E E E 4EKEE@#EEEE EEH@E NE _PEEXE\E E E EEE ^EmvEKvEA E[EDE0bE EEjEE?EnRE .EhAiAhA<cADdA\gAgAUccp(iAliAoApATpApAlsATsAzA|{AԀAȁA`AԅAAA`AA(  v      W 1 Q `  A@  0 2 A@ A   @  @ @   P0 P  A   h }  } } } @  85   A  L+ L `AL2 D   O  {ĔAo  A @AؚAABBB|HBhF hudav_miibus_readregudav_miibus_writereg[B[Bx^B8_B$nBnBrB`yB@@9WP P Q@url_int_miibus_readregurl_int_miibus_writereg܌BBBBP,BBBBG W WnPnPA  ! 4Xhp9{#{{{S&@'ah 33.U 1(Ex$ l(BB BB0    hBLB$BB   `BdB,BBe  l!  P ` c feX|BBBBfzʀ=^ȁ;`a&@BtBxBBGe2@BK #(-2>'()*+,-./@ABCF'()*+,-./@ABCF'()*+,-./@ABCF/@ABCDEFGHIJKNMNO`abcdefghik*++,,--../-@@A&''(())**++,,- KVXZcfk                   " f`& g`* h`. i`$ f`( h`, i`0 j`4 k`8 l`< n`@ o`d h l p t x |          3 3 3 3 3 3 3 3  3  3  3  3  3 3 "3 f`&3 g`*3 h`.3 i`$3 f`(3 h`,3 i`03 j`43 k`83 l`<3 n`@3 o`d3 h3 l3 p3 t3 x3 |3 3 3 3 3 3 3 3 3 3 L rCrC(xCبCtG5H5H[H5HHH8HDHLHTH`HHHĒHВHC$CCC$!A  !@@@@CCCHC$CCHHH0C`#}B]?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abc  !"#$%&'()0123456789@ABCDEFGHIPQRSTUVWXY`abcdefghipqrstuvwxy0123456789abcdefghijklmnopqrstuvwxyzK%  `   X,nK22Kn,X` %KOpenBSD4.1GENERIC#55 @(#)OpenBSD 4.1 (GENERIC) #55: Sat Mar 10 20:56:55 MST 2007 OpenBSD 4.1 (GENERIC) #55: Sat Mar 10 20:56:55 MST 2007 deraadt@zaurus.openbsd.org:/usr/src/sys/arch/zaurus/compile/GENERIC dackirqtargetlunintrsocketfunctionchanneldrivemuxconfigurationinterfaceproductreleaseportnoreportidphypfpflogpfsyncspppencnmeaccdksymssystracebpfilterbridgecarpgifgrelooppppsltunvlantrunkpppoewsmuxhotplugwdc_log: head %x wdc_tail %x wdc_log: type %d size %x wdc_log: head %x tail %x wdc_default_read_reg: reading from a write-only register %d wdc_default_write_reg: writing to a read-only register %d drive at %s channel %d drive %datapiscsi at %s channel %dwdcsplwdcstart: channel waiting for irq%s channel %d: reset failed for drive 1 drive 0atapi type: %s c_bcount: %d c_skip: %d missing untimeoutwdc_probe_caps%s(%s:%d:%d): using PIO mode %d, Ultra-DMA mode %d, DMA mode %d using BIOS timings%s: transfer error, downgrading to PIO mode %d %s: transfer error, downgrading to DMA mode %d %s: transfer error, downgrading to Ultra-DMA mode %d wdccmdwdc_exec_command: polled command not donewdccommandwdccommandext%s:%d: %s %s(%s:%d:%d): %s physio split wd ioctl request... cannot proceed user_strat: No ioctl IBSSLucent WaveLAN/IEEESony WaveLAN/IEEELucent Embedded WaveLAN/IEEEPRISM2 HFA3841(EVB2)PRISM2 HWB3763 rev.BPRISM2 HWB3163 rev.APRISM2 HWB3163 rev.BPRISM2 HFA3842(EVB3)PRISM1 HWB1153PRISM2 HWB3163 SST-flashPRISM2 HWB3163(EVB2) SST-flashPRISM2 HFA3842(EVAL)PRISM2.5 ISL3873PRISM2.5 USBPRISM2.5 ISL3874A(Mini-PCI)PRISM2.5 ISL3874A(PCI-bridge)PRISM3 ISL37300PPRISM3 ISL37300P(PCI)PRISM3 (USB): unable to read station address wi_attachaddress %sWaveLAN/IEEE node%s: received packet on invalid port (wi_status=0x%x) %s: received packet of unknown type on port 7 %s: Error decrypting incoming packet. %s: oversized packet received (wi_dat_len=%d, wi_status=0x%x) %s: oversized mgmt packet received in hostap mode (wi_dat_len=%d, wi_status=0x%x) wihap: failed to copy header %s: wi_cmd failed with %d %s: timeout in wi_cmd 0x%04x; event status 0x%04x %s: wi_cmd_io: busy bit won't clear %s: init failed %s: invalid data path: %x %s: failed to allocate %d bytes on NIC %s: unsupported crypto algorithm %d wiscan%s: wi_scan_timeout: %d tries %s: mgmt. buffer allocation failed %s: tx buffer allocation failed wi_do_hostencryptwi_do_hostdecrypt%s: wi_do_hostdecrypt: iv mismatch: 0x%02x%02x%02x%02x vs. 0x%x %s: wi_start: dropping unassoc dst %s %s: wi_start: xmit failed %s: host encrypt not implemented for 802.3 %s: wi_mgmt_xmit: xmit failed %s: device timeout Unknown PRISM2 chipSymbol %s: %s%s (0x%04x), Firmware %d.%d.%d (primary), %d.%d.%d (station), %s: Firmware %d.%02d variant %d, %s: %u (%d dBm) put_rateswihap_init: sc=%p whi=%p Sending disassoc to sta %s Sending deauth to sta %s wihap_shutdown: FREE(sta=%p) wihap_shutdown: sc=%p whi=%p wihap_timeout: disassoc due to inactivity: %s wihap_timeout: deauth due to inactivity: %s wihap_auth_req: station %s short request wihap_auth_req: returns status=0x%x wihap_auth_req: algorithm unsupported: 0x%x challenge: 0x%x 0x%x ... wihap_auth_req: new station wihap_auth_req: station %s algo=0x%x seq=0x%x wihap_assoc_reqwihap_assoc_req: bad ssid: '%.*s' != '%.*s' wihap_assoc_req: capinfo: not ESS: capinfo=0x%x wihap_assoc_req: returns status=0x%x wihap_assoc_req: already assoc'ed? wihap_assoc_req: polling not supported: capinfo=0x%x wihap_assoc_req: WEP flag mismatch: capinfo=0x%x wihap_assoc_req: rates mismatch. wihap_assoc_req: from station %s wihap_deauth_req: unknown station: %s wihap_disassoc_req: unknown station: %s wihap_data_input: no TODS src=%s, fctl=0x%x wihap_data_input: incorrect bss: %s wihap_data_input: dropping unassoc src %s wihap_ioctl: i shouldn't get other ioctls! wihap_ioctlwihap_mgmt_input: len=%d MGMT: unknown (stype=0x%x) assoc resp: assoc req: probe req: reassoc resp: reassoc req: ann traf ind beacon: deauth: auth: disassociation: probe resp: ftype=0x%x (ctl=0x%x) : where did the card go? ne2000_attach: setup failed ne2000_detect%s: remote transmit DMA failed to complete ne2000_write_mbuf: negative lenne2000_write_mbuf: data != lim%s: %d silo overflow%s, %d ibuf overflow%s comprmcomstartcomcninit: mapping failed: unknown uart %s: console : ns8250, no fifo : ns16450, no fifo : ns16550, no working fifo : ns16550a, %d byte fifo : st16650, no working fifo : st16650, %d byte fifo : ti16750, 64 byte fifo : st16c654, 64 byte fifo : pxa2x0, 32 byte fifo (SIR)comattach: bad fifo type%s: can't establish soft interrupt%s: probed fifo depth: %d bytes version %d.%d%s %s: unsupported OHCI revision %s: reset timeout %s: SMM does not respond, resetting ohciohci_alloc_std: curlen == 0ohci_free_sitd: sitd=%p not done, legacy supportohci_allocx: xfer=%p not free, 0x%08x ohci_freex: xfer=%p not busy, 0x%08x ohci_intr: sc->sc_hcca == NULL %s: blocking intrs 0x%x %s: unrecoverable error, controller halted %s: resume detect %s: %u scheduling overruns ohci_add_done: addr 0x%08lx not foundohci_softintr: sitd=%p is done ohci_device_ctrl_done: not a requestohci_rem_ed: ED not foundohci_close_pipe: pipe not empty sed=%p hd=0x%x tl=0x%x pipe=%p, std=%p ohci_close_pipe: pipe still not empty ohci_abort_xfer: not in process contextohciabohci_abort_xfer: hcpriv is NULL ohci_root_ctrl_startOHCI root hubohci_device_ctrl_transfer: not a request ohci_device_bulk_start: a request ohci_device_intr_transfer: a requestohci_device_intr_close: ED not foundohci_setintr: 0 interval %s: isoc TD alloc failed ohci_device_isoc_start: not in progress %p ohci_device_isoc_abort: hcpriv==0 ohci_device_isoc_abort: early return radioradio at %s/dev/ksyms: Symbol table not valid. ELFpf_find_state_recursepf_find_state_allpf_src_connlimit, %u states killedpf_src_connlimit: blocking address pf_insert_src_nodepf: src_tree insert failed: pf: state insert failed: id: %016llx creatorid: %08xpf: state insert failed: tree_ext_gwypf: state insert failed: tree_lan_ext lan: gwy: ext: (from sync)pftmdiagnostic /usr/src/sys/net/pf.cstate->timeout != PFTM_UNLINKEDstate->timeout < PFTM_MAXcur->timeout == PFTM_UNLINKED[%u]%u.%u.%u.%u:%u%u [lo=%u high=%u win=%u modulator=%u %u:%u wscale=%uICMP ICMPV6 UDP TCP invalid address type: %d pf_change_appf_change_a6pf_change_icmppf_modulate_sackpf_send_tcppf_step_into_anchor: stack overflow pf_map_addrpf_map_addr: selected address pf_map_addr: src tracking maps to pf_get_sportpf: NAT proxy port allocation (%u-%u) failed pf_get_wscalepf_get_msspf_calc_msspf_normalize_tcp_stateful failed on first pktpf_test_state_tcppf: loose state match: seq=%u (%u) ack=%u len=%u ackskew=%d pkts=%llu:%llu pf: BAD state: fwdrev seq=%u (%u) ack=%u len=%u ackskew=%d pkts=%llu:%llu dir=%s,%s pf: State failure on: %c %c %c %c | %c %c pf_test_state_udppf_test_state_icmppf: ICMP error message too short i(icmp) pf: ICMP error message too short (icmp6) pf: ICMP error message too short (udp) pf: ICMP error message too short (tcp) pf: BAD ICMP %d:%d -> state: seq=%u pf: ICMP error message too short (ip6) pf: ICMPv6 short opt pf: ICMP error message too short (ip) pf_test_state_otherpf_routablepf_rtlabel_matchpf_route: invalid parameterspf_routepf_route: m0->m_len < sizeof(struct ip) pf_route: TAILQ_EMPTY(&r->rpool.list) pf_route6: invalid parameterspf_route6pf_route6: m0->m_len < sizeof(struct ip6_hdr) pf_route6: TAILQ_EMPTY(&r->rpool.list) pf_testpf_test: pf_get_mtag returned NULL pf: dropping packet with ip options pf_test: kif == NULL, if_xname %s non-M_PKTHDR is passed to pf_testpf_test6pf_test6: pf_get_mtag returned NULL pf: IPv6 short opt pf: mbuf shortage pf: IPv6 short rthdr0 pf: IPv6 short rthdr pf_test6: kif == NULL, if_xname %s non-M_PKTHDR is passed to pf_test6pffrentpffragpffrcachepffrcentpfstscr/usr/src/sys/net/pf_norm.cBUFFER_FRAGMENTS(frag)!BUFFER_FRAGMENTS(frag)TAILQ_EMPTY(&pf_cachequeue) || TAILQ_LAST(&pf_cachequeue, pf_cachequeue) != fragexpiring %d(%p) trying to free > %d cache entries trying to free > %d frents LIST_EMPTY(&frag->fr_cache) || LIST_FIRST(&frag->fr_cache)->fr_off > frcache->fr_end*frag == NULL || BUFFER_FRAGMENTS(*frag)frep != NULL || frea != NULLcomplete: %p(%d) drop: too big: %d frent != NULL%d < %d? missing fragment at %d, next %d, max %d adjust overlap %d overlap -%d *frag == NULL || !BUFFER_FRAGMENTS(*frag)frp != NULL || fra != NULLfragcache[%d]: done 0-%d fragcache[%d]: dropping overall fragment fragcache[%d]: adjacent(merge %d-%d) %d-%d (%d-%d) cur == NULLfragcache[%d]: adjacent %d-%d (%d-%d) (int)m->m_len == ntohs(h->ip_len) - aftercutfragcache[%d]: chop %d %d-%d (%d-%d) fragcache[%d]: gap %d %d-%d (%d-%d) fragcache[%d]: adjacent (%d-%d) %d-%d (*m0)->m_next == NULL(int)m->m_len == ntohs(h->ip_len) - precutfragcache[%d]: chop %d (%d-%d) %d-%d fragcache[%d]: gap %d (%d-%d) %d-%d fragcache[%d]: dead (%d-%d) %d-%d fragcache[%d]: new %d-%d %s: pf_find_mtag returned NULL(2) dropping bad fragment %s: pf_find_mtag returned NULL(1) reass frag %d @ %d-%d max packet %d mff and %d IP_DF pf_normalize_tcp_initsrc->scrub == NULLpf_normalize_tcp_statefulTimestamp failed %c%c%c%c tsval: %lu tsecr: %lu +ticks: %lu idle: %lus %lums src->tsval: %lu tsecr: %lu dst->tsval: %lu tsecr: %lu tsval0: %lu Broken RFC1323 stack did not timestamp data packet. Disabled PAWS security. Did not receive expected RFC1323 timestamp dst idled out of PAWS src idled out of PAWS multiple TS??src->scrub || dst->scrub/pf_find_or_create_ruleset: RB_INSERT2 '%s' '%s' collides with '%s' '%s' pf_find_or_create_ruleset: RB_INSERT1 '%s' '%s' collides with '%s' '%s' /*pf_anchor_setup: ruleset pf_anchor_setup: .. beyond root ../pf_anchor_copyout: '%s' '%s' pf_anchor_remove: broken refcount pfruleplpfsrctrplpfstateplpfaltqplpfpooladdrplpfpurgepfpurge threadpf_setup_pfsync_matchingpfioctlpf: started pf: stopped altq: started altq: stopped pfrktablepfrkentrypfrkentry2pfr_clr_addrs: corruption detected (%d). pfr_add_addrspfr_del_addrspfr_set_addrspfr_tst_addrspfr_get_addrs: corruption detected (%d). pfr_get_astats: corruption detected (%d). pfr_clr_astatspfr_enqueue_addrs: IPv6 walktree failed. pfr_enqueue_addrs: IPv4 walktree failed. pfr_mark_addrs: IPv4 walktree failed. pfr_mark_addrs: IPv6 walktree failed. pfr_lookup_addrpfr_insert_kentries: cannot route entry (code=%d). pfr_reset_feedbackpfr_route_kentrypfr_unroute_kentrypfr_unroute_kentry: delete failed. pfr_walktree_pfpfr_add_tablespfr_del_tablespfr_get_tables: corruption detected (%d). pfr_get_tstats: corruption detected (%d). pfr_clr_tstatspfr_set_tflagspfr_ina_definepfr_commit_ktablepfr_update_stats: assertion failed. pfr_attach_tablepfr_detach_table: refcount = %d. pfr_pool_get%fingerprinted %s:%d %d:%d:%d:%d:%llx (%d) (TS=%s,M=%s%d,W=%s%d) pf_osfp_fingerprint_hdrpf_osfp_fingerprintfingerprint 0x%x didn't match osfp matched %s %s %s %x==%x osfp no match against %x pfosfpenpfosfpadding osfp %s %s %s = %s%d:%d:%d:%s%d:0x%llx %d (TS=%s,M=%s%d,W=%s%d) %x Found "%s %s %s" instead of "%s %s %s" Couldn't find "%s %s %s" pfiaddrplpfi_kif_get for pfi_all failedpfi_kif_getpfi_kif_ref with unknown typepfi_kif_unref: rules refcount <= 0 pfi_kif_unref: state refcount <= 0 pfi_kif_unref with unknown typepfi_kif_get failedpfi_attach_ifnet: cannot allocate '%s' address hookpfi_dynaddr_setup/%d:0:peer:broadcast:networkpfi_dynaddr_updatepfi_table_update: cannot set %d new addresses into table %s: %d pfi_address_add: address buffer full (%d/%d) pfi_address_add: no memory to grow buffer (%d/%d) pfi_fill_oldstatuspflog%dpflog_packetpfsync%dpfsync_insert_net_state: unknown interface: %s pfsync_insert_net_state: invalid creator id: %08x pfsync_inputpfsync_insert: PFSYNC_ACT_INS: invalid value pfsync_insert: PFSYNC_ACT_UPD: invalid value ignoringpartialpfsync: %s stale update (%d) id: %016llx creatorid: %08x pfsync_insert: PFSYNC_ACT_UPD_C: invalid value pfsync: ignoring stale update (%d) id: %016llx creatorid: %08x pfsync: received bulk update request pfsync: received invalid bulk update end: bad timestamp pfsync: received valid bulk update end pfsync: received bulk update start pfsyncioctlpfsync: requesting bulk update pfsync: bulk update complete pfsync: failed to receive bulk update status pfsync: cannot allocate mbufs for bulk update pfsync_sendout_mbufpfsync_insert: PFSYNC_ACT_TDB_UPD: invalid value hotplug_device_attachhotplug_device_detachhotplug: event lost, queue full hotplugclosehtplevhotplugreadpppoe%dpppoe: alien host unique tag, no session found %s: wrong interface, not accepting host unique %s: host unique tag found, but it belongs to a connection in state %d pppoe: packet too short: %d pppoe: unknown version/type packet: 0x%x %s: unknown code (0x%04x) session = 0x%04x %s: failed to send PADR, error=%d %s: received unexpected PADO pppoe: received PADO but could not find request for it %s: session 0x%x terminated, received PADT %s: session 0x%x connected %s: %s: SERVICE NAME ERRORTAG ACCOOKIE ERRORAC SYSTEM ERRORGENERIC ERRORTAG HUNIQUE ERROR%s: tag 0x%x len 0x%x is too long %s: parse error pppoe: packet content does not fit: data available = %d, packet size = %u pppoe: could not get PPPoE header /usr/src/sys/net/if_pppoe.cm->m_flags & M_PKTHDRpppoe (data): dropping too short packet: %d bytes pppoe (data): unknown version/type packet: 0x%x pppoe (data): could not get PPPoE header pppoe_output%s (%x) state=%d, session=0x%x output -> %s, len=%d pppoe_send_padi in state %d%s: failed to transmit PADI, error=%d %s: failed to send PADI, error=%d %s: timeout %s: disconnecting %s: could not establish connection pppoe_send_padtaltq assertion "%s" failed: file "%s", line %d altq assertiontbr_set: no cpu clock available! altq_add: no cpu clockread_machclkinvalid weight value %d for red! use %d wtab_alloc: malloc failed!cbq_add_class: borrow class != parent cbq_add_queue: no parent class! altq: packet for %s does not have pkthdr rmc_init: root class not allocated _rmc_wrr_dequeue_next_rmc_prr_dequeue_nextrmc_root_overlimithfsc_dequeue:All breakpoints used. Already set. Too many breakpoints. Not set. No breakpoints set Map Count Address %s%p %5d %-12sdb_commandCount missing Bad modifier Ambiguous No such command the kernel did not panic procscalloutbreaksextentsmallocobjectpanicpoolregistersuvmexpwatchescrashhaltrebootpoweroffmachineexaminedeletebreakdwatchwatchstepcontinueuntilnextmatchtracecallshowboothelphangmandmesgddb> Bad function %#n Argument missing Too many arguments ELF[ %s symbol table has bad start address %p ] bad magic[ %s ELF symbol table not valid: %s ] bad e_machine.strtab.symtabsymtab unaligned[ using %lu bytes of %s ELF symbol table ] symtab corrupted= 0x%lx \%03o%-*ld%-*lo%-*lr%-*lu%-*lx%-*lz: %*d%*o%*r%*u%*x%*zAddress missing Value missing Syntax error Symbol not found Divide by 0 Negative shift amount ^R String too long Bad escape Bad character Bad character in number End of stack trace. --db_more-- -%*lo-%#*lo-%*lu-%#*lu-%*lx-%#*lxFaulted in traceback, aborting... Starting stack trace... %-12s%#*ln %s+%#lr[after %6d] bsd[ no symbol table formats found ] No slots left for %s symbol tableUnable to find symbol table slot for %s.invalid symbol table name%s %s%s Sifting table %s: db_printsym [%s:%d]+%sBreakpoint at Stopped at RUN AT LEAST 'trace' AND 'ps' AND INCLUDE OUTPUT WHEN REPORTING THIS PANIC! DO NOT EVEN BOTHER REPORTING THIS WITHOUT INCLUDING THAT INFORMATION! After %d instructions (%d loads, %d stores), radixmaxoffmaxwidthtabstopslineslogUnknown variable No value All watchpoints used. No map. Too many watchpoints. No watchpoints set Map Address Size %s%p %8lx %lx Unknown size %#8n = %#8n Nothing written. () Score: %lu/%lu db_hangmanmiccdspeakerheadphonesaudioaudio: missing method audioattachaudio: could not allocate play buffer audio: could not allocate record buffer monitorsourcemasterauddetaudiodetach: %s didn't detach au_portofaudio_attach_mi: NULL oplaudioprint: unknown type %d%s at %smpuaudio_open: 0 precision aud_draudio_drain: copying in progress!?! aud_hraud_rdaudio_silence_copyoutaud_wraudio_write: cc == 0, swcode=%p, factor=%d au_set_gainau_get_gainau_set_portau_get_portaudiosetinfoaudiogetinfo%s: error %d on component %d%s ccdiodone: countWARNING: no memory for concatenated disks ccdbufplccdattach: count <= 0ccd%dccdinitccdinit: device name too long. ccdbuffer (mirror)fictitiousccdlckcnopen: recursive/etc/firmware/%sSamsungK9F2808U0C 16Mx8 3.3VK9F1G08U0A 128Mx8 3.3Vflash%s: reset failed device 0x%02x : vendor 0x%02x: %s: identification failed block %d page %d verify failed flashdump flashsize NAND flash%04x: %02x, address %s dp8390_initdp8390_start: no header mbufdp8390_xmit: no packets to xmitdp8390_xmit: desync, next_tx=%d inuse=%d cnt=%d new=%d%s: length does not match next packet pointer %s: len %04x nlen %04x start %02x first %02x curr %02x next %02x stop %02x %s: NIC memory corrupt - invalid packet length %d : failed to clear NIC buffer at offset %x - check configuration %s: device enable failed midimid_rdmid_wrmid_clmid_dr: <%s> midi: missing method midi at %sunconfiguredsystrrd%s: attach to %u: %d strprocplstrpolplsystrace_fork/usr/src/sys/dev/systrace.cstrp->proc == p%s: %u: policy %d %s: new, ents %d %s: %d: code %d -> policy %d %s: %d -> pid %d %s: %u: %p(%lu) %s: Trying to detach from %d %s: allocating %d -> %lu systrmsg%s: %p: pid %d -> pid %d %s: free %d vndencryptvndbufplWARNING: no memory for vnode disks vnd devicevndioctlvnd%dVNDIOCSET: device name too long vndioctl: null vpvndlckarc4_stirarc4maybeinit: prematureextract_entropyrndrdcd9660_inactive: pushing activecd9660_reclaim: pushing activeRRIP without PX field? RRIP with incorrect flags?RRIP with incorrect NM flags? IEEE_P1282RRIP_1991AIEEE_1282SPcd9660_mountroot: can't setup bdevvp'scd9660root_deviceCD001%/@%/C%/Eisoinodefhtovp: directory crosses block boundary %d[off=%d/len=%d] fhtovp: bread error %d fhtovp: crosses block boundary %d fhtovp: lbn exceed volume space %d cd9660_strategy: spectag VT_ISOFS, isofs vnode udf_disklabelspoofudftrpludfndpludfdspludf_mount: enforcing read-only mode udfFSD does not lie within the partition! Cannot read sector %d of FSD Cannot read sector %d Invalid root file entry! Couldn't find the fsd Can't read sector %d of VDS unodeInvalid file entry! *UDF Virtual Partitionudf_find_partmaps*UDF Sparable Partitionhash entry is NULL, up->u_ino = %dudf_allocv: failed to allocate new vnode udf_transname(): name too long udf_transname(): Unicode translation failed udf: invalid FID udf: invalid FID fragment uiomove returned %d udf_readdirInvalid FID tag tag VT_UDF, hash id %u udf_lookup: Invalid tag warning: udf_readlblks returned error %d Unknown strategy type %d Cannot deal with strategy4096 yet! File offset out of bounds Unsupported allocation descriptor %d elf32_load_fileOpenBSDexec: a VTEXT vnode has writecount != 0#!exec_script_makecmds: epp already has a fdexec_script: copyinstr couldn't fail/dev/fd/%dvmcmdset_extend: not necessary/usr/src/sys/kern/exec_subr.cocnt > 0exec_process_vmcmds: RELATIVE no baseswapperfork initcfpendcannot mount rootcannot find root vnodepagedaemonfork pagedaemonreaperfork reapercleanerfork cleanerfork updateaiodonedfork aiodonedcryptocrypto thread/sbin/init/sbin/oinit/sbin/init.bak/dev/consolewarning: /dev/console does not exist warning: /dev/console error %d initexecinit: couldn't allocate argument spaceexec %s: error %d init: not found no initacct_processacctAccounting resumed Accounting suspended initclocks: unable to register softclock intrfdescpldup2: fdallocfd_unused: fd_lastfile inconsistentfdlockclosefclosef: count: %d/%dclosef: count < 0kqueueplknoteplkqread/usr/src/sys/kern/kern_event.c(kn->kn_status & KN_QUEUED) == 0kn->kn_status & KN_QUEUEDexecve: argp == NULLexecve: no vmcmdssys_execve: falloc indx != iinit died (signal %d, exit %d)waitppwaitWARNING: thread `%s' (%d) exits with status %d unable to allocate kthread_qktrsyscallktrsysretktrnameiktremulktrgenioktrpsigktrcswktrace write failed, errno %d, tracing stopped lockmgr: process context requiredlockmgr: using decommissioned locklockmgr: non-release on draining lock: %dlockmgr: make up your mindlockmgr: not holding exclusive locklockmgr: non-zero exclusive countlockmgr: locking against myselflockmgr: upgrade exclusive locklockmgr: unknown locktype request %dlockmgr: release of unlocked lock!lockmgr: draining against myselflockmgr: pid %d, not exclusive lock holder %d unlocking lock type %s: SHARED (count %d) lock type %s: EXCL (count %d) by pid %d with %d pendinglkmopnlkmlookupDDB symbols added: %ld bytes %s,devbufdebugpcbroutetblfragtblifaddrsooptssysctlioctlopsiovNFS reqNFS mountNFS nodevnodesnamecacheUFS quotaUFS mountshmVM mapsemdirhashVM pmapfile descsubprocVFS clusterMFS nodeExport HostNFS srvsockNFS uidNFS daemonip_moptionsin_multiether_multimrtISOFS mountISOFS nodeMSDOSFS mountMSDOSFS fatMSDOSFS nodettysmiscfs mountadosfs mountadosfs anodeadosfs bitmappfkey datatdbxform_datapagedepnewblkindirdepVM swapRAIDframe dataUVM amapUVM aobjUSB deviceUSB HCmemdesccrypto dataIPsec credspacket tags1394ctl1394dataemuldataip6_optionsNDPip6rrrp_addrtempNTFS mountNTFS nodeNTFS fnodeNTFS dirNTFS hash tablesNTFS file attrNTFS resident data NTFS decompNTFS vrunkqueuebluetoothbwmeterUDF mountUDF file entryUDF file idmalloc - bogus typemalloc(): allocation too large, type = %d, size = %lu malloc: allocation too large???malloc: wrong bucketmalloc: lost dataprevious typeData modified on freelist: word%s %d of object %p size 0x%lx %s %s (0x%x != 0x%x) %s %d of object %p size 0x%lx %s %s (invalid addr %p) malloc: out of space in kmem_mapfree: non-malloced addr %p type %sfree: multiple freesmultiply freed item %p free: duplicated freefree: unaligned addr %p, size %ld, type %s, mask %ld%d,HighUseLimitRequestsType LimKern LimType%15s %5s %6s %7s %6s %9s %8s %8s InUseMemUse%15s %5ld %6ldK %7ldK %6ldK %9ld %8d %8d rw_enter: locking against myselfrw_enter: unknown op 0x%xphysbuftodo < 0; minphys brokentodo > MAXPHYS; minphys brokenphysiodone < 0; strategy brokendone > todo; strategy brokenputphysbuf: private buf B_WANTED%-16s %-8s %18p %s %5d %5d %5d %d %#10x %-9.9s %-16s COMMANDSTRUCT PROC *UAREA * PID %-10s %18s %18s %18s VMSPACE/VM_MAP PID %-16s %-8s %18s %s EMULWAIT-CHANNELWAIT-MSGFLAGSWAITPPIDPGRPUID PID %5s %5s %5s S %10s %-9s %-16s usage: show all procs [/a] [/n] [/w] /a == show process address info /n == show normal process info [default] /w == show process wait/emul info procinit: mallocprocplzombieplucredplpgrpplsessionplpcredplchgproccnt: procs < 0enterpgrp: setsid into non-empty pgrpenterpgrp: session leader attempted setpgrpenterpgrp: new pgrp and pid != pgidenterpgrp: mksession and p != curprocidlestopzombiedeadonprocADVLOCKCTTYNOCLDSTOPPPWAITPROFILSELECTSINTR SUGID SYSTEM TIMEOUT TRACED WAITEDWEXITEXECPWEUPCSSTEPSUGIDEXECNOCLDWAITNOZOMBIEINEXECSYSTRACECONTINUEDBIGLOCKTHREADIGNEXITRVSOFTDEPPROC (%s) pid=%d stat=%s flags=%b pri=%u, usrpri=%u, nice=%d forw=%p, back=%p, list=%p,%p user=%p, vmspace=%p estcpu=%u, cpticks=%d, pctcpu=%u.%u%, swtime=%u user=%llu, sys=%llu, intr=%llu mawn%c%5d %-10.10s %18p %18p %18p plimitplsensordevsensorssensors kthreadsigaplpausepsignal signal numberissignal Process (pid %d) got signal %d postsigpostsig actioncoredump%s.coreuiomove: modeuiomove: procureadc: zero residureadc: non-positive iovcnthashinit: bad cnthook_disestablish: hook not establishedpowerhook_disestablish: hook not establishedkern_sysctltsleep: no identtsleep: not SONPROCtsleep: p_back not NULLwakeup: p_back not NULLwakeup: p_stat is %ddenied attempt to set clock forward to %ld denied attempt to set clock back %ld seconds nanosleeptimeout_add: not initializedtimeout_add: to_ticks (%d) < 0%9d %2d/%-4d %8x %s ticks now: %d ticks wheel arg func smashed stack in %s/usr/src/sys/kern/sched_bsd.cphzpreempt: cpu_preempt not yet implementedsetrunnable not configured unsupported >>> %s probe returned %d >>> probing for %s* mapply: no match function for '%s' device>>> %s probe won >>> no winning probe root device %s not configured %s (root)config_make_softcconfig_make_softc: allocation for device softc failed%s%dconfig_make_softc: duplicate %sexpandcreatconfig_make_softc: %sing dev arrayconfig_make_softc: device name too longconfig_detach: bad device fstateconfig_detach%s detached config_detach: detached device has childrenconfig_detach: forced detach of %s failed (%d)config_defer: can't defer config of a root deviceconfig_defer: deferred twiceconfig_defer: can't allocate defer structureconfig_pending_decr: config_pending == 0config_activate_children: shouldn't get hereevcnt_attachwrit%s%d%c: %s %sing fsbn %d of %d-%d (%s%d bn %d; cn %d tn %d sn %d)disk_attach: can't allocate storage for disklabeldisk_detach: disk_count < 0disk_unbusy: %s: dk_busy < 0 rootdev=0x%x rrootdev=0x%x rawdev=0x%x cannot open disk, 0x%x/0x%x, error %dfilesystem type %d not known.. assuming ffs dk_mountrootcannot read disk label, 0x%x/0x%x, error %droot filesystem has size 0bufq_default_alloc: no memoryextent_register: already registeredextentplextent_create: name == NULLextent_create: storage provided for non-fixedextent_create: extent `%s', start 0x%lx, end 0x%lx extent_create: end < startextent_create: fixed extent, bad storagesize 0x%lxextent_destroy: NULL extentextent_alloc_region: NULL extentextent_alloc_region: extent `%s' (0x%lx - 0x%lx) extent_alloc_region: start 0x%lx, end 0x%lx extent_alloc_region: region lies outside extentextntextent_alloc_region: can't allocate region descriptor extent_alloc_region: extent `%s', start 0x%lx, size 0x%lx extent_alloc_region: overflowextent_alloc_region: extent `%s', size 0x%lx extent_alloc_region: bad sizeextent_alloc_subregion: NULL extentextent_alloc_subregion: NULL result pointerextent_alloc_subregion: extent `%s', ex_start 0x%lx, ex_end 0x%lx extent_alloc_subregion: substart 0x%lx, subend 0x%lx extent_alloc_subregion: bad subregionextent_alloc_subregion: extent `%s', size 0x%lx extent_alloc_subregion: bad sizeextent_alloc_subregion: bad alignmentextent_alloc_subregion: extent `%s' (0x%lx - 0x%lx), alignment 0x%lx extent_alloc_subregion: overflow after alignmentextent_alloc_subregion: can't allocate region descriptor extent_alloc_subregion: extent `%s', size 0x%lx, boundary 0x%lx extent_alloc_subregion: bad boundaryextent_free: NULL extentextent_free: extent `%s', start 0x%lx, size 0x%lx extent_free: extent `%s', region not within extentextent_free: start 0x%lx, end 0x%lx extent_free: region not foundextent_free: overflowFLWANTEDWANTEDNOCOALESCEFIXEDextent `%s' (0x%lx - 0x%lx), flags=%b 0x%lx - 0x%lx extent_print: NULL extentklogmtx_enter: ipl not implementedmutex %p held in %smutex %p not held in %spr_rmpage: nidle inconsistentpr_rmpage: nitems inconsistentphpoolpcgpoolpool_init: pool item size (%lu) too largepool_init: too much uptime/usr/src/sys/kern/subr_pool.cpp->pr_itemsperpage != 0LIST_EMPTY(&pp->pr_fullpages)LIST_EMPTY(&pp->pr_partpages)pool_destroy: pool busy: still out: %upool_get: %s: crossed hard limitpool_get: %s: curpage NULL, nitems %u pool_get: nitems inconsistentpool_get: %s: page emptypool_get: %s: nmissing inconsistentpool_get: nidle inconsistentpool_get: %s: items on itemlist, nitems %u pool_get: %s:must have NOWAITpool_get(%s): free list modified: magic=%x; page %p; item addr %ppool %s: putting with none out pool_putpool_put: %s: page header missingpool_prime_page: %s: unaligned page((((vaddr_t)pi) + ioff) & (align - 1)) == 0ph->ph_nmissing == 0 page %p, nmissing %d, time %lu,%lu item %p, magic 0x%x POOL %s: size %u, align %u, ioff %u, roflags 0x%08x alloc %p minitems %u, minpages %u, maxpages %u, npages %u itemsperpage %u, nitems %u, nout %u, hardlimit %u nget %lu, nfail %lu, nput %lu npagealloc %lu, npagefree %lu, hiwat %u, nidle %lu empty page list: full page list: partial-page list: no current page cache %p: allocfrom %p freeto %p hits %lu misses %lu ngroups %lu nitems %lu group %p: avail %d %p no log curpage %p FailReleasesPgreqPgrelNpageHiwatMinpgMaxpgIdleNameSize%-10s%4s%9s%5s%9s%6s%6s%6s%6s%6s%6s%5s db_show_all_pools%-*s %*u %*lu %*d %*s %*lu inf%-10s %18p %18p %-10s %18s %18s Allocatorusage: show all pools [/a] pool(%p:%s): page inconsistency: page %p; at page head addr %p (p %p) pool(%p:%s): page inconsistency: page %p; item ordinal %d; addr %p (p %p) pool(%s): free list modified: magic=%x; page %p; item ordinal %d; addr %p (p %p) pcg->pcg_avail <= PCG_NOBJECTSpcg->pcg_avail != 0pcg->pcg_objects[idx] != NULLpcg->pcg_avail < PCG_NOBJECTSpcg->pcg_objects[idx] == NULLkernel %sassertion "%s" failed: file "%s", line %d%s: table is full panic: splassert: %s: want %d have %d spl assertion failure in %slogprikprintf%llx%llobug in kprintf: bad base0123456789ABCDEF(null)0123456789abcdefaddchangeddbdisableenableexitfindquittimezoneverbose--- more --- 0%o*UNKNOWN**FOUND*%3d free slot (for add) Unknown devno (max is %d) %3d at disable %s flags 0x%x ???%3d %s count %d (pseudo device) %s [] ? Unknown argument %3d can't change free slot change (y/n) ?%3d %s changed flags changed out of memory. already disabled Error unknown state %3d can't disable free slot %3d %s can't disable pseudo device %3d can't enable free slot %3d %s can't enable pseudo device command args description [count] number of lines before more enter ddbdev add a device8|10|16 base on large numbersdevno|dev change devicesattr val|devno|dev disable devicesattr val|devno|dev enable devicesdevno|dev find devices this message list configuration leave UKC[attr [val]] show attributes (or devices with an attribute)[mins [dst]] set timezone/dst don't know toggle verbose bootingUnknown routine /%c/ Unknown attribute Unknown pseudo routine /%c/ Value missing for attribute %s ? Not same device type No more space for new devices. No device of this type exists. Clone Device (DevNo, 'q' or '?')Insert before Device (DevNo, 'q' or '?')Device not complete number or * is missing Argument expected Dev expected 8|10|16 expected DevNo or Dev expected Attr, DevNo or Dev expected timezone = %d, dst = %d Unknown command disautoconf verbose %sabled Unknown command, try help User Kernel Config UKC> Continuing... sys_ioctlselectpipelkpiperdExpected pipe buffer wraparound disappearedExpected wraparound badPipe buffer overflowpipewrpipeclpipepl/usr/src/sys/kern/sys_process.c(p->p_flag & P_SYSTEM) == 0ptrace: impossiblemsginfo.msgssz %d not a small power of 2msgmaps is NULLmsghdrs is NULLmsqids is NULLmsginfo.msgseg %d > 32767msghdr->msg_spot != -1msghdr->msg_spot out of rangesys_msgctl: msg_cbytes is screwed upsys_msgctl: msg_qnum is screwed upmsgwaitmsg_perm.mode & MSG_LOCKEDsegs_needed > nfree_msgmapsmsgsz + msg_cbytes > msg_qbytesno more msghdrsnot enough msgmapsnil free_msgmapsnext too low #1next out of range #1next too low #2next out of range #2didn't use all the msg segmentsmsg_first/last screwed up #1next too low #3next out of range #3msg_first/last screwed up #3msg_first/last screwed up #2semaplsemuplsemwaitsemop - can't undo undossemexit - semid not allocatedsemexit - semnum out of rangeshmseg free count inconsistentshmplttrstrtttckoutqttwritettyrub: would panic c = %d, val = %d load: %d.%02d not a controlling terminal no foreground process group runningrunnableiowait cmd: %s %d [%s] %ld.%02ldu %ld.%02lds %d%% %ldk empty foreground process group ttyfree: tty_count < 0/dev/XtyXXptydevnamepqrstuvwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZptcreadptcwriteptmattach: Can't find pty slave in cdevswputc: required clalloc b_to_q: required clalloc WARNING: mclpool limit reached; increase kern.maxclustersmbplmclplm_copym0: null mbufm_copym0 overrunm_copym0: m == NULL and not COPYALLm_copym0: off %d, len %dm_copydata: off %d < 0m_copydata: null mbuf in skipm_copydata: null mbufm_copydata: len %d < 0m_zero: M_READONLYm_apply: len %d < 0m_apply: null mbuf in skipm_apply: null mbufm_apply: off %d < 0m == NULL in m_pulldown()unixsockplsoclose: NOFDREFsoaccept: !NOFDREF/usr/src/sys/kern/uipc_socket.cm == so->so_rcv.sb_mbreceive 1aso->so_rcv.sb_mb == mreceive 3receive 1soqinsque/usr/src/sys/kern/uipc_socket2.csb->sb_mb == sb->sb_lastrecordsbappendaddrsbappendcontrolsemi-panic: sbcompress(sb->sb_flags & SB_LOCK) == 0sb->sb_cc == 0sb->sb_datacc == 0sb->sb_mb == NULLsb->sb_mbtail == NULLsb->sb_lastrecord == NULLsbdropsbcreatecontrol: message too large %d acceptuipc 1uipc 2uipc 4piusrrequnp_attachunp_bindunp_connect2unp_disconnectbremfree: lost tailbufplgetblkallocbuf: buffer larger than MAXBSIZE requestedallocbuf: negative bufsizeDirty buffer on BQ_CLEANBQ_CLEAN has buffer with dependenciesgetnewbufClean buffer on BQ_DIRTYbiowaitbiodone alreadycache_revlookup: found entry for .cache_revlookup: found entry for ..nchplcluster_read: size = 0cluster_read: DONE bpcluster_rbuild: size %ld != filesize %ldcluster_rbuild: too much memorycluster_callback: too little memorycluster_wbuild: size %ld != filesize %ldClustered Block: %d addr %x bufsize: %ld Child Block: %d addr: %x Clustered write to wrong blocksvop_generic_revokeallvop_generic_revokeoperation %s not listed in %s. vfs_op_descsvfs_opv_init: bad operationvfs_opv_init: operation vector without default routine.nameilockfpllf_findoverlap: defaultnamei: nameiop contaminated with flagsnamei: flags contaminated with nameiopsnamei: bad cred/procleaf should be emptyrelookup: null namerelookup: lookup on dot-dotrelookup: symlink found.vfslock%s_mountroot failed: %d Clean vnode has pending I/O'scleaned vnodecleaned vnode isn'tfree vnodefree vnode isn'tvref used where vget requiredUse count is not zero!vnode already on free list: vnode already on free listvput: null vpvput: bad writecountvput: v_writecount != 0vput: bad ref countvput: ref cntvrele: null vpvrele: cannot lockvrele: bad writecountvrele: v_writecount != 0vrele: bad ref countvrele: ref cntvclean: deadlockvclean: cannot reclaimvclean: not cleanvgonemissing bdevvgonel: not cleanmissing aliasVNONVREGVDIRVBLKVCHRVLNKVSOCKVFIFOVBAD%p, type %s, use %u, write %u, hold %u,vprint flags (%s)|VALIASED|VBIOONSYNCLIST|VBIOONFREELIST|VBIOWAIT|VXWANT|VXLOCK|VSYSTEM|VTEXT|VROOTkinfo: vp changed WARNING: some file systems would not unmount retrying unmount of %s failed with error %d syncing disks... giving up done softdep vwakeup: neg numoutputvinvalbufvinvalbuf: flush failedvinvalbuf: dirty bufsvflushbufvflushbuf: dirtyvflushbuf: not dirtybgetvp: not freebrelvp: NULLbrelvp: holdcntvfs_register called with vfc_refcount > 0 AGENEEDCOMMITASYNCBADBUSYCACHECALLDELWRI DONE EINTR ERRORINVALNOCACHEPHYSRAWREADWANTEDWRITEINPROGXXXDEFERREDSCANNEDPDAEMON vp %p lblkno 0x%llx blkno 0x%llx dev 0x%x proc %p error %d flags %b bufsize 0x%lx bcount 0x%lx resid 0x%lx sync 0x%x data %p saveaddr %p dep %p iodone %p dirty {off 0x%x end 0x%x} valid {off 0x%x end 0x%x} NONUFSNFSMFSMSDOSFSLFSLOFSFDESCPORTALKERNFSPROCFSAFSISOFSADOSFSEXT2FSNCPFSVFSXFSNTFSUDFtag %s(%d) type %s(%d) mount %p typedata %p data %p usecount %d writecount %ld holdcnt %ld numoutput %d clean bufs: bp %p dirty bufs: RDONLYSYNCHRONOUSNOEXECNOSUIDNODEVASYNCEXRDONLY EXPORTED DEFEXPORTED EXPORTANON EXKERB LOCALQUOTAROOTFSflags %b vnodecovered %p syncer %p data %p vfsconf: ops %p name "%s" num %d ref %d flags 0x%x statvfs cache: bsize %x iosize %x blocks %u free %u avail %u files %u ffiles %u f_fsidx {0x%x, 0x%x} owner %u ctime 0x%x syncwrites %lu asyncwrites = %lu fstype "%s" mnton "%s" mntfrom "%s" locked vnodes: %p %p, %pall vnodes: %p, %p,syncersched_sync: fsync failedmounted on: %s syncer vnode sys_mountmount: lost mountunmount: dangling vnodesys_getfhsys_fhopensys_fhstatsys_fhstatfsvn_lockgetcwd: oops, forgot to null lvpgetcwd: oops, went back too farvop_islockedvop_lookupvop_createvop_mknodvop_openvop_closevop_accessvop_getattrvop_setattrvop_readvop_writevop_ioctlvop_pollvop_kqfiltervop_revokevop_fsyncvop_removevop_linkvop_renamevop_mkdirvop_rmdirvop_symlinkvop_readdirvop_readlinkvop_abortopvop_inactivevop_reclaimvop_lockvop_unlockvop_bmapvop_printvop_pathconfvop_advlockvop_reallocblksvop_strategyvop_bwritedead_read: lockdead_write: locktag VT_NON, dead vnode dead_badop calledchkvnlockfifowfiforfifo_read modefifo_write modetag VT_NON, fifo with %ld readers and %ld writersfifo_badop calledportal_closefd: error = %d portalconportal_open: %d extra fds tag VT_PORTAL, portal vnode portal: bad opspec_read modespec_read procspec_read typespec_write modespec_write procspec_write typespec_ioctlspec_fsyncspec_fsync: dirtyspec_fsync: not dirtyspec_close: not specialtag VT_NON, dev %d, %d spec_badop calledspec_open_clone(): cloning device (%d, %d) for pid %u spec_open_clone(): new minor for cloned device is %d spec_close_clone(): freeing minor %d of dev %d for pid %u dos2unixtime(): month value out of range (%ld) denodedeget(): pcbmap returned %d detrunc(): can't truncate root directory, clust %ld, offset %ld deextend: file too largemsdosfs_reclaim(): pushing activemsdosfs_inactive(): pushing activefatentry(): function code doesn't specify get or set fatentry(): get function with no place to put result extendfile(): attempt to extend root directory extendfile: pcbmapmsdosfs_lookup. .. doscheckpath(): .. not a directory? doscheckpath: source and target on different filesystemsRRaArrAamsdosfs: reducing max cluster to %d from %d due to FAT size msdosfs_sync: rofs mod dev %d, %d, %s msdosfs_createmsdosfs_create: no namemsdosfs_write(): bad file typemsdosfs_rename: no namemsdosfs_renamemsdosfs_rename: lost to startdirmsdosfs_rename: lost from startdirmsdosfs_rename: updating .. in root directory?msdosfs_mkdirmsdosfs_mkdir: no namemsdosfs_readdirmsdosfs_strategy: spectag VT_MSDOSFS, startcluster %ld, dircluster %ld, diroffset %ld (LOCKED)bpf_detachd: descriptor not in listbpf: ifpromisc failedbpfbpfwritebpf_mcopybpfattachtoo many interfacesif_attachhead: mallocif_attach: mallocif_clone_listifioctlifconfif_getgroupif_getgroupmembersegressif_group_egress_buildifpromisc%s: can't handle af%d lcpipcppapchap%s: input packet is too small, %d bytes %s: invalid input packet %s: protocol queue overflow %s: Cisco packet in PPP mode %s: invalid input protocol %s: PPP packet in Cisco mode %s: no memory for transmit header %s: cisco invalid packet length: %d bytes %s: cisco unknown packet type: 0x%x %s: up %s: loopback %s: cisco input: %d bytes <0x%x 0x%x 0x%x 0x%x 0x%x-0x%x> %s: cisco output: <0x%lx 0x%lx 0x%lx 0x%x 0x%x-0x%x> %s: %s output <%s id=0x%x len=%d%s: %s invalid packet length: %d bytes %s: %s invalid conf-req length %d %s: %s tlu %s: %s send code-rej for 0x%x %s: %s id mismatch 0x%x != 0x%x %s: %s send terminate-ack %s: %s: ignoring RXJ (%s) for proto 0x%x, danger will robinson %s: lcp echo req but lcp closed %s: invalid lcp echo request packet length: %d bytes %s: got lcp echo req, sending echo rep %s: lcp invalid echo reply packet length: %d bytes %s: lcp got echo rep %s: %s input(%s): <%s id=0x%x len=%d%s: %s up(%s) %s: %s down(%s) %s: %s open(%s) %s: %s close(%s) %s: %s TO(%s) rst_counter = %d %s: %s %s->%s (incoming call) %s: Up event%s: Down event (carrier loss), taking interface down.