ELFa( 4ĆJ4 (   ȥ!ȥ!!BBH(H(HPJHjHjxb / /;0&00Qd;0 2 @00Q8$/ // @ <  B00 R=~Р -L͓ HjpHjmain() returnedlp   ),@@(LQ 0/wjp - L 0 $ 0 $ -0L  T  T p-H$,$HP0`L@ 0p -0L(  -0L( _ "- L0 -4L\ ,00,0 200b104 0 ,00 200b10> p-0LSP P ,  4 ` ,  0P,00,0pp 0 $Pp@0D PT0T0S , , -0P@Lp8`  R   0@ 0 d -0P@Lp8`  R   0 @ 0 d -LP@x`0 P  'H0!@ 0',0 0` 0 0' M-L0&HHH0$H@  , 0&&, $, 0`@ * 0 0 0''X(K 0-_02@P L0@ 0'0@-0@  0S  4000$ 4 @4@ -4L0S @440S - L0 -LM40S  3 lH0 ,P5 K 0 Kh+ ? ? p-LM@`P3PUOx3e H0 P 00 h0 \83 @893  :  ? ?@$ ?4 ? ? Q-L@0 H ?T ? p-0L @P ,00,0 R 0$ 0 00  0 p㝹,0`0,0 R 0$ 0 00  0 phtCn -PLス4p`V$ 4! ,0 J0 ,0 000,  ,  0h豸P)@0D PT,0 0,0? #@l ?t ? ? ? ? 0-L@8P,G@ኸT ` .0tCn -4LSPp `00 0<0000@0003  00   0  dM4S0;0ShgK:4S 0 00L$H@0@@000 y31C0 1-L?rcWP`S ̹V @ 0DPT0`T0d  D0PT0C4Q -LàL0L0Ϡ@blpP30 0S PVd0P0,0 00P 03Q - @p`R0 0L PP 00  0 00000\4SX 03g4   -L@pX00S/0W3 ] 00`M 00P00Zpd3 X0  0W  -0pS0L00@`% 000PU00S`U \     8 U   Br ?@ ? ? -8@QL0z2>0 p-8P@L@`4 00 00S > S 0 p R  B  ho  000 Pg Xp 0 00 W  ?T ?$ ? 0-L@LP H0( @0( 0h7' p-L@`u .PUP00SXP ?sp  000PS p 0U 0 0 0P 0UPp@p -0LSP 0S" 00 @ = p`Z8:Xo`Z6 @ 3S `V 㽷0@ 㲷0TTPPQ @Op@ 㔷00000@TP3038P060 0 303 R 00   @500卵j B p-L@ KP`dU  0>00PY YR`pp 0-LP@P 0edH@ @0lP' 0H@ 0_ 0' -LM0` Pp @2?0S3  0BP.0  0&0,0K0,0 Kh ж Kh\ Ķ0S 㿶000Khm 㴶 0P00 0S  0P3g4 MKhI -0`10#LP8p&@P@ 00 0000  0 0, |0| 004 PN`0  @៴0@  00    ? -L M0PS` 0Sp K@K *PE 03K3[03K0p Pp]3[03K3[<3K0@0 4 @K?0K1 :`@ 000S3033 T] o3dp0p|14 P=303@To3 `3`V㏏H0"S3R1  KC0 ,pK (3 00,0K,0K3 f @4  0+@K*K( {|(#t003 P3,00,0PPXj B p Br  -L M`@^   P00 K,0 $`U00(B ?tCn p-0QLM@`  `*SxR P 0P ,Vx p-0QLM@`  `00!010!,0?@0p?<0,0 A00 P!0p20A 0?A0S 0% 0! <4("4! < $ +0) *(@! 0 T! 0 TW(K0!0R0>0U;0U8! P 0 0S0S00@ P"0!B20T1 0U>0G0D!010?0p?<0!0 400000p00Ġ0U0V0, 0TW0020!0100?<0!0 000Sh0Kd0 ! *0 ! < - L0p @05 $P is0$ , P0 * 0, 0 (0 $ @ 00 .0P@ T`$00  0(0 00 $0` 0e0 0" $e 0 $ @ 00? -LMP0 R @p  l0 ! 0W0U V T0`S  0 (0 0 0^U0VR0VO< 0RN \ Q 0S[0A0@!0?30`0200 >0!0?<0040!000`000Q! 0 TP 0 T!0 T 0|`~0S  ` 0Hp0 (00j d|l?T?8<??? -P0 RLpẀ` @H 0S0800 0300#0! < $ +0) *(0! 0 T@00 @@ ""  0! <4("4! 0 000 # 0S/000 0300P 0! <4("4! < $ +0) *(0! 0 T0800 S0 0 00 0 z 00! 0W 0U V T0 000 # 0!000S0 +x? 0-0@L $0P0 Tdの0 T0 p-L@P4r0B $C $`P U_p0R $0N $ PR R @R Dpt?0N TpD30 0N Tp꠆`?D???(? p-0L@ $00 TP x0U 0 $PpD0@P T`$0 p? -LMp @0Tڭ 0T@ 0T 0T@ 0T 0T@9 0T@ 0T@A 0TN 0T@O 0TH 0TP00@0 T%020J T0 0!0; T0;V 0O $0PM T0 ;dX@0 0O TM 0T@0O T0 3 DT0R $   0 S0C1 000R $  M T0  0P@" T`$ 00" 0  0@PG T`$0G 0  0T0 T0g -LM0p 0 ,0 G QE 0㊁8 0 0,0 : 0lppl 0P`$@(,(0 c 0..p .̠p, 0((< 4("4! l0.̠..l l j!lo 芁 0p llp0@P0 ,< $4.4,$  0   :4PP  K PB?P0`  0 PP! `:PP 1, : !0` , <800 <4("4!  (  4B C@A00! 0GDE0F00 <4("4!   ( 4HJ KI00 <4("4!  (  4R SPQ00! 0ge0f0d0000 < 4("4!̃, ,,4kj_ \ ] ^ i0h0, <4("4! , < $ a bc0`0< 4("4!@0.̠.$.T 0@ @ :48x (  4 008 80<4x (  4 004 4 "4<x (  4!10< < <"8"4x  4 ( ! 10# < 4("4!  10...̠ 0" ! 1.< 4!4" 10...̠ 0d" ! 1/< 4!4" 10...̠ 0"< 4("4! 10 ...̠0p! 0Q1R1SPϤ a_p0d0 d 0, 0 , d1,0 S@h㷤p\10\!\(Ko 0,@0 <48 ("44 $" <  㳜(Ko讜(Ko tPT@@GR J0!0 PU@@DZ(00< 4("4!< 0Z\S0@ 1Y>0 1Y>0 ,$!$#< \10 I LS @ < 4("4!, !10\h @ 0Z? 02|R@ 1 Y>!0@\ T0  @Dh D2@|P".$2@|!.@2|0 S0Z/C1!PZ/B1! R0001 0 Pg?P1pPATP 80P80 mpP0) (\ 00: 1>, \  @0  !< 4("4!,10\ " @LXP @0  !< 4("4!,10\" @t<B8<@<? -L M4 l440%00KR,0 0 :4Q1 10pW# 0`00P0 @T ,00@,@ 0 g m0 `PR00SZ0S40% R4 hAT$00 0P0,  @,@ 0 fg A@PU04 l10 0P,00@,@ 0 Qg,40pAT$00 0P0,  @,@ 0 ΟW 0@@ @ `l"!13p mW  4 0 80 , , 08 10 0@ 0 $<0@  @1 , , 1@c , T W% 0 !0 "$#(, <4!4",  @Kfc I` 㧠A0t033 W 0 $ 0\04 $<0@ R R 4 @+0t03%5 W} 0$040 , 0400#@ @TF@ 1p0, \, A, 8p 4p 0 W 4 qe\ M00 ,P@W< $0SS(;T 0CT` & T 0CT  -40S 40,0, , 1@c , 0 0@P; T`$00;  @U W 0 <#0! " rD ,01mz 1p0, \ 04 T@ 1?, \t 1=>, \f! 0"4#8,@ ` !PM TK Z G0@P, \`,0@, 9D8T( 0CT  0TH04 $P5 $06 p$10!Rh 10P AT 0G?, \dHb\E]TBX>0 ,@, , 1 c<0(W 0$04 , bJ\D 4P 6T 0T05 $(0<0X 1p0, \6T |0T0, , !b4Q0,0es R 0B< 4("4!̃B,<,$,O0M NL 1=, \d05 $<@80 $P` #P 4P c0 00 ..ZVd1t!l \|0`apahaXaa:g`0@`003Ta@K00  x_ _ BT:6 -P0 L  80C 8(R2 d #8Xt$X -P0 L  80C 8(R4 h #8Xt$X -< <0L00\0  (@ \$X8;80@-8 0 0@0@0 0@0@ -L MA0P` ` ,0K "[P1RC R $K2[ kCX#X(`+p@  1 R0C8 p (K"[p0 R2K"[0X00@ 0   00   &0Kt 0 00@0@,[D <@  0'$\tD$p# 0-MLM@P80000& 1 R+ 1 t!0Sd1 KX!0KL1AKA AP(1K R000K003X000 K  0C,K 0AKA AP K00C S񟗼@ 0 ؈ ؈ ؈ ؈ ؈ ؈ ؈  000000000000D'D -80(0L 0 '0 0   p-0LM @+P-` x0 00> `P||0 R0C  (P 0PP8 x+r 00a=C4`#hl 0dx0S 40< `*  `0:0t'8'x? p-0L P@p0`   000廕2  R`* ^P00 S 0PV@pt##lp# -1@LP H0 `p 1 R 0 0< S\  SN  SL  SPS000H1  R Ԕ     Ĕ 1 8 0 R 0 0 导0tx 0 R0 R S 0 p0 `0 P0 H0  0 0 00D$'t -41` BpL R L T \ d l 0GS̕ ȕ < $ ȕ D  0 0JP<@ 1P l0l pᲀ\0 R    D -L\M4@KP  03K/P3#K 8#c[Qr Qn 0S3Q   2 3K2#K 2["[`0 2[d h0   2 ㌂#K3K0[[3 1C 0"Pr0!2"[0<P"KKK 7 Py Ps r2 ">?DFcà.L !2c N"10,Ϡl`P!PdP0PhPc 0` P@A(K T1   D1`  T!T1QQZ@K& 05K015K P-V0[@S*T0[.S'Q0[-S$N0[S!U0[S[#!BR[ O[3 A 1C "P[05A1!1 00 `p["[2[D'|<$ $@hQ??v'N$?? 0-LMP`0  @0@800@ 8H=88t' -8L@@, 000 000t 0-d3 LR@P H3R $<3R Q03R 20RB R3 00CR "2Rg -2Rv 0R- 10h)V0CRt 72RD >0R@2@ 0C 0h:0CRI l2Ry 0R X2@@00CR0 0R( 0? R2 0h,0CR> 0R1@@00CR 0R1@@01@@0 1 01@@01@@0|1@@0D@0 e  a 041@@0$1 0h1@@0 1 0 30h0@@0$D ; 0 0h 0 0R |00 0 # C###? -MLM1 0 p 000CSp(KBKII$ D .0T `0 S` @ T c pP@VP8K 8K 0l"0C4K02K#K t B("(04"43K@QBK0 5[[90K  5K[*K& [M @ 0 B-$[4[Q04KD 0 D B0000 <  [M@0 B ,DPt 0 P0! 0C0 0 a0 RB .Y0 R 5[TK< 5K06KNK {pPt w5[K RD0 <0BacT#$t ?'Bgfff -LdM∠Kd 8 !<(K1 (K:P> `@p10C0P OP  Vp W@P0 `8< 82S W@` d0008#88K@0 $K 0 0' 6S-LP` 8SB  "p 00Q8  X@#8  00Q`8X@   #8`@@Dt `X0 R0C  (9Tp<,?\$X -LMt!0 0 @P  @ 4QPE⽑uD q 0aR0 ` ( U3 0R" D ( R4 h 0X 60aP?`VP\\0 R0C6 l P0XU<'H?$\X -0L R xPx`x@0 $0 p0TR 0TiH$d`h 0-@LP@<40 00 @0@0p?' p-0L M @RP+ 0`0 P PEu KpUt 000\01KP01K01K0K 00P$'?t -0LHMp$Kh`KD10 ZK P. H(@"(D0#K0K"K0 0H00< 0 04P  {tp' ? -LTMl p _l @oh?` A4pQ  | A48/0 ɱ$? p 3p&PE?n*T  C>T N0CT R>Tv >T*p< 0lpX >Tc 0CT 0T  p0l0╰pX 4W. X0S x 6x\ 0. 0:0ɰ`h(K=T !=Tv =T5 =TpP 4WX l 5@p x xpAp4h=T` '0CT 0TpP0= R p  p X ,pP4X 0 S <R  R 0CR L= Xp0X,0p t p0X `,pP l 5@> < R: X7pP g㠌pPpmpX [㔌pP Æp X X+ypPX0 \U;Q= ;Q 2 Qp;  Q K0XpPXpPl 5 0"0p  * 0*0004K?4K T;$K NK:Q !0Q ;Q :Q :Q |:Q t:Q \:Q\ pL:T D:TF <:T0:T# (:T :TpPpopX 9T:p pX 9T 0Tl 5D = S @S 9 l0p%9 p/pX 8 Rp 010   ,X X0/ D9 XPX0 8R p 101zl 5 8 RA 4߅t8X 0X <08 XPoX 0 Sk !ɅX0 x Vxp  ! xpJニpPr !ⲅp0!  x gpP xX 5 Qp;|7 R᎝@_ ]P x &@N`K@&@@,7@4KDK dG$K HK l x5 0x 9pP(\6 R l 52p 6 R  $[l6X 0X0)   6 XpPn(6M@ V   e6!l%0@a ܸ 20C%Jpl 505p0 0S/ 5 pp6pX يpP4 R (5X 0X0, <5 R 05 XPX 0S >0T0 p X 0T 00bYp 0{SX |0 P\ d0 t UX t0 `9  |@h p h>  : t0 0$30 R0S   05 %<0 S  S  7S  nS  0t B02 R B000 C B0 2 R0x0 hHPx00x0p0\ | pPp0 T0 p0 X 0T 00b Sp 0d | Sd :|0B\0 pYpX &pP Up X X! pPrX(p C(2X 0X0, <2 X@PX p0  \)1X 0X0, 1 XPX0 p0!݉pPp 1S ?X 0p 1X 0X3pP!l 5 1 1 p0"p@ lpt?ii i5i i i iiii 81-71#%Ci8i|6i(iii8i i #AT#Bh gfff?Bxp##t$'ppX 3p2p0 ! pX &U a0  f 0 Rg 0 4K04K0$K NKZ| wP1Rc 0RP 0CRj 4PB XDgL1  9 0 R: h1 4K04K|AX0  2 0T X 0Z1>p,0Xp ꎝ@ x xP X 00"0X 0S00( $XD U"D2 RhBX0   0X 02X 0000 X 00B=00X0 T (0X +002Q' D0CQy >0QCu3Q. 0Q<(3 R~X B=  kX3 t ,l3 o i3 @j a3 e YX0 pM3  X 3 R 3 Xp;1>p,02 -L R6 l  ( R6 l 0X @R6 l 0X 60 d@P R6 l (T0P R6 l ((0P(K\X$4xV -L0M`P? QC ,3P 3QX Fd0CQd  80(P/ @rR8 p 0X R8 p 0X\ RL8 p 0'h2  0TP (K0S=0.`K2K0K2K 2Q7 0Q0ST2K?2K.`K02K00C SGD < 4 , $  0!02K0"Kx.`K2K l10S4 \10S* S[.`KK8!TK0@20pPK&/W?D  K5K&0 P@T0 RP 0H2K.`K0"K2KI      $$\X'!#((## p-LM`80@RPP<<0 R0C8 p 0&xx$\ -3LM PR@v"0 0!P$ 80"P4 娂 0rR8 p (0`P 0R8 p (0S (K`0\ RL8 p 0d&0? SD 1 R 1R 1R 0R d0CR< 0RP P 0AS@    (1Q% 0Q0S? .PK2K"Kt0\= R40 00 000 .PK2K"KV<8# $'$\X #(( -LLME0 PB= R0t5 RN B`P ; h1 0 0@0@(KDp0p P <C42 D@F Q000P@ @tP  㙐B= RD4Q Dl0KP6[p5[p0 `P ;  1 p0 00pC bp b3 R 6[* RV  RT  RR $[Qy0H# 00. Px 3 P  5[  2 R 2 RlK @P dS CT0 0S Sk S2< @>h<@0 fL,=  wA$[P& >K 8K  *K  0  0D P 0 0@0@|갤[>0P 6[Px lK0 <0< P 8 ^<00 0lK BM @ 0 p G*P 8 A00 @0@B= G80 =  K''##?l?H??(?? - 3L  8sc @RR2 d 0X R4 h 2X蜢b r0R2 d X 0R0 ` ( RP4 h 42Xsc 0R" D ( R4 h @0X1 Rd &4  1 R0C4 h :XTT1 R0C2 d D1X 2S0K0 R0C4 h 0X0 R0C4 h 0X R4 h 0X R4 h 0X~{t$\Xpl -L$MDD8Dx}/` `P, $8 $K4K JKP 1, 0R(K˯ FKW ` y70P8$ @! 0 1( |7!0@p 1 `  P 3DD7D'ᲀ0C 0'00(7 ' <07 Ⳁᲀ0d '006 &6岀 ?$K3K@@K0P66#[   6Q Q( Q +>3K (6$K P3[ST&000 ,  (T(6:@K3K 03K5 P5  [^5ࠃv5  P J<@%5ḧ 0㓨pu 0㍨0 De0y_0@ⓨហ  W$000>h$010m4 4@ Q 44 $}.  |42Q x4Q D$0 <004H   D4Q$0;0 = X3^ʎ04\`0@  03\000Ǟ=A 0c 00  0 0 c 0L0 20p 0b 00[R J20Y 0է 0bЧ03L (0D  0§: 0"㼧01 0㵧0( 2(2 P0À 02 P 00 0Ǟ= 0㛧0 0唧0 0፧ 0凧0 0倧0 0ly0 0Tr0c 0<k0Z (0dp 0^0g 0W0^ 0PDѯ렕n|'???@?+ #$t( @?$'(j)_eNap<-0 |0"32C0cPP 1S!0S!0SP~H -0L@P` 00㥀p@P 1;0 < -L@P 1ڬ 0-P@0@@L 00000 -LP\`@0Sp\@0^ 00g0   -8(L`P"x 6lX[M@T0 _     qhU ? S0-L@ P $0P 101 0 0h8 0h ? -LHMES, `Ph l0 (ھ0ᲀ0 S0 Nh0 l & l@K`pK!hK 0nPaK hK @0KdP 8\Da [0R 8 8D, 0R(KR0 Bh0 l ͆0a[ ⤟ Pp $@P  Y:<$ @ @ 000CS  l :0 0:0<  P2: < : :P;Uq8[[]P2@@O0 h0    h0hKⰀh 0h0 岠h0h0 ,2岐h0 0h0 }040K@@(0K {0 0B@(0K t0 0B@(K i0@ 0B4 K0& NR:00:0:0< 0R:00<0ĕ:0< 0R:00<0L8 0(寭 ,0S㶃 8  0 R  8   0S 㴓 8 x01h08 H ꠕn#0!? !?`!?H"?t!R 8 XzO p!1S?!R=~뒍$ YPP 1 8D  }`1瀪0 3z}0P8PD "2R:0O  1  0 0@0@<0!0 1Sq<p10q "8   "0% `P 0CpP 1<1202k"?"?.\'"?ʚ; - LPDp` vP pE 1‚32C0c0QA20`><@ ,=A?0C @300  00S 0 0=,0h 0 0P0 00@ 8 00 pҩ~Hx&$$t& !\' -SLM` 0 ʼ8b(K0L 0  0A 0  V@K0KPK P0SK 0KPP $ VpPQ 3犩Q> Qb 8 []P2  O    0Y,2ᲂ $ ڨ K0 K& 68  02 R@ 8 1  1!Q ʼ89| @p$|Wx1 R0S( S Y@PU 0  Q9 A 0R  R1Ḑ0 1 @PU @@P4D@T 8^  tPP@101At0@0\'#?<#?#?p&t&#?l#?#? 0-8]L@$P 0 R 0t0t P00h0X0 qP  x +>8  0h襦 R$p&$$ !$? p-CPID@DL`0 #DB@@0 00 R 0\00 0   R 0 0 0 @Ptt 00C0px&$t& -LM8pş@`h5P, p P5MQ$@| 0CQ 0CQ pş, 0R(K4Q :4Qpp{4 @T  0{S|㨐K˯ 000@TI 0|SE:|pH| & Kg  KcL4K0 6K34K3U K#4V0Kf KK:00 e0Kf K:0 f [(0K0=0AfK:0 f [(K 0=0AfK:0 f [(0K0=0AfK | pP z긠K  epPD3 V{@T 0S`؀K@T 0`S:pF K K3P 00D0Q 40> 900) 2 4 &?* p-PL`@U 8.04< XV V Vph804< XVph Uph&? p-`Pe,:L!;@,:5=54=847 0T8@4< 0X84> 0X P jj@k3S <0$03@T@l7S <0$07@Tp -LMⰧP b0Pe 0 0@0@0/"-0?0b b0#RO <0(C\E 0 00 <7(r\ 0 00 W2@7#<07(`V  $0  B< $703 0 0@0@0 0@0@7rW'尧R:;ü:7S0Ӻ: 8(*4@0T 0-@LPQ<<308# 0< -LM5P+`,:  7p 0 @0  BQr0CW 087(*@04T05 020#R KUP P0@DQ!0S*DpP  ˀ'7R 5;50@DP0S*00 @0@ 10R!!  10C1 10R!!  10C1 0-@LtP;,*  839,:5t0h383 <30S ,2)S,* Ph 0-LM'P"C0  @@RC0<(\ ; B$0   7G7GG8 -LMPP ;@P7 0!0 0 y<凁0g 1 P 7(K<(\' $0 <੕( \,  0 00 < (\ 0 00 Z v90,0 0G,0@,0, ?WA0 @<(\ 0 0 0 ,10<(\ 0 0 0 0/"-0?00b9&? -L@9?Sj7P -L M9PP0 S䙕sd3 0*R1z01*zpz0/"-0?0Qb[<I( b\pO 0 00 <(p\,p  0 00 X=1@w9<0C9(`V  $0  < $ P#$2 @R``  T 7S 0 0@P0@ ,0::pX,p 䙅p (K:S0D0 0 t!0Ca% BbQH1 L! 0 Q AC1 01*pz0 D:: 0 0@0@0  ,: ,0  202, :S 9S202P  ~ 0E  2022:S 9S* 00C0 0t  0-@PL YYYZZ0 0-L84@7 0TPPU t8047 $U ,:  84 0T0'? 0-8L#88P814` \@@sT 804` ,PT 0hs$'? -PL@p`rP#0R  0iqVT('!&!'!'!'!'! '!d 884#8Xiq 0f h j {b t<'? Qp-L@ plR 884` \PPsU 804` ,`PU zs p804$poX'? -`LP@BrP#@1pR  @qH$TUU* f U XU  F|qUwqU Ud 804(@hqj 804 $804h (@804b (@@t<'? -LXÐp0 6H804P@T`$00P dr804@PP T`$00P r804@PP T`$0P drȀ P 804@PP T`$0P  -LMp,  804@PP T`$00P dr804P $ 08#804@PP T`$0P drXʠ,0尐 -LM8pK@4P0 P T`$<<0P d]rZ*804@PP T`$00P  * K804@PP T`$0P 0"[0 X 804@PP T`$0P (K -L M80 "Kp@ `4,T+ RP# R@ !4;R 7(;R0 &R. !5CR7,: , 2Rs R) R R R&,: , !Rg ]R Rf R,:, Ro jR R] R , , eRp R, S , , 08: F0}0@:@:<*P3)S!0D\3 }0\3 D,:@ Q @0PK80 4$@TP#x9R p98 :(*O H9\ P#0S \Q "( wP q< Q(m}>0 `@ 0 `@,0,P; V(K0X3*K0C"[d86@KR0X30 0PK 00[S/0[S.0[S-0[S,0[S+0[S䗟ZS  +0[ 0+0K<7{ '2 4P t <0'0P7@ :(*l<{>0  0 P) <0'"8804S $0!0@\3 Sc !0\3,:0,:P#"lL<7'2 P@ ,<0@TU 2<'?0  B 5 P@ @[@Q <0T<0$ R R, Q , ,  , ,:8, ,: v, B0\3R R,  , R R,:Q , ,  , <$> 0⟮?@D0 0@ ,,P p@<>) 0D4 4P ,.<0 )0<> 0  0 P <0#8<)3 P@ |<0@T6 1<~> 0  0 PP@ @\@Q <0T<0$804 ,pB 804,00 Pp,:h" d2*1\2\"1X2P1!0 0B424"1! N ,:.  0 01!@31_@D#H3!1(帓 0̠50CT/  㦔A ᯌ 804@Po T`$<<0o P3 S804@P T`$0 ,:D "0V"n|@|t?<'?'?'?)8Dn!!l!|!(!D&!!!t!\)? p-LM80P4D ,*x 3S<<: 0` 0 `0 ,:" 8 <(4"4!<4 \ 8 <(4"4!<4 \840D \Kp84 0 \8@4 0\ K`P @@ԍ P 00 @  01 0 0 T -LMym /418 )  ,:@  004 X0K 84P 0T8@4 ,0\84 00\8@4P 0T%z98p,P`04 \8),04 \'8,0@04$ \'8@,04 \8 047 T :Ss P#1RC 84@ 1\84 0T8@<4D \ :S1 84< 0XD:8@8#84> X8L 04\P#1R 84 0X :S *l(K84@ 0\D*D|3804@PR T`$ 0R 05 @0;5l,:9,:84@ 0\t? -L`PlpD00 @0@phkp)? -PL@`pml<1T% 0CT-  0P΍@4T k0T 0T0/@4T5@ @k5 @ Mk@50@5 0 RP@@@ @@i 5i 6i( -:L@@`804> (1PP P`Pp DQ- W ,2S 804> X %7Pp` !00! 00p ,  ⮗`,:  Kp`p`  6804H \#`4 2 -@QLPppU@RpW?`0OOP$ 2>AB?D*PP``0O?0@@ cAQaQ p- @L`0T 0TP$ U  $8P pp -0L040 T -,0L8l02 0B6j -,0L8l02 0 B6j0 8B0 -1LMpQKP 0K 00`P 0@  T 0@`\ ڔ 0S 00 S R0Ġ T 0$ 04 000ĠBTDnvjXDn8cjdg!DDn -04Pp008@L `T0 T0  00C  0Tdk $.dk 0TP":P 0T 0T 0T 0TP 0T $0 T -0L`4P 0T 0T 0T 0T 0T 0T0S0'0 Tp0 T}N@T (k $  T 0pWdk}~@ $ pW k0@W}~ $0P0P@0T @*? 0-@L i04 00P T0hi -0㈠4p0  LT54 QT  $  0PT  0T  0T  0Tdj@T T! 0  T0S\ SxO!dM!N!N!O!DO!PO!N! O!  $ P" P!0000  T  $P00 0  T  $P00 P00@0S0 0 T !0 T  $P  0T  $0`  T  $Z0P  T  $0@  TZTU000x 0a 0 S0 00  0T  $q0@  T@0  T0@ 42P ("(Ÿ0 S[00 SY Q׽T "<  TPlf 1 R0  01弽幽嶽0@000?`\卾TQ0004国(Q 000|厽ym  $0 r0$ 0440 0S0 ji0 @0 0 00\DTDn0+?vj8cjdg!,?L]!4D!X!X+?D+?+?+?,?t+?+?+? +?hpBLDn',,? -@L `pPh 0TpP0 %TT0 T 0T 0T 0T0 T $i=g -LMP@pP 0`P  0<<0< 80@` ,0 $ $0pHDnBhpTDnB BPDnB p-LMl`h0hP P0@P D0S40000 0r$0@x嚽TDnBHDnPDn B\DnP,? -8pLW`4@P t0 0@00C SU!U!tU!S!S!S!S!S!S!S!S!S!S!2Ÿ 0i; @0TP 00 T0 T(40 T0 T03 0KSpږ SpGpӌ0Sd p0 TdFh $ 0Td9h $0S 0 T$ $ 0 T0 T 0T 0T 0T 0T 0T 0Tn $00 pTBPDn -LM@`pf}^PU g $  0 T00 0 }^PU g $  ie0 TDnHDn -LP `sfp $  $@ $e 0 TDnHDn -@LOft0  0t0e -LP@?fT @e0@`@<0 R 0p0S `e@谀 -PPLL 0RH 8pf@堀`T Q):W0  t0 oYe0 0040 TIeT*tt ` x p0 0Rp0x T<8 l0  2@ 0X6j< -L M80`S4@删  $8 , 8  $PP 0  0, Py0  , 0  , t0 0t0| R,0HG, ,l08"20  $R  $p lP 000 g0S^ 0g0@ 1 R4  $p*  $0U :x t0 0Rt0x T<㢑0pP0UP, 0 0 00 TPu(K0, l0 20,Pw 0 00  Tl000 00dl0 20,^6j5j -L M@d0pPtpx0p0t0Ed<<0W ``U 0p`建KO?@l,? -LM⬑P1p ,  A4`pdt0 0-d, 0R/(K|0Sʤ0 0 H0S t00t002 000 H0S H@TP<0 00 TB HR #KXPP @ D 0@ TTK00 TꠕnB< -LM#p0`0Q(@0P4,0 $0S T @(K0, R@pp  Rp  R*    p0p pYp# 0S $0R 0Y0! t@H"2d |@|@|0@P0C|0 8WApp0,00 T, 0T0 0Si $0KS00, T0000N 0N 00$0(  0 9S0&6R l0d!20P  0 00, T@n,0 T0  ,T)4,0 T,0 T0,00 T 00, T,0 T$0KS0!0, T0, TB,?6j -LMŸa48@, l ሠpPP(K0 P`2Wh T2W4 @0CW6 42W I1CWd ;1CWJaP 00#3000000000 , , T0 00 0 0 0H1WG 0W0 @00, , T1W 0W000 000 000000|0  @@0@@@,  @ LD ,0@$P@@a0 0B6j]t@yt ktzt lt - LA8P4pt0`  0  l0 20 bt0  t0 0t0 a000 T<ҎB6j - (LM(" P4 80 0qW \b8P@UB atX5X% 0 px   8``PIEb , R; t0  ,a@(K$ $ 0  0 0 0T 00 T $0  0tt4  0S ,Xa@\#3 ťt@P t  t0S  ,5at@́t@X3 0 0@;K<<#000000900080006020a0, 0H}  :A0 4@` Ql!l!k!,k!,k!,k!,k!,k!,k!,k!,k!,k!k!X2 T2  @0T0G 0KSږ S㇀Gӌ0Sb 0 Tdb $ 0Tdb $0S00 T 0T 0T 0T 0T 0T 0Ttt00,y` 8 l0@P8 $0 00 TO!B]!_!D6j+B BB6j@B p-0 00 LR`#ڔ0SP00S PU@ 0@# 0#8PV<⥌T⣌lLpPvj8cjdg! 0-LM0@SP ! 0 10 0 R<0(\  $0  B 0(0$0 08P -2LMP0V/,1 1b !, ^'`    """Ƞ  (@T x!x #"BPT1 !/b32Cc,0 S9 $$1 (`#rBV B=C@  0 h00 0 R00Q  , $ $!,""̠" $0D ` 0\(KT*PX -LMpA  $(,    $(,"(*"* R   $(,, """Ƞ !(@T G/ #"B 00/-000b 0 0P( 0C3`j\,  00 @ t , 1JP 0L$Q00 808 ( 0\(KPlTX0@ 00CSs!s!s!s!s!s!s!s! P P@7P,@nPX@l`0 $H0AhSwu!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!u!0 0 Rf Q Q0-L@P   0@T  08#0`08#0@jPj$x!x!,x!x!x!x!x!x!x!4x!0@818!8!010!10@!0` `Vj&0 0(3 0#2 uG 0 X0S 0 D0C @<0D BD0s DT!!TX'?p/?/?/?/?0?q'='=!!!<D!ر!|!P!!4+<:$0? -LM0@S  # 0 30 S80(\  $0  B 0 0$0P0 000CS!!!!!!!! P P@7P,@nPX@l`0 $H0AhSw!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!0 0 Rf Q Q0-L@P   0@~T  08#0`08#0@jPjD!P -LM@0 p! 0,0(0$0#aB0  0 PP ޛ|(K|1!,0K0 0 *,PP Dś,!0 ,  04PP0 0  PP 媛妛0, @  >P W`ʹV d00 0  0 PP` 0}(y PP4.?X.?.?|.?.?.? 0-PA L!rA 0@4r^+e@AB(@TFG0P@>0 -2"LQ`B 2QB 0@1!8!1!10@!0` `7d1!1(3!1#2!VJ  X0M1  D0C|!@<0D BD0TABB- P 00hÚ  _p@$P[0P DU=0@@ PM0P U=0@@@0@ T=0pr0?0?q'='=H""\"<@!x!!!"4+0?0?a'= -LTM0h hPd c7(Kh dp0 `K  @  : @@ ,a,qP 0 ;C*@,0 T0Zd Z p@P0* `, + 0pT Wdp0 R8hP :0h-[0S0#0Q0 000?TX,?,t -LKM00 H! ,0 /0 0@0@ 048<0#, ##$0(@T ll4 00 #<0@4  ! ?  a 4 `( 0CPC0\p 0C  @0  0 48< @<L1 S0PD1 ;L!xD1 a(\<   $0 L! 0$D1  L1000 ;P@ <D! , J͠ -00.  /00H10 048<#8:#:0 0 RH TbTr0*,0",0@*,",PP@AJ͈0 @!  1!1 .0*0CJ͈@1J$ K(1 1L \p<@ÜA0 S p g c LA ]0 %W? Q M   G0 %A? ; 7  20 %,gl 0SS Z  ^0 m?=$= -pAM@AmL4`pX]j[jZ *8!!!!P!8pGl8HS +\'l(RRA RC R 1  ^0}j  08p8pjU@P0*,t ,0`*,4< \l(il(h<TXd0 -LUMtȟ0, T1 0p@P! H f HP  0q(P0820003\Q4 4 8S @! \7` VXþʌX 41S S ڬ8S S<  T1T2 àd1 h hd@7a4ǟC-|0C`P B AD0 0 0P0`P@@TPSJ=P z?C@?@41&067 0K͇ C ADP0 hŸ  04 P`J=P 0"z?C0! 2K͇ 0"0 240C$ ;.\$0$ 0;.\TX_ -`P0L@p ,0 \W 0p ,8#8:H \00 ,0 \TX,( -0 d@8`Tp4 P0L<4 \ 04 \TX -0 hp@8LX`4 P0<8 \0 84 \TX  -XP@LPp`D ,\80 00 \TX p-0P@ 0PL`` 0/\\8 |Ph Ph$0, 01.\pfTX -NpLP @l0T TH6T8 404 \1`V@>.4 6.02/\>.4 6.02/\>.4 6.02/\`0`  08".\<0< @08.B\TX -0L`p @P*,0 1# 0*\H@`@P0AK ,0 \TX@ P 3" 3"3"3"$3",3"43"<3"D3"2"L3"2"T3"XTPLHD@<840,,?1?1?1?1?2?2?2?2? 2?(2?1? -|9|Ix9x)QL -XI   4-3,  4/3.  4013  K(@xP8 P 4U0D@8(QH 4#(Px8R 0  P8 <8  (88 8P 8 ' 0G 4#8S7'000S 7' 0 B0l7 ym`pO@@)W 0@ 40  4X706p 0 S00ƅ60S060ƅR`m!`pO@@<`V S@ 40  4(X706p000S00ƅ6000S060ƅ(Q`5 0S p4# R m`oxU  @ Ȅ 00< C<S0?!"P0 0< C<S0?,"Q΂yY(`T/ 4$ 8 4$ 9 D4 $ : 4$ ; 0l$Sh4 0C  j @4@$ k $4$$ l D4 $ m 3# n 0#S3 0C  # #  ;$ 2"Qp3ʗ0S`3  X3 $ B% <3<# &  3 # " X2\"ŸQ2 {0 ʇʗ0 $0C0S" ʇ0 0C0S 0ڇ?0ʇ 0 00S000 00S00R@0`@00cpp$2  0"0 0M 0S~ Q00 1!0Sr 00S00m K8@P0 P 4U0D@l1l!-,PP10l0D!Q 0 T0Qd0!0D08 0'\p0LI"'L(N(P('' (( (`(((((((((%((((( (!(#("($(&('(((((((((K(UU!"'TX,O"5' Qp-L` @P0 ,0 \0/,;00/\pp@pP0 ,0 \0/,;0/\pTX -0L@0p ,8 # Q  Q Q 0$ 0 \TX -LM0yP72 8K ա `0 S@000 03 K!Q3K93K#K@ptP0 80K4 K7pK0+0 0t 0 ( t ậ(KT@=Xx -LM0@Sp Q(\  $0  B 0$ +80  0Q 0 `0倀S`  (PU $00 $l @Q 0 VP -LM0@S Q(\  $0  B 0$ +80  0Q 0 p`@pT`  (PU $0 0 $ 00@@VpPh -LMp`@T㈠  (PU $0 0 $ 8  00@ @X`01 11Ph p-@L0` P 0 =<0` fa @ p0o0 ;@PT0  fba @ pP0000 ԗ ԇ bbfa @ p(((( -(LMp"h@@!,dTw 1!!,dTj AWQ( (40! \`0 0;  0H!\W@1!!,0 S  Z@d+TP` 0\@ 0\<T x`xp0| ,@\ 0\P08 \14C@TTXppp 0 ("(PgK( -LM5P@`@-@5|q=5E 0\a0/\S0,!,P 0 !\ 0\P0 0; 0 \0@3A4@T]  Z X0 R L@0000TX'L`8@0 -LMEUh&h 0,` \`p ;p * 0\` ;p * 0\` ;p * 0\` ;p * 0\` ;p * 0\` ;p * 0\` ;p * 0\` ;p * 0\` ;p v* 0\` ;p e*0 ,0``,0ԢSF r@A0 \ P ; D* 0 \ @ ; 3*`VZ  0\ @ ;  *IpQa 0\@;   *0 ,<ʠlj@ Ƞ 0,\ ; pG)w 0\@ ; ) 0\@ ; ) 0\@ ; ) 0\@ ; ) (KTX -@LP8`-#,00 81-\@@)}T Pp0-,0}T ?0?S Y.b0 ("(,8 # TX? -LMlalQp+8\L!L@0  *t+0\@0 0; +0\@ 0\ 0\@0 0; @@)T H0H +, T(}<TXlp(pp0? -LM0Q,Ap !0\`0 0; PP(U `̀0/,@ U|<2(%0/\Q0 \ QX00 '5' (TX Q-L !0S0Q@@̓=0 `p@           0 0S  S 00SP  S@ 0  p@     i$ =DB''' ( -LP@@'dT l`lp0d ,PdT  4&#51 \mzTX ,? Q-`Lq 1p0S01 1R0S S0-=Q0  $7@`P dT1  @@ d00T $7&0`0S  T0D@@   < -L` @f$ 3##,x3 R 0C !R 4DCDS8#\0,#, 0 #\S@0 @&T r@ 밂0S( "@D ; 0@ @  V D"/ ; 0 A' >2 !R[AQ0E/,0E/\1 R^ q0SG 1 R 01 R l 1 ?d 8]1 !R0 R 1 R0 #H A 4F |00S`0 S@0\00S STX ( ='5 ( (''''( - K@ L7 bp >P 7 b ? @7 b V W2 RrR KP 2"/, 2 RRR wKP sX2X"/, 020("/\2"2"P \S WF1 1P \f Aa0!\1!Q> W$1!Q!!0Շ0՗00.0  B+i"R $KF Rb KF  ;0! 20 0 0P \P$P0/,0  WL :0 0.B\P$ W (TX(''5'(p0(VUUU` 0-LP0 fx0@PP h0h QT@TT0he"0'p0 -LM }2 ,p Pp  0 `Pb !M,0K0@0 0 *,`P 4vQ 睝<,  ;4`PI  @;`PC (\ 0 0; 0,p 0 p0Z000p BAD0m 80 0 0 ~  mM ,@`PPn  Lug(K0u$uPhX.?l|.?2? 3? -LM` `p 00 @p  0 PP u$K (0K 0 0p  ,PP u (  ;4PP  ;PP (\ 0 0? 0,  $runuP.?X.?2? 3? -LMß5PA0, ASu 0BSxp"Lr"Tr"Lr"Lr"Lr"`r"Lr"Lr"Lr"Lr"Lr"Lr"Lr"lr"080 0022< k< iR} H3H# 0 00t00S* 0SS   S .4 <30K2 K4K.x. x ,4,`1K0pK/K.K-0K2"<0!0*040Kt0p( TBTR0*,0 1#8 3*\, 0Rw(K080 8 8 < QA0aK ,8000 \PqP0 00tl8S2 @P 0Pt P0tl0P00 S̀ ,#,430K2K1 K0K4K-K.K/Kw.4 <_  3 K40K2K^@P 0Pt P0t9M렕nTX= -LMp: 0C0S P h Gt`P*000H: Rr/\+9\@0 0; +<\`P9O0 ᤝ9\I U-0 s@ ,, \$9T@@dT h숟0/,0 dTs =<`s 4p8p(.B,ds~>/\@/08\+7\@P ;P +<\@'0\'0\@ ;P  0d'\\G(W(g @\T,7,'Q00 , @@ZdT 尦0 ,,PdTpd&000/,@0}0/\u-B;\ 4&0\@  &0\ r0`PE\ 0P+@; )00 0P*@\E 0P+ 0P+@0 *00Am8`^ĄĤ $1\@ @0\ P 0\)U@0 \ /0\@ /0\ @$@4\@@dT Sc0/,0 dT >/\@0!.\ [ K'@7P0A0S @Tt3 A QR}T3R 07@3S 01,3B 0T*R0S0"0 01 0S&2 0S  S 2\ @2x"Q` n2"Q(8p0A 0r먁0",!0 4!\(10P xZ`P',0\@/1\0  `1 05;@05( 8S   5\0 \0 @21C! c%-  @IT`X-? (TX(02?$1?(3?? ='p0T3?(ppP'L(N(P(''5Dd'80' -PL@`pY1T* x1T4 p1T  j4P@4 <10S01T4 0<@4T@505 0S' 5@ @@@  84P@8S 5A0AS@0 =@05A0AS4@Di i i ϖ1i 0- 0%-LQP@AT@05 0h]8pb00 @0@0p? -LM` p` 00 P`  0 @Pe ",0K 0 0`  ,@P pT p`,  ;4@PO  P;@PI0, ` !꒝P;B  L @  2@P/ Z, ` -00.  /00@* Ԑ!  00 0  @P; np-(Klep`apX]p7@ (\ 0 0; PX.?.?2? 3?t3? -LMH `0,0 H1@9L! rD 0SZ P~ 000S@ \0 < 0U0a 8ȟ R 0041 h8pZ 00UL<8000H1P ^"40 0@ 0 XU 0$0 &!4"0 0 H'00S0 0p0PS0000SlD!DWeHD,  H!0PP@PP00 0!T 0P 0( 1/0  ?P8! PT!00 06&0 0  0D0<1 S!4 0 0(P,@U+0 0  0PE 0 U %!4000/"-0?00b0 2  00  !40@U00 0 0 09#$ 0 P TU00H 0L$,B010(@T 4   b00(\  $0 (\ h4 $0 P!T0 001$D  ?8#= ?  c?Q C3<"0/0\@ß, 0Rs(K8 ^ 000Z*000(440#,2 2000008s8 (30041 U30 0< 01 <1 2<   @`0 S8P0 $NPPH7@ 049#$ 0@L!80཈841 cH1 R<; Y13Hޚܚ7@G _nHҚ|"1  0 0<1!0!0 0= K0L$1 H1KK L,1 ( $mH 0HH쀟00H 0埚   0@P 00! #0P 0T! 0( 1/0  ?P8! 0 $y7@"HQ c Tmoꠕnh@=|<Pt|'l'|Th''$=&?<<<= -LM5P=@S`0p-  1R0' '  $8$80C0C$8$80 0 P  $ sP=  05 É00 @0@P1 RM > RI. 0@ BT0S*8S. 0@ BT&0S* 00S:A BT  1R0! !  11D0C0C11P  # KH@P 1R04( 8(  t8t80C0Ct8t85;5h -LMP0 200"00180 00/3<0 ,8<0,  01!00,0 Q4 F p01ᄑ0 @Tt ) (`V $0 0 $兙4!00@ 0@010 0  00/"-0?00b , AR 08< 00-01\ 0?Q0 02@0   84;8(KoTPh' p-8LS@0` hP8 0# +80p@0S8 0C000C0!0 Rd -LJM6 , 0P/,6 @ @ *00T@! D1 50P6 R D@D N?K0 4 xD{ 049#$ %0(@T 5 00# 0%@00@Q@ 5ş0 H1 (\` h5  0  03 0 48< { ;P (\A 4A  $0   $帤0@ $4 4 0p;P< l$ p,0H!0-  .00/  @D10 04:#:0 0<8  @@  81081  0@E3QO 0RࠓࠃQL00 Xx3 ࠁRG  0l#0 0 E<3 0C 09k  S{ "ͅ==C$ KKK 1L1L ,q (1 !n 0002Q< X"P0t"0C07-B\ Ÿ, 0R(Kߗ 2 2  0p;Pn H,0 0-  .00/  0 0@0@>D0> h00 @0@w0Sp"`"P""L1   @TK@2A p\0 [0 S00(4ڋ$q ,0 ,P\0 2S P UZ#0  0N \ @\@DJ0NS` 2"0 P`0, [0 S, (K20  @80H00!0+0!0t@=T -pHLT`p` XL""h"h""TAQ0!,8`!\& @18pl8S '@l(RR' R) R u}8p  t8p8pT ^yl(l(TX<(2! -  A [ -0LM PR `p0 ,8S  0h x 0\@0 0; 0 0\hTX"8S S0❉ -pqpa0PL,,p@ P,0\   @" %(+ .       @       ~TX 0-LP@Y4P 0p 0 |" 330 2S Q <0 5A0AS 0{0@=h 0  0-0@LPY2@3A4@T] q0P 0l AA--,L`0 P|2 2RR8  fQAbUA@PM-U 5 R6 M@PJUh1P/UN>0@H1 @!@1(18!810@1!0` `.1Y1!1(3 0#$3 0(#3 0 #3 0#2 V < X0_ 0 D0C @<0D BD0 0hRh3?'a'=$ =q'='="0"l"<"\")")"H*"0/"X0"p"1""Ġ"4+<.<3? -A=L M P `0@@"dT X2X"X B,0@s dT h0S!B**("(B! ! o!CL  ("(0P,,("(0^ $,       tL  ("(,iTLLLz("&+ 'U -0LSPp #0S L+("(+@ @@Tc_M00:C d3@T0SPcSDc@0 @pT Rc 0BS c@0 @_5T RJu .U2@T* D @B2"Q  5 1T2 0C R02  $$"h"- -("(Z  aK00 :C @Y TaALD00:C 01@T|aJ109C \1@TdLa K10 :C ,1@T A 1@Ty@ \p X Tk `<`< H D꘺Tv+x===*== <<LPnO),'===5 =5$TTPPI=aq -@L  ' ("( ("(,h, p-LPL@ 8`("(  phsQ 0S0#R Q 0  F=0 $ -L@h Q0-LP n? 0m/00m?@C q0d f"\0R 0S 0m0hRyn?p "("(RTP 8#8 0 -`L] 08# = P-Lஈ謈 -LM0,  㰐Რ\Ppp` `0eS0cS@`VP0V ( 8B(C62 ~0P, P0-:@C,S 0C8:0?S?0?0 Q p-LP!h@f@P P  @{@Tp 0-41"LRP 00! ,0S:0C *0b10 0?A2c>S@>@OL G$( ,0S t h \ L @ 4 ,0hP Pgfff  8( c31 0P @PP p-0L` 0   8P@0Ch h0P@@\P* phc(PK$H HP  0- 0LSP X@ @00\T@ @ 0tT0 -Lp@0P`  0S 8$#:# #("(X 0S/ X (" 0S"ڼ ("(, 0Su t , \0SH XP T 8 L$H=08#8T " *=08#8" b/=08#8b/ 0S@ AQ4,\0SC/4\封0DS;#HM- ("(8X#P`0@ p  |e w0 P@^ X`(08#8^ $z*("( YO~a'\`+ (-L`"X@p  4 0@(T"X 0 S R10lAC 0CS? 0C@m@S@P @ -(0L("(0*(\A- BRq0 /h 0bS1b1P# &L#$#&Ġ& 0`@ -pLtP@`T@ @P P,@ 8U4U 0-H0L0P@0 ,$0 0 $#20 0\0!  r 3R0000   -rL@z@0@P00000 Q0C @R000PLkN -Lp`!HPY04 4 0P(U"H -H0L0@pPK/\`,0K/\ -L0L0P`@K/\p,@0K/\ -pL P`@!1 $O\H@0 \0@1 0C\\` -L M$  0@  KT -L M@00 @K--- p-8lL@` 6P#81-BX`40, 0`4 XVp\`",P+@P P -@31CLp`PP PP@0A҄T  008#`08#H0Baຄ(0 R 08#Mbf -0LϠ̠ 0( 0@0l 1 \\` -@0L 0( ,  P\ 0-LP808 @ B,H@@T0\`5@  0\ -0L  -0L MP@ (pK`. |"K |@ 0! Q @- TK p-L@cP2U  80(0PP  @pp4U8U -LpA`@ 0#0PW@ @p P@D  I @B0@ 58U4U p-`L@Ph y%T s @ m(,P U hp蠯 -@!XL<p#X`!O K E ?,9-O`Vp \,, $, ,  -LM0@  *KD0 { *K> D` 0< 40 Y`@ @I@I``T@V`F*K,K z080 T0 T@@ D,0[  + [2[08S9p 0^S ,|0S>0@``1@T  :`P@ >T KQ0@11Sʜ2TJ01"0R 40`1p@ t` RPT`<0R4 `!4 qt`PCD4?4?P =4?