%s: Down event (carrier loss) [invalid] 0x%lx send conf-ack max_failure (%d) exceeded, send conf-rej send conf-nak [glitch] %lu [empty] [non-empty] [mine %s != his %s] [chap not MD5] %s: lcp parse opt values: send conf-rej [not configured] [invalid chap len] [rej] %s: lcp parse opts: [don't insist on auth for callout][access denied] %s: lcp rej opts: magic glitch %s: lcp nak opts: sppp_lcp_scr%s: ipcp_open(): no IP interface still need hisaddr send conf-ack %s [ack] [addr requested] %s [not agreed] %s: ipcp parse opt values: %s: ipcp parse opts: %s: ipcp rej opts: [agree] [wantaddr %s] %s: ipcp nak opts: sppp_ipcp_scrsppp_chap_input%s: chap invalid packet length: %d bytes %s: chap input <%s id=0x%x len=%d name= value-size=%d value=%s: chap corrupted challenge <%s id=0x%x len=%d%s: chap unknown input(%s) <0x%x id=0x%xh len=%d%s: chap dropping response for old ID (got %d, expected %d) %s: chap response, his name != expected %s: chap bad hash value length: %d bytes, should be %d Welcome!Failed...%s: chap input(%s) <%s id=0x%x len=%d name=%s: chap corrupted response <%s id=0x%x len=%d%s: chap success%s: chap failure%s: chap failure %s: chap TO(%s) rst_counter = %d reconfirmedtlu%s: chap %s, next re-challenge in %d seconds re-challenging supressed %s: chap tld %s: pap invalid packet length: %d bytes %s: pap corrupted input <0x%x id=0x%x len=%d%s: pap corrupted input <%s id=0x%x len=%d%s: pap input(%s) <%s id=0x%x len=%d name= passwd=%s: pap failure%s: pap failure %s: pap success%s: pap TO(%s) rst_counter = %d %s: pap peer TO %s: pap tld %s: LCP keepalive timeout sppp_paramsconf-reqconf-ackconf-nakconf-rejterm-reqterm-ackcode-rejproto-rejecho-reqecho-replydiscard-reqchallengenakresponsemruasync-mapauth-protoqual-protoproto-compaddr-compaddressesaddresscompressioninitialillegalstartingclosedstoppedclosingstoppingreq-sentack-rcvdack-sentopenedestablishterminateauthenticatenetwork-%02x\x%x%d.%d.%d.%d%s: phase %s lo%dlooutput: no header mbuflo_altqstart: can't handle af%d ifmedia_add: can't malloc entryifmedia_set: no match for 0x%x/0x%x ifmedia_set failedifmedia_match: multiple match for 0x%x/0x%x, selected instance %d sl%d: can't allocate buffer %s: af%d not supported slstartslinputpppioctl%s: no compressor for [%x %x %x], %x %s: comp_alloc failed %s: decomp_alloc failed %s output: if_ppp/ccp: not enough data in mbuf (%p+%x > %p+%x) %s: got %d bytes %s: input queue full %s: VJ uncompress failed on type uncomp %s: VJ uncompress failed on type comp %s: decompress failed %d pppdumpmpppwritepppasyncstart%s: too few input mbufs! %s: packet too big %s: bad protocol %x %s: missing UI (0x3), got 0x%x %s: garbage received: 0x%x (need 0xFF) %s: no input mbufs! %s: bad fcs %x %s: too short (%d) %s: bad char %x %s input: pppdumpbbsd_decomp%d: bad sequence # %d, expected %d bsd_decomp%d: peer should have cleared dictionary bsd_decomp%d: ran out of mru bsd_decomp%d: bad code 0x%x oldcode=0x%x max_ent=0x%x explen=%d seqno=%d bsd_decomp%d: bad CLEAR z_compress: deflate returned %d (%s) z_decompress%d: bad seq # %d, expected %d z_decompress%d: inflate returned %d (%s) z_incomp%d: inflateIncomp returned %d (%s) file errorstream errordata errorinsufficient memorybuffer errorunknown compression methodinvalid window sizeinvalid reserved bitincorrect header checkincorrect data checkinvalid block typeinvalid stored block lengthsinvalid bit length repeattoo many length or distance symbolsincomplete dynamic bit lengths treeoversubscribed dynamic bit lengths treeoversubscribed literal/length treeincomplete literal/length treeinvalid literal/length codeinvalid distance code0.95Pstream endtunopentunreadbridge_ioctlbridge_brlconfbridge_input(): no HDRbridge_rtfindbridge_ipsecnot implementedbstp still activenot a bstp membervlanattach: hashinit%s: initialized with non-standard mtu %lu (parent %s) vlan_ioctlvlan_ether_purgemultirn_addmask: mask impossibly already in tree Mask for route not entered Non-unique normal route, mask not entered rn_delete: inconsistent annotation rn_delete: couldn't find our annotation rn_delete: couldn't find us %s %p at %p rn_delete: Orphaned Maskrn_init: radix functions require max_keylen be set rn_initrn_init 2raw_usrreqrtentplroute_init rtable_addrtfreertfree: %p not freed (neg refs) rtfree 2ifafreertflushclone: called with a non-cloning routertflushclone: no rnh_walktreertrequest deletertinit: wrong ifa (%p) was (%p) rttmrplrt_timer_init: already initializedrt_timer_queue_destroy: rtq_count reached 0 rt_timer_remove_all: rtq_count reached 0 rt_timer_add: rtq_count reached 0 rt_timer_timer: rtq_count reached 0 route_outputsysctl_dumpentrysl_compress_tcpenc%dgre_ioctl%s: capabilities 0x%08x trunk_port_lladdrtrunk_ioctl%s: using proto %u %s: failed to remove multicast address on all ports trunk_ether_purgemulti%s: ioctl %lu failed on %s: %d trunk_ether_cmdmulti%s: port %s at index %d trunk_lb_startwlan%s: bad channel ignored; freq %u flags %x number %u %s: invalid channel freq %u flags %x %s: invalid channel (NULL) ieee80211_media_initUnexpected mode %uBad IBSS channel %u ieee80211_wep_crypt%s: %sassociation failed (reason %d) for %s %s: station %s deauthenticated by peer (reason %d) %s: station %s disassociated by peer (reason %d) %s: impossible operating mode%s: received %s from %s rssi %d mode %s %s: got power save probe from %s %s: power save mode off for %s %s: power save mode on for %s null mode%s: open authentication failed (reason %d) for %s newly%s: station %s %s authenticated (open) %s: station %s sent bogus aid %x %s: station %s aid %x doesn't match pspoll aid %x %s: enqueued power saving packet for station %s %s: station %s sent pspoll, but no packets are saved %s: station %s sent bogus power save poll ieee80211_ibss_merge%s: rates mismatch, BSSID %s %s: sync BSSID %s -> (from %s) %s: ieee80211_ibss_merge: bssid mismatch %s %s: my tsft %llu beacon tsft %llu %s: sync TSF with %s %s: tsft offset %s%llu ieee80211_ioctl80211scan%s: no memory for AID bitmap! unable to setup inital BSS node%s: begin %s scan passive%s: creating ibss %s: end %s scan ieee80211_end_scanieee80211_find_nodefreeing bss nodebogus long slot station count %dbogus non-ERP station count %d not in ap mode, mode %u%s: failed to queue raw tx frame %s: sending %s to %s on channel %u mode %s null node%s: no node for dst %s, discard raw tx frame %s: npkt %d firstlen %d lastlen0 %d lastlen %d fraglen %d overlen %d len %d rate %d flags %08x 802.11 packet too large: %u%s: station %s deauthenticate (reason %d) %s: station %s disassociate (reason %d) %s: station %s power save queue overflow of size %d drops %d %s preamble %s slot time%s %s: bogus xmit rate %u setup assoc_reqassoc_respreassoc_reqreassoc_respprobe_reqprobe_respreserved#6reserved#7beaconatimdisassocdeauthreserved#13reserved#14reserved#15INITSCANAUTHASSOCRUNauto11a11gturbo0x"NODS %s->%s(%s) type#%d %dM +%d WEPTODS %sFRDS %sDSDS %s(%s->%s)%s: no recent beacons from %s; rescanning associatedsynchronized%s: %s with %s ssid channel %d start %uMbshort protection enabledAPL1APL1AAPL1_ETSICAPL1_FCCAAPL1WAPL2APL2CAPL2DAPL2_ETSICAPL2WAPL3APL3WAPL4APL4WAPL5APL5WAPLDAPLDEBUGETSI1ETSI1WETSI2ETSI2WETSI3ETSI3AETSI3W,ETSI4ETSI4CETSI4WETSI5ETSI5WETSI6ETSI6WETSIAETSIBETSICETSIEU1WFCC1FCC1AFCC1WFCC2FCC2CFCC2AFCC2WFCC3FCC3AFCCAFRANCEMKK1MKK1_FCCAMKK1AMKK1A1MKK1A2MKK1BMKK2MKK2AMKKANONEWOR01WWOR02WWOR0WWOR1WWOR2WWOR3WWOR4WWOR5_ETSICWOR9WWORAWWORLDaeauazbgbhbnbrbybzcncocrczdkdodzegf2fifrgrgthkhnhuiliqj1j2j3j4j5jmjojpk2kpkrkwkzlbliltlvmcmkmomxmyninlnzpaphpkprqarusasgsisvtntttwuaukuyuzvnyezazwarp_rtrequest: bad gateway value arp_rtrequest: malloc failed arprequestarpresolve: unresolved and rt_expire == 0 arpresolve: can't allocate llinfo arpintrarp: attempt to add entry for %s on %s by %s on %s in_arpinputarp: attempt to overwrite entry for %s on %s by %s on %s arp info overwritten for %s by %s on %s arp: attempt to overwrite permanent entry for %s by %s on %s duplicate IP address %s sent from ethernet address %s arp: ether address is broadcast for IP address %s! arptfreearplookup: unable to enter address for %s revarprequestrevarp[NULL][ ifa_addr= ifa_dsta= ifa_mask= flags=0x%x, refcnt=%d, metric=%d la_rt=%p la_hold=%p, la_asked=0x%lx rtentry=%p flags=0x%x refcnt=%d use=%ld expire=%ld key= mask= gw= ifp=%p ifa=%p genmask= gwroute=%p llinfo=%p (NULL)Route tree for AF_INET (not initialized) in_controlinvalid argument to in_lifaddr_ioctlin_ifinitin_addmultiin_delmultiin_pcbinit: hashinit failedin_pcbinit: hashinit failed for lportinpcbplIPv6 pcb passed into in_pcbconnectin_pcbhashlookup: faddr=%08x fport=%d laddr=%08x lport=%d in6_pcbhashlookup: faddr= fport=%d laddr=in_pcblookup_listen: laddr=%08x lport=%d in6_pcblookup_listen: laddr= lport=%d interneticmp_erroricmp lenicmp_reflecticmp_mtudisc_timeouticmp_mtudisc_timeout: bad route to timeouticmp_redirect_timeout: bad route to timeoutipqeplaeshmac-sha1deflateip_initipintr no HDRsave_rte: olen %d %x hops %xip_srcroute: nhops %d mlen %dredirect (%d) to %x forward: src %x dst %x ttl %x ip_savecontrolip_mrouter_init ip_mrouter_init: so_type = %d, pr_protocol = %d ip_mrouter_done add_vifrmtaddrmaskadd_vif #%d, lcladdr %x, %s %x, thresh %x, rate %d reset_vifdel_vif %d, numvifs %d add_mfcadd_mfc update o %x g %x p %x add_mfc no upcall o %x g %x p %x add_mfc %s o %x g %x p %x dbx %p multiple kernel entriesadd_mfc o %x g %x p %x dbg %p del_mfcdel_mfc origin %x mcastgrp %x ip_mforward: ip_mrouter socket queue full ip_mforward: no rte s %x g %x ip_mforward: received source-routed packet from %x ip_mforward: src %x, dst %x, ifp %p expire_upcalls: expiring (%x %x) wrong if: ifp %p vifi %d vififp %p phyint_send on vif %ld err %d port %x prio %d bw_upcalls_sendbw_upcalls_send: cannot allocate mbuf bw_upcalls_send: ip_mrouter socket queue full unschedule_bw_meter: bw_meter entry not foundip_output: IPv6 pcb is passedip_outputip_output no HDRip_output: tag of length %d (should be %dmalformed IPv4 option passed to ip_optcopyip_setmoptionsrip_attachrip_detachrip_usrreqtcp_inputtcp_input: TCPS_LISTENm_pulldown malfunctiontcp_dooptionstcp_sack_optiontcp_pulloutofbandsynplsyn_cache_insert: bucketoverflow: impossiblesyn_cache_insert: cacheoverflow: impossibleinvalid sc_tp in syn_cache_cleanupsyn_cache_respondtcp_output: options too longtcphdr too bigtcp_outputtcp_output: template len != hdrlen - optlentcp_output REXMTtcpcbpltcpqeplsackhlpltcp_inittcp_respondtcp_ctlinputtcp6_mtudisc_callbacktcp_signaturetcp_timer_rexmttcp_usrreqtcp_identudp_inputudp6_ctlinputIPv6 inpcb to udp_outputudp_usrreqIPv4 Simple EncapsulationIPsec AHIPsec ESPIPcompTCP MD5 Signature Option, RFC 2385gettdbbysrcdstno tdb hash table tdb cnt bucket cnt %d%c %d +(unknown address family)ipsp_addressipsp_is_unspecifiedipsp_reffree: illegal reference count %d for object %p (len = %d, malloctype = %d) ipsp_spd_lookupipsec policyipsec acquireipsp_spd_inpipip_input: should never reach hereipe4_input(): should never be called etherip_inputipsec_common_inputipsec_common_input_cbipsec_common_ctlinputudpencap_ctlinputah6_input: l went zero or negativeesp6_input: l went zero or negativeipcomp6_input: l went zero or negativeesp_initesp_input_cbah_initah_massage_headersah_input_cbcarp_hmac_prepare_ctxcarp_hmac_generatecarp_hmac_verifycarp_setroutecarp: packet received on non-carp interface: %sreceived ttl %d != %d on %spacket too short %d on %schecksum failed on %schecksum failed, on %spacket size %u too smallcarp_proto_input_cinvalid version %d != %dincorrect hashcarp_send_adip6_output failed: %dip_output failed: %d%s: master_down event in INIT state carp_join_multicast6carp_ioctl%s demoted group %s to %dcarp_ether_purgemultiipcomp_initMD5FinalRMD160FinalSHA1Finallibdes v 3.21 - 95/11/21 - eaycryptopcryptodesccrypto_waitcryptof_ioctlcrydevcuio_copydata: off %d < 0iov_copydata: empty in skipcuio_copydata: emptycuio_copydata: len %d < 0cuio_copyback: off %d < 0cuio_copyback: empty in skipuio_copyback: emptycuio_copyback: len %d < 0cuio_apply: len %d < 0cuio_apply: ind %d >= uio_iovcnt %d for offcuio_apply: ind %d >= uio_iovcnt %d for lencuio_apply: off %d < 0swcr_encdecswcr_authcomputeSoftware crypto device cannot initialize!DES3DESBlowfishCAST-128SkipjackRijndael-128/AESAES-CTRARC4HMAC-MD5HMAC-SHA1HMAC-RIPEMD-160HMAC-SHA2-256HMAC-SHA2-384HMAC-SHA2-512Keyed MD5Keyed SHA1MD5SHA1DeflateLZSaes_ctr_cryptmichael_finalrpc denied, status=%d rpc denied, error=%d RPC timeout for server %s (0x%x) prog %u krpc_call: sosend: %d bind failed nfs_read mode nfsbioread: type %x unexpected nfsbioreadnfs_write modenfs_write procnfsvinvalnfs_doio: type %x unexpected Process killed due to text file modification nfs_boot: using interface %s, with revarp & bootparams nfs_boot: socreate, error=%dnfs_boot: GIFFLAGS, error=%dnfs_boot: SIFFLAGS, error=%drevarp failed, error=%dnfs_boot: client_addr=%s nfs_boot: set if addr, error=%dnfs_boot: server_addr=%s hostname=%s nfs_boot_initnfs_boot: bootparam whoami, error=%dnfs_boot: no suitable interfacenfs_boot: bootparam get %s: %d nfs_boot: mountd %s, error=%d nfs_boot_getfhnfs_boot: portmap NFS/v2, error=%d nfs_boot: bootparam_whoami: bad reply nfs_boot: bootparam_getfile: bad reply nfs_hashlocknfsnodeplnfs_commitlknfs_inactive: pushing activenfs_reclaim: pushing activenfskqlcknfskqpwnfskqdetnfskqpollnfsrv3_accessnfsrv_getattrnfsrv_setattrnfsrv_lookupnfsrv_readlinknfsrv_readnfsrv_read iovnfsrv_writenfsrv_write: nd_mrep not freenfsrv_coalesce: bad offnfsrv_createnfsrv_mknodnfsrv_removenfsrv_renamenfsrv_linknfsrv_symlinknfsrv_mkdirnfsrv_rmdirnfsrv_readdirnfsrv_readdirplusnfsrv_commitnfsrv_statfsnfsrv_fsinfonfsrv_pathconfnfsconnfscon sotypenfs send error %d for server %s nfsd send error %d receive error %d from nfs server %s Egad!! short receive (%d/%d) from nfs server %s %s (%d) from nfs server %s impossible packet lengthnfsreply nilnqnfstrynfs_requestis alive againnot respondingnfsndlcknfs sndunlocknfsrcvlknfs rcvunlocknfs_realign_fixup: no memory to pad toKerb nickname short Kerb nick verifier bad Bad kerb verifier Not fullname kerb verifier nfs server %s: %s nfs getstreamnfsd wakeupnfsrcnfsrv cachebuild > MLENnfsm_uiotombuf: iovcnt != 1nfs S too bignfsreqplnqnfstimrcld kerbnfsd initnfsdmbuf siz=%d Bad nfs svc replynfsidlnfsionfsauth1nfsauth2nfs_getnickauth verf too smallnfs_mountroot: rootroot on %s nfs_mountroot: getattr for rootswap on device 0x%x nfs_mountrootswap/swapswap on %s nfs_mountroot: getattr for swap WARNING: no swap nfs_mountroot: can't setup swap vpnfsnfs_mount_diskless: vfs_rootmountalloc failednfs_mountroot: mount %s failed: %dnfs_args: retrying connect nfs_mountnfsdismopen eacces vtyp=%d EEK! readdirrpc resid > 0 EEK! readdirplusrpc resid > 0 .nfsA%05x4.4nfs: sillyrename dir nfs physio/asyncnfs_fsyncnfsfsyncnfs_fsync: not dirtytag VT_NFS, fileid %ld fsid 0x%lxbwrite: buffer is not busy???dev = 0x%x, bsize = %d, size = %d, fs = %s ffs_alloc: bad sizefile system fulluid %u on %s: %s %s: write failed, file system is full ffs_alloc: missing credentialdev = 0x%x, bsize = %d, osize = %d, nsize = %d, fs = %s ffs_realloccg: bad sizeffs_realloccg: missing credentialffs_realloccg: bad blocknodev = 0x%x, optim = %d, fs = %s ffs_realloccg: bad optimdev = 0x%x, bsize = %d, bprev = %d, fs = %s ffs_realloccg: bad bprevffs1_reallocblks: unallocated block 1ffs1_reallocblks: unallocated block 2 %d,ffs1_reallocblks: unallocated block 3ffs1_reallocblks: alloc mismatchffs1_reallocblk: start == endffs1_reallocblks: non-logical clusterffs1_reallocblks: non-physical cluster %dmode = 0%o, inum = %d, fs = %s ffs_valloc: dup allocfree inode %s/%d had %d blocks out of inodes %s: create/symlink failed, no inodes free ffs_clusteralloc: map mismatchffs_clusteralloc: allocated out of groupffs_clusteralloc: lost blockffs_nodealloccg: block not in mapcg = %d, irotor = %d, fs = %s ffs_nodealloccg: map corrupteddev = 0x%x, bsize = %d, size = %ld, fs = %s ffs_blkfree: bad sizebad block %d, ino %u bad blockdev = 0x%x, block = %d, fs = %s ffs_blkfree: freeing free fragffs_blkfree: freeing free blockdev = 0x%x, ino = %u, fs = %s ffs_freefile: range: dev = 0x%x, ino = %d, fs = %sffs_freefile: freeing free inodeffs_checkblk: bad sizeffs_checkblk: partially free fragmentffs_checkblk: bad block %dbno = %d, fs = %s ffs_alloccg: block not in mapstart = %d, len = %d, fs = %s ffs_alloccg: map corruptedffs1_balloc: blk too bigffs1_balloc: ufs_bmaparray returned indirect blockCould not unwind indirect block, error %dffs_update: bad link cntffs_truncate: newspaceffs_truncate2ffs_truncate1ffs_truncate: partial truncate of symlinkffs_indirtrunc: bad buffer sizeDisk overlap start %d, end %d overlap start %d, end %ld Disk buffer overlapffs_mountroot: can't setup bdevvp's ffsWARNING: %s was not properly unmounted WARNING: R/W mount of %s denied. Filesystem is not clean - run fsck ffs_reload: dirty2ffs_reload: dirty1ffs_mountfs(): obsolete rotational table format, please use fsck_ffs(8) -c 1 ffs_mountfs(): Sorry, no UFS2 support (yet) ffs_statfsupdate: rofs modffsinodino1plffs_read: modeffs_read: short symlinkffs_read: type %dffs_write: modeffs_write: typeffs_write: nonsync dir writeffs_fsyncffs_fsync: dirtyffs_fsync: not dirtybmsafemapallocdirectallocindirfreefragdiradddirremsema_release: not heldadd_to_worklist: already on list%s_process_worklist: Unknown type %ssoftdepsoftdep_move_dependencies: need merge codesoftflushpagedepplinodedepplnewblkplbmsafemapplallocdirectplindirdepplallocindirplfreefragplfreeblksplfreefilepldiraddplmkdirpldirremplnewdirblkplsoftdep_setup_inomapdep: found inodesoftdep_setup_blkmapdep: found blocksoftdep_setup_allocdirect: lost blocksoftdep_setup_allocdirect: Bonk art in the headsoftdep_setup_allocdirect: lost entrysoftdep_setup_allocdirect: non-zero indirallocdirect_merge: old %d != new %d || lbn %ld >= %dallocdirect_merge: extra newdirblknewfreefrag: frag sizesoftdep_setup_allocindir_page: Bonk art in the headsetup_allocindir_phase2: not indir blksetup_allocindir: lost blocksetup_allocindir_phase2: blknosoftdep_setup_freeblocks: non-zero lengthsoftdep_setup_freeblocks: inode busysoftdep_setup_freeblocksdeallocate_dependencies: not indirdeallocate_dependencies: already gonedeallocate_dependencies: lost pagedepdeallocate_dependencies: Unknown type %sdeallocate_dependencies: Unexpected type %sfree_allocdirect: extra newdirblkcheck_inode_unwritten: busy inodehandle_workitem_freeblocks: block count handle_workitem_freeblksindir_trunc: lost indirdepindir_trunc: dangling depsoftdep_setup_directory_add: lost inodedepsoftdep_setup_directory_add: lost entryfree_diradd: unfound refnewdirrem: whiteoutnewdirrem: not ATTACHEDnewdirrem: inum %d should be %dsoftdep_change_linkcnt: bad deltahandle_workitem_remove: vgethandle_workitem_remove: bad file deltahandle_workitem_remove: bad dir deltahandle_workitem_remove: truncatehandle_workitem_remove: lost inodedephandle_workitem_freefilesoftdep_disk_io_initiation: readdisk_io_initiation: indirdep gonehandle_disk_io_initiation: Unexpected type %sinitiate_write_filepage: already started %s: dir inum %d != new %dinitiate_write_filepageinitiate_write_inodeblock: already doing I/Osoftdep_write_inodeblock: lost dep2softdep_write_inodeblock: lost dep1%s: indirect pointer #%ld mismatch %d != %dsoftdep_write_inodeblock%s: direct pointer #%ld mismatch %d != %dsoftdep_write_inodeblock: lbn orderinitiate_write_inodeblock: already startedsoftdep_write_inodeblock: Unknown state 0x%xdisk_write_complete: indirdep gonedisk_write_complete: not gonehandle_disk_write_complete: Unknown type %shandle_allocdirect_partdone: dangling dephandle_allocindir_partdone: dangling dependencyhandle_written_inodeblock: not startedhandle_written_inodeblock: new entryhandle_written_inodeblock: filefreehandle_written_inodeblock: live inodedephandle_written_inodeblock: bad size%s: %s #%ld allocated as %dhandle_written_inodeblockindirect pointer%s: %s #%ld mismatch %d != %ddirect pointerhandle_written_inodeblock: Unknown type %shandle_written_mkdir: bad typehandle_written_filepage: not startedhandle_written_filepage: attachedsoftdep_update_inodeblock: update failedsoftdep_update_inodeblock: bwritesoftdep_update_inodeblock: bad deltasoftdep_update_inodeblock: bad link countsoftdep_fsync: pending opssoftdep_fsync: dirtysoftdep_fsync: Unexpected type %ssoftdep_fsync_mountdev: vnode not a disksoftdep_fsync_mountdev: not dirtysoftdep_sync_metadata: Unknown type %sflush_pagedep_deps: flush failedflush_pagedep_deps: lost inodeflush_pagedep_deps: MKDIR_BODYflush_pagedep_deps: MKDIR_PARENTsoftupdaterequest_cleanup: unknown typeclear_remove: vgetclear_remove: fsyncclear_inodedeps: fsync2clear_inodedeps: fsync1clear_inodedeps: vgetsoftdep_check_for_rollback: Unexpected type %ssdsdtydrain_outputsoftdep_deallocate_dependencies: dangling depssoftdep_deallocate_dependencies: unrecovered I/O error%s: got error %d while accessing filesystem deps: ATTACHEDUNDONECOMPLETEDEPCOMPLETEMKDIR_PARENTMKDIR_BODYRMDIRDIRCHG GOINGAWAY IOSTARTED SPACECOUNTED NEWBLOCKUFS1FMTONWORKLIST%s%s(%p) state %b %smount %p ino %u lbn %lld worklist_printfs %p ino %u nlinkdelta %u dino %p %s bp %p savsz %lld fs %p newblk %d state %d bmsafemap %p buf %p lbn %lld newlbk %d oldblk %d newsize %lu olsize %lu %s bp %p inodedep %p freefrag %p savedata %p savebp %p off %d newblk %d oldblk %d freefrag %p %s indirdep %p buf %p vnode %p mp %p blkno %d fsize %ld ino %u previno %u devvp %p mp %p oldsz %lld newsz %lld %s chkcnt %d uid %d mode %x oldino %u vnode %p mp %p off %ld ino %u da_un %p diradd %p bp %p mp %p ino %u dm_un %p pagedep %p softdep_free: unknown type %dmfs_mountroot: can't setup bdevvp'smfsmfs_rootmfs_mount: dup devmfsidlmfs_open not VBLKmfs_strategy: bad devmfs_closemfs_close: dirty buffers mfs_close: ref count %d > 1 mfs_inactive: not inactive (mfs_buflist %p)tag VT_MFS, pid %d, base %p, size %ld mfs_badop calledufs_bmaparray: invalid argumentsufs_bmaparray: indirect block not in cacheufs_getlbns: Invalid indirect block %d specifiedufs_getlbns: indirect block %d not found/usr/src/sys/ufs/ufs/ufs_dirhash.c((((ip)->i_ump->um_fstype == 1) ? (ip)->dinode_u.ffs1_din->di_size : (ip)->dinode_u.ffs2_din->di_size) >= (1 << 9))(dh->dh_onlist)ufsdirhash_lookup: bad offset in hash array(dirblock < dh->dh_nblk && dh->dh_blkfree[dirblock] >= (((slotneeded) + ((4) - 1)) / (4)))ufsdirhash_findfree: free mismatch(offset < dh->dh_dirblks * (1 << 9))(oldoff < dh->dh_dirblks * (1 << 9) && newoff < dh->dh_dirblks * (1 << 9))(offset == dh->dh_dirblks * (1 << 9))ufsdirhash_dirtrunc: blocks in useufsdirhash_dirtrunc: first free corrupt(offset <= dh->dh_dirblks * (1 << 9))ufsdirhash_checkblock: bad offsetufsdirhash_checkblock: bad dir endufsdirhash_checkblock: bad free countufsdirhash_checkblock: bad first-freeufsdirhash_checkblock: missing first-free entryufsdirhash_checkblock: bad dir(block < dh->dh_nblk && block < dh->dh_dirblks)(dh->dh_hused < dh->dh_hlen)ufsdirhash_findslot: '%.*s' not found(dh->dh_hused >= 0)(dh->dh_hash != 0L)((((&ufsdirhash_list)->tqh_first) == 0L))ffs_inactive: pushing activeufs_reclaim: pushing activei_ffs_size too smallmangled entry%s: bad dir ino %d at offset %d: %s bad dirFirst bad Second bad ufs_makedirentry: missing nameufs_direnter: newblkufs_direnter: compact1ufs_direnter: compact2checkpath: .. not a directory usergroupundefinedchkdqufs_quota_free_blocks2: vnode is not locked %s: warning, %s %s disk quota exceeded %s: write failed, %s %s disk quota exceeded for too long %s: write failed, %s disk limit reached chkiqinode quota exceededinode quota exceeded for too long %s: write failed, %s inode limit reached chkdquot: vnode is not lockedchkdquot: missing dquotmissing dquotquotaon: mount point not busyquotaoff: mount point not busysetquotasetusefree dquot isn'tdqsync: dquotdqsyncdqsync: filechown: lost quotaufs_linkufs_link: no nameufs_rename: no nameufs_renameufs_rename: lost to startdirrename: EXDEVufs_rename: same fileufs_rename: lost dir entryufs_rename: lost from startdirufs_mkdirufs_mkdir: no nameufs_readdir: lost in spaceufs_strategy: spectag VT_UFS, ino %d, on dev %d, %d flags 0x%x, effnlink %d, nlink %d mode 0%o, owner %d, group %d, size %lldufs_makeinodeufs_makeinode: no nameext2fs_alloc: missing credentialmode = 0%o, nlinks %d, inum = %d, fs = %s ext2fs_valloc: dup allocext2fs_alloccgblk: cg=%d bno=%d fs=%s ext2fs_alloccg: dup allocext2fs_nodealloccg: block not in mapcg = %d, ipref = %d, fs = %s ext2fs_nodealloccg: map corruptedbad block %d, ino %d dev = 0x%x, ino = %d, fs = %s ifree: range: dev = 0x%x, ino = %d, fs = %sifree: freeing free inodeext2fs_mapsearch: block not in mapext2fs_alloccg: map corrupteduid %d on %s: %s ext2fs_balloc: ufs_getlbns returned indirect blockext2fs_bmaparray: invalid argumentsext2fs_bmaparry: indirect block not in cacheext2fs_bmaparray: num=%d ext2fs_bmaparray: numext2fs_inactive: pushing activeext2fs_truncate1ext2fs_truncate2ext2fs_truncate3ext2fs_truncate: partial truncate of symlinkext2fs_indirtrunc: bad buffer sizeext2fs_readdiri_size too smallrec_len is smaller than minimalrec_len % 4 != 0reclen is too small for name_lendirectory entry across blocksinode out of boundsbad directory entry: %s offset=%d, inode=%lu, rec_len=%d, name_len=%d ext2fs_dirbadentrydirenter: missing nameext2fs_direnter: newblkext2fs_direnter: frag sizeext2fs_direnterext2fs_direnter: compact1ext2fs_direnter: compact2 %u %uext2fs_direnter: compact2checkpath%s: mode%s: short symlinkext2fs_read%s: type %d%s: typeext2fs_write%s: nonsync dir writeext2inoplext2dinoplext2fs_mountroot: can't setup bdevvp'sext2fs%s: file system not clean; please fsck(8) ext2fs_reload: dirty2ext2fs_reload: dirty1ext2fs_statfsExt2 fs: bad block size: %d (expected <=2 for ext2 fs) Ext2 fs: unsupported inode size Ext2 fs: unsupported optional feature Ext2 fs: unsupported revision number: %x ext2fs_link: no nameext2fs_rename: no nameext2fs_rename: lost to startdirrename: linked directoryext2fs_rename: lost dir entryext2fs_rename: mangled dirext2fs_rename: lost from startdirext2fs_mkdir: no nameext2fs_mkdir: blksizeext2fs_makeinode: no nameext2fs_reclaim: pushing active@(#)$arla: xfs_common-bsd.c,v 1.25 2002/12/18 16:32:03 lha Exp $%u/%u@(#)$arla: xfs_dev-common.c,v 1.61 2003/07/15 16:25:42 lha Exp $xfs_devclose never opened?xfsreadxfsNNPFS PANIC Error: Message to small to receive wakeup, opcode = %d xfs_message_rpc: deadlock avoided pid = %u == %u NNPFS PANIC Warning xfs_dev: Unknown message opcode == %d NNPFS PANIC Error: Could not wakeup requestor with opcode = %d properly, to small receive buffer. @(#)$arla: xfs_message.c,v 1.84 2003/06/02 18:25:20 lha Exp $NNPFS PANIC WARNING! xfs_message_installroot: called again! NNPFS PANIC WARNING! xfs_message_installnode: no parent xfs_message_installattr: tokens and no data NNPFS PANIC WARNING! xfs_message_installdata failed! Reason: lookup failed on cache file '%s', error = %d NNPFS PANIC WARNING! xfs_message_installdata failed Reason: No node to install the data into! NNPFS PANIC WARNING! xfs_message_updatefid: %d @(#)$arla: xfs_node.c,v 1.3 2003/02/06 12:56:09 lha Exp $xfs_node_purge@(#)$arla: xfs_node-bsd.c,v 1.70 2003/02/28 02:01:06 lha Exp $xfs_lockfailed to allocate syncer node when xfs daemon diedxfs_attr2attr: bad valuexfs_attr2vattr: bad valueNNPFS PANIC WARNING! xfs_dnlc_enter: %s already in cache @(#)$arla: xfs_syscalls-common.c,v 1.72 2003/01/19 20:53:49 lha Exp $lookup_nodegetfh_compatxfs: remote pioctl: got a negative data size: opcode: %dxfs_pioctl_call: got a humongous in packet: opcode: %d@(#)$arla: xfs_vfsops-bsd.c,v 1.72 2002/12/19 10:30:17 lha Exp $xfs_fhopen@(#)$arla: xfs_vfsops-common.c,v 1.40 2003/06/02 18:26:40 lha Exp $@(#)$arla: xfs_vfsops-openbsd.c,v 1.16 2003/06/02 18:26:50 lha Exp $@(#)$arla: xfs_vnodeops-bsd.c,v 1.123 2003/02/15 16:40:36 lha Exp $xfs_readdir: mail arla-drinkers and tell them to bake burned cookiesxfs_lock: lock NULLxfs_unlock: lock NULL attr: %svalid data: %svalid flags: 0x%x offset: %d @(#)$arla: xfs_vnodeops-common.c,v 1.94 2003/01/27 11:58:50 lha Exp $NNPFS PANIC WARNING! xfs_fsync called after reclaiming! xfs_uio_end_lengthxfs_lookup_commonxfs_create_commonxfs_remove_commonxfs_rename_commonxfs_mkdir_commonxfs_rmdir_commonxfs_link_commonxfs_inactive: failed writing back data: %d xnode: fid: %d.%d.%d.%d /usr/src/sys/uvm/uvm_amap_i.h((offset) & (PAGE_SIZE - 1)) == 0amap_lookup: offset out of rangeamap_lookups: offset out of rangeamap_add: offset out of rangeamap_add: replacing null anonamap_add: slot in useamap_unadd: offset out of rangeamap_unadd: nothing thereamappl/usr/src/sys/uvm/uvm_amap.c((sz) & (PAGE_SIZE - 1)) == 0((padsz) & (PAGE_SIZE - 1)) == 0amap->am_ref == 0 && amap->am_nused == 0((entry->end - entry->start) & (PAGE_SIZE - 1)) == 0((addsize) & (PAGE_SIZE - 1)) == 0amap->am_maxslot < slotneed(((entry->end - entry->start)) & (PAGE_SIZE - 1)) == 0amap_wipeout: corrupt amapcownowpagecownowamap_cow_now: non-resident wired page in anon %pamap_splitref: split at zero offsetamap_splitref: map size check failedamap_pp_adjref: overshot targetamap_pp_adjref: negative reference countuvm_anon_add: can not allocate %d anons uvm_anon_add/usr/src/sys/uvm/uvm_anon.cpg->loan_count > 0anon_pagein: uvmfault_anonget -> %duao_set_swslot: uobj = %p uao_set_swslot: attempt to set a slot on a NOSWAP object/usr/src/sys/uvm/uvm_aobj.cslot == 0uao_create: kernel object already allocateduao_create: hashinit swhash faileduao_create: malloc swslots faileduao_create: asked to enable swap on kernel objectuaoeltplaobjpluao_flush: strange, got an out of range flush (fixed) uao_flush: weird flagsuao_getuao_getpagepg->flags & PG_RELEASEDaobj->u_obj.uo_refs == 0TAILQ_EMPTY(&aobj->u_obj.memq)(pg->flags & PG_RELEASED) == 0udv_attachudv_detach/usr/src/sys/uvm/uvm_device.cuobj->uo_npages == 0 && TAILQ_EMPTY(&uobj->memq)udv_faultfltamapcopyanonget1anonget2flt_noram1vm_map_lock_read: intrsafe map/usr/src/sys/uvm/uvm_fault.cresult != VM_PAGER_PENDuvmadvice[ufi.entry->advice].advice == ufi.entry->adviceflt_pmfail1uvmexp.swpgonly <= uvmexp.swpagesflt_noram3flt_noram2uobjpage != PGO_DONTCAREflt_pmfail2flt_noram4flt_noram5uvm_fault: want to promote data, but no anonfltagain2uobj->pgops->pgo_releasepg != NULL(pages[lcv]->flags & PG_RELEASED) == 0uvm_fault: uvmfault_anonget -> %d(map->flags & VM_MAP_INTRSAFE) == 0start >= vm_map_min(map) && end <= vm_map_max(map)va >= entry->startentry->next != &map->header && entry->next->start <= entry->enduvm_fault_unwire_locked: address not in mapscheduleruvm_init: page size not setuvm_km_init: could not reserve space for kerneluvm_km_suballoc: unable to allocate space in parent mapuvm_km_suballoc: submap allocation faileduvm_km_suballoc: unable to create submap/usr/src/sys/uvm/uvm_km.cuobj->pgops == &aobj_pagerUVM_OBJ_IS_INTRSAFE_OBJECT(uobj)(pp->pqflags & PQ_INACTIVE) == 0(pp->pqflags & PQ_ACTIVE) == 0(pp->flags & PG_BUSY) == 0km_getwait2vm_map_pmap(map) == pmap_kernel()km_allockm_alloc1wuvm_km_alloc1: non-released pagevallocwaitkmthreadkmallocvmmaplk/usr/src/sys/uvm/uvm_map.cuvm_rb_insert: duplicate entry?uvm_mapent_alloc: out of static map entries uvm_mapent_alloc: cannot allocate map entry# uvm_map() successful calls# uvm_map() back merges# uvm_map() missed forward# map lookup calls# map lookup hint hitsvmspplvmmpeplvmmpekplUVM_OBJ_IS_KERN_OBJECT(uobj)(align & (align - 1)) == 0(flags & UVM_FLAG_FIXED) == 0 || align == 0tmp && tmp->space >= length!VM_MAPENT_ISWIRED(first_entry)uvm_map_replace1uvm_map_replace3uvm_map_replace5uvm_map_replace4tmpent->start=0x%lx, tmpent->end=0x%lx, end=0x%lx uvm_map_replace2(start & PAGE_MASK) == 0 && (len & PAGE_MASK) == 0(flags & UVM_EXTRACT_REMOVE) == 0 || (flags & (UVM_EXTRACT_CONTIG|UVM_EXTRACT_QREF)) == 0uvm_map_pageable: stale mapvm_map_upgrade: failed to upgrade lockmap->flags & VM_MAP_PAGEABLEuvm_map_pageable_all: stale map(flags & (PGO_FREE|PGO_DEACTIVATE)) != (PGO_FREE|PGO_DEACTIVATE)start >= current->startpg->uobject == NULLpg->uanon == anonuvm_map_clean: weird flagsfork: encountered a submap during fork (illegal)fork: non-copy_on_write map entry marked needs_copy (illegal)MAP %p: [0x%lx->0x%lx] #ent=%d, sz=%u, ref=%d, version=%u, flags=0x%x pmap=%p(resident=%d) - %p: 0x%lx->0x%lx: obj=%p/0x%llx, amap=%p/%d submap=%c, cow=%c, nc=%c, prot(max)=%d/%d, inh=%d, wc=%d, adv=%d OBJECT %p: locked=%d, pgops=%p, npages=%d, refs= PAGES : <%p,0x%llx> refs=%d PAGE %p: %b flags=%s, pqflags=%s, vers=%d, wire_count=%d, pa=0x%llx uobject=%p, uanon=%p, offset=0x%llx loan_count=%d [page ownership tracking disabled] >>> ANON DOES NOT POINT HERE <<< (%p) checking pageq list >>> PAGE NOT FOUND ON PAGEQ LIST! <<< uvm_page_printit page found on pageq list anon backpointer is OK checking object list >>> PAGE NOT FOUND ON OBJECT LIST! <<< page found on object list /usr/src/sys/uvm/uvm_mmap.c!UVM_ET_ISSUBMAP(entry)start >= entry->start!UVM_OBJ_IS_KERN_OBJECT(entry->object.uvm_obj)/usr/src/sys/uvm/uvm_page_i.hpg->wire_count == 0lcv != -1uvm_page_bootstrap: no memory pre-allocateduvm_page_init: lost %ld page(s) in init uvm_page_inituvm_setpagesize: page size not a power of twouvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: out of memoryuvm_pageboot_alloc: pmap_growkernel() faileduvm_page_physget: called _after_ bootstrapuvm_page_physget: out of memory!uvm_page_physload: page size not set!uvm_page_physload: start >= enduvm_page_physload: tried to add RAM after vm_mem_inituvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX uvm_page_physload: bad free list %duvm_page_physrehash: WARNING: could not grow page hash table rehash: physical memory config [segs=%d of %d]: 0x%llx->0x%llx [0x%llx->0x%llx] STRATEGY = RANDOM number of buckets = %d /usr/src/sys/uvm/uvm_page.cobj == NULL || anon == NULLoff == trunc_page(off)uvm_pagealloc_strat: bad strat %dfree_list >= 0 && free_list < VM_NFREELISTpg->flags & PG_TABLED(pg->flags & PG_TABLED) == 0saved_loan_count == 0/usr/src/sys/uvm/uvm_pager_i.hrvemergvapager_map/usr/src/sys/uvm/uvm_pager.cnpages <= MAXBSIZE >> PAGE_SHIFTpppp->flags & PG_BUSY!uobj || obj_is_aliveswap || pg->uobject == uobj!write || (pgs[i]->flags & PG_FAKE) == 0pagedaemon: deadlock detected! pgdaemon/usr/src/sys/uvm/uvm_pdaemon.cp->loan_count > 0anon->an_swslot != 0uvmexp.swpginuse <= uvmexp.swpagespagedaemon: pageout returned invalid 'unlock' codep->uanon != NULL/usr/src/sys/uvm/uvm_pglist.c(alignment & (alignment - 1)) == 0(boundary & (boundary - 1)) == 0(m->pqflags & (PQ_ACTIVE|PQ_INACTIVE)) == 0%s = %d Current UVM status: pagesize=%d (0x%x), pagemask=0x%x, pageshift=%d %d VM pages: %d active, %d inactive, %d wired, %d free min %d%% (%d) anon, %d%% (%d) vnode, %d%% (%d) vtext pages %d anon, %d vnode, %d vtext freemin=%d, free-target=%d, inactive-target=%d, wired-max=%d faults=%d, traps=%d, intrs=%d, ctxswitch=%d softint=%d, syscalls=%d, swapins=%d, swapouts=%d, kmapent=%d fault counts: noram=%d, noanon=%d, pgwait=%d, pgrele=%d ok relocks(total)=%d(%d), anget(retries)=%d(%d), amapcopy=%d neighbor anon/obj pg=%d/%d, gets(lock/unlock)=%d/%d cases: anon=%d, anoncow=%d, obj=%d, prcopy=%d, przero=%d daemon and swap counts: woke=%d, revs=%d, scans=%d, obscans=%d, anscans=%d busy=%d, freed=%d, reactivate=%d, deactivate=%d pageouts=%d, pending=%d, nswget=%d nswapdev=%d, nanon=%d, nanonneeded=%d nfreeanon=%d swpages=%d, swpginuse=%d, swpgonly=%d paging=%d kernel pointers: objs(kern/kmem)=%p/%p uvm_swap_init: can't get vnode for swap deviceswapmapswp vnxswp vnduvm_swap_init: extent_create failedswapdrum_addsys_swapctlswapctl: copystrswapctl: miniroot copy failedswap0x%04xswap_on: miniroot larger than swap?Preserved %d pages of miniroot leaving %d pages of swap swap_on: unable to preserve minirootdisklabel region/usr/src/sys/uvm/uvm_swap.csdp->swd_npginuse == sdp->swd_npgbadswap_off: swapdev not in listswstrategy: vnode type 0x%xsw_reg_strategy: swap to sparse filevnx->vx_pending == 0uvmexp.nswapdev >= 1sdp != NULLwarning: resource shortage: %d pages of swap lost sdp->swd_npginuse >= nslotsflags & PGO_SYNCIOswapmount: no device swapmount: no device 2 swap_deviceswapmount: copystrswap_decrypt: key not initializedsbrk: grow %ld failed, error = %d uvm_coredump: user process with submap?uvm_deallocate with null mapuvnsyncuvn_attach: blocked at %p flags 0x%x uvn_attachuvn_deref: vnode VM object still has pages afer syncio/free flushuvn_termuvm_vnp_terminate: io sync wanted bit setuvn_releasepg: page not released!uvn_releasepg: kill flag set on referenced object!uvn_releasepg: pages in object with npages == 0uvn_flush: obj=%p, offset=0x%llx. error during pageout. uvn_flush: WARNING: changes to page may be lost! uvn_flushuvn_flush: PGO_SYNCIO return 'try again' error (impossible)uvn_cluster: offset out of rangeuvn_getuvn_getpageuvn_iosyncgif_output: recursively called too many times NULL pointer passed to ip_ecn_ingressNULL pointer passed to ip_ecn_egressNULL pointer passed to ip6_ecn_ingressNULL pointer passed to ip6_ecn_egressin_gif_outputin6_gif_outputin6_pcbconnectin6_pcbnotifyHuh? Thought in6_pcbnotify() never got called with mapped! in6_ifloop_requestADDDELETEin6_ifloop_request: %s operation failed for %s (errno=%d) in6_controlnd6_prelist_add succeeded but no prefix prefix ioctls are now invalidated. please use ifconfig. in6_update_ifain6_update_ifa: addmulti failed for %s on %s (errno=%d) in6_update_ifa: failed to remove a