= -2p"LQ= Rb0x"X0/(HD"0X0,"(@>ʠ2,ʠ#$N 0R10% R. R S!1P\E S0@T@ T0@@Rxh10d1P \1PE PS81P* 4S00 110!S1 !1 1 !111!11010,@0T@000 10!10 S000! 10t0110p 1T0!1| 01!DC\`5?` 5?P S D5?5?0#|#"D"li#L}#\# """"("*P 5R`BR0 ,t2)[h"0`2[ B0 8 #X,2[A- SZ 2U  0 S R Q`!1 B PU 0X 1   @t0C!! PX0/0"0)[0L!L1 @@T 0`P ) K!c[1C-PP 0P) [Q)0[S4 #0  Q`Q QLC= xQ`CC  `<6?JH=6?\`C(=7?F@7?`7?4?x7? -`@p0PL.,1 010P,00 X |0 R lVQ,8\0,,0000\`7? -@P0Lp.,`43.\.,0S@@dT @ P dTQ<\`7? -p@圀0P`L.\,0. 0J/\0.,J/, o\` -@pLP>.(0`@.\P,7.0S8Sw1 011 01\` -LfP p0@P.\`,0.0., @`0@T H0H J/, $0TnP< \`'7? -0LS8S!tpt0P@.\`,7.0., B1 01\` -LM8K`P@m  pp#[3[,K0K@P ,@ 0P C[ " 1R 8#H2[3K3[CK3K :(K,P0QTQ,0S0 A0C A@,0 0 ,0 0 @ 8#HT,0 0@,0 0 00  , 1 B !H, 0 P P -LM1p@ Nx1t!QI )PKX PP 0SA p P;)0[( ['[&[ 0  ?0? ??)0K( K'K&KP"[2[[00[00S 0C1UA% KP[! a00B1Zc?0 b c!B0 E$KZ AP`0@0 0HL p-PLE8`S ph80 S $@~00A <& -@0L <4,4!Z Bp`JRPP0 88 S L23:I^Oh1@`0 4`NX0ZPF) V/0 88 S-*Q ^`N304 8<̠Č@ Č#<\0ZPFV  tNdN 0HN8N(N\`h8?7?8?H8?(8? p-L!@`mPP Q !ePPpNp Np8?8? -X"p1L0C #a,B4A\VP"<4!4 <Y/\P ~V@Qa@L.1,С\Y/9\@.d1\X @P8!<4!4 <Y/\P JX@P`J/0\@.0\@@3T `吀0J/,PU Th!N<0J/,  JP(N\`8?8? p-LMRP`@"iT 0 $(, <4!4"<NS  Mx0S  `@Mx H0Mx0S @ @Mxx@9?|9?9?9? -LM1!pQL (!1!@P!X`(10! 0S6 1@1 0S< mO(K 0PKm m 03K02K 02K@0101)1cP`P*Tv v e K0  (K0Sڸ"p0Rv ("(vl<EM1@01L\`{zP 9? -L P` A 0pw P M@ 0f P  M蠀0 U@0.,1 S 0`` L0J/,P 0,$ LUU:?UU0:?\`D:?<=h:? -L;A S ################################# M:?H[A@[A:? -鴁Q0pL!,@ `h!8\@TB <10&088#8#8ESF0C8#Ƞ  0b8#Ƞ\ 08 #(Q"(0S%48U# U Kp9S:0C8#Ƞ -S.0C0C88#Ƞ #Ƞ U 0Uppp|0   P 48U# U p U (0U pp p;?P - 0LSP 0@R`p R0Sp0"R 0@`p i0S 0`00@ p@0@`pJP P(;? p-`0L`mQL[0@0P0S 40 $v00 @TpTX -!HL`o|I6$ᘐp 0II0C 0"|0A@@ l0@hP$u Q 0je Q$08;8<;?XT -LP`p0.,@P]/ 0,0$00 @0@8 0\` -0LMp0(`\P $ $0  B 4@T , 20 x0/"-0?0@bV4`XT -x0x` tP00pL ,J$JA1 \8 0T\` -L`0p@R0h0 1 ,:#&RS R @ T xH T \!TT0h0 0\@$$0h0 1 ,  @ T H T }0h0 0 0\ 3 $0 01S=<0@P0PS `0 $t000S gd00U@0T\`L;?x;?X -QL`0p$3$001<@P0PS 0 $tQ:d0 @U XYx0x  QL[(@(P0S @0 $xt 0 @TX(T -LMp, , ,3$00PPU0 "10 0؁S=<00@`0`@  0 P , 0GU S=80@h1 `V@, l (K,  R, ;(00@ 0 P @ G,@@T a 0fQ<000 P0P 0 P p GT L 0fP 0P U0,  X;?;?;?0Q(T -0L M`,g0(\ $ $0  B 0(@40P0Pp@ p@U@P0(\  $0    00PR KTX -$300 1L@ 0M  0 hg0(\ 0 $0  B p0ppp@Ph` 1 1\$OH 0\HTX@TDT\0T` -p@L1g00S* S0  ,P` 80UaP@Lo10Fo\0\ .B, a00PPP `@`\`=8U 0-L MA-0@'PK0B8 KPP Kh0h .B,41C  c800n$0 P\`R -!L M0p0KB8 KP1!Q A=  0 R'c0CT!@P.B\`,8#87   00S/ S0 ( 0\(K7$000" c`P@#9 \$h 20a #9 \00( ( ?\D!C`\?BC -0@00L p5f|2fH0 88 0  @R00<<O$f81|1 -L0M`@#VD@T@D6,D@T(( ))("( ("(h`  ("(D<4&, 0Szp ("(zz ("(zcdP7 zz { ("(xp%h D ("(,$ ("( 0 ("(}0 ("(tZ-pY.lX h0S }*("( \dt ("(LSDk@$4 Kc` @ ("(Az, ("(z2@K ?e03K0K2KJC  Cp  {0SPP@0VC @ T @D0Ÿ,C @Dt ("()("( 0SU@ᔢPBKp 0 @TPڶ%[%[(%[(K "f@BK @TP࡟@DBK@T. /   ,("(h`@ ("(H`@ ("(`,("(ypP {D HPW$HPEpUW  DpP {,p HpW$HPpUW  ,==)="x -8L#8MP@0  *K< 5d080 40 00 0"p0"烀<8@`H4 R Z  !*K dX_X080 X0080 C)(02R  ( 2@8@0 z10  !*K 0pW4000S40 0 8(K)h @P *K c C,1Z 080 @@R ` @ C)(y0R t N @0 @80 *KcZ)(C_ d08 8@0 )H @*K c CL08` 8 T=== -2@0L`CqkTP p1%40pP21C0`0gSp 0-P@L00 p-@LP`P P  ph phC 0, $  @ 0 @P) >(K 0,  04@P  0@@ @P 0> 0, 0 > 0P 00   ,@P s> ,0,  :4@P d> $, @@:@P$0, 00( 00@O> 0, 0XTl=?D=?=?=?=?>?(>? -3LM`P ڤ#00Q-0  1Q8 h30S<*040 00 ,0 PBAD8+ @  p00  0 p K0@0@P 0 @PPU ,;0@0p 0 @P3 =(KSCh"UC4 00 @ Y=p T=kP=gL=cX>?()#|"#hG#$#"<"F#L"0(#U"!#x"4""0"""$""",""H>?l>?>?>? -L M -@B , L.[@Q \00HS 0\ 0R B0HSQ.B , . -8LS@ 0$ ,XB }hQ# -pQLP2 8@$1$!!(SM)@` Q Q  T0W0  Q+ * S (u`V@0 0 XR 4hS e\0pQ W W Q Q  0 R  \` 0-@A L$PBA <?U0P0 0-5 @LP% ` 0S 0CS005 0hE)0(c<00 @0@Tp)? -L M5P=@S`0 (K3 0 p240 4 00<0S0(AR@q8S  1ASNq B00St2p l2   %. 0@ BTm0S* 0, 0P  `0@KZT ,0'P ,Q X0 0@0@ )̠  0  S p`T 20 40 0A@T:0S* 0 Sm@P \P, 6 DP  , Kd@Pv , - X1@Pb Z ,W0,0  10R''  $80C$8 10R!!  10C1h5 ;5pc)T -lplP0h`@L (L0 '0 X 0S  h8\` -PL0@p` ( 0d X0 0 0 ?/à€0R , 04 0m\` -0QL0@ 0 0@0  `R0 0R^ ^ ^X 10 h4;,0$0@nDU=>? p-1LM @R Z 0SV xad!,0B$f2K!K<C4S̈́K1K* PK R00L 0\00L00L00\0 AQR 0\Q00L00L Q00L 0S PR  4S   Kph0S=(000 \ L 00?00 10C 0`Lr=~=W#"DU -0LQp1 "0R ,0S Q00  0@PX`&>@8#8?.O\0 0P@X`&>@8#8?. i9:P \??\= -L,Mp "JKT ZRKb3"ЃR0P0  *h"3R` +#`@ ("(R+@T`\S@ ("(R8#@6#8S!h1P1 T R `@T<8P#X/ ,0"8#h@6#8 S11T<8"#X, ("(/"@2R $[;(K+$"*"$[ $[*#[5$[$[$[0"[C"[zR"[ RT h1T0`!P0/X *K5KKK0KCKzK@TK0P/(RP 00 2KT/h0X3[X  52[  zPP \`?? -L0M,0pS ~((^v'W UG0'(X 0`P`'X@(98#88'@,7%.0D@T@D7H<0D@TFV0&(T 0/(P 0SBzp ("(z4K Y03K0 3K03Kzz 0S  0 ("(0  ("(z ("(zz8#z 0S ` @ ("(050%@P/X`(:8#8/z ("(zu$0S0 ("(0 ("(t X03K03K 03K,0S Rd ` ("(RACZ ("(C7Z-aY.]X Y H@8DQ8 X0 c`0tZǡǡSӜSLWH#< 7(O(# /@2.0D @TRbX0"X@T0"XP0/X@x2<0D @T70 ("( )("(0SZ @PLK` 0 @TPN(K褑@LK@T.  0SS) S' SS9 `@ ("(`,("(쐟@LK @T0UC e,,("(@ ("(kL  u)\`==0x=x -L$Mp@4G.D@T@D>Ki@TCS0#(H 0#(/(D 0Szz LS0 %@ T7 ("(.) &(() \ X 0Sxx) DX 0S@9  40)T ` 0 @P)X`(98#8(55d (5 0 ((P 0 /(L 0S S@ ("(0 P@/X`(:8#8/H 0S 00S w's+'o00SP bl'^QI ("(Q',0S R C9 ("(CX @P@Z-:Y&6X 200Sڜ\ %|&! 00SPr 4& 00S_ %-XP 00SژDX @t%T0 㣤X `PQ x v@Z6-Y$X 00S $ V00St4 X$ C00S $ 0-XP z00Sڼ| m@#hT0#TZo:`Vt3/R00000#[T@L3@(K/B00 c 0Ÿ ST@D0Ÿ6C @9TBRP0"X0SHd 5'Z 0S1 00S60P@,"X`(88"a@BPK @ T\ X (Ko!H` 0T0/X(KL0/Xl1 0!X\H 0SHx& CC ~\ X ` T  0T0 `0 0P` 0@/(0T 0/X0X0 \0 @=8=,=) P\`VUUU " ??" 0R00 /xA!` -1LQ@p- 8#8 *TI``! 0 PX`@>@8#8?.Z 0aP@/X`(00/} 0 R! @0P` 0 P@/X`(;8#8/ E@0P` \`T -0L  -`PB}pL@P U! 8p"P!l8S U%  1U0 U A <  0! `2蠘'|0{p0  l(R R 8s}i 80A $c  l(HjT$??@U -@L)3+|0   u hm -L(Mp0"JKP0 lR0<@E@U08%(98#8%X0/(]*KY5KU`KQCK zKRK0K 0 CK0/X. x 3[# 52[#z +#*#08@ #[0@| ,L &"(`$H D (8@m.#0a /"Rb 0/X$[*$[5#[`#[C"[r"[znB[R@BK00 R2Ka 0!X0 #[#[}#[y#[u#[q#[mP (K! ("(`/![t1e#[ DP3[T! 0JK9K5#[K((X3[`  D \`x) -&`L>pzX ("(z, 0BSQR 8FP  !??`aˆh\`@P+ -0LS`p 4$Q 0$Q DP P&LU@5:,,("(5LD2S 00S=ڸ2S 4$0 $X,("(*("(# ,5 d ("(5] ("(]0S &3+0 3# 3/X0Sh  "0SW  PB>2S u wy sP oP# k2Sd [{ d \`zy ("(zW  }2 y*!u2S8 1!P@/X`(?008#8/X1X!/:X L!L&,G!,!C" !?#!;$!7l] P Zp 8 $zP ("(zz ("(zQ ("(QL !P \`+j"?0>c7~g p-0LS@`  R RP D  R0 B RRuPPPPPp  R0Rx ,0S 0S0,0S43#Q "3R,0S Rn?  ("(Rh0S03 L .#0SL/#00Sm"w2 @ 00S:sy ,0S: Q2 |2(R> p00SXX"RLL"NU @d ,(D {.">0S/!70l J&,0S!%1 1(R5! X-P((ph 6"0*&("(6iG+  c ("( ("(> "("(R5~P PuxDC02)> 0-|0@Lp =-B,  0S 000PU \` -2pL"`2/X "z& v0 r>,nXBP PgLDU@DR/:X0S A2S u y P P# 2S;  72 32SK 5h!,&3+%2SB </X*!2S Z0  i* P Zp [{ \ z 8` 2 &,\`"?0=<P Pˆw -LMH 00 `P@C ,K K, <(4"4!<S  X R,0 3 PpL@,0S  X RH@& HKH K KEPPp@@< (4"40 !<0D <(4"4 !<0"(K@ -LLMc0@ 0 q/P:P 2+ 0RK1S 1S= 1SZ 1S  RR R0BSvP*D0`pKS0#@,"*!dKs?_P d0!u0P  0* 0`pKS00@!~*!dKu?8Pd0!p0P  RR 0BS0*0`pK@ T*!dKw?Pd0!i0zP| k`pK@ 07*!dKy?Pd0!i0]Pb NꠕnD??0???`=T??`?????????? -Lp(h HXP 4PP4 R0C R h0C#P@ B\`,20#PP  *c吣 .3\PPhPPPP@PP00 0,# X$)0S 0"X@ a.9X0 "X@ "<Xx2h"J/9\@1$PwD4 0 \8"@T?C P7 Tg 0 @P!\`,6! !0 !X 0-@U<PP>@TT1PP:1 41@P50 !P0X P0}? }101; b/1\@ c/4\x 00000C tB) h>)\:)P` @?\VUUURUU(@?L@?l@? 0-0LS@3nPP 0PP 0S- ^PPPPVPP000l 00d0\ 0X D,0,  B,0\` -4LMP$100!0#0#?A3c03@ 0CB @@ A $ A  <*D`P `P\3  7`P `P`P`PM2 Rp(K31C01C= 0@ `PL`P (`P2p R=`P`2`"1!X2X"1(  0P`B<2\$B @0AS2Q` !)5 Q0S㠀h 068 QN@pp1/Wᰀ@OH ,3:\(X1  0D!08<10@(N-B(3= 1!" 1 !3(!^U L X00  oD0C @<0D BD04T ,3   'BMbDUQ#A##4#XT#S#T@?q'='='?_SRU V6%D@l0@X0PD%\`VUUU@?g0HUA?A?(UU,A? 0-L0@PP0 R @@C 0@ R00S0S<SH0H0<<0S<<   <0CS,<00-,000-,000@-,00@0@<0<0 Qp-L`P @Vp040 -0@DL4 0 l\|0St 040x R|00|0x |- 2! 00202 -0L@3 0< p-L0`P="R p0X 03MD0 @/A#b, vlpBMbX# -L@P 0h 0-0P L@3  $0S0$00h@-P4@pT D`  !00\;0 #;^0 L00dL00 0@P# 5 )P  0;-R#;  'Pv Q  Q0 00000v 09040 -L0@SS \ 0 \0! 0:0::Q: ^   P2hx p-L0P`="R04  RD0 BA?t@lPp@<Sx0,x00h0<|`p p p-LMlR@`pt2 ` l” 0pXdClRpt2 ` l” p0Xx -0LP@ ra00B@0U0 0 0"2R0CB200 -0PLD`0pSS  4@0T0 1* **P\^h  p-PL`0 L@0U0 0 <SLp00 p-| LRPh` x0@S | 0|@Dp php p-0LP` L@0U0 0 <SLp00 p-0LP` L@0U0 0 k<SLp00c p-| LR@h`P x0S | 00|0 0S DX0Spp0t phD p-PQL`@p<U 000ESQ 000 0ASQ0pp 0-LMLPT 0< kBK0 0KP  ,0 0  ,  ^ @< 0-LMLPT 0< BBK0 0KgP  ,0 0  ,  ^ @< -L$MPp@H L0 8 @  h4@ !(K@7J @D  "JP@TT 4*0*40 |1|!Q @D< ,@ "< , RG,p,`0hP00 @ L0S88 444i0 079 @ 0`V , 00 00p#J*PHq@P" @ ,00P< 0V @0  IPDQ @0@ @ H @A? -LM`pDPh@U L0 0P0 p ~0(Q | R x0S | 0|KH0 < K$@K @8$ U040 $0p t0 L0 0P  00 -LMP`0p="R @ K0< $@K0?H0  K @@P$ 040$0 l`t0p D0S<@Sx0,x00h0<|p@  L0 0  D0S -L@'P 0h 0-LLTP H0S<> 0< @hP0e @P -RLMp, g R@@IgP P= T`: U  0"100"P V `^U#`00 `V# P  V1@`F4V g,0LDP`F, LDP @`, L0@T3`A? -0@Lg ` P p11$$00WW@D4(D0@T PPT1Q@CRJD0&PU@DZDg@PD 0  ^ 0@ 0H0L i 0-PL80@40 <R P P 0X1000P100000S ####0, 1r00 0h000XPD00000hm000KPD oPPD0ePTDP0 H0P DPT0(B@BpBBBXB -0Lp@D0 0 Q50(P`•D0\ PP 0S0 0 `` VP6Dgii- A? -0DPLp`U@L0@T@L0@4TLgi -L0MP,+0  Q`%8 <  D 4 H TDPp@@  040<,K < 400@K @P[00,@ 00 < H0X  L% (HH0D 68Ǡ-0 0b @H0L 40S,08 001100 f  0 0 pptl`@  p004 0pS @ PP V@  @T@Qb@T 0 mA? -@L0P`p="R680 XQ/0 R+ pPp R 050 R 00@<%X 0 @si$p@PglpA?A?$0S0$0 0-L@vP0h-0 =\ $00 00 <# 0-=2LSPX20QX2 @T<SX20CX200< O 0-@ LPP PPQ\<S 3 0<H0eS<> 0<0<S01j -QLMp Q l—Ppt2 P l2p (l—@pt2 P 42l—0< pXd l—pt2 P l2p (lBpt2` P l—1p0 Xdl—pt2 P l2p (l—pt2@ P $1l—00p X 2l—`pt2 ` l2 p(P &  lBpt2` l—00p XX lBpt2` l—I=0p X0 T9R\P \PTl— pt2  B l2p (0@\ \0@S񟗣#<#|##|#|#|#|#|#|#|#|#|#|#|#(##|###T00ŖʔL8R.  RT0 0 ʼnʇ8R 0R R RpTn  <tRq rP Ǖl l0@ 03 < LL#0P\ 004 0\ nlb pt2 P l—0p Xlbpt2 P l—p 0Xmj B@#1j p-LMlP pt2  B l2p (?0@# s# <S x``` `t `n  =2S! 0=2Vx0=2xlB pt2  B l•8#8p X\20\2xDlB?B?B?B? -LMl@ pt2  B l2p (?h p-LMP0U`0@PUJl” pt2  B l2p (? `0S x PP 0Sxh 0-0L P@=2S 0P<2S00 -L@gP 0h -LM@P0`="R  K0 Dp0H ?L0<$K(@K @P( 040$(0plPt0 $0  w0 0 R 0 0 0 !1?0P0S0SP-(0#16S,0&,000a>000, R000000 !1?0P(0S(0S,P0 =2S, 0 ,(4 0000 =P  - 0p`L<0@@pP4xC p-PL@߾` 8 0 Hph0 p-PL@ξ`p80Hph -LMRp`4`R 0K0S@C a< TP,@ 5<*U   0010#Q Y@, Z㌾, 10"0 0  ۽U ,00010# Q#0,0@0S@ `X00090,o㷼@Po lpC?C?$0S0$0 0-L@㚼P0h0 A p-LM H`T ㅼ X@ 0 82040 05лKp 0K PPPi@   ,0 0 ( (@ ^ 8ᱻ -LM408 0<0 =P}<0s<0"00<0<04 @0 ,08@\^j4 PL@&j, ;, p0 0, 4R0><ʅ0 S00,0 ,4 0PLCJ 3( 25 < ( 4<0, ^0, P<0@ B00p*0 W!`<apP- ,#(0L",A P p4,<0@ 00 <0@ `ӻ(08 08p090(Ko$(K<0$(Ko<  (KoC? 0-LPlP@0X0 p-LMH`T 㢻X@0 8 10$00*Kp 0K=PPPㆻ@   ,0 0  (0 ^ 8κ -LMP04=Z10  , p8@`P& 0 &$ 170<0@ ,, 00C 00 2`$PL@?008`090哺 ( -L@P 0h -`P(0 SL4p8@jP 00$1l00< @0, 00 00C 00$P202L@0080004 -LM<0 <0, 0@,0<P,0\GFǠ0E0@8 0 4 @4:#:zc>0`P*P S= R; 00 ^8 `PP0E  0`"0X$0<\,  008 0@8PP4P!  0 0R@$PR @(K00C 00 市P`2$<\ -L MP`%8 0+p 0<0 ,8@P, } P $4 0D4 $2 <0 $084 ^080,000   ,K@E,0P , h0440<0@ % 810<@ 0, 0 0 $`0L!,PD10L@0,0,0, ,0 , 02,0, $`04 08lBpt2  B l—0p \0S <2S 8 (KP@ TDP0 H0 ,! ,(0\ $BMb 0-LMHPT 08 2/00K0 0KUP  ,0 0  (  ^ @8 -LMP0@= `Z0 p ;80 S9 P2 pW4[ P, Q 8 0 40Q # 800 0S00 00W# $, $T $ $J@ ៸(KP 100 P1 000002 @ ᇸ <00  PP , R E RP 8 (" , , D0r00 (Ko;$000(Ko\BtBBBBB-0 =\  0 xt0| h## -LM=BT (KX20X2ϸ084X4H40 0H$U%Z P" $`V 0SS P0S 0C0b20000#>80 s2Z P40S`  4P$0U00 W 0SSQ 3N 4 @00b@0 L, 0 倐3. 0 p#> 00Y R00`V,0@ 1@*C6"*0S8# 00V,00,0 3 cY@ 0L0D@ᚷ0 R8S?X20CX2^$pW@V$0S 4 00lB pt2  B l˜p 0\80S 0 000 @c@0S800@UR08 -$HLT H0S$8>0(8 i-e )@P 0-@LPP `PP LQK01j -L4M⨚ , 0p="R =,+ )0*T d<0@ %0& P('$Ry .0:R <R R R 0lB pt2  B l—p <\00z@Tж, 0R$(K Rk  R z`9R 0RU80R _(9R 0R 0 R H9R} RV8VUlB t2p  B l—!pP ,0 L#Ġ# XK WKVKU@KX0K5V8V!0NPPS񟗆$$$$$$$$$$$$$$$$p$,$$ $7R RmU000zx7Ru 0Rr 0sRn 0o7RWVU8VR!0NPPSL$8$$$$$$@$$$$$$$$$$$$$$$$$$$$$$,$^Ǖ= 0=lB pt2  B l—p <\)lB pt2  B l—p 0\@d=^l— pt2   l2p , @TlB pt2  B l—p 0\lB pt2  B l—p 0\lB pt2  B l—p 0\lB pt2  B l—p 6\l— pt2  B l2 p, HlB pt2  B l—p 0\lB pt2  B l—p 7\lB pt2  B l—p 7\lB pt2  B l—p 8\lB pt2  B l—p 8\8l— pt2   l2pH ,T`K@( z48 R0K$40#  $<@Q KO0KP@Kl— pt2   l2L p,P 0  @P ! 0 0R@1@!  T0KE4^ 0N4S= S* SH(U@1@# H8 C4  0'4U00U  *U0 0 U 0R0* R# R  k U`1 `#@f TP1 P#p@e 3T@# 3x 3P \ J.  Dꠕn#  #BBL=A?BBBC? -L@P 0h2 -LMplBP t2  B l2pP ,Z8 <0 @1pCWp!U*W"@T`l• pt2  B l2 p,/.00 b` T!0,!