route to the old destination: %s in6_update_ifa: the prefix length of an existing (%s) address should not be changed in6_update_ifa: valid lifetime is 0 for %s in6_update_ifa: prefixlen should be 128 when dstaddr is specified in6_update_ifa: a destination can be specified for a p2p or a loopback IF only in6_purgeaddr: failed to remove a route to the p2p destination: %s on %s, errno=%d Couldn't unlink in6_ifaddr from in6_ifaddr in6_unlink_ifa: autoconf'ed address %p has no prefix invalid argument to in6_lifaddr_ioctlin6_savemkludge: no kludge spacein6_addmultiin6_delmultiin6_are_prefix_equal: invalid prefix length(%d) in6_prefixlen2mask: invalid prefix length(%d) in6_prefixlen2maskin6_ifawithscope: output interface is not specified get_rand_ifid%s: interface identifier generated by random number %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x %s: failed to get interface identifier %s: borrow interface identifier from %s %s: got interface identifier from %s %s: got interface identifier from itself in6_ifattach_linklocalin6_ifattach_linklocal: failed to configure a link-local address on %s (errno=%d) %s: no ifid available ia == NULL in in6_ifattach_linklocalin6_ifattach_loopbackin6_ifattach_loopback: failed to configure the loopback address on %s (errno=%d) in6_nigroupin6_ifattach: %s has too small MTU, IPv6 not enabled in6_ifattachin6_ifattach: %s is not multicast capable, IPv6 not enabled in6_ifdetach%s: didn't unlink in6ifaddr from list in6_cksum: mbuf len (%d) < off+len (%d+%d)in6_cksum: out of datainternet6%s:%d: ip6q already locked /usr/src/sys/netinet6/frag6.cip6q_lock%s:%d: ip6q lock not held ip6q lock checkicmp6_mtudisc_callback_registerENOBUFS in icmp6_error %d icmp6_input: unknown type %d(src=%s, dst=%s, ifid=%d) ICMP6 checksum error(%d|%x) %s icmp6_notify_erroricmp6_notify_error: in6_embedscope failed icmp6_mtudisc_updateni6_inputicmp6_rip6_inputicmp6_reflecticmp6_reflect: source can't be determined: dst=%s, error=%d /usr/src/sys/netinet6/icmp6.csanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d (src=%s dst=%s tgt=%s)icmp6_redirect_inputICMP6 redirect sent from %s rejected; must be from linklocal ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s ICMP6 redirect rejected; neither router case nor onlink case: %s icmp6_redirect_input: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s icmp6_redirect_input: invalid ND option, rejected: %s ICMP6 redirect rejected; redirect dst must be unicast: %s ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s ICMP6 redirect rejected; no route found for redirect dst: %s icmp6_redirect_outputicmp6_mtudisc_timeout: bad route to timeouticmp6_redirect_timeout: bad route to timeoutip6_initip6_inputip6_input: packet to an unready address %s->%s ip6_savecontrolip6_pullexthdr: invalid nxt=%d ip6_nexthdrip6_nexthdr: m == NULLOpenBSD-currentip6_forwardcannot forward from %s to %s nxt %d received on %s cannot forward src %s, dst %s, nxt %d, rcvif %s, outif %s ip6_forward: tag of length %d (should be %dip6_mrouter_doneadd_m6ifregister_mifdel_m6ifadd_m6fc: %s o %s g %s p %x dbx %p del_m6fcip6_mforwardip6_mforward: ip6_mrouter socket queue full ip6_mdqregister_sendip6_outputip6_output: tag of length %d (should be %dassumption failed: hdr not splitip6_ctloutputip6_getpcboptip6_getpcbopt: unexpected option ip6_setmoptionsip6_setpktopt: impossible case ip6_rthdr0nd6_init called more than once(ignored) nd6_setmtu0: new link MTU on %s (%lu) is too small for IPv6 ndopts == NULL in nd6_optionuninitialized ndopts in nd6_optionndopts == NULL in nd6_optionsduplicated ND6 option found (type=%d) too many loop in nd opt nd6_options: unsupported option %d - option ignored uninitialized ndopts in nd6_optionsln->ln_rt == NULLln->ln_rt->rt_ifp == NULLrt_llinfo(%p) is not equal to ln(%p)dst=0 in nd6_timer(ln=%p)nd6_lookupunspecnd6_lookup: failed to lookup %s (if = %s) nd6_freend6_rtrequestnd6_rtrequest: bad gateway value: %s %s: failed to join %s (errno=%d) nd6_rtrequest: malloc failed nd6_ioctla router(%s) advertises a prefix with non-link local address default router list contains a non-linklocal address(%s) ifp == NULL in nd6_cache_lladdrfrom == NULL in nd6_cache_lladdrnd6_output: can't allocate llinfo for %s (ln=%p, rt=%p) nd6_storelladdr: something odd happens nd6_storelladdr: sdl_alen == 0, dst=%s, if=%s scope error in prefix list (%s) nd6_ns_inputnd6_ns_input: src=%s nd6_ns_input: dst=%s nd6_ns_input: tgt=%s nd6_ns_input: invalid hlim (%d) from %s to %s on %s nd6_ns_input: bad DAD packet (wrong ip6 dst) nd6_ns_input: lladdrlen mismatch for %s (if %d, NS packet %d) nd6_ns_input: duplicate IP6 address %s nd6_ns_input: bad DAD packet (link-layer address option) nd6_ns_input: invalid ND option, ignored nd6_ns_input: bad NS target (multicast) nd6_ns_outputnd6_ns_output: source can't be determined: dst=%s, error=%d nd6_ns_output: max_linkhdr + maxlen >= MCLBYTES (%d + %d > %d) nd6_ns_output: insufficient MCLBYTESnd6_na_inputnd6_na_input: invalid hlim (%d) from %s to %s on %s nd6_na_input: duplicate IP6 address %s nd6_na_input: lladdrlen mismatch for %s (if %d, NA packet %d) nd6_na_input: invalid ND option, ignored nd6_na_input: a solicited adv is multicasted nd6_na_input: invalid target address %s nd6_na_outputnd6_na_output: source can't be determined: dst=%s, error=%d nd6_na_output: max_linkhdr + maxlen >= MCLBYTES (%d + %d > %d) nd6_na_output: insufficient MCLBYTES%s: starting DAD for %s nd6_dad_start: memory allocation failed for %s(%s) nd6_dad_start: called with non-tentative address %s(%s) nd6_dad_start: ifa->ifa_ifp == NULLnd6_dad_timer: called with null parameter %s: DAD complete for %s - no duplicates found %s: could not run DAD, driver problem? nd6_dad_timer: called with non-tentative address %s(%s) nd6_dad_timer: called with duplicated address %s(%s) nd6_dad_timer: DAD structure not found nd6_dad_duplicated: DAD structure not found %s: DAD detected duplicate IPv6 address %s: NS in/out=%d/%d, NA in=%d %s: DAD complete for %s - duplicate found %s: manual intervention required nd6_dad_ns_input: ignoring DAD NS packet for address %s(%s) ifa == NULL in nd6_dad_ns_inputifa == NULL in nd6_dad_na_inputnd6_rs_inputnd6_rs_input: invalid hlim (%d) from %s to %s on %s nd6_rs_input: lladdrlen mismatch for %s (if %d, RS packet %d) nd6_rs_input: invalid ND option, ignored nd6_ra_inputnd6_ra_input: invalid hlim (%d) from %s to %s on %s nd6_ra_input: src %s is not link-local nd6_ra_input: lladdrlen mismatch for %s (if %d, RA packet %d) nd6_ra_input: bogus mtu mtu=%lu sent from %s; exceeds maxmtu %lu, ignoring nd6_ra_input: bogus mtu option mtu=%lu sent from %s, ignoring nd6_ra_input: invalid option len %d for prefix information option, ignored nd6_ra_input: invalid prefix len %d for prefix information option, ignored nd6_ra_input: invalid prefixlen %d for rfc2374 prefix %s, ignored nd6_ra_input: invalid prefix %s, ignored nd6_ra_input: invalid ND option, ignored defrouter_addreqdefrouter_delreqdr == NULL in defrouter_delreqdefrouter_select: called unexpectedly (forwarding=%d, accept_rtadv=%d) defrouter_select: more than one router is installed nd6_prelist_add: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_remove: failed to make %s/%d offlink on %s, errno=%d prelist_update: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_update: nd6_prelist_add failed for %s/%d on %s errno=%d, returnpr=%p pfxlist_onlink_check: failed to make %s/%d offlink, errno=%d nd6_prefix_onlinknd6_prefix_onlink: failed to add route for a prefix (%s/%d) on %s, gw=%s, mask=%s, flags=%lx errno = %d nd6_prefix_onlink: failed to find any ifaddr to add route for a prefix(%s/%d) on %s nd6_prefix_onlink: %s/%d is already on-link nd6_prefix_offlinknd6_prefix_offlink: failed to recover a prefix %s/%d from %s to %s (errno = %d) nd6_prefix_offlink: failed to delete route: %s/%d on %s (errno = %d) nd6_prefix_offlink: %s/%d is already off-link in6_ifaddin6_ifadd: failed to make ifaddr %s on %s (errno=%d) in6_ifadd: wrong prefixlen for %s (prefix=%d ifid=%d) in6_init_prefix_ltimes: preferred lifetime(%d) is greater than valid lifetime(%d) rip6_inputrip6_outputrip6_attachrip6_usrreqrip6_detachudp6_outputPF_KEYpfkeyv2_policypfkeyv2_sendhmac-ripemd160hmac-md5hmac-sha2-256hmac-sha2-384hmac-sha2-512lzsaesctr3desdesblowfishskipjackcast128pfkeyv2_parsemessagenmea%dnmea%d: tty timestamping enabled, but no PPS signal nmea%d: PPS signal ok GPRMCGPS simulatedGPS autonomousGPS differentialGPS estimatedGPS not validGPS unknownGPSspsrr1r2r3r4r5r6r7r8r9r10r11r12usr_spusr_lrsvc_spsvc_lrpcund_spabt_spirq_spFaulted in DDB; continuing... address %p is invalid address 0x%08lx not a valid page framedb_fetch_reg: botchbranch_taken: botchscp=0x%08x rlv=0x%08x ( rsp=0x%08x rfp=0x%08xBad frame pointer: %p Bad user frame pointer: %p %sr%d=0x%08xtrace: pid %d at %p not found frame address = %08x frame address must be specified spsr=%08x r0 =%08x r1 =%08x r2 =%08x r3 =%08x r4 =%08x r5 =%08x r6 =%08x r7 =%08x r8 =%08x r9 =%08x r10=%08x r11=%08x r12=%08x r13=%08x r14=%08x r15=%08x slr=%08x mainbusmainbus_bs_alloc(): Help!mainbus_bs_free(): Help!cpu%s, #0x%03ximbimbrangeswiblxblSnmsmlaSnmsdumullSdnmssmullumlalsmlalstrtdaWldrtstrbtldrbtstrldrstrbldrbstmYnWlldmXnWlldrsbldrhstrhldrshswpdmoswpbmrsdpmsrpFmpF2bxclzdmbkptSdn2eorsubrsbadcsbcrsctstDn2teqcmpcmnorrmovSd2bicmvnadfPRfghmufsufrsfdvfrdfpowrpwrmffmlfdvfrdpolfpbopmvfPRfhmnfabsrndsqtlgnexpsincostanasnacsatnfpuopstfQLvldffltPRgdfixPRdhwfsrfswfcrfccmfPRghcnfcmfecnfemcr2#zmcrmrc2mrccdp2#ycdpldc2L#vldcstc2stcund%s %08x %s%s#0x%08xp%d_f%d#%s[r%d]cpsr[%c - unknown]%d, c%d, c%d, c%d, %dr%d, c%d, c%d, %d, rrx, %s r%d, %s #%d{r%d-r%d}^[r%d#0x%02xf%d, c%d, No support for this CPU type (%08x) in kernelcpu.branchpredictcpu.cachecpu.nocachexscale.branchpredictxscale.cachexscale.icachexscale.dcache/usr/src/sys/arch/arm/arm/process_machdep.ctf != NULLprocess_read_regs: Interrupts blocked in user processprocess_write_regs: Interrupts blocked in user process/usr/src/sys/arch/arm/arm/syscall.cnargs <= MAXARGS/usr/src/sys/arch/arm/arm/undefined.ccoproc >= 0 && coproc < MAX_COPROCShandler != NULLUndefined instruction in kernel WARNING: not updating battery clock Warning IRQ's disabled during boot() real mem = %u (%uK) %uMB cpu_startup: system table size inconsistencycpu_startup: cannot allocate UVM space for buffersavail mem = %lu (%uK) using %d buffers containing %u bytes (%uK) of memory cpu_startup: not enough memory for buffer cachecpu_startup: no room for system tables; %d bytes required_bus_dmamap_load_mbuf: no packet header_bus_dmamap_load_uio: USERSPACE but no proc_bus_dmamap_load_raw: not implemented_bus_dmamap_sync: mix PRE and POST_bus_dmamap_sync: bad lengthunknown buffer type %d _bus_dmamap_sync_bus_dmamap_sync: ARM32_BUFTYPE_INVALID_bus_dmamap_sync: ARM32_BUFTYPE_RAW_bus_dmamap_sync: bad offset %lu (map size is %lu)_bus_dmamem_map: size botch_bus_dmamem_unmap_bus_dmamem_mmap: offset unaligned_bus_dmamem_mmap: segment unaligned_bus_dmamem_mmap: segment size not multiple of page sizeuvm_pglistalloc returned non-sensical address 0x%lx _bus_dmamem_alloc_range%s: SA-110 with bugged STM^ instruction rev 0rev 1rev 2rev 3rev 4rev 5rev 6rev 7rev 8rev 9rev 10rev 11rev 12rev 13rev 14rev 15step Jstep Kstep Sstep Tstep Bstep Cstep Dstep Erev 10step Gstep A-0step B-0step B-1step B-2step B-3step B-4step B-5(IXP1200 step A)(IXP1200 step B)(IXP1200 step C)(IXP1200 step D)(IXP1240/1250 step A)(IXP1240 step B)(IXP1250 step B)step A-1step C-0step D-0step ?step C-5step 0ARM600ARM610ARM620ARM700ARM710ARM7500ARM710aARM7500FEARM710TARM720TARM740T (8 KB cache)ARM740T (4 KB cache)ARM810ARM920TARM922TARM940TARM946E-SARM966E-STI ARM925TARM1020EARM1022E-SSA-110SA-1100SA-1110IXP1200i80200i80321 400MHzi80321 600MHzi80219 400MHzi80219 600MHzPXA250PXA210PXA27xIXP425 533MHzIXP425 400MHzIXP425 266MHzCPU_ARM2ARM2asCPU_ARM250CPU_ARM3CPU_ARM6CPU_ARM7CPU_ARM7TDMICPU_ARM8ARM9TDMIARM9E-SARM10ECPU_ARM10SA-1CPU_SA110XScaleCPU_XSCALE_...wr-thruwr-back**unknown 3****unknown 4**wr-back-lockwr-back-lock-Awr-back-lock-B**unknown 8****unknown 9****unknown 10****unknown 11****unknown 12****unknown 13****unknown 14****unknown 15**%s: IDC disabled IDC enabled WB disabled WB enabled LABT EABT%s: %dKB/%dB %d-way %s unified cache %s: %s does not fully support this CPU. %s: This kernel does not fully support this CPU. %s: Recompile with "options %s" to correct this. %s: %dKB(%db/l,%dway) I-cache, %dKB(%db/l,%dway) %s D-cache branch prediction enabled DC disabled DC enabled IC disabled IC enabledunknown CPU (ID = 0x%x)%s %s (%s core)Processor failed probe - no CPU ID Vector ExceptionAlignment Fault 1Terminal ExceptionAlignment Fault 3External Linefetch Abort (S)Translation Fault (S)External Linefetch Abort (P)Translation Fault (P)External Non-Linefetch Abort (S)Domain Fault (S)External Non-Linefetch Abort (P)Domain Fault (P)External Translation Abort (L1)Permission Fault (S)External Translation Abort (L2)Permission Fault (P) uvm_fault(%p, %lx, %x, 0) -> %x UVM: pid %d (%s), uid %d killed: out of swap Non-emulated page fault with intr_depth > 0 data_abort_fault: Misaligned Kernel-mode Program Counter kernelFatal %s mode data abort: '%s' trapframe: %p FSR=%08x, FAR=r0 =%08x, r1 =%08x, r2 =%08x, r3 =%08x r4 =%08x, r5 =%08x, r6 =%08x, r7 =%08x r8 =%08x, r9 =%08x, r10=%08x, r11=%08x r12=%08x, usp=%08x, ulr=%08xssp=%08x, slr=%08x, pc =%08x Fatal abortInvalid, Fatal %s mode prefetch abort at 0x%08x trapframe: %p, spsr=%08x Non-emulated prefetch abort with intr_depth > 0 badaddr: invalid size (%lu)mmrwpmap_clean_page: cache inconsistencypmap_enter: no pv entriespmap_enter: failed to allocate L2 bucketpmap_init_l1: can't get PA of L1 at %ppmapplpvepll2dtblpll2ptpplpmap_bootstrap: WARNING! wrong cache mode for primary L1 @ 0x%lx pmap_bootstrap: WARNING! wrong cache mode for L2 pte @ %p pmap_bootstrap: No L2 for va 0x%x, pa 0x%lxpmap_bootstrap: out of static L2spmap_bootstrap: No L2 for L2 @ va %ppmap_alloc_specials: no l2b for 0x%lx/usr/src/sys/arch/arm/arm/pmap.cnew_page > last_bootstrap_pageCannot allocate L1 KVMCannot allocate L1 physical pagespmap_alloc_l1pt: pglist not empty((va | pa) & L1_S_OFFSET) == 0pmap_map_entry: no L2 table for VA 0x%08lxpmap_map_entry: can't find L2 table for VA 0x%08lx((va | pa) & PGOFSET) == 0(va & ((L1_S_SIZE * 4) - 1)) == 0(l2pv->pv_pa & PGOFSET) == 0pmap_map_chunk: no L2 table for VA 0x%08lxpmap_map_chunk: can't find L2 table for VA0x%08lxpmap_map_chunk: no L1 table providedxscale_setup_minidata: can't find L2 table for VA 0x%08lxuser pmap (%p): pmap_kernel (%p): domain %d, l1 at %p %08lx: %c |0000 |8000 |10000 |18000 |20000 |28000 |30000 |38000 pa 0x%08lx: krw %d kro %d urw %d uro %d %c va 0x%08lx, flags 0x%x dumpconf: bad dumpdev=0x%x dumping to dev %u,%u offset %ld dump device bad aborted from console i/o error device not ready succeeded area improper area unavailable dump to dev %u,%u not possible pagemove: size=%08lxvmapbufvunmapbufThe operating system has halted. Please press any key to reboot. rebooting... reboot failed; spinning Attempting to power down... %08lx -> %08lx @ %08lx cpu not recognized! OpenBSD/zaurus booting ... initarm: Configuring system ... physmemory: %d pages at 0x%08lx -> 0x%08lx Allocating page tables freestart = 0x%08lx, free_pages = %d (0x%08x) initarm: Failed to align the kernel page directoryIRQ stack: p0x%08lx v0x%08lx ABT stack: p0x%08lx v0x%08lx UND stack: p0x%08lx v0x%08lx SVC stack: p0x%08lx v0x%08lx Creating L1 page table at 0x%08lx Mapping kernel Constructing L2 page tables freestart = 0x%08lx, free_pages = %d (0x%x) switching to new L1 page table @%#lx...bootstrap done. init subsystems: stacks vectors undefined page pmap initarm: out of memory/usr/src/sys/arch/zaurus/zaurus/zaurus_machdep.cxscale_minidata_clean_size <= PAGE_SIZEglassbootfile: %s bootargs: %s ffuartbtuartstuartunknown option `%c' attempting to switch console to lcd screen %sCheck Condition (error %#x) on opcode 0x%x AT BLOCK #: %d (decimal) SENSE KEY: %s INFO: 0x%x (VALID flag %s) SKSV: %s FRU CODE: 0x%x ASC/ASCQ: %s COMMAND INFO: 0x%x %c Incorrect Length Indicator Set%c EOM Detected%c Filemark Detectedscxsplsctkplscsiunable to create scsi task threadslackingoutstanding scsi tasksgetxscannot allocate scsi xs only the first 4,294,967,295 sectors will be used. scsi_execute_xs: USER without NOSLEEPscsi_execute_xs: USER with POLLscsicmdscsi_execute_xs: NOSLEEP and POLLscsi_execute_xs: invalid return code (%#x)scsi_scsi_cmd: buffer without nosleepunknown error category (0x%x) from scsi driver scbusyprobe%s(%s:%d:%d): No Additional SenseSoft ErrorNot ReadyMedia ErrorHardware ErrorIllegal RequestUnit AttentionWrite ProtectedBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare ErrorReservedNo Additional Sense InformationFilemark DetectedEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnCleaning RequestedErase Operation In ProgressLocate Operation In ProgressRewind Operation In ProgressSet Capacity Operation In ProgressVerify Operation In ProgressNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Not Ready, Rebuild In ProgressLogical Unit Not Ready, Recalculation In ProgressLogical Unit Not Ready, Operation In ProgressLogical Unit Not Ready, Long Write In ProgressLogical Unit Not Ready, Self-Test In ProgressLogical Unit Not Accessible, Asymmetric Access State TransitionLogical Unit Not Accessible, Target Port In Standby StateLogical Unit Not Accessible, Target Port In Unavailable StateLogical Unit Not Ready, Auxiliary Memory Not AccessibleLogical Unit Not Ready, Notify (Enable Spinup) RequiredLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorLogical Unit Communication CRC Error (ULTRA-DMA/32)Unreachable Copy TargetTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureHead Select FaultError Log OverflowWarningWarning - Specified Temperature ExceededWarning - Enclosure DegradedWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedWrite Error - Recommend ReassignmentCompression Check Miscompare ErrorData Expansion Occurred During CompressionBlock Not CompressibleWrite Error - Recovery NeededWrite Error - Recovery FailedWrite Error - Loss Of StreamingWrite Error - Padding Blocks AddedAuxiliary Memory Write ErrorWrite Error - Unexpected Unsolicited DataWrite Error - Not Enough Unsolicited DataError Detected By Third Party Temporary InitiatorThird Party Device FailureCopy Target Device Not ReachableIncorrect Copy Target Device TypeCopy Target Device Data UnderrunCopy Target Device Data OverrunInvalid Information UnitInformation Unit Too ShortInformation Unit Too LongID CRC Or ECC ErrorUnrecovered Read ErrorRead Retries ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block ReadNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite The DataDe-Compression CRC ErrorCannot Decompress Using Declared AlgorithmError Reading UPC/EAN NumberError Reading ISRC NumberRead Error - Loss Of StreamingAuxiliary Memory Read ErrorRead Error - Failed Retransmission RequestAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRecord Not Found - Recommend ReassignmentRecord Not Found - Data Auto-ReallocatedLocate Operation FailureRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorData Sync Error - Data RewrittenData Sync Error - Recommend RewriteData Sync Error - Data Auto-ReallocatedData Sync Error - Recommend ReassignmentRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data Without ECC - Data RewrittenRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With L-ECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteRecovered Data With ECC - Data RewrittenRecovered Data With LinkingDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationRecovered ID with ECCPartial Defect List TransferInvalid Command Operation CodeAccess Denied - Initiator Pending-EnrolledAccess Denied - No Access rightsAccess Denied - Invalid Mgmt ID KeyIllegal Command While In Write Capable StateObsoleteIllegal Command While In Explicit Address ModeIllegal Command While In Implicit Address ModeAccess Denied - Enrollment ConflictAccess Denied - Invalid LU IdentifierAccess Denied - Invalid Proxy TokenAccess Denied - ACL LUN ConflictLogical Block Address Out of RangeInvalid Element AddressInvalid Address For WriteIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBCDB Decryption ErrorSecurity Audit Value FrozenSecurity Working Key FrozenNonce Not UniqueNonce Timestamp Out Of RangeLogical Unit Not SupportedInvalid Field In Parameter ListParameter Not SupportedParameter Value InvalidThreshold Parameters Not SupportedInvalid Release Of Persistent ReservationData Decryption ErrorToo Many Target DescriptorsUnsupported Target Descriptor Type CodeToo Many Segment DescriptorsUnsupported Segment Descriptor Type CodeUnexpected Inexact SegmentInline Data Length ExceededInvalid Operation For Copy Source Or DestinationCopy Segment Granularity ViolationInvalid Parameter While Port Is EnabledHardware Write ProtectedLogical Unit Software Write ProtectedAssociated Write ProtectPersistent Write ProtectPermanent Write ProtectConditional Write ProtectNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedPower On, Reset, or Bus Device Reset OccurredPower On OccurredSCSI Bus Reset OccurredBus Device Reset Function OccurredDevice Internal ResetTransceiver Mode Changed to Single EndedTransceiver Mode Changed to LVDI_T Nexus Loss OccurredMode Parameters ChangedLog Parameters ChangedReservations PreemptedReservations ReleasedRegistrations PreemptedAsymmetric Access State ChangedImplicit Asymmetric Access State Transition FailedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedCurrent Program Area Is Not EmptyCurrent Program Area Is EmptyIllegal Power Condition RequestPersistent Prevent ConflictPrevious Busy StatusPrevious Task Set Full StatusPrevious Reservation Conflict StatusPartition Or Collection Contains User ObjectsOverwrite Error On Update In PlaceInsufficient Time For OperationCommands Cleared By Another InitiatorIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledCannot Write Medium - Unknown FormatCannot Write Medium - Incompatible FormatCannot Format Medium - Incompatible MediumCleaning FailureCannot Write - Application Code MismatchCurrent Session Not Fixated For AppendCleaning Request RejectedMedium Not FormattedMedium Format CorruptedFormat Command FailedNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorEnclosure FailureEnclosure Services FailureUnsupported Enclosure FunctionEnclosure Services UnavailableEnclosure Services Transfer FailureEnclosure Services Transfer RefusedRibbon, Ink, or Toner FailureRounded ParameterEvent Status NotificationESN - Power Management Class EventESN - Media Class EventESN - Device Busy Class EventSaving Parameters Not SupportedMedium Not PresentMedium Not Present - Tray ClosedMedium Not Present - Tray OpenMedium Not Present - LoadableMedium Not Present - Medium Auxiliary Memory AccessibleSequential Positioning ErrorTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyEnd Of Medium ReachedMedium Magazine Not AccessibleMedium Magazine RemovedMedium Magazine InsertedMedium Magazine LockedMedium Magazine UnlockedMechanical Positioning Or Changer ErrorInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetLogical Unit FailureTimeout On Logical UnitLogical Unit Failed Self-TestLogical Unit Unable To Update Self-Test LogTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has Changedcomponent Device AttachedDevice Identifier ChangedRedundancy Group Created Or ModifiedRedundancy Group DeletedSpare Created Or ModifiedSpare DeletedVolume Set Created Or ModifiedVolume Set DeletedVolume Set DeassignedVolume Set ReassignedReported LUNs Data Has ChangedEcho Buffer OverwrittenMedium LoadableMedium Auxiliary Memory AccessibleRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorData Phase CRC Error DetectedSCSI Parity Error Detected During ST Data PhaseInformation Unit iuCRC Error DetectedAsynchronous Information Protection Error DetectedProtocol Service CRC ErrorSome Commands Cleared By iSCSI Protocol EventInitiator Detected Error Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorInvalid Target Port Transfer Tag ReceivedToo Much Write DataACK/NAK TimeoutNAK ReceivedData Offset ErrorInitiator Response TimeoutLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureErase Failure - Incomplete Erase Operation DetectedCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedSCSI To Host System Interface FailureSystem Resource FailureSystem Buffer FullInsufficient Reservation ResourcesInsufficient ResourcesInsufficient Registration ResourcesInsufficient Access Control ResourcesAuxiliary Memory Out Of SpaceUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change InputOperator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedFailure Prediction Threshold ExceededMedia Failure Prediction Threshold ExceededLogical Unit Failure Prediction Threshold ExceededSpare Area Exhaustion Prediction Threshold ExceededHardware Impending Failure General Hard Drive FailureHardware Impending Failure Drive Error Rate Too HighHardware Impending Failure Data Error Rate Too HighHardware Impending Failure Seek Error Rate Too HighHardware Impending Failure Too Many Block ReassignsHardware Impending Failure Access Times Too HighHardware Impending Failure Start Unit Times Too HighHardware Impending Failure Channel ParametricsHardware Impending Failure Controller DetectedHardware Impending Failure Throughput PerformanceHardware Impending Failure Seek Time PerformanceHardware Impending Failure Spin-Up Retry CountHardware Impending Failure Drive Calibration Retry CountController Impending Failure General Hard Drive FailureController Impending Failure Drive Error Rate Too HighController Impending Failure Data Error Rate Too HighController Impending Failure Seek Error Rate Too HighController Impending Failure Too Many Block ReassignsController Impending Failure Access Times Too HighController Impending Failure Start Unit Times Too HighController Impending Failure Channel ParametricsController Impending Failure Controller DetectedController Impending Failure Throughput PerformanceController Impending Failure Seek Time PerformanceController Impending Failure Spin-Up Retry CountController Impending Failure Drive Calibration Retry CountData Channel Impending Failure General Hard Drive FailureData Channel Impending Failure Drive Error Rate Too HighData Channel Impending Failure Data Error Rate Too HighData Channel Impending Failure Seek Error Rate Too HighData Channel Impending Failure Too Many Block ReassignsData Channel Impending Failure Access Times Too HighData Channel Impending Failure Start Unit Times Too HighData Channel Impending Failure Channel ParametricsData Channel Impending Failure Controller DetectedData Channel Impending Failure Throughput PerformanceData Channel Impending Failure Seek Time PerformanceData Channel Impending Failure Spin-Up Retry CountData Channel Impending Failure Drive Calibration Retry CountServo Impending Failure General Hard Drive FailureServo Impending Failure Drive Error Rate Too HighServo Impending Failure Data Error Rate Too HighServo Impending Failure Seek Error Rate Too HighServo Impending Failure Too Many Block ReassignsServo Impending Failure Access Times Too HighServo Impending Failure Start Unit Times Too HighServo Impending Failure Channel ParametricsServo Impending Failure Controller DetectedServo Impending Failure Throughput PerformanceServo Impending Failure Seek Time PerformanceServo Impending Failure Spin-Up Retry CountServo Impending Failure Drive Calibration Retry CountSpindle Impending Failure General Hard Drive FailureSpindle Impending Failure Drive Error Rate Too HighSpindle Impending Failure Data Error Rate Too HighSpindle Impending Failure Seek Error Rate Too HighSpindle Impending Failure Too Many Block ReassignsSpindle Impending Failure Access Times Too HighSpindle Impending Failure Start Unit Times Too HighSpindle Impending Failure Channel ParametricsSpindle Impending Failure Controller DetectedSpindle Impending Failure Throughput PerformanceSpindle Impending Failure Seek Time PerformanceSpindle Impending Failure Spin-Up Retry CountSpindle Impending Failure Drive Calibration Retry CountFirmware Impending Failure General Hard Drive FailureFirmware Impending Failure Drive Error Rate Too HighFirmware Impending Failure Data Error Rate Too HighFirmware Impending Failure Seek Error Rate Too HighFirmware Impending Failure Too Many Block ReassignsFirmware Impending Failure Access Times Too HighFirmware Impending Failure Start Unit Times Too HighFirmware Impending Failure Channel ParametricsFirmware Impending Failure Controller DetectedFirmware Impending Failure Throughput PerformanceFirmware Impending Failure Seek Time PerformanceFirmware Impending Failure Spin-Up Retry CountFirmware Impending Failure Drive Calibration Retry CountFailure Prediction Threshold Exceeded (false)Low Power Condition OnIdle Condition Activated By TimerStandby Condition Activated By TimerIdle Condition Activated By CommandStandby Condition Activated By CommandPower State Change To ActivePower State Change To IdlePower State Change To StandbyPower State Change To SleepPower State Change To Device ControlLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackPacket Does Not Fit In Available SpaceIllegal Mode For This TrackInvalid Packet SizeVoltage FaultAutomatic Document Feeder Cover UpAutomatic Document Feeder Lift UpDocument Jam In Automatic Document FeederDocument Miss Feed Automatic In Document FeederConfiguration FailureConfiguration Of Incapable Logical Units FailedAdd Logical Unit FailedModification Of Logical Unit FailedExchange Of Logical Unit FailedRemove Of Logical Unit FailedAttachment Of Logical Unit FailedCreation Of Logical Unit FailedAssign Failure OccurredMultiply Assigned Logical UnitSet Target Port Groups Command FailedLogical Unit Not ConfiguredData Loss On Logical UnitMultiple Logical Unit FailuresParity/Data MismatchInformational, Refer To LogState Change Has OccurredRedundancy Level Got BetterRedundancy Level Got WorseRebuild Failure OccurredRecalculate Failure OccurredCommand To Logical Unit FailedCopy Protection Key Exchange Failure - Authentication FailureCopy Protection Key Exchange Failure - Key Not PresentCopy Protection Key Exchange Failure - Key Not EstablishedRead Of Scrambled Sector Without AuthenticationMedia Region Code Is Mismatched To Logical Unit RegionDrive Region Must Be Permanent/Region Reset Count ErrorDecompression Exception Long Algorithm IDSession Fixation ErrorSession Fixation Error Writing Lead-InSession Fixation Error Writing Lead-OutSession Fixation Error - Incomplete Track In SessionEmpty Or Partially Written Reserved TrackNo More Track Reservations AllowedCD Control ErrorPower Calibration Area Almost FullPower Calibration Area Is FullPower Calibration Area ErrorProgram Memory Area Update FailureProgram Memory Area Is FullRMA/PMA Is Almost FullDEFERRED CDBParametersError in %s, Offset %d, bit %dProgress Indicator: %dActual Retry Count: %dASC 0x%02x ASCQ 0x%02xDiagnostic Failure on Component 0x%02xDecompression Exception Short Algorithm ID OF 0x%02xTagged Overlapped Commands (0x%02x = TASK TAG)host adapter code inconsistency unknown error category (0x%x) from host adapter code User command with no ioctl User command with no buf scistrcmdlen too big physio split the request.. cannot proceed scsi_do_ioctl: impossible cmd (%#lx)DEC RZ55 (C) DECEMULEX MD21/S2 ESDIA00IBMRAID 0662SIBM 0663HIBM0664H3171-S2KZ-CDFRSS2FQUANTUM ELS85S iomegajaz 1GBMICROP4421-07SEAGATEST150176LW0002HPC3725SDCASSONY SDT-5000 3.WangDAT Model 1300 02.4Model 2600 01.7Model 3200 02.2ALPS ELECTRIC CO.,LTD. DC544CSW03DCR-2801TE1.07CREATIVECD3630EAC101FX320Sq01GCD-R580B1.00MATSHITA CR-5741.021.06Memorex CRW-26421.0gNEC CD-ROM DRIVE:2734.21SANYO CRD-256PSANYO CRD-254PSANYO CRD-S54P1.08CD-ROM CDR-S11.70CD-ROM CDR-N161.25UJDCD87301.14scsibusscsibus at %s: %d targets scsibusattach: can't allocate target linksscsibusattach: can't allocate lun linksPLEXTORCD-ROM PX-40TS1.01MICROP 1588-15MBSUN0669vendor-uniqueremovable targ %d lun %d: <%s, %s, %s> SCSI%d %d/%s %s%sscsibusprintdirectsequentialprinterprocessorwormcdromscanneropticalchangercommunicationenclosure servicessimplified directscsibusprint: device type T_NODEVICE offlinescsibusprint: qualifier == SID_QUAL_BAD_LUscsibusprint: qualifier == SID_QUAL_RSVDNEC CD-ROM DRIVE:260%s: WARNING: unable to establish power hook %s: not queued, error %d cdioctlATAPI CD-ROMSCSI CD-ROMdvd_authdvd_read_physicaldvd_read_copyrightdvd_read_bcasddrive offline%s: WARNING: unable to establish shutdown hook %luMB, %lu cyl, %lu head, %lu sec, %lu bytes/sec, %lu sec totalsdattach: unknown result (%#x) from get_parmsSCSI opticalSCSI disk%s %ssdgetdisklabel%s: WARNING: cache synchronization failed atapiscsiwdc_atapi_send_cmd: polled command not donewdc_atapi_start: not ready, st = %02x wdc_atapi_intr_command%s:%d:%d: device timeout waiting to send SCSI packet unexpected data phasezero length transfer requested in data phasedata transfer direction disagreementdata phase where none expecteddata transfer direction disagreement during senseunexpectedly in command phasewdc_atapi_intr: warning: device requesting %d bytes, only %d left in buffer wdc_atapi_intr: warning: reading only %d of %d bytes wdc_atapi_intr warning: bcount value is %d after io atapiscsi: Shouldn't get here BSYDRDYDWFDSCDRQCORRIDXERR%s:%d:%d: device timeout, c_bcount=%d, c_skip=%d, status=0x%b, ireason=0x%x Device Reset Wait%s:%d:%d: %s timed out IdentifyPost-IdentifyPIOMODEunknown statedmamode%s:%d:%d: soft reset failed /usr/src/sys/arch/arm/arm/softintr.csoftnet_intrhand != NULLsoftintr_establish: unknown soft IPL %dpxaippxaip_attach: failed to map CLKMAN: CPU clock = %d.%03d MHz pxaip_attach: failed to map RTCpxaip_attach_critical: failed to attach INTC!pxaip_attach_critical: failed to attach GPIO!pxaip_attach_critical: failed to attach DMAC! addr 0x%lx intr %dpxa2x0_probe_sdram: impossibleWARNING: using filesystem date -- CHECK AND RESET THE DATE! pxa2x0_io_bs_alloc(): not implementedpxa2x0_io_bs_free(): not implementedpxaintc: Interrupt Controller stray interrupt %d intr_establish: bogus irq number %dintr_establish: can't malloc handler infocouldn't establish interruptirq %ldpxagpiopxagpio_reg_read: not bootstrappedpxagpio_reg_write: not bootstrapped: GPIO Controller %s: Can't map registers! pxa2x0_gpio_intr_establish: Pin %d not GPIO_IN%s: failed to hook main GPIO interrupt %s: stray GPIO#0 edge interrupt %s: stray GPIO#1 edge interrupt %s: unhandled GPIO interrupt. GPIO#%d pxa2x0_gpio_set_intr_level: bad level: %dpxadmac: DMA Controller : unable to establish interrupt pxa2x0_dma_to_fifo: bogus peripheral %dpxa2x0_dma_to_fifo: bogus dma channel %dpxa2x0_dma_to_fifo: bogus length %dpxa2x0_dma_to_fifo: bogus burstsize %dpxa2x0_dma_to_fifo: bogus width %dpxa2x0_dma_from_fifo: bogus peripheral %dpxa2x0_dma_from_fifo: bogus dma channel %dpxa2x0_dma_from_fifo: bogus length %dpxa2x0_dma_from_fifo: bogus burstsize %dpxa2x0_dma_from_fifo: bogus width %dpxaost%s: Cannot map registersclockpxaudc: cannot map mem space : USB Device Controller usbc: unable to establish connect interrupt pxaudc_read_epN: ep %d, no xfer fifo full when trying to set short packet ep%d: fifo error endpoint %d already used by %c%s: init failed, error=%d %s: cannot establish powerhook %s: unable to establish interrupt at irq %d: failed to map registers %d%s: Unknown depth (%d) %s: unable to load dma map, error = %d %s: unable to create dma map, error = %d %s: unable to map dma, error = %d %s: unable to allocate dma, error = %d pxa2x0_i2s_freem: trying to free unallocated memorypxa2x0_i2s_start_output: request with bad start address: %p, size: %d) pxa2x0_i2s_start_input: request with bad start address: %p, size: %d) apm%s: battery life expectancy %d%% %s: AC on,off,unknown, battery is undecoded (%x)highchargingCRITICALbackup power,%s: failed to create kernel thread, disabledapmevpxa2x0_apm_attach_sub: failed to map POWMAN apmlk%s: failed to map CLKMAN %s: failed to map MEMCTL %s: can't map GPIO pxa2x0_apm_sleep: can't map OST bogus new frequency 0 for rate %d maxclock %d manufacturer 0x%x%sproduct 0x%x function %d "pcmciapcmcia_card_attach%s: error %d detaching %s (function %d) (pcmcia_function_init: function is enabledpcmcia_function_enable: function not initializedcard has intr handler, but no function doesfunctions have ih, but the card does notdisestablishing last function, but card has no ihchanging ih ipl, but card has no ih@ %lx%s%lx%s%lx; iomask %lx, iospace %lx%s%lxunknown (%d)multi-functionserial portparallel portfixed diskvideo adapternetwork adapterauto incrementing mass storageSCSI bridgeSecurity servicesInstrumentSerial I/O Bus AdapterPCMCIA 1.0 PCMCIA 2.0 or 2.1 %s: can't alloc memory to read attributes %s: CIS checksum failed %s: can't map memory to read attributes %s: CIS version PC Card Standard %d.