@W 0 0 m 0-=2LSP 0㘴,@0h -LMPP "R pWO 0``c00v[ VlB pt2  B l•A0p \4` X2\"0 X2\"|smW@IX2V0CX2 lB pt2  B l•p 0\4 04 W l• pt2   l2p ,` "p0=2l• pt2  B l2 p,"`,\Z@` lB pt2  B l•p 0\h ``\80\8P`z $\(`0\8r8D? D?C?C? 0-LMlBP pt2  B l•p ,488h -LM`0Vp0P`VJ=2 SlBt2p l•p ,4 0S 00hZ -LM@P ` =2S  $K0 40< ?@0(K8pk(P060( 060(202( 0(0 $LpG(0W   $P(0 S00( 8090lBpt2 l–0p \0S <2S x<2S hP@ ($0 0 ,!\ $BMb -L@P 0hv 0-0L P@=2S 0wP<2S0/0 -L@P 0hP =2S 0 R<2S3PXj -LMp0  R0 0 R0>0/8 $(8 80QP (Kx2|" ,([04P I 090P < 090P0 0@9P02>U 0 .P@0E?01P E 0R904 0 @RJ1?P5@TZ |y8U$3 2 \!l—Ppt2 P l2p ,l—@pt2 P l2p4 ,l—pt2 `P l2pH ,0 l—pt2 P l2pL , L, 4@ mdlBpt2 P l— 40p\dlBpt2 P l—p 0\@ l—pt2  l2p ,@ T@P@T ]l—pt2  x2l— |,00 p\lBpt2  l—$0p \lBpt2  l— $0p( \lBpt2  l—p 3\lBpt2  l2p ,lRp t2O  4l—0@0p \lBpt2  l2p8 ,l—Y %Ypt2@a  FN.B Bl— c0#1A80p4 \lBpt2  "`l—1p@ \lBpt2  0l—:pH \lBpt2  l—P 8p\lBpt2  l—pH 00\lBpt2  l—,0pL \0@ Pl—`pt2 ` l2pH ,@ T0@T 004 0THPH _L lRpt2 ` l—4p1 \lBpt2 P l—p 40\ BTD?@%I$@BD#1j$ -LMl`ppt2 p l2p , H T81S[ l–pt2 p l2p ,lBpt2P p l–0p \@Xl–ppt2 p l2p ,@dTP ,lBpt2p l–p 1\lBpt2 p l–p 1\  DlBpt2 p l–p 1\hD? p-LMPl• pt2  B l2p ,d B`0 @`0P T <0`2xV0`2xD?@D?D?D? -QLMp` Q Q PS0=2<2l0<2pt2 p x2l– |,00 p\lBpt2 p l–$0p \lBpt2 p $l–0p( \T8SPHT lRpt2 p l–@@0 p\ulRpt2 p l–@0p \lBpt2 p l2p8 ,l–XH pt2Pp  10CxN>C 0Cl–0b "!HQ0p4 \lBpt2 p X8! l–1p@ \lBpt2 p l2pH ,lBPpt2 p l–pH :\lBpt2 p l–P 8p\lBpt2 p l–0H p\2<2 0C<2X(T(P(<2l0<2Ppt2 P l2p ,PHpT lBpt2 P l–0p \2<20C<2l–Pxpt2 P l2p ,l–Tpt2 P l2p4 , Xl–pt2 p l2p ,@lBpt2 p T(l– 00p \%I$0U0 !3  22a0S1 0-Ll@px"0\lRx"p0\06SH0H064 010 0-Ql2x"@P@L p,l”x"*0 p:\00 =2S 0 &6D0 0-@LPӭ6S\0&\0`0V`@0h$ 0-PL@­640F0h Qp-L`P 4@Vp-0 R0S ^600  -L@JP 0h p-0L P\` 0S @R60 0  @ 00<phUp -@LTp`; 0S8 `PU# 0 0l0t?\0\0\0S `Pd@TQ d@T Qdd@TQ]000x&\01x2 x0\0S)D? -@P0Lp@0`0C@0 R 0S R06 0 hX -@T`Lp\D 0\@0P0 ;0C 80 0 , $(\LpC 0\Q 0Ph p-T`@PL\ 0D0 D0T\0HPD@D0 SH@P0\000ph 0- L$0PS0$000㠬@z0h -0LSS`5 0 00S: @40T1 Pp4 <D 0k 0S P%40S %%88 8pc4@40S@p ;0 %""0 000i7"888S@P 000S@$@$@$@$@T% pPtl 0'40U01#.#8*"*8 #Ƞ00PpP40Sd@T00E? 0-0L PQ 00S @ tl 0 1SRP0hSQ0h LE? p-0LP`CT0S@d0 R y)0D00 C10` pLc0D @PXj 0-=2LSP 0㴫@30h  -0L Pp`=2S@0 00 @0 000Ph㊫\  1R11d\֪y0@6mh 0Ǫ@00D h``@P87h貪pE?xE? -0LS8 p 0D<  20$ PW@S4PW D<@ 0D`0 &888 D  0m P0hmxm3E?0 00S 0  -LMPl2x"p ,!BP x0S QD\P*(0KP`}4(0$, 3  h (0Kl0p@t6S\06\ ` ^``pV\ R`0`0`0 \ 7 lt 00x0\0`0d0 KP -LMF`T 㖪V@4064  0H040K?*$0K4PPP}@p$0 P,@ 8$0K<0@@DP6*U40@&Ὡ -LM<P,@@ `@ F0 p 0T.W26 \4 < 8 ,   'p3, 0P4 <!4 0PP` W00< p>800c S@1p301 :J$JJd '@`pW00, RP <^P8 8:#: \ &0^ 0004S804EH I 'T44 W, R ,p D<4 0` P(K0<90D04 , 0P -LMp`(0 S0S 0S @R60 0  @0 0<00{ K 0 S*0"*:! ,ʠ (!804 0080 80\4  4 K00PU< 0P*@0, R00@`>  0^$0ʌ@ D P 0 $ 040$0 ,0(,  $::5 0(0%,0   <,0, S @(K1914 0d0 ¥D@0S<l2x" p,D 2P 0C" 00C3 R PS0Q<0S&@\@@F\D 2 @ 0S00h01&0\0&\0xS`0`02<Pc TdD @0<0@0@0嘠060&@p$@ἤ<2S0}$y  XF?lG?8G? -L@Ph -LMP0`="R @  K0  4p0 < $K(K? P@P @(0$ 0 $0S <2S 00& 6@P@\<2S BP@ e4p$ -L@P 0h -LMP0`="R @  K0  4p0 < $K(K? Pc@P @(0$ 0 幤$0S <2S 00& 6@P@<2S P@u p$ -L@BP 0h 0-0L P@=2S 0(P<2S00 -L@P 0h p-PQL`@pU 000ESQ 000 0ASQ0pp -LL0M , 0p="R 1,+ )0*T d<0@ %0& ('$RD9Rl 19R Hڣ R 9R 09R00@RP, 0R9(KL9R R R RTF 0A?CR< "8R, RU0008R T`K( "6 R0Kl—p, 007 0P0KQKO KP 0  @0P0 00S@1@!  TK!V 6VUx"l—1@  p,5  A4 XKW0K6 SL4 XK U0KVK! R 85R 0TFǕ 05R 0Rr  06 < 0t |0x@0e C@Po$  A-LPQt$hs$q$q$h<2lx"0<2 p0\2l•x",2 0p\&lBP0x"0 p\l•x"6 p\6Sp`6Sx"l2A@  p,=S`x"l•@ @0 p\6pSW 26S@6S~x"l2a@  p,=S@x"l•@ @0 p\<2&0R<2@6Sx"l2a@  p, 2@0Sx"l•@ 0 p\6Sl2px",l•0`px"0\@gdT\ l2x"p , @l•10px"\@OdTH l2x"p , @ <20C<2P0=2l•px"2\lBx"@ p0\@$dT l2x"p , @2<20C<2h( H?TD? 0-@LPP WPP n QzK01j 0-=2LSPX20QX2 @T|2 6S n 6SX20CX20m06I -LMl2p $l™xp ,l2p ,l™0`2x"0Cp\ l™px"0\@dT l2px",@l™`02px", Py$y$4x$y$<2姏 *0P, A0"0R2 ,2 !Q l™,0x"0 p\e ]P 0,0  3k.&00H 70 ` @4 6@T' _P?  0,0 ,l™p 0\s 0,0 ,;2<2 0,0 ,@:!0=C 0Lp@Dp @@@\TD ;0C`@0P1TpD 0 P@PD PPLp\TT"P@Uf:@TP!0 @P P :0 @0 0 LT\H@D@D ;0CgFl™P0x"0p \n $npl2pR@xb \p, 08 10l™x"0@ p\dZb sl2x" p, l™x"6 p\B "P001"PTBH?TD?4B$H? p-T0L@`TP @T 9S  @Tp`Dn -04 10@TLP  > 00l*R90  q@-@p+ P`T^ X) 0!"4# 8̓ \0S \0S  R` VP@PP \0SX P Pp0t: p0C{*:vp0t: _0C{v*:0p30 P  0 00@-: Q3 @00S)% 0S$+ 4 0R0 40S  40S0l04 *lp  D:HJ0@ D:HJ00Sp0 Q 0 0Sp0 Q@-TQ 9SĀ$$$x$Ā$0@9I ) \ 0@)9I 0@)9I 0@)9I9S T - PL`0  R( T \^0\, XIp 0! "4#8<W*9X  ,0( 4;0( P$ p 4 # @Q 0SS 0Q@TX  ,0( 4;0( P$ @  405 6478`:p ?;P L<$+4 0X)540674 8<0X)! 0"#4 8̃X405 6478;P8p 4 ? 4 8\,Q0P , C8K00K0S@P`P`D0 @@ DKB2MP`0 K Yc`X@P 0 S S 0PP P,0( 4;0( @$0  0  @ 0 < W X| -`Lp@PT1@S X)` 0!"4# 8<P T  P   P000 0-X@ 0 & 9PL)p  &T⫢09 R 0 ep30@$ -LLM000  @ 0<0 0 @P`p 40 080 @0,, 0@ P`p4@$8(< 0~,0S(K (Kou8H?@ 0-LP@@jT0@ -L M0 4 X, 04 8 P ,$0S ,0 S S] SA p0,@(Kp08 08< 044 @0 0@, $04``p4 `00p` pX998< =>@ $?:P(; W ,0 04804@V0 {:0t*v:1 0C*:,0 0@ p,H`P0@pDP0` p0@ L#D <P`0@(!(Dp#L440@H?H?H? 0 -L4 8<SH? 0-@LPx 0 0 9@)0hĘ 0-PLcIT R0009 0  寘0 -0.@L 0JP hc$H? p-@L`P U T1PS @ XX 4Ppp -L@P0 ?0 <@ <0  -L\MX|@KpP$ `f 0$ 0R K렕n|= -LM0S 0l0*lp :T @ 0 K$ p-L@PԘh0`S 8@0Th0 @t@T0h0ph$I? p-0 LPsP3@岘0`l9@:UH D0 20l#PP0l9UpPK: 렕n= -XILT`L m00a 0 0 /0C 0 B0CP 0 B=0C 0 P P PPPPPPPPP`) a9 0b0c 0PP9 8  0! "4#8|W1 ɖ00243 8<0PH H0W -!LM00 9Y   @)2@9 P R0 p-dPL `R@ 0S0S  R  tP00pp`Dn -LM Xi@V Hßd9 "10 0 0 VP $̠$$$H  @ 0 P$ (< L  !4!!̠""H"\@ 0P00 R  !" 4#p8<@ @P9\@\ ?  !" 4#p8 <SPhYU ., .>YNU !"#p 48 ,0 W 9 *YZZ ``@WtP<0S8<06 0-40LS@P <2P#TǚPP PP01j -LMS8# 0 ,K WXP`XI 0ؐK:0 . 0h0 0, 0 0 P` Lp 00 H D P P P l0 0l00 m 40 + 0 S ?04X@ `p XP1X#\   ?04X@@,PTk(K 00P@K00@@lpdK?PX H⨇ , @pWK 0SpWC 0SC ,0X)p h0 h0Sd Q@ @8 R 0 S@RlQjV 8 R 0 S@Rl`V1T !0 !8xYh , ,0Ho60S*㺍@8I \ P,0 @P0Q0CP00S00㹅8, 0, @0N?N?BHO?TO?0O?H -L}Me\pK 0, PP P  H@, 0R(K @}K_S@P y@T 0fP =PP@ 0 f2P.K0@(gP 02(K (RP 0 DJ 0fPW/K 4"  @  ! 2  "<K@K  !  G \1`02 hSK"00B@(,"042 >B<K8 ZH0 @X@ m0a 0 0 0 /0C B0 0C B0 @<K     = B(1#4! 2 1",,(##Ƞ070 2?90=: ;> !"#0123456[@8![<  !1H\0!XW |廄 X2\d99  h㩄" 20B@|91P#H@@ R( 0S0P00P0崅@"R PQNY I hLQ >@ @ꠕnN?O?=O?lpedAN?O?O?P? P? K? 0-0LSP  R6 0 P0 TAT\T R R R 00|)R \0S\0P Rp0  0h 0hB dP X)p 0P?8P?K? -L8M0pXK@`P 0( dɔ\048 L1 $(T\ ( 0Rc$K"1   P dX1U8@K `0Y` tP0 4 8<S S04 80 0 m e00t X04 8,P00 $렕nmarcxP?BXP?CRAMP?P? P?= -LpvM0,0 ! '((0"4#2 40 $ yKQP D ! 0ß, 0R(Kß@ 0ddP M.K0dP[Ÿ 0`d@PM  `P  P M !KdIA K<Yv 0S0$0 $yK! PPd 0dPM0 P J048 L1 $(T\ t!0 drMP 0diMz8 Vu ㆂq1U L K 0 1P 0  0cCM m0gHcX ℂ@ 100 0@ꠕnP?lpedA marc,Q?CRAM=Q?xL?XQ? -LM  apd "10"P080 |iV0` } 0㨀00 @ ,0 `Vt X0S\ 0 \ 8P0\X0048 L1 $(T\1U \ 0P< `,0SV \ L)(0 !*4"@+$ 8#(,- 21C0b@ 1P<040 4  4 @.)h99p: ShI P  ^) (0*4+84 <S00\000 㠁Y 㛁0(K8  ākX , 0 BmarcCRAM -L0M0RX ,0 `S Rp@T  㟁T0|900| APt0\@X0, LK 0iPK@OP4!P0 bP2 hP0 `0 0S @00$@S p TqT  XpW@d, 0TR(KT0P T 4%0T0 PKT 嶷렕nlpBQ?,= -L4Mȟp0 Q,0 X B .XQ4  \ h"0h9P KPT y OPo0| #aV*@ P@VP# P L@K  0 `  P ``|ǟ, 0Rg(K  (pd S   @PQ08d뗮@P P V t :PP:S  P}X)p T X)405647 8<S {`pv``q`+P P7P  ``[`d)U` BIX <|Y $7006045 X)&<#0&0!"0 `X8 Lʘ\ 00 @ PX H @bX 4%0HX  %0X0 0T `9`#V#`FIX)0wX0S`9`;PqP:S  PT el`%T`P@( X 0 4 80P 0#,##8  0X 048 <  " "4"Ƞ 0 @ 7T0Se`Pg9`St 09HX 4`X  `p X `h9S8 㬉2 "hS@ 0P @ T0- XQU T( 1A pTP [`P% $R`TQQX9h3 0 1 2 X p X)p ;(X)p 5`n| PW!,PPT1SP0P0PP0 TQ X9%,%%3 120PX @p J +5P09Q  LX @p XP X9 p0X9%,%%3 120PX  pꠕn R?LR?S?S?$R?R?R?lR?R?<=O?O? P?@S?R?S?R?S?,S?$$TT? T?8T?$T?pT? -8pLP@`*1T^ 1TA 1T5 1T* @d1TC X1T@01T, (1T@10S@U@@ V@@+@_@ B&B("BP!Bp%B'B(B )B$ݽ? 0Q 1Q 4{-ud@ -LdM|h|@0 T,0 P  R $0Sk0Sh  R D~PP $00 sP  mP@P $ P K@P TP RT  @ @ `PP`  0P`T0$ T40se Q@*$@T' T P ^N T0 SH0 S RQ? T000V00T` A P @( }PPu T0 4T0@0T0 T 0R 0 0S 0S$ RQ$ $P0$0P ^TT0 0 V T00 T`   }pPB   }PH QL P$PUS `v0S }P= L@KT  0 XT0 \hT080 `0T 80(0,@T 80004@rT 8H H0H@0X0~@ R @ 0S0吐P00P0g~$PUPT`Kg0s 0p0  CR 00  0@ Q PT $90L@K0C0T0  0T0 D@T1 r A0 R PT  0!rT0100T 010TPT  0R  18@6K0 17Kh xp ~|K }$PUP $`P @|T|PV R @}|TPP @t|T0S@ @g|TW `|X [|,, 0 R6(K RT S  9PTT0p0 PT D 0Sp{0S7p8pQ Pt-@ @ @ T@ T忲L!@ @ ,z>P=l 0 1\@\PT 0@Lv48@0U?V?$`Dn@BT:6|$,n$1jV? - LPM , X9p89:=@< ;P>$?(<L  %P\ X A P , 0RZ(KL@K X0X #?`@p嬁 ČɯȌ9 0:`8̌Pp弑 帡 ;币崡 嬡T/ᣀX 0OOl 堁  p㤜jOK0 0OS! 1 jK\~K<@  ! !sc ʃ|qK  ̑ ȡ sKPQ a   ! X! ڌ1!>1d Z*AY& @ QUKjKpWP`P`B2MP`j/K AAc0`Ap Qd p p CXQ 1 \0Ku 1 KӠKPKpKDP1`@HL!TQdqрK吁ڐKKРKKK K0KPKq 0@0 0少@P004㢁Pl@!A :lp0q *@ P 됁 00|$됑 0 KK밡40QX)...̠%H%%<0@4[堐0[夠X9 @壀妠᧐Č Ȍ89p:`< =P p ;>@l ?$(Yx t .K ^KpWP`P`B2MP`^/K @c@`hQ,q刁0T0W Z  0 PVhA A9S@ OKp`P0PU`Q v(儡 Y1X)p hhU,QqUe(儑 Xa! s?K1 |A \됁 0   0 XT@g!ꌡW dbP 1AX)p PqPQD{0qW0ꠕn4V?hV?W?K?W?V?V?V?V?0 h:0 9l l0L*P:d d0T*X:\ \0*:T T0*:L L0*:D D0`:d*$$d$`$0$$8$؎$T~$<$~$t$$ p-X9L] ! @\^P" D_# `H LBD#9p 0-L MX@! 0Y"4#8 0 K00SPڀɔ0X R1X R0K! 00P000SU\p 0(ɄK0p 0HW?(W? -L MP`p, 00 E ,00,0$00 0S$00:(0S1(0,0:SHl0SE Ul Rp0p0p0:l p0 4Q l 0R0p0p0 :4p0p0l 4l9S @:S% ,(Ko~0,04@ l@(00(00q0  d $  f|W?W?W? -LLMl 00K\0 @t$X@ P\P`XIh` ! 0"#48] \<P`,0Č0 ^僔T P X@X $@0d@ l@4 00\ T@9A`@  X0 S,00@@D @ $ L H L@K0< K =L K dPt@pǏDPK`PU`h0p R0VP`\jPm |"=00 ~PlP }lp80<@X)]0\^_ I9(KXX?0 h:0 0 l0)h L:d0P*` T:0X*`:P P0*:H H0*:@ @0*:8 80*d:%%$%\%8$$T~$؎$~$<$$ %@-X)@ 0!"#48 <9 p-`LP@h0S  R000<0 0 8P 808  <0 P4@Tp .,`X?|X? -@P`Lp}00  (00(00q0  d$00 Q$ * mY| ,00 0,0$0Q$:(0Q8 0(0,0:SEl0SB Tl Rp0p0p0:l p0 4P (0SYl 0R0p0p0 :4p0p0l 4 ' 0  <l9S @:Sr0  0,00,0 0) 0 0^ DB h0S 808  <0 P0 09&By*4 }yX?W?X?W?X? -LM0Kh#P`X)0K0P 48<@0 , 0 00080  PP 00@0"0000 0 0*0 00K0@$ < $080$ 2@ 4H p, 嬀0  )XI`< 4 !0 "# 00< `1X R-(K) 0X R02S ! 0"4#84 <S 4 02II 00 0090  \0D0) 0` l00l0 h0SC <00< P<80Y|{ 0@ 0S S 5P{X9 !"#$ ( P8 0ZA 00900 000C00X)p (Y?$lpX?X?Y? 0-L MXI! 0Y"4#8 0 K00SPڀɞ0X RO1X RK0K! 00P000S/ S 0S$0S,0S> U0%t%\%%%0%\0<' \Ɏ$ K0\0<&p 00\0<\0< p 0,L 0  > HW?(W? $(Y? -LMP@`z)q0X@T) T %%%(%@%%%V V >z)0X)p 0PV0X`h0p9 0 T  Ki z0FSV ViV V X?$ -@PL [ -@PL P -P M-L0Rp`T X9%&,%%̠&&H:? 9;=>@8P<` K@Y?0 l:00 09x0)t P:p0L*l X:h0T* `*:X X0*:P P0*:H H0*:@ @0d*h:4%,%%%(%8$$T~$؎$~$<$$%%0 % @-BA 0 0#^0  -pQLP`@h@>TX:@D 0AZS@@W..T`)WPHY?@  808  <0 P0 0=4 A PX?Y?W?X?W? -LM 00K0 @'@ PP匐X9P]!\ "@ $#( ^_唐 ZD $0`KP P0@Y0@ 0H l h  d ` 唀`P0Hd 0c@ XBd K QHQP6@K`pK X9T P lK H0TKXY( hd d K 6| x 0S @d K P 06d K x R0 S\ X0   |K| x  T@K0 PE06NPU>E DKT p t0##8 K 0 )|0{1 X Rz yP  @(KL XLKX0S `P D ˠ| 0 p`/P\ 0 `"PD| 0 P `\ 0 PL0K0S @L0 H@ 0w @K0@ P@ P DPPDP p t 0 ##wdK\ X S026 |KD Z`\`p| ^ 0  DPc` `WdV| ^ 0x\AG  D@|0 @P > @P v 8|Rv됀PX 0 0@ 00l 4l *p : 嘀  0 0S S P`uY?X?Y?Y? -LMP@`Fv9q0X@T( T X%%h%%h%h%%V V u)0X)p 0\P.VX`h0p9 0 $ J KimuVY?$ -@PL  0-@PL GP 0PPX9\] ^_  Tp 00 M-RLP0`p/0S/  3X)p0^0_p\p]pX PE] \0^4_ 8<40c@o  1.#@$,#Ƞ#$T$h? 9:;=P>`80<@K Z?Z?@-00 0 9 0@ QT8XH0 h:|0L*x P:t0T* X:`*d0d \:p*\0\ :*T0T :*L0L :*D0D :d*%P=%%%05%%:%%8$$T~$؎$~$<$,% %-0 4 8<S0,0 -LMp!(KP@P W0 0(0 KX)04 8<0@(K ( $ PK X!=00 (0K0@$ < $080$ @ 0 1000 00 0 pH p04p P, p90  \0D0)0` l00l0ph0S! p<00< <t`dP @t00900 H X)p  (Z?*%lpX?$Z? -0808 pL` 4PU40@408 4 8P%wP(  (0`(`h w p-`0P(0h LR 8@T P@Tl9S @:S pphF8Z? 0-4 (08PS 0L,0{t@s0 p-(04`SL8P 0 , gt@sph p-`PLF 0P 0llATXp4 ^P>0@pPqPv$@T R000(0 0 <P0 R 40800Y;l$@Txvpqp% -LrM#@LK 0`p, q (PPPPKyK9pP!$P 0eMP 60pP00S "0 eM6, 0R](K 0.K0 MpP 02(K01SS  H00 :M60 0  kP  0P @U k0  0P p@405 6478<s  Xq@H/ k\`!0p@`0@` \ )(0 !*4"@+ $8#(L, 21C0b1 $0( P P Ό0 48<S S ^@ @ꠕnlpPZ?edAN?N?Q?pZ?= -0L@P $0S P P Vk `$ pP Pk0S0 (  R,(n00P 0 a 0-L,0\@00P q P0 X) 0!"#4 8<90 P 00 $Q   R2P0# 0 -LM4 0@00 ,@ 4 P8 u$\ R000(0 0 @ t@0 0$00   0 00 S St S $044S  R40084 804 40 ,S"?1SAO.!0 T8XH0@0 0s $0000$00 0008PU p$ 0 0  ,0 < <0$(<SY S 0 8  4Q40400 80408 (K400  0K@ 00K0 @00 ,@ 4P@U^ p 0@ p,H`P0@pDP0` p0@ L#D <P`0@(!(D#Lp4 0 , [<00< 0 $ @ F0@ SG 08<04@00 ,@ >0sc 0480@00 ,@ /00484sZ? -@P`Lpq00 C ,00,0$00 Q$0(0Q00,0,0:S)l0S& Tl Rp0p0p0:l p0 4Q l 0R0p0p0 :4p0p0l 4a0  ,Q  op l e(00(00q0  d`P 00D < `+q@0Zp *(W?Z?%W?Z? 0- L0 j@P@ 0 <0<0 qP08P00@(@[p00h\% -LsM$ 0L K@, PPHyK6PPdp 0VJP 3@T H$0 YJ3L K  , 0 R(K.K0JP 02(K01SS L K@ 0.J3@L K| h\@1@P`0LK h@P1LKX)5406748 <00@4P(@,P  X 8H0  V Xhm0a 0 0 0 /0C B@0 0C B0@ 嘐噐嚐囐圐坐垐埐 !`X  P0407p001p2p3p5p6p P!"#89:;<=>?@!1H0!X bhp48  0XidЙLk hQhA  吐|k' (P)*+Ah0 0! oh9!9h)P1S gW@ Pgg@V g\剞L KPZ g ꠕnlpPZ?edAN?N?O?O?Z? P? =K? -LFM@`KO_Kp@1 , @K\q ww U@! P *'\$, 0R(K2렕n= -LzM@`TpP@K z  K肏K,dPU @ @dU@ -LM ,( P9Q)PR 4S8|WN@ P`?< L#?1S@P3400  D0 `P P0U|)@8`%[%`Z%Z%8$$T~$؎$~$<$J%XY%D% 1 0cdDndHn-1 0 dDndHn -p`@QLU   %dP 8p8 10!  \@dKndHndDn -LMP 0 ,0 M@P[ X[   !0@000000 0 000090000000K: 0001@`H<`8`4 0,   1\ D 9 !`pl00l0 0崐 P S  cP$   00 000< < @00<000(K sP )P  F%lp 0-PL@ R000<0 0 8P8 0< 0P4@T01|X? -L MXɐP! 0i"4#8L8 K00STڀ 0X RM1X RI0K! 00T08 R- 0DR࠳ 0S,pWT4V E%E%E%F% F%E%^0>& p 0^0>' K^0> ^0>p 0H@ֿT `9`X ̿TPY?(W?Z?[?[? -LMP@p000 `j, 00v㸐,0V0,0 P H< P H< 0  b0m$00 Q$<:(0Q= X0(0,0:Scl0S` Ul Rp0p0p0:l p0 4P (0S{l 0R0p0p0 :4p0p0l 4P4G C 0  [l9S @:SR ,(Koi0 700 G0,00,0 0F 0 0Ӌ@8(00(00q0A  d0 H< 0H000  X$ /00 j 808  <0 Pᖋ0 0ᑋ~/4 b300 ϿX?Y?W?X?W? - 0L0 0l0*lp :8@T  @T -LM00K0 @|.@ VPeP`X9`]!\ Pp"@^ $#_` p( Tp $Z 0`KP 90@Q0@G 0H@P@ P ĀP0H ㄐ 0c9C  0 Q 8@Q㣔4ˉX0 0K0 @P0 L@ 0K0 @ \ P儀KH0 D@ \0K0S@@0 <@ @_8 4 d@ `P 凔ˉd ` `>@ VB K QFQP'봀`X9pPKK l h lK KQ t p p(` ̂Y ʄ K (H K   (8KX 80K0 @ P Uʶ 0K@  Yʦ 0K@  P l0K EP6NU>E ;|0 x B X \@0##@`KDp WGڴ 0 0 @ 1X R02 X 0S `V  @D  RO P R $ `Pp)90 K葽Tt D^-`@P\p | K ` X t@K00TPˠ ppPpPDp@_W dKt0KQ d `  PK`P`P ` T``T` H0SP  tPP tP } 8@/pPvTt 0Tt | K pKt`Kp @pP5PYt`K| K p @p#PGt`K| K p @pPP6tKT  | K  P#t0K| K @`@  pPtK| K P pPY Yh   ,1(KY@ 0SPU@ `VpW@^3 X"Y .dQwdKt p rX \P0##@@P P@ P wH\ @  t`K| K Tp pH\@   1P U0X]T^LCKF@0 pt TtPK`| K `T`ˠ  @@`pBPfD\`0@X) R+ \. ; 0 t K T0C0| K  P@`DP0OUʓH\XY RPU \^K0޻@0 @$ t pT/t@K0| K T`0` [` P`P Pt@K00| K TP `PpPD`VL`0@X- ^/ Q2 PU5 ; 0 t K T0A0o| K   P`DP0OUH\ XY ^P Q R PU\HPH\H^'(fpPW 0 0@ 00l 4崀l *p : 帠 0 0S S P Zeg([?[?[?[?dHnY?4[?\[? -LMP@`e9q0X@T( T Y%LZ%Y%Z%Y%Y%Z%V V 0e)0X)p 0\PԻVX`h0p9 0 $  KieVY?$ -@PL Z 0-@PL P 0,PPX9\] ^_  p 00 M-RLp01 X)0^0_\]X PG] \0^_4 8<40c@o  1.p@Wp3$,##Ƞ#$T$h? 9:;=P>`80<@y$K[? -LM  0^&_% -LM) 0^&_% -eL`Pp< (00p04S80,0d0804p 00 , 0@07< w)&((0"4#220$00 (O 0i*B[?[?WEV_% -P L d&@ =pP` |1TI p1T) *`ĕP1T* H1Te/`(10S ` 0 ߞ`P 呢`P0T$ Ξ0 00" 0`0 e\@ 0ce/ \ 0V 4,0( H)`jrdAhdsd edAk~gd_% -DL!88#!ƚP1 p" D0020p(P00`4Q!<00@aT@!0   H<00d@02d@ c o'0 <+0400 @!d@ ovcH jBB 8 8-#TLL%pq`P 0@2 9*j 8 8-#L@(SPPp 0`pP ޔ0S  0p0 pPj -L@n0⠞Pa%0L00 -p`0L [P$  [@P P00 `(Pp 0|P,0X@P00 @m i勹剹jPjj[?n[?\?800S SP 0Sj -0L 0-@0L@PT@T uP0j 0-`0L PRT  0@ST000@I[T 0j 0-PL@ l[P 0 @ P00S0 0 0j -LM q 1@T  P0 1T, %0T( 0T% @0T*0CT*0T0`K 0@PP@ 0RKp0T h0T[P  f@80T @(렕n'B&B("BP!Bp$B B B(B %BD= 0 0 |jpjtjxj 88#4 P00pjPკ0 R|j -@Lb4 R00 0S00haꀞj -1Ls@ $080eb 00@ajj -pL0PSPb\\0`@ L 0?V0C0a|jxjtj 0-LMDP00@K0 P  0R0K0ܐ렕npjP= A-L 0 R >|jj -LMp0PS  @ 0RK8`K0HD YPP 1s# 坐렕ntj \?`= -ĠLp@W `P L @?V@W00 hxdX0 R L׶@ ,0?S?0C00d|jtjtjjpj(\?xj -LMD@0 ( $K,0  ,K 0RKF렕nl= -LMD@0 ( $K,0  ,K 0RK-렕n= -QLMK 0K 0SB$ R p-LMPK@` TCJ |4QZT00V0S 10C x 00(j80 P0S0SP,j@ P P 0S00e,jL\? -H L@T00 ((0 R00@M(j$jXnX\? p-L`P@P @ph=P , P @``00p ph.p\?,j\?r -`@L0S P@T <0 ,@Th ,j\?\?|F(@\? -@L ;hj 0-DPL0S 40@T  )@T0000j,j p-L`zPP @0 0` @0!# pȵ\? 0-XPL0SH0@T  #@T0000j,j0@-\P@ 0R R R  0R RT@@\0@0@0 Hj -LM|F(0Q omn\?\? p-`LQ 0R p 0 S0\ P  \ 0S@@PP n   \ phe na0 -L<$ X -L6$H -L0$ H -I L*$ -L%$I - L$ -L P -LhMa0@K 0 Ppo 0RMK@p P& @lPK1@0 T0\0X 0 T0P 0 L0H 0 lK@ <K0@ ӴlPKhP@@ P P ƴ1 ZP @C P  TH巴" Tʺ, 嫴 ꠕn\?\?d?\?= ]? P-L 嚴 0PU0@Xnf|F(UJ|F(Q0 Zlp|F( የ|F(> fQ|F( fQ|F( fQ|F( 0fQmho|F(4) 0fQbTo|F() fQ;|F( p-<` @fRPPTL  @TpDo|F( fQ|F(|F([V|F( fQ|F( -LQ @  Q ]?Hj -LM`r0`@ 0 P# PP P 4i 0RpKTH PK DP7 P1  @T; l P M !0@ 0K\ 0K0   h1 R`1T1X!P!@10!0巳" $峳 @ 00@@, P @KK9P00  00@@  P 00 0qx P h偳KPLyyKx ꠕnd?hnXn4jXnXn<]?(]?Xn=H]?X]? -0L0M0@ 0 T  0 45T E 800T`?d`? p-LM`KPKpD0@S@ PK T00  00b0 0 40@S@P 00T`? p-LM`KPKp0@S@ PK RT002320 0 0@S@ P4 R$ 00T`?t`? 00Cs0 -(0L @RhPXj -@`LpP 0 @0 SR0 ӧ P R @ 0a0CSa0Q-S   RD'@T 0a_S@ Th==`?`? -L(M 0sS  P `PLKV>  T a0@S( K$ \R0S  0S0SQ+0@a$0Lv U TA00 01 ֭(KP0SJ }1 ǭ` t!0S PPBXaTU Up0K0 0@ =00cP H 0 3,U`$0S@  @ 0a0CS0@SV P0P000 R  a0BS(0K +00B R0:S 0:S_0PE$0L000C SP0 \YXnXn`?j% 0-@QLPJ @TZ0 Q-L`ሀp@00fT*P 00fS 0c00f000f0hnhn p-@@@`08PcL0`000phnhnhn 0-@QLPJn @TZ0 0@-L@~S~%D%p%x%%%p%%p%@%%p%@%%p%`%p%%p%d%ė%p%З%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%%xx6 Q 0@^S)\V Q0q0 R:@0 00 `P0aU 0R 0 0CR0:E%0S 00C0x5l%0Q*LU@0Q* 0 RE5 Q* 0004$0Qd帄0\ᔔ $0ST t吤T000 0 S\4T00S0  0 0 @04#0S*cC3Q`3 be#C0 0Sn0RR0B B  0S 0S S0R SU K 0RLRr 0Gb 0SQ P000B Q6br00CS0吢% G"8:|R0B0 S C R0!H"010Q? 0$RC 0 0R "p쑟000 0 1R R 1 1`1蠡 G0000R010 0QH L!<000 0 41R R0 0R0 0p Đ P* Q% 0Sp0PQ 0S|0\^0SRL0 @J hnhnhnhnjjjXnj`?Xn -P@L@PpP`P0P @D@PPP P  00`hnhnhnhn0 00inhnin4 P00 0 Q4#5jhnin0j0j -L 000jj -Lt T8 !0@]S@00@ SE0P03P0cp0 QR`TWpD@T7pD0u" @/TA DaDU9070S0pDU A D00DR Sa0D_TS0oPOPP tPTP P xPXPP 2P@A @a0@SR2\T( 2@P2@U tA @a0@SR@0@_P Q:P\P00 \Tbp P@8g0d0hSp P@X\P_P 0?SCȟ%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%l%d%\%T%L%%%D%<%4%,%$%%%%%%%%%%%%%%%%%П%%>P 孩 +@<P*@.P @  jin`?hnin`?`?`? P 00j -(@xL0P 00@ininhn0j p-LMPP`V Dxh @8@0 ,$0{`x萞j`?a?E(@8a? -SLM@ 00S S h0Pd  0^0?l 0寨000 P  0 P jpa?xa?Pa?Xa?`a?ha?0 0 `Rjj@ -造倀`LpVl0@aWV@@ HT0fp`Vp =`jjj -1L `Rڴq B0R !0F]S& VT V1 VK VZ tQ-@@T cP: qP8 PP@ 0P0C0(APU @0 0 S 000P@00CR 0  0P0X 0000@0 (0 hjja?a?jjjj -DL4M088 S, 2PLKHpKPKTK ` 0L @@ 7 L (TQ 0P PL0P #P Rd P0Sl0HH, 0R (K0@,$nVjnUja?dja?@pa?=r<0  4 40pQ 0inininXnin40,0, @pQ0 inininXn<04 40pQ@ 0inininXnin cR(0$0] B   0 0ininXn -8@LP 00@P 00jj 0-H@LP  Q 2l 6S Q X0X 0S 2H 8S T $000jj 0S00in -pL0@SSHP S 0S i `0 Q00 2| 6S Q 0000SXP 0  iUitinin -PL`eHp@P8 00CS0 @TR]@0S S' S: SJ 0S 00J 0 00C0 14 S 1!0S 2!8S 0S 10S 0S x10S 0S HpX!00CS0D1 R 8峦,實 0Q/ 2 8S* 0 RT T U 0Q 2 8S0勦00 CR@@D傦Ta`| U\ 000D 00CS0u injjinina?@ina?in@ -L\  in - 0L0S in -L\  in -鄐@L0Mp`0 ,0 P \ ,0K ,0SP11@5@T00 P(Kinj -L\in -LM@PP` \p 0KPV 00@0)V 00in 0-t0LM R8K L@PD0T 0S@ xP UP 8\jjTj -LM @K< 0S0B :00A0 R 0 蕞jj -LM$\  in -LM$@0 0in -L\  in-0   in -0L0Sin -L1L`MD0 PP(0 `pl KtKx KHtP 1l R*x0S@ hK0@@( 0R$$Kl RW 0pK| KP p| T@hK0@@$x~`jndj0@a?a? = p-L@P`־P 0S ppʾp3p - LR`P; R :R0p0E@2S P @T:00E+` RZ p|0"P@0pS@ hP WPT:00E0Ppja?in -LM@ 0P  K -LM PR@ ` R :R0p0F@2S OP$ @T:00FP RZ `0P , 0"@P0`Sh [\0 KV@P(KT:00F`0 , ja?b?d% -`pL`@2 RP P @T$h*0 jb? 0-LX@PP " 0 S0 00 0j@b? -Lp`PU0FS to@0@S S P 0@S o٣lb?db? - 0L@ h蛣TT p0\ dpPb`\ 0 40WP$p$00h~pB^?pb?Tjintb? 0-LAPMKQ0!0P 0Q#0S卣H0@0k0 R0 R P{yd00K0lodl0S P D08^pninb?XnPXjnb?c?b?b?|F(@@ -0LS 0 -L\    00R0 0 0  p-L`P ~pP0S @0 @SlP@pTPT0S@0 @S ռP@pdc?jhjhnVjUj -LMtPlHKP l PL@KzP dP08K1 .dc?d?xc? -LM KP K K -LM@KP b 00j0 j 0-dPL0ST0@T . . ,0@T000jjdp -L@L0S <|@T ( au@Thnjc?c?c?L0 P 0S0R:0SW00jL\? -H L@T00 ((0 R 00@<jj\nnc? p-`@LPP P 0S 0RHph P 00@0 00 pphjp\?jd? 0-LM@KPPP8 -L,MD @, 0hS ?lSC IpLK@# 3HPK@ x` 0@PҡL 0PɡL p@ ZPTl h0h hp, 0R (KS bS {렕nd?|F(,d?4d?0-: 3:*fA*Q 0, ::,!,,,\V0 !0!"Y!0` 0Ѝxnnunund=1s s080 080jj; 0: 0Pკ@-44 0@0 0 @* @@wtnj< -LM   0v htl%`nn -LpPL@J 0x, `0P`P`hJjjnn 0-PPLMJK< w40 0@0@J8jjnn P0-LP P@``@P:00 -LMJ00p̠`0@hP \hl 堀0,0 ( @J,K\J P@P\0 0S@0%050%\kJ$Ksj|nnjjnntnpn -#LM0pŸ @ 00, :Bp PPZJ 00 0bC2S0c0S U 2@xP x| T+J(K`0D"\B"\ s \p 00,0&:#0 1 1b 8 4 @ `P`P`P`}p=8K !\!PP``dq儁$A00SA I 0 0c bo"oFS0c aR bV00S0 "^08PP C4PC2P C1P0PPUhI 0XXfP0@pP pt 0KlE1s|nntnjjjnntn -LlM蠟0P`(0 %UpK8K pK8K*塼|=* @U@1@#C@ ᑼ0dPU`<婵X㦵㣵( 0R$K u렕njun<= -pLM0lK @,0 P1 ^_KD0 0# 0Q FI!$0S:  @09v[KJ&I@  v yv0I >0p P`<p@ P`x P$`p I @L` I@, 0R (K^_K,l 0SNu렕n|nnjnnjL= -LP`p  >PP  P@1J# WpP  00 RA<P PpX k>^vV -p0LP \0R E@ <p00 hp !na0%`nn|nn% -LRMh@0T`$0 $ 0RM K  V> TpP1Q$  Q@1J#U YK @u BW@P U㕴>U 0W@PQU@ YK@`~udPKYOK@D@<@ u~u@kP~t렕nX=C-0 pR 00P`U%  p00 N @ l3)^Q<0PU hl 0> n1 ^2R P R 8 - Ql08! j00Re R0O4P`P` 4P8`Wl004PXP X< <p* K<0PlD"[0R |<X X R h@X0O|0 x@ 4`S< ph P26B 0bC  R7AQT7Rx 0P0K |K0P h `@800 j H0l0 |K48d R 0@@PSPT00S40,00@8V` w0<S t0X@lL4 K0T0}@0TV ^< t D06040H0D 0  H0t0P}D@0 :@^^ `P`p4P8`2@8P 8< d UL0.S#%@DP@ L T pX :LṲPH;8jHt TN8jt01< tD060<t X@L0T04 K@P>V UF40H0d1@0P 04 O0 tt H y\@ @p0plLP! Pl0*0 04PXP 4h 0K 0Pw h0Sl* ;0S9@0U5:0S\ \ 0S 0S 0S0Pg R @ R 0@4 R(K0S  R P`0OTS/0 0OR 0 C, l5.)0S#Q 00K?P0 H00@PQ -L4M  $0 0<0 @K;   1KB KTj -L4M0@ $ @K <0 3 K$j 0-L M(0@ P b$p岯!0S(0 K0S   00 p $ (0!I(0 @ F p-0L@`P5 P⟵00 x |00  000p0P x0P 000pPi00 x |0 3.Px(P 0-@LP 0h(hd? p-0L4M"`@l1Ph 㾮P 01`l1D 㵮P <LK( 0P H0 t  Kpd?j 0-L8M @( ,0 xP!0Kp!H 0@ $ K0[S< L@KLK0L@KH0 0H0 jj p-0LS@P p R R`d cP0 <0p`8XP0 S NP d?d?d?0 <#<0@0  p-0L@ S |%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%% +"P8#`(0  ("( Q&*0(00 $0 e0b$000p` PB8#`Pp`P\`P0PP`8#$ Q$0V0$0000pd?@nn -LM0 0P0,0 , (0U@$p0>*X2S/00@0 S\%%% %% % % %t% % % % % % % %H% % % % % % % % % % % % % % % %,%h@`T   0P,0pS(0$p@00 0S000 (K`@T (000 $00a$0 ᐐ@`ip`@d0`\@0pd 㸐 ᭭`@ pd`@@d?nn0@- 0P840 pP,0H@ ⑩P#0SG S S; ,P 0,0 dY,P 0,0 < R 0 DD Q0DT0 X _ p,PH RR   0 [Yu 9`20 2oLQ, <@ L ,p H0Sl0,8@ H ,p X@ 5@ P @ h -@0P0P @0 %8@0P@ 0 K0@0p Ph 0p f  9]I2]y@<P 0P84<  0p?! 3$CB4pB2. +P0S / P ꤤP -LM0@00 !@K -L0ML @00@ 0 D0 H -@A@BAH p0#L@0S40 80 @3 H 0#280 -4 @8 D#0<3H0P`(S,cH0438CD0h @ <0 <@T'# d1PS L0 R UD38@0c0L40 00PH?0 @L0 <309-(K@Q  0@@ 0P0K0D|Pl00H @PT  0@_`/PP``(S,c Tk0Xg !0T"b0`L0 04020O (,#d1S& O,,Q!0S< ST d1!S000 *0K  p 2[2d!R!P_`e!N0* K*0[S2 / P PPPW !/ !/ PB0K D0PP_`)4,@02!/ ~,CRq@ -L   00000 n04 8 h X T*"!Bp2P@@00 Y 400 00 X T*00"!B2P@ hY@0 4 00   0 <.>, 00 0^nP`U TG*AT1 @f0P  00,80 (KT/*. A.0P @@0 0 Y K400 00< 0S0c<0la0 , N@}@y@bu@yI&H&H& -L0M 0 ) K0 3SP`%PP!10C8S1< R (KBB &  0@{P &01 1\$ @pL 0 Sm*{  0YPbp\ @0SY SLPL L 1S D L0SYE XD l3 414  0 D3FP 03\ @)pKp 00K \PP)0[402Sa0H @<0 80  pQ QH  Q 2pSO0 @<0 80 QYx PiztDP( L T{ L 0@  c4 8K@ d80!1{80! 1w !10>0>0 1!D4 8K 00b>01 ! T[x đ0IiP0 0 1 D10! dڸ1(K! ؑ $@ h 1 >00>0S0a1 1Q>2=12>303h0 5|0/ Ƞh!h0K ~Pu $|0% h0ԑY# . 0C0b00 1 ! 0D10|0|!0N|0 %P000$@긑 \ḑ ʴ#[RQ@   @R Fl h Q!Ŕ 0cd d hKlK d0KA PH\:h0\d%* d b0 0b$1#[0d0 hd$h!h0K P~$|0$% P -ꠕn$=X= -LHM@aD1V@$0 p 8Q$K 0yP kP $>x K#5x50d0  0\0 ` 0T0 X  0P L0 *0D0 H  0@ 4 8 <0 0<dK7 ( , 00 Ao -L@P @1S<@ -L$M (18 @ `@ 0S( P 0PSU *0 S   0 S  R:p(K00@ T T@ T T TH@ L@ D@  0T0S T L  0L0  T LL @T TT D H 0;00 0 40  8 0 0  M,K.}pP0<0 y(1, 0(1,0|, $,0 , (00(0,,00C,0,(0 c00P L0 @(1? 0(1 U#?< P#0 0 {L0 $f?;j(f?o p-LM R 0.>0 0` Ȍ.$qΌ@P 00 ``Kp -LM pR`$K0.>0 0`.$ 0 @P``0 g`P0@ `  0``P0S  $ . . 0`*` -LM @R`@# 0:#:S&0:#:S!z'zW #P @ $@ Ȍ PqΌ00 pp@P K0@ 0-LQ@ P21C 0 P  QP P0\0 ?!00P0 -0LS`P pP2C@0 0 000 R00P0SPp p-@P00L? @!"`!BȞ 0P?\!`p p-1!1!0@0 00>0>0PL 1/*"`!B ` 10a 0`0PP PPP0P:"!B00` 1 0 10a0P PPpH&(0lp0lp -0LHM,0 0@ L0 T0$ ( TK BT P0 fP P $} K}@64f?lf?Df? -L 08!$P$+Hd.V3]G=PJ#0S @P0SCLd'@M:& PK4@1( K0( !@TcW ß0 @ @`PB0S 0 "I0S7[20S P .}ŸR$09$0 0 @Pe Hr 0f!0 @ 0 0X 0 @JPU 0@^L000PU* 1P? 1P6 xx1P- dd1P$ PP1P0KJ00,@P@$J 9 1 PQ71PqH!0@I|||||||lpnn4=\?ؗnnpnnĕnn4 jf? x'`'nn B8p ndpdpp BnnN& ng?1jW?Dj g?Do|ohnb28g?XM&Tg?\M&hg?lM&g?a2g?hn1jԗng? g?f?g?g?pg?\g?Dg? XP X0SX0X0\0X0X0XX0SX0\0XP0X00X   PX0S0 0SX0X00PRP -L zP00 q[ 0-dL(\0PU @(00Go(PU 00G0hd(/j/jn p-P@L`l(0 0CR0 S O(0p0pGH(0p0p 0-PL@Q( 0@7(0 p-`@LP@( 0ph%( 0-PL@1( 0 @(0 - L M, (@,( T4 Qb0epP , ,(0 S@0P 4`  "100 0c4 0 @X 0eP00e0 0p,'40 0b0(K= p-LM' 00t't0@T P'0 S `D0 iH0S'@Tx/jn/jg? -LM`@p'0S PP0 HH0Sp@000 0h~'g? p-L` 00 ;4 00%@~k$EPPp 0-LM@ 0P00xk'0S h0XX H0SD R00 0S008h;'n/jg?/j 0-QLM@P%('21C @P l@l1'0S \0LL G0S8 ,00P '8zz=n/j(h?