%d unknown (major=%d, minor=%d) %s: CIS info: %s: Manufacturer code 0x%x, product 0x%x %s: function %d: , ccr addr %lx mask %lx %s: function %d, config table entry %d: memory cardI/O cardcard type unknown; irq mask %x;%s: %d errors found while parsing CIS audio readonly powerdown irqlevel irqpulse irqshare io16 io8 bvd_active wp_active rdybsy_active mwait_required; maxtwins %d; memspacepcmcia_parse_cis_tupleSVECFD605 PCMCIA EtherNet CardV1-1%s: using CIS quirks for AmbiCom IncAMB8002TPMX PE-200DIGITALDEPCM-XXPCMCIAUE2212D-LinkDE-660DE-660+RPTI LTD.EP400CISV100RPTIEP401 Ethernet NE2000 CompatibleACCTONEN2212ETHERNETW89C926Seiko Epson Corp.P/N: EEN10B Rev. 00CNetCN40BC EthernetNE2000FastEthernetLNT-10TNNDC004743118001TAMARACKGVCNIC-2000pR01Ethernet CardiPort10/100 Ethernet CardFast-EthernetETHER-C16PCMCIA LAN10Base-EthernetLinksysEtherFast 10/100 Integrated PC Card (PCM100)Ver 1.0DE-650DFE-670TXDLINKSYSE-CARDI-O DATAPCLAcorega K.K.corega Ether PCC-Tcorega Ether PCC-TDcorega EtherII PCC-Tcorega EtherII PCC-TDcorega FastEther PCC-TXcoregaFEther PCC-TXFcorega FEther PCC-TXDSMC8041TX-10/100-PC-Card-V2XircomCompactCard EthernetCFE-10: unexpected I/O space configuration : unexpected number of i/o spaces %d should be 1 or 2 : no suitable config entry : can't allocate I/O space port 0x%lx/%d, %s: can't match ethernet vendor code : can't map ASIC I/O space : can't map NIC I/O space : function enable failed : can't get subregion for asic %s: couldn't establish interrupt %s: can't map mem for enet addr %s: can't alloc mem for enet addr %s: can't alloc mem for LAN iobase %s: can't map mem for LAN iobase MEGAHERTZMODEM XJ2288Novatel WirelessMerlin UMTS ModemNRM6831: can't allocate i/o space : can't map i/o space port 0x%lx/%luDigital Mobile Media CD-ROMPortable CD-ROM DriveNinjaATA-EXP PnPIDEF1SHUTTLE TECHNOLOGY LTD.PCCARD-IDE/ATAPI Adapter: can't handle card info can't allocate memory for command queue ,0x%lx/%lu: can't map second I/O space : can't map first I/O space %s: couldn't enable PCMCIA function %s: couldn't establish interrupt handler %s%s : can't map io space : can't alloc i/o space Wireless LAN PCC-11Wireless LAN PCCA-11corega_K.K.Wireless_LAN_PCCB-11WL PCCL-11ISL37300PWLCFL-11INTERSILHFA384x/IEEEVersion 01.02SMC2632WNANOSPEEDNECWireless Card CMZ-RT-WPVersion 01.01NTT-ME11Mbps Wireless LAN PC CardAddtronAWP-100 Wireless PCMCIACabletronRoamAbout 802.11 DSIntersilPRISM 2_5 PCMCIA ADAPTEREval-RevASymbol TechnologiesLA4111 Spectrum24 Wireless LAN PC CardPLANEXGW-NS11H Wireless LAN PC CardD-Link CorporationD-Link DWL-650H 11Mbps WLAN AdapterAllied Telesis K.K.WR211PCM: %d slot%s pxapcicpxapcic_mem_map: bogus kind%s: unable to create event thread for %s pxapcicevpxapcicsspcic_attach_card: already attachedlcdzkbd: unable to establish powerhook zkbd_poll: PCMCIA/GPIO controller : failed to map %s %s: failed to map memory %x for scoop%s: invalid CF slot %dscoop_pcic_read: bogus registerscoop_pcic_write: bogus registerscoop_pcic_set_power: bogus power statezssp: can't map bus space %s: can't establish power hook /usr/src/sys/arch/zaurus/dev/zaurus_ssp.czssp_cd.cd_ndevs > 0 && zssp_cd.cd_devs[0] != NULLzssp_ic_send: invalid IC %d zssp_read_ads7846: not configured apm_acapm_bc/usr/src/sys/arch/zaurus/dev/zaurus_apm.capm_cd.cd_ndevs > 0 && apm_cd.cd_devs[0] != NULLzts%s: enable failed zaudiohpjk: I2C, I2S, WM8750 Audio : codec failed to respond : unable to attach I2C : unable to attach I2S ulinearmulawalawslinearslinear_leulinear_leslinear_beulinear_bevolumemuteoutputszrc: CE-RH2 remote control : failed to map controller %s: read from pseudo-register %02x %s: write to pseudo-register %02x %s: non-FF ECC bytes in OOB data %s: ECC failed %s: can't erase block %u, retrying %s: can't write block %u, retrying %s: can't erase old block %u %s: no spare block, giving up on logical block %u pblks %u lblks %u blkno %u: can't read oob data zflash_safe_start%s: %u unusable blocks blkno %u: badblock status %x blkno %u: duplicate logno %u blkno %u: logno %u too big blkno %u: can't read logno wd%s: %d-sector PIO, LBA, %lluMB, %llu sectors %s: freeze lock command didn't complete wdattach CHS, %lluMB, %d cyl, %d head, %d sec, %llu sectors LBA48, %lluMB, %llu sectors %s: IDENTIFY failed __wdstart: bad return code from wdc_ata_bio()wddone%s: soft error (corrected) device faultdevice timeoutST506/MFM/RLLESDI/IDE diskwddumpwddump: try againwddump: device timed outwddump: unknown error typewddump: %swddump: drive faultwddump: DMA errorwddump: polled command has been queuedwd_get_params: bad return code from ata_get_paramsST506%s: flush cache command didn't complete %s: flush cache command: drive fault %s: flush cache command timeout wdc%s:%d:%d: not ready, st=0x%b, err=0x%02x %s:%d:%d: timeout waiting for DRQ, st=0x%b, err=0x%02x %s:%d:%d: bad state %d in _wdc_ata_bio_start _wdc_ata_bio_start: bad state%s:%d:%d: intr with DRQ (st=0x%b) %s:%d:%d: read intr before drq %s:%d:%d: device timeout, c_bcount=%d, c_skip%d %s:%d:%d: bad state %d in wdc_ata_bio_intr wdc_ata_bio_intr: bad statewdc_ata_ctrl_intr: state==RECALrecal%s:%d:%d: %s drive fault error (%x) piomodeno media/write protectedinterface CRC erroraddress mark not foundtrack 0 not foundaborted commandmedia change requestedid not foundmedia changeduncorrectable data errorbad block detectederror not notifiedraiduse one of: %s[a-p]parsediskrootconf: device name too longboot device: %s. root device (default %s%c)swap device can't figure root, hope your kernel is right rootconfroot on %s%c boot device not knownboot device: lookup '%s' failed. invalid geometrydisk label I/O errorno disk labeldisk label corrupteddos partition I/O error!wsdisplay_console_inittedtype->nrows > 0type->ncols > 0crow < type->nrowsccol < type->ncolswsdisplay/usr/src/sys/dev/wscons/wsdisplay.cscrdata->nscreens > 0%s: screen %d-%d added (%s, %s emulation) wsdisplay_forceclose: bad screen%s: screen %d deleted wsdisplay at %s mux %dwsdisplay_console_initted: console (%s, %s emulation), using %swsdisplay_console_device == NULLdmuxwsdisplay_common_attach: no memorywsdisplaytty() on ctl devicesc != NULLwsdisplay_switch3: giving up wsdisplay_switch3: screen %d disappeared wsdisplay_switch3: not switching wsdisplay_switch3: invalid screen %dwsdisplay_switch2: giving up wsdisplay_switch2: screen %d disappeared wsdisplay_switch2: not switching wsdisplay_switch2: invalid screen %dwsdisplay_switch1: screen %d disappeared wsdisplay_switch1: not switching wsdisplay_switch1: invalid screen %dwswaitwsmoused_sleepwscons: copybuffer memory malloc failed pcvtwsevent_init: already initialized wsevent_fini: already invoked wsevent_readwskbdwskbd at %s/usr/src/sys/dev/wscons/wskbd.cwskbd_console_initted: console keyboard%s: attach error=%d wskbd_console_device == NULLcannot load keymap!wskbd_console_inittedwskdetwskbd_detach: %s didn't detach wskbd_console_device == scwskbd_input: evar->q=NULL %s: event queue overflow wskbdread: evp == NULL %s: connecting to %s %s: disconnecting from %s wskbd_get_mapentry: %d(%d): bad entrywskbd_load_keymap: %d(%d): bad entrywskbd_load_keymap: %d: recursion too deepwsmousewsmouse at %s attach error=%dwsmdetwsmouse_detach: %s didn't detach wsmouse_input: evar->q=NULL /usr/src/sys/dev/wscons/wsmouse.cev->value >= 0wsmouseread: evp == NULL wsmux: attach out of memory wsmux_getmux: no memory for mux %d wsmux_mux_open: no parent wsmux_mux_open: busy wsmuxopen: dev already in use wsmux_do_open: bad child=%p wsmuxclose: bad child=%p wsmuxread: not open wsmux_do_ioctl: bad child %p wsmuxpoll: not open wsmux_attach_sc: busy wsmux_detach_sc: %s has no parent wsmux_displayioctl: bad child %p wsmux_set_display: bad child parent %p /usr/src/sys/dev/wscons/wsemul_vt100.cedp->console == 1wsemul_vt100_output_c0c1: ESC in kernel output ignored wsemul_vt100_output: kernel output, not consolewsemul_vt100: invalid state %d\[>24;20;0cP0!u%5\wsemul_vt100_handle_csi[?62;6c[%d;%dR[?13n[?21n[?27;1nP2$uwsemul_vt100_handle_dcs: bad type %d[11~[12~[13~[14~[15~[17~[18~[19~[20~[21~[23~[24~[25~[26~[28~[29~[31~[32~[33~[34~OPOQOROSOpOqOrOsOtOuOvOwOxOyOIOMOD[7~OBOCOA[8~[6~[3~[2~[5~[4~[1~OjOkOlOmOnOorasops_init: couldn't lock font rasops_init: font table is empty rasops_init: fontwidth assumptions botched!rasops_mapchar: no font selectedfontwidth not 8/12/16 or RASOPS_SMALL - fixme!wsfont_unlock: font not lockedpre 1.02.0usb: USB revision %s, not supported usb_attach%s: can't register softintr %s: root device is not a hub %s: root hub problem, error=%d usbtaskunable to create event thread for %sunable to create usb task threadusbevtusbtskusb at %susbreausbreadusb: usb_nevents got out of sync! %d usbd_add_dev_eventusbd_add_drv_eventusb_add_eventusb_detachusbdet%s: event thread didn't die usbd_close_pipe: pipe==NULL usbsynusbd_transfer: has old buffer! usbd_transfer: not doneusbd_alloc_buffer: xfer already has a buffer usbd_free_buffer: no buffer usbd_get_config_descriptor: dev == NULL usbd_get_interface_descriptor: dev == NULL usbd_endpoint_count: NULL pointer usbd_set_interface: NULL pointer usb_transfer_complete: xfer=%p not busy 0x%08x usb_transfer_complete: pipe->methods->done == NULL usb_transfer_complete: bad dequeue %p != %p usb_transfer_complete: actlen > len %d > %d usbd_transfer_cb: pipe==0, xfer=%p usb_insert_transfer: xfer=%p not busy 0x%08x usbd_start_next: pipe == NULL usbd_start_next: pipe=%p no start method usbd_start_next: error=%d usbd_do_request: not in process context usbd_get_quirks: dev == NULL usb_desc_iter_next: descriptor length = 0 usb_desc_iter_next: descriptor length too large usb_desc_iter_next: bad descriptor usb_detach_wait: %s didn't detach usb_block_allocmem: in interrupt context, failed usb_block_allocmem: in interrupt context, size=%lu HomeConnectBluetooth3C19250 Ethernet3CRSHEW696HomeConnect 3C460U.S.Robotics 56000HomeConnect 3C460BAR55233CRUSB100753Com OfficeConnect Analog Modem3Com U.S. Robotics Pro ISDN TA3Com HomeConnectAolynk WUB320gXX1XX2URE450 EthernetUFE1000 Fast Ethernet1/10/100 ethernetXX4XX5XX6RTL8151XX7XX8XX9WL54XX10BWU613HWU54DMRT2573WUG2700USB320-EC Ethernet2664WT-Sinus 111 WLANSMCWUSB-GSpeedStream EthernetZD1211BMEZ1000 RDAUSB 2.0 Data LinkWarplinkAcerscan C310UAcerscan 320UAcerscan 640UAcerscan 620UATA/ATAPIAWL300AWL400Prism2.5 WLANPrism2.5 WLAN AROPEX FreeLan 802.11b802UAT1ACT-IR2000U FIRHHKB ProfessionalI/O BoardI/O Board, rev. 1AWN-8020 WLANAWU-120AN986A EthernetAN986 EthernetAN8511 EthernetAN8513 EthernetAN8515 EthernetUBS-10BT EthernetQ-DriveSnapScan 1212USnapScan 1236USnapScan TouchSnapScan e40SnapScan e50SnapScan e20SnapScan e25SnapScan e26SnapScan e52AirPrime CDMA Wireless EVDO cardAWU2000BWM-168bUSB-HASP 0.06One Touch 535/735SpeedTouch 120gMacAlly Kbd HubAU9814 HubMicroConnectors/StrongManNEC Kbd HubAT-USB100ADA70 SpeakersASC495 SpeakersBack-UPS Pro 500CG-WLUSB2GOEagle IEagle IIEagle IICEagle IIIEZUSBEZLINKADU-E100HOptical mouseADB deviceSpeakersTrue Random Number GeneratorARK3116 SerialPENTAX Optio230WLL013 (Intersil)WLL013Voyager 1010USB 2.0 10/100 ethernet controllerAX88178AX88772RT2570WL-159gMyPal A730A9T wirelessWL-140Parallel10Mbps EthernetUC-110T EthernetUC210T EthernetDSB-650CUSB Cable 205UHB124 hubW-Buddie WN210DWL-900AP Wireless access pointAT76C503 (Intersil 3861 Radio)AT76C503 (Intersil 3863 Radio)AT76C503 (RFMD Radio)AT76C505 (RFMD Radio)AT76C505 (RFMD 2958 Radio)AT76C505A (RFMD 2958 Radio)AT76C505AS (RFMD 2958 Radio)ATC-HA4USB USB headphonePC5740 EVDOUSB Audio Speaker1200UuLinks RS-422/485Card readerF5U002 ParallelF5D6050 802.11b Wireless adapterFBT001v2 BluetoothFBT003v2 BluetoothF5U103 SerialF5U109 SerialSCSIF5D5050 EthernetF5U237 USB 2.0 7-Port HubF5U257 SerialF5U409 SerialF6C550-AVR UPSF5U120-PC HubF5D5055F5D7050 54g USB Network AdapterF5D705A 54g USB Network AdapterF5D705C 54g USB Network AdapterF5D9050 ver 3USB100N 10/100 EthernetUSB100LPUSB100ELUSBE100USB2AR EthernetBCM2033BCM2033 (no fw)HL-1050 laser printerKeyboard/Mouse6ch ConSerCANOSCAN N656UCANOSCAN N1220UCANOSCAN N670UCANOSCAN N1240UCANOSCAN LiDE60PowerShot S10PowerShot S20PowerShot S100PowerShot G1PowerShot A20PowerShot A540Netmate EthernetNetmate2 EthernetUSB Chief Bus & Protocol AnalyzerAndromeda hubQVBE-300 PDACASIO Nameland EZ-USBEasyDisk PortableMy3000 keyboardMy3000 hubCypressKB-8933 keyboardPro ThrottlePro PedalsFighterstickFlight Sim YokeUSB200M v2WUSB54GCWUSB54GRWUSBF54GHU200-TSiPAQ PocketPCA1500iPAQ WLANW100WLAN MultiPort W200Personal Jukebox PJB100iPAQ LinuxSnapPort EthernetCM-5100P EVDOC11UWL-210C54RU WLANC54RUEye Q 3xQuickCamEther USB-TFEther USB-TXWirelessLAN USB-11FEther USB-TXSWireless LAN Stick-11FEther USB2-TXULUSB-11 KeyWLAN USB Stick 11FEther USB-TXCNomad IINomad II MGNomadVoip BlasterBlueCoreEx1300 hubTG54USBthermometerKeyboard/HubFM RadioUSB2 HubPhotoClipJ-6502 speakersUSB-FOB/iBUTTONDM9601HenTong WK-668TrueMobile 1180 WLANBluetooth 350W5500 HSDPAEarthmate GPSEarthmate LT20Rio 500WL-200UCHUSB 611GWL-240UXH1153 802.11bC-Net CWD-854 rev FAccelePort 2AccelePort 4AccelePort 8PS/2 Active10/100 ethernetDWL-120 rev EDWL-122DWL-G120DWL-120 rev FDWL-AG132DWL-G132DWL-AG122DWL-G122 rev C1WUA-1340DUB-E100 rev B110Mbps ethernetStorage AdapterVigor550Vigor600ANT dev boardFlash DiskTouch PanelDiva 852 ISDN TAhubGoldpfeil P-LAN29UOLD-USB/TXLD-USBL/TXLD-USB20UC-SGT SerialUC-SGT0 SerialELSAMicrolink USB2Ethernet1S serial2S serial1S25 serial4S serialE45 EthernetCentronics1S9 serialEZ-USB2U4S serialUSB PrinterISD Smart Cable for MacISD Smart CablePerfection 636U / 636PhotoPerfection 610Perfection 1200U / 1200PhotoExpression 1600Perfection 1640SUPerfection 1240U / 1240PhotoPerfection 640UPerfection 1650GT-9700FPerfection 2400Perfection 1260Perfection 1660Perfection 1670Stylus CX3650XTNDAccess IrDAFalcom Twist USBFalcom Samba USBWL-430UConnector for DVD drive8U232AM Serial2232C SerialPS/2 Keyboard/MouseMJS Sirius To PC InterfaceFT232BM SerialKWYSY6Y8DB9Y9Coastal ChipWorks TNC-XMatrix Orbital MX200 Series LCDMatrix Orbital LK202-24 LCDMatrix Orbital LK204-24 LCDCrystalfontz CFA-631 LCDCrystalfontz CFA-632 LCDCrystalfontz CFA-633 LCDCrystalfontz CFA-634 LCDSEMC DSS-20 SyncStationMass StorageAH-F401U Air H deviceYP3X00 PDAIque 3600GeneLink Host-Host BridgeGL650 HubGL641USB CompactFlashGN-BR402WGN-WLBM101GN-WBKGGN-WB01GSGN-WI05GSSMCWUSBT-GGoCOM232 Serial converterGWUSB2EGamePad ProCF-writer/MP3 PlayeriMate, ADB adapterExpert mouseCLOCK USBDA LeaderHWGUSB2-54 WLANHWGUSB2-54-LBHWGUSB2-54V2-APFlashGate SmartMediaFlashGate CompactFlashFlashGateCrossam2+USB IR commanderHandspring VisorHandspring TreoHandspring Treo 600WinTV FMUF200 EthernetDVD-CAM DZ-MV100A CamcorderDeskJet 895CScanjet 4100CPhotosmart S20DeskJet 880CScanJet 4200CCD-Writer PlusMultimedia Keyboard HubHN210WScanJet 6200CPhotoSmart S20DeskJet 815CScanJet 3300CCD-Writer Plus 8200eDeskJet 1220CDeskJet 810C/812CScanjet 4300CCD-Writer+ CD-4eOfficeJet G85xiLaserJet 1200Scanjet 5200CDeskJet 830CScanJet 3400cseDeskJet 885CScanjet 6300CDeskJet 840cScanJet 2200CScanjet 5300CDeskJet 816CDeskjet 970CseScanjet 5400CDeskjet 959CDeskJet 930cInkjet P-2000UDeskJet 640cPhotosmart P1100HN210E EthernetiPAQ 22xx/Jornada 548Jornada 568PhotoSmart C500HUAWEI Mobile E618OpticalCD-ROMQuantis USBFlash Go!EdgePort/4 RS232Hubport/7Rapidport/4Edgeport/4 RS232Edgeport/2 RS232Edgeport/4 RS422Edgeport/2 RS422/RS485Hubport/4Hand-built Edgeport/8MultiTech version of RP/4Edgeport/(4)21 ParallelEdgeport/421 Hub+RS232+ParallelEdgeport/21 RS232+Parallel1/2 Edgeport/8Edgeport/2 RS232/DINEdgeport/4 RS232/DIN1/2 Edgeport/16Edgeport CompatibleEdgeport/8 RS422OEM deviceUSB2 StorageIDE ISD110IDE ISD105Portable USB Harddrive V2USB cableUSB Storage Adapter V2EasyPCAP310 AnyPoint IIWireless 2011B82930 test boardPrism2.x WLANValueCANNeoVI BlueUSB-SSMRW SD-cardUSB-SDRW SD-cardUSB ETTUSB ETTXUSB WN-B11USB Airport WN-B11ETG-US2RSAQ1 SerialUSB2.0-SCSI Bridge USB2-SCZip 100Zip 250CDRW 9602iFP-1xxiFP-3xxiFP-5xxWM1080APC-60BJD 350AirH"PHONE AH-J3001V/J3002VMP-XP7250 Builtin WLANMP-PRX1MiniHub 4000PKC-180 IrDAHKS-0200 USBDAQOrbit trackballTurboBallOrbit trackball for MacVideoCAM VGAUSA-28 serialUSA-28X serialUSA-19 serialUSA-18 serialUSA-18X serialUSA-19W serialUSA-49W serialUSA-19QI serialUSA-19Q serialUSA-28X/XB serialUSA-28XB serialUSA-28XA serialUSA-18XA serialUSA-19WQ serialUIA-10 remote controlUIA-11 remote controlKNU101TX EthernetDigital Science DC220Digital Science DC260Digital Science DC265Digital Science DC290Digital Science DC240Digital Science DC280EasyShare DX4900Niche mouseGenius NetScroll mouseFlight 2000 joystickColorPage Vivid-ProAH-K3001VKPC650 EVDOHard DiskCD R/W9531 GPSjumpSHOT CompactFlash2662W-AROptra S 2450USB1000Camedia MAUSB-2USB10TXUSB10T EthernetUSB100TX EthernetUSB100H1 Ethernet/HPNAUSB10TA EthernetWUSB11 802.11bWUSB11 802.11b v2.5WUSB12 802.11b v1.1WUSB11Network Everywhere NWU11BWUSB11 v2.8WUSB11 v3.0M2452 keyboardM4848 mousePageScanQuickCam WebQuickCam ProQuickCam ExpressQuickCam Pro 3000QuickCam Notebook ProQuickCam Pro 4000N43N48 mouseM-BA47 mouseWingMan Gaming MouseBD58 mouseiFeel MouseWingMan GamePad ExtremeWingMan RumblePadWingMan Force joystickWingMan Formula Force GP (GT-Force)iTouch KeyboardUSB-PS/2 TrackballTrackMan WheelCordless mouseCordless keyboardCordless Desktop OpticalQuickCam ZoomLCS-8138TXUSS-720 evaluation kitD-Link DU-H3SP BAY HubRS232 InterfaceSitecom RS232ML-4500LUA-TX EthernetNintendo Wi-FiLUA2-TX EthernetLUA-KTX EthernetWLI-USB-S11MCR-SM2 SmartMediaUSB-IDE Bridge: DUB-PxxGWLI-USB-KS11G wlanLUA-U2-KTX EthernetWLI-USB-KB11 WLANWLI-U2-KG54-YB WLANWLI-U2-KG54 WLANWLI-U2-KG54-AI WLANWLI-U2-SG54HPWLI-U2-G54HPWLI-U2-KG54LWi-SpyRicochet GSProtection Center 1 UPSProtection Center 2 UPSSP128AR EtherFastSideWinder Precision ProIntelliMouseNaturalDigital Sound System 80Sidewinder Precision Racing WheelTrackball ExplorerIntelliEye mouseInternet Keyboard ProMN510 WirelessSCSI-DB25SCSI-HD50CameraMateFreecom IDEPhantom 336CX - C3ScanMaker X6 - X6UPhantom C6ScanMaker V6USLScanMaker V6ULMidisport 2x2Digital WalletDimage S304Dimage XDimage 7iDimage A1CD-R/RW DriveMouseFDDMA-620 IrDAEasiDock EthernetMCS7703 SerialMCS7830 EthernetMC141555 hub controllerT720cUSBLANSB4100 Cable ModemSB5100 Cable ModemMT5634ZBA modem1200 CU600 CU1200 UB1200 Plus1200 CU PlusBearPaw 1200FMDC-800DV2000DiskOnKeyGPIB-USB-ABearPaw 1200BearPaw 2400RepeaterPicty760Picty900Picty920Picty800USB2.0 Hub6-in-1 Flash Device Controller8-in-1 Flash Device ControllerMulti-format Flash ControllerTurbo-ConnectClik! 40EthernetGadgetUSB 2.0 Fast EthernetMA101MA101 Rev B802.11b802.11b V2WG111TWG111UWPN111WG111v2E990E880E885CA-42 SerialNV-902WExpressCard 3GMerlin V620S720Merlin U740XU870U720C-1C-700 Ultra ZoomUSB TO EthernetOV511OV511+MDCFE-B CFMemory Stick+CFDatafab-basedPNY/Datafab CF+SMSimple Tech/Datafab CF+SMCF + SM Combo (LC1)Datafab MD1-II PC-Card8In2model 01 WiFi interfacemodel 01 Bluetooth interfacemodel 01+ Ethernetmodel 01 Ethernet interfaceSolid state diskDKU-5 SerialUSB Serial AdaptorPalm m500Palm m505Palm m515Palm i705Palm Tungsten ZPalm m125Palm m130Palm Tungsten TPalm Zire 31Palm ZireLS-120MultiMediaCardTY-TP50P6-S 50in Touch Panel6 in 13 in 1Serial ConverterAt-Home EthernetWL-503IADSS 350 Digital Speaker SystemDSS XXX Digital Speaker SystemPCA645VCPCA646VCPCVC675K VestaPCVC680K Vesta ProPCVC690K Vesta Pro Scan CameraPCVC730K ToUCam FunPCVC740K ToUCam Pro PCPCVC750K ToUCam Pro ScanDSS 150 Digital Speaker SystemSNU6500SNU5600DIVA mp3 playerPS2 to MacXkeys Programmable KeyboardCRW-600 6-in-1GW-US11H WLANGW-US11S WLANGW-US54HPGU-1000TGW-US54MiniGW-US54Mini2GW-US54SGGW-US54GZLGW-USMMPlatronics DSP-400 Headsettest boardExpress EthernetTravel Flash DriveG2-200G2E-300G2-300Colorado 9600Colorado 600uVisioneer 6200Colorado 19200Colorado 1200uG2-600ReadyScan 636iG2E-600ComfortMouse-in-a-BoxSony PCGA-UMS1PL2301 Host-Host interfacePL2302 Host-Host interfacePL2303 SerialParallel printerATAPI-4 Bridge ControllerPL2501 Host-Host interfaceUSB-1284 BRIDGEScorpion-980NCDMA MSM modemCDMA MSM phoneUSB StrikePadi-Key 2000RT2671USB serial REX-USB60RTL8150RTL8151 PNARTL8187BlackberryUA-100 Audio I/FUM-4 MIDI I/FSC-8850 MIDI SynthU-8 Audio I/FUM-2 MIDI I/FSC-8820 MIDI SynthPC-300 MIDI KeyboardUM-1 MIDI I/FSK-500 MIDI KeyboardSC-D70 MIDI SynthUM-880 MIDI I/FSD-90 MIDI SynthUM-550 MIDI I/FSD-20 MIDI SynthSD-80 MIDI SynthUA-700 Audio I/FGamepad 203USBXG-760AXG-76NACyborg 3D Gold JoystickImageMate SDDR-05aImageMate SDDR-31ImageMate SDDR-05ImageMate SDDR-12ImageMate SDDR-09ImageMate SDDR-75JY-DV9USB gamepadSanyo SCP-4900 PhoneI330SWL-2100USL11R-IDEUSB-Serial converterNUB-8301NUB-862Root HubSN1 L1 System ControllerST268Pocket AdapterSL5500A300SL5600C700C750E-USB BridgeeUSCSI BridgeImageMate SDDR09eUSB SmartMedia / CompactFlasheUSB MultiMediaCardSony HifdeUSB ATA/ATAPIeUSB CompactFlashCD-RW DeviceSCM MicroSX1X65X75GSM module MC35SpeedStreamSpeedStream 1022Siemens Gigaset 108EM5625MC5720AirCard 595MC5725Aircard 580 EVDOMC8755MC8765MC8755 HSDPAMC8775 HSDPAAircard 875 HSDPAIrDADatum Networks SSF-7X Multi PlayersDigiFilm-ComboMULTICARDREADERU2EPsion Dacom Gold Port EthernetPololu SerialArgussoft ISPCrumb128Degree ControlsSuunto sportsBurnside Desktop mobileIP-Link 1220Lipowsky Baby-JTAGLipowsky Baby-LINLipowsky HARP-1DCU-11 cloneCP210x SerialYAP Phone (no firmware)YAP PhoneNetComm Roadster II 56LN029WL-022CN104LN-028WL-113WL-172WL-113 rev 2SmartLink EthernetsmartNIC 2 PnPEZ Connect EthernetEZ Connect 11MbpsEZ Connect 11Mbps v2NUB100 EthernetNUB110 EthernetSony DSC CamerasMemorystick NW-MS7Harddrive V2Memorystick MSAC-US1HandycamSony MSC Memorystick SlotClie v3.5PlayStation2 keyboardPlayStation2 keyboard hubPlayStation2 mouseClie v4.0Clie v4.0 Memory Stick slotSony Clie s360Clie v4.1 Memory Stick slotClie v4.1Sony Clie nx60Sony Clie tj25KeikaiDenwa 8KeikaiDenwa 8 with chargerMS3303H SerialUB801RCommunicatorInternet Access DeviceMobile AdaptorU-Cable type D2U-Cable type P1Slipper UIr-TrinityU-Cable type A3U-Cable type A4Type 6 KeyboardType 7 KeyboardType 6 MouseSGC-X2ULSupra Express 56KSupraMax 2890 56KRio 600Rio 800Nike psa[play 120EP-1427X-2 EthernetEricsson DCU-10/11ZD1211USBPS2CameraMate (DPCM_USB)ZodiacUSB-PDC Adapter UPA9664USB-cdmaOne Adapter UCA1464USB-PHS Adapter UHA6400USB-PHS Adapter UPA6400FD-05PUBALLNET 0193 WLANZyXEL ZyAIR B200 WLANU-300CQuickWLANMicrophoneMissile LauncherKY-BT100 BluetoothUT-USB41 hubTUSB2046 hubNex II DigitalFusion Digital GamepadArgos Mini SmartcardThumbDriveThumbDrive 8MBU209 SerialUSB/MP3 decoderXXX 1100SM-2000G240TEW-429UB_ATEW-429UBTEW-444UB EUTEW-429UB C1ALL0298 v21200 UB PlusAstra 1236UAstra 1220UAstra 2000UAstra 2100UAstra 2200UAstra 3400Panache Surf ISDNUSR1120 WLANUSR9000 SureConnect ADSLUSR5422 WLANUSR5421A WLANUSR5423 WLANMC60 SerialG773 Monitor HubP815 Monitor HubAirsyncG773 Monitor ControlCPiA CameraOneTouch 7600OneTouch 5300Scanport 3000OneTouch 6100OneTouch 6200OneTouch 8100OneTouch 8600DSC350Vodafone Mobile Connect 3GGlobeTrotter 3G FUSIONGlobeTrotter 3G QUADGlobeTrotter 3G QUAD PLUSCT-0405-U TabletGraphireGraphire3 4x5Graphire4 Classic A6Intuos A5UR055GImaging DeviceIBM PC CameraFlashbuster-UUX256 MIDI I/FUX96 MIDI I/FRP-U200NetVolante RTA54iNetVolante RTW65bNetVolante RTW65iNetVolante RTA55iU640MO-03M4Y-750XI-725/726XI-735AR5523 driver2986L Fax ModemZD1201Omni 56K PlusZyAIR G-220AG-225HM-202G-270SG-220 v2G-202PrestigeUnknown vendoreGalaxBernd Walter Computer TechnologyAOXAtmelMitsumiHewlett PackardAdaptecNational SemiconductorAcer LabsFuture Technology DevicesEastman KodakMelcoLeadtekCreative LabsADI SystemsComputer Access TechnologyStandard MicrosystemsAdvanced Gravis ComputerSun MicrosystemsTaugagreining HFAdvanced Micro DevicesLexmark InternationalNANAOAlps ElectricThrustmasterTexas InstrumentsAnalog DevicesSilicon Integrated Systems Corp.KYE SystemsDiamond (Supra)MicrosoftPrimax ElectronicsMGE UPS SystemsAMPCherry MikroschalterAmerican MegatrendsLogitechBehavior Tech. ComputerPhilipsSanyo ElectricConnectixKensingtonLucentKyoceraPlantronicsSTMicroelectronicsYAMAHACompaqHitachiAcer PeripheralsDavicomVisioneerNikonCypress SemiconductorSeiko EpsonRainbow TechnologiesI/O DataTDKU.S. RoboticsMethode Electronics Far EastMaxi SwitchLockheed Martin Energy ResearchFujitsuToshiba AmericaMicro Macro TechnologiesKonicaLite-On TechnologyFuji Photo FilmPhilips SemiconductorsTatung Co. Of AmericaScanLogicMyson TechnologyDigiITT CanonAltec LansingPanasonic (Matsushita)SharpIiyamaShuttle TechnologySamsung ElectronicsAnnabooksJVCChicony ElectronicsBrother IndustriesDallas SemiconductorAcer3ComAztech SystemsBelkin ComponentsKawatsu SemiconductorAmerican Power ConversionAdvanced Connectek USANetChip TechnologyALTRAATI TechnologiesAladdin Knowledge SystemsUniversal AccessViewSonicXirlinkAnchor ChipsSonyVLSI VisionAsahi Kasei MicrosystemsATEN InternationalMustek SystemsTelex CommunicationsPeracom NetworksAlcor MicroWACOMe-TEK LabsEIZOElecomHauppauge Computer WorksBAFO/Quality Computer AccessoriesY-E DataAVMQuickshotRolandRockfireRATOC SystemsZyXEL CommunicationIomegaA-Trend TechnologyAdvanced Input DevicesLaCieOmniVisionIn-System DesignApple ComputerDigi InternationalQualcommQtronixRicohBrainboxesUltimaAxiohm Transaction SolutionsMicrotekSUN CorporationLexar MediaGenesys LogicFuji ElectricKeithley InstrumentsEIZO NanaoKawasaki LSIFFCAnko ElectronicP.I. EngineeringAOC InternationalChic TechnologyBarco Display SystemsBridge InformationSolid YearBio-Rad LaboratoriesMacallyAct LabsAlarisApexVivitarAvisionTEACArkmicroSilicon GraphicsSanwa SupplyAcer Semiconductor AmericaSigmatelDrayTekAiwaACARD TechnologyProlific TechnologySiemensAvance LogicMinoltaCH ProductsHagiwara Sys-ComChuntexAskey ComputerSaitekAlcatel TelecomAGFA-GevaertAsia Microelectronic DevelopmentBizlink InternationalKeyspanAashima TechnologyMultiTechADS TechnologiesAlcatel MicroelectronicsSirius TechnologiesBoston AcousticsGuillemotPutercomMCTImationSusteenEicon NetworksSyntech InformationDigital StreamAureal SemiconductorMidimanSurecom TechnologyGriffin TechnologySanDiskJenoptikNokiaBrimaxAxis CommunicationsABL ElectronicsSagemSun CommunicationsAlfadata ComputerNational Technical SystemsOnntoBeADMtekCoregaFreecomMicrotechMotorolaOlympusAboCom SystemsKeisokugikenOnSpecAPG Cash DrawerB.U.G.Allied Telesyn InternationalAVerMedia TechnologiesSIIGCASIOAptio ProductsArasan Chip SystemsAllied CableSTSNZoom TelephonicsBroadLogicHandspringAction Star EnterprisePalm ComputingSOURCENEXTAccton TechnologyDiamondBayNETGEARTopre CorporationActiveWireB&B ElectronicsPortGearNetgearSystem TalksMetricomADESSO/Kbtek AmericaJatonAPT TechnologiesBoca ResearchAndrea ElectronicsBurr-Brown Japan2WireAIPTEK InternationalSmartBridgesBillionton SystemsExtended SystemsM-SystemsAuthenTecAudio-TechnicaTrumpion MicroelectronicsAlation SystemsConcord CameraGarmin InternationalGoHubsAmerican Biometric CompanyIntrepidYanoKingston TechnologyBlueWater SystemsAgilent TechnologiesGude ADSPortsmithAdirondack Wire & CableBeckhoffMinds At WorkAltius SolutionsArris InteractiveACTIVCARDACTiSYSA-FOUR TECHAIMEXAddonics TechnologiesAKAI professional M.I.ARESCOMBay AssociatesAlteraCambridge Silicon RadioTrek TechnologyAsahi OpticalBoca SystemsShanTouBroadcomGREENHOUSEGeocast Network Systemsid QuantiqueZyDAS TechnologyNeodioOptionTodos Data SystemASUSTekram TechnologyHAL CorporationATIKurusugawa ElectronicsASIX ElectronicsAmbit MicrosystemsRealtekAddonics TechnologyAgate TechnologiesDMIMicrodiaSealevel SystemEasyDiskZ-ComAtheros CommunicationsTangtopPen DriveABCConceptronicMicro Star InternationalELCON SystemtechnikSitecom EuropeMobile ActionSpeed Dragon MultimediaHawkingG.MateOurs TechnologyPilotechNova TechiTegnoAirprimeVTechFalcom Wireless Communications GmbHResearch In MotionDynastream InnovationsGIGABYTECCYU TechnologyAudiovoxSILABS2USIPLXAsanteSilicon LabsTen X Technology, Inc.Integrated System Solution Corp.Japan Radio CompanySphairon Access Systems GmbHDeLormeServerWorksAcer Communications & MultimediaSierra WirelessAlcatelTsunamiPheenetRaptor GamingTwinMOSCyberTAN TechnologyHUAWEI TechnologiesAraneus Information SystemsTapwaveAincommMobilityDick Smith ElectronicsBaltechCisco-LinksysSharkWistron NeWebRadio ShackHuawei 3ComSilicomRalink TechnologyPlanex CommunicationsSilicon PortalsOQOU-MEDIA CommunicationsFiberlineSOHOwareUMAX Data SystemsInside Out NetworksGood Way TechnologyEntregaActiontec ElectronicsGigasetGlobal Sun TechnologyAnyDATA Inc.JablotronCMOTECH CDMA TechnologiesSenaoMetaGeekAMITQcomTripp-LiteNHJASUSTeK ComputerAEIPQIDaisy TechnologyNational InstrumentsMicronet CommunicationsI-O DataiRiverDellAceecaAveratecSweexZinwellSitecomIntelMosChipNORMAL_COMPLETIONIN_PROGRESSPENDING_REQUESTSNOT_STARTEDINVALNOMEMCANCELLEDBAD_ADDRESSIN_USENO_ADDRSET_ADDR_FAILEDNO_POWERTOO_DEEPIOERRORNOT_CONFIGUREDTIMEOUTSHORT_XFERSTALLEDINTERRUPTEDXXXvendor 0x%04xproduct 0x%04x%x.%02x, class %d/%d, rev , addr %dusbd_devinfousbdly0 lengthout of datausbd_fill_iface_data: bad descriptor(s): %s iface descusbd_fill_iface_data: bad max packet size usbd_set_config_index%s: device addr %d (config %d) exceeds power budget, %d mA > %d mA %s: port %d, set config at addr %d failed usbd_new_device: addr=%d bad max packet size %s: No free USB addresses, new device ignored. usbd_new_device: cannot find HS portusbd_print%s, %s configuration %d interface %d port %d%s: at %s (addr %d) disconnected usb_disconnect_port: no device %s: %d port%s with %d removable, %s poweredmultiplesingle, %s transaction translator%s%s: bus powered hub connected to bus powered hub, ignored %s: no interface handle %s: no endpoint descriptor %s: bad interrupt endpoint %s: port %d power on failed, %s %s: cannot open interrupt pipe %s: no ports, hub ignored uhub%s: %s %s: hub depth (%d) exceeded, hub ignored uhub_attach%s: port %d reset failed %s: device problem, disabling port %d %s: strange, connected port %d has no power %s: illegal enable change, port %d %s: port error, giving up port %d %s: port error, restarting port %d sel%d-uaudio_add_selectoruaudio%s: audio descriptors make no sense, error=%d %s: audio rev %d.%02x, %d mixer controls%s: alt %d missing AS interface(s) %s: failed to get configuration descriptor uaudio_mixer_add_ctl: no memory i%duaudio_get_cluster: bad data mix%d-%suaudio_add_mixermixeroutdacphonelfeauxvideofmsynthuaudio_add_feature%s.%sbassmidtrebleagc4 msdelaybassboostloudnessuaudio_add_processing_updownpro%d-modeuaudio_add_processingpro%d.%d-enableuaudio_add_extensionext%d-enableuaudio_merge_terminal_list: no memory uaudio_io_terminaltype: no memory uaudio_add_alt: no memory %s: ignored setting with type %d format %s: ignored setting with precision %d %s: ignored setting with format %d %s: non sync-pipe endpoint but multiple endpoints %s: ignored output endpoint of type async %s: ignored input endpoint of type adaptive %s: ignored audio interface with %d endpoints %s: no usable endpoint found uaudio_identify_ac: skip desc type=0x%02x uaudio_identify_ac: unexpected AC header uaudio_identify_ac: bad AC desc subtype=0x%02x %s: no memory inputsequalizationuaudio_round_blocksize: blk=%d uaudio_chan_pintr: count(%d) != size(%d) uaudio_chan_rintr: count(%d) > size(%d) umidi %s: %s %s: out=%d, in=%d %s: disabled. USB MIDI I/F%s: illegal endpoint(in:%d) %s: illegal endpoint(out:%d) umidi: (ok) %d: already on intrq umidi: (again) %d: already on intrq umidi: missing intr entry Fixed EndpointYamaha Specific(genuine USB-MIDI) ucomucomlkucomopenucomstart: err=%s ucomstart: null oxfer %s: read start failed %s: lost %d chars ucom at %s portno %dugen%s: setting configuration index 0 failed %s: setting configuration %d failed ugenclose: not open ugenread: no edesc ugen_do_readugenriugenrbugenread: no pipe ugenwrite: no edesc ugenwiugen_do_writeugenwbugenwrite: no pipe ugenpoll: no pipe ugenpoll: no edesc hid_start_parsedefault bType=%d Local bTag=%d Main bTag=%d Global bTag=%d BAD LENGTH %d hid_report_size: lo != 0 uhidev%s: %s, iclass %d/%d %s: no report descriptor %s: sc_intr == NULL %s: %d report ids %s: no input interrupt endpoint %s: unexpected endpoint %s: could not read endpoint descriptor uhid at %s reportid %duhidev_intr: bad repid %d uhidev_set_report_asyncuhidevwiuhid: input=%d, output=%d, feature=%d uhid_do_readuhidreauhid_do_ioctlukbd %s: attach failed, %s : %d modifier keys, %d key codes, country code %d, layout %d%s: was console keyboard ukbd_decode This port is broken, it does not call cnpollc() before calling cngetc(). This should be fixed, but it will work anyway (for now). too many modifier keysbad modifier sizemultiple key code arrays key codes not on byte boundarytoo many key codeskey code size != 8 and Z dir.: %d button%s%s %s: mouse has no Y report ums %s: mouse has no X report %s: X report 0x%04x not supported %s: Y report 0x%04x not supported ums_disable: not enabled ucycomucycom_openulpt%s: setting alternate interface failed bi%s: using %s-directional mode uni%s: could not find bulk out endpoint %s: couldn't get ep %d ulpt: iface desc out of rangeulptop%s: offline %s: out of paper %s: output error ulptwrumassCBIBulk-OnlyRBC%s: using %s over %s %s: bus attach failed %s: command protocol=0x%x not supported %s: isdata not configured %s: unable to get Max Lun: %s UFIISD-ATACBI with CCI%s: waiting for refcnt %s: got polled xfer %p, but %p already pending %s: BBB bulk-%s stall clear failed, %s %s: Invalid CSW: sig 0x%08x should be 0x%08x %s: Invalid CSW: tag %d should be %d %s: Invalid CSW: status %d > %d %s: Phase Error, residue = %d %s: BBB reset failed, %s %s: BBB bulk-in clear stall failed, %s %s: BBB bulk-out clear stall failed, %s %s: transferred %d bytes instead of %d bytes%s: Unknown state %d%s: CBI bulk-in/out stall clear failed, %s %s: CBI intr-in stall clear failed, %s %s: CBI reset failed, %s %s: CBI bulk-in stall clear failed, %s %s: CBI bulk-out stall clear failed, %s %s: Get Max Lun failed: %s umass_cmd: large datalen, %d %s: Unknown status %d in umass_scsi_cbDCF77HBGudcfUnknownurio%s: setting config no failed %s: getting interface handle failed %s: missing endpoint uriorsuriowruvisorGeneric%s: no proper endpoints for port %d (%d,%d) DebuggerHotSyncRemote File System%s: init failed, %s %s: device is neither visor nor palm %s: failed to get interface, err=%s %s: failed to set configuration, err=%s udsbr%s: request failed err=%d aue%s: EEPROM read timed out %s: MII read timed out auemii%s: address %s %s: couldn't get endpoint descriptor %d %s: detach has active endpoints %s: no memory for rx list -- packet dropped! %s: %u usb errors on intr: %s %s: %u usb errors on rx: %s %s: usb error on tx: %s %s: aue_send error=%s %s: tx list init failed %s: rx list init failed %s: open intr pipe failed: %s %s: open tx pipe failed: %s %s: open rx pipe failed: %s %s: watchdog timeout %s: close intr pipe failed: %s %s: abort intr pipe failed: %s %s: close tx pipe failed: %s %s: abort tx pipe failed: %s %s: close rx pipe failed: %s %s: abort rx pipe failed: %s axeaxe%d: read PHY failed axe%d: write PHY failed %s: media change failed axe_setmultiaxemiiaxe%d: getting interface handle failed %s: %s, AX88172, AX88772, AX88178 couldn't get ep %d %s: usb errors on rx: %s axe%d: usb error on tx: %s axe%d: rx list init failed axe%d: open rx pipe failed: %s axe%d: open tx pipe failed: %s axe%d: tx list init failed axe%d: watchdog timeout axe%d: close intr pipe failed: %s axe%d: abort intr pipe failed: %s axe%d: close tx pipe failed: %s axe%d: abort tx pipe failed: %s axe%d: close rx pipe failed: %s axe%d: abort rx pipe failed: %s cue%s: read MAC address failed %s: cue_send error=%s kue%s: warm boot, no firmware download %s: failed loadfirmware of file %s: errno %d %s: cold boot, downloading firmware %s: failed to load trigger segment: %s %s: failed to load fixup segment: %s %s: failed to load code segment: %s %s: loading firmware failed %s: could not read Ethernet descriptor %s: no memory for multicast filter buffer %s: kue_send error=%s %s: no proc!! cdce%s: no data interface %s: could not find data bulk in %s: could not find data bulk out %s: no union descriptor %s: too many errors, disabling %s: usb error on rx: %s udav, setting config no failed udavmii, read MAC address failed , missing endpoint , couldn't get endpoint %d , failed to get interface, err=%s %s: detach has active intr endpoint. %s: detach has active rx endpoint. %s: detach has active tx endpoint. udav_setmulti%s: udav_send error=%s %s: %s: dying upl%s: upl_send error=%s urlurlmii%s: couldn't get endpoint %d %s: failed to get interface, err=%s %s: url_send error=%s %s: %s: bad register %04x no %s: data interface %d, has %sCM over data, has %sbreak %s: Could not find data bulk in %s: Could not find data bulk out %s: status change notification available %s: could not set data multiplex mode %s: no endpoint descriptor for %d umodem%s: no pointer to data interface %s: close notify pipe failed: %s %s: abort notify pipe failed: %s %s: abnormal status: %s %s: Invalid notification length! (%d) uftdiuftdi_openuplcom%s: failed to get device descriptor %s: Could not find interrupt in %s: reset failed, %s %s: failed to get second interface, err=%s %s: close interrupt pipe failed: %s %s: abort interrupt pipe failed: %s umctuvscom%s: failed to set configuration, err=%s %s: uvscom_readstat: %s %s: uvscom_shutdown: %s %s: uvscom_set_line: %s %s: uvscom_set_line_coding: %s uvsop%s: cannot open interrupt pipe (addr %d) %s: uvscom_intr: abnormal status: %s ubsa%s: failed to get interface: %s %s: failed to set configuration: %s %s: ubsa_request: %s uslcom%s: could not set configuration no %s: could not get interface handle %s: no endpoint descriptor found for %d uarkuipaq%s: no proper endpoints found (%d,%d) %s: unhandled set request: reg=%x onoff=%x uscanner%s: bulk-in and/or bulk-out endpoint not found %s: could not get interface descriptor, err=%d,id=%p %s: cannot open bulk-out pipe (addr %d) %s: cannot open bulk-in pipe (addr %d) uscannerclose: not open uscnrbuscnwbusscanner%s: open in pipe failed, err=%d %s: open intr pipe failed, err=%d %s: open out pipe failed, err=%d %s: alloc cmd xfer failed, err=%d %s: alloc cmd buffer failed, err=%d %s: alloc intr xfer failed, err=%d %s: alloc data xfer failed, err=%d %s: alloc data buffer failed, err=%d wi_usb%s: open pipes failed %s: already detached %s:%s: invalid packet id sent %x invalid packet len: %x memsz %x max %x %s: %s: error=%s write_record buf size err %x %x wiTXsync%s: %s error=%s UGH RX UGH TX wi_usb: received USB_BUFAVAIL packet wi_usb: received USB_ERROR packet wiIDLwitxlwiusbthratuatu-rfmd-intatu-rfmd-extatu-rfmd2958-intatu-rfmd2958-extatu-rfmd2958smc-intatu-rfmd2958smc-extatu-intersil-intatu-intersil-extatu-at76c503-i3863-intatu-at76c503-i3863-extatu-at76c503-rfmd-acc-intatu-at76c503-rfmd-acc-extatu-at76c505-rfmd-intatu-at76c505-rfmd-extatu_send_mibatu_start_scanatu_initial_configatu_joinunknown-device%s: %s loadfirmware error %d %s: reattaching after firmware upload atu_get_card_config %s: could not get card cfg! atu_rxeofatu_tx_startural%s: MAC/BBP RT%04x (rev 0x%02x), RF %s, address %s %s: no endpoint descriptor for iface %d %s: could not allocate tx buffer %s: could not allocate tx xfer %s: could not allocate rx mbuf cluster %s: could not allocate rx mbuf %s: could not allocate rx buffer %s: could not allocate rx xfer %s: could not allocate beacon %s: could not transmit beacon %s: could not transmit buffer: %s ural_rxeofural_tx_data%s: could not allocate protection frame %s: could not read EEPROM: %s %s: could not read MAC register: %s %s: could not write MAC register: %s %s: could not write to BBP %s: could not read BBP %s: could not write to RF RT2522RT2523RT2524RT2525RT2525eRT2526RT5222%s: timeout waiting for BBP %s: could not allocate AMRR xfer %s: could not allocate Tx list %s: could not allocate Rx list %s: could not queue Rx transfer %s: could not open Rx pipe: %s %s: could not open Tx pipe: %s %s: timeout waiting for BBP/RF to wakeup %s: could not retrieve Tx statistics - cancelling automatic rate control rumrum-rt2573%s: failed loadfirmware of file %s (error %d) %s: could not load 8051 microcode %s: MAC/BBP RT%04x (rev 0x%05x), RF %s, address %s %s: timeout waiting for chip to settle rum_rxeofrum_tx_data%s: could not multi read MAC register: %s %s: could not multi write MAC register: %s RT2527 (MIMO XR)RT5226RT2528RT5225 (MIMO XR)%s: could not run firmware: %s %s: could not allocate beacon frame usbf%s: can't establish softintr %s: usbf_new_device failed, %s %s: can't create task thread set config activated /usr/src/sys/dev/usb/usbf_subr.cdev->function == NULLdev != NULL && dev == up->deviceup->device == NULL%s %s, rev %d.