/jg?h? p-@LTP00U00S p0Tʄ 41Cc00C7PpH0`>Tp 0@@#cBB p-\0LM`PP0PHH0@^ ,0K(P $@ ,` 7KpB$nB B n -brH0 LS@P RH D W X23%00S4 U 00 OD0Ÿ0CSD02 RPU 0 0@0@,0 0@,00@0UD0 X0!0X00S000hS00 BD0P0CSD000@0@ <0S400@0 @1$8!0HhzD00CSD0ʪ00S U L0S 0 0@0@$00@D$0(@HDz00@0@40 0@408@lpj np>nLn$n 0-00L 00 @T 00CS0@P0S #,0, @|$0h"Dn$njj -00L  0  \ 00S0H0 R c#404 @,0( U$h"Dn$nHn njj p-LM@ K#G  0PQ@c=YB@DB ]BT00U00S Kp0Tڀ0`Td0@AנP8 41Cc0A0ǠcBB p-lQ`LP 00"  L1 R* @00CS@0,]IONPp0 @0S0 0S0S 0IPN0@P `I%0S ph0%@00CS@0pQ000 0@@0@"0S0S (0IPNlp$nB ,0S3 0P0 K00P 0c0,0S P0`0QP,{ 40   0,n0S) iPpQeX Sbv$0P< ,\0@000 ` 0P D300 00 0 ,A$0HK L0 sP3[Sq #[8C8SS S R*@L  H0KPHK Օ,0@, 0@   H0Kp Vf @ @P H0K@@ HK0@0KT;00@H0 D@ @H0KL,HpK@@KR.00@H0 D@ ~,0( C,SP ,0CP0 S, 000,>s @ < 00S@H0 D@ q @ < 00S@H0 D@ K B3~fwt@vt}f -L MPp0  O@P  0 0S (K0S0 U*Y0 ,0(`0,00U, K^P ,0( 0C,0Zl,$>Z ,0U0 000PZr Bh? -LM`W? (P@P ,00,0, KpP ,0( 0C,0 ,=W (K p ,0p p-0 !L  Q b1@sP 0<!0 !0U p0 #  1 0 1wp -Ldh` D bP3 P00 S"\D0@ P P 0qQ 0 0 @D @ < 800sa Q@PPQ 0@S 0SPQ 0008 4 < Q@PPQ@ R 0s iPQ@@cTڃ ?@cTT '02P"0R q' 0Q' }Pn -L(Ÿp `, ^P@dP @ T( T  00R@D 0s @ 0@  00 0101 1s5 0W@p@ @1 1  0A @ 10 1 1s0 0 W 0pV ` 1s 03 !0  !0Vh1 217 R H0R @ "1 011 21lp -LM@p$`KU$ PPtt1 Q(@$ 0^   1s 01 !0  !0^ pP0  #1 0100 g0(0 R 0S00 0$ 0 0W  000X$00,00,0 0S0؛n B?nܛn -4 L014 s0$80   0j40$ R00 0S0040$  P(04 ( R0(0 0S00 P0 010S 080$=P(0 0 (0!P 0-@L P R 0 0 00  0 (  ( 00C00h 0-80P@QL! 04 1 Q000S00(080 R 4 ,00,0440he08 #4#0<1 ꤜn p-@LT`P 80 @Tp0!4 -LM, 0$`Q4 1@0T p0PSp' U@0Q8Q q < 1@0T p0PSp U@80Ste,0$40,  , 8 4?0zeP80 qePnn p-P$`Lp㎎0*O  80<@H p -8 L0`SP8\2 0< #4#0 1000`(00@0TLS* .0 p!4^0`U4P0@4p04 1000`(0@ 80)8< -0L@  h$00h:0 0 0h{ 0-@L P00  0@(00(0   0h 0-@LTP@T 80 P (00(0@T0 0-(PL@ 0h -L$P @pZA@ `V  ~{000@ -QLlM $`  S# %P  4 0(K80 P(00(0  B 00 0 @(00(0  B 80 z <0W$ 0 0R( 43C" cb 8K<, 400 80P=9@ =C0 , 0 ,0 00 ,0 0 @Km 4 ,0R  c ws  ~ 0#S@ zS@ wMbh?QB?B -LM0`A8PZs}J 83Zx 0Sw pP . ,0 0 ,0 00P@#'*40AT"@T 0S!0S 000 1 80  0W   (Kp0 TV 0,0 0 0$0 80P P (00(0   (0 {(00(0  (0 o(0P R0(0 8Pp@ < ,4,0AT@T 0\0S1ASpWcP,  ,@WP4p8 ,0( 0C,0, 0,0,0 0  00,,P p ,  Rn,7h0jn p-LM,`2PS S PKp 1:0$@2K1,K , $` @ 2KP( 4P0 0( 1( R 0S000(0 -L$M`@ nP<  0S 8 8(K,00,0P 4@K 㱍P8 < <,0( 0C,0 ,V7@< Q$G 0D0 Q 2 ! D, 名P8 ,\%Pp2A"@ @@*" Pp  0S) ,  0 0 B 0 ,P\  !0l  S Y@ 0 ,K<,0@8 08 p-LM`K K@{PP Kp0 0 0p  h:bP0$  00S0P@(00(0 ,00C,0(0 ,60jn -<@L@ 00C0`0j p-0LM `Q #0000Ϡ! KNl# !B A31C01 0 :1P 01   @(B?@<@Kpd0j`0jMb& -LM( 0 0@ 0(  10T0Ϡ!KNl# !B A31C010  <@KMb p-L@"PP) 00^$0`0\  0S P14P 0 1 10:  10(  0(@pp p,0  lp 0-@ MLHPH 0@Pb0 ,@0P@bK04jh?nh?n -LM40@8 Xc>0np`   @唵$@0 `@P0 ``P @ (K 0@{|0(K>00 nd`@0@ !P 0 `@P 4,归0, 0Oj -LMp4 8 @P 8K` dP*840 @10@0!0P,0 P@8 ,K ,妎P8 0,0 B0R,0 P8  =P'00K@ (K4K  /P`@Z`J,K ,~P0 ,0@T0P,0 ` J P'00K  P -L M"0(0, `PP 0pWx W P8_ Z(K0  0 PPL0$0! 0@;00 0 PP1 I 0  0PP I@0 Pp0 ,K  PP:, 0h0b 0 RP/Pq@ P41<  T T (1#29P0 pS00S 0S T P P @ 0S* PB0  0 8`6_wPT$1 !SP#P3R0!0 $0S UcPaDojj -LMT T200P `2 0X \" 0`L2 PXxZc00 T2@? @ d0 l@ h@ @ 88" 0K < 02 ," ">K KT K$2 0#60010,!0. "&0 1>0#60(! $101P00D"cL@K@ H K H2 $P = '@P0 8&nQ ]P \]L"T2@5H'K<? T `(W5?P100C TTT!T2XBT0S0# 00 T"<T24% 00T\0 A @P"@1T,@0P,0T0 Q0Q Ѷ0  T[PֶT0 00 0  P,0X$$H'\i]T2L"@;P2(} ,0S T KPy  \2 KT(T PmT00 ?< T1S# L R S  1 T27  1ST70D 0R KT 1T1`q  T"@<T2T 00000T 0000T" 00T 00T" 00T 0085TL0@l0  T"0 000  T0 00`T"040 )P4  `VGP",P2!2$ 0Q*0Q'&< K4KTV@@Px8KPP'T2&T 8 P%x8 <00<040@4 00408 40$ 4(00(04 ,00C,04(0 ,1< 4T5|T<4T-8|rꀕn4 j `P 0PBDP,QphF1T T0 0$S$0#T0Q/00HH ph  -LM0`S040  b  `p$\} 80Q 40 r \D @0q  ,0S00S5PU> U   0800QJ @1$K0  㶇 ,00S0   0⽴800Q0 Q? $K$   ᙇP* 00$ t1P 800Q Q? $K  P Q HH wPE h? 0-@L8K4P,0S<0 <0@0@@P-0h00j0j 0-LMP4@T  01@T < R@0@0@0 p00 050 ,Q 0 /0U0 00j0jTg? -80LSP`@!$ Dd0 R000 0 0  R T 0 $00S @02#00S,0S0 j[00H,: ): &:004 @0S  G < 0R50@0$@0@0 Q 0 0 0S0 0 0P00 &$@T# Ȣ0/W@ 0p 00  0㸳  ,㰳,⬳/00Q?` H H幌H0  HHy00 \  1L0S!0008ce00M@0(  x1 $0S|/ e0  00J\0Q Q?`  >!0200 KpW6 0@<Q?`  *pT)N/! R 0T 00004C@|0S   zP  Rh?h?AP:  0 000 @P@0 @ 800800 P .0 5@00 g1j0jBj0j]? OjOj<:pn x'`'Xh5f&f&pnhnln nnnF8p@Bi? -LM t   R d0R R  @@    )- 0  K$  -LM 0   K -LM0 , @$ 0@@K& -00L @h p-T`T0@ TL 00PSP0S@Tp0jn p-d0L@`TP p  mP $ `P@0p`됝n0ji? @P-0ÃɃ@!><0C64 P@00 6R80  0PP @@@RPP"  Y0 0cC61`0 0@ 8 0 iU *ii 0U :^  ,@/] 4E\('] n0j(n0j Ojnnj?j?j? P>0 à 0Rl PR 00S 00 p-0LP`@V0D  Ppph( -0L(!(M10 p  `@0   PP0S (Kp(@8K" 0P' p38K(  #8K( p38K(8Kd(P lp4= -L @ hP -L@ h AsP -40L   @fPhlp -L@ hs QP<0S8<0 -LMbp<0 P @2Pp8 p (K)0 + @p T0Tp p-0P@L `0S 0S 0S P  XP,pp -P0uL@G 0SD 0 R 0S uP7v 0S 0 R 0S dP&w 0S 0 R 0S SPu Pv `wp,ɥw 0Sv 0 R u 0S -L MP0|  0\  KK~0@T00 p-0@PL`0S , R 0S 0S P0S P P 0@a0@@@@,ap T0Tp -P0uL@Y 0SV 0 R 0S PIv 0S 0 R 0S P8w 0S 0 R 0S P'u P 0@a0@Pv 0S C`w 0Sp,w 0Sv 0 R u 0S -L MP0|  0\  K~K~0@T00 0-@QLP 40 P 8000008 Q P 04 4 0P 0 0-@QLP 08 Q P 044  0Q 040000 -PVLP@+KTp40@ 0S V08` 0hE08 R e@P =P 404 P @\ K08 R fP 40  Q@,0  @괥n -@L0|8PKphK40` R AP 8J,J 0Pnn@- 0@P =9@ =C00P=9@ =C  0 0S  0 L0|0?B00CS0Jn p-L Mh`@PT XX0 PPL0048K@ s00Kp(jDo?4jn R0"0 v -LM@ D0 < @ 0 , P`輐Q0K0@0@0 <@D 0@R00000(K(1(q R1! 0O80 4@  0# 0@P@ 0G@W%8 K  0@P < 0 D0<@S 0,@8 K ! 0@PD 0D$n@BB -LHM0pSP@ d`K { H E|@T T 500CS @T@H uS s K @0 WdKH !| 0H@ -QLM`?P0p 0R [P0P0@0Sp000C0 00p0JS &&&&&&&N 0SE @ 1QI 0SA Z  1 ?Q 00SZ0T1 U+(  d0a. . $ 00 ?|0 t0 0S@0S0SPT a 0dU BB0j0j p-LM@(`KP tP UKp p-0PL0\ Q0^00S0< @TP<@ @`T X+@Tp0 0\ Q p p -0LSPp S& S P:Q  hP; P @T ` @T`V0S0 000@T `000 Q @TV  s`04ꬥn p-0PSL`4 S SP=P <(^)^ 0N0ppp0S0 000\ )\ 00@0 Q<0^ࠡP P P )<0^ࠡPl04ꬥn p-@LPP0 <0l1&`P| P0Ta&p0 Q p\$0$    0 ap̨n0j0jШn0j0j0@-P0P@0P0B2Q 0 0\00, j0@-P0P@0P0B2Q 0 0\00, j0@-T0P@0P0B2Q 0 00\00, j -|0L RBQ P@  0P0SB8j0, jȨn y0j㽠 -LM00p `$10 @ P,K!02P/0Q$ P- `Q 'U00V0 SP`@P0@Sp0p0P 0P R0S8  0 @ ԨnШn̨nlpnnnܨn -LM$pK SjP$ `Qc@P P TR00V0SR00Q0#S PJ`@P eШn̨nܨn-!P0"0CP0 R 0 00\  0  X R0>T!00T1T!RAШn -LM$PK2`q 10TZiP@T@PV 0x刀 0@00 @T 00\W00V0Sp`Шnn㮟 -@L 0@0jȨn -LP00,P0!00 @\\0$@\@T1  00 /40 R!Q?X`4 @e!00 !0R R 0 00  !`G!~ @> !p3!j0j(p? -L MP0p mR0 Aj Y (0 03 a0( 1T10,0 1,   <0S0<0… 04 Q< 0,0 4 蠅|000  ė$00Y00S 0@T T @T,Q 50@SL Se S`" ^V 0(Ko40S 50S (K R R 00 0 P00  `(, q 34Q00SL0Q00S  ,0` rQ?p(Ko0   W#`12S201Ņ 蠅 3X000 ~ R0Ow0 @PpEQ, b40S0Q`0S   /0,Q ,0S` `0S` 050m 0jl>n - L N -x0L@T@T 00 00( 1  @Tꬥn -LM@0 P(`0A s  ,4(0Q Ki1 0<  < ! 10! !1 1 0U1 0!10101 K0j Pp-L`P @T U  ,0 t@Tp P-L@P  h -LS`p) T1@TN @T 800S0 T00Q0S 0RP W e@TX* R4 TP$ PU PU @t 80S00 R  0'P W 500CS6謥n -LPp`P P U 0 R Q 00S U U U  hlP @T0P \ 00S U U U @T U  -P0 UL@p #R#0R = B @`P  0S  `P 00 0P  U r R 0i| 0i b0i @B($10CS$10(0(< n 0-LP <(J/@n0$10 n 0-(0L$!PR @(@0 -`L(P!R p^0 @ ! 0 !1@  T101A!0R101 1P 0R 1P0j -L M<< 4@0 ,J 0@>KЩn+'4j4p? n p-L`P @T @Tpp@T R0000 0  R0000 0 R -pL@` PxP W` P 00  00S00@ P0-LPP@@@T:QP T 01 R0D00D 0B9S񟗊e'g'g'g'g'g'g'g'g'g'g'g'g'g'g'g'g'g'g'g'g'g'g'e'g'g'g'g'e'g'g'g'g'e'g'e'g'g'g'e'g'g'g'g'g'e'e'e'e'e'e'g'e'e'g'e'g'e'0BLSg'4l'l'k'l'l'k'k'Tk'k'j'j'j'`j'j'`j'hj'tg'Xg'Xg'dh'h'tg'h'`j'`j'Dj'g'q' j'i'i'Xg'ndp -0L pRP 0@T `@T L0S`L0VL0V[1j 0-@L =`0PS 50S L0΃0hq 0-0 SL@P P  R 00 1 P ( @ 000 00 0lp 0-0Q@LP00㐃 R  00 10 0 P  `0S0 50 0`P0lp -H L00K 0t#x00d lpQ0d lp 0- l0RQLP@ Q 1<000hL  5 @00@0 lp p-LM`\P0 R 0@Kp(@K0 kP90p03U0SPXjnxj -1LM pR@ `[ P@P 0K NUP KtM0@PVL $ UPL0  !p( KP0(P  R V  UP#, $0R  , $0acQp0 @0 0 d 0, ,0 0,AZ<0@_ 00CUAP1j1j2p?ʚ;BB -LM0@KPpU ,` @ t3VP K'`@ 08j -LM 4 0, @ P`0 c5F$0@X  ,0S 40, SW0001j -L Mp(K$P (5 0`@ Kʚ; 0-LPP T 0000S  00000 p-LM`U @K ^OPV   VOKpB p-L(M0 K`NPPE 41@@K 0@a@0 < PP7V0K. P0 pP #PPV" 8K,4008 a`Q0 , 0 aQ `t0(  B( 0$ $0 (0S0(K (0 $0 OPPKpk@ 0 , MbPjxh 8& CRQ#0@$'q?r? -LM@P8`pP  !0K@n p-LMP@ R00xhR `'0 S ` N<0 0Sxhq?@r? -L`p$ PP @P `@@0@ 0 3' p-h` MLP\0 T@ P  0D$ @P @Kph@nLr?4j' -LD'\r? -L@KP 剕T0< 0 0S0# Q !<0S 000lpl>ndp p-0 @1P0Q0TLT00AP0 0CS0 k00CS0 NPTphp 0-@L T0P0$S$0#T011S 1ԅ1ą0h4 -`0@ L< 0S 0 fvL0S$ $000 [vnl>ndp -50LS@ S&00  Q?0S 0CAv0500S0 S( <0!R 55030505pr?lpl>ndp p-LMQ`1 K PQ 00S0 a cR =) - 0A  0 0@1 P=9@´ =C¸Ÿ0 0P0S0 0S"  0S*0@ utV050 000L 00Kp   0S000S0S0Slp?Bxp8pdp 0-d0PLP  1 15 @ D00D0p0hM%lp|r? 0-H0L @ 1 P15 @00@0V0h3lp -l1l!`0Vム\1L`T1@T< Dq@T7 50 0CS0 00 0\ S5\0 dV\PX X"1WMT0 \ X OMTg1Q50S ! !@TPA o !"1!S  11s$np nn4jn -<@L 0,0, /C!b0 hTjб'Bgfffn-444 40 0004jn$nn 0- L P0(@S 000(0P(@0-0 000 n - 0L 0S ,00,0 Q-L@0Q0P (0@ ,00CS,0 -@LTP`p p@T $0SV VʹpW V V $0S 0 @TUp##r?r?00C0 Rq n -pL@`TU@ 0P$ RU00000 U@$n 0-$0LS@P  P 80@ P0  00hG }${$$nr? s? -"LM0rP,0 0S ڈ2xx q0S0CX0 <K = P0S P ~ 00S0 , 0 Rl(K R P!0S@ @ @0S V0QI Q0(0BS0A0- R 0$10  0  01' Q0S  Q00000 R<K>l1S R0000 T"0 R000  $#렕nn4jn -0LS@`p3 0S$0S  0PS'0U 0S PPp0S00S0x"0l!0S T!p0 0!i!4jpt?Xt?ĕ?t?lt? -QLM0p0 4 ,0 (  0 Q0$ `0V 0  P0S 0S 0C8S  0J@0 5R 0Z P0S`V`0 R , R $0DS 000\!,K4K^S!n4jt?t? -L M`p\00 @0S @200 .0S00lWi 0 QP `b @ 0,0 Q0S00a 00 P W[ ` !00S  `1\ 0S 0S T 8CR0S00 S00 0S\ S ,00 R 00CS0lb h(K`Pj 8CR00` n4j 00B0 S;?( K Q02\ 0A0@T P @  I8P) @TZ \ 080 8P0.S a0BS8 a0BSW0BZ렕n ,{??z?z?{? p-@LTP` `@ @`T@T  @`T@T  @`Tp -L8M⼢ ( pWaWW "2, 2`Vkt0Sd 80s 8Kd" d X P@_e$ @ @@@Od $ P@P_e  @@@Od  P@P_e  @@@Od  P@P_e<  @@@Od h P@P_e4 H @@@Od , @a W `V aWd X0 `V( 0R"$K L 0 g8K qx p렕nx|? ?.@|?4j?`?|?|?|?|?|?|?,|?4|?@|?H|?P|?X|?`|?h|?p|?|? |?{?|?{?h = p-L4M`QPa l0<M X0  @TY 0 0S0 ``` 00C 0L0 0CH L0h0Q @ H 5 \ @00C\ R000  R0@0@0 @Kp08 0S0 R000  R 0@0@0|tLK 0 (` @0>0S! ! r.P11"p"l00``0SS\60D D0D0D 0 0 C08n kl00l0 l@ l P 0@@ P` `  $ll l l@ P0 P` ` ll l  l P0 PoV dP l00d@l0 00T00,Kp } R5 ,K2p 51`:R ]Kd`Pp@ `0U  S\  \ l@\\ l| h\ @bTZ T W00 S 00  v @DT`Q Z T W00 S`@@ 0 b |P @eTvZ TW00 S000  N @Dh P0 bh x0l@@l@ 1>A Pp00  c`p0 l@ 0Rp p000b ap  bd`Pt@00Dx!0000@ Qx t h0 x*P 0@ \t d x@0P!0t 00A 0 \?d0 x x l00l0 l@ɟ X ^ PP `l0  00l@@  ` l@ ` !x0l@Ll@ bxl @ l \x0lPl@l @x0 l@ l Pl  P0P 0O 1P0P0p0 p7Qd0P Sp [ P] p@dPd UdP\ \ P@`@ `` l@7 X0 lk P 0@P`@ l { PL0 H@  ` 0S6 SL S`H@L0CK&@@CD R Z T W00 S   [ @Pl 0 P`l 0x@ X 0 t@ ` xl  l x+` PP0CKP p \P C0KP P0 `\PP `CP0P@00 `ctPx PCKp \P CK|` Rx0x@ ` xl  l P0P@0h0 h0\xP0 -Pu`` <  @D|T@W00 S   pp PU):p0Z h\ @bTuZ T W00 S000   @D0 @D`0 @Dl h \0@cTZ T W00 S 00   @DTP  @Dl2 ZW TW00 SB   $,Kp %2X> &BP p0`cp0  cJ` rV U-Kp ,K,K @ 0 m0d 0mQP` @Dp@ p@00 d0 P000T0S  Rt @ ;  06t 1l  cl@` P0 8CXo dl Nl @K P@08#X` (lNl0@ P@0 尀lHl  P 0 L H zl l@ P08#X` l  l @ P@08#X` P0P` P 0@P`@ P0P` P@0Po P0 5P0 L H 4ꠕn}?|}?}?}?}? =}?x? @8Q pL0H@0 `P  P@ l@2A \@QLK<@00`!0@^S!0@^S^<,Z9 TW00 S  j !0@^ST@W00 S  [ !0@^SZ Qp /P\ GdP?\0 H@L0CK!@b 7l@ P 0 8#8@L0 H@ HL0CK "Jl \P@0 P0 L H ^ Z TW00 S>00}  zPx 0?d0 P0x 0P0 -L@MQ  K" 0(@ K 0 K(90 --0 L M0CQ0  0( K  ! K0 K( 0 0-LM@TPb 0P40@ R B89=85jn --LMPE 0 ,0@ R #K5jn -@L3[P @ P >  0RKp렕n$@ = -p-LM `9 0@PP PJቩ00 R0PP >zKpn -p-LM@ `P 0@@ @%d,0 R0@@ UKpn }? --`LM0PSP pAO d P PL0 R g>4nU,@ 0@Ln}?@5jj -@0 LH@00S S S  Uh>>hU}?5j~? -LM  00~? -LM00P20#R0`0! R b1 #88P$H*0pK@ !P1[0 1K!P ҅ - 0L0S  c1 #880S$H:0000N0 l>n - @LT`pT @@ P 00 00廅ᎨE-鰠0S㨀 p嘀` @00 q0 pP A8Pq 0S2  0S 0N0$B,5j(5j$B05j, ,0,0Q0 ÷ D5j<5j@5jLn-000 \ 0   D5j@5jLn<5jp@- `-R PP0R @/ 0B RS2R0  T ! 0B RSR 00B \WBa0BSA0BS70B Tp/0 S a pp XRxR @@0 @-PaLQ`pࠁ@@@a0LS*\0 0@0 S008C8!0000@ 8 R#8 P P PP@0 -p0E L`q0S \(H\(T\(d\(d\(4QT"(1 T0`!10 0 0c0C1 0S/0cd0Y:g0hr0ho0hk0 e@dA"OpZ0 LR@@M8J(5j$B,5jl BP B?p B$?~?0?~?܁??P? -LM40p,S0 @h, 0' 00 @(r 0 P (r @BVW 0Rp,eQ sQ dQ ,Y h00T 0 SW@@A(5j45j$B$B\? p-LM0P S S` S S S S 0 S S S S S SPx@KP @ |x0 S S xt?(? -LM R R00P R R P R R  08 R R# R R R R  P R 0S=8@ Cx`0 08 CHT#hP0  8P#800 08 CHT#h0 8CHt Qs (K,`KOPs A>05jB(?? -<3LM `R#$SP3 P8CxnTNT X@yTYTYTyTz (K(Ko 8C800 nTNT xX@lyTYTYTyTcD2 Rp @P( p Wp 0S$ QY` P0 sp p0ps PZ @ ,@ x0 8s dPCu08s<lY0 0%0(Ko[(KocvW@aA00c10I0 0c10 |:(KoiP! ,XP,  ,bL(Koe(5j,5jl B?@܂?$B$BBȂ?~?Ђ?~?p Bi?P B?? -L8cY(Cx2B  "0`S* @P 0PS# 0P0 PW WQ W0 S0SSPc0ISFf(f(f(|f(PQ0SD@0@S PWc0IS@f((f(f(e(cY0   0@004|00SS P@45j$Bl BP B?,5j\? -LM`p(@0 S SPP S@S(K,KP0, R ڜ?P QPqP |2p 0 -P,00aZ<tf 0(?Ln(5j~?(?$B0? -L0MLK(8B(` T Cx#3 Q W ß0SأP @$0 @S P0  $0PPS @U ,PKpa 0Pm,@t H# T0(i PKtKY,0sq aT,",p RP 2"PP@ PE U @D2 |B@T`Ÿ 8C8s S<2 P(2\ 8C8s S1 PP!001 R$ @p 0S# 0 P0  ]P0S S0WpT(KH@,@T0S @P 0S 0P0  /P0S S0UP p0@S 0S 0P0  P0S S1pTA(5j,5j$B?؃?BBL BD B?H?h? -LM0 S SPpp0 S S P S S{ Sy Sw  ` S S `0 S SPሆ0S @@0S lP P@0S@ T T`` TPz9 0 D B2R@n(n(n(n(n(n(n(n(p(n(n(n(n(n(n(n(n(n(n(n(n(n(n(n(n(n(n(n(n(p(o(o(dp(,p(p(n(o(n(n(n(o(n(n(n(n(to(n(`o(8o(n(o(0 S0` 0$K`5000 000 ğ$00s03S0000 TpD 000 T0@ qp000 T,0@ 000 T ,`K@P,?0@ T ,KvPo,  RR@@ Rt30 Tf ,`Kl@P,e s0@ TX ,`K^@P{,d e0@ TN ,`KF@Pv,@0@ |TW50@ vTG/0@ p,`K.P'0S ,0B0 0B RS 0B RS Rtn R R R P,00(000 =0@ 9 0@ 50@ 1>000 ,,KP, 10 ",K& K(0K$@P,"[2[n0@ @P,,0@ & K(0K @Pf"[2[,f0@ @P#,0@ & K(0K@Pc"[2[,M0@ & K(0K@Pd"[2[,=0@ & K(0K@Pe"[2[,-0@ H5j?̄?4j? A?B?$5j4? ?(?p?X?D?85j -L8h4f(,i P P hZ??n?N- 21CXj 32C8cjH0 $\,0 \ 0 1s,0vjwjvj-l0 $ RP0\D0S   Q 1S0$<vjwjvjE -LP@p`V `P@ PP -LMR,0 P p' p`0Sp` VP 0S00űY|@P 0 p0 ,00,0 ,0( 0C,0 ,M,0p -LLM0`03l l0PQ!p Uh d A T`Kt l0 wPd  t Q ざd(KU 0 1 0R0hq h 2h0La#!B !C31C010K,0 0 !P8K,04 8x"00P=9@ =C0 , 0 ,0 0pH"@Cp0  ]p0SRhq% 8K800Pc  RE00K@0 <@ < 40@ cR=9 =`< <0 1@ A@ QGڔ!43C" cb 00@@ T!0S F 2` Kl0t  Pd nv@C 0F =d *d0S @uCd#P Xp PTl  d M0,0 00 @Ky4 ,0R  0@UC d 9l   P0d d0 / BMb?BxnQBX?tn -LdM`Qp@P  Tㄑ  Tc,0( 0C,0,4 (KT 0PK0 vP; Tp,` HP D@ 0 4 8 p8p 0S3W00p8p 0S*W( RP0  H KP80c0P`pǏP H0`0@0P4`H0L@00S D80W pP  fP #P -LM`@PpzP 0 K,0 0,0P p_ -LMpP`z@P 0 K $0 ( ,0 0,0@(0KP@ : 0-8PLP@ PP0MP ` 0R0000tn 0-@L"P" 40PP0 㢜` 0@R 00@0hl0 \ I0PP0050S ᛽0@+Btnxn -L M@ @8 < D H 0 , 0 DH0X4 642a070`o 0PpC P<" X y@P@ - ,0,0 ,0 P  !0!88 !,0( 0C,0 , X, 00 0 R, 00 8  (K = -LXM00S0!h0 h0R\t lAd L 0 0d X Kp\0 `@` x P2  PP- 0`@AuP #U UQ \ _PPPQ ` UPP Q d MPPx0S ړ(KP  PP P  PPP 0@K PPP0`Py @FAX@Kpx@ L0KHKD KT`KP@K\0 ` d , 0 0l0 0`@p At \ h0PPt 0S0S& 8K800P?  R00K@0 <@ < 40@ cR=9 =`< <0 1@ A@ Q#!43C" cbl F00@@ p 0S @@F l0垽PዚU C@Kvl 4 ,0R  8K,04 8< 00P=9@ =C0 , 0 ,0 ňxnQB`?tn?B -LM@`xPP6 03 pD3W& 0W. '8ჩ᪩ Z@#,0Z0,00K0 fWo0Z0'?g2Wo 1CW!0S$0< $ @000(K @ @00000P2W# 0Wc 0 @T0Z0' @,0( 0C,00S 㶒  0,0 S00@0@0000, K@,;  Ȓ Z   w@P , 0S2 R0b,0 P@ 40 , 0, K@0,0 S0000000, K@0` 0@0c0$< 0 @0 0D0{f |f}fvt~fwt@ -LdM`Qp@P  Tㄡ  Td,0( 0C,0,» (KT 0PK0 P< 0Tp00 HP D@ 4 ,` 8 p8p 0S3W00p8p 0S*W( RP  H K0@P8`8P`pǏP P0`0@8P<`P0T@00S ё8W tT  P #T T  ,8 -LM`@Pp=wP 0 K,0 0,0P pV -LMpP`w@P 0 K $0 ( ,0 0,0@(0KP@ 10Q$ 0Q0Q  1Q h0Q80008000P@0@000@0@0}f~fs s@-40!$r< r<080  ^0 80  5j5j40!$r< r R00 0S00\ R00 0S0040$ < @03Q0@0 1 91\  40$ <Q @0 19 1  00b S 0 -L M((@ $H 0@;Kh?4jn@ < @0<@0R 0-L@@\, 0 @P 0<@00p? 0-LQP 8@ ^4 0 n0C0 0 qG000j|nOj -Lp$ :0 `H @0P8@0@0շg c``^#`\P000f#?|n 0-@P@L x D@@@<@@P 0⻹04 0, 80($ 0 -LMp(`mP@P UD(Kt@P ,K8 K{@P,0 ,0, ,0$P,00K4 Kz@P100 0 0000$0 <, K -0LS0s0s S-0t0B!`R?R? 8#0S> hSh03,30""21C09#8>gfffON0  hnLnR  Rx0x0'' Q Qx0x088 RA⟷ -0@ 2L &0Q p00  (00H >1>1>1t00  |0S0 0 0l0$0(QLnhn p-QLM@`@00CSꤢ(ܢ((((000 P @Kp-@h0`0X0KH02 0B @啋`nPnDnXnLn -` @0L0C0 R0 <00  0 |(zHx>hsLnhn 0->L@ C㚋0PT;:h0h0h {(h wHh sD00 8 P0$0 0P坽0hnLn( 0-LP 0NᆵP>T0 -@L`^ VpH 0耓0RUV hp t0`0t00_H0U 00 XH A =lpB? 0-@Lגt0P0t00h) p-LM@ǒP`H0St0t0$ 0  0S H0St t  0  0S 0t0H 0uPP x\6j p-`<X 40#"B LPヒL0H 0b 0H@>T@@ԑp8cj 0-@<` 40#"B LPf R00 0S000h賑8cj 0-@<` 40#"B LPG R00 0S000h蔑8cj 4 0p-#Lp"B @`!r r p<0P80<`00@up0P808cjt6jd6j -L0MpP(K 3 "  1ˌ3Š"10A0 0cX0S |0S \P \2 U+ 55 A0@QR  PS000S Su S 0AS00 @R  R Rl R 0R:00w 00_P\5 \@0BRS$0 0K$0< 8 K< ,1N͌\40, N=L L0 , 0^8`4 =N` N8` 4 508`S80 S( | 1Z31C0!02 ;5,.ϠClB/<@nB 0 `@QT T0Rm:8 80R  Rf PXL@00UpQ??B???h$??ȅ?? -@Lst0 | ,hڲ -.H0LS@ t0h[0t0HȲIJ p-@LPt0` p@ 0t0xt0<t0Op -t0L@@ 0  P H Pt0@0t00 0S Pt0@0t0 - L X_ X X X - X00"# 0@d 0 d HH PL#0?0S 기((ذ(خ(Ȱ(((0r8#(.a0HS H0 `0HSqd(((((((((((((((((((((((((((\(T(l(L( 0 .0Pc0>SpH  P``0O0@d  d 囏>V0 H>{  0@d 0 d  H P 0>eHb 08#(,!0 Q0A8#(|A0H\XSPP 0@d \ d H Pl =^P!P(P'P)X)P2 l 0@d 0 d  NH~ PJ>SD @Pn =o@ p-LP@ďt0`   U tp0  p 0-t0L   % P"20# P0  @@T 0h0@T00 P0S P ^T @^? -LMPP i(`$pKW @P $ ' @P`H @P $  @Pt0:t0城0>0> p-`QL@ Pg dP`Up -LM2@0 SP 50 ^ B?@0CS+1 ? R/  t0 ! X0N>O2n @ :t0\ 8CR؎t0 :t0>%`(pKⰎ > PP ( PP0t 5*0t .8C8Ac Q.PPQJPUZ =X? -LM0`P0 ,0 8" p4b ㍎t @0  82#3UӍY  G̍\#04 R|  VR8 0H0XDVT V(ڠ0@ "?0@V' 0>H .` . 0O0@d P d p`l?ʨ0H0X VR  ^NVP)0p`FH0XH0@X#82Tt0!0t01H R`1l#OK MP@4Vpp4b ŚH0CH0@XH\,  |0P| 0y w(0!s1Fp0S7  ݜ 0@P< T  4QKD, 0 R(K  4 Q 02R# #}Lb4K   oꠕnD6jlp =Pn\6jnL6j = (6j p-L@Pᄍ` (Q)Q#t0 >;.t0.@phnjq t0àLp <t0HQHP (Q HP8cj Q-L@ t00t0t0 0t0 0) P P 㾚 -t L @0\%0 t0 0)P P 㚚zQ  q, 3 2CHt 00t00 Q>|  00CS0 ttjn -`pLpD0 㨀噌@  0@D  D 9@P ✠$ !,t 00S s PWP|@  =?= t {RyW  b @h0(PTh ?R](0Sڜ0  P HPt0@t0 0S Pt@tt  p [ t|  0S- 0S  0S 0SI 0SW~ XzY| t h 0@$  $ i0 t@0  Xth0@t t    0R50,50t o pG0 #Y!   A0GS p0S P 0S 0SM @T T   }t@(0 h0S&  .H0Stn  0S 0SWt W W@ p p(0 S|PPPY T 0S 0S 0S >08#8S>>>t  ^0SpSn l >(B8CS@1@#Td@DpT]0p  x t  (Wt{pp !W|pl 'W`pi W Xn0|S W 050;|[(0 0S050,| tWctW   ^tɌt z Tx 0>(xW 0S tWW9 tl 0W tW   >Rq iQc0>t>tW  |@i P0 P p ^p P P 0 @POp0 P P W 0@0S  tt/ W   t}\Wˌtxoq0̌#"B0t )W}p ^W~pr  R @>0S(| .|Xn`nDn =8cj p-LM4`K@P0t2Ɍ0t[Pt09t0Kp -4LM0p40 0P00 < @ 8p ,p 㨠@Z@0 4 0S\ ݉@w0$($?Aas P0S Pi8 R , R,0 8 0^t 0  @0#P30#p8\ 8 0#p  0S00SW#W00n㨠pᏉ@ k0 4 0S, |0P 4 (0!41@0S  t|"2@?pPu =(0S( ᷈` @P%0T: 0TT X<TpP<0S X` T 0T 0T 0T  T` /h1@/ b\)8 R 87(KT =  S| V  !1pP 0PCʡ#W  ] 0%>0S8\, 7 8 Y8ٴ80S, 8д0p0#pp*plpBgfffD6jT6jnL6j( -0L@  (0 P0S0 p-`< 40#"BL P㞈@ 0 t0191p 0Sp8cj 40 -LàL@`wApP@ .H0SPUWT ṇPʤ0  P T t0 P8cj -LTMPx0 U`$ G:U t:U J0U `:Uk CT:U H:U $:U 0U+ p(K:0S4 0 S , |0^ (01F0S/  )9@pP 9U'0CU*0CU`9U (0CU D9U# 0Uׇt @  5,0t #p8U 8U , >p8UD 8U$ 0U 8U40 R  㼅P|pP\P8US 7U v:80Sr㎇8t 0S$0SVt܆pb'0Zp\ pZP W0S Z t0(0(SpL  @0h 'D0 @0CpKp0 l H@ @ ?pP=X \c 0 \`p \\KW(Ct0@tq <àL&t0 iQ0CU 0U,t0p;t0傆 d6U 6U0St0t000t0t0KP6U H6Ul0p006U 0U征40 Q$,0! Pp 0Qp| p5@ p`Tp#*l0Sm l0U20x   pP   l0 'p@  PH  | Õp40 @T0S QQ 00CS0 40, 0p004 004 | 40 2,w  Tpq㌆1! piㄆt0p;t0څapP Y bpUH0p0Q0 0S x0q 40 R,0 l0|#20 p6 p2M@ ᢅp(Cx08x0 @8x0  x07x00@x08x00 x07x0b(0S0S  pP{t  0    00C 0 00003!0 !00l # B,0 000-0S 0x 0 QR BP0R 0P R00c!0R#<0j-H0P R 00c!0R#<0j -@LQ@ 0 S00C0C 0 0A 0R 0l!0R# Q @( 0-@LPĄ0S US 0S\ a aR QPb0bU00S0 00h000 0 -@L`ᕄp^P V  0 PbU0Pb 0 b PP 0eS0 1S00PS0eS0 0PSᵃ 0-@LR0SP%  0P0\ 00a!0R# 00a 1  \ 0 0S00000CS00 00 -PL`V@-Q@)pQ$ 0S`0`Q@@  P 0a0 0S00`dd0Vp@hQ  @ -@LP Y>{P 0SBM>{000 p-@`LP > |V`0 0 0P  pUB> { -pQLP@p1㝃 Q( Q* `0Q! 0Q a a0RPP `P  0a 0 0S 00pe 0WȂ R 0   p-LP@U `R4 R0S) 0 0 0P \  a 0 10 0 P000  0p0 #0 00  V0vp -LMp0S" 0S 0R _p$K@@KP@K $KmB,0 40 0S \ p-LM`P, 4 @T \Q Q 0 S ,l(Kp`\at -Pp L,0` 40 @T  <M^ 0{\ `]` -Pp L,0` 40 @T  <*^ 0G\ `]` p- P,0L` 40 @T  <^0 [ `a]p`p80 P0S0SPpn -L@PP*0S( BT 4P: P0-LP@0P QT 4Q R0S T0SR\ 0 -h0LPpU` @T * \4@0  ^PUpn p-`0LP`U @ T*$04@S  RPUphpn p-`0LP`U @ T*(04@S  RPU}phpn -LMQP@#P P EP U Q4Q0S0\ E 0 $K*A$Km 0-0 L 0P0S@ T* 04@S  RPU 0|S00p0 @h0@d@ T姫PP ᣫ0#40hpnAjhCjQj8jn\njtnXn(j4($ 1S!P@7j.R0>> S9>R0!03Q>  p-PL@`p21C0Nnpp@-L!La0P 0cS@(010,1  1 ^  >!R 30bS01\> ^21C0Pp0S5@ 21C 0Qҁ0S0 S*0>p, 0 0cS00@nn=jnn4j"!B >0>\P 1 0 STQ X0\"!B >0C>T@-@P$ Qࠡ \00 a0 0l 0^Qʲ1 0 a0b0  R( 0 0 R`0 SQ1 a 00a01 a 0S*cPQ- ^0n\  S ^ 0n\S1  \0S   @00cc@ 0b1  \0S  0  b @ L0 0c 0-@PLtl1!dX H@@ 1 @L X PTDH ` \0(0 "": ,0 4#t<#d\;1ꀆ???(?D?\? ?H?t???t??܇?(??|??؈?? -LpP`A @A1: 00100 P1@00 -@PL 0@  @T 1 @L @T -QLM`  p$R KPP VU 0 @@cV@1 `d0 0 VpP  0???? p-L~h0`PU @ T*,04@S  RPU 000ph$~pnxn @0- 00@ 1L,80<0 -\LQ@ `0`0` \1 01L 1 D0S H @L1 01L X @21C c`nH? -1T00!L B!1@@l1xnn 0-@PL `~PP@0h}0 0-L@P~P@}0 0-L@P@0SU 0  00 0PP 1  \0S5 0S P00 p-@L`~TPt%@P h 101a}@0 001a ,z0<0pP}pnxn -L@pP`}W P1T% 21C! cUPP@# W 3 }1@ 01 $ 0L H0X`TpD0`@\@P @ } }@Z = |@`n p-PLP@pv`PD  R 0 1 .p0`00 01  1@ 1 0@ ,@1  $ @@1@ 01 `P\PS}@|@p p-@L`D}TP\S@P P 101|0 a 100p|pnxn -LM@Pp `QP P R*P`bU1f0Z P 0j0!: @@@00|\0!\01\\ 01`P`<|0 0 `0 P  rP&0!0g00,0 pZ 0j0 :0 PPS,00< -LϠMϜp0 Q10 K0 l`P} W0,0 ,@K,n@@0@0 0 0z|\0!\01\P \0``1`P{00W  pl 000 S0`00 WEVA @ PP> Z& 00 0bW1! & 0S  ;O NW1! 0  00b\! 0   Pd0Wp00 W,(K, ʚ;??l? -LM^ -LQӿRQ`pP PP 0 \@ @ 0S*@cTS5X V 0!0 00P0000f0xPP" 1 `000 0X0j 0    0S 0S00P 0PX 3 -LM Q-Lp@`9W 0 0g 0 1000+P& 1 Q@ PQ QPQ100@00 0g0 `` pW`Ȋ? -L@P  0 0 +@nnn -P@P`U^LpL P <0@T0h`n$B7jn -L M@ 0@0p嬐嬀嬠`0@ @P#5  0@PPH`uVp<< P(Ko?n=(B`n8j7j,B?n8) -PLMp, Z ,  0Q`%,` P`U0@TpccP @P0U U1Q  P P@U`0X#@gT@!  0X PU X`p0S P P0gX@cTPP P, 1 0YpP XPp 0 h1777 -L`RPp/Q+U" 0Q*U 0ScPPV`dVP U 0@`T@! P $# ! ?8??? -RLMp`@0,0 PP V@`C,K,0S PP; 젠 kR&,0S W0 gpZ @1@!S @  `dVPx0Z0 c; 1 5,,Fn -1L`>0,0Se* Rb 0Xpc`-X00VX 0 X@1@!  d 00dS 0000`X00VXS`` `Q@@T, XpP T,1 Q@ PQ QPQ1@00X@@ X0+0S* R; 3100 2022RP0S0SP00 -@LP 0o0qP02 - @R0L0 0S00op R0 0 R8#82 0-PQL@0o qP @P0 0-@ LPP 00 -@Lp`@T PU00002 P02@T P -LMPp, 00  R, KUP @ @ \0@X@0 ,`RV \ 0Pf 0$PfW00S Z,00 0(KW# UaVj0@TSYTS  0 PQ ,0 0@, R  0 R0W2\`eHPW@T& P0,  0 0e 0 00 00 000@0,0 ; 1 ; 1@P  {P0 VT  00 00 0Oe,0S 00S UT 0S:0e 00, ( 00e 0,@ E 6F눋? -40ML @   0Klp40$  0  191# 3S,0 00Q0Q40$# P 0-40@L$PVw R00 0S000S?0?0hv 0-40@L$P;w R00 0S000S;0;0hv 0-!40r@L$ r 0P0P80w,  3,@03jv00P008080 9j8j8j 0-LM@v0P9@ %@ 80  0@AvK0lp p-LMP@v@0` 0 @&vKplp -LM0@P`-@ Kv0p 0  8@vP,0P   0@lp -LM@Pv0p  0`P 0S000UP 0U D 0U003uK Pulp9j 9j -LM`P@\v p0 @uK -@L<@ D0ԅh -LM^@P` 0S \ ` 0 *0 Up 0[ UX 5UU PUR *X2U0CU7D"0_[ 0@02 p1US L0U4 0U 0 R_ - U F@U U 0 0000CU 9 U 0CU 0 U U0 00 0 ` 0S  R  R \ `0 3 003 0  U  Ux0U 0Uy 0 0 0*9 BB -L MXP`,0 p" 0S \ ,0K0 0 @(K3RN Rq R  R  R *@W  R7  R R T@R RWT 0S%0 R00 0000 0S \ ,0K0 0 @S5 0S00S S0@\2s@PD"V`<2V 0S  R  R \ ,0K 00 @R R R@W 0S0*B BQ@@R񟗦P)()))0T@00T@00 NP 7@o0DPP@ 7@_P@x 7@WW 0S0 0 0W0@`QY!@Aʙ#8#(00 S P0V/U 0V+Q@.R]  R);lp!BB -L8M;@@0;0P ;-[tp` ;  +%X`K82[0;,00s0 00S< K~ 0; p-LMQ@P ` Q Q KpT $ 0 0lp -QL8MT P @ P< P 00 00S00PH 00H0 0 H  H HZU0 (, LP 4 ;0; H# PsD PU H  T0S 80080< 0H00X0 ! HX  00b0!RR 00b00,C 1L00c0P0Su P0X0 0XPU 1SYsX R 0S  0PU0 XQ UV T 0 S Y R 0@0 80 1S 4Pv 0H @00TR` @0cVp 08L0lW,pPQT0g0 8 0b S H8X 8 L R X0 L0 0 j 00 0 0g g0 H0S X\0gSH0  H!3`T 0S 00#X00S 3S0 P hPQQ00SPQ T0 S Y R<0H00X0 v HH  T00S  Q R H 0 ;L' +mD!rpn 00b0!RR 00b00,C 1L00c0PX <0 \ 0 R  P0 0 0PDq8 T ߃, r,0D STg 8 0b SC1H00H0 HX @ P8 S4\ @S@ TUX\U; <0 0S 5  H0<u<0Q 0 R P;,% +Dq (K  a 1SS 00b00,C 1L00c0LQ PLP 00PL X00U XPXQXP!RH04 0H0 1 ȞH  H H T0 R9*0R:H@3 0Q00S-<0)3Sy U 1S 1  1S 1 R 0 T 0S\  H;# +"DqY uT0S 2 <0X㠀夀*PP  0PP 0 0;GK  7(2P H 0  <P! U3 0UHS;! +^Dp!X㠀夀60;T T Q!喂T P0P0Y0S UPUq0S]X㠀娀 0S㨀XP0 H  X ,0S\ 0H000@000;⾒G0;Ṓ#Pi9lp p-LM@`p P p00 0 0 5@ L0  0@.pKp lp? -LQ@ 0 0S P Hhn p-LMPp0`AP, 0J @R 0 B?BS8 8 ,1 6F!@P 0S 1  0T@0,00oKp@T @T  @TH0  0C@P JB?lpȋ? -LMSh1p0 @ `VO 0SL 8CT)@ (K`p , .P0 0$ 尀 $n P000   0@ @@ @A@8p `@P 000,?o,0L6␌0S   -0@0800L6w0S   -L@48 0 @F P 03PP 0,  B, (0 ,0 $ P  -@PL' Q 1S 0 Sl0 R0S0 0C#qW P`Z0 ` 0WP@TP d)P( 0S0 0  (0(nP, 0  0C0, 00C0An -,L RkrR@0T0  (0 ( @T@T ( i  ( 00C0( 0 S( M @T@T1& [`Q7 P R 0R(0, 0 0P 0, pLW@P@T J P0S$P /@TZ@WP@@TPZ&Z00$Q d0 R0 D%@ Q 0Q@nܛnn؛n8jd) -LM`P0S 2R `(K Q 00R 0A#q ! _S1\ `  @bJ@T; 0X0 M 0@p0PK 0sB 0s? 0SA , p 0X0 0,@D000  /  0 ?\㬠,K , P `W㈠,pK @ w, PE 0U0C 0,00C0  B ʌ`7`P ``P`n -LM@  2< Q B 0A#"!R1! 1 80 Z< 4  0 0Sf Zt<@P U+ P, 0@S$00S S0 :=P`(,[<@P 0 ,0 P,Z@([4Y(K([0p@40aP,K  WBP 04 @ ,0Z1+p5NE@TZY(` (Z(ZV0p@O@`(ZZ8 04 8 ` 0< 0@  0(Z<< 0,0  Z B Alpn00S S PP& - @LT 0 00S S S *0 0h%0S00 S  R  R 0S00  000 t? 0-@LP0S 00p0hX0 -@ 0LR ) 0S S S4ƶ 00脌? -LLM Pi\ 0p@ 0—j\8@h P1 0D H0 D 0 BpKl@ h0 p @P @P\`00S&@ w#(K0 0:@PxX 0R)@ 0 5 0=@@P  t P  000 0 0$0 080( t  0 t0 _@ʚ; 0-0LSP @x@$@ 0S 63P6 0040 R $X0h 0hXn -LMpP@> 0BgSPB9hU<` P0 0 0 0 o0 0 <0 hKl0C` h0 d @ 8 V`P T@T P@K:PP "&$0` K`$`@K 00 0 ˠˠPTK@ K 8`PT0 x 0 P0P  00$008@P(@: -0LS@ 0S0S S Sl}h0h P < WP @4/$0$ 7蔌?89j<9j@9jD9j -LM Q@pP`. U QU0v03Q0SQ{v)u)u)t)u)Du)4u)u)t)Lv)8v)0v)u)t)t)v)v)t)0v)t) 0S -U Z  - 0S ;0S S S   0Sq 0Sn  0n 7 HPI PG 00 R3  8 40$ 04 00, (0  ƴ5XO0(B8S SN SL H峴 0S 0S0 0|0S  0qV8n jh R 00H0 DZ Qf 0 0 `000,0 0l ,UC<nP>00,0 0, PT XpZR` ( 00 0c c 00, 0 b0b0 ,%\7   U0Y0 W 0S80 lP @Q㄀ 0=P7 WU0Y0 P90U0Y0 ꄀ P,Pꄀ 0S P   Pꨌ?n??(9j? -` ML @00Ph p @000< 0@080P $KnČ???4? 