%02d/%d.%02dusbf_devinfo_allocusbf_allocmemxfer %p already has a buffer usbf_free_buffer: no buffer usbf_start_next: %s SIMPLEQ_FIRST(&pipe->queue) == xferbus->soft == NULLcdcefOpenBSD.orgCDC Ethernet Emulation%s: usbf_add_config failed %s: usbf_add_interface failed %s: usbf_add_endpoint failed %s: usbf_add_config_desc failed %s: usbf_end_config failed %s: usbf_alloc_buffer failed %s: usbf_open_pipe failed %s: usbf_transfer failed cdcef_do_request encap error uow%s: failed to set config %d: %s %s: failed to get iface %d: %s %s: failed to open bulk-in pipe: %s %s: failed to open intr pipe: %s %s: failed to open bulk-out pipe: %s %s: missing endpoint: ibulk %d, obulk %d, intr %d %s: failed to get endpoint %d descriptor uow_ow_matchromuow_ow_searchuowcmd%s: cmd timeout, type 0x%02x, cmd 0x%04x, param 0x%04x %s: cmd failed, type 0x%02x, cmd 0x%04x, param 0x%04x: %s %s: read %d bytes, xfer too big %s: read failed, len %d: %s %s: failed to alloc xfer %s: write %d bytes, xfer too big %s: write failed, len %d: %s mii_attach: phyloc and offloc specifiedmii_activate: phyloc and offloc specifiedmii_activate: DVACT_ACTIVATE%s: config_activate(%d) failedmii_detach: phyloc and offloc specifiedOUI 0x%06x model 0x%04x rev %d at %s phy %dmii_phy_setmediamii_phy_setmedia: MASTER on wrong mediamiiautnsphyDP83840 10/100 PHY: %s, rev. %d nsphyterDP83815 10/100 PHYDP83843 10/100 PHYDP83847 10/100 PHYqsphyQS6612 10/100 PHYinphyi82555 10/100 PHYi82562EM 10/100 PHYi82562ET 10/100 PHYiophyi82553 10/100 PHYeephyMarvell 88E1000 1 Gigabit PHYMarvell 88E1000 2 Gigabit PHYMarvell 88E1000 3 Gigabit PHYMarvell 88E1000 4 Gigabit PHYMarvell 88E1000S Gigabit PHYMarvell 88E1011 Gigabit PHYMarvell 88E1111 Gigabit PHYMarvell 88E1112 Gigabit PHYMarvell 88E1116 Gigabit PHYMarvell 88E1118 Gigabit PHYMarvell 88E1149 Gigabit PHYMarvell 88E3082 10/100 PHYMarvell 88E1000 5 Gigabit PHYMarvell 88E1000 6 Gigabit PHYMarvell 88E1000 7 Gigabit PHYexphyxl: 3Com internal media interface %s: ignoring this PHY, non-zero instance exphy_service: can't isolate 3Com PHYrlphyRTL8201L 10/100 PHYIP101 10/100 PHYrl: RTL internal PHY rlphy_service: attempt to isolate phylxtphyLXT970 10/100 PHYLXT971 10/100 PHYmtdphyMTD972 10/100 PHYicsphyICS1890 10/100 PHYICS1892 10/100 PHYICS1893 10/100 PHYsqphySeeq 80220 10/100 PHYSeeq 80225 10/100 PHYSeeq 84220 10/100 PHYtqphy78Q2120 10/100 PHYukphy: Generic IEEE 802.3u media interface, rev. %d: OUI 0x%06x, model 0x%04x %s: no media present bmtphyBroadcom 3C905B internal PHYBroadcom 3C905C internal PHYBCM4401 10/100baseTX PHYBCM5201 10/100 PHYBCM5214 Quad 10/100 PHYBCM5220 10/100 PHYBCM5221 100baseTX PHYBCM5222 Dual 10/100 PHYamphyAm79C873 10/100 PHYDM9101 10/100 PHYDM9102 10/100 PHYDM9601 10/100 PHYAm79C875 quad PHYacphyAC101 10/100 PHYAC101L 10/100 PHYAC_UNKNOWN 10/100 PHYnsgphyDP83861 10/100/1000 PHYDP83891 10/100/1000 PHYurlphy: RTL internal phy %s: %s: enter %s: %s: link %s onewireowdtfamily 0x%02x"%s" sn %012llxonewire at %sowscanonewire_searchowidle%s: can't create kernel thread IDMultiKey4kb NVRAM + RTC4kb NVRAM1kb NVRAM1kb EPROM16kb NVRAM64kb NVRAMTemperatureSmart Battery MonitorJavaowidowsbmTempVDDVADCR: unable to register owsbm update task owsbm_updateowtemp: unable to register update task owtemp_update ttcompatCLGET: returning %x getflags: %x compat_43_sys_acceptcompat_43_sys_getpeernamecompat_43_sys_getsocknamecompat_35_sys_fhstat[Od'( <<d d@@((@ @ @p@ FF FFF̡FFFܓHAH$F,F8F@F2HHFԔHLF\FyHhFpFxFFF  DA7EFBCDGHI2@>:90!()14K*  .f4R'8P+IIII@ITII IIIIIzIzIII{I{IIIIIII0IDIIIlIIII̝IIIIIIIII$IIIIHr(X>I@'&>IHr(>IHr(>IHr(?Ip'&D?I &p?I%&?I*?I8%?I% @I'&L@I'&x@I%PAI'&@I)&d;I4)&@ID)&@IHr(xAI*0nM'`m*`t*4G't?'?'T( ) l)) D) ) p)8***v*hg'$DD>'Dt&(?'I(& H`'?'d'L'(L'4&e'e' }( '\*܋* * &<*T}*D\DD0w'p&0w'0w'(C90C9Dp9M9 `O9 P90w'0w' E9@'J'X>'@' X'@D0w'D'DDطDX&0w' &|(0w'* M' () ) DL'DDpd< ,)@)̰)0w' DDD,e',D |D D0w'L'tU')0w' u( z(ȶ' *$*lDF'4F'*DtDL&*)))**(*0w'' ЮDDxDDdDDp@'|w*XD pD0w'0w'0w'0w't4`D0w'0w'0w'0w'́*0w'0w'0w'<0w'0w'0w'0w'0w'0w'0w'**0w'0w'0w'0w'0w'0w'H'I',H'0w'0w'0w'0w'DDDD*ا& 9R' P'* H90w'***~'Q9R90w'*l>'[80w'''''''''''0w' ( D0w' 0w'D((( `( 0w'( tDx'г'@'0w'0w'0w'0w'0w'Ĵ'0w'0w'0w'0w'0w'0w'0w'0w'0w' P9& ,(?' x*>' L90D D D Pz*x*Xy*)Ԃ*ԶD*D**̼&&,S9S9 )0w'0w'0w'0w'0w'0w'0w' A' xB' (D' D'0w' 8C9&f' ( T(,*&ܐ**ȿ( ( ('0w'0w'0w'0w'0w'*'D&L&T&\& &&&X&&̺&&&&/I/I/I/I|2I `/IF\FmFmFmFmFmFmFmFmFnF nFqFnFnF$nF0nF8nFDnFPnF\nF`nFhnFlnFtnFd)G|nF̦FnFnFnFnFnFnFnFnFnFnFnFnFoFoF$oF0oF@oFXhFHoFXoFhoFxoFoFoFoFoFTGoFoFoFoFoFoF|THoFoFpF pFpF$pF0pF8pFDpFPpF\pF`pFhpFppFxpFpFpFpFpFpFpFpFpFpFqF qFqF qF0qF 1I 0 x'4x'x'2I2I2I2I2Id@B $I4G|F|F(`( 3I t-(-(-(-(\-(l-( A% F~HF0>HFjGFFF*GF(GF,H FH$RF@PG G&HDWFHH(F,HRFF0FFI TFL>I `F|>I lF>I xF>I F?I FIX>I>I>I>I?ID?Ip?I?I?I?I @IL@Ix@I@I@I@I(AI8;I*;I0*;Ip*;Ip*Ip*X>Ip*>Ip*>Ip*>Ip*?Ip*D?Ih*p?Ih*?Ip*?IPr(?IPr( @I*L@I$*x@I*PAI *@IH*d;I,*@Ih*@Ih*xAIPr(|M4BI8;I*;I*;IH*;IH*IH*X>IH*>IH*>IH*>IH*?IH*D?IH*p?IH*?IH*?I *?ID* @I*L@I$*x@I0*PAIH*@I*d;I,*@I*@I@*xAIPr(MTCI*@***8;I*;I*;IHr(;IHr(IHr(X>I@*>IHr(>IHr(>IHr(?Ip*D?I *p?IHr(?I*?I(*?IL* @I*L@I$*x@I*PAI*@I *d;I,*@I*@IHr(xAIHr(MDI8;I*;I*;I(*;I(*I(*X>I(*>I(*>I(*>I(*?I(*D?I(*p?I(*?I(*?I*?IPr( @I*L@I$*x@I$*PAI*@I*d;I,*@I\*@I*xAI*MEI. .. 8;I*;Ip$+;IDI+;IdK+I\+X>Ih]+>I]+>Ie+>Ii+?Ii+D?Ij+p?I8q+?I*?I@ +?I + @I@q+L@IXq+x@Iq+PAIr+@Ils+d;Itq+@Idɜ@ۿRdv!0&gv4DUJüXџn|ك1 w.fT@R+:dN_vm|$ÿ6H ;Z*^lO}~l .ǟ䩐 2ZLKy^hh ?z.ĕ*8FkzTHYb-IV5X>Io5>I_5>I5>I$5?I{5D?I(5p?I5?I*?I2?I2 @I*L@I$*x@I5PAI5@I5d;I,*@I|5@I5(AIHr(xAI$5N$dI8;I*@Ih7X>Ip7>I 7>I7>I07?IĦ7D?I7p?IL7?I*?ItB7?I6 @I7L@I7x@I7PAI<7@I7d;I,7@I07@I7(AI6xAI*NfI8;I*@Ip7X>Ip7>Ip7>Ip7>Ip7?Ip7D?Ip7p?Ip7?Ip7?I7?I7 @I*L@I$*x@I|7PAI7@I<7d;I,*@Ip7@Ip7xAI*I%8X>I&8>IH(8>I28>I58?I68D?I47p?I78?I*?IX7?I:8 @I7L@I7x@I7PAI<7@I7d;I,7@I07@I\88xAI*NjI8;I*@I`l8X>Ipo8>Il8>Ilm8>Im8D?ITn8?Idp8p?Ip8?Iq8?Iq8 @I=V=V='(r((r((r((r('(r((r((r((r('(r((r((r((r('(r((r((r((r('(r((r((r((r('(r((r((r((r('(r((r((r((r('(r((r((r((r('(r((r((r((r('(r((r((r((r('(r((r((r((r('(r((r((r((r('(r((r((r((r('(r((r((r((r('(r((r((r((r('(r((r((r((r('(r((r((r((r('(r((r((r((r('(r((r((r((r('(r((r((r((r('(r((r((r((r('(r((r((r((r('(r((r((r((r('(r((r((r((r('(r((r((r((r('(r((r((r((r('(r((r((r((r('(r((r((r((r('(r((r((r((r('(r((r((r((r('(r((r((r((r('(r((r((r((r('(r((r((r((r('(r((r((r((r('(r((r((r((r('(r((r((r((r('(r((r((r((r('(r((r((r((r('(r((r((r((r('(r((r((r((r('(r((r((r((r('(r((r((r((r('(r((r((r((r('(r((r((r((r(0r(0r(0r(0r(0r('(r((r((r((r('(r((r((r((r('(r((r((r((r('(r((r((r((r('(r((r((r((r('(r((r((r((r('(r((r((r((r('(r((r((r((r('(r((r((r((r('(r((r((r((r('(r((r((r((r('(r((r((r((r('(r((r((r((r('(r((r((r((r('(r((r((r((r('(r((r((r((r('(r((r((r((r('(r((r((r((r('(r((r((r((r('(r((r((r((r('(r((r((r((r('(r((r((r((r('(r((r((r((r('(r((r((r((r('(r((r((r((r(=%>%X?%?%4@%,@%@%(r(4A%XC)Pr(C)TD)D)Pr(|E)(r(8(<<<<8<(r((<Pr(Pr(̨9 9(r((r((r((r()))P!)\-)")4-)T((r(8(8#)#)h$)&)\-)Pr(4-)L))(r(,)h((((r( ((r(((r((T&(r((r((r((r((r((r((r(G! H!H!(r((r((r(((r(0r(0r((r(0r(0r((r(((r('(r((r((r((r((r(((r('(r((r((r((r((r(((r(l p , T((r(8(0r(0r((r((r(0r((r((r((r('(r((r((r((r((r(((r('(r((r((r((r((r(((r(?4?X?? ?(r(((r('(r((r((r((r((r(((r(0r(0r(0r(0r(0r((r(((r(L%P% %%%(r(((r('(r((r((r((r((r(((r(8&%l'%p1%2%2%(r(((r(y+dy+y+|+}+(r(8+(r(+'(r((r((r((r((r(((r(f=i=@o=o=o=(r(((r(0r(0r(0r(0r(0r((r(((r(4=(7===P==>=(r(((r(0r(0r((r((r(0r((r((r((r(0r(0r((r((r(0r((r((r((r(0r(0r(0r((r(0r(Pr(((r('(r((r((r((r((r(((r('(r((r((r((r((r(((r('(r((r((r((r((r(((r(5-6-A-DD-=-(r(I-(r(PJ-8>>(r((r(\>(r((r((r(> ' '(r((r('(r((r((r($$d$@$$(r($$$ %\## #(r(#(r(#(r(4#(r((r((r((r((r((r(((r('(r((r((r((r((r(((r(%%%%4%(r(,%(r(%'(r((r((r((r((r(((r('(r((r((r((r((r(((r('(r((r((r((r((r(((r('(r((r((r((r((r(((r('(r((r((r((r((r(((r(l""(r((r("(r((r((r(d22222(r((r((r('(r((r((r((r((r(((r('(r((r((r((r((r(((r(%%%%%(r((r((r(;8<8@8 A8<8(r(<8(r((r((r((r((r((r((r(((r((r((r((r((r((r((r(((r(0r(0r(0r(0r(0r(0r(0r(T((r(8('(r((r((r((r((r(((r((r((r((r((r((r((r(((r(p%4%%%%(r(,%(r(0r(0r(0r(0r(0r((r(0r((r((r((r((r((r((r((r(((r(E?xG?4I?I?J?V?DJ?T(S?\T??x??(r(?(r(l?(r(??0?(r(?(r(?(r(?P?8?(r(?(r(?(r(G@ I@(r((r(XI@(r(K@(r(LAMAOAPASA(r(,TA(r(HUApuAxA(r(`zAzA(r(((r(PA$AA AdA(r(A(r(AAAP A AA AT((r(8(B8BdBB8B(r(B(r(BAA"A%Ap2A(r(3A(r(5A0r(0r(0r(0r(0r((r(((r('(r((r((r((r((r(((r('(r((r((r((r((r(((r('(r((r((r((r((r(((r('(r((r((r((r((r(((r('(r((r((r((r((r(((r((r((r((r((r((r((r(((r((r((r((r((r((r((r(((r((r((r((r((r((r((r(((r((r((r((r((r((r((r(((r((r((r((r((r((r((r(((r((r((r((r((r((r((r(((r((r((r((r((r((r((r(((r((r((r((r((r((r((r(((r((r((r((r((r((r((r(((r((r((r((r((r((r((r(((r((r((r((r((r((r((r(((r((r((r((r((r((r((r(((r((r((r((r((r((r((r(((r((r((r((r((r((r((r(((r((r((r((r((r((r((r(((r((r((r((r((r((r((r(((r((r((r((r((r((r((r(((r((r((r((r((r((r((r(((r((r((r((r((r((r((r(((r((r((r((r((r((r((r(((r(4D!D!(r((r(E!(r((r((r(45)<5)D5)L5)T5)(r((r((r(0r(0r((r(0r(0r((r(((r(adG\b@%K@p0A @ 0,@PG$"VD D H >h>0 -44ddd[[d[2d[2d[(Pdp[p"CRd$ HpT<><>c0' c'c055$s ?/ 5|II5u>P{>{>HHHHHl>>>`>pX>ԇ>>> 4H-PHhHtH|HHHHARC >܎>l>>(H><>@>>>>>Ȕ>̔>>>>@>stdIP|>>H<>D>Hl>t>x>>>lE<>Ȫ>@Hh>>H>е>><>8>>H>>DE$8l>> HD>L>>8HWM87501.0wmX>t>|>0>>h>>x>>>>>>< >>>>`>Ed> > H>>>EX>t>d>F%>4>(>>>>>$>>>D"H$?%H'H4'HH'HX'Hp'H'H'H'H4G&HH'HX'Hp'H'H'H'HD"HxGPXF^F'HG)H0@?`@?0A?b?\b?b?-H??,??d2d`???X?D?++#aa@(([//\))](-{/-|)-}!!c/l-y-soxoco<<>>?? ' ` ~ ^ "' ,AAA AA'CEEEEIIIINOOOOOUUUUYaaaa aa'ceeeeiiiinooooouuuuyy"A"E"I"O"U"a"e"i"o"u"yA^A`A*A~ACE^E`EI^I`I~NO^O`O~OU^U`UYa^a`a*a~ace^e`ei^i`i~no^o`o~ou^u`uy/H???|????l???L??$E?????x???????t3H|3H3H3H3H3H3H3H3H3H3H3H3H3H3H3H3H3H4H 4H4H4H4H 4H$4H(4H,4H04H44H84H<4H@4HD4HH4H????@`px|~ 08<>????????????????????????? @`px|~ 08<>????????????????? @`px|~ 08<>????????? @`px|~ 08<>? Boldface.iso1 @Iwfllllllll||| 0 `F8ll8vv0 000000 0 0f<0p000x6 0>p00p>p|`08l 8llF`0| 0|``f`?8`DDE9  2 2 a>wc`aaa?`  0  0f`vvf`    ` 00`000000006??a@ 0  @````@``@? !? ?1```@```0 00`gop``````p@??`@@000  000 ``````p?```<     `xx``88`9  ?0```g ollg`0? ? @@`@`````a``````````` `````` 0 @a``````````````````@a0@0@000?00000 0 0@0@000?000000x` ````a`` `0````````````````````````80acflxx|ngca`px00000000000 0 p`pppY`Y`Y`M`N`N`D`D`p` p x X L F G C A@@@`0 ````````````` @0@00`0`0`07000000x `````````````0@8@#a````|ngca`p0`` ` p<@`@``F p` ` ` ` ` ` ` ` ` ` p@?`@000 f f f v w@3@7@;;p` 0@8   @`p` 0@ ?   ?``00 || ||1`0009 ```gop````````p`xO1 ````p@0`````1 ````````p9`p0``````0`   1```1?`? `@ @ ?0p00790000000y 08````acf|x|ngcnf`f`f`f`f`f`f`p'y0000000y ````````p@8q``````````@p````  ````````p`8````s48000000x00@8 0?  @y00000009`p` 0@0@ pf f f 7@;@;@p@8  ` 0@0@  xp`A8 p`8    8 >`6gC0000~|V`s@ o`?0000?o`@ ``00`0?a00`0`00/@)@(@(@)@/@0``0`0`?` 6ll6 `??0/@)@/@*@*@+@0 33 ???<f0`~<ff< y00000009>`0000x?```?````````` 8<0`0`0`?l6 `` 6l08@@@@08 8D8D8@@@@ 000@9  ? @@` ? @@` ? @@`  ? @@` ? @@` ? @@`   # ##CCC` `````` 0 @  0@0@00?000 0 0@0@00?000 0 0@0@00?000 0 0@0@00?000 0  100`0`0``0`0`0`0`0@1 p` p X L F C A@@`0  ``````` @0@ ``````` @0@ ``````` @0@  ``````` @0@ ``````` @0@ 0`  0` `!!c`c`f`f`l`l`8@8@8o p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` 0@ ``````````8```acc````````ac 000900090009 0009000900096@&``?fff v@;1 ````p@0  0``````0`0``````0`0``````0`0``````0` Dl88lF ````p@8 'y0000000y  ````````p@8 ````````p@8 ````````p@8  ````````p@8 ````````p@8``#c`f`f`l`|@8?`` y00000009`y00000009`y00000009`y00000009`` 0@0@  xp````aaaaa`` 0@0@  xpI@I  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ͳɿپ̴ް?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~IorIIII II&I!ItG5H5H[H5H5HL@L@H<X@@@|@,@|@@(@@@@0@@@\@@0@@@@USB audiouaudioH@@@,@L@HlJtJ\JJJJJJJ JJJ<JDJ  ,JlJtJ\JJJJJJJJJJ,J4JJ\JdJLJJJ|JJJJJJJJ$J JLJTJ<J|JJlJ|JJ JJJLJ|JJJ J<JlJ J J#J',J)\J+J̫FHH,HHH4A4AH4A4AH4A&  % 3u Du u <u 8u 2u 0&'u 1&u 0&u     )%uu 0 1 8%u   3 D D%uu < 8 2u 0&'u 1&u 0&u  hHHTA(UATA&DEHģHoA(mAjAkALlAlAHH\H\H*H H$H4HpAHATAH̪HH# # H8HбH0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-H{{ԳHHܓBq O~%A$\9|0aIh"  XC'S@/@^t%tj?~IP9xh-I(,SMgCLvIh'lgT+@\%=&\Gc@L]NlZ.LT.<:684xu2@p@'h,.z-0 tYI0r@%$d5QO? D<I*Q|>e( )8`;HID(B@X$ }Dd,/ `,A5=8@x7LQP*<^ď&@hTH< $-  ) M ?X M  M `U*. 8@xG MX 'h^ Md Io N)w ? J =H &  `/( lJ M@ * X 7 :/ dD ^%T) I8 2G -_ $%Xx = MD POI `&d YI h}- hI L-$ *| ,{D0 MD T.X& $9 @,K ;\Y 0CLb @w ( pM T2< $ $1d r.T < 4. d9 N   `J< D $M Ĺ28\ |]?m 84DFE LOUh <_P/HF!Dt_@D >x2 D0T?@I)0(0QO f)#AC6gIxIHMS9"t_}I f܌Bs\M7!(Mp% $@xLCx9D><!)\ M'X?x-89> 7J5I[Eg;0u+x# HM,5Xm.l)6+X&M[B0Mt9`̺&=#f797C&XSD-$dzDtmг'ph#TGC E<=PId<2' |$tt# PI0\'p-Լ"TFHD SHe=P\h0t>|?TT>t\Z8x /Dlc'PJ@[8,x@XNI *@X3IH$3Tr"0k/pu,LM HAH+$ =hI[@pt-t$@E|4?\#i#4`4@CX,KT&TXC\bе>s< -,|Ih=hOI4Xj=H0(t"x#pd9 ChG+HX&$>E%D =*>=/HL@/I\-XglsAs>}@MD\6C.0j@Tģ0D`+L4'@v$P/$X#lAd,)6(}D(?9OD4P_*nlC`|8>,-&%:?I$d$8B4L88>0@m* M;Ip/D5%(dEx*HP\+l_&Xk$$8y/  `MJ X8B 9Z@@|9@`84( ܯ=`9.$e.CdMN8EHXHM^%jsD}X;.4hD[I@[I /,$X$XO(t)İ2 H)P(C9`?,+XDp2|@G`'PU(\D[ $g4>uE?d8-=@2@'&00A?M JlYId"IX (N@$*O2>? 0PfDi5s,(h{`B,N\-S&HCxXOXO:%Df;t>>LOA+LO:1My@x]pXIjUIdy+h@6z(M'\te#8lBn) lATBH ԀA-x@$BUILBZ}Bk$<,P@/L|%<ДC0? &pMXA/$Z#40|I̪=X6TI`!p9m!3.x~! '!5$!$?t!]@!IO!K<!pA!' "a?$%"te7<" <1M"/Th"&\t"M"^I"|M"@'"@$"-"PuM")t"LM@"k&"#< #I#I#8,#(L'P9#h$H1$M$MP %=T%=,%M5%7I?%^CI%>P_%uIo%"C%ĠI%UI%%8%UI%JI%,%P%$v<%M&xO!&h= )& %5&$?&BTM&T._&@>#q&$8L{&$u6&DYI&B&n/&*&%&xBD$&tA&K<&x%'&(d'T/I'24+'M6'\+ C'NO'L+^'xJ(xj'_=w''D'?H'4'O '='2'/'8N%$'|I'XB (P`9d(<8p((tM7("hB(CQ( 9@Y(>#k(+Tz(S&(B(ܽA(C(dfI( -<(\J(@N0(M(E)3I )TC)nB\ )PI*)mD2)X$x>)hA$J)LOa),H'm) =})l?@)M)L09)%).C)l=B)y2X)aC)l=<4)> *H/1d*K%l.*A@*=\T*hh#8h*|Iq*%*I*dBH*I* >*$*J*e-*&*&*,%*'+H&+I'+@:+x'@I+@ V+ 'P b+-\>d-$O- K'<-)-0H-x10?I$B0li@LV0?(j0̌${060xe-H0 =C00/t0L))0D+0@$0&?<040djI 1/I1B)1 (31L>d=1D=>P1y+hX1=h1(q1DQ) z1E1T'10M1$!1,3"3Cx3Bh3sI3Ƞ84J4B`4M'4E54v<K4t" Z4h#<m4l#Ty4Cd4%84HI4&\4-x4z-4Pq#4h@(5P:l5N/"58%h45 s?D59T5d0|b57!4|5lyA5P*66 J68BW6Xm7t`6L)j62I{6LO64B6X.6*L6C`6T<6O6-,6I6|  7C`7I%7pC77>8L7i=TT7l=Ih74*(}770`70J)7Lw'7t?'$7$7W97bE7|&,8y8X8{CP+8OA8 4TM88X8TIl8#48Y'8D#88̿A 8܈<l;JO x;h*O;<=H;8; dI;poI;C;(;: ;/I<`MD<W9&<q&L7<x" O<Hd.f<T&s<p&@}<X<<?I<(I<`t9<IOx<YO< *`<ĝ=<^=<O =N8=lI+=@BT7=1@K=4,X=QIi=xIz=D<=j8=tM=*= =h8=-H=0@>>> LO*>{75>D2$A>`?Q>`>e>POm>C>\M>b->D#H>7!>(I>|I>(;*L>tB7>$C,>HBp?,@P?DvI ?C2?()=?@DK?AT?22T`?LCIv?!X?@BL? C@?p2A?>@?*?*?&8?7D?4BI@J@LlAL&@&9@%lB@ IL@H*W@ܱ&<^@Ķ1,m@J |@7,@M@lA@N@X2X@BP@=@-@$=@1PAUI*AZ'?A PAؼ@4`Ah<$vAMAAA` AHAX' A^*$Ad AE0A]IA=+Bi#(B؆ &B!:2B$> $C8[I%Cl?9CDtQCzIZC iC&\pC4$C>dC 'CĖDCTCC@CԳ%4Cp?)LC`l8pC̄<`CJD=D$X+Dp><;D0ILDPXIZDث>LnDX95\xDtED(2D$MD7*DPBxD0=DVDD&D+'D?Dl9X EIE@D4(El"0EE:8 REl6pE-&L|EP,! E\ZO\E?E$IE[OEj8 EĽ7EME$E`X  F@DF-T"FX$`1Fd$BFHUAOFN]F̼*8jFMxF̼&F<%@F%2 F.0Fd8FNxFlEFl@HF":Gu.\G`$GA-G?D0JGSD]Gh*pG9I}G,tGC`Gd-G %GG!@GxIGSDGDAG$AG\{DLG ( H<'Hq"T.HIĦ78JI45)RITC_I(AlI7@vI*I\^@`IoC I/I\-ID$ICD`II%I\*.I t( Jd*TJ/P J*(J B6JD!EJBXJ;DfJBTtJE|J\? JAlJ,)`J%\J$4JQOJNJ>0JMJV@ KMKI(K !p)KI3K(IGK2xL4%L|,0LH)LD%dL@GDL=@L5<`LH(`LILEL/ MMMM!MDB\0M4|GML7!0\M >gM !dsMA\M;0M|6MMM4-MDI MIM<)MIM=dMtXIN"N?(%N=:N-DN*XNNX&P\NTIdN$$rN#l~N|#NAHN?$NUIN01dN\MN@'N{<(Np) NL@$OO@O=8 O/p(O+\2O0x=OB8MO8w7TO|p0|dO >wOK)O)*0O#DOWDO#O47O;x O*OU#O*xPF P7,PF"P̛ -P>4=PAIPLy<ZPL2 dP&tpPhBP$AP%?pP[9P< 5P9hPp)/pP P`>PTDQMQ-<.QM(?QxCIQ=dQH5qQ yQt QEBQA-<Qx*<QY%8Q1Q'hQ 9)QUIRp)RC\R7*R6I1RlX&t=R<FABR<$PRl#haRJjR1dvRtG%(RS?xR2IRx<(RLBDR 9 R0$R= RODR^IhSpMS&S@%L S F ,SC6S8NGSjBPS4IWS"?fSد-uSHISp'SsISH/HS$ISt8,S/S0r(SHF1T*TITI)Tc?\CTpINTh<YTl"`TF lT$Y?Ti8 TpJTx1T2XTT-TF'Tg@ T| CUXBUP9'U%d5U(?XBU0I`OUDc8\Ud2gU&MvUh U<[IU$$U$sDU@6IUp@Uv=U*UJUYB UD&V(V@I$V"P.VBx;V0EVNQV(UIYVd_#|hV HvV@JV{ExV$4V=Vs+HV 0V[IV'V@BVHIVPY@L WIHW&M!W]1x'W&.W@ M6W J@WC4IW`,VWD/I eW$xW(I)|W W|IW8WE WVOW7W |W8*WCW9(WK(X,h'\ X<~BxX?/XY.BXNISXA*bXC`rX?8X ?X44 X8X J XtDX8"<XLBXgDXDX'XP|C Y(LY4 YB7YD0>IYL ,UYB_YTE mY;Y0L.dY$,YlJY=Y=HYB`YBYP=Y0F Z,f&pZ0 %'ZpCD3ZD>AEZp0DSZCgZ>@vZNZ&ZuIZOZ6Z0 Zt'Z0WO8ZO/4ZW*dZ,XB`ZAX[6 [.h0[]':[#PF[H+P[[#hn[@*Xy[DM[PJ [@@[`Ih[./[wD[ F [I[\9[;#`[D><[<' \s(\ty&'\D%t0\M;\ BpL\T%X\7>Lo\ c8y\.T\NI\l*&<\ !\@t\ Al\M\EA\ )\\$0\PCX ]UO]l4+]4I1]L2<0A]7N]!b]1p]X<{]LN@]$]']pKM]@*O]05]\I$]l+x]$X^>\^HI^hM$^(:))^)4^G&4=^\%H^0MV^>Lf^F%r^;M^fC^q?`^@<^M^o.T^*)h^)^7D^̰)x_`m* _N"_#4_j'l=_!<J_lA)tQ_ (d_$,|_><_8!_x0p_@_0_ $_e9<_`|>hO`|6Y`l?\h`5hx`@$`.@x`8I `TI4`D=@`P)$`D`h $`x&\`A`X@ aTBla=` a'D/a7*:aK?0Ja=7d]aVIfa 0qa< aL@pa*a%a(Na1aUIa@$La8>/a-(b<&8 b&))bJO4bA>bo=`FbNTbD M\b&`bbF%nbPC~bAb=Dxb&Bb>;4b$8bM-bVIblMbCHc" 5c,DBcMNcD7 YcAec7`nchfIzcPIcYBc`:c:$c;IcT(c+c(lc&c(%XdtAp$d=P,d6- 5d$xEd pbdhhIud( ~d,pdODd|Id?>Pdh<d|!2(dd#4d8N&d!<eBB<e<7De !!2eC?e)BLeQO]e7?xuel+HeVMeC eDBe4Beh7Pe0MeD)PeXBe/Ie !D f]+lf@' -f;8$@fx28Mf4I[fP}D<efXO=ptf=4fd<f%D f;If4%hf' f"Tf)DfA g|:dgN $'g E/gTQB@:g:`JgoI\g7lighA<tg,Igls*g,$ITg>@4gp>,g%LgԻ2 gJgAg?hT$:$h89X 0h\=pBhDKh,e'hZhX&ih?th=h\@0h(2hPk'PhpMh=hhn.hK<i:I i<i-+i<$x>it?LiHOYiD2Tai&\mi'|iV'i| i4i0ixBhihF>(iCiBi[Ijd9dj$.'jJ0jGD<>jHvINj.bjI($gjAxxjAj0IO8j`)j,%PjNj@%<j0Ij*jgDj+DjUOjL'k<>dkdD0kp2@?kTCBMk4![k0.rk Myk $! kLMkJkt7BlkY<kh.,ku)k\&tkhH=kp@IllLMl,=Tlt-($.l3(H8lOAlAlX9hOl#$bl@D<rl|7\}l\S;l&lU;lt>LlXOlxE+lb&lBXltv8ml42ml\,m-,&mo!7mXJOJm%Ymм$tmm`Y! mB0mp)mj"m!@mX@8mNmU+mQDnBn`DD*nB\7nr&LLn>XnLU8gn.{n(n&Tn $nDn>n@}>8nxr8n (`nIn܇8oXj6lo @oC,opMEp0,VpLj.PfphD,qpXWIp-pp1%ppLMp 1p<+p-p- \pȠ=pOqHIq4Nq**q(6qęD DqNSqDIeqO*rqDv;(}q8>hq#1q!\qT*qDzs AXsVEsD*sLJ s%stKMxsP!0s[<|sd`I$s)sH(tT2Dt*tD -t>IBt8*@KtE0Ut0>ftIdt4d/t8@tdJtK*ttoItNt,t:$tTuMt$" uhAu<\I$#u2I/uJ$$>u\@Tuع=eu01 ru@'#uB u?uT?u|'|udrCu$LOu(JA8uL'(v8=v/I.vD1:vsILvlIdvL >0uv+}vh$Lvnz("9z&z+zH J z<z!4z{W9 {nM/{6?{)tJ{8M(D\{4 Je{5| r{N{]({xL',{&\{I{^!@{?|b?|M |YO,|X=TB|`# U|.j|H*Os|L5)||A(|;|<"|L=|u)0|$$|@|C }HI2}LM}(> 1}(l=}ԧ#TU}8h}$|}p2(d}PW'}$X}7,t}P;9}zI}5 } 6,}?'~&~4A&~&(~hu=;~p{1N~+X~Dj~0Aw~?~6~%$~L?X~l;0~B)~M~HI~18~lI )0u9& +P8TAxGMSdeDjBTz'=X(rDA8@n=0g8xQ*L$\JOt<.P+xJԻ("L&$<AB#(TCPd+l;)q%~Ht< *DB$.MÀHsDπ2ۀO hԮ.lT~!P,@B\9xa4DAa&xT0 `;MkJtDJ}bAPf4l%)`DN4 ƁH3ԁN\jC.8[."<.VI5pIHi-YطD(ulY9lMȪI0>d]I>\ςp#tuI80@P 2=hR(%lIT*@_4 C4o17=dBD4D70ƈx9ֈ' -6*4' PD<++N81IGQO U`.lب>v7dIIi895/4*0̉po8ՉPp/4QI&8S,؜>P[I$&Z(`6E|EX8 R\-XfKMoHB{ԅA@[INDVEL'DŊ#@ۊJp2L'N l2NjzI֋$I" $Bp0$!:d(DH*/|h-:s)lADtM\CYg?dMo\B BD$ܝ$<|\+XɌܭ@p4PCHx: %8+() x3CL?l=N$MS,+ \Mm&L~q9j8h@,l#$0hٍt>b8 M8@ T,OP<"4A28tXApDI UXODeTq<p0nM%H4#\%\u/Apʎa! 2I Dt=I$V=$D)=A|[<E0|T dLW?L\wIǐc8Ґ3<ݐllB7`/OX\I$=,p(\Z'86 ^7\CZ1Q +4Z&Td!D rC8~@2 0L(( 4ő2Iב=UId7I0.<Xr( 'M3ؒ<Γ8ܓ+JD%=Pا&/M!!,,>0C?XM,c8VPIaPIzv)\wM=%=|t3$gChȔBڔ%8$I`C4,hC>H! AI<7IF-MS4>``<8mP!TT<>,HMl9@,CLCŕH?וG#L87| @\&N4PI>\*PJ@? Z|8oB&zY# X.txAhJO8+ɖľ$Ӗ"2C85@he? ܸ4XM#Cd.P<@X<@NO*H\8!sD?I$R @7"*|=ODԗTNI$tBP/@SAxsI+! 9(LOM4F'ZIdX]@@tB\tq8<H=%t,f@(*Z*dǘ ܘ@# XO5| *B0$X>02>81DK6Y`)a=wH*[IBPB,>|0IәC!@ߙj8|$,1x K<?&`-TvI< 0`G,=|VVIa)4jLK0r,)~,VB O,+d |IdҚ52ߚC0]ILI>xL& %7Dd4\J;zIEQ*@W B$`TCOhi*0t\71Pt=*X)tM A<l7T˛0֛DM&8НT7IH CX< : ,/ %N7\0BtC=\x@I$j? K'4$L|u, ?4+,L7'&Ct8TTw8dPPI@XA\$I@ϠE*d &84%hI8#<#:4\v$<F S|I% fP$qPAx OȒD3C$9!$pM ġ=֡-,M IhWOR;x;7%%,4*?MGNT6]0h|2-yM)\=d8;I$*$Xx~>΢L2DܢX>@1=uMDNdO@p$LAI<\-(L'M[ P/h(`wx& Ho)@Mh^D1 HzDpţj8ΣXuMޣ xdD}7M48'"t/ I@@CW0=XgX:tN-L֤9,D `>x4=(2\%@8d_IJ;"V%<hK@pMz$#Hd A"L,LO4>\˥dVEԥL9Tp+9Ddx@U*#Ȣ8$2J)9d$$Fm@V \ItvEp8Tn8*@ 1?0\uMæA,ͦx& %<$$|$xx#-`> 5NHx-8['d(@*xi@wD}3A0.\? *0+ç F;pͧ\+'ݧMD4'0o4h̔>$#I.p%!@IQ@JX;gm4x 04C0DDI>0Aè@0Ө`@\>;  8a.,/AB80PdP3] q@s \824*X(JPI$"D˩A ԩ(+(4nM/MX@@ sI2,%L0<1u(;ؖ8PH'S=$i<v8\N*t\o' DYO(DȪTAh٪LH:,&P=*("D 0C#x93=@(/O - ]0n#jlc8s,%h~x'PC!`D C<pE+«*˫tLM٫> P0I<8N}+( $%D " ?l;LP6Al\1iPIu>0d9M5h>$IȬ>HӬ/<D<|6,) .@@CF8[01hmLI,u+'@UD̙1B,M|8Ӯ9+) '\$F ,C%> 341I0TJ[X>hmػ1|{@)X8HB%xԊ*$AT6¯>H̯MկN0T'8\REM3I)?IA4eDVdM`+.i=~',@N!8*4M>°d4˰IְBB4@|Bl @-(D42\K'(9A%\@PA|N9(\01p0LO:l,D\B!TIȱxAӱ0Lޱ5P|(D B J 8?/? A=K[8<`MI8r(089%( 8|1DX@4Ʋ2,β\a&@ݲ&MXD,D8@84=`&04J@A4Pdg2D c؎1t`1&` IB Jd/D m8p̛6ų?dֳ4'8߳ # ,fD0VAD +D-N=H2JXIR4E\.lr'LzDj8?DF/@eDA8 Jʴ>lӴN>Ph-l '` nI's95_'BIIlxI_$q4d}0+x`B+' %D@εP+@۵(xT8V5HC+8SdQ)\IiA|ؚ>O2T&T(VMĶq8Ͷ@77 XUI(,Q! aC)?X6<|J&\[0Cn8Du +xpqD(c8.,M>!Hɷ>طs8 0'@ BlV=$A<,l=,8,LQHIZ8_B g\,v?4T7'p7x&8TJXøjAϸ>PsDxD@(=42\WIA3I OCam7jNvx.48V,8$ |A H@r($D4Źt'͹l-|׹`.\oI($9I̽*D A YO552XAxML@@aD=vh;<JH,A(8|f.ź M׺$X(|2MDdC"L7/2+ <TeIS8Cd` +g$r&C8B`hR;H87h8XŻ$$ϻ7޻0b,O˼MDڼ~=dL=<-p W6tj1&s!9\CI9[]2hlpD|'4u$Ę=h/ؽXAX8A\+I N (#/y-=@,(d:B4GdyMPnDZ;dOt&}>>1'd'$pȿa5 ֿ(<"@*:l@(hk?D,=B)LX&|U$_H(Mm@iIuDY"|~IS9 2tQ@=\|=4w#Dlr\;p8x8D8K'4+Th8d2(M<%<$dPI\#=$?@r(l'N(8T1'@UALK.IW@B `Dv1m Iz2I "I-P+3;I$Q&JlC@pAT OH|6<!7*,P+T3QO <|-pT)\)|eP%|{,?<2T (hY6@=P/6p *hJ gAX $04b=(%52Z*t=tD0R08ME1^.@nCP)A|x9oM=` ?,D(H:X7DuM,"@J'<3I<(!Ep,+7`57Ib.d^4F*LeD#x3=H<8WIT/DC4WIU'$Q) Nw?hqDL0;8I)ر+l/h.#=(@@\K(i7TpNcQ,Hj {\hBAD\+[Bh0<~*DTA\(I5\sI4AeCVЂ<n7'w>-d!`r9X0CD? (IPt#{.H "+DA07-B$kC`U$fx>|8 MMj.,HIHM8?I$liAt.$Ȫ> @8(p*\6IE_5Pd0[,.<o$%D`BCHND%#0C9в$4.` I )?(5(1|M@`%TT+_t qv?LgD1IIX?sITE4Xv)kCP?28:I$oItM&D`@dJ[.@fyD<p$hx@L(&I(dIX0dWI.\@t%B$IeD^6l-v%l'B 2(p"Q;7IbD(0$|U.8%|jIh60,i+:8I\+HW$I,^37ts * DHLCXe@h_7XHYIp8,CD<,h;4-L$p'h=t0|#@Eo)4PDD2TX0-x`B*e4LO|<WI &#pBTp@PI%L r7P2 .IM"@2dD@(%tH\$dTeDi̼Axq>@=8p20.P'CB xMS,(dEh+MUIlF++pM1(L;`T@OxMZB>Hn,MvXOtc8xA7$N/pRMd @|D,0C,%CПIT^I$"#??07@+TF=I[hFAr3I@VM̦#<$5 @ +0o!ht8h< MMX? $X_B`#ԘA\1=<8Nx,V7IfpM0oy=Lv4)x%!T`?dx8N`,(lMDXDXDp  oCOB<+,L%;dIF@l]$fP;!0}?l$- A$(lVDO(M8@7x2(@&d TqM<(D&?`5O?DE6Vt)_Eg F s̪C`|>(P PI4($MIL( r8H0:I\C8"A 3<0`6h?$/lIxE@[sIj2 |(^Dtg@4I(3I$0hV!@`%00B.>"'CI MI?\+(ofDVD*:$F+HH D$S@$WOx+n)H 3ܝ) L#@/7&4;|7!LPDOIZ2(ljBpy :I.I)t7C$(lD@rM(a%8-^1J ܤ=@S07`dvMj$}%!\?IA)[OID*DI18X>@3Bx.Ip?I$$@%87 *B (,O\B avI}L><#:/ d*8!03@>lOl'%T.l*H 5h3ChWIXwȪ+*|% s=PUE4~ X?1I0O/,P*L DP!)l)]@<:?lL4 $TU1hj#=wT2*p<Ch7Dl't<JCXl(t sI\(HO2$d&J/'d9اAdG>]/pmApzN`J .LA80CLHO4>8d XB 40PP+T+&9r8H 6HT&Z tf|CHwL?`c8 ,@=*N +!0M8}!CO8%p<$tl"@(WBh<4:H =<a^Ipj.HMp"8x=8@1I$ P==@jI"4I('\6I?}C\LXO$XX6q @>h\8NDI 5@_D\Ao!I4dD3;M; F G F S@A`DhUI|J D@BpMsIt1<ApE.-)P%PpI"$Tf@d5vDM(]-iPNv,*LpX9,7@LN :R9#8P8,v(l1\VD%*1m#8B0.tZ*'Dg= Pv:D.(B@xcBlm8x@Ne,M>< *_< D)N$b<9ܐ*C%Q>xd4t,`| &!4$!@&10`yB,<\XC)x< uI(*,2Ih~%$E1}I81E9+S`!TqF }hA,PCBTD/<B%48$qD(}68J0)& ,18%DA`SDTxIkUE tD@`B(3I8$"@l@d2H+d|/I>I$HE &>x7 I@8@NP=B\[=Bdi/`sp= IO'DrMd=h((л?$88WIIJ 5X0>l*H0+,>D,E!([T`\8052lA&LM0$B<;hADMDTq8<`l0$kDtx(~#T9@O$xfCL0E`0ODj87I tDP"X@ 7O=@GpuAP[O\`?s,@%z'< N>3@8.HX&d2H+xLM@$TE x0 PP\?,*?8>8XL*Y`7He>z= ,dD8-4DDi!0PD@!XeD td?`<'sI:7Ct<RpE[d(* d.Dl*<yI|HADeDTWI<&$LLfD`JAd80px+t V=x%<1,2 D@[8$R0P_An$>l==@1@*$`a%"8$2XJ0?zA)h TI9I'&2f.>HBHBU A:hcr. rpuMtC4N8-@|(x>9(4|#PM> =$j%%d ?$,l`/:({&4Kt<U Ma^@}81Il<%Ahi.M4I8D h >L$4 \7<PvI!sI(8;MF`*XPdMDd,<p Jz)L*D$|2w14Xq/,I>(m?PsDl`7x]%dQ.8* =-H@%$S=L,MMC.$0h(T<(=Th8&%,6hN4>D "P@IX<ttWOyT=1(DqC>=T L-,B %`,BJ,l|CHuMF  2tx@,4T.,B,$Rh($Z97pj4P-x:,L)M0@H.MLN,D$[:|1+`H#jD+/l+${%0Y!0/X@?VIH@7;Wd1d4l.v&8p) % 4=I$ C X@LM*LXNVO |M-<h9R,!^`Cl;IvH7 `D0P- *$At(eDTN22|M?,&=4:L7pFB%TM "t\U)g\aDnJ=_?T,J;C>K=,@oI0(T< >x'0$`'40 tNȮ@bJ-tr)|[BgA@\T?X8VDBL>8<;MzAxb<  I#,+ .I6[CAD7*tJ 'S|?4kL7Lz-<$*r)@?̷"0@?l9pq+0*4 M0T-fI6+B%\S0\cL(qT&~$IL*X&sI8$@ZOY*LaA=(.Iԕ)(\P%?l'G$YO^P4,j/ |'e'F@8|OI,C4886hJ$@!>1,N<h'K{Ix[D+(p>0<$hDԕ@8+MF#<' \"0 #D ")&p@9$HUJ]ħ?Lj5XtԶD sMОDX?oIt#M88J$`DU T)l8  2 xW*t )L WD eB@ 8?D' >2 XM@ h0R p+a p=xu \vI< ̟), 8X @' <74 .  7I4  I 8l #= pN, ̶B %D' @$2 d(A !Q tJ[ XNe {Dk  \| = $( LM JO  - C, D9& A@ hHI (x $=X (\ J BH. pA: p4E hMQ |2I] 8!4w J (I  ,WO ? # @vD 4I B< < UI =  }H`Y4[I$*|`EN@BLWIM * D*H$`)X3p)D(mA8Q,r@gD,huE@(t7IxDL2<QI<<@o=@sI($,$+HxAp%?l9*T$\A.w6=Lq' Gd*HWhIg\k@\}Џ+2Id 8$<=0M @ImD  N,.h0E8D>8Os@T]|9j%HsD7$d|H:4\;0*H`'h+&$PJI>tyD(:=- KO%tJO%8L6C)?'&M<,[3Ii$ECsxG?N 'HD4'`4 F}+4'0!B>W80EH,I:`!XL (j$D x`0Dt'T( 'Tp&A,<)J%\oI4E9 v@``#1\**@7`AdH'U|LMa8`? v]IdD7 u,:*h)4ĸB`?A O\I8(0d-%KMx-iM6:I8@]pN*hdDx*@E =Il>T`7H(l< F CL 0&ĕ9"7!4:c?,Sx)TܪItb%P C<1 ,>)%l=2h7>62Pdu.cT*nB{l8d86da!0<ȽM%#Hp#M0I ܭ6xRM"(y-.==H/HhMQ|1_a*l.ht&L%(,ICdx+J`\I$@M02dKM$dD ,@\?3+$D<&QE](.(c`dDuKD$HCB,@q+( 8YOđ+6L0htM),ЙD(-,M 68D"$MND]x9g *Hx`&p#@I0I:<̳=X?@M&I ,J00 %81<>\?DLOVMlt%{A0QI9)dS&?hN"I`p <BT@ M8(,T$I4IG#[DiP*Pt* MD8 lNHLO2SB2)lq'*x B>8+T, <&4I?/HU,SDhIpPDt @tLAd>Dx]-+$ 1TC!PAlH.=A܉0pY%+`586R+,C`$W! al 8iY@Ty,:1.0D?p2I`BCN8xL$DTBXI@ D<\ &l& (:6 0@ ́*J 8V .`e @OIq < ${   xh8h 2  ? ԝ2 PI OD pA H>!x;$!J:L(!dA,2!TCI(G!i@PX!]%<j!$Hz! !dI!HJB!T]6!UI!4*B!`?!\C8!d-l!D8"d?"LS& "B)"DI+ 8"P&E"|IT">_"=r"H {"03I$"$8"`""TI"$4" I">I "#4""\#xM # #|#l)`##li<@2#H*0;#|B\F#6_#@QIp#(}#I#.D#E2#K'H#LM#FC\#tB#4?#JO@#\*$C@$tDCP($N=$`',K$ '0V$ܥDHj$#0y$ 8Y&<1f&((t&`=&ؔ2L&T&&BL&&XO&=&PM&-&xAI$ ' %' *D'"&' :`='L7G''6LT'M^'/4Hl'4G'w'?' &' J'k@\'b7'X)'u-',|'I0'T * (@D (I/(C(A(>T(A](_9hm(h4`{(1(I0X(P A(J:(p7(N(4(<2 (CH(8A$)=H)D+)M7)-H)IM)6I])$(e)<#r)4 =)<)XM)&<)v6)2|)DD)<1`)d )lJ)dp8*TXI*0 #*hE-*sD8*<&HC*.=@. 7P /*(/*H"/4J,/h>>/tfI$F/8OIT/`I]/Ee/Br/pr8/Pr(/x"/H#h/M/9/%/M@t/N/g.H0tC.\ 0@,T0 &0I/0l'h70>d?0t$4K0XF X0BDb02n00x0L 0y/0,D0h&80|HB02801I0$`0BC0s@$1MD1;8+168:1$I1i?pV1 :f1d-x1$01A1e81:)1h4T8=D4r84N4-4lyM5IO58'5\I$65XC`D50lQ5I^5Mm5Jv5%h50)'5`zAt5`I 5\N5 @5B5?\5 ?5|XI6L0,6x*T6(7=,%62836{*h>6D<(G6+R6M\6<>m6xMw6dI}6vB6x?6lC6 >6*6(6&l6(M6PAl6v<$7* 7pI@7tOI47P--7GI@<7N,E7zIP7\eIxi7$ }7(@7hS%7X= 7HM7E97 7>$731  8.8"8@88*@dH8MT8HMa8x@(p8?8~8 8NC$88VB8/8EP8W@8$8fI08tJ9&D,90>%9D>029DNE9XMB|W9x*b9t>p96~9D{7@9:IP9x&l9T#9sD9X8@9D`9M9 (9'#T :6:-P":',40:dNE:*T:X%_:=4v:m<:@8:8C:A:.:}(:PCH:@a5L:[8<:L+d;l&|;;M;A ;i7h.;.pB;\+R;$Id;=hy;CD;d/&;B;h\:P;6@;W<;RD;x(T;(;6AH <(= $<M/L3<#)l<<@XMI<#|\<5Hh<u+s<LuM}<?<$F<O<xM<Bl<d98<%<<nD<DA<P!)h<- h = =['@)=M1=8!;=(C=E.TU=RM_=Al=N= -=,#h=I==d/=@>N>|4 >14>4B0=>,:I>.U>,J^>Jj>Dq7v>x B>H"h>M>x@>N> 2><*<>!>F >L94 ?>I$?P6H*?42 ;??E?)T?,'0c?lIi?J?TE>?!?o. ?=?q8?6 ? (@@C@?"@ 0H<@BF@<8$Y@p'hi@xDp@6 z@2@")@8(x@d=x@M88@#7x@|+!@@-'@I\@^IAxH:4AP;D%AXdB.A$>7A$NACTLFM[FX8eFQOrF8\FLQ8F,TAFv.F.hF1IFH%*F10Fp)*hF7IG$,GB!Gl<*GA 3G$^2@ EG`(OG!]G$EgG%pwGBUJlo@mJ@-.~Jp(0JD<JԱ>J<}7lJw*J<0Jh8DJ-pJ()MJG8K(W) K|=K=3K.P:K\D GKpo.8VK*jKCD<wKT>D\K,CKAKt9K@Kܰ@K=KWILM LA4L$x:L9'hGLX#VLiCdL2`pL)0wLx'XL<[%L$2dLsIL\(L gDLL:L"L_*M`HIM==X'MpI% 9M- GM4'SMM^MyD(gM#dvM`_?Mh!TMDM(M8A\M@|<MD>Mv/PM$M}=NM=N28NT&!l)N`7,9NCTFNJON ?^N;`mN,'\uNp&LN$$N4s8NNNJ,DNMN8*NCN(@#N<MO=OtgD&OA940O,QEQ`hMQ0>HQ<8Q\&.DQ@?lQ-Q7: R8$RSMR=2R%L;RR8NRT/TYRJI iR'wRF%R-R+RMR%@R($0Rhr8RNRXy*SD#0SX^# ,S(#X9SBCSELS%UC6U:8EU =6PU@'l^UJfU.|U@IUOU|%|UtCUNDU;lUT&; U6U("V Vz7%V ',-VI7V[O?V4:ILVCtXVBaV 2BlV8xzV7V\SEV@`I$V" 9Vl OVB>V2VLBV"hVxBVP xW N@Wa70/W-=WMLW&Z >Z|"LZUIZP.Z$pZL?!H[dS@*[$=[`MH[> ][X0Tn[lM[:I[$[ȳ?[P7[ @[̻:\[|L8`[̰7D[@\xTM\dc? )\;=\*H\X(U\l>'|a\@ q\)~\$\$\:T\L1\M\$\-\%\rB<]0TD]0Ad-]6`7]1$H]m%T]D@`e]c!0]8?](:|]8. ]@M]`A]?H]}I]do,(^((%^DE ^l<((^x89^`2-C^JQ^Ж,Z^t'f^9 y^`^`N^40_A_a'_4"_l)._LA7_|-F_*R_+P__|DTf_!t_o. _|w*x_>At_8c|Ic7cg)cJdEddN$d<\.d078d$2Hdx DSd.gd}DkdA<wdTLOddDd$:d'dt OdXMdx`AdNdNI d؋!,e&,de (eL;>8e@2XMeG&VeMAX`e1pe@YI{e,(de%Le8eR7eh-$eT"l e@PeoIe4E4 f-$fM*fx6D08fMDfYBHTfi.8gfp7pf*{f$f|2<8f+Tf6fhCf`Z>Pf :<fpJfDfw=g\+g*g#(g=.gk=6gzI OgS8^g(6}gH2 gIOLg@w. g&lgI n1HntMn #nNn<`nJOn\TE4n$'ln ol.oI o>(+oPZ:|:o9@GoIOTo|I$poMI8|o$ (oܶ=o. oe+o&oDAhoP*@HoNp|1<pI p$=0pW;:pWIEpp*0Tp` _p$@ppp\r 8r-r;8r+:xr\b?r"#0s(= sd>-s#;s,A4Ns̨9@Us4Ics;tusj8~sT<=0sl*s,G8s*@sC\sdMs\%Xs7 sK+s&8sjD t*t0%!@/t*<:tX@ Jt.L\t.lt4x'L{tWItDF!$tH(8` t$;1tMtCtdZ@Tt=t(8tx& u~BDuJ"uI ?u,IIu&4Pu>I$`u,#tui!up u`ATu6ut"(u+|upMu&4vCD vОI@v441vsI?vP)CSvB^v}9tv4v\*vB0v><v\=v['4vP>dv(v1,v|?>Lw=!w}4.wIAw@C8Kw>$[w/;kwH!uwU= wȗCTw>lwT<wTYIw?w<;\w&,w?Xw8wh[ClxYOx4>!xM)x)& 6x!@Gx̫+|UxM]x(wMdx@NrxNH}x4)&xFxdBlx <xt*:8xxClx/x Bxp-4x/CxA4 y<2y.l,y (p:yCDy84PyEIhyԌ&tyl<\y6yb@yAXy#@Ty@GI yJy(5-z%4zN&zx&4zd${0-%{)t+{8l7{h48E{Xv4LX{UIc{|y#o{l@\{>{@<{p.{l>{?${ H!{XLAh{0D||! ||9C|AD(|XO6|T6T|,>?j|0<z|c8|}.<|T%|XJ|<|,2|0P|RM|ț9@|DiI }4!}v=4}0?}8F$DP}I,(]}`C l}TE4z}X7d}*P}RM}̛!},21 }+4}P (}D)}@ ~}>,~*X)~m<5~CHG~ j7O~e#c~(Ddt~?H~؋8~D~Q#@~*`~<$~2 ~'D~XO@*D&|uM HD(@ $8K+F #R!8 a2sh>D~J$X &*(!t;d:(0MBTxyBh@, (<l t6%hG/MV,<|,9,5<́>4Tԁ;P!h7tM %&b?H5gDF0*LR$DdXAq?0|=h=8(]- M: 7I‚0^%˂?(T6lg3<.@n!$h$)T,q#@+@R@>b 0Dm)`v39@Nx(1P#Nȃ2ӃH<%D|C ;@$L?10h.ˇc*هdB}'x2%,"I*| D5=Np{90\74fH;!}ET9x9l-/D$-t(@0ψ?\de?= _!+|<\`=5X}Ip-02IωHI/#8C $\@69*ETAO% YLAeH0s'(<&Xl<'t=P?ϊ<,֊&682 4"P;!4"I)(D6YAT@.HBlPuMP. ϋ:`ًl$d\JCTP8(  mI<@ND2`OI<j*K`IX+/e118p;}0C,Hu$H?lIIЌ3I׌%1OI])T TEKA"jI3L!?>TLoI`D#ll8l},^(@PjI ύNۍD'=ADO't 0B&`86L#p11(?P?6;pPF \=@t.8#)$h.9&;B$ʎA?xt>-($ 9@t#<44oIG-RhNDbp7Tm[I@~H)8`?*<WhD=*pAtEBX>%ÐTC֐,r4ߐhLMpn=DWIUI h8*`/ ;pCL|CUCe,MlMs0%(|x$ CX@T8w9p,\1ёVIۑ&|8(o5 UI)v.'TE/H>9-/DEȿ(RNe.x`O9-Pm!8K4@PI̒r+h?I46I4Iǔ=ؔC('l (A7`sI ,^I2 9I=H'I{IP: \X$4fxMo= 3x_C'=tD B?4ʕ,CDӕ@C-M)G%8 +uM3n==hIVCLi$AHxT,x %Y?4I8`'`Ȗ(+ ՖA<ޖIN3 %C$4A</C0C<=MhM[uMcJm;x'h80WI3Ic802P˗$-ܗ4W%hxC,1IlAd 28Dn.$-)t>k)$%xD?7.D8D$?eD[@.rC`CXJ>$4B\<Йd"(M (I$mI0}2.MDC\=(QlWO\<0gs)otCx(=h<0|7H04԰' ʚ)֚D5)ޚ8)8@1Lt4x@d&7)wD@.hKM4,!4L8uIYxA;f\RDx-DTD,J,BZIb-D,nEy$`1X?@YO8)M ĝ،BםY;x1M$0HNx+ )@)/<$@r 8P<@Z7Xhh.t0MpB\=(\mB$(1@L]Iٞ@IF%(E @PDX*<!*,)6%!8ID ZyCl%$+|l. >x*tm/4T:7$G0#V5B<d=\rtAIZOPCd!?uMx2dǣ(UA գ`)ޣ8RE$t>=%'T)M(5XQDGP$,T>o,MJOIVT(_E)PjP]*tuMl*O a,L\,@#^@\˨(?<ިP6P%Ȟ4Tp@$)4Q9>`#hTDMb @qd;>\a=@@D4ЮD$K*t©DȩtB0ѩ'XM`L&v*5t.X-Z.>$N!DZ$<1n v|5N(r(ADj6$dA%@̪L0ݪ#:d,04rC8 ?x"$%M8Q.K|MR)]D5C0gQO pMz)%wEX+l*<8D ƫ9HӫI۫?l>`LON  #`*x@Al<(F<7DfJo0Jx \ PI1(\iA QO>'̬$h1XB,DlA)3@;@>H\p\.tk,wMt%`2Y@P=`PNx|M|E)Xĭ0YC8ϭIܭ9#8 =(lM=$"RD5@BS/O3I T<<]>l`(;0|?T+$\)B!T-<ЮWI83)*mM ,9#$I O,sI9dv"4LD\Y D8fHC,o(-<}eD@0lL<@7LTMƯ\8 ٯpd<$(KO)-UI$I,PI2DJ?X?D#BHT'$WAe0*mL+)tz|`1,d)@7'TJdDROȰ<ٰ|oI \9TG&7!4A?*67: J2XD`L!- )'@:A,0Eg@`V4b%@f BvKC'h! |tN$1($Ƴc@DM4P+`< HeCP %*N7t-@Mt-W9xg,61yM@h8?N`(ȴ& ӴXC.ݴĨ&$@4I? =#I'5X5*d?\'IS.]|$$h= u\8tIl<WI3IȵlMҵX2 @PAn9DHq"*([A6*C7Vܞ2Lbd?\tZ?h>Ix 9|\*ö&ʶs'LӶ&$߶8J`('"3$=l($d%($=7+ ?(*\JIXTc@,h'r$u; HC 0p)|%jA˷ @۷dLO-t ~62&$%TE¸LMԸg@,4xA\f) Il2)P27MBDBA Ox6^l$ @oIz,=wIXIù ˹HZO ع $Q=@'A P0,F 'v-7$*HA$)O8%YI_Mg8)(@oA@DA@vI14"º!غCJ>$)$ض@$#XvI-"?|MDNtEXX^Ig$0I! MdD9&p%4ϻuBT߻2HVIIChzIl2-,F7$%AdBL*<XD"|f,&=x(;10h#\$JBlNż?8ݼpDpNtMJ$w82<""(+L*,)dIѾLJ<8߾d-h,T!D0BoI@N-H&`>L'|O]%@ZUIm8YIk.8 - l.¿F*ɿ%׿<D x/@L=3Iw" 4HD0B;=KA'YԂ*dLEu*l%=pTMxI4I <8L-tJ88x ;%)$*4PAI$FEO;C\9md;I$XfBIa(Pe*PB =0<6p 1`M }@l?%B8<5dc,8Fb*P|( [\>dp]D`2pM4-MDC<4VEq8(l,14 -$*l./PG4NOTObMs/}P>,4X'T&nB vI7L?N Lb*(!,%-4C@@M 9H]p,`o(ydB4,g6,,$x#@tl%,?%lf#DA@ID$,$,>)J,;W<{%kPIdE*%p؊%P|?= 911(;VES,<|I =%`o1/$DXCP`f?])f-<yP)lHI4I71(%,7s@s68 *$ * $nMh>,)l,H5,G 8V09Le@/qTS=dz6,{'x),PA?@0X5|UII8 Bl%L(@M0M8f=l? 0HICWl0f%Du`%LtVE,yDM?#I `)=`L;4,/%Hz@ J<T1PTAD2;8PIO8vI\I<.0 L) A6|#CAH/dC:EDyCV4`PI$n)0x$I`#T>,( x9 D$!hpG@$ N*dtB|*DB9MAFd,8I01#>$S#M68f01|w-<$h'  1T*r#P<28-L8MlK,*$<(9TIJpT(ZDh Cxh CdD67N%13 \EC<%CHh(@}D ?``6I   J(pK8 @<=8PIk Eu4B UI`*x% DVEJ0C`=L)_D B  o?pTO 'ę#4;wEHO3I^@TmDNvt,4tM p0pX>H/>`7+;M>AHTZO 89I$$$)>=eIVD^*|] Mgc8w(9D\AMfDl[!042PI"(<%) 0CAV&c*$oR74CH!@L (|F B0ODw<8g#pD$>X$B<<$1@p5NE?I\|-Mh`*vl>%p<@dk8xB,W? l-(>?t018bDr-T  l2I()1QCD8s@hT>b$vDrJO8 / Mp< 8L,,q&DN 4T0mD =0*:G&D.&Qz%D`DDzD4J,-t)0)&=I$I8E@d!>lLO&`8:x3=E 4]84j+hvP'$=`l7/>NMPY*x$L$<+P?LM)N2 [ d<4MK U`$Hj7t=+8I4<\l#|LI CO<1"$@8}@T0M,*pr7@B/"\#H.$5I5I?i+0O܋* [ܥ:h9)oD0 '|H3%P(#Jp[@(HN&$DL82(`CpAC T& aTMl|,@yZ<q%OIeI-(8H+8$D0@?0$: N1|D,/Z%\9>HK`I\p;L|SM x  IZ9NP#:H%d*Od"DCH4?DZ8HS0.tg+Xs*hd9784N%G@ DdA<8`74.(X"h?\0M@ B`K,SM_'k|!{,D( J  6A0l8Y8H=C04L< J$I0 \<$[I.tD4F9I@QL'hbWI4nMD}t1/,PT}*00 HJpLOD<@!I$# nI(=8"(@hDE,8ND1 "t@|.G;9&0DPDZL>I nMyhN,W0d/t+(@II>(M,E AD6X 4&`):%1ZBF*D,Q$ ` OjH>}ND-`#2%8?hO.I(&=T p8x|IJ 0*D8LK/|C!>"94'(PCCDP-`2h \'{,&$ >'$,IO)T)pUI 90'DLD4Hc,XB\ 4"-0'"A@e=L 4Y$f/tr$@C d?hAD>'Cpl[8<*TM v8\~'L,$X<<V'XmTJDw MBl`$p=tM$L?xB\e@6:\lN|,%>;NOHJYT?8hTD{IT5),8PNP!(R8P6IuMsIh[@ >h%P) )%2ĔA<E2RUIc@Ml$ILw$Nh7^f?Dk(,dy3I?$M J ,7I;>X$PIXJ$ItA-sI:xYIH<5)Q)0\pNh==,p<}1<xr( M'$q;<8#8!=I?`%8?X/(8=@*Md?[&b"(oبC|<&2M% EC @(9@-X0h@X5$ $* 19/.p<.RX._t + h$>}@5,(0+Ml`I XXI/P)@I$x?,83,D)&< Nh~8``U/mty8@/I,&I`7H:p+8LX!T*L9@@hl`* t0d. D5B\BcALLX.lc )8r*,H=I$$WD4;(6|DI0y<.p|H+T%hUD82Ep: PI8hh0 x+h6<l.4I@T5'L @I$.CpWON'd'8.C%;l@,TE`2m(nM"PX1d0(-.,'0D?LH%;LvIuB`TE \I& n/-$0`7IJ< PYQ; d"L}tAX?L4If@PH0lCLB (|"@-GO6̉/?VMIH$W`Id@ lz8DlXIDv:07I#'T`C {;$,`'B\w6t,CX9"x4 0L%84@%@7<JI0X(c$.D@plM|,M %I<'@)\t#681LM,p&A $)C$[=6*'PEOR,_M(o%CF%H@x|WO@2 o)L0C$@4<[.| oDNI(7AD5$M+E$hXLNbxc)k8M~5?0ls+xLO($E(Ԕ&4!?!tC,  iBqD2(D'@h1'IXOZHA$,pCj+ h*dIC0]@=>P{5MЧ($$ 4NxM D+A? DSD b2nB|}VElKM@!BT'D$6DX70*?<IJ 2,'6ACH>S^1]t&,$m)Ht$I&#h8D7"o=@;!$}I|I<8T (l"/I<*E(8ICu8T`($a'toУ@X}0sD|YI9dt]%@@sD@x&F'T>`sIHI B@1<<$43|M(Eh'Y*Tc88rx&~JAd,l<>l|7\)&h*$G)8D?'hLYI!\B/^ <8>DD>O\>40Y8+Ahx>${e#pH.>L9`N(p0+=|%DX>'SMI B+Bl7_AB8NLIZLCoBl|TCDYO)`B<`S7NEBKAdPDG)ADl%UB3I<ATO-V*c9lzN<L $?@|=-|IPDi,h3  $M"(X.J78Ispec_vnodeop_opv_descwi_set_nwkeyucom_unlocktrunk_port_statepfslowtimonanouptimeukbd_rawrepeatzkbd_poweruvm_map_callrandomreadaxe_tickuvm_page_lookup_freelistnfsv2_procidpf_normalize_iplongjmpwi_usb_rx_list_initimport_flownewblk_in_progressffs_vnodeop_opv_descvfs_opv_descskdb_trapvfs_allocate_syncvnodepcmcia_printarpresolvedp8390_readchange_displayparamchrtoblktblsys_minheritbridge_startputcharsystr_policy_plural_update_promiscpfkey_addrbufq_default_allocchild_returnuaudio_add_outputrtlabel_unrefne2000_write_mbufuvm_map_initne_pcmcia_cauvscom_attachipsec_soft_first_usenkmempageswdc_atapi_drive_selectedcopyinstraue_miibus_readregsys_getgidext2fs_vnodeopv_descsdofilewritevwi_inquire_usbuftdi_matchdumpmagttyflushsys_setsockoptipcomp_inputvop_lookup_vp_offsetscomdefaultratexfs_message_installattrieee80211_watchdogpf_state_tree_lan_ext_RB_NEXTwihap_sta_disassocdefrouter_lookupinetswpowerhook_establishohci_powerwi_get_fid_usbwdog_periodcdce_rxeofip_reassrt_maskedcopyin6addr_anyVOP_ACCESSusbd_get_quirkspfr_fix_anchorip6_get_prevhdrtrunk_fail_inputscheduler_startdb_logpxa2x0_gpio_intr_stringdisk_finduvm_maxkaddrnsphy_cdicsphy_resetrlphyattachpxa2x0_gpio_intr_establishipmforwardingmainbusprintohci_waitintrzssp_read_max1111flashgetdisklabelsys_closeusbd_do_request_flagsbmsafemap_pooltrunk_port_watchdogrtflushclone1in6_purgemkludgeffs_inode_allocnfs_receivedes_encrypt2sys_setsidieee80211_encapbridge_timerax88190_init_cardudpencap_enableusbd_intr_transferaudio_attach_mizaurusmod__ashldi3vn_statcom_pcmcia_disable1vop_getattr_descucycom_matchzaudio_jack_intrunp_detachnd6_nud_hintether_ip6multicast_minsys_msggetumodem_breakusbd_submatchchange_sign16_swap_bytes_be_mts__mainsppp_lcp_downwdc_ioctl_getaue_stopxfs_emptyqufs_quota_deleteportal_mounthardclockpf_get_wscaleenc_xform_aes_ctrwi_read_data_iohandle_workitem_freeblocksipsp_is_unspecifiedmyip_ifpwdc_reset_channelumodem_set_comm_featurein6_domifdetachvtagsudf_mountfsnfs_syncfilt_audioreadwskbd_cndetachdb_get_variablecd9660_vgethotplug_get_eventieee80211_inputcrypto_dispatchgeneric_armv4_bs_wm_2if_group_routechangetprintf_opentcp_del_sackholeswsdisplay_burnerpxa2x0_apm_sleepfiq_claimbstp_received_tcnohci_device_intr_closeurl_csr_read_2dest6_inputgsignalacphy_cabstp_info_superiorpf_socket_lookupipport_firstautomii_mediachgwi_txeofaue_devsipsendredirectsbpf_setifpfi_bufferzrc_enableunp_internalizetk_rawcc__wdstartevcount_intrfc_lfcemptyvfs_export_lookuprasops_eraserows_rotatedif_cloners_countyieldifnetohci_endpdm_freemwsmuxattachuhid_seltrue_filtopssc_print_addrfilt_seltruecomspeedloguark_cdusbkqfiltervn_writechksoftdep_count_dependenciesin_ifscrubarmv4_tlb_flushIdp8390_media_initpdevnames_sizemichael_updatebstp_message_age_expiryalaw_to_slinear16_be_mtsscsi_mode_select_bigmainbus_bs_wm_2route_dstinit_execcarp_clonerbridge_rtdeletewskbd_cdbstp_set_all_rerootsys_getdirentriesbcmpgeneric_bs_r_1ieee80211_node_detachdb_set_breakpointsuaudio_set_paramsnd6_dad_startrum_inituaudio_add_extensionmsg_freehdrexec_maxhdrszblf_zerokeydb_force_whitespaceipsec_delete_policyieee80211_ifattachmmmmapieee80211_clean_nodesuvm_map_spacefitsnewblk_hashtblsetjmpprefetch_abort_handler_addresswdc_disable_intraes_ctr_reinitwsdisplay_switchnmeacloseuow_cmdudcf_bv_intrurlphy_funcsuvm_deviceopspppioctllogread_filtopsucycom_get_cfgrasops_cursorvndxfer_poolfilt_fifowriteffs_specop_ptcp6_mtudisc_callbackcopyoutstrext2fs_fifoop_opv_descatu_capte_l2_s_prot_uimport_saieee80211_countrycode2regdomainradio_attach_miusb_transfer_completelxtphy_serviceapm_suspendswcr_newsessiontcp_attachwskbd_cngetcvop_print_vp_offsetsbuf_dirtysoo_writesystempagem_zeroural_alloc_tx_listffs_specop_entriesunp_gcingpf_pull_hdrbdevswumodem_matchbaddynamicportsohci_root_ctrl_closesemu_listau_set_lr_valueX_db_line_at_pcural_ack_rateuvm_mk_pclusterbswap16zflash_oob_status_decodeptsstartdomainnamelockinitwsmouse_detachswap_encrypt_ctlgetdirtybufttywrite_filtopswi_usb_devsnd6_ns_outputbpfkqfilterpppoeintrwi_headnfsfifo_readtrunk_lb_attachttyunblockremovedepfr_sinudav_miibus_statchgigmp_timers_are_runninguvm_deallocatefilt_procattachpxaudc_showufs_quota_free_inode2mfs_closefilt_procdetachcbq_remove_queue__divdi3sys_clock_settimepfr_destroy_ktableural_txeofwdc_floating_busuvisor_capxa2x0_spllowerlocnamesnfs_vinvalbufdisk_busydb_breakpoint_allocpfi_initializetcp_pulloutofbandevcount_sysctlpf_anchor_global_RB_FINDsqphy_statussddetachtcp_signature_tdb_inputpxa2x0_i2s_round_buffersizemouse_copy_extend_linezapm_power_infoxfs_dnlc_lookuparprequestsiginituipaq_cdxfs_has_paguaudio_activatebridge_clonervn_default_erroruaudio_query_devinfousb_task_thread_procnfsrv_mkdirpf_frag_tree_RB_MINMAXip_sysctlsppp_ncp_checkpf_main_anchoruhidev_closemsdosfs_vptofhscsi_mode_sense_bigffs_fifoop_opv_descusbd_clear_endpoint_stallbstp_inputdb_vnode_print_cmdums_casetdisklabelpfr_lookup_tablenfs_disconnectdeflateknote_removeuow_matchscoop_pcic_writepmap_bootstrap_pv_page_allocbstp_set_other_tcpropwm8750_hw_ifpxa2x0_i2c_closeroutedomainusbf_interface_numberhid_locateicmp6_errorimport_identityVOP_MKDIRrtl80x9_media_initusscanner_scsipi_minphysufsdirhash_recycleip_protoxsys_settimeofdaypcmcia_read_cissdstrategyaddlogpf_purge_expired_fragmentspf_osfp_flushuvm_page_physgetusbf_add_taskmsdosfs_syncudf_inactivescoop_pcic_attachusb_known_productsscsi_mode_sensepxa2x0_i2s_mappageip_savecontrolstackgap_randomvlanattachulpt_detachzrc_ioctlfiq_setregsffs_clrblockgre_clone_createusbd_set_hub_featuretcp_timer_freesackbpf_filterchgproccntpriq_getqstatsip_draindb_map_print_cmdpflogstartumass_init_shuttlesoqremque__adddi3uvm_map_inheritnfsrv_initcachefifo_printinfousbf_rem_taskapmopenbridge_flushrulecd9660_syncin6_ifawithscopevop_inactive_descaudioreadumodem_set_line_statenfs_rootuvm_schedulerzts_pollsync_printnchashvnopsieee80211_rssadapt_inputpool_cache_initsys_lchownmsdosfs_removecd9660_readdb_read_tokenieee80211_regdomain_compare_rnwi_get_idzeroin_addrbmtphy_cdwdc_set_driveuscannerioctluvm_map_protectusbd_get_xfer_statuswsfont_enumprintfpxa2x0_splraisegif_clone_destroytrunk_ether_cmdmultisched_lockcdce_devsencifrandomwritepxa2x0_cpu_suspendprelist_updatenfs_sigintrhmac_ipad_buffercrypto_drivers_numsppp_pap_closeinit_machclkip6_protoxsys_shmdtsys_recvfromswcr_freesessionttrstrtsys_sbrkwskbd_mux_openrandomuaudio_mixer_add_ctlsysctl_doprockcopyaudioattachzts_sync_sendwsdisplayopenext2fs_initrtfreepxaudc_freemcuio_getptrcd9660_linkwsdisplay_emul_detachhostnamelenupl_cdipcompctl_varscd9660_specop_entriesusb_needs_reattachmulticast_register_ifzkbd_cnpollcgre_mobile_inputxscale_cache_purgeID_rngnfs_flushttyopenuplcom_rtsnfsrvhashraw_ctlinputudf_printwi_usb_ctl_unlockzkbd_devpxa2x0_gpio_iohccdlookupnd6_ioctlzssp_ic_stoplcd_set_brightness_internalphyslockaxe_miibus_statchgpte_l1_s_protocarp_carpdev_stateusbd_get_stringipsec_in_useipsec_exp_allocationsbpfcloseusbd_probe_and_attachsoftdep_setup_removesys_writevsys_setprioritypfr_setflags_ktablesumodem_set_line_codingm_tag_prependaxe_cmdurl_unlock_miiumass_detachusbd_free_iface_dataip_defttlwi_usb_attachurl_rx_list_initsppp_auth_type_nameusb_schedsoftintrarpintralaw_to_mulawrum_writewsemul_vt100_output_scs94_percentkqueue_registercred0in_delmultipfr_ina_definetcp_signatureppoeinqpxa2x0_init_interrupt_maskspmap_procwrnfs_fsyncuvm_forkvfs_op_descsuid_findumass_activatend6_rtrequestuplcom_cduvm_km_suballocusb_delay_msucomparamrasops_eraserowsip_mrtprotobstp_update_infoif_getgroupattribssys_closefrombpfdetachonewire_tripletfifo_ioctlumodem_closetunkqfilterttydefcharssigexithidirtypagesin6mask128tcp_signature_tdb_attachdead_lookupbus_space_read_raw_multi_4atapiscsi_cauvm_amap_poolin_pcballocVOP_LOOKUPonewire_read_blockpxa2x0_lcd_powerdb_shift_exprxfs_statfspf_qid2qnameapm_pxaip_caphysical_startbs_notimpl_bs_c_8pcred_poolenqueue_randomnessexphyattachusbd_set_idlebridge_ipsecipcomp_initieee80211_find_node_for_beaconemul_nativeaxe_txeofwskbd_inputdes3_zerokeysppp_cisco_sendsystrace_nameiswap_ctxtacphy_cdnfsm_strtmbufcrypto_getfeatvop_rename_vp_offsetssys_ovadvisesl_compress_initlockmgr_printinformc_delete_classwsmux_attach_scusbd_pipe2device_handlecpu_do_powersavemainbus_bs_freeaue_rx_list_initbufq_default_freewsdisplay_kbdholdscreenufs_quota_alloc_inode2ipcomp6_input_cbieee80211_name2countrycodemicrouptimesocket_poolnfs_realign_countpgrphashsys_setpgidaltq_enablebstp_assign_rolesprofhzcache_enterdb_watch_tableexec_elf32_makecmdspf_osfp_insertradio_cdradio_caext2fs_bufatoffsys_setlogininitarmmainbus_bs_r_1pxa2x0_lcd_suspenddb_trapuaudio_halt_out_dmaudf_statfstcp_do_rfc3390ieee80211_req2nodexfs_ioctlsys_setresuidpfi_group_changegre_in_cksumsimple_lock_debuggersppp_attachcrypto_kinvokeauth_hash_hmac_sha2_384_96tcp_sackhole_limittrunk_rr_inputdp8390_debugrn_deletesd_get_parmsiskmemdevstat_rush_requestsreq_clear_inodedepssppp_ipcp_scrwi_watchdogatu_start_scanpcmcia_powercarp_proto_input_cipsec_def_compfc_lmdistancepxa2x0_intr_stringwdc_atapi_ctrlnch_poolsomaxconnural_readpxapcic_socket_enableip6_mrouter_veratu_external_firmwarepxaudc_ctrl_methodsipsec_exp_timeoutsystrace_processreadyip_directedbcastppp_clonersystrace_fname_bus_dmamap_loaduihashtblpf_src_tree_RB_INSERTscsi_get_xsau_get_portaudiommapumct_activateieee80211_get_rtspfr_validate_addramap_initffs_flushfilesetherip_allowubsa_baudrateicmp_sysctlsys_lseeksystrace_ioowsbm_attachulpt_resetmainbus_bs_subregionaudio_check_paramspool_cache_getnprocsdes3_decryptllinfo_arpmsdosfs_polldiradd_poolmsdosfs_accessaddupc_intrdvd_read_bcaamphy_servicewsevent_fininfs_connectip6statpxaudc_setupnfs_doioip_mrouter_setflash_chip_read_oobhotplugread_filtopsuplcom_set_line_stateuvm_pageboot_allocxfs_devpollconfig_pendingpf_rm_rulemii_phy_updateswwritepfr_enqueue_addrsether_crc32_leudf_islockeduvscom_set_crtsctsaue_csr_write_1rum_rxratenfs_numasyncrn_searchugenread_isoc_filtopsipipstatsecureleveluftdi_cadb_consolerum_txtimeurl_matcharpt_keepsavectxdb_printsymums_disablepte_l2_l_cache_mode_ptsys_seteuidpxa2x0_bs_allocwskbdpollmax_protohdruvm_map_checkprotmixer_openatu_tx_list_initcdce_activatedes_is_weak_keyural_rf_writedb_access_irq_spzapm_poweroffesp_sysctlflash_chip_read_blockumass_scsi_attachwdc_atapi_intr_datapfr_destroy_ktablesbufpagesrandomkqfiltervnddkdriveruipaq_attachusbrev_strzflash_safe_next_blocktbr_dequeuerlphy_cdbridge_outputsys_keventcopyargsarc4_reinitmi_switchcd9660_statfsrndwrite_filtopsrasops_rotate_fontsysctl_sensorsuaudio_drainkern_sysctlnd6_delayrum_bbp_initin_pcbinitsqphymatchnfssvc_addsockcompat_43_sys_recvbs_notimpl_bs_rm_4tdb_walknmbclust_updatehw_prodfdremoveflash_chip_verify_pagepxaudc_softintruvm_tree_RB_NEXTigmp_fasttimophtree_SPLAY_INSERTudf_getattrscsi_user_donebstp_ifsflagsuserconf_cmdbuflinear8_to_linear16_lewi_get_pmumass_bbb_stateaudio_init_recordxfs_insertdb_print_loc_and_instpf_reassembleohci_device_ctrl_abortvop_pathconf_vp_offsetsrt_mpath_matchgatesppp_ipcp_downubsa_stopbitscdce_startuaudio_identify_assensor_task_schedulepxa2x0_i2s_start_inputapmioctluvm_map_entry_poolcrgetunp_bindtcp_delackudcf_mg_probecsignalreaddisklabeldb_print_cmdusbd_clear_endpoint_stall_asyncwskbd_set_displayvirtual_availtunopenucycom_closebs_notimpl_bs_rr_2tcpstatuvscom_readstatwddkdrivera4x_bs_r_2xfs_devreadfree_msgmapsdb_break_tablefillmapentrynfsspec_accesstcp_timer_persistnfssvc_iodrelookupwsemul_vt100_output_esc_hashudav_newbufsys_umasksyn_cache_reaperieee80211_find_rxnodefilt_fileattachsysenttun_lookuppmap_alloc_specialsbs_notimpl_bs_r_8tcp_setpersistwsscreen_lookup_syncufs_ihashlookupubsa_intrpxaudc_hideread_machclkmemmoveicmp_rediracceptugen_set_interfaceapmclosevop_reclaim_descusbd_get_hub_statuswsemul_vt100_detachdb_boot_halt_cmdsoftdep_setup_inomapdepbridge_stopural_attachip_outputptcpollbpf_mtapuaudio_add_selectorfindblknamenfs_reconnectmfs_vnodeop_opv_descnkmempages_maxkue_rx_list_initpool_initlcd_ioctlpcmcia_card_attachbpfreadpxaudc_ep0_intrpool_putm_copym2umidi_casysctl_structpf_statusohci_hash_rem_tdpmap_pinitxfs_writenfs_ngetaxe_ifmedia_stssysctl_rdstringuvn_attachlasttimefiforead_filtopscryptoclosesysctl_disklockcnkqfilterdesiredvnodesbs_notimpl_bs_r_2ufs_pollusbd_remove_devicepmap_map_sectionmsdosfs_readlinkpmap_devmap_bootstrapdes1_encryptusbd_get_device_statusspec_vnodeop_plookupnchinitexec_mapdb_qualifysnprintfcomcngetcext2fs_readlinksoftdep_setup_blkmapdepaudioprobeether_ioctlumass_bbb_transferrnd_attachedtqphy_servicescoop_pcic_functionsnmea_time_to_nanosppp_state_namepf_normalize_tcpoptrum_bbp_writeuscannerkqfilterip6_forwardinganon_swap_offural_cdkue_resetarp_allocatedrasops_isgray_bus_dmamap_load_mbufwdc_print_capspfsync_bulk_updatepflogattachwi_watchdog_usbslinear8_to_mulawifindex2ifnetcd9660_ioctlrt_mpath_conflictbridge_rtagepfr_dynaddr_updateusbd_get_config_desc_fullin6_savemkludgein_pcbnotifyallfilt_audiowdetachmouse_copy_worduvm_pglistallocsyn_cache_addohci_device_ctrl_transferulpt_do_writewsdisplay_addscreenxfs_devwriteincoreurlphy_cdhzusbf_attachulpt_statusmsgdefrouter_resetstart_cryptocd9660_ihashinsfreefile_poolwdc_atapi_send_packetcheckaliasdl10019_mediachangecue_activategetquotattyretypestartuphook_listpte_l1_s_cache_modekue_detachrt_timer_queue_changelf_initwi_ioctl_usbcpu_attachuvm_km_pages_lowatrn_mpath_countsd_switchwdc_preata_drivemii_phy_matchpxaudc_cdural_amrr_timeoutzapm_enable_chargingsdclosevop_poll_vp_offsetsvop_generic_kqfilterowtemp_updateuaudio_set_speedzts_attachtdb_freepffasttimoinitsiginfosys_getuiddb_set_cmduvm_unlock_fpageqcpuidsexec_setup_stackxfs_getattr_commonrum_free_rx_listpager_map_wanted_locknfs_clientduao_createdb_free_watchpointspfsync_update_net_tdbsensor_detachpfr_clean_node_maskaue_lock_miiidentify_arm_cpuffs_realloccgcdcef_newbufuplcom_set_crtsctsudcf_activatewskbd_load_keymapxscale_cache_cleanD_rngcd9660_bufatoffaudiocloseugenintrgroupmemberuvmspace_initether_sprintfatu_calculate_paddingmsdosfs_unlockscsi_task_listsoftdep_move_dependenciesselwaitwm8750_devicepmap_init_l1ppp_bsd_compressktrnameiudsbr_get_infocarp_set_addr6icmp6_mtudisc_callbacksxfs_susersys_forknfs_readdirsppp_ipcp_tlfpfkeyv2_dump_walkerip_setmoptionsuvscom_resetcarp6_proto_inputpf_hash__qdivremumct_matchpxagpio_reg_readspec_openpmap_vac_me_kpmapswcr_sessionsfilt_bpfreaddb_watchpoint_freeaue_shutdownwsdisplay_emulinputuvm_fault_wireusbd_abort_pipepcmcia_ccr_readkernelstackip6_forward_rtableidsi_freexfs_inactive_commonnfs_niothreadsvm_nphyssegrum_eeprom_readshmget_allocate_segmentip6_randomidproc_filtopsfiq_nullhandleruvm_lock_fpageqelf32_os_pt_notewdc_print_current_modestrunk_ether_purgemultifiledescopensys_vforkpmap_vac_me_uservop_reclaim_vp_offsetscomcnspeeduvm_pager_initcpufuncsCopybufferwinChkNamepxaip_matchdvd_read_copyrightvmi_list_slockxfs_node_purgedb_history_prevuark_detachcarp_ether_delmultisppp_ipcp_TOmyip_initializedpxapcic_scoop_capfkeyv2_sysctl_walkerxfs_getattrsync_vnodeop_psys_mkdirdl10019_media_finiuao_reference_lockedbstp_set_port_roleuaudio_get_propszflash_regx_write_pagepmap_devmap_tableufs_fhtovpcrypto_donewskbd_translatecom_pcmcia_activatedumppcbusbf_string_descriptorrttrashbridge_brlconfpfi_fill_oldstatusohci_root_ctrl_abortmblowatrasops_rmaskgetnewvnodeufs_inactiverum_readkue_load_fwuaudio_opennd6_mmaxtriesrum_setup_tx_descsys_socketuaudio_getdevugenopenSHA512_Lastdead_vnodeop_opv_descohci_shutdownfilt_uscannerdetachwi_init_usbugenioctlzssp_read_ads7846spec_close_clonevop_generic_bwritenanotimeufsspec_writedead_vnodeop_entrieslxtphy_caucycom_readiso_disklabelspoofmidireadpcmcia_cafifo_badopfdfreeipcomp_zeroizeuslcom_methodssppp_get_ip_addrstty_countucycom_writemkdirlisthddeflate_globaluftdi_detachpxaudc_intrraw_disconnectpxaudc_ctrl_closeipsp_pending_acquireipsec_ipcomp_default_levelsensor_task_registerKERNEL_BASE_virtuaudio_identifyremove_coproc_handlerticket_altqs_inactiveumass_polled_transferucom_to_tiocmsensor_attachbrelvpwdc_loggpio_strobe_pins_c3000auth_hash_hmac_sha2_512_96msdosfs_mountfspfr_match_addrwi_stopip6_sprintfzts_ioctlsync_fsyncvop_setattr_vp_offsetssetstatclockratecd9660_strategypf_init_thresholdohci_allocmuserconf_parseural_tx_bcntiocm_to_ucompxaudc_intr1ip6_keepfaithsys_msgrcvext2fs_alloccheck_inode_unwrittenzapm_ac_onusercryptowskbd_deliver_eventcompat_43_sys_getrlimitdb_eregscom_fifo_probefdcopyrmc_get_weightpxapcic_event_processlkmopenemul_findatu_send_mibuaudio_setsystrace_msg_ugidb_to_qxfs_removebus_space_read_raw_multi_2udcf_cdpxa2x0_lcd_setup_rasopsred_getstatsscoop_set_irledusb_blk_freelistudp_sendspacescoop_gpio_pin_readnfs_mknodulpt_caSHA1Updateifg_headvfs_rootmountalloccue_tx_list_initnetintrbs_notimpl_bs_sr_2cd9660_openrw_initwsemul_vt100_output_dcsuvmcnt_dumpglass_consolenfsrv_wakenfsdpf_frag_tree_RB_REMOVE_COLORip6_mforwardsoftdep_setup_allocindir_metaudf_vat_mapohci_root_ctrl_startbsdi_siusl_attachproccmask_bss_end__xfs_uninstall_filesysext2fs_blkprefmsgmapsdb_pool_print_cmdwi_alloc_nicmem_ioicsphyattachbstp_stopdb_delete_lineellist_get_mindluhidkqfilterrpc_auth_unixVOP_ISLOCKEDshm_committedsys_kqueueccdgetdisklabelSHA512_Transformieee80211_tree_RB_REMOVE_COLORuao_referencexfs_channelurio_causbd_kill_pipein6_addrscopeieee80211_ifdetachdb_searchuvisor_attachusl_sync_checkapm_get_eventbs_notimpl_bs_wm_4vfs_getcwd_scandirmaxlockdepthpppclosewi_usb_tx_unlockraw_usrreqsystrace_closepolicyksymsopennblkdevbs_notimpl_bs_wm_2uhidev_detachurioclosescancttyinput__stack_smash_handlerpf_frag_tree_RB_FINDukbd_consopsbiodonecarp_hmac_verifyural_activateah_inputdb_set_breakpointcrp_req_queue_tailgettdbxfs_message_installrootmulaw_to_ulinear16_be_mtswi_usb_txfrmmaxslpext2fs_makeinodeswap_bytes_change_sign16_lecue_startaue_csr_read_2usb_eventsufsread_filtopsufs_symlinkptmopenrum_ack_rateudsbr_attachufs_mkdirvfs_getcwd_getcacheusbd_get_no_altsural_newassocin_iawithaddrbstp_transmit_bpdu__anddi3owsbm_updateflash_chip_identifyrt_missmsgdofilereadVOP_BMAPip_dooptionsvn_lockcue_tick_taskpf_change_icmpusscanner_activaterip6_ctlinputubsa_activatecdce_cawsemul_vt100_handle_csiumass_cbi_adscsbdropmidi_out_stopaltq_assertmsgbufphysmkdir_poolscoop_discharge_batterytcp_debugusbd_transferinpcb_poolohci_hubdohci_pollnextralocpf_consistency_lockexport_tagsetusesys_setegidblf_keynoswap_bytes_mtssppp_ioctlpf_osfp_find_exactwdc_wait_for_statusbus_space_write_raw_multi_4ucom_status_changefifo_readrn_matchcd9660_symlinknfs_progppplogcharautoconf_verbosein6_setpeeraddrunp_externalizesys_munlockalluvm_faultuark_breakscoop_led_setrandomioctlpppwritesoreceivesystrace_newpolicyowtemp_matchpxaudc_connect_intrnmea_scanpool_getuextralocsharp_zaurus_C3000db_show_radix_noderootfspf_frent_pludav_csr_read1nfs_in_committed_rangeohci_root_intr_startzrc_attachpf_calc_mssucom_shutdownrip6_outputsoftdep_freefilemfchashtblinflateportal_vnodeop_entriesscsibus_cdndflushppoediscinqpxaudc_allocxipsec_last_addedpf_commit_altqcompose_tab_cmppxa2x0_lcd_start_dmarn_insertspec_pollfilt_kqdetachmidi_cddb_flush_linepfsyncstartpf_osfp_findaue_unlock_miiwsmux_getmuxipsec_exp_bytesipcomp_sysctlbufqueuesconfig_defer_bus_dmamem_allocm_tag_initfilt_usbreadusb_add_eventxfs_appendqbsearchif_attachgre_lookupusscanner_matchdqsynctcp_sack_adjustlcd_get_brightnessm_reclaimnameipfi_kifaddr_updatebs_notimpl_bs_sr_4pfi_ifhead_RB_INSERText2fs_readdirip6_ctloutputdead_pollpfr_clr_tstatsvn_accesstqphy_funcsmfs_reclaimversionwihap_initzaudio_set_portudcf_detach_bus_dmamap_synclzs_dummykqueue_inituplcom_set_line_codingaxe_rx_list_initata_dmaerruvm_pagezeronfs_readrpcin6_setsockaddrigmp_leavegroupcom_common_getczaudio_get_propsbs_notimpl_bs_rr_8mountlistbstp_initializationuserconf_histbufuow_writewdc_atapi_the_poll_machinenfs_mknodrpccomsoftwihap_mgmt_inputudav_inittunreadVOP_REVOKEflashstartcarp_group_demote_adjconfig_deactivateclallocipsec_esp_trans_default_levelbiowaitusbf_insert_transferfilt_ufsreadunixswudf_reclaimsccsdb_stop_at_pcpfr_attach_tabletqphy_cacarp_sysctlflash_reg8_writewsdisplaymmapccpupmap_updateowid_activateuvm_map_replacermc_newclasspxa2x0_gpio_intr_maskgeneric_bs_sr_1nfsrv3_procsboothowtofdinitarc4randomnsphy_funcsrum_ioctltcp_delack_ticksupl_stopttopenata_get_paramsbstp_update_tcether_ipmulticast_minconfig_rootsearchrip6_sendspaceieee80211_countrycode2namescsidebug_lunsuao_dropswapip_mrouter_detachenxioesp_attachsys___getcwdusb_cdrnd_event_headwsdisplay_switchtoconsolein6_maxmtupmap_enterpfopenamphy_funcswsdisplay_update_rawkbdxfs_install_filesysundefined_handler_addressRMD160TransformSHA1InitinflateInit2sys_setreuidusbd_ratecheckwi_usb_open_pipesudav_tick_taskuvm_map_findspacesystraceioctlwsevent_initl1_sec_tablexfs_quotactlcryptoopenpfr_ktable_cntcomcnattachuserasymcryptodb_var_rw_inta4x_bs_w_2ptcread_filtopsusbd_devinfo_freesdsizesys_pwritevonewire_caudav_lock_miikqueue_scansys_semgetvop_print_descpf_find_rulesetuplcom_breaktcp_closenfsnodehashicmpsrcpfr_ina_commitohci_free_stdumidi_evlensd_patternsX_db_search_symbolscsi_initmsdosfs_advlockdl10019_mediastatusswcr_idwdog_registerkue_attachif_indexlimusbd_free_xferdb_varspfr_kentry_plm_padfallocbufferslxtphy_cdatu_joinsppp_lcp_tludeadproc_mutexdb_breakpoint_freepfctlinputcomcnprobephys_mapuvm_anon_removeumass_bbb_methodssoft_intrqufs_lockcomintrsys_accessnsphy_statusgif_ioctluserconf_initkillpg1url_tx_list_initwsmouse_mux_opentrunk_port_destroytunwrite_filtopsvputonfreelistrum_set_macaddrmouse_removewdioctlnfs_getreqext2fs_mountrootumodem_methodsregyearpf_commit_rulesurl_ioctlpage0compat_43_sys_sendmsgsetrunnablerum_next_scanpool_do_putnfs_closeusscanner_sensedata_cbpxa2x0_pi2c_closewi_set_ssidcue_ioctlzts_accessopsnd6_prefix_onlinkgre_ioctlsppp_ipcp_initugen_seltrue_filtopsatapi_to_scsi_sensewdc_atapi_ioctlumct_intrcue_attachpxa2x0_stray_interruptosversionelf32_read_fromau_get_lr_valueatu_get_mibhid_is_collectionnsgphy_statuswi_usb_tx_list_initapm_power_infofilesys_syncertvtohzip6_mroutervmi_listnewfreefragudp6_usrreqratecheckpxa2x0_imaskin_rtchangevfs_syncwaitudav_ifmedia_statusaue_crcffs1_reallocblksieee80211_node_lateattachcansignalhotplugpollmsdosfs_check_exportpfi_detach_ifgrouplf_setlocknbigpipecue_devswsfont_map_unicharnfsv3_procidin_controllmaxrlphy_funcswsmux_srcopsuvm_pagecopypfr_clr_astatszssp_ic_startsysctl_quadsys_readexec_process_vmcmdsvndclearpf_nfrentskue_tx_list_initmidi_attachpxa2x0_pi2c_setvoltagexfs_startieee80211_tree_RB_FINDtunread_filtopsudf_disklabelspoofohci_freemuaudio_matchucomioctlmbstatuhidev_intrttyinfodb_flush_lexusbf_transferscsi_task_poolnfs_savenickauthttyinexport_udpencapmfs_checkexpohci_root_ctrl_donecarp_set_addrgetnulldevusb_get_next_eventdb_dmesg_cmdextent_destroydb_lpip6_forward_srcrtnfs_writebpenc_xform_rijndael128if_group_egress_buildaltq_detachzapm_pollloop_clonerwhichqsgetcttsetwaterudf_readmididetachsl_softc_listfilt_apmrdetachflashdetachdb_last_addrural_update_slotmouse_copy_startpmap_enter_pvmsgbufenabledtrunk_lb_gethdrfilt_ptcrdetachunp_disconnectufsfifo_writesys_listensys_mountfifo_nfsv2nodeop_photplug_put_eventpgsignalpf_get_sportfirstcshm_delete_mappinglinear16_to_ulinear8_bedb_read_bytespf_poolmasktcp_rndiss_inituhub_detachtdb_deleteaudio_silence_copyoutuvm_page_rehashvop_getattr_vp_offsetspfsync_sendoutvop_islocked_vp_offsetsksymsattachusbf_set_addressne_pcmcia_enableffs_fsyncwsmux_mux_opennfs_sillyrenameau_portofrasops8_putchar12wsdisplay_consinetdomainwsfont_findcbq_pfattachmemcpywdc_enable_intrkthread_exitaxe_activateuaudio_chan_set_paramcue_newbufsi_getdisk_constructvfs_unbusywsdisplay_paramufsdirhash_getprevip_nhopsrip_usrreqpfkeyv2_cleanupfilt_usbrdetachspec_writeaudiostartrdqhashcarp_ifgroup_ioctlipsec_esp_network_default_leveldb_map_equalin_broadcastpool_page_free_oldnointrfd_getfileptcwritemsgbufaddrucomclosesdioctlrpc_msgdeniedutsnameexit2__hex2asciiusbf_set_configaue_resetonewire_threadkue_open_pipesip6_mloopbackext2fs_cgupdatebridge_clone_createmulticast_encap_iphdrcurpriorityusbf_set_endpoint_featurepf_anchor_global_RB_INSERT_COLORpppasyncctlpcpu_setperfufs_lookupugen_attachufs_bmapdoasyncfreepxagpio_cdudav_miibus_readregip6_mrouter_detachip6_randomflowlabelsync_vnodeop_opv_descttpolldegetlogpollkthread_createmulaw_to_slinear16_le_mtsugen_set_configsi_findtunclosedb_elf_sym_initwdc_default_read_raw_multi_2ffs_fifoop_entrieslogclosesppp_increasing_timeoutgeneric_bs_wr_4nbufpcmcia_submatchinstall_coproc_handlerSHA256_Updatepfr_skip_tableudf_readdirohci_rhscudav_detachufs_strategyohci_device_requestrum_bbp_readkue_watchdogphysical_freeendbounds_check_with_labelif_qflusharc4_timeoutrum_newassocumct_openusscanner_data_cbext2fs_checkpathpppoe_softc_listsocantrcvmoreuipaq_rtsfile_filtopspf_tbladdr_setupmsdosfs_renamesysctl_proc_argsext2fsfifo_reclaimdes1_zerokeypipe_wfiltops__lshldi3cd_load_unloadpxa2x0_rtc_getsecspmap_activatebmtphy_resetvop_create_vp_offsetsmidi_getinfoconfig_make_softcpf_anchor_node_RB_FINDunp_discardcue_csr_write_1ip6_outputwi_read_record_iouhid_caudav_rxeofip6_mrouter_getswap_syscall_lockufs_kqfilterums_enablescsi_autoconfcheckdirsexecswwsfont_addzapm_batt_minutesmulaw_to_slinear16_beSHA256_Update_intnsphyter_cdumass_atapi_attachwsemul_vt100_output_csiin6_are_prefix_equalin6_controlpxaudc_bulk_startleapyearsys_sigsuspendcd9660_unmountwsemul_vt100_output_scs96wdc_atapi_the_machinetcp_seq_subtractswcr_authcomputetrapsignalcurprocpxaohci_enabletrunk_lb_porttablemainbus_bs_allocrushjobpmap_devmap_registerrn_inithead0db_single_step_cmdwd_flushcachend_defrouterblf_decfdcloseexecevcount_attachlimcopywi_do_hostencryptnfs_vptofhtcp_timer_rexmturl_ifmedia_changepcmcia_io_maprum_rf_writeuftdi_attachcrypto_pool_initializeduvm_swap_markdecryptrt_timer_initudsbr_cdowtemp_detachnd6_useloopbackieee80211_next_modeputsaxe_tx_list_initudcf_sl_intrrip6statptydevnamemulaw_to_ulinear16_le_mtstcp_debxcnpollcd_casys_truncateesigcodeacphy_servicescsi_xfer_poolsysctl_wdogscoop_pcic_clear_intrarmv4_tlb_flushIDnfs_boot_getfhudav_csr_readohci_add_doneieee80211_tree_RB_NEXTsrv_ipohci_add_edwdc_xfer_poolusscanner_cdcdce_newbufbus_space_copy_2sppp_pap_opensoacceptkqueue_pollcdgetdisklabelvop_bmap_vp_offsetsdb_call_depthlcdintrpool_page_alloc_kmemdb_printfuhidreadin6_ifaddlooppflog_clone_createonewire_famnameufs_creatend6_optionscd9660_seeknd6_llinfo_settimerzaudio_update_mutesfreqmsdosfs_unmountelf32_load_psectionuftdi_writexfs_close_commonSHA512_Finalslinputrn_mpath_nextpf_src_connlimitarm_pcache_unifiedmidi_out_startdb_add_symbol_tablepf_state_tree_ext_gwy_RB_INSERT_COLORuplcom_setm_tag_nextpf_check_congestionohci_intr1uaudio_id_namemax_softdepsmsdosfs_writebs_notimpl_bs_w_1cue_resetcompat_43_sys_getdirentriesuslcom_matchexec_script_makecmdszapm_resumexfs_attr2vattrieee80211_reset_erpfilt_pipedetachcd9660_rootdb_unaryiophyattachzts_readposne_pcmcia_get_enaddrxfs_eopnotsuppselrecordpxaudc_caxfs_reclaim_commonffs_validatecomstopatu_wait_completionaxe_ax88772_initrip_outputpxaudc_bulk_methodssppp_strnlenext2fs_accessmld6_fasttimeounode_poolkthread_qimaxcdcef_txeofwsmouse_matchvop_unlock_vp_offsetsohci_free_seduserconf_pdevuvm_object_printitpf_find_state_recursetcp_sack_partialackclock_secs_to_ymdhmsmbpooltcp_canceltimerstrunk_rr_attachtqphymatchrip_recvspaceroute_initccdreaddb_store_countipsp_spd_inplink_rtrequestbstp_calc_path_costwdc_get_xferpxaip_measure_cpuclockuvm_vmspace_poolpxapcic_cdmfs_rootbasespec_lookuppipe_createstackgap_initnfsbootdevnamefifowrite_filtopssysctl_vnodend6_sysctlpxa2x0_setperfipsec_common_inputpf_tbladdr_copyoutvn_openpf_frag_tree_RB_NEXTnfssvc_sockheadpf_anchor_node_RB_NEXTsppp_pap_TOif_clone_createmachclk_usepccpf_route6cdce_tx_list_initbstp_info_cmpuao_detachcpufunc_controlmallocamap_pp_adjrefrpc_versesp_inputin_pcbrtentryudf_readatoffsetnfs_iodwantknote_dequeuewi_cmd_usb__udivsi3tcp_outflagskqueue_statcdce_ioctluaudio_io_terminaltypenfs_boot_initpppdealloccd9660_rrip_analyzeohci_hash_find_tdexphymatchnfs_vfsopsonewire_scanuriowriteip6_v6onlysys_preadvuark_methodssystrace_execve1db_tok_stringpf_src_tree_RB_MINMAXuserretnfsv3_typesys_recvmsgpipe_statskipjack_setkeyvn_writemtdphy_servicevop_mkdir_vp_offsetsVOP_LINKubsa_devszflash_oob_lognopcmcia_megahertz_xjem1144_func0icmp_inputuvm_km_free_poolpage1umass_cdvcountvm_page_zero_enableinodedep_hashppptioctlin6_delmultistathzpf_test_state_udpudcf_intrenc_xform_cast5wdog_ctl_cbhfsc_add_queueuaudio_mixer_get_portpxagpio_dispatchah4_input_cbpfr_ktablehead_RB_INSERTuftdi_get_statuswdc_ata_bio_intrwskbd_cnattachktrcansetrum_attachhookvirtual_enduhidev_get_reportsys_getloginpxa2x0_gpio_intr_disestablishbuckstring_initipsec_hdrszicmp6_rediracceptext2fs_vnodeop_opv_descpxa2x0_i2s_closedetruncdb_elf_symbol_valuescopyoutpfindcomconsaddrip_ctloutputuhidev_set_report_asyncwsevent_readenc_xform_arc4pf_routearp_ifinitdb_write_variableufs_dirbadcd9660_readdirrum_enable_tsf_syncvfs_unmountallpf_match_portccdattachwsdisplaypollohci_allocxxfs_reclaimcopyrightsdattachxscale_optionswdc_default_lba48_write_regxfs_message_wakeuptcp_timer_keepportal_inactiveusscanner_attachusbd_devinfo_vpwsemul_vt100_cnattachtcp_mss_updatefree_pagesffsfifo_reclaimdb_proc_print_cmddb_show_all_procsrw_enter_readvunmapbufgpio_sense_pins_c3000ip6_sourcecheck_intervalroute_outputrti_deletevop_kqfilter_descsys_geteuidpxa2x0_gpio_set_functionhostzeroisbroadcastchange_sign16_swap_bytes_bedb_output_positionrasops_masks_initapm_attachzaurus_main_batteryicmpmaskreplmsdosfs_mknodin6_pcblookup_listencd9660_specop_ppflogifsip6_defmcasthlimsys_munmapudsbr_hw_ifpxa2x0_lcd_initializefilt_solistenvsnprintfowtemp_attachwsemuldisplaydevprintarplookuppxa2x0_i2s_setspeeduvm_map_pageableproftimer_trampolinechainallocuplcom_methodspmap_copy_page_xscalepf_change_a6ifmedia_baudraterum_get_rfusbd_setup_default_xferzssp_attachuvm_pagelookupudf_trans_poolfree_allocindirsoshutdownuserconf_hist_cmduftdi_cdnfs_writerpctcp_rndiss_reseeduserconf_listproc_cansugidcd9660_rrip_getsymnamedb_command_tablepf_state_tree_ext_gwy_RB_REMOVEwsemul_vt100_scrolldownwsdisplay_getc_dummybpf_iflistPaste_availpxa2x0_i2c_detach_subwdc_downgrade_modeieee80211_node_leaveip6intrqptmwriteaxe_newbufnd6_rs_inputpf_rtlabel_matchwdc_atapi_real_start_2soabortlinear16_to_linear8_beuaudio_trigger_outputusbf_clear_endpoint_haltcast_encryptunp_inozflash_reg8_writelogkqfilterpfsync_insert_net_stateuvm_tree_RB_INSERTdb_extent_print_cmduprintfsensordev_installdb_clear_single_stepsppp_set_ip_addruvm_page_printitmainbus_canfs_pollsoftdep_flushworklistsys_issetugidinitclocksudf_hashinscd9660_mmapsd_reassign_blockscarp_hmac_generateif_detachttcompatsetlflagsaue_watchdogwsmuxopensetup_allocindir_phase2midiprintwdc_ata_bio_startnd6_cache_lladdrcatqsession_poolifqmaxlenipsec_get_acquireext2fs_specop_opv_descunp_connectuvm_pagermapinif_detached_startudsbr_set_infopool_serialxscale_cache_flushD_SEuplcom_activatescsi_probe_lunirq_entryaue_ioctlsdrestartxfs_mount_commonvfs_mountedondb_expressioncputypepmap_deactivatert_lookupfc_lookup__bss_start__semu_allocpf_hash_rulelinear8_to_linear16_be_mtspfr_destroy_kentryusbf_alloc_xferif_downndqbfilt_rndreadallocsysVOP_GETATTRuark_setieee80211_fix_rateticket_altqs_activea4x_bs_wm_1nfs_reclaimuvm_km_pages_headwihap_deauth_reqieee80211_node2reqpf_purge_expired_src_nodeswi_usb_matchnfs_advelf32_check_headertcp6_usrreqdb_historyeephy_cdinphy_cdukbd_parse_descnfs_loadattrcachemidi_unit_countttytstampnfsm_rpcheadnfsrv_readdirtcp_rndiss_cntural_set_txantennaieee80211_crypto_detachtrunk_port_ifdetachpmap_unwireipaddrip6_auto_linklocalbridgeintr_framecompat_43_sys_getdtablesizeuvm_pageunwirehw_seriallcd_pxaip_cazrc_timeoutauth_hash_hmac_md5_96apm_thread_createpfr_kentry_byidxip6_mrtprotouvm_unmap_puaudio_halt_in_dmacdattachuserconf_deviceuark_caurioreadnonidempotentin_localaddrpflog_clone_destroyflashdkdriversys_sigaltstacknfsrv_fsinfonfsrv_symlinkDES_versionsl_uncompress_tcpsoisdisconnectingBlowfish_initstateauth_hash_key_sha1wi_media_changenfs_vgetnull_decryptsyn_hash2rttimer_queue_headptsreadarm_pdcache_sizebridge_filterruledp8390_enableexphy_caucom_dtrrtredirectuvm_map_printitwdc_atapi_pio_intrdb_read_variablepfr_destroy_kentriesnsgphy_caulpt_cdsoftintr_initdb_regsdb_stack_dumpttymodemdb_lbuf_endwsdisplay_defaultscreensmtx_enteraxe_devskqueue_pooluaudio_mixer_set_portvntblinitallcftablesudf_hashremxfs_vnodeop_puhub_activatepf_src_tree_RB_REMOVE_COLORax88190_mii_bitbang_opsnfsrttonin6_ifattach_linklocalVOP_REALLOCBLKSugenwritenfsrv_accesssys_setresgidmsdosfs_sync_vnodesplassert_failarm_picache_waystty_initaxe_ioctlwsdisplay_clearoncloseindir_truncpriq_add_altqudp6_recvspaceuvm_km_freeusscanner_intr_cbbstp_listsys_killstart_nfsiouserconf_numberperflevelpfr_update_statscomconsiohpmap_set_pcb_pagedirinsw16rt_setmetricssys_getegiddb_set_single_stepusbf_config_descriptorudf_get_spartmapvndgetdisklabelxfs_fsyncpfr_create_kentryumass_init_insystemdirchkflashattachpxa2x0_i2c_readexphy_resetipip_outputpipeclosealaw_to_slinear16_le_mtsext2fs_fifoop_entriesVOP_REMOVEwi_usb_activateufsdirhash_findfreeconsinitowsbm_matchurlphy_statusext2fs_dirremoveipsp_aux_matchuvm_vnp_uncachesysctl__stringffs_clusteracctnfs_timerconfig_detachmtdphyattachifaof_ifpforaddrcryptop_poolsensordev_listminidatacleanrt_timer_queue_destroyzkbd_syncrequest_cleanupwi_cdsd_cdxfs_make_dead_vnodenfs_createnfs_sndlockportal_setattrxfs_linkicmp_mtudiscipport_hifirstautosys_fstatslcloselcd_show_screenenc_xform_3desuserconf_enableukbd_sunlayoutext2fs_vinitbstp_set_port_protodb_endlpuplcom_intrumass_bbb_resetcryptodevallowsoftgeneric_bs_w_1sa6_anysys_getprioritypfsync_request_updateatu_radfirmnfs_bioreadsysctl_diskinitnfsreqplbridge_listuvm_km_valloccdcef_watchdogieee80211_send_mgmtcue_getmachandle_allocindir_partdoneieee80211_dump_pktsys_unmountuvscom_dtruipaq_detachbootdvapmkqfilternfsrv_getattrmainbus_bs_tagelf32_probespf_fragcacheumct_detachtcp_signature_tdb_outputin6ifa_ifpwithaddrvgonelbridgeintrsofreeeephyattachinphyattachctrl_eventcomsiraddruslcom_get_statusuvscom_shutdowndb_del_symbol_tabledb_add_exprpmap_removebpf_mtap_afuaudio_determine_classnfs_statfsusbf_free_xfericmp6_fasttimoext2fs_removeif_clone_destroywdccommandcdcef_ioctlpxaintc_attachmyipbpf_setfuserconf_historyktrsettracevnodeuvm_page_unbusyxfs_stat_filesyssppp_print_stringfilt_hotplugreadipsp_skipcrypto_unmarkzaudio_closexfs_pioctl_calltk_noutext2fs_mountmif6tablepmap_collectBlowfish_expand0stateukbd_enabledb_symformat_elfgeneric_bs_rr_4cpu_sysctlcd9660_vnodeop_pcd9660_deftstamphotplugkqfilteraudio_rintip_randomidaue_tx_list_initpf_state_tree_id_RB_INSERT_COLORnosuidcoredumpukphyattachvop_poll_desccddumpdb_search_cmdpxa2x0_lcd_alloc_screenasttcp_disconnectvop_open_vp_offsetsuvmspace_execcbq_remove_altquow_cawi_usb_detachwsmux_createpxaohci_attachxfs_link_commondeallocate_dependenciessys_mmappf_anchor_global_RB_INSERTbstp_getstatebootuaudio_hw_ifnd6_is_addr_neighborblf_ecb_encryptwsemul_vt100_output_normalunp_rightshostnameaudio_cddb_print_llinfozkbd_rawrepeatwsdisplay_emulbellsadb_exts_allowed_inxfs_fhtovpnmeaattachupl_outputext2fs_bmapip_mforwarduvmexpenc_xform_blfsppp_ipcp_opt_namesensordev_getufs_diremptyesp_output_cbreinsertfinishdupukphy_serviceqsphy_resetdeflate_decompresstdb_hashpool_destroylogwakeupdl10019_mii_readregshutdownhook_listpxadmac_intrip_dosourceroutesoread_filtopsieee80211_media2ratebdevsw_lookupdisk_changewsemul_vt100_resetopuplcom_matchsc_devsamap_lookupsdoreallocblkscache_revlookupred_destroybpfread_filtopssoinitVOP_MKNODuvmpxa2x0_update_intr_masksnd6_ifdetachin6_ifaddrroute_protofilt_ugenread_isocpxa2x0_lcd_geometryhw_uuidext2fs_truncatecd_play_tracksscsi_do_mode_sensevirttimer_trampolineip6_maxfragpacketsdb_errorax88190_media_finiudcf_cazaudio_start_outputprefetch_abort_handleruvm_km_threadsppp_cp_inputttydebuglminscsi_probe_bussys_fpathconfpfi_addr_plpf_get_mssscoop_battery_temp_adcwsmuxpollxfs_rootarpt_pruneohci_device_bulk_methodssoconnect2knote_poolcnopenscsi_test_unit_readyrmc_modclassural_set_bssiduscanner_activatearc4random_bytesnmbclustrum_set_basicratesural_get_rfzaudio_detachvop_reallocblks_vp_offsetssominconnpf_osfp_listzaudio_powerxfs_devclosepf_src_tree_RB_FINDpcmcia_matchnchashtbluvm_vnp_syncusbf_end_configusbf_add_configwsmux_set_displaypfr_unroute_kentryufsdirhash_checkblockwihap_assoc_requaudio_chan_ptransferinodedep_poolarpt_downportal_rootwsmoused_wakeupxfs_printnode_commonudf_accesspfr_ina_begintrunk_port_checkstackingulptclosearm_pdcache_line_sizebpf_tapdb_lookupSHA256_Finalmii_phy_autorasops15_putchar12wsmousednfs_mountrootmax_datalenuow_ow_bitwsfont_rotateufs_mindirhashsizemsdosfs_initohci_device_ctrl_startvop_readdir_descwi_write_record_ioext2fs_writelf_clearlockpxaudc_writegeneric_armv4_bs_wr_2nfs_udpsockdb_lastsymurl_memip_srcrouteuaudio_add_mixeruhidioctlip6_accept_rtadvpf_test_otherpte_l1_s_cache_masksys_setregidpcmcia_cdusbd_device2interface_handleurl_csr_read_1xfs_unlockccdlockusbd_dopollportal_statfsvinvalbufmii_bitbang_writeregpfi_ifhead_RB_INSERT_COLORzts_rawmodenfs_mkdirsys_ftruncateubsa_dtrzflashmatchaes_ctr_cryptah6_input_cbsoftdep_fsyncm_splitsoftintr_disestablishfifo_pollkrp_req_queue_tailumodem_ioctlurl_stopzts_irqtcp_timer_initdb_tab_stop_widthradioattachxfs_setattrdb_putncharscarp_clone_createmainbus_bs_unmapudf_find_partmapsnd6_maxnudhinttcp6_inputwdc_atapi_doneip_mroutersosetopttcp_msscache_purgeudav_stop_tasksl_clone_destroybpf_mcopyax88190_mediachangepcmcia_3cxem556_func0SHA384_Finalrum_write_multiauth_hash_hmac_sha1_96pcmcia_intr_disestablishfork1onewire_detachcurpcbdb_activevfs_hang_addrlistcue_tickmrt6statdead_writeufs_dirrewritecarp_set_enaddrinsmntquettreadtk_canccdb_write_bytesext2fs_blkfreeudp_outputvlan_taghfind_last_setcd9660_vnodeop_entriespxaintc_matchtcp_rndiss_msbsys_chmodccdsizeuow_ow_read_blockucomreadprelist_removeffs_vgetaxe_encapinitprocsystraceread__umoddi3onewire_printpfkey_buildprotoswnfssvc_nfsdsystracepollarm_dcache_alignugenclosesppp_lcp_RCN_rejip6_log_intervalnull_encryptwihap_auth_requvm_page_physdumprootconfccdbufferpf_insert_statewsemul_vt100_nextlinenfs_readlinkrpcX_db_sym_initsyn_cache_timervt100_initchartableslcd_paramext2fs_checkoverlapsolisten_filtopsatu_internal_firmwareprocess_kernel_argsin6_update_ifa__wdcerrorstat_inode_bitmapcdce_detachpxa2x0_intr_disestablishvop_bmap_descwsdisplay_usl_ioctl1suser_ucredaltq_remove_queuetcp_sack_optionmulaw_to_alawsd_shutdowncom_is_consolewi_shutdownmem_noext2fs_buf_allocdp8390_startsoftdep_disk_write_completesystrace_seteuidipcomp_input_cbatu_xfer_list_freewihap_sta_deletemainbus_bs_rm_2pfkeyv2_get_proto_algpfkeyv2_releasepmap_free_l2_bucketRMD160Update_intrevarprequestkernel_mapwi_init_iodumpdevxfs_update_handlepxa2x0_i2c_writeppp_dequeuewsmouseioctlsppp_lcp_upcd9660_lockxfs_rmdir_commonxfs_read_commonieee80211_mgt_subtype_nameugen_do_readchange_sign16_swap_bytes_le_mtsdb_not_taken_bkptuaudio_chan_initvfs_mount_foreach_vnodekqueue_kqfiltermidiclosesoftdep_typenamesimport_lifetimeip6_mrouter_donepriq_remove_queuewi_mgmt_xmitflash_chip_disableaudio_openuhid_do_ioctlzeroin6_addrstrncasecmpatu_tx_startohci_device_bulk_start__guardwdc_atapi_minphysbstp_ifstatein_ifaddrzts_cdcurrent_spl_levelnd6_optionufsdirhash_findslotsppp_chap_initwin2unixfnmax_hdrnum_inodedepffs_readinet_ntoa4tun_clone_createm_freepxaudc_ctrl_startvop_default_desccbq_add_queuene_pcmcia_dl10019_get_enaddrurlphy_attachzaudio_openscsi_inqmatchfdesc_poolufsdirhash_poolusbd_add_drv_eventvop_strategy_vp_offsetspool_page_allocpfr_kentry_pl2in_pcblookupfilt_pipewritecd9660_pollm_tag_delete_chainpool_head_slockbadaddr_read_4ipe4_initbzeroxfs_opentickfixintervalmii_bitbang_syncarmv4_drain_writebufufs_closemrtstatfixjobcpf_anchor_removedb_show_all_cmdsusbf_set_endpoint_haltscsi_execute_xsin6_addmultistat_ino_limit_pushrn_newpairvop_setattr_descdb_find_breakpoint_heremsginfopppfcszts_enablesys_obreak__udivdi3pxapcic_attach_cardpxa2x0_gpio_set_intr_levelblf_setkeyusbd_set_config_nodesirednfsrvcachepf_routablesystrace_msg_emulusbpolllastddatepppoeattachucom_do_ioctlpf_rtlabel_addpmap_curmaxkvaddrzflash_regx_read_pagein6mask0swap_key_cleanupbpf_validateonewire_write_blockusbd_get_string_descvaccessuao_set_swslotmbinitchange_sign8usbd_get_reportabortwskbd_default_bell_datascsi_readsafe_cmdamap_allocxfs_readdirVOP_LOCKMD5Finalwskbd_matchcp_timeaxe_rxeofcd9660_vget_internalsystracef_readlinear16_to_linear8_ledb_page_print_cmdpf_osfp_initializewi_intripsec_acquire_poolbstp_same_bridgeidlkmioctlvgetpxa27x_cpu_speed_91ugenpollieee80211_create_ibsswsmouseopenwinChksumfreeclusterchainmld6_initrw_test_and_setmainbus_bs_w_4disk_initnfs_nameipxapcic_intr_establishcd9660_fifoop_opv_descohci_hash_rem_itdohci_bus_methodsatu_cdrip6_ctloutputnfs_getattrcachewdcrestartrum_prepare_beaconnetiopfi_updatezaudio_start_inputaue_sendusbd_getnewaddrrasops_erasecols_rotatedzaudio_play_setupnd6_na_outputext2fs_fhtovptrunk_ether_addmultiumass_cbi_transferext2fs_createnfsrv_createusbd_bulk_transfer_cbwi_sync_medianfs_realignvfs_opv_init_explicitpipe_pollnsphy_caseminfobmtphyattachucomopensysctl_dopoolcd9660_fifoop_ppfi_stateheaduhub_matchpmtu_expirecrypto_getreqtcp_respondsys_readvamap_cow_nowroundrobinsa11x0_intr_establishbadaddr_readuvm_map_createworklist_tailvfs_opv_initissignalwdprintCopybuffer_sizenetclsfilt_uhidrdetachin6_selectroutektrinitheadercdevvptagname2tagpfr_insert_kentryuvm_pglistalloc_simple_setsoftintrigmp_joingroupinflateIncomppfr_pool_getxfs_syncrandompolluiomoveohci_device_isoc_doneoutsw16wi_usb_wridrespmsdosfs_startlf_allocdb_loop_countwi_intr_ackfiq_releasemfs_rootsizebpf_reset_dslinear16_to_mulaw_lepf_anchor_node_RB_INSERT_COLORnd6_dad_stophid_start_parsecarp_send_nauseloopbackscoop_pcic_socket_setupuvm_waitpf_anchor_stacknfsfifo_closefilt_apmreadnexecszts_avgposieee80211_regdomain2namepmap_referenceprocess_worklist_itemsys_bindax88190_mii_statchguaudio_trigger_inputxfs_message_wakeup_datacarp_addr_updatedloioctlrw_exit_writebs_notimpl_bs_wr_8carp_iamatchumct_initpmap_bootstrapbs_notimpl_bs_wr_2ipsec_auth_default_levelbstp_rerootedblf_cbc_encryptsys_mqueryarm_picache_line_sizebigadjkmeminit_nkmempagesspeedtablesnfs_sysctlipsec_policy_poolspec_vnodeop_entriesonewire_read_byteusbd_new_devicewi_pcmcia_detachshm_last_freexfs_lookup_commongif_clone_createfillinusemaprecvitfill_kproc2bmtphy_funcsusbf_get_descriptorscoop_suspendipsec_common_ctlinputtdb_rehashums_cdcom_pcmcia_enableipcomp_outputfilt_sowriteuvm_kernacccnpollcsys_linkucomsubmatchadd_to_worklistlcd_blanklog_opennumnfsrvcachegettdbbyaddrevcount_initfragtbl124portal_vnodeop_puserconf_totdevvop_inactive_vp_offsetsxscale_cache_flushIDrt_tablesrt_ifmsgwdc_atapi_real_startrealitexpirepf_src_tree_RB_REMOVEunix2dostimeipstatzrc_set_ledsnfs_initscsibus_caubsa_attachuvscom_openurl_newbufusbd_delay_mspool_page_free_kmemcompat_43_sys_truncatecrfreecnputcuhid_do_writein6_gif_inputipsp_delete_acquirepte_l2_s_prot_wip6_lasthdrdl10022_mii_bitbang_opsohci_device_isoc_abortuhub_uhub_caugen_matchtcp_reapernfs_bmappool_sethiwatwi_read_record_usbuftdi_methodswsemul_vt100_output_c0c1wdgetdefaultlabelmicrotimexfs_update_read_credppp_deflate_draftsysctl_sysvsemuvm_swap_getaudiosetinfoext2fs_reloadurlphy_matchnfsrv_getstreamcsefindelf32_copyargsisocharpf_frag_treeiophymatchxfs_message_receiveuvm_km_alloc1cdopentcp_usrclosednsphyter_caaue_ifmedia_stsskipjack_backwardscarp_send_ad_alludf_checktagphysmemuslcom_paramurl_cdnsgphy_servicexfs_rmdirpagedep_lookupwskbd_holdscreeninferiorpfr_ktablehead_RB_INSERT_COLORxscale_cache_purgeD_Eukbd_attachclusterallocext2fs_fifoop_pcryptof_readxformswuplcom_cart_if_remove_rtdeleteltsleepxfs_closewskbd_attachin_pcbbindxscale_cache_flushIumass_cbi_statemtdphy_cazrc_intrnfs_node_poolzaudio_standbyrtalloc2endtsleepwihap_check_txxfs_vnodeop_opv_descuvm_pageratopsigactssharezrc_cdsadb_exts_allowed_outdb_set_watchpointnfsrvw_sortbpfattachuftdi_openif_detach_queuesitimerdecrvnddumpusb_create_event_threadether_outputshmexitpmap_bootstrap_pv_page_freeexport_authauth_hash_md5crypto_kdonezflash_oob_statusnfs_removebpfilter_lookupm_copym0pppoe_cloneraxe_miibus_readregpxapcic_detach_cardvm_physmemSHA256_Transformiso_shipdirrnd_timeoutxfs_bmapufsdirhash_dirtruncicmpmaskpipe_ioctlpf_state_tree_lan_ext_RB_INSERT_COLORural_set_chanwskbd_enablepmap_devmap_find_vacd9660_mountrootusbf_devinfo_allocnetlckbpf_allocbufsset_stackptrxfs_unmountrt_gettablemsgbufmappedohci_device_setintrpxapcic_attachxfs_data_validcomprobe1getphysbufuark_paramcdsizedb_symbol_valuesumass_lookupscsi_deinitsppp_lcp_check_and_closedb_evarsupl_activatesppp_ipcp_openwsmouse_mux_closeufsfifo_closewakeupsoftdep_slowdowngetnanotimeatu_devsucycom_openwdc_pcmcia_disk_device_interface_callbacka4x_bs_wm_2compat_43_sys_sethostidpxaudc_ctrl_transfertcprexmtthreshkprintf_mutexusbf_alloc_buffersetquotastat_countprt_getifaslstartdb_malloc_print_cmdwi_get_fid_ioenosyscompat_43_sys_creatlockmgrbstp_tickrtlabel_name2iduvm_vnodeopsvfsconfVOP_OPENcompwroffurio_attachwsdisplay_console_inittedSHA384_Initbuckstringusbd_fill_deviceinfoscsi_interpret_sensepfkey_unregistersqphy_cdugen_do_ioctlext2fs_flushfilestrunk_ioctl_allportsmsdosfs_vnodeop_paltq_attachdes_ecb3_encryptcomconsattachedlxtphyattachwi_usb_txeof_frmufs_readlinkdoscheckpathnfsv2_vnodeop_opv_descrum_set_chanpcbmapaudio_readatu_newstateuscannerclosend6_option_initmfs_initminirootuvm_km_alloc_poolpage1audiopollext2fs_setsizeprocess_set_pcin6_init_prefix_ltimessoftdep_change_directoryentry_offsetesp_outputnchstatscd9660_fhtovpmsgbufpsys_setgiduserconf_common_attrfilt_ufswritepxadmac_attachrt6_flushpppoe_clone_destroypxapcic_io_freeuvm_mlk_callgeneric_bs_r_4atapiscsi_attachpxaudc_epN_intrmmrwbstp_destroyffs_bufatoffah_input_cbpf_insert_src_nodewi_usb_rridrespuvm_errno2vmerrorsubkey_table_gencompat_43_sys_getsocknamedohooksnfs_quotactlpriq_add_queuewdc_atapi_tape_doneieee80211_rssadapt_chooseukbd_activateaue_setmultiif_detached_ioctllocnampstat_ino_limit_hitpfr_initializebridge_rttrimvop_close_descwi_usb_castat_blk_limit_hitbstp_enable_portfilt_tunreadtun_outputuserconf_showip_mtudisc_timeout_qpf_remove_if_empty_rulesetaddress_exception_entryffs_fhtovpgetvnodefilt_ufsvnodecrypto_get_driveridspeed_to_freqpool_setlowatuscannerpollkmembaseswi_entryrip6_inituvm_aiobuf_poolisofncmppcmcia_card_detachipsec_add_policysysctl_emulsys_sigprocmaskdb_commandnfs_renamerpcsys_shmctlpf_get_poolin6_if_upfilt_pipereadskip_spc_rightcompat_43_sys_gethostidpxa2x0_intr_establishsoreservepidtakendb_formatpfr_ktable_plmfs_pripf_test6consoleuvm_mmapxdr_string_decodeusb_activatepxaost_attachscsi_report_lunspf_osfp_matchufs_quotactlradioactivatetcp_newrenoaroundin6_pcbnotifyusbd_clear_endpoint_togglecrypto_threadstrrchrrum_detachgetdevvpzflash_oob_set_statusdefrouter_selectamap_unrefext2fs_statfscompat_43_sys_sigveccrdupbpf_mtap_hdramap_wiperangecuio_copybacktickdeltaisodirinodb_strlcpycfrootsscsiprintwsmousepollchrtoblkuserconf_pdevnamminphysukbd_matchacctchkfrequrl_tickah_output_cbztsavgloadedtimeout_mutexcd9660_specop_opv_descrtalloc_nocloneether_addmultinfsrv_rmdirvop_mknod_descudf_strategycdce_cduow_ow_write_blockucycom_activateip6qffs_vptofhvfs_isbusyifunitirqstackbstp_hello_timer_expirybawritetputcharflash_chip_write_pagewskbd_detachpmap_postinitcsedeletepool_print_pagelistffs_fragacctpxa2x0_lcd_resumeffs1_ballocsys_fchownuvisor_methodsums_activatedb_breakpoint_cmdcd_powerhooknfs_strategyvwaitforiocompat_35_sys_shmgetpxagpio_camii_phy_tickuscanner_do_closecd_read_subchannelextendfilelortrequestuark_attachicmp6_inputwsemul_vt100_outputuserconf_addwdc_atapi_resetnfs_openohci_device_intr_methodswi_func_iocreatedeuvscom_closeowtemp_cduow_cdsbreleasedb_history_sizepf_cksum_fixupmsdosfs_islockedpflogoutputmax_linkhdrumass_attachwsdisplayioctlalaw_to_ulinear16_lecryptof_statudav_resetget_stackptrsysctl_rtablemsdosfs_reclaimvop_mknod_vp_offsetssqphy_serviceuserconf_hist_eocext2fs_getattripsec_adjust_mturtlabel_id2nameusbf_setup_default_xfersbdroprecorduvisor_activateuvm_coredumpudf_ds_poolpxaip_searchwdsizeacphy_statusip6_sysctlmfs_mountrootsavacctppf_thread_createsuserusbf_devinfo_setupdiskconfsemtotural_tx_dataatu_get_card_configvn_syncer_add_to_worklistusbd_get_interface_descriptorgeneric_bs_rm_1memalltrunk_media_changetk_ninsysfilt_opsclusterfreerootdevaudio_fill_silencepf_normalize_tcp_initpf_print_stateufs_ihash_slockm_tag_firstpxa2x0_cpu_resumemixer_closecdmatchpmap_map_entryusbd_get_config_descriptorffs_checkoverlappfr_clr_tablesdumpsysicmptstampreplif_detached_watchdogusbd_ar_pipeatapiscsi_detachext2fs_fsyncnfs_ticksdoforcesys_fsyncpfr_get_astatswi_usb_stopfree_allocdirectuserconf_add_readusbd_reset_portifconfcpu_apmwarnamap_wipeoutuser_configrum_select_bandcast_setkeydb_map_currenttcp_outputtcp_rndiss_nextnsphyattach_bus_dmamem_mmapwsdisplay_emul_attachpfdatatopacketupdate_ledsext2fs_updatepxa2x0_memcfguvm_swap_initcryptnfs_accesstcp_timer_2mslpf_osfp_entry_pltbr_setne2000_writememaue_openpipesudsbr_detachffs_reload_vnodepf_tag_packetmsdosfs_setattrVOP_RMDIRwdog_tickledb_delete_breakpointif_addgroupieee80211_setmodeudf_readlinkuhid_matchpool_allocator_freefilt_proceopnotsuppumodem_paramfifo_lookupffs_reallocblksnfs_removeitrandomcloserootvpaxe_miibus_writeregugen_do_writepxagpio_intrlowpcmcia_intr_establishuserconf_maxlocnamespool_reclaimusb_quirksbpf_sysctlufsdirhash_removetrunk_ether_delmultivflushpfr_reset_feedbackcddetachpmap_clear_modifytcpctl_varsarptimernfsrv_dorectcp_reass_limitruaddm_copymallocdirect_poolmouse_copy_extend_charbcopy_pageip6_freepcboptsdb_free_breakpointsif_uppfr_del_addrswsfont_getflgchkdquotnfsnodehashtblslopenne2000_ring_copyupl_intrucomprintural_matchuslcom_openVOP_BWRITErt_timer_queue_createbstp_received_stpwddonezaudio_initmsdosfs_ioctlupl_matchtdb_soft_timeoutsys_openurio_matchrasops_pmaskinet6domainural_enable_tsf_sync_bus_dmamem_alloc_rangepgdeletepxapcic_intr_stringbstp_createpf_matchuvm_pageidlezerousbf_do_requestwskbd_do_ioctl_scphtree_SPLAY_MINMAXdb_symtabspfsync_send_busieee80211_media_changepf_anchor_copyoutucom_detachraw_attachural_set_rxantennadb_boot_sync_cmdmax1111_adc_value_avgastpendingnfree_msgmapstrunk_rr_startether_ip6multicast_maxpipe_pooluao_initvop_abortop_descucycom_attachifa_ifwithroutescoopattachumidi_get_quirk_data_from_typespec_kqfilterzrc_keymapdatanfs_renametcp_notifyieee80211_match_bsscd9660_tstamp_conv7ural_free_tx_listffs_dinode1_poolcompat_35_sys_statrandomattachpfi_ifhead_RB_NEXTsys_sstkdb_print_positionnfs_lookuprtflushclonedb_radixgetblkmouse_pastenfs_readdead_vnodeop_psystrace_prepinjectsppp_flushdl10019_stop_cardmouse_copy_endxscale_cache_flushD_rngmaxsmapaltq_inputwdc_ata_bioip6_mcast_pmtumfs_vfsopssoconnectural_initwskbd_repeatnfs_writevtypesswap_encrypt_initializednobufferscompat_43_sys_sethostnamedata_abort_handler_addressrtrequest1__lshrdi3db_find_watchpointusbd_errstrktremulpf_pool_limitsnfsd_waitingtcp_identtcp_rst_ppslimrtrequestxfs_lockifinitcd_load_tocunpst_recvspaceshminfoquotaoff_vnoderpc_callzlib_versionne_pcmcia_attachkue_initxscale_cache_purgeIDfree_inodedepraw_inputcd9660_reclaimkue_ioctlnfs_nhinitfilt_logrdetachpfattachnd6_ifattachunpdg_recvspaceoutswm8pipe_closeaudio_draintrunk_port_lladdrcd9660_inactivedesireddquotsoftdep_mountmsdosfs_rmdiruvm_km_getpagemsdosfs_fsynccfdataufsdirhash_endusefulportal_printffswi_usb_tx_lockusbd_do_request_async_cbufs_checkpathesp_enablesppp_paramscdcef_rxeofpmap_pte_init_xscalepfxlist_onlink_checkbstp_update_rolesdb_elf_lookupinittodrpfi_ifhead_RB_REMOVEm_tag_findblf_encadler32vputpte_l1_s_cache_mode_ptvector_page_setprottcbhashsizecd9660_setattrfilt_hotplugrdetachuark_activateusbd_get_configflash_chip_resetufs_quota_initz_freekqread_filtopspf_pooladdr_plusbd_setup_pipexscale_setttbvndlockaudio_closexscale_cache_cleanIDaue_csr_read_1pcmcia_check_cis_quirksxfs_is_xfs_devcryptowriteieee80211_beacon_allocatu_attachubsa_get_statusbioopssltioctlcpu_classesbpf_setdltpf_cache_treeipprintfsmsdosfs_statfslboltpipe_initusbd_open_pipe_intrsyncerprocpcmcia_card_gettypesemseqspxa2x0_clkman_iohxfs_vgetufs_ihashinsin_setpeeraddrccdbufsizeofwdcactivateeephymatchinphymatchatu_taskpxa2x0_a4x_bs_tagwindow_inflatedb_readlinepf_rollback_altqwsdisplay_delscreenether_ifdetachvop_fsync_vp_offsetsuhidev_get_report_descuserconf_histcurrndstatspfsync_clone_destroynfs_bwritemsdosfs_inactivepf_add_thresholdxfs_open_commoncurrent_intr_depthpanicstrwsdisplay_kbdinputaudioioctlupl_newbufumass_scsi_cbscsi_delayext2fs_sync_vnodepppintrunpdg_sendspacesession0viscpyptmattachsystrace_answerpf_step_out_of_anchorwsmouse_do_ioctlxfs_mkdir_commonespstatsppp_ipcp_tlssys_msgsndhw_vercopyin__umodsi3comparamural_stopudav_sendsppp_up_eventcd9660_defattrpxadmac_cauaudio_round_blocksizealtq_addohci_device_bulk_closeusl_detachackrtalloc1rmc_dequeue_nextbs_notimpl_bs_sm_8uao_swhash_elt_poolxfs_message_gc_nodesufs_ihashgetdes_set_odd_parityencode_comp_tne2000_read_hdrsigacts0findblkmajorpager_mapntohlbmsafemap_lookupsorflushugen_caiophy_funcsusbf_create_threadlcd_matchttioctlarpintrqvprintfslpqueohci_root_ctrl_methodsttycharsxfs_advlocktdb_hashstatssyncdelaywi_usb_infofrmugenreadnmeaopenffs_mountwsmux_mux_closeext2fs_specop_entriesuaudio_chan_rtransfericmp6errppslimSHA512_Update_intbadaddr_read_2usb_desc_iter_initusb_neventspool_inactive_timelinear8_to_linear16_bepf_state_tree_lan_ext_RB_REMOVEdp8390_mediachangeencattachpxa2x0_i2s_freemconfig_process_deferred_childrenohci_ifcdwsdisplaywritepool_cache_reclaimxscale_cache_purgeID_Ebs_notimpl_bs_sm_2in6_setmaxmtumsdosfs_rootmii_bitbang_sendbitstqphyattachusbd_finishsoftnet_intrhandbpf_getdltlistm_tag_getnfsrv_commitsb_lockpfr_add_tablesudf_unmountohci_root_intr_abortrt_labelscrypto_unregisterupl_watchdogsuid_clearacctresumettwriteatu_initchange_sign16_lecompat_43_sys_recvfromswapdev_vpdp8390_resetvlan_set_promiscah_inituipaq_methodspxa2x0_bs_mapxfs_getnewvnodedead_readusbf_reallocpxapcic_socket_disableufs_pathconffile_pooldb_boot_reboot_cmdohci_timeoutvop_symlink_vp_offsetsunputcendpcmcia_verboseVOP_CREATEprobe_switchcarp_ifdetachzaudio_jackcdce_stopacctsuspendvop_readlink_descrasops_copycharuvm_map_referencespec_ebadfphtree_SPLAYuvscom_get_statusnd6_recalc_reachtm_intervalzaudio_attachpfi_if_comparein_ifinitfifo_closeohci_device_ctrl_closerasops15_makestampwi_pcmcia_activatein_pcbhashlookupapmread_filtopsipcomp4_inputmainbus_bs_mmapgettdbbysrcdstural_writeucom_cleanupnfsrv_initcd9660_vnodeop_opv_descVOP_ABORTOPmfs_vnodeop_pchange_sign16_swap_bytes_leswap_encryptuvscom_set_line_codingsys_acceptnsphyter_statuspxa2x0_pi2c_writeuvm_map_entry_kmem_poolccdclosetrunk_lladdrwi_inquirenfsrv_setattrtcp_rst_ppslim_countukbd_detachcom_pcmcia_enable1if_clone_listsys_futimesccdinitsdgetdisklabelxfs_vfsopswi_do_hostdecryptinternal_commandmalloc_errintvlin_losingsppp_ipcp_tluVOP_SYMLINKcompat_43_sys_sigblockgeteblkusbd_set_interfacewsscreen_detachred_addqcarp_join_multicast6scsibusmatchcrypto_kregistervn_ioctlwi_usb_ctl_lockufsspec_readdb_show_calloutaxe_cdrum_tx_datapipespacefiqvectorohci_alloc_stdip6_sendredirectsshmforkcast_decryptddb_sysctlukphy_caitimerfixudcf_ct_probepxa2x0_apm_attach_subip_stripoptionsaxe_setmultisyn_cache_countulptuseinieee80211_add_xratesxfs_message_sendusbf_errstrnd6_timer_chne_pcmcia_ax88190_set_iobasecpu_resetudav_ticknfs_mounttcp_ctlinputether_multiaddrstart_cleanerxfs_returnzeroffs_blkfreeexit1ohci_detachrum_media_changewsmouse_add_muxxfs_mount_caddrsppp_lcp_tlfbdevvpfreefrag_poolifa_ifwithdstaddrpf_free_statesemu_poolpf_state_expirespim6statmidi_ointrdb_watchpoint_alloctag2tagnameudav_ifmedia_changein6_nigroupscsi_mode_sense_big_pageauth_hash_sha1trunk_rr_detachuihashpf_frag_tree_RB_REMOVEpxaudc_read_epNrijndaelEncrypttcp_keepintvlvop_reallocblks_descflashsizeuvisor_detachvop_remove_desccdwriteufswrite_filtopsttybgconfig_searchflash_cdrum_newstatezts_sampleshandle_workitem_freefragwihap_sta_findusbd_printscoop_set_backlightuvm_km_valloc_prefer_waitsyn_cache_poolcom_pcmcia_prodffs_allocwrite_multi_1aue_tick_taskpf_check_thresholdatapiscsi_cdcpufunc_faultaddressdb_preveephy_funcsinphy_funcsucom_hwiflowbswap32ipsec_exp_first_usecdcef_cdrlphy_serviceusscanner_sensecmd_cbplimit_poolip6_defhlimcarpattachumass_setup_ctrl_transfergre_outputbstp_timer_stopunp_connect2systrace_findpf_testusbd_set_pollingpxa27x_frequency_changepool_prime_pagern_walktreeproc_waitingsys_chownuvm_pagewireufsdirhash_freerasops_putchar_rotatedold_setgroups_funcin6_joingroupsys_munlockhotplugattachuvm_anfreedofilereadvipip_sysctlbs_notimpl_bs_sr_1vn_statfilepfr_detach_tableieee80211_iterate_nodesrw_exit_readwi_intr_enableip6_mrouter_settablefullumct_set_line_stateuhub_exploreupl_txeofxfs_mkdirtcp_maxidlepppallocmclpoolscoopmatchvfs_getcwd_commonset_cpufuncscttyioctlffs_vnodeop_pprocess_write_fpregssys_lstatfilt_rndwritescoop_gpio_pin_ctlnfs_clearcommitpppopenohci_timeout_taskohci_hash_add_tdiso_uiodiripe4_inputurl_activateimport_addresscttyopenpmap_link_l2ptinet6ctlerrmapshmctl1fifo_vnoperatedisknamesmidi_iintrumass_quirksdumploRMD160Updatemsdosfs_mountpf_state_tree_ext_gwy_RB_FINDacphy_funcssppp_set_phaserum_read_multiuvscom_activateexport_credentialsnullcnpollcuvm_km_initbzero_pageffs_sbupdateuslcom_cdudp_sysctludf_rawnametounicodeax88190_mii_bitbang_readsystracef_ioctlbs_notimpl_bs_wm_1sadb_exts_required_outvmmapbsyusb_add_taskurl_int_miibus_readreguserconf_histlendb_list_breakpointspf_begin_rulesusbd_set_protocolnfs_getcacheblksppp_inputnkmempages_minvop_mkdir_descukbd_accessopspxapcic_io_allocusbcloserpc_msgacceptedudav_matchcdce_get_descmrt_ioctlpxauart_matchvector_pagesys_sched_yieldvmspace0scsi_decode_sensettywaitwsmousedevprintuvm_map_setuptcp_syn_cache_sizewdc_default_vtblowid_cdnfsspec_readlcd_set_brightnessetextifa_ifwithnetmemchrohci_device_ctrl_doneqsphy_statussqphyattachpte_l2_s_cache_maskcomp_algo_lzszaudio_capxa2x0_bs_unmapscsi_mode_sense_pageboot_argsvt100_selectattributepxa2x0_i2s_detach_subxfs_get_pagSHA384_Updateumass_scsi_setupproc_pooluplcom_dtraue_intrmainbus_bs_wm_1xfs_abortopudp6_inputttcompatsys_writepfsync_update_tdbswap_key_deletemap_forwmergedb_get_valueural_set_txpreamblesharp_zaurus_C3000_blgeneric_armv4_bs_rr_2xfs_accesssb_maxemul_flags_translateusbd_fill_iface_datacd_set_pa_immedulptopen__bss_end__wsdisplay_maxscreenidxcnstopextent_print_allihashtblnfsrv_writegatherieee80211_set_shortslottimesys_dup2nfs_asynciosppp_pickdb_inst_countdb_read_lineusscanner_cawdc_ioctl_findwsdisplay_switch1wd_get_paramsxfs_devclose_commonsys_readlinkext2fs_sizezaudio_update_volumepxa2x0_i2c_opencpufunc_faultstatusbstp_disable_port__ashrdi3pf_state_tree_id_RB_MINMAXbs_notimpl_bs_mmapohci_intrxscale_cache_flushI_SEwsdisplay_burnpmap_dump_ncpgip6_auto_flowlabelmfs_initpfkeyv2_expireuipaq_calf_splitifafreeVOP_STRATEGYtzucom_rtsxscale_cache_syncIrip_sendspaceudf_sysctlaltq_getqstatsxscale_cache_cleanID_rnguhidev_writeamap_addtcp_freeqif_setgroupattribscom_attach_subrdvd_authsppp_pap_screxphy_servicexfs_dnlc_purge_mptdb_firstuseumass_scsi_cmdscoop_gpio_pin_writecdreadrasops15_initspec_inactivedp8390_stoppf_anchor_global_RB_REMOVESHA512_Initwi_func_usbwsmux_do_ioctlulptioctlsys_sendtoicmperrppslimgeneric_filtopsknote_droptrunk_startuftdi_setcue_watchdogin6_selectsrctrunk_lb_inputsoftclock_siwi_usb_threadxfs_node_findbstp_set_port_tcshmget_existingzkbd_ioctlin6_pcbsetportnfsrv_nullpfi_kif_matchalldevscom_pcmcia_attachpxa2x0_i2c_initdp8390_rintwddumpicmp_do_errorvmcmd_map_readvnpmap_dumpcomconsfrequsbd_get_interface_altindexamap_extendsigpropvmapbufvndencryptaxe_rxstarttrunk_link_activedehashtblsocketopsonewire_bitpxa2x0_i2s_attach_subX_db_sym_numargsnmea_gprmcnd6_maxndoptip6_iduvm_map_clip_startrawcbtablespec_readfiq_nullhandler_endimport_authumodem_cdunp_markacphyattachdes_key_schedcarp_hmac_prepareicmp_mtudisc_timeoutnwsmuxzaudio_getdevskip_char_righta4x_bs_r_1pmap_zero_page_xscalettyread_filtopsdrain_outputusbd_bulk_transfervop_lookup_descdb_map_addrzaudio_query_encodinggetinoquotaflashminphystrunkattachfifo_ebadfscsi_do_ioctlrtable_existswtab_alloccd_resettimedeltapf_altqs_inactivegreattachX_db_forallsemctl1scsi_detach_busxfs_root_commonsystrace_detachudpstatpf_test_state_tcppfi_allpfkeyv2_sysctl_policydumpercsr2cd_read_toccarp_inputural_amrr_updatecdioctlbstp_addr_cmpcue_stopsystrace_policyuvscom_detachifmedia_addatu_usb_requestacctplxtphy_funcsskipjack_zerokeyusbd_set_config_indexsppp_pap_initsppp_chap_inputlogopenufsdirhash_hashbridge_deletesppp_phase_networkbreadntcp_hdrszpf_osfp_pltcbtable__xordi3frag6_draindosdiremptypfr_walktreeidleigmp_slowtimoifpromiscrtl80x9_mediachangepf_state_tree_lan_ext_RB_MINMAXrasops4_putchartbfdebugip6_setpktoptscarp_send_adtrunk_fail_detachfork_returnsys_getsocknamecd9660_lookupnfs_getauthvop_fsync_descwi_usb_intrusbd_alloc_buffermask_rnheadproc_isundernfsd_head_flagsi_headbridgeattachpte_l2_s_protouvm_swpkeyscreatedufs_rootptyttyusb_known_vendorstcp_sysctlVOP_SETATTRusbreadpmap_kremovesigactsinitusbd_set_reportexec_elf32_fixupradioopenowsbm_caxfs_fhopenrt_newaddrmsgvop_generic_lockcomconsiotuvmfault_anongethandle_allocdirect_partdoneconsttywdc_pcmcia_cauvm_pagealloc_stratpf_test_udpural_bbp_readusermountext2fs_dirrewrite__ucmpdi2bridge_ioctlvn_closefileumass_discovfs_free_netcredpool_cache_do_invalidateip_mtudiscmld6_start_listeningtcp_signature_tdb_initcpu_mainbus_cakue_matchpmap_kenter_papidhashtblaue_matchusbd_get_protocoltcp_drainpmap_l2dtable_ctorm_pullupbpendtsleepenterpgrpwdc_pcmcia_lookupxscale_tlb_flushID_SEpagedep_in_progressnull_zerokeycrypto_freesessionMPFailwsemul_vt100_output_string_escpxa2x0_rtc_getalarmpause_timercnbellpf_find_anchorm_copydatainswm8umass_atapiscsi_devwdc_atapi_timer_handlerwsscreen_attach_syncowtemp_caatu_stopzflash_reg8_readcd_setchanuaudio_value2bsduvm_cnt_headmtx_leavepxa2x0_i2s_allocmfilt_signalsigactsfreewdc_default_write_raw_multi_4uaudio_feature_namefilt_tunrdetachttymallocupl_attachums_intrrasops_copyrows_rotatedwsdisplaykqfilterbs_notimpl_bs_sm_4kue_setmultizapm_acintrmmioctldb_nextumass_matchsendsigohci_device_ctrl_methodsbpf_ifnameohci_cdural_ioctlvfs_busylkm_listmouse_copy_extend_afterfilt_ufsdetachvlan_ether_delmultilf_getlocksolistenwskbd_compose_valuepf_anchor_global_RB_REMOVE_COLORusl_attachackip_ecn_ingressmsdosfs_bmapfifo_bmapaltqs_inactive_openrip_ctloutputffs_vtblif_getgroupsystrace_findpidipmobile_sysctluserconf_morekqueue_ioctlmax_processesportal_reclaimsys_wait4rip6_recvspaceamap_share_protectusb_all_tasksfs_sysctlukbd_cnattachpxaost_matchieee80211_ibss_mergeboot_filefilt_sordetachflash_chip_write_blockpsignalwsdisplay_console_confnfs_getattrieee80211_regdomain_compare_cnconfig_pending_incrsys_osigaltstackusb_task_threadamap_pp_establiship_mobile_allowatu_activateuvm_anon_initffs_reclaimbmtphy_causb_free_devicezaudio_get_portdqfreelistsysctl_sysvipcxscale_cpufuncsif_link_state_changelcd_max_brightnesspmap_virtual_spacepage0_endusb_disconnect_portbpfpollnumemptybufspfr_route_kentryupdatepriohci_activatepf_anchor_global_RB_MINMAXbmtphy_serviceptcwakeupumidi_search_quirkulinear8_to_linear16_be_mtsuhid_cdwskbd_cnbellnfs_printcompat_35_sys_fhstatruntimettcompatgetflagsvt100_decmodeuvm_doswapencryptpf_default_ruleucycom_cdoutswwi_seekfilt_soreadpmap_remove_allrtable_addzeropagenfsrvw_coalesceipsec_def_encpool_logsizesoftintr_establishpxaudc_detachip4_input6pfr_ktable_comparepdevinit__iordi3nsphytermatchinetctlerrmapffs_specop_opv_descresetpriorityau_set_portusbf_device_descriptorrasops4_putchar16enoioctlwi_usb_start_threadudf_mountsigacts_poolexecsigsmachclk_freqpfkeyv2_getconfig_initcpufunc_null_fixupgif_outputencstarticmp6_redirect_inputkrpc_portmaprw_enteraue_read_maccarp_join_multicastsppp_down_eventmixer_ioctldb_access_abt_sppfr_ktablehead_RB_NEXTscsistrategynd6_ra_inputffs1_blkprefin6addr_loopbackttypendvprintin6addr_linklocal_allroutersuvm_swap_freepagesreserve_spitunpollpfi_buffer_cntqsphymatchin_revarpinputstrlcpyieee80211_wep_cryptcompat_43_sys_sigsetmaskX_db_symbol_valuesumodem_setusbd_reload_device_descext2fs_advlockknote_fdclosesppp_keepaliveif_clone_detachpipe_rfiltopspfr_maskubsa_openin6_cksumcomcninitstrncmppf_state_plvfs_opv_numopsxfs_outqdes1_decryptvfs_shutdowngetsockbs_notimpl_bs_c_4upl_startmouse_hidezssp_matchin_interfacessyn_cache_respondif_creategrouppxa2x0_gpio_set_dirllinfo_nd6sbcheckreserveuvm_iopreemptmfs_printieee80211_begin_scanunixdomaindb_next_free_breakpointuvm_tree_RB_REMOVEscsibusattachetheripstatumct_rtssystrace_replaceaudiowritesysctl_sysvshmpf_unlink_statensgphy_cdsyn_hash1ulminwihap_data_inputpxa2x0_lcd_free_screenmsginitdb_last_symtabproc0paddrrn_addmaskuow_ow_resetudf_quotactlusb_attachbpf_bufsizeselscanpxa2x0_do_pendingsoo_poll_randseedumodem_activateulpt_attachnfsrv_nooprtafidx_maxsig_filtopsohci_device_bulk_transferukbd_cdzkbd_accessopspxaip_scwskbdopenpfi_clr_istatspxa27x_fastbus_run_modettclosurl_rxeofpfkeyv2_acquireipsec_soft_allocationsscsi_task_bus_dmamem_mapbridge_addrulesppp_lcp_opt_namenet_sysctlcom_cdsystracef_writeusbf_devinfo_freeuaudio_identify_acpfi_address_addxscale_cache_cleanD_Ewskbd_do_ioctldead_ioctlpppasyncrelinqfill_eprocaue_initusb_match__wdccommand_startufs_dirhashchecksysctl_iflistrasops_alloc_mattrvwakeupsystracef_kqfiltersl_compress_tcpif_clonerswdcbit_bucketnfs_kqinitvgonewdc_probe_capspmap_initializedtcp6_ctlinputdb_stack_trace_cmdusb_allocmemufsspec_closeucycom_intrne2000devsnd6_prefix_offlinkuvm_anon_dropswapccd_need_kvmdl10019_mii_bitbang_readwi_detachucycom_methodsucom_lockigmp_inputvop_ioctl_vp_offsetskmemusagezapm_suspendnfsm_mbuftouioswcr_sesnumlf_getblockucycom_causbd_add_dev_eventumodem_attachtcp_rttdfltcleanerprocportal_pollfifo_reclaimsbappendstreamm_tag_copy_chainucycom_paramusbd_intr_transfer_cbsppp_ipcp_RCRusb_event_threadsowrite_filtopsstrncpycseaddrevarp_in_progressdb_disasmsdreadicmp6errratelimsys_opipelinear16_to_ulinear8_leupdatefatscue_memata_perrorvfs_getvfsaue_txeofffs_sync_vnodeproc_stopvfs_vnode_printdb_history_lastusbd_set_port_featurebpfilter_createsysctl_lockax88190_mii_writeregcdrestartlockfpoolwihap_disassoc_reqrasops_copycols_rotatedaudioread_filtopscpu_switchtoufsdirhash_listieee80211_find_nodeucom_cahtonluvm_km_kmemallocusb_find_descin6_mask2lenvndioctlrmc_initmrt6_ioctltcp_dooptionsdos2unixtimesys_sigactiondeupdatpow_wsl_clonerzapm_get_event__negdi2in6_purgeaddrtunioctlcpu_modelsystraceclosearm_dcache_align_maskuvm_tree_RB_FINDcttyreadcd9660_unlocksppp_to_eventuserconf_cmdsural_taskwsdisplaycloserpc_replylkmcloseiophy_statusschedclockrum_cabpfioctlconfig_attachohci_alloc_sitdcue_rx_list_initzrc_matchxfs_dnlc_enteripsp_addresszaurus_battery_life_c3000pxa2x0_bs_tagpf_state_tree_ext_gwy_RB_NEXTdl10019_init_cardbmtphy_statustdb_timeoutsysctl_filesys_semopdisk_unbusyugen_detachsoisconnectedurlphydebugsystrace_msg_resultamap_clean_worksukbd_trtabin_gif_inputusb_block_freememetherip_sysctlVOP_PATHCONFumass_fixup_sonydk_mountrootdb_run_modewsscreen_detach_syncauth_hash_key_md5xscale_cpwaitmfs_strategyppp_restartvattr_nullsys_getsockoptumct_paramuhidev_attachfrag6_nfragpacketspxapcic_pcmcia_functionstdb_initvlan_unconfigdb_linewildcardin6_restoremkludgeuvm_anon_lockloanpgvfs_sysctlcpu_get_controlVOP_READLINKumass_cbi_methodspxa2x0_intr_bootstrapdb_ed_stylezflash_oob_set_lognoufs_seekshm_find_segment_by_shmidnsphyter_funcsmii_submatchktrpsiguvmexp_printohci_root_intr_transferwsdisplay_unset_cons_kbdmsdosfs_pathconftimeout_wheelpxa2x0_setsoftintrbpf_m_xhalfaverunnablecd9660_getattrflash_wait_readyttyfreecom_pcmcia_matchttysleeplcd_cddp8390_initatu_get_opmodecarp_setrunzapm_bcintrunp_disposescsi_inquireufs_getattrBlowfish_encipherieee80211_mhz2ieeevfs_exportuplcom_closeuvm_km_pgremovesoftdep_disk_io_initiationpf_state_tree_ext_gwy_RB_MINMAXpfkeyv2_sysctlex_region_plpfr_ktablehead_RB_REMOVEpf_anchorsfscalenewallocindirccdmapbridge_hashpxaudc_disableip_optcopypf_altqscarp_setroutevfs_registerieee80211_proto_attachsys_dupulinear8_to_alawmcllowatmii_printbpfilterattachowid_caenc_xform_skipjacktimeout_todoswcr_initdb_lccpu_read_cache_configrasops8_putchar8wsemul_vt100_scrollupsppp_cisco_inputudf_checkexpzkbdsleeptvpanicget_pc_str_offsetL_cksumdataural_rxeofcue_rxeofsppp_ipcp_tldmsdosfs_lockseltruewsdisplay_console_devicebpf_m_xwordsoftdep_initializeipsp_skipcrypto_markncvhashtblunp_shutdownstackgap_allocwi_resetext2fs_sysctlmark_ecngeneric_bs_wm_4gif_startcluster_callbackkthread_run_deferred_queuepfsync_bulkfailvop_lock_vp_offsetspf_tagsnmea_date_to_nanopxa2x0_gpio_bootstrapwdreadlastdaycheck_execdb_max_linewi_usb_cdtcp_initsystrace_execve0pcmcia_attachpte_l2_s_cache_mode_ptdeferred_config_queuedp8390_getmcafucomreadcbipport_lastautoptmpolludf_unlockwsmux_detach_scnum_on_worklistcd9660_fifoop_entriescom_raisedtruslcom_activateuaudio_chan_opennnfs_init_headpppgetmdb_last_commandpxaudc_bus_methodspfsync_clone_createicsphy_statuswinSlotCntvn_kqfilterfiq_getregsext2fs_syncproc_waiting_timeoutpte_l2_s_prot_maskcryptoreadudav_ioctlcrypto_registercache_purgevfspostsigsys_pathconfcue_open_pipespxapcic_mem_allocsppp_lcp_RCN_nakgetmicrotimein_addmultibs_notimpl_bs_rm_8zssp_cdmaxrasops_reconfigumass_clear_endpoint_stallzflashdetachbridge_ifdetachsppp_outputipsp_acquire_saohci_setup_isocaue_newbufscsi_probedevaxe_ax88178_inittcp_template_flashstartnfs_commitmsdosfs_readdb_object_print_cmdohci_initcomopenusbd_setup_xferesp6_inputieee80211_tree_RB_MINMAXbcopywsmouseclosewdog_autourl_tick_taskrum_amrr_startxfs_remove_nodealtq_lookupcue_detachusbioctl_bus_dma_inrangekqueue_wakeupip6_unknown_opttcp_reasssys_getfhext2fs_vgetrt_timer_timerrtbl_id_maxcomcnputcKERNEL_BASE_physxfs_unmount_commonSHA1Update_intwsemul_vt100_output_scs94cuio_applyscoop_cageneric_bs_rr_1axe_resetlcd_get_backlightdefrouter_addreqin6_clearscopesppp_nullfifo_vnodeop_entriesusbd_set_addressflashsafestrategyaudio_free_ringne2000_readmemscoop_cdudav_openpipesffs_setblockipsec_expire_acquirekue_stopwsscreen_switchwaitatu_send_commandinflateResetmemcmpwskbd_init_keymapudf_lockumct_dtrmsdosfs_createcd9660_startdb_output_linezkbd_hingepxa2x0_dma_to_fifocomstartpool_allocator_kmemdb_examinepf_rollback_rulescfroots_sizedb_end_linetickadjvop_rmdir_vp_offsetspfsync_get_mbufpf_init_rulesetpf_rule_plpfi_kif_refsbreserveundefined_initvrecycleubsa_matchhandle_workitem_freefilein_pcbnotifymissextent_printaudio_caieee80211_alloc_nodeblf_ecb_decryptcrcopydb_symformatural_newstateuslcom_attachwdcloseundefined_handlerssys_revokeusbf_get_xfer_statusural_free_rx_liststat_direct_blk_ptrssysctl_stringsys_rebootcompat_43_sys_lseekpfsync_timeoutpmap_dump_alltrunk_capabilitiesbufpooldl10019_mii_bitbang_writeMCFailwdccommandext_bus_dmamap_load_buffercpu_forkcompat_43_sys_getpagesizeumidi_activatebstp_received_rstpaudioopenpfr_add_addrswi_write_data_iodb_print_ifattylistwdopenflush_inodedep_depsuvm_vslockcast5_setkeyxformswNXFORMSWdeflateResetpf_osfp_validate__bin2bcdttyoutputkue_causbf_cacd9660_tstamp_conv17vndbufplwskbd_calxtphy_statusuftdi_8u232am_getratetqphy_cdpxa2x0_wakeup_configcarp_set_ifpsemundo_clearwdc_atapi_intr_completecryptodev_cbudf_lookupumodem_detachpcmcia_scan_cispxa2x0_memctl_iohclockintrrn_mkfreelistbstp_timer_latchvop_bwrite_descvndreadVOP_READpfclosein6ifa_ifpforlinklocalufs_ioctlffs_freefilelastdtimenfs_sndunlocksys_setuid_wdc_ata_bio_startstart_updateudav_cdusbd_clear_port_featureufs_quota_free_blocks2senditbridge_spansppp_lcp_tldlcd_bpp16_screencluster_writecompat_43_sys_waitrnd_event_tailusbf_add_endpointpxa2x0_i2c_write_2uriopolluvm_setpagesizenfsrv_zapsockipsec_update_policytcp_xmit_timerucomwritein6_recoverscopemfs_badopufs_dirhashmemnfs_nullskipjack_encryptnsphy_serviceaue_tickpxa2x0_gpio_get_bitcompat_43_sys_fstatpf_cache_plbridge_ifenqueuetickmclpool_warnmsgdb_termpflog_packetscsi_preventmmclosenumfreepagescd9660_accessffs_statfsxdr_inaddr_encodecompat_35_sys_lstatrijndael_set_keywdcprobeiophy_cdxfs_symlinkudp_recvspacewdc_ioctl_strategyuaudio_caa4x_bs_w_1udf_fhtovpbus_space_copy_1syn_cache_unreachuserconf_histszsys_getrlimitbpf_attachdicmp6_ctloutputsppp_qflushulpt_statusstuck_keysbridge_rtfindufs_dirremoveahctl_varsnumvndumct_setpxagpio_reg_writecinitrum_amrr_timeoutif_attachsetuppipe_writevop_symlink_desccryptof_pollstat_sync_limit_hitsbappendin_pcblookup_listenrmc_queue_packetpfr_remove_kentriesm_copybackipcomp_enableuvm_swap_puticmpbmcastechogre_allowfifo_advlockesp_zeroizeevcnt_attachSHA512_Updatedb_continue_cmdcarp_hmac_prepare_ctxcarp_ouretheruslcom_breakurio_activateufsdirhash_lookupsoftdep_errortcp_signature_applyprocess_write_regsconfig_scantun_ioctlwi_get_nwkeypxa2x0_gpio_clear_bitnuidhash_maxfilt_ptcwdetachpmap_copy_page_funcsppp_cp_type_namepxa2x0_lcd_attach_subscsi_runningripsrcshminitiso_nchstatskue_txeofnfsm_srvwccugenkqfilterural_amrr_startscsidebug_targetsnlineswflashclosedb_restart_at_pcdb_sstep_printpf_test_icmpohci_rem_edether_ifattachusbd_devinfo_alloctunwriteinflateSync__wdccommand_doneumass_adjust_transferbridge_rtlookupsignal_initnsphyter_serviceptyioctlffs_updatedb_print_formatwsmuxclosenfs_checkexpdp8390_getpxa2x0_i2s_openpxaudc_is_deviceclear_inodedepsunix2dosfnspec_advlockmtdphy_cdmax1111_adc_valuefragtblraw_sendspacepfsyncifubsa_cauvscom_breakxfs_pathconfnulloppf_find_fragmentpfr_copyout_addrbw_meter_chip6_ecn_ingresssystrace_insert_processusb_discoversackhl_pooltrunk_watchdogencioctlsppp_dotted_quadcomdiagextralocunsleepwdprobeX_db_lookupmtdphy_funcsuipaq_setblf_encrypttdb_allocohci_alloc_std_chainipintrsppp_ipcp_closegetnanouptimeudav_activatedes3_encryptmaxdmapaltq_removeural_alloc_rx_listusb_block_allocmemmainbus_bs_w_1pfkeyv2_flush_walkerext2fs_symlinkdb_skip_to_eolinverse_charip6_savecontrolbridge_blocknonipau_check_portsudcf_mg_intrxfs_mount_common_sysq_to_bpfkeyv2_initsoftdep_process_worklistmountrootpf_tbladdr_removenfsrv_setcredsyn_cache_resetdb_inputcharuhidev_openudf_vnodeop_entriesdb_boot_cmdsundefined_entryip_initreaddemsgctl1process_read_fpregsohci_freexural_txtimecd9660_rrip_getnameufs_check_exportdes_encryptsysctl_rdintpf_cent_plcd_interpret_senseural_eeprom_readusscanner_detachpxagpio_matchlodirtypagesumct_get_statusfindwin95sys_nanosleepVOP_WRITEusbf_free_buffertcp_update_sack_listcompat_43_sys_getkerninfostart_init_execputtdbpf_state_tree_lan_ext_RB_INSERTatu_detachsppp_ipcp_upifa_ifwithaddrpf_match_uidclock_ymdhms_to_secsprocess_checkiopermstat_indir_blk_ptrsdb_write_cmdif_clone_attachuplcom_get_statuswsmoused_releasesys_getfsstatohci_abort_xferbpfopencom_pcmcia_detachcdstrategyxfs_pushdirtynfsrvhashtblvlan_configkmemstatsnd6_slowtimo_chuvm_km_valloc_alignenc_xform_nullrum_set_bssidipsp_reffreedb_max_widthmntvnode_slockowsbm_cdfilt_audiordetachmalloc_printitulptwritenv2tov_typenfsd_headcomwriteuvscom_intrusl_attachtimeoutmouse_copy_selectionipsec_policy_headsppp_pap_tluVOP_RENAMEcdclosecast5_zerokeysys_fchdirgreen_onsysctl_ifqalleventspxapcic_mem_freerandompidwd_cdurl_initusl_detachprocusbf_open_pipe_ivalzrc_inputportal_getattrfilt_ttyrdetachsys_ktracearp_inuseuhidwrite_bus_dmamap_destroyvn_pollinet6swrouteswencap_findgwifadosdirtemplateslattachmainbus_cdspec_nfsv2nodeop_entriesdb_uvmexp_print_cmduaudio_query_encodingflash_chip_verify_blockpxa2x0_lcd_cnattachvlan_tagmasksys_mincorene2000_test_memapm_power_printipcomp4_input_cbieee80211_tree_RB_REMOVEuaudio_add_processingrasops8_putcharlastsecondswdog_timeoutuaudio_signextwsmousedoopenwi_get_txpowerural_plcp_signaludav_stopip_mrouter_doneusbd_error_strsusbd_sync_transferaudioactivateffs_vnodeop_entriescdcef_caamphymatchscoop_set_headphonepxapcic_intrtcp_maxpersistidleudav_tx_list_initspec_ioctlzkbd_set_ledsnewblk_lookupufs_initsync_vnodeop_entriesproc_reparentpf_osfp_geta4x_bs_r_4uvm_exitcompat_43_sys_sendfc_bmapcallspr_rmpagepfr_ktablehead_RB_FINDffs_initbridge_filtersppp_chap_tlunfssvc_sockhead_flagcluster_wbuildflashioctlpxa2x0_gpio_clear_intrbootsyncuvm_initcdcef_matchaue_attachieee80211_crypto_attachsys_ioctlusbf_clear_endpoint_featurenfs_renameitsys_xfspioctlif_free_sadlktrsyscalldb_dotucomstopquotaon_vnodeieee80211_node_joinfilt_bpfrdetachwsdisplay_emul_capxa2x0_clkman_configrum_update_slotudf_startumodem_openicmp6_initrasops15_putchar16disassemblebs_notimpl_bs_rm_1filt_ttywritepool_update_curpagehid_end_parsepxa2x0_gpio_intr_unmaskin_setsockaddrptccloserandom_statepfi_dynaddr_updatenfs_advlockbpf_moveinacct_procwsemul_vt100_output_esc_spcostypevndbuf_poollastpiduplcom_resetuvm_page_physloadaudiogetinforeset_entryucomstartptswritewdc_exec_xferwdcresetsensor_task_createipintrqohci_noopipcpermgre_clone_destroyccd_softcudsbr_statussoftdep_workitem_pendingvlan_ioctlpfi_attach_ifgroupmaxprocusbf_add_stringusb_frag_freelistpxapcic_intr_disestabliship_slowtimouaudio_add_inputpagedep_hashtblnfs_setattrrijndaelKeySetupEncubsa_rtsip6_nexthdrrtdeletemsgumidi_cd__bss_startqsync_vnodekue_rxeofpf_get_ruleset_numbershm_nusedrasops4_putchar12rpc_mismatchrijndael128_encryptVOP_KQFILTERpf_calc_skip_stepsukphy_funcssys_msyncvop_rmdir_descallocdirect_mergedeflate_compresswskbdreadsbappendrecordevcount_detachsd_causcanner_seltrue_filtopspcmcia_function_disablepf_change_aptrunk_lb_port_createpxa2x0_dma_from_fifoxfs_islockedsoftdep_fsync_mountdevinitmsgbufrum_select_antennawsmouse_attachtcp_signature_tdb_zeroizeuipaq_dtrxfs_symlink_commonconfig_activatememsetsema_initcuio_copydataptsstoppipe_free_kmempxa2x0_splxxfs_message_versionufs_getlbnsohci_strphysiopcmcia_3cxem556_func0_cfe0nfs_realign_testin6_selecthlimonewire_searchupl_sendwdattachdb_symbol_is_ambiguoustrunk_fail_startmii_phy_delete_mediausbd_set_report_asyncpxauart_attachnfs_cltpsockcrypto_kdispatchicmp_mtudisc_clonesppp_print_bytesclass_cmp_spllowersodisconnectpool_allocator_oldnointrumct_closesys_setgroupsmainaue_csr_write_2udcf_probelxtphy971_funcsthreads_pendingucomttynfs_vfs_initprocess_sstepohci_device_bulk_doneusbd_initmtdphymatchpf_anchor_setupcarp_ioctlpf_remove_fragmentrasops_init_devcmapuplcom_openipsec_acquire_headktrgeniopfr_clstats_ktablepfr_insert_ktablesural_set_basicratesip_flushmidipollkue_startdp8390_configrasops_mapcharnfsspec_closeaudio_polluvm_unmap_removetickdelayowsbm_activatepmap_alloc_l1zflashattachinpcb_pool_initalizeddb_hangmanicmp_errorukbd_delayed_decodewsmuxdevsusbf_transfer_completepxagpio_attachbs_notimpl_bs_sm_1xfs_access_commonupl_rx_list_inituvm_swap_markbaddes_set_keykqueueopsaudio_pintpf_addrcpyvholdubsa_parityurio_detachdb_help_cmdrt_if_removewdc_atapi_in_data_phasesystrace_wakeupusbd_no_quirksl_clone_createuipaq_matchmidiopenm_adjalaw_to_ulinear8mld6_stop_listeningflash_chip_erase_blockhotplugioctlpmap_map_chunkppsratechecksys_ptracescsi_free_xsbridge_rtagenodekmemlimitcompat_43_sys_setrlimitbstp_decode_bpdufilt_tunwritelcd_powergre_softc_listamap_copyphysical_enduvm_rb_spacenew_xfs_nodeuhidpollieee80211_ieee2mhzieee80211_dup_bsssysctl_kmemlocklf_findoverlapcarp_proto_inputlf_wakelockdoclusterrazdb_sym_numargskue_attachhookdumpconfwi_rxeofskipjack_forwardssys_shmatpf_match_addruslcom_cafilt_rndwdetachwsdisplay_cons_kbd_pollcdead_badoppxaudc_is_hostcom_pcmcia_cacalcrusys_unlinkblf_cbc_decryptdb_cmd_listmainbusmatchrt_setgateulpt_activatedqrefsema_gettcp_ack_on_pushtrunk_port_createpmap_growkernelext2fs_rmdirsysctl_intuslcom_detachupl_tx_list_initkqueue_closewsdisplaystoppte_l2_s_cache_modepfr_clr_addrsstrlcatifnet_addrssysctl_int_arrulinear8_to_mulawau_set_gainbs_notimpl_bs_wm_8cdce_matchumidi_quirklistsoftintr_dispatchdisk_unlockpf_test_tcpufs_ihashrempf_map_addronewire_activatewsdisplay_usl_ioctl2cttywrite_bus_dmamap_createurl_stop_tasksdmatchusb_freememudav_txeofpool_chk_pageproc0ccdopencdce_initufs_renamesppp_lcp_initaxe_cauaudio_chan_pintrext2gennumberudav_attachusbd_get_hid_descriptorrt_ifannouncemsgsoo_readcompat_35_sys_shmctlscoop_resumeufs_opencopyout_statfspmap_modify_pvonewire_lockbstp_set_port_statepfr_ffaddrxfs_message_installnodem_catsplxpxa2x0_rtc_setalarmrtinittqphy_statustrunk_lb_startcluster_collectbufsowsbm_detachonewire_createthreadwi_write_data_usbumass_scsi_minphysuvm_swap_inituaudio_chan_alloc_buffersuaudio_add_featurepxagpio_intr0tcp_nowttystatsaue_miibus_statchgdb_trace_until_matching_cmdproc_printitpfi_match_addrural_bbp_initdes1_setkeyunp_gcsys_clock_gettimeflashgetdefaultlabelcsefreeip6_hdrnestlimitpool_catchupxscale_cache_syncI_rngfrag6_initpf_enable_altqbuf_replacevnodemsdosfs_vnodeop_opv_desclba2msfflash_chip_enablevlan_ifdetachtimeout_settrunk_list__subdi3pfi_kif_updatewsdisplay_resetpf_state_tree_id_RB_FINDntohsmsgbuf_putcharudcf_sl_probe_bus_dmamem_freezaudio_matchinet_ntoadb_boot_poweroff_cmdsd_flushcd_setvolext2fs_mkdirohci_openext2fs_direntermii_pollstatrlphy_cawdgetdisklabelpfkey_registerrw_exitdupfdopenchange_sign16_bexfs_attr_validnfsrvlruheadifmedia_list_addpidhashvfs_mountrootcdcef_encappfr_lookup_addrtree_src_trackingpxaohci_detachxscale_context_switchuvm_totalsppp_lcp_TOencdebugpfr_table_countdb_unread_chartimedl10019_mii_bitbang_opsstat_worklist_pushwskbd_rawinputstart_initelf32_olf_check_headeruhub_attachtcp_mssdfltuvm_swap_freetcp_rndiss_sboxatu_newbufwdc_atapi_update_statusdata_abort_handlerxfs_lookupudf_hashlookupusbf_setup_xferpfi_unmaskbs_notimpl_bs_r_1axe_initrnd_wseldb_look_charowid_detachuow_resetuhidev_set_reportin_pcbdetachmsdosfs_vfsopspf_state_tree_id_RB_REMOVEaue_ifmedia_updradiodetachcd_sizettycheckoutqread_multi_1icmp6_mtudisc_callback_registerdb_set_variableuvscom_set_linene_pcmcia_detachaue_carnd_event_spacezaudio_set_paramspmap_clear_referencert_getmetricswdc_ata_bio_kill_xferbstp_pdu_flagsin6_ifdetachdb_search_symbolcn_tabwdc_atapi_intr_commandvndstartfree_all_xfs_nodesip_forwardppp_compressorsextent_createflash_reg8_read_pagebstp_timer_startbpf_freeddisklistslinear16_to_alaw_leswap_bytes_change_sign16_bexfs_revokeallocindir_poolsys_fstatfspfsync_tdb_timeoutpfr_ina_rollbackpfsync_inputurl_txeofkue_devsbs_notimpl_bs_sr_8m_injectudav_setmultiip6_mforwardingnd6_setdefaultifaceffs_isfreeblockccdioctlufsdirhash_uninituvm_map_lookup_entryxfs_fhlookuphztoicsphymatchBlowfish_expandstatevop_pathconf_descbs_notimpl_bs_w_4m_pullup2dead_strategyswi_handlervif_deleteusbf_new_devicerum_txeofktrcswspec_fsyncpriq_pfattach__wdcwait_resetcom_pxaip_caip6_optlenportal_unmountflash_pxaip_cauvm_map_deallocateicmp_reflectpf_anchor_node_RB_MINMAXzkbd_attachmii_phy_activateext2fs_reclaimffs_ballocsys_getgroupsurio_cdieee80211_node_attachuhub_cduvm_km_pages_freesystracef_pollwi_start_usbgeneric_bs_wm_1pfkeyv2_createip6_raw_ctloutputsoftdep_setup_allocdirectpf_rtlabel_removekernel_textufs_startlkminitohci_devd__end__kinfo_vdebugnsphy_reseturl_sendcdce_encapuvm_rb_insertufs_bmaparrayfragtbl8nfsv2_typepfioctluvn_sync_lockpcmcia_function_enableaes_ctr_setkeyumct_attachpf_mv_poolurl_resetwdc_get_logusb_needs_exploreufs_quota_alloc_blocks2bstp_transmitfc_fileextendsexport_lifetimefilt_sigattachwsmouse_cdVOP_FSYNCffs_sysctlipport_hilastautoarpinit_donedoclockintrspec_closecd9660_closepxaost_cauark_get_statussys_shutdowncngetcpfsync_alloc_scrub_memorypfi_instance_addzkbd_cdxfs_readlinkrnd_statesm_gethdrbstp_attachrum_cdugen_activatebridge_inputconfig_rootfoundcue_cdputcieee80211_phymode_namesysctl_rdstruct__divsi3uhidev_cdumass_scsi_devwsmousereadxscale_minidata_clean_sizeschedcpusematprintf_closeurlphy_servicesbappendcontrolukbd_set_ledswsdisplay_screenstatea4x_bs_rm_1nfs_lookitupwihap_sta_timeoutugenread_intr_filtopssoftdep_flushfilespf_frag_tree_RB_INSERT_COLORdb_access_und_spipv4_inputm_getclrpool_headcompat_43_sys_quotaptsopenax88190_mediastatususl_sync_initwsmuxioctlnfs_in_tobecommitted_rangesysctl_ptywdc_atapi_send_cmdusbd_interface2device_handleapm_matchpxa2x0_i2s_initpf_tag_refipforwardingieee80211_get_cts_to_selfdb_lexohci_device_isoc_transferusbd_open_pipe_ivalaudio_calc_blksizebufhashtblpxa2x0_wakeup_statussyn_cache_lookuparc4random_stateprtactiveaudio_mmapksym_upcaseufs_makeinoderasops_copyrowsip6_process_hopoptsxfs_message_updatefidufsfifo_readusbd_find_edescsystrace_lckwsdisplay_set_cons_kbdpfkeyv2_sendmessagefifo_writefilt_ttyreadsys_getpgidcom_common_putccache_lookupaudio_clearred_allocin6_purgeifrijndaelKeySetupDecfree_msghdrsdb_boot_crash_cmdbstp_migrate_delay_expirysystrace_forkurl_detachbs_notimpl_bs_rr_1umass_scsi_sense_cbnewdirremrijndael_encryptdp8390_intrrasops_do_cursorpf_state_tree_id_RB_REMOVE_COLORwsemul_vt100_handle_dcsin6_ifawithifpieee80211_recv_mgmtpf_altq_plaxe_detachwskbd_set_console_displaydumpsizepppoutputccdstrategyukbd_keydesctabirda_onxfs_write_commontunattachusscanner_devpppstartextent_freeuvm_aiodone_daemonusb_cookie_noaddupc_tasksched_syncusbd_clear_hub_featuresc_err1db_mount_print_cmdcomclosepcmcia_print_cisnewblk_hashtdb_add_inpudcf_ct_intrsetsigvecmountnfssys_sendmsguhidopenbridge_rtdaddrvn_marktextsppp_isemptystrcmppf_print_hosttrunk_lb_port_destroysys_quotactluhidev_matchvop_close_vp_offsetstrunk_clonerrndread_filtopstcp_mtudisc_increaseulmaxatu_txeofin6_pcbconnectdehashsystrace_msg_policyfreekue_cdcarp_ether_purgemultihook_disestablishexphy_funcsudsbr_setfreqbpf_catchpacketffs_isblocksystr_proc_plucomwritecbdb_stack_trace_printpf_anchor_node_RB_REMOVEpxaip_cdzaurus_startusbd_find_quirkpf_anchor_node_RB_REMOVE_COLORuaudio_getuvm_swap_allocpagesuvm_aobj_pooltrunk_rr_port_destroyhotplugclosepfr_insert_kentriesuscanner_do_readdb_show_frame_cmdsys_adjfreqmouse_copy_extenddb_examine_cmdqsphy_funcsuvscom_seticmp6_reflectsetrunqueueudv_attachsettimeuow_ow_matchromcdce_rx_list_inituhub_intrarm_pcache_typertable_initpppdumpbonewire_unlockhfsc_remove_queuedp8390_detachata_set_modevop_access_descmii_phy_auto_timeoutsyn_cache_getnetisrdb_clear_breakpointspxaudc_bulk_transferttyrubpfsyncattachrevarpwhoamiieee80211_get_ratetrunk_ioctlvop_generic_islockedrum_taskpxaudc_bulk_closeauth_hash_hmac_sha2_256_96uaudio_match_altwsemul_vt100_output_stringwsscreen_attachzts_powerbufcachepercentmfs_ioctlm_pulldownonewire_cdlcd_screen_listnewdirblk_poolpmap_initufs_rmdircryptodevkey_cbrlphymatchieee80211_next_scanminudsbr_startpmap_zero_page_funcarmv4_tlb_flushD_SEip6_initconfig_detach_childrengif_softc_listrawcbukbd_cngetctcpcb_poolz_errmsgpf_addr_wrap_neqsppp_chap_openmii_bitbang_readregpxa2x0_cpuspeedBlowfish_stream2wordudf_openuhidclosecarp_prepare_adipip_allowsys_pollalaw_to_slinear16_beuvm_map_clip_endufs_makedirentryvlan_vlandev_statepf_normalize_tcp_statefulusbd_set_configkcurnfsrv_getcachecbq_getqstatsvnode_hold_listonewire_matchlastdosdateudav_unlock_miitrunk_media_statusufs_linksys_mkfifodb_cmd_searchimport_tagifa_ifwithafhandle_written_mkdirural_read_eeprompcmcia_parse_cis_tuplein6_leavegroupsqphy_caiminsddumpsppp_cp_sendsys_chflagspfsyncoutputdelaysdstartdb_machine_command_tablevattr2xfs_attrinitiate_write_inodeblock_ufs1skipjack_decryptddb_regsieee80211_media_initacct_shutdownvt100_outputipforward_rtableiduvm_km_putpagepf_fragqueuecom_enable_debugportpage0_dataxfs_open_validext2fs_vnodeop_pvn_isunderusbd_get_port_statuscarp_ether_addmultiuvm_pageoutpf_qid_unrefpxa2x0_setiplpffindtypepdevnamesuipaq_breakinodedep_in_progressqsyncwi_setmultififo_opencd9660_vptofhsystrace_replacefreewi_attachusb_camii_phy_downuvmspace_forkraw_initsemundo_adjustknote_enqueueswap_bytesums_accessopsudpcksumtcp_sendspaceurl_csr_write_4dl10019_mii_writeregdb_maxoffffs_oldfscompatnfs_rmdirrijndael_decryptwdcdetachmaxlocksperuidpf_get_mtagfilt_ugenrdetachin6_matchlenstat_dir_entrysys_madvisepfr_tst_addrsupl_openpipesscsibusdetachxdr_string_encodesystrace_setegiddisk_attachwskbd_displayioctlip6_clearpktoptsncpusdb_cmd_loop_donearptfreevlan_ether_addmultisppp_pap_inputubsa_detachipq_lockedfilt_ugenread_intrdb_show_arptabcom_detachfifo_vnodeop_pvop_write_descaxe_stopvop_read_vp_offsetsbs_notimpl_bs_w_2ural_set_macaddrmfs_startdead_printeephy_serviceinphy_servicemii_media_tableswap_bytes_mtswdstrategytcp_rndiss_encryptflush_pagedep_depsttyprintfccdinterleavesigcodedb_elf_search_symbolipip_inputpfkeyv2_parsemessagedb_delete_watchpointcomttyne2000_detectbuf_undirtysysctl_tstringrmc_dropallnfs_unmountnfsrttmsqidsdb_watchpoints_insertedxscale_cache_cleanDusbd_start_nextnfs_fsinfofilt_ttywdetachuvm_tree_RB_INSERT_COLORvop_unlock_descpool_allocator_nointrsys_sysarchpf_src_tree_RB_NEXTBlowfish_decipherpf_state_tree_lan_ext_RB_REMOVE_COLORrum_free_tx_listpxaohci_powerigmp_initpfsyncstatsmii_phy_add_medianfs_del_committed_rangeputphysbufcpu_reset_needs_v4_MMU_disablenfsv2_vnodeop_entriesvop_remove_vp_offsetsMD5Initqspfi_attach_ifnetcryptodesc_poolbus_space_write_raw_multi_2cpu_info_storeffs_vfsopssysctl_mallocwihap_ioctlieee80211_outputusb_dev_openlcd_burnerfrag6_slowtimouvm_map_hintwant_reschedpmap_bootstrap_pv_allocatorppp_deflatephtree_SPLAY_REMOVEpxa2x0_gpio_intr_fixupieee80211_ioctlmsdosfs_mkdirkthread_create_deferreduhidevsubmatchrasops8_initnfs_xdrneg1export_keyscsidebug_busesscsibusactivatend6_timertcp_do_ecnportal_symlinkcomcnpollcuaudio_bsd2valuevop_open_descatu_matchusbf_stall_pipeudcf_bv_probemsghdrssemexitqsphy_servicepxaip_attach__cmpdi2cd_patternsowid_matchraw_detachaudiodetachpmap_get_pdenfsrv3_accessural_read_multibooted_kernelcarp_addrcountcompat_43_sys_stataudio_writemulaw_to_ulinear16_lebs_notimpl_bs_wr_1domainnamelenusbd_get_report_descriptornfs_sendip_rtaddrfiledesc_initurl_ifmedia_statusudf_initatu_get_cmd_statuscue_csr_read_1bstp_send_bpduvrelewi_set_pmwsmux_do_displayioctlohci_alloc_sedpxa2x0_lcd_setup_consoleprtrealloccheck_consoleapm_record_eventamap_freebstp_ifupdstatusxfs_devopenin6_domifattachwsdisplay_cnputcpfr_ktablehead_RB_REMOVE_COLORwdc_atapi_reset_2zapm_restartpfi_set_flagsugen_get_alt_indexswreadusb_blk_nfreend6_prefix_lookupxfs_pollcddonesync_inactivexfs_uprintf_devicespec_printusbf_start_nextlocleanpagesarc4_stirext2fs_lookupmsdosfs_openext2fs_linkcpu_switchvop_generic_revokeohci_hash_add_itdfifo_printusbd_get_bufferieee80211_add_erpieee80211_decapfilt_sigdetachtcp_do_sackradioprintext2fs_renameesp6_input_cbipsec_def_authmii_activateusbd_setup_isoc_xferpxa2x0_bs_vaddrttywflushcd9660_rrip_offseturl_startumidi_hw_ifwskbd_default_keyrepeat_datacomcnmodeclosefvop_rename_descpfsync_clear_statespf_state_tree_id_RB_NEXTcomioctlumass_cbi_resetsoftdep_sync_metadatapf_setup_pfsync_matchingif_clone_lookupudf_vnodeop_pgetmicrouptimemii_tickpxa2x0_bus_dma_tagnfs_mount_disklessip6_dad_countatu_complete_attachumct_breakuvm_pager_dropclusternfs_fhtovpfilt_generic_detachuvscom_rtszssp_powerhookpxa2x0_lcd_mmapsensor_task_unregisterzssp_ic_sendpool_print1sppp_auth_sendpcmcia_card_deactivatepxaudc_allocmnfsrv_fhtovpdb_breakpoint_listrum_startwi_pcmcia_matchip6_copypktoptsksymsreadcd_get_parmsrum_enable_mrrzkbd_cngetcpmap_extractespctl_varsusl_sync_donend6_ifptomacsppp_chap_TOwsmousedoioctlamap_unaddural_watchdogbooted_devicelcd_cnattachshmseqscd9660_printohci_rhsc_enableif_congestionshmsegsnfilesindirdep_poolipcompstatcd9660_islocked__bcd2binuscannerreadatapi_printin6if_do_dadrum_watchdogrevarpwhoarewecue_txeofbstp_set_all_syncatu_rxeofaue_detachcryptodev_keyieee80211_iserp_stapipe_kqfilterrum_rxeofext2fs_openportal_vnodeop_opv_descacct_threadpmap_devmap_find_pasoftdep_setup_directory_addusb_insert_transferaxe_matchrasops4_copycolsmsdosfs_vnodeop_entriesukbd_keymapdatatun_switchmulaw_to_slinear8freeblks_poolstopprofclockdb_hangstat_blk_limit_pushbstp_etheraddrnullioctlukbd_is_consolecryptof_closepte_l2_l_cache_modeipsp_ref_matchportal_linkisohashparsediskumidi_print_quirkbstp_timer_expiredalaw_to_slinear8wi_set_debugzkbd_onbstp_transmit_tcnbreadamap_lookupnetaddr_matchnfsm_srvpostopattripctl_varspf_osfp_adduaudio_chan_rintrpxa2x0_i2s_start_outputpmap_page_removert_timer_remove_allzkbd_irqwskbddevprintksymscloseuhid_intrcompat_35_sys___semctlwdc_output_bytesatu_ioctludsbr_matchzkbd_modstatesoftdep_setup_allocindir_pagewsdisplay_closescreenexport_identityxfs_checkexpieee80211_media_statusflashopeniophy_capmap_set_pt_cache_modemichael_keytcp_usrreqdb_playsuvm_swap_needdecryptmfs_vnodeop_entriesnfs_getnickauthsd_interpret_senseudp_usrreqrmc_delay_actionifmedia_initusbf_open_pipeext2fs_vfsopsext2fs_inactivedead_bmapdb_guessespf_send_icmpesp4_input_cbif_getgroupmembersdb_show_all_poolssoo_kqfilteruaudio_add_processing_updownne_pcmcia_disablefifo_pathconfcpu_startupuow_ow_write_bytequotaonpfr_setflags_ktablettcompatsetflagswsemul_vt100_output_dcs_dollaramap_refcompat_43_sys_lstatpfr_get_tablesfilt_fifordetachdb_command_loopwdc_ioctlamphyattachapm_suspendsfilt_fiforeadfdexpandtickssrandomwdc_ata_presentmsdosfs_closehotplugreadext2fs_setattrxdr_inaddr_decodeapm_resumehfsc_remove_altqsysctl_clockratevn_rdwrohci_close_pipend6_need_cacheip6intrpflogif_listuftdi_activateurl_setmultiusbd_get_device_descsys_msgctlwdc_default_write_raw_multi_2systrace_msg_askpfi_buffer_maxflash_chip_read_pageuvm_pagedeactivateuscanner_attachvop_write_vp_offsetsearly_clkmancarpdetachpf_find_mtagufs_unlockrum_matchmainbus_bs_r_2tcp_ctloutputccdbufplpxa2x0_turbo_modemono_timeukphy_statusMD5Updatepf_anchor_global_RB_NEXTblktochrvop_create_descpf_purge_expired_statesifmedia_setpcmcia_function_initpmap_createuvm_map_extractnfs_readdirrpcnfs_msgnd6_prelist_addpf_get_translationufs_removeboottimecd9660_readlinkwsdisplay_set_console_kbdxscale_cpu_sleepVOP_ADVLOCKdb_watchpoint_cmdaxe_watchdogwskbd_mux_closewdc_atapi_intrxfs_onqbridge_updatefrag6_inputunpst_sendspacedumppagewsemul_vt100_output_escffs_indirtruncnfsrv_mknodieee80211_add_ratespf_find_state_allptcreadpf_osfp_fingerprintrasops8_makestamppxapcic_mem_maptcp_rscalettwakeupuvmspace_freeext2fs_inode_poolipsec_common_input_cbpfr_del_tablesffs_ino_poolcryptopollpmap_pageidlezeromulaw_to_ulinear16_bemii_phy_statusmsgpfkey_initwsdisplay_internal_ioctlcpufunc_domainsVOP_PRINTfdsharenfsrv_removebuficmpv6ctl_varsxfs_printinverse_regioncdstartcompat_35_sys_fstatpf_pabufsppp_pap_tldfilt_generic_readwriteuserconf_disableumct_methodsvlan_ether_purgemultivrefspechash_slockusb_detachtun_clone_destroyipforward_rtdb_elf_forallohci_device_isoc_closeuplcom_attachurl_int_miibus_writereguhidev_activatevt100_ansimoderasops_lmaskuvisor_cdfifo_nfsv2nodeop_opv_descdb_set_temp_breakpointticket_pabufdb_buf_print_cmdsys_nosysat_pollrum_set_txpreambleallprocpf_tag2tagnamecdevswnfsm_uiotombuftun_createxscale_cache_flushDonewire_matchromne2000_attachzrc_accessopsumodem_get_statusuaudio_process_asfree_diraddsys_mlockallvndsizeusbf_config_endpointgallant12x22zflash_ctl_tagwskbdcloseuvm_sysctlmalloc_lasterruscanner_cdpxaudc_powerstatintrgetsn_bus_dmamem_unmapsys_fchflagsnamei_pooldisksortpxa2x0_pi2c_readrt_timer_countvfs_buf_printusscanner_scsipi_cmdpowerhook_disestablishcryptodev_opfilt_audiowritezssp_caukphymatchpxa2x0_gpio_get_functionuvm_pager_putmfs_mountohci_device_bulk_abortudav_caip6_ecn_egressin6_gif_outputin_canforwardvlan_inputrasops_unpack_attrremove_selectionwsdisplay_shutdownhookpxa2x0_bs_subregionpf_state_tree_ext_gwy_RB_INSERTohci_device_intr_abortieee80211_tree_RB_INSERTrasops_copycolswi_pcmcia_attachpmap_destroyscsi_mode_selectnfsfifo_writekernel_pt_listbstp_addpowerhook_listetherbroadcastaddrieee80211_rssadapt_updatestatspfi_dynaddr_setupcdcef_do_requestrasops4_makestampvfs_getnewfsidaue_rxeofvndunlockucom_attachudp6_ctlinputitimerroundudf_vptofharm32_vector_initwdog_shutdownscsi_print_sensewskbd_update_layoutmmopenffs_inode_freeSHA384_Update_intpf_normalize_tcpohci_device_intr_transferwdc_cdamphy_statusukbd_intrrtioctlkue_ctlipsec_acquire_pool_initializedieee80211_tree_RB_INSERT_COLORbstp_edge_delay_expiryzflash_safe_startprofprocswdc_free_xferip6_inputtbr_geticsphy_cdwi_usb_cmdrespxfs_rename_commonxfsdebpagemovegeneric_armv4_bs_rm_2route_srcspeedup_synceraudio_blk_msigmp_sendpktesp4_inputpfkey_senduploop_clone_destroypriq_remove_altqwdc_ata_bio_doneifmedia_baudrate_descriptionsv_putcsystrace_msg_childipcomp_attachgre_clonerm_getptrukbd_cauhid_activateufsvnode_filtopspf_send_tcpscoop_pcic_set_powerreadbufferspfi_skip_ifuvm_fault_unwiresppp_cp_change_stateuserconf_common_attr_valumidi_detachext2fs_vnodeop_entriesipseczeroessys_getitimerhid_get_datadonicewdcstartudf_allocvmerge_inode_listsetherip_inputcpu_configureip6_freemoptionssqphy_funcsscsi_create_task_threadieee80211_amrr_chooseptcopenaudio_alloc_ringieee80211_end_scanudf_synccdce_txeofwsdisplay_common_attachne_pcmcia_matchpool_page_alloc_oldnointrwsfont_rotate_internalpmap_fault_fixupuvm_swpkeysdeletedrn_refinesgeneric_bs_rm_4mfs_statfshmac_opad_buffersockargswsdisplay_getactivescreenvop_generic_abortopsetregshandle_written_filepagepfr_prepare_networkupl_rxeofusbread_filtopsufsdirhash_delslotnfs_rcvunlocksobindvmcmd_map_zerodb_read_charxfs_readnfs_asyncdaemonnfs_del_tobecommitted_rangezkbd_pollpxagpio_intr1vfsinituvisor_closeupl_caubsa_paramcncloserum_load_microcodenfsm_adjdb_tok_numbersddonetcp_do_rfc1323ip_fragsxfs_remove_commonfilt_fifowdetachwdc_dmawaitmii_phy_setmediarum_stoprum_read_eepromlo0ifphostidpool_chkaudio_ioctlwi_alloc_nicmem_usbusbd_free_bufferuvm_pagermapoutcheckreplaywindow32ipqmaxlenktrsysretext2fs_vptofhnfs_linkip_maxqueuesysctl_ttyieee80211_chan2ieeeuhub_cazssp_initin_socktrimsys___semctlext2fs_dinode_poolieee80211_node_cmpsys_mprotectrtallocpf_find_state_byidnfsrv_updatecacheieee80211_std_rateset_11gmsdosfs_reallocblksvop_readlink_vp_offsetspt_softc_lockwi_pcmcia_capfkeyv2_ipo_walkbridge_rtflushdequeue_randomnessurioioctlcue_casyncer_maxdelaypf_normalize_inituark_cmdwsdisplay_getscreendeadprocbstp_pdu_bettersamestart_reaperuvmspace_unsharesys_fcntlpf_change_areq_clear_removevfs_free_addrlistsys_setrlimitsys_sigpendingloop_clone_createuvm_map_cleanicmp_redirtimeoutccdiodoneowid_attachxfs_initqsppp_chap_scrulinear8_to_linear16_lettyclosewdrestartzapm_charge_completepxa2x0_lcd_ioctlusbf_freememdisk_resetstatugen_isoc_rintrmfs_inactiveicmp6_nodeinfocomp_algo_deflatemaxvfsconftimeout_addcpu_cdip6_forwarddb_fncallnumcachepxaudc_write_epNnfsrv_linkural_write_multilkm_nofunccpu_initclockscue_sendwskbdioctlmii_downcdcef_attachrn_mpath_hashkinfo_vgetfailedbrelseflash_reg8_write_pageext2fs_unmountpsratiosdminphysohci_device_isoc_methodswi_usb_tx_lock_tryaxe_unlock_miisppp_close_eventaudiokqfilterwsdisplay_switch3ttyoutuvm_map_pdevice_lookupsppp_dequeueDebuggerwdc_pcmcia_prinodedep_hashtblnfsrv_statfssystraceopenwi_usb_txeofudsbr_stopcdcef_start_timeoutcdminphysnumcleanpagesschedhzurlphy_carip6_inputlkmdispatchuvm_tree_RB_MINMAXtcp_totbackoffuserconf_basexfs_vptofhSHA256_Initbstp_pdu_rcvtypeflashstrategylooutputtasklistcue_setmultirijndael128_zerokeytrunk_lb_detachsoisdisconnectedcpu_coredumppxa2x0_bs_barrierxscale_cache_clean_addrrevbitsdvd_read_disckeypmap_clean_pageuvm_aio_aiodonecrp_req_queuesystrace_attachrum_plcp_signalpmap_clearbitcrypto_freereqclrbitsdb_boot_dump_cmdvndshutdownufsdirhash_initonewirebus_printxscale_cache_clean_minidataieee80211_proto_detachmii_phy_statusuow_ow_read_bytepcmcia_card_intrnfs_repheaduvscom_matchpfkeyv2_dump_policypf_anchor_node_RB_INSERTcommajordl10019_mii_resetscsidebug_levelxfs_devcrypto_newsessiongeneric_armv4_bs_r_2pxadmac_matchpxaic_basegre_sysctlsocloseuow_readscsi_detach_targetinstall_coproc_handler_staticmfs_bmapnfsrv_pathconfwakeup_nsys_connectptmreadbuf_daemoncarp_outputsys_nfssvcuaudio_get_minmax_ratesufsdirhash_buildskpcdb_leohci_root_ctrl_transferipv6ctl_varsroute6_inputbs_notimpl_bs_w_8vlan_startcompat_43_sys_mmapvop_read_desccdcef_stopcsr1switch_exitboard_startupcluster_newbufsys_socketpaircnreadudp6_sendspacedounmountuvm_swap_allockthread_create_nowwskbd_pickfreekbd_resetalaw_to_ulinear16_betcp_ackdrop_ppslim_countdb_elf_line_at_pcusbf_cdarm_picache_sizepool_cache_destroychkdqchgttspeedtabulinear8_to_linear16_le_mtskqueue_readcd9660_mountufsdirhash_addnfsrv_renameuserconf_maxdevcue_initfork_tfmratelxtphymatchusscanner_sensepv_sizensgphymatchzkbdhalttvah_zeroizewskbd_activatewsdisplay_cons_pollmodepfr_sin6wi_media_statusurl_miibus_statchgnd6_purgecarp_multicast_cleanupshm_pooldb_mult_exprtcp_keepidleif_attachheadnextcdb_listbreak_cmdwi_scan_timeoutiszerodevsoftdep_printtrunk_inputpfsync_sync_okuscanner_matchpxaudc_matchupl_inputcarp_clone_destroyauth_hash_hmac_ripemd_160_96vop_advlock_vp_offsetsflash_reg8_readumass_cageneric_bs_sr_4lf_freesys_fhstatnullmodemohci_hash_find_itdwihap_sta_deauthrum_alloc_rx_listsystrace_setscriptnameif_attachdomain1ieee80211_amrr_node_initraw_recvspaceccdunlockpfi_ifspf_disable_altqdiskerrwi_startptyattachcd_cdwsdisplay_screentype_pickudf_bmap_internalpf_qidswsdisplay_addscreen_printpxaudc_opendb_machine_commands_installieee80211_state_namesys_preadne_pcmcia_activatewdc_pcmcia_detachkernel_pt_lookupkmem_mapcd9660_check_exportconfig_pending_decrqsphyattachrum_update_promiscaxe_startsoqinsquediskstatsums_detachcdce_attachavail_enddes_ecb_encryptswap_key_prepareudp_inputnchrtoblktblbooted_partitionihashrn_search_mresettodrufs_readdirgeneric_softclocksys_flockarc4random_initializedlkpvwi_usb_do_transmit_syncspec_badopusl_sync_getmsdosfs_linkbs_notimpl_bs_c_1ohci_root_intr_methodshfsc_add_altqpfr_ktablehead_RB_MINMAXicmpctl_varsigmpstatsppp_proto_nameudf_bmapradioioctlmichael_finalvn_initialize_syncerdpf_check_proto_cksumxscale_controlcd9660_quotactlzrc_scanicmp_sendufsdirhash_adjfreepfi_get_ifacescdce_watchdogpxagpio_intrNvop_bwrite_vp_offsetsbsdi_stringsusbf_abort_pipewdc_ata_errtime_uptimekrpc_callfilt_uhidreadsowakeupinsidepxapcic_create_event_threadpxa2x0_lcd_stop_dmasystrace_make_msgpfr_nulltablebs_notimpl_bs_r_4db_putstringpxa2x0_i2s_round_blocksizeprefetch_abort_entryflashdumptcp_clean_sackreportuow_activatemouse_copy_linesigactsunsharetimeout_hardclock_updatespppattach_edataupl_detachrijndael128_decryptpf_match_translationttkqfilterm_tag_deletecd9660_ihashremsensor_findxfs_setpag_callip_fragmentusbd_endpoint_countsys_statfscarp_send_arpSHA1Finalexport_flowsensordev_deinstalluaudio_attachrawin6pcbtablepmap_protectonewire_crcpool_cache_invalidateslinear8_to_alawkprintfdevice_unrefulpt_matchrc4_keysetupuow_attachscsi_startvnode_poolin_cksumdeflateInit2vnode_free_listpfsync_tdb_sendouttcp_savetiusbf_matchuvm_pagereallocapm_battlowsensordev_countuvm_fault_unwire_lockedklist_invalidateuvm_km_createthreadipsp_process_doneaudioprintpool_printitpfi_ifhead_RB_MINMAXubsa_flow_enddes_check_keysogetopthid_report_sizeusbf_endpoint_attributessoftdep_freequeuearc4maybeinittun_softc_listmidiwritedb_deletewatch_cmdsoftdep_load_inodeblockwsemul_vt100_attacharp_intimervlan_clonerpollscandomaininitvflushbuftime_secondip6_forward_rtslioctlsppp_lcp_openpfi_dynaddr_removeusbd_get_interfacewskbd_get_mapentryinitiate_write_filepagevndclosenfsrv_slpderefusbd_read_report_descsbcreatecontrolsys_mlockhotplug_device_detachpf_cachequeueuaudio_add_altpxa2x0_maxspeeddvd_read_structportal_vfsopscompat_43_sys_getpeernamevdevgonehtonsubsa_setdb_show_callout_bucketbucketkqueue_writesys_syncnfs_readdirplusrpcieee80211_reset_scantrunk_port_ioctlaudio_selwakeuppf_addr_incipsp_process_packetcominitnfs_pathconfnfsstatsenodevudcf_it_probeffs_mountfsudsbr_reqslinear16_to_alaw_bein_delayed_cksumin6_is_addr_deprecatednfs_rcvlockrum_attachwsemul_vt100_edpf_ip2keyicmperrppslim_lasttrunk_clone_creatertstatttvtimeoutatu_startabtstackspeclisthbdwritevndattachversion_to_spcsppp_open_eventVOP_INACTIVEonewire_resetswap_decryptzkbd_cawsmux_do_closezaudio_query_devinfopte_l1_c_prototcp_syn_cachepfsync_setmtuwsemul_vt100_translatehaltsoftdep_deallocate_dependencieseephy_cainphy_cawihap_sta_is_associeee80211_std_rateset_11akputcharums_ioctlbootargssys_getsiddb_trace_until_call_cmdRMD160Initwi_write_record_usbcompat_43_sys_sigstackcue_csr_read_2rasops15_putchar8wdc_pcmcia_disk_device_interfacetrunk_port2reqfileheadvndsetcredrc4_cryptusbd_alloc_xferpxaudc_ctrl_abortxfsnextvnodeidcttypollural_startrotatedfontssys_swapctlpfsync_pack_statepxaohci_matchbd_reqpxa2x0_probe_sdrambs_notimpl_bs_rm_2rasops4_initin_selectsrcmsgscpu_exitzapm_batt_lifeip6_initpktoptswsmux_add_muxbpfilter_destroyunp_attachohci_device_isoc_startimport_credentialstcp_syn_bucket_limitpty_getfreesys_renamernd_rselpfr_get_addrsusbd_nbusesfrag6_nfragsip6_log_timepf_flush_fragmentseephy_statusinphy_statusuow_intrrtalloc_mpathxscale_cache_purgeDuaudio_match_alt_chandisasmufs_ihashinitunp_deferuvm_km_valloc_waitsys_sigreturnsys_shmgetlid_suspendsbflushbstp_deleteipsec_require_pfsswapdevwd_cawsdisplayttykue_sendsysctl_intrcntaxe_tick_taskvn_readfilt_ptcreadah_massage_headersbwriteleavepgrpqsphy_cdarmv4_tlb_flushDkernel_pt_tablepmap_get_pde_pteuvmpageropsuvm_page_initudf_closeohci_root_intr_closewsdisplay_common_detachufsdirhash_movewihap_sta_alloccast5_decryptxscale_setuppf_match_tagwsfont_locktcp_timer_funcsipqent_poolpxaip_attach_criticalbufq_default_addif_attachdomainpfr_set_tflagsaltq_pfattachubsa_requesticmp_ratelimitieee80211_rssadapt_raise_rateinvalhashusbf_iface_endpointuvm_km_page_initrttimer_poolipe4_attachieee80211_regdomain2flagax88190_mii_readregusbd_get_config_desctdb_soft_firstusepfr_clstats_kentriespxa2x0_gpio_set_bitsosendsema_pooldosetrlimitpxa2x0_pi2c_getvoltagern_initbufq_default_getloopattachusb_match_devicedp8390_watchdoguscanner_detachural_rxratelkmexistswdc_input_bytesnfs_hashlockRMD160Finaldb_listwatch_cmdusbd_do_request_flags_pipenfsm_reqhchainlengthprocess_read_regsural_disable_rf_tuneau_get_gainpagedep_poolbstp_set_timer_msgagern_lookupuvm_map_reserveudpencap_ctlinputstate_listuaudio_find_ifaceallocate_copybuffernum_dirremuserconf_show_attrsys_execveencoutputfdallocuaudio_match_alt_subwsdisplayreadscsi_doneudf_vnodeop_opv_descnfsspec_writechkvnlockhw_sysctltrunk_clone_destroydb_siftingpxaudc_freexxfs_readdir_commondb_look_tokenpmap_alloc_l2_buckettcp_syn_cache_limitconsintrnumvnodescryptof_ioctlcomreadurioopenuvm_pagefreecompat_43_sys_acceptpf_frag_tree_RB_INSERTukbd_decodeportal_startext2fs_inode_allocswcr_encdecusl_detachtimeoutwsdisplay_switch2scoop_check_mcrdb_examine_formatin6_pcbbindcluster_rbuildreapercoredumpfilt_kqueueugen_cdmalloc_roundupnfsrv_readpxaudc_bulk_donepipe_readaudiostartppxa2x0_bs_freeifioctlsys_utimesdb_symformatsusbd_do_requestlkmenodevnd6_storelladdrusbf_endpoint_addressrip_initsocreatesystracef_statucycom_get_statususbd_find_idescpmap_cache_statebstp_update_stateureadcatu_get_dfu_stateaue_startufs_setattrrijndael128_setkeyieee80211com_headlogprimemhookdoclusterreadzapm_batt_volthandle_workitem_removecast5_encryptsys_exitsystracef_closesbtrypf_state_scrub_plusb_desc_iter_nextnfs_decode_argsuvisor_matchm_applyxscale_maxspeedswcr_processcryptof_writeudav_startaxe_lock_miifree_newdirblkwdc_exec_commandpxaohci_capppasyncstartpxaudc_bulk_abortsadb_exts_required_indb_watchpoint_listwdcintrusb_seleventaltq_disablecd_playsys_clock_getresaxe_attachsyn_cache_insertnsgphy_funcsbridge_rtupdatespec_bmapttystats_initmidiprobene_cdncvhashpool_cache_destruct_objectucycom_detachucom_matchnd6_umaxtriescarp_set_statetag_unrefohci_device_intr_doneusbf_get_stringpcmcia_intr_stringcbq_add_altquaudio_merge_terminal_listnd6_debugpf_hash_rule_addrmainbus_bs_r_4umodem_cawindow_deflatedb_delete_temp_breakpointpf_src_tree_RB_INSERT_COLORcpu_cpuspeedcpufunc_idudf_vgetget_random_bytesurl_csr_write_1SHA1Transformmrtdebugesymusbf_schedsoftintrfiqhandler_stackcrypto_invokeosreleasevndiodoneubsa_breakVOP_RECLAIMpf_empty_poolscsi_probe_targetipcomp6_inputgre_inputpflogioctlucom_cdusscanner_donespec_nfsv2nodeop_pwsmux_evsrc_set_display__modsi3tcpqe_poolpgrp0mainbussearchfilt_ptcwriteurl_watchdoguvisor_initudcf_attachwihap_timeoutuserconf_changepxa2x0_lcd_new_screenmakefstypedb_paniccddkdriveruvm_anon_adduaudio_closeuserconf_helpufs_advlockicmp_initmouse_movereluvm_growcsecreatevfinddevif_detached_initnfs_falsedopowerhookspfi_ifhead_RB_REMOVE_COLORcarp_group_demote_countah6_inputbw_upcalls_chapm_handle_eventimport_udpencappf_test_state_icmpether_delmultivfs_op_initptckqfilterdb_history_currmainbusattachrn_mpath_initheadpppinputpf_match_giduvscom_paramgif_clonerrpc_auth_kerbexec_sigcode_mapsys_gettimeofdayflashwriteipsec_soft_timeoutipsec_policy_pool_initializedtrunk_fail_attachwdccommandshortieee80211_rate2mediavcleansystracewriteiophy_servicerasops8_putchar16cd_getvolsplassert_ctlpf_free_fragmentowtemp_activateuslcom_setwdc_atapi_startsys_getresuidsys_fhopenzapm_battchkratedos2unixfnscsibussubmatchrtentry_poolpxadmac_cdzkbd_consopsxfs_select_wakeupfilt_tunwdetachuaudio_cduvm_km_pgremove_intrsafeext2fs_sbupdatedefrtrlist_delsystrace_getcwdsys_fchmodvop_strategy_descudsbr_caatu_watchdoguvm_unmap_detachvop_islocked_descupl_initwskbd_srcopsuserconf_common_devvfs_mount_printuscanner_do_writepxa2x0_irq_handlersema_releasestartipe4_zeroizewdog_cookieusbd_devinfoskip_spc_leftxfs_message_rpcppp_clone_createvn_isdisksys_selectscoop_charge_batterybadaddr_read_1cryptoattachvnode_free_list_slockbstp_received_bpduzombprocdb_branch_takenin6addr_intfacelocal_allnodesxfs_inactivelogreadnfs_realign_fixuprn_mpath_capabledead_lockieee80211_name2regdomaintcp_issphysical_freestartfc_largedistancereset_vifcom_pcmcia_disablenfs_add_tobecommitted_rangesys_setitimerisofntransurl_attachnd_prefixclear_removewsemul_vt100_resetext2fs_specop_pvfs_unregisterseminitvndstrategymii_phy_flowstatusvt100_setnrcswap_key_createsppp_ipcp_RCN_nakselwakeupumct_set_baudrateffs_reloaddb_set_watchpointspfi_table_updateuaudio_ctl_setmidi_out_docnwritepfr_clstats_ktablesumass_bbb_get_max_lunzkbd_keymapdatacompat_43_sys_killpgdb_show_panic_cmduipc_usrreqnd6_na_inputrtl80x9_mediastatusdb_next_free_watchpointvflush_vnodefilt_rndrdetachmulaw_to_slinear16_lewsmouse_activatescsi_scsi_cmdin_gif_outputah4_ctlinputrip6_usrreqin6mask96sloutputcoldpxaudc_ctrl_doneah_outputdb_clear_watchpointscdcef_startbutton_eventunp_scanvlan_clone_destroysbappendaddrbpf_maxbufsizesemutotesp4_ctlinputextract_entropyufs_islockedusb_detach_wakeupffs_unmountfifo_inactivene2000_detachsys_pwriteisohashtblscoop_pcic_matchppp_timeoutsppp_ipcp_RCN_rejwihap_shutdownuvmspace_allocrevarpinputcd_pausesoftdep_setup_directory_changehashinitttstartumass_setup_transferwdwritenfs_removerpcipsec_keep_invalidsystrace_debuguao_detach_lockedumct_set_lcrsystrace_prepreplnexpiretree_idsdopentcp_tracemii_phy_resetip_getmoptionsmidi_attach_midp8390_mediastatusin6mask32__moddi3disk_countpfr_mark_addrsohci_confdscsi_detach_lunpmap_page_protectnfsrvw_procrastinatedead_openmsgpoolkue_setworddb_list_watchpointsatapiscsi_matchuserconf_attrwdc_kill_pendingbmtphymatchucycom_seticmp6_redirect_outputroute_cbvop_revoke_vp_offsetsva_nullexphy_cdreadeppf_print_flagsudcf_matchlxtphy_resettcp_slowtimoieee80211_std_rateset_11bamphy_cdcd_play_msfpmap_remove_pvdqreletcp_newtcpcbsys_fhstatfself32_load_filebstp_ioctlsys_getpeernamepxapcic_io_mappfkeyv2_sendccdintrhfsc_getqstatsumidi_attachchange_sign16_be_mtsportal_pathconfudf_rootpfr_validate_tabledb_taken_bkptdb_eqnamescsi_strvisbpfwritedoingcachesys_getrusagepf_state_tree_id_RB_INSERTpf_rtlabel_copyoutapm_threadrasops_initmainbus_bs_mapipcomp_output_cbaue_reset_pegasus_IIcryptoioctlxfs_devtoname_rnmea_countnd6_prunecomconscflagsl_uncompress_tcp_corem_getffs_truncateuhidevprintmii_attachuvscom_carum_alloc_tx_listnfs_replyhfsc_pfattachttylclosemd_diskconfpfi_ifhead_RB_FINDzflash_safe_strategypool_allocator_allocwdc_default_read_regin6_ifremloopchar_typeohci_free_sitdusbctlprintpagedep_hashvn_closeuftdi_readudav_csr_writeuhid_do_readexport_addressin6_createmkludgediradd_inode_writtendoclusterwritecdcef_initusbd_close_pipewsdisplay_cfg_ioctlffs_writebremfreefilt_sowdetachnd6_initip6_maxfragsexpire_upcalls_chlimfreexfs_devopen_commonmachclk_per_tickpfr_set_addrspfr_get_tstatssoftdep_setup_freeblockscarp_master_downbstp_set_timer_tcdb_show_regs__wdccommand_intretherip_outputportal_lookuppf_osfp_fingerprint_hdraes_ctr_zerokeybstp_notify_rtageuvm_km_free_wakeuprootvnodeifmedia_ioctlpmap_pmap_ctoricmperrpps_countuserconf_modify__one_cmpldi2usbf_setup_pipewi_usb_rxeofcpufunc_nullopufsdirhash_newblknewblk_poolcd9660_ihashgetnfsrv_writeumct_camii_phy_detachatu_media_changesys_shmat1__muldi3wskbd_add_muxmbtypesumct_cdxfs_message_invalidnodexfs_stat_devicedb_qualify_ambiguous_namesuhidev_caurl_lock_miiip_mtudisc_timeoutvfs_opv_init_defaultrandomopenin6addr_linklocal_allnodesamphy_causbf_allocmempxaudc_attachbufinitinswubsa_closeskip_char_leftbootconfigpfi_dynaddr_copyoutscsi_quirk_patternsuserconf_linesuaudio_ctl_getnfs_truedeflateInitlimit0tcp_sack_outputlcd_set_backlightpxa2x0_pi2c_openuniqdosnamedb_recoverzaudio_halt_inputudsbr_activateusb_async_procext2fs_mknodvttoif_tabdb_delete_cmdwdc_pcmcia_activatefifo_nfsv2nodeop_entriesbgetvppgrp_poolxfs_dead_lookuponewire_write_byteucomstartreaducred_poolxscale_cache_purgeD_rngpf_state_tree_ext_gwy_RB_REMOVE_COLORnfs_startdes3_setkeyarp_maxtriespf_begin_altqpmap_uareacd9660_bmapax88190_mii_bitbang_writeaue_eeprom_getwordacct_processportal_openufs_dirbadentryusbf_close_piperasops4_erasecolslogioctlicsphy_funcsubsa_databitsgeneric_bs_wr_1_bus_dmamap_load_uiopfr_create_ktablestrlenzflash_safe_stopdb_machine_initrasops15_putcharnfsv2_vnodeop_pvop_abortop_vp_offsetspfr_ktablesfifo_kqfilterzkbd_enablemidiattachwsfont_initxfs_createkue_activatewsdisplayparampool_page_freewdactivatewsmouse_inputah4_inputcopystrbridge_broadcastwdc_do_resetwdog_ctl_cb_argsys_pipeural_setup_tx_descusb_detach_waitpxapcic_printpxa27x_run_modearm_pdcache_waysarp_rtrequesthw_vendorxscale_setup_minidataext2fs_reload_vnodesppp_lcp_RCRelf32_check_brandwi_cor_resetnfs_getset_niothreadsudp_initproc_trampolinepxaudc_read_ep0sys_rmdirudf_ioctludf_vat_readdp8390_disablecompat_43_sys_gethostnamecd9660_vfsopscdcef_methodsinflateInitallocbufsocantsendmoreproc_zapvop_revoke_descpxaintc_causb_rem_taskpf_set_rt_ifpzflash_default_disklabelpte_l2_l_cache_maskxfs_readlink_commoncdactivatenfs_merge_commit_rangesuvm_vsunlockether_inputlockstatus_splraisequotaoffarpioctlpxa2x0_read_ccntffs_fifoop_ppf_ncachefs_posix_sysctlaudio_init_ringbufferulinear8_to_linear16_beif_slowtimowd_shutdowndb_load_countudbtablewi_setdefppp_softc_listwdcattachchange_sign16_le_mtsufs_printpxa2x0_i2c_attach_subfatentryzaudio_cdnmeainputpppoe_clone_createwi_update_statsmf6ctablecarp_startdrop_earlyusbd_printBCDntp_tick_accsys_statdqgetin_baddynamichotplugopenlineswpxaost_cdmsdosfs_symlinksys_symlinkicmp6_sysctlclfreecompat_35_sys_semopconfig_found_smnfsrv_readdirplusalaw_to_slinear16_lepfi_kif_getuhidread_filtopsusbd_interface2endpoint_descriptorrpc_autherrfdreleasedb_line_at_pcuvm_swapout_threadsural_bbp_writeusbf_add_interfaceknote_attachmax_keylensppp_lcp_tlsbus_space_copy_4dp8390_ioctlgre_wccpspec_nfsv2nodeop_opv_desc__assertif_congestion_cleardb_put_valuewsdisplay_emul_matchin6_prefixlen2maskesp_input_cbcompat_43_sys_recvmsgflashdonescoop_akin_pulluppcmcia_megahertz_xjem1144_func0_cfe0udp6_outputcn_devvpcom_activatewi_get_debugmaxfilesuvm_pageactivateufs_dirhashmaxmemin6_addr2scopeidsystrace_scriptnameip6_sourcecheckvop_access_vp_offsets_bus_dmamap_load_rawffs_mountrootuplcom_paramnfs_add_committed_rangetprintfpxaudc_write_ep0uvm_map_pageable_allesp_initdofilewritesystrace_injectipqdl10019_media_inituscanner_capxa2x0_lcd_show_screenmfs_doiomsdosfs_strategytimeout_delpxa2x0_i2s_writeural_media_changewsemul_vt100_elxfs_dnlc_purgeieee80211_chan2modeif_delgroupspec_strategyuvm_pglistfreeworklist_printnfs_attrtimeonfs_bufqmidiioctlusbopenax88190_media_initums_attachxfs_uninstall_deviceext2fs_readsl_compress_setupsoo_statwskbd_cnpollcpf_altqs_activekue_newbufpppreadrusage_pooldisk_detachpf_purge_threadstrchrubsa_methodshid_clear_localxfs_renamexfs_dnlc_enter_namescsi_sizeusbf_host_resetmainbus_bs_barrieruvscom_cddb_deletegenericconfget_bootconf_optioncrypto_driverscompat_43_sys_ftruncateiftovt_tabsysctl_int_lowertcp_backoffmainbus_bs_w_2carp_iamatch6sppp_pap_my_TOsys_chrootwdc_ioctl_freeubsa_cdavail_startcompat_35_sys_msgctlexport_saieee80211_rssadapt_lower_rateumodem_dtricmp6_redirtimeoutbridge_initenc_xform_dessoisconnectingmtx_init1pf_test_state_otherwsdisplay_pollcvop_link_descpfi_kif_unrefaobj_pagerscsi_task_threadpf_tagname2tagrasops4_putchar8zaurus_battery_c3000uvm_tree_RB_REMOVE_COLORgeneric_armv4_bs_w_2MD5Transformumidi_matchmld6_inputacct_startgeneric_armv4_bs_sr_2vop_link_vp_offsetsbpf_d_listsoftdep_worklist_busysyn_cache_cleanupip_pcboptsfc_purgemidi_ca__data_startpxapcic_mem_unmapifmedia_delete_instanceurl_caucom_breaksoftdep_update_inodeblocksys_acctccddumpudav_miibus_writeregacphymatchdb_single_stepicmp6statzssp_write_lz9jg18generic_bs_w_4inflateEndpfr_commit_ktableccdwritewsevent_pollmap_backmergeieee80211_pwrsavesys_profilvmcmd_map_pagedvnnfsm_disctin6_pcbhashlookupsystrace_exitwsdisplay_cdbpf_detachdVOP_UNLOCKsyn_cache_initieee80211_find_txnodevop_readdir_vp_offsetscd9660_wchar2charip_ecn_egressbridge_send_icmp_errether_ipmulticast_maxmouse_copy_extend_worduvm_init_limitsukphy_cdusbf_softintr_establishin_pcbconnectokaytocloneVOP_POLLVOP_IOCTLvlan_clone_createsafeprinumccdaudio_init_playpxapcic_io_unmapsys_rforkpxaohci_disablewdc_default_read_raw_multi_4uao_swap_offmachinewi_cmd_ioVOP_CLOSEuvm_anallocin_pcbdisconnectradioprobezts_sync_ads784xuvm_vnp_terminatepool_cache_putwi_usb_rxfrmbridge_fragmentz_allocsensor_task_threadwtab_destroysys_getpidnd6_defifindexunp_dropptscloseipmultipathuvm_map_advicetcp_mtudisctimeout_startupudf_vfsopspppattachcue_matchpf_normalize_ip6rn_addroutepf_find_or_create_rulesetsdactivatenfsrv_errmapread_dsfielddb_print_sadb_elf_sym_numargsural_detachwsscrollbackdb_trapperchkiqchgradiocloseukbd_cnpollcshmsegdvd_read_manufactundstackconfig_activate_childrenpxaip_printmulaw_to_slinear16_be_mtskrp_req_queueremrunqueuepfsync_sendout_mbufatu_initial_configsoo_closesystrace_redirectumodem_rtsnfs_kqfiltertcp_recvspaceah_sysctluvm_meterumodem_intruhidev_maxrepidsubnetsarelocalpmap_needs_pte_synctcp_ackdrop_ppslimportal_readdirnfs_requestlinear8_to_linear16_le_mtsnd6_lookupieee80211_cache_sizeprocess_domempager_map_wantedviftablebridge_bifconfurl_openpipesukbd_countrylayoutzts_matchsys_getppidmii_anarxfs_update_write_credVOP_READDIRdomainsxfs_uio_end_lengthsys___sysctlaudio_calcwaterarm32_dma_range_intersectextent_alloc_subregionin4_cksumpf_src_tree_pluscannerwritedb_putcharpxauart_powerneedbufferaltq_add_queuewsemul_pickusscanner_cmd_cbusbd_do_request_asyncin6_ifattachsoftdep_worklist_reqppppktinzflash_write_strategytcp_rst_ppslim_lasticsphy_cawsdisplaystartbs_notimpl_bs_rr_4wsmouse_srcopsptmioctluvm_rb_removeahstatohci_root_intr_donefree_xfs_nodeptcwrite_filtopstickfixip6_multipathusbd_get_device_descriptorpxapcic_submatchcd9660_initccdstartumass_fixup_yedatamichael_initipsec_soft_bytesnselcollemul_elf32usbd_open_pipenumdirtypagesohci_softintrbufhashmulaw_to_ulinear8msdosfs_lookupspec_pathconfmountroothook_listpfi_detach_ifnethook_establishtcptv_keep_initaddrmasksys_chdirktrsetchildrendb_unread_tokenext2fs_diremptymotion_eventsppp_chap_tlduserconf_cntmouse_zaxismfchashuvscom_methodssppp_lcp_closeext2fs_inode_freepxaip_capcmcia_ccr_writedb_find_variableapm_cdxscale_cache_clean_sizepxaintc_cducom_activateip6_rr_pruneudpencap_portptmclosesbcompressdirrem_poolmsf2lbapmap_free_l1rijndael_set_key_enc_onlycdevsw_lookuplogsoftcsys_adjtimewrite_dsfieldnd6_outputxfs_devioctlpfsyncioctlohci_device_clear_togglevop_kqfilter_vp_offsetswdstartwsmuxreadamap_splitrefspec_open_clonewskbd_do_openktropspf_qname2qidrum_activateudf_get_vpartmapcryptof_kqfilternclruheadvndwriteural_next_scanrasops_alloc_cattruvm_aio_biodonern_initheadusbd_get_descnfsfifo_reclaimvop_generic_unlockuvmspace_sharert_timer_addieee80211_print_essidroute_usrreqdeextendpxapcic_event_threadrasops_erasecolsnfs_readlinktcp_dropsppp_detachicmpstatnv3tov_typeudpctl_varsip_mrouter_getm_prependvop_advlock_descwsemul_vt100_output_scs96_percentnfsrv_readlinkcd9660_pathconfax88190_stop_cardxfs_create_commonin_pcbrehashxfs_setattr_commonin_arpinputzts_scaleudf_vat_getzts_caufs_accessin6_embedscopeif_alloc_sadlpf_state_tree_lan_ext_RB_FINDunix2winfngifattachwsfont_unlockreassignbufip_freemoptionsnetconuslcom_closeums_matchieee80211_release_nodesohasoutofbandspec_vnoperatevop_ioctl_descddb_initbs_notimpl_bs_c_2nd6_dad_duplicatedsoftdep_change_linkcntfifo_vnodeop_opv_desc_bus_dmamap_unloadieee80211_free_allnodesmsdosfs_fhtovpbs_notimpl_bs_wr_4nfs_inactivepim6_inputxfs_message_installdataipsp_spd_lookupether_crc32_behandle_written_inodeblockieee80211_add_ssidcpu_reset_addressuaudio_get_clusterpgfindvop_lock_descatu_rx_list_initsoftint_pendingtcp_ackdrop_ppslim_lastrqinitloadfirmwareuaudio_chan_free_buffersrasops_cmapswcr_compdeccd9660_ihash_slockpf_test_fragmentip4_inputtcp_inputsysctl_dumpentrydkcksumwsdisplay_cnattachflash_wait_completepfkeyv2_policynd6_gctimerurl_csr_write_2ucycom_devscd_switchiptimerip_inputaudiowrite_filtopswi_set_txpowernd6_setmtupf_normalize_tcp_cleanupaxe_ifmedia_updwdc_ata_ctrl_intrnfsrv_cleancachedb_last_non_spaceusbd_get_endpoint_descriptorudp_ctlinputmii_detachudav_rx_list_initpool_sethardlimitrasops4_do_cursorn6expireip_freefvnd_softcaltq_pfdetachdb_show_cmdswdc_default_write_regrlphy_statusudbhashsizeicmp6_mtudisc_updatesun_nonamekmeminitnsphyterattachnd6_ns_inputdeflateEnddevice_refuark_matchffs_syncusbf_task_threaduvm_map_submapnfsm_srvfattrvndopencnioctlufs_vinituaudio_devicepool_primensgphyattachpgrphashtblcomconsinitsystraceattachsddkdriverktrwritesys_getpeereidpfi_clear_flagsinodedep_lookupcarp_hashifmedia_matchstatclockaue_activategetnewbufwi_read_data_usbdvd_read_physicalrw_enter_writeuvm_mlk_hintsppp_lcp_scruserconf_argbufatu_media_statusflashactivateuaudio_chan_closepxa2x0_lcd_consoleMD5Update_intm_tag_copyrum_amrr_updatedb_value_of_namepmap_l2ptp_ctortrunk_port_getdata_abort_entrytun_clonerhid_get_itemmsdosfs_getattrdb_find_breakpointcarpstatsm_devgetntp_tick_permanentwritedisklabelgettdbbysrcmsdosfs_printkernel_pmap_storewsemul_vt100_opsstartprofclockpf_modulate_sackohci_device_isoc_enternsphymatchupl_ioctlundefinedinstruction_bouncesys_getresgidprocinitapm_userstandbysrmc_update_class_utilatu_switch_radiomsdosfs_readdirdead_ebadfpfsync_cloneruow_detachusbd_interface_countpxaudc_enablewddetachnfs_symlinkpf_frag_plsoo_ioctlred_getqnumdquotforkstatwi_card_identaue_miibus_writeregdl10019_mii_statchgicsphy_servicenull_setkeywi_send_packetin6mask64db_lbuf_startohci_rhsc_ableuipaq_activatesoftclockaudio_initbufsonewire_attachmfs_openportal_badopupdate_modifierdb_breakpoints_insertedswdevtblf_decryptdisk_lockudcf_it_intrscoop_pcic_readah_attachsppp_chap_closesbwaitudf_transnamehotplug_device_attachufs_reclaimpf_tag_unrefsdwriteohci_device_intr_startxscale_minidata_clean_addrkernel_debugxfs_install_deviceshm_deallocate_segmentmemnamelcd_accessopswsmouse_caxfs_fsync_commonfilt_logreadsysctl_rdquaduaudio_detacha4x_bs_w_4carp_optsuvm_vnp_setsizeflashreada4x_bs_rm_2vmcmdset_extendural_casys_lkmnosyszapm_batt_stateip6_use_deprecatedpflog_cloneruftdi_paramimport_keynfs_setattrrpcuserconf_hist_intextent_alloc_regionsys_mknodext2fs_mountfskill_vmcmdsuhid_attachppp_clone_destroyzkbd_matchufs_mknodsbinsertoobknotelf_advlockpffinddomaineephy_resetwsmux_do_openfreeah_enablepf_src_tree_remove_stateusscanner_cleanupwi_ioctlzts_disablelcd_attachnfsrv_rcvugen_get_cdesczaudio_halt_outputpfr_insert_ktableieee80211_compute_durationpxa2x0_ccnt_enableswstrategyuserconf_pnumget_sa_requirescsibusprintrtl80x9_init_cardsys_getpgrpccddevszrc_cauplcom_detachuftdi_breakukbd_ioctldqhashtblaudio_defaultusbf_add_config_descuscanneropenuow_ow_searchwsemul_vt100_console_emuldatasonewconndb_fetch_regufs_direnternfs_reqqudav_csr_write1uhid_detachgeneric_armv4_bs_c_2pffindprotoonewire_matchbyfamudav_watchdogbold8x16_iso1bridge_clone_destroycluster_readuvm_swap_initcrypt_alltcp_saveti6wdctimeoutwsemul_vt100_inittun_wakeupnchrdevieee80211_merge_print_intvlundefinedinstructionaue_cdsppp_phase_namenfsrv_lookupaf2rtafidxshm_find_segment_by_keyqsphy_cashmmaxpgs