0-L \P( 00 8A/ 00S@ 0$@\$0$0$00 $ 0 0@0 @08dA/(00S@(0,@@ 0S 0S $wP0UPnn\?n 0-@L]]00P 0P 00  \00  00<00000  4P0p? -LM`@P6]Kp`H@ DP @P 00 @\K000000010000000*000008 -L M=-A封0`pS 000S@d _0!M0@`A#OPpP1d 0p=4!0 0C?2cQdS0d000!S100&R 5@. 0@^Y0 @@00Q  B!|0EA`l `d0@d`P P0@@ KDXj0B4B4oQDon\offfx?hongfffn,o@o@o0o 0- |R0P00h L 0@\ 80C6LS000P 00h`onho -PLb\00 00;0000 9 0S 20S0000000P `H0 S 80C6ᄂ (0`Q(,sp L0S 0  0 0$0 0,2P$0003 80C6O 0@ 0$@000; 0S 0  0$0 0!0P$00(00 0@0 @0 * 0 p!0S-00$ mC[800C6, (0`Q(,000 00 $0 P0K?(000800{}0C0v}P xt0Sr00 m[P00800[}P `uHo@onnn1j<o 0-00L PL00p<P0050S 10S00 *   00  00  00 #00 0@004@00@ 00 0h008000h}00@00000080080 0@80<@FHon? -$2LM 2 0[ p0$ RG !0}0KƀPġU !0$ Rᤁ> fWfZ00 /0S 00g l!0S  P(8K⚀, 400bS8 00PcPEZUp 0$ R0 R*mZp 0S:00700Z 80pC6O0@ 0$@ `0@$00P  klpdonnn8ohg?,oHo 0-00LP 0E Q2 1C0Q 0  0 00<000h00000Z@Y(0 000000h[vjXjlp - LRpb 00Sx0L0 P00S $0@MQ X@ x0 0@x0|@ P0`@0 0@@0D@04 0@00<0008ZP0 000000l  l Y008005X@ @(h0 0@h0l@e@00nlp -LpL0PS` 8@+<@ R @00 00;00V` RQ00 ht00800h{ -LM`Y1V ԁ B!1P, D``q娡娑!1n`U`A |A0SI0S` { PU 0 R 0$ R!0 C{0 R ,oX0 R 0{0 R0$ Rp0, R(0S0S 0S*gfffn,o4Bn0o@o@on8o?<o -LMhD@0 @0\S0 4 < 8 884 Q1Y@ , R? 4 $@_Q}y z(3 ?Qʫ @@P`>0#6pǏ0 ORʔ xC0S @Tz PVP `Ue@Td PU*P`0 `P C3 @ P0K/D0( P@ p< 40S <KP< K 0 04M40`nP@ PR00 D2`@ \h,X(K 0S*2( ?QzP|wQ0S0C0bA 000YUP` p0ORڔA!0z,WpQlg^Q\PQ0Q0OQ0@P `70, R70( R200@;004@@H+`吤,WpP,Wp4 D3`o4B4onn8o@onho!Ce1jH9j0oL9jDo<o?? -L@ 0P  -LMp` 00 & XW 0PPWK` Tp P PP 00 00 8000l Lz@9WT P(KDP0 0@P0T@0 0 ""W꼍?n -LMp00  Z00Sx0LP Z p0 0@p0t@$K0 0@0@-00`9 000P8` H00@8< H0L@20 ,00,0nlp -LMP @Pp, Z `@"P` P U (Ko, 1 -LM@h -L(M@PH `u>0~pW (K4K 0H ,@K@C2 PD,04 @r,@ TP<  YOPD < PR.JD 1`PU&J0O U 00HP`F<@T D1P @00;00{< TDN0 <D0\ 1@ > D8 1P8`H0 t0@H0L@8<  /00xP`900040K  0t8p X. WFʁ qp tq U<9 Xt0   0 0Su0000rtuXYTU0SVt0 TY t6 q: R Q W t0 00cR XY V qrruuXuVzrQ,? p-L M0PK0%@ `K0S 0S  0`%PKp  -LpP01 0101 P`u 0P@`PU`P `400v0@0 @ -@L0H00C0h0o 0-L@PHUT004ߘ0P0T$0 0   R0o:j -0SL 0R& 08 pk P` 0S@ 0@ 0p $0( 0S 0 0@ 0R0 @  -L M0P@T$pK `K$0   0`x@P ]0DS t)H)$))) 0 0 @K 0 @ 0@ 0$0 @ 0$  0@R  0S v 0 0$  @ 0R 0 0@ -L M0SPIJ@PN d @ 0@ 3 c`Q |0S\  0@  0S @ K  `V $ (0@(, P$0#0Bm0@S (Q,0, ,0, $ 00T 00F` pK'`@(K 0P ( `P )))4)))#@@T $0@P(  0S^ 00@T$0P( 0 0@(z@0SL P ( R,0,0,0,0$0 $0 ,0( P((0 $0PT& $ 0P( $0  q@ 0R:  0R& `P(0 @ 0@ ($ 7@(0$ (0S *(0S # 0R$0P( 0 0@.@'9j:j -L M00 0\40 1, E\A`V@ p pppV2U , P9 0Y ; @PMP# ` p0,  40@ 0$0  4  0080Y40& Y Y P\ P(K`P`(KoY0P10 +P PUlp -L M((@ $8 0@KD?4jo -LM 80@ `#%0 R\ 0 [  "P|0P0C,P SP%0 ,0S 0 e$xP @ 00WL0$  P WL0$  0  R  0  ,0S L0$ q &$ L?`? -LM,( 0 0<0 (000 R0 0`80 S P< 40  , $<@0/S D 0S/S 0S/S0dS@0 c0/S ,,0SɌ,<0SɌ,,Ɍ,@0S , ! 0U D0U 40,P L0P  Q$0Sy 0Sv 40 ,  00,P0 !PD R,Z, 0 jb, D0,SɌ,P00 Sx@T$  "tP, v#,K0 pcW^ ,P,P00 S SJ\30 S ( @<@ <@ D 0S/SY0c@ 0/S^0/S ,`jnj ,WPPx,  (00CSP  |80S,t @S #0.SM0.Sʌ,HIS,hR < @0 0! RO Z T, 00 (K0/S 0 db<00@S p0S8 0p03R0S,PɌ,p@) ? p "y,4 R0L0$ +  4 " , 40S L0$ 8 Rq L0$ m p@0 0 jȌ,0  p|o@ -L(M0,0  p0(40P 0S 8+0$`V/ R+ ,0 80CQ 0S/S0/S{L Q0$0 R3  0/S dq $P8僓 ``8}00(K Ps8L0S < P`Pw,0p 0L"H RU $0S0$0q0S80`0K4 PP 0PK@4` H0 D@ 8 `8P ~ 00b Rؒ `?`|oo0@-P@ R( 0S%\ ) \ ^ \@ 0 0\0 S 0  0S R 0 000@ 0 0  R P,  R/ 0\ 00 S 0  0S0S 0P@ 0S@@0  @0@ 0 0 0S00S0@ 0\@@  @0@- R 0S^ 0Sk0 0R 0SI0SD \  R0 0 \0S0  0S R( ^ 0Sm R 0S 0R 00 S00 S0 0S    R 0 000 0 \0S0  0SR 0S@0T 00 S @0  0 S 0R 00 S00 S0 0S    R R 0SP0U 00 S P0@  0 S@ y -`LV@3 ^=0S`PVPU p` 0S`` TPR 0T 0RU 00SW `PV p PU` 0S``P p P 0S0SP0SP0S  P 0S0SP0SP0S PQ00SQ00S0-@0 S0 UTR p-@LTP `P`@@T@p 0-@LPT P@@T0 p-@LT`P@P  R0T 0 PPP@p0@ 0@@P0 T- P  P 0S 0R PDo -LM 0 0p00 `R 0|040@4 Q0$0 $PK @$00$0 08P#8@$00KvjxjDo 0LP  \ @0D0<0804000,0(0H0$0000 00L0S X R\0\0\0 QL0SX0 X0\0\80080@0D  D R80SPPPT0T D0T0 PT 0P0 PT 0D 0D0LooD0@ 0CD0S80SPDPT0T 80T0 PT 0P0 PT 0oLo -L@p`\ L0S XPPU L0S \ -L M0   K0 P K*-2L?0\ \ x 0S00S0ox0S 40  0 R  R x 0\0 00R0S R 0-L$@ P R 0100S P 0$   00$0@- P@P -0A0@0@P -LMD0P,4@ ` @P@0d0(HL@Pp8<P@ Pp KȎ?|?t?Џ? -L M`0P1p ^0Lx@10P @Dl@8 <0@WKd@T  @T\h@T < @T:j?:j?@???? - pL| ı,0S' 0 ,`0\h0h dx<0@@pP`0LP T0X@DPH`Z ㏷Z ㊷[l i腷 -L M$ R @0|"( Pl  0PLP 8@0H @`0 ,0 04 00`KP `p PX``@000p  0 x@0h0P @0p0Pt >0 \ T @TP P01Ps #X 10CR c. \P X@T (^$K @T 0Xe\"!10C c RP X@T\ \ L Ԑ??H?|???? > >@VR U? ?8? P-L l00Csl0 @  S 0@0lh`;P? p-`LV@P00   R000   pl00l0!Ce@-Q @P -\ 00 R 0@Znx:j -1 RL PpU. `PU 0 00S00` >@((>W`pGZ`V Z ?'P0@X PU`(ѓ ΓlpH9jn'5 t?h? p-L@`\P0^0%S I p\ 0S <P%3 @0  0S pp@  0S p p-LP`@`T0  r600%VPp) - L@0 1]6 -LM\@PT`n T]dPZTXPV1 t6p`X\ *PG\ 0S d RD@$T@6 0\ 000   0V0P@@T@!0400P 㽼0400 R R 0S 0S $1 0\7@15@@\` ֵ@Pd 0S Ǯ$0 @0400P ၼ 4 $0<$0pn p-0L@P`    fP$0<$0p8$0<$00 -L MQp@@ @+ R t1\ \ 0R@@@A 0,P K0S S S -P0 KiPP0p  KiPQ0PU 0S0S PU-P $5@$ 0 00$ 0OPK5h9jd9jn -QLMp`0T@$KW00 P@ $5W -80T 0CSL@80  h80S@0 hlp -LM8P@U08040`pI<405`9U2 V$P7U 800CS80 0,0@4$40, 04  KD0SW 09<40 Ki`^  0堒垒 園4;D0S P R T0T0T0 @00@0:8P RT 0 P T 0 P ?oLo -000CS1!2?01L`P@p 0 00S 80S1p@T @T x 0S @T $:3x Px0Ppx  x0Px Px]T` 4 +4 40;40@ XPY00S    ,0 0,0 lp0o -LM1 `00U0 4 8 ,0 OL ȁA0 ?0S0 " 0`:1 `RD!0S9 P@UKPPUH PP RT0T0T00P T0 @  @ 900S ,0x040@0@00080,040P80@(KT`p 0S 0S 9l U0 0 `0|0 P 90500$olpn otjoLoTo]? -p0LM@Pp0 $0KT `P00 $`0p P$  $``;j  3 0- 0LSP@ 00# @ 3P0@2? -`L@T& pU@ PPp0 P  LUp@W 0َX $Վ@TDolp?(?X? -L9LĎH0Q P ,h蹎$h趎 Xd?nx??n -PLM4 8 \ 8 04 X> 4000 {P@/ R, ( L0S30X@`Y6:P,K,pP T,@  L0S YX@$:` ԱpP P M(K0` @F0T04 b80ph0 R \R0` 0 40a8  p0+,0p " 8- Do|:j? o -0LP@U. PU+ `.pP !J1@p P 0$0 p0 00$0$(0$0 }/00Y 0ᔳ@h9j 0-p0 ML@d@P@XX 0PP[<<0< P0 P K0hIB$o]?4jToLooDo - LύD? -0 P0@L`p8@  p Rt0t0t0 @  @ 0EL X000 Rp p0t0 @ti7:j:j,oj 0-@L80Q 0L0PPg8pQt0t0t @00@077D D0 ?R4 0 00g(on:j:j:j -@1@ <1<L `7P  0S01   @ pT  7P*70 070PS @T 6l R B0 0S0(@ @Y800@lp1j(o:j:jj:jT?n:j 0-0@0P 0LOH0 000,o:jj- -LMP0   -LM0 c -0<2 -L@P 0S $00 R ,0 0,0  -LM` PP 0 p$0W00S , (K , 0,@   ٜ(K -L M`@PpP" 0 $0^00S 0 $0 ,0 0,0,KP p$0K@0,@ (P 姜K -LM` iPP 0 p$0W00S , (K , 0,@   (K -L MpP`=P" 0 $0^00S 000 ,@  ( $ ,0 0,00K(0KP ט K p-@0LM 40 0CX `0 8 0@`K\0 0@ PP Kp0L` 0KPP0 0P S4PP80SZ40  p-LLM@0P `40 `K0CX `0 \ 8 0` P L0L@~`Kp -L8MpSP@`$ K`P$ 0 ` 0S$00S `,00C,0$(0 K,W00K 0@ P0 L 8` <` ,p 4P @p $ 0H0 D@ PK (0K``xH0K$` 0 @V$ @0$ 0c0 0-LM@0PK PP  (K0 -LhM0@ CPP  0S:$00S6 ,,00S`/ S S 0 (0 L, ,-W(K0 KP,p K  0Z S 0 @0 0,@@0D@  0, p-LMP8 `KL4 X ` \ `0P @P L@T H8KHP @Kp@KG 00 0 ˠˠ HLK8 K @PL -LMP0   -LM0 c  -LMP@ hKL< ` h d @8P pPHTp10!Q 00 0KP @ 0 娀 ^PP'@`T 00SA 00SP WPWA U( KV7 T@KPPx@KPzP  \P0u KT -`@KPT0@ KP00SPP,,o -LMP @0  @wK -LMc  0j K p-LMP K`P x0h$@ 0 0{ `R ,00C,0(0 ,Ux -LhM`@( KPP&(p0X00# 0 0P$  00SP wPP  (,00C,0((0$K,U@Kpp l (0 0 P -LhM0@( KpPP $K(0 $`L0$ Pxw! 1P0 R 0匠K 0 k PP  (0,  B, ((0 ,gUꌠKP  P 倀 |p 0  0] P0[Sx:j -LM Pc0d l0 h D @ PP |`00SP  800c 0 K0@@0 <@  D  (0K4P 0P ( H0 $ ,p 8 0 HKQ P -LMP @0  @K -LM c @K p-LHMD00 40 `0C`KX `0 \ P8 @P L @LHKp -LMP`@ D00dK80 \ d ` < 4P @P KpK P @P#TB-Pp @ @ -LM0 c  K -LMP @0  @K -LM0 c K -LHM`0P @$KD0lK@0 d l h D < l@PVX 0 p000 P\P@P0  e@P{- -0p 0   @ -LMP @0  @K -LM0 c K 0-LHMP@P K00 \K,P 40 0 T \ X PP H@ 00SDP 4KD DP _]DP 40 DPR D4 KP'DH4 KP -LM0 c 0 -LMP0   -LM0 c 0 -LM@`p6{P+0@P lz K0 hK`@ @0 < h` dp 8 @PT0S P@KPT0P Tc@`@K0PTK ˠˠ0@ K P@o -LMP0   -LM c  -LHM`@-0hpK@0<0 ` h d @ 8` F@P TP 00S0@0 0 `@ < h d0 8` 5@P T0S P@KvPT0P T@ KP@ K@ 0-L M@P 0  PK0 -L M@c  0 K -LMp`Py+@P0 R@ $K0lKd@ D0 lp h` @ K@,0 $ @,00C,0$(0 T$048,0 O@,K -LHM@0p P80 dK0C\ d0 ` < 4P P KPL@,`0 P$048,0 -`L@pT 4P@$P @)T@0$0!00 @$0@0$0Do -LM80`S2 x K0 Pp1PU 0S PU @0S A 00PP 0S 6 0 0EPPU<@P  8 # ~묥n|o\? -$0@@0$0Lp`P 00$0 0 0PP4 0PUU  $00#X00S$0 R0000 0P  0x0 00C0PU z  7p~Dop? -LHMD0 p<0 hK0C` h0 d @ 8p @P0TP L`0P \&@P$0  1@ K+40 % 7P@ 0b@ -P5LMH0 S, `p,&@PPKZ 0Ԣ@P , 0RV(KD00  0CK@ 0 P 尀 @PP 40C@0QK 0@P10 81S %@P%%P  0L p$0p0 0@P 00S @0 x` kVL H! $0L1 -@@0 P %@P%P  L!pp @P$8$$$"2 00$  0K @Pl2 $0 h P$$T$L$40S\ R?xTH!00000 R0) C$0 3, 0   0@P P00 PH K ` 00SP< PP8 0PP1  00Sb  0PP%40 H<00<0(K  0,0@0,0(PP0S (0P#  00l PPSPPK, 00 000 @ 0( SPPk ] 0PP@;40  00 @KP 0@p@ lP PP -LMPp, K@P t 000(K`H0 00 t 1@P00H00\ 00 0D@P 00, @ lp -SLM 0 `  0K0 #@Pt0 PL 0C"(40 0΁Y000Q 0 010!La000 Ѝ8B0oųE.8o<onm "=8"=4ok_k0@-@PP0  U0   R 0U 0  P0` R.00  \@ R (0U 0  Q000P$=P"=E-@Mp 00 Q 0C 0.Q00P.Q.0W0ЍS P J Q.Q 0 S.SQZ0.SP.0W00P R J0 S .SU \  RZX \0d`c `hV 0 S  PQ 0 0LV \00SQH\ᘡ'P0@ S  PR 00A\  Q00SRQ 0S0C0P W\_00W @0'0!00c000l0Q0Q Tp:Su  B0 S 00l bS0a  ~0 R0P 0 Q0I0 s R .R P#=0@-@0 S0C R .RN21CP 0 0 R 0e0@ 0  @@  ^@%J 0p 0 ^ BJ0r0 ^J0 BR0000@000  E- @@  0S ~? 21C0 CPbUP U`p@PEupG8 0`P0@Sw@pPUpG&J 0`Pᐠ0@SwPU@J 0P0SU@ J 0P0S 0S P"=p@-@?0|03\0SP`@ 2 1C 0 0q  ? >1C0 0C 0S0 00n 0C0p 0S p/SN 0S~0S0 00n0C000Bp/SN V:0S~0S0 00b0C0/S 0S0S0  /S 0S 00L 0 3A0qQ P@ R .RQ4 0?AcQ 0?AcON -PPLpPP!0S|0 <@Ph@d1 T!T10Q@0!81>@ Q  0P@ 00C0$#Bb2 0a༐ 0> 'b! 1  b0àD~ pLAD RlPEd31C 0 !000(lDo@o8"=nm "=QB?0@- P$@ 2 001^   R 0\$0T0U00S 00LoHo R0S  0 -h0L@ h 0-PL@ P 0 0=R0 -LM@pL $0P PK,`K:   4 00 y    h0  00S K$ KC PP\$ れ$d }h $0 $0 i $0 $ 6$ #40$ 6$ #40$ 6$ #40$ 7$ #40$ 7$ #40t$ t0$ #40h$0x   h0$ y000h0$ z000h0$ {0004 $x0sv0004 $x0swW ,Ps  j li0 y0rp h0 0h0k [ n -LM@0 4phP4` x0s $ h kP(K x0WlW;t0 00 , tpdX01YY0xp$00W 0i, r 00KPPX0 G2#, 0Q= x0000s7 PdX0A1A ,0K%PPdX0A1\0080 Y `X ,0H `0Cd04K 夾PP 4凹 JPPX0` 70bd0 40dH80cU 4`4*갖? -LM@\0S` 00S` \0S L $00  %0`\0 -LM0P4@4 x0s` h0p`x R#*d0X  B2!0C03r T0Q` 0`P0$0xP0i5x 0pjk? -L MxPQppD0 @ "@@P< `<0#0 0AT@T 0S$0W0V00S  PD0@`(KT#00Kn`P'= g 0@,#<`g 00@0 ` `8`00 P$p@ 0v`P 0V2D 004 0U 00a x0s[ ,K 40KP,\ ^,d Y,0 h ,0 i ,0 4 &,0 4 &,0 4 &,0 4 ',0 4 ',0 4t, 040 0 0x04 x0s? 42h0' 0 000tQ% D @c@0Sw0 40040h x0st`1D @0t0x0!76i000 0 t80KyPP X 802x0,0 $ (t (ui`&lpLoHo=j?? -,0 L;P0'%0BLoHo -@LplP`0p8< U##00V 0` S 0!40X lὑ@-|@Pp\|P00p0S \ 0P\ 0000|0Q0|00S0#0% -L MßD D@ `0 <` 04P p t\0 o ^d0( K0`"00K,nQ4 |P#000W{x00 00 s@0k8K4 K@0Kx4Q <P ?4,8K 40@P0@#pC :CP80H 040 :0 80 H 00X 0@@0@ @0@ 40T*UH xl1PU` P80,H 80 H000@40@T0@ :8, uU.@(K80H 0 400 0280,H 00 80,H 00,̠ 80H 00 0@@0@ 8, C0h0Q 0S<@@8倴 -LMQ`<0 pw W8  h@  i2iPP  9l4 0\ B 020C!0s 20C@ 0WFX4@ 5PP10\ B Z! 20C@ 0W,P4@ Z 02B!0C0s  ZX 8 R4  <0(K0K4,0 C8  -RLM`PP0R (K00K, K40K,8K 40PF8@ xpwC 8@0H0 2$W y  00 s00( x1\a |9 :C\H00 40  0:80 H 00 8@, C@0h08@ T ᇳ8儳8@0H 0 4 00, H00B 0  0$  " 80"H0080"H00",80H00 8@H 00" 8 0H008@"" -0L|MT00T0R1@01`  0K1P 0! !TATKV 00 -L Mt< @0 P4p h0 d 4 4(K2  q <0S40  t0,KS0,0  , 0K,< 0fP4 @ 00R80 ,004@ t0Sd, 4t 00 0A 0 B0 <8 \< `X, Hl0B , d0 PH<嘄Z0@0P0 00As00 h0`` Xd0b ``` PX00b> c @SPQ0 `P10s H<hZ0@0P<0sd, 40x@P0, Pj l@ T,0K@P4 R[0@0@4 , 4@ F8?oh?Po -LMP p 02@$p  0 !P  0P:0RT0P$pH0 L1$^A   !T00T01 01$pP0S2:0'lPWP`W( K,0K*($K ,0 PP$px~H 04 0 0, $pرP K$ұ -LM4p`P4K(K 0>@P$,K(04KжP,(0H R:S 0S Q0S$K蟱Pꜱ,喱 -LMQ@`PdX 032`DnP6"\050@0 0 P吶pPX 0\ H `X H0N a 0PypP ]00 -LM$@ 40   -LM04`<0  <0xPD p,K8 K0PP40K,08KAPP.0, H0P*0@SH0 @0S0S 0 |P 0, H0 @0Sp(KUP0<\PP0<00<0 -LM4p8K,K 0X@P80K,08KP30P,H0P *@,0PH0 @0S\ 0` \ (|P d "|P 0嫰᧰pᣰ(KT0嚰|?? -LM00( 0C4Pp00 @4K,KX @D4 0`P1(K,04K吵`P-(\0H0 R (0S  @000 A @D\0 0S (R`P 0\ 00T00S$KI(F -L M, ( h0 h0 pa(0S$Ktt0\p \H 4`x0sA ,K`X H `0Ld0 .pP@,H0 @ 3  }{P,0x 4qP0 40Xt0S( U$ q@0S (0L, (0K,p pP(h0 t@0\p,p\ ֯W,,pꔗ?? -L(M(PxL ^p4:dX0  a<à  0, `PX0x ,(#x X4K>< K,0K`P( ,0H S\00K H 40<K婴`P00(\ H @\ pd lh0 0 i0 0& 6#40& 6#40& 6#40' 7#40' 7#40t  t0#40h xh0y000h0z000h0{00040x rv00040x rw000,0SKxD  @  D 0 @ BP: ,0 @D0CS,03(0\ C(0`P< K0 (4K A(X>`P0K40<K`P00\ (H @x 0(K00`PL R h0 t, x0s P0H0  H L0,`@0P,` H -,LhM0,0  H x @00 T |  d 00 4| ` dh0t , 0tR-(K@ 0Pt | ᨹPt @40p@ ( 8K0P P` P0t0 \ X  `\0 0R   S R\ o T `k 0Y 0R S .SY B0l0 D0 h0 p@KdhP K<0KP@`HK@0PK\@P2@PHHPH 0@ s 3SS9\0S`lp R PP p'hh l \ X V\ `lp V0fl2l Q 0\0"'t X |  S0t0 P\`\ 0\`S 0 P X0S@H` 0 0  GH@8K JyPd(pd0,0`0x 4r` <0SPZ V<` PRH廭 v 3`x0s00 @`Rw T 00R00SS  Q u  0Pt dt0S  Z Rt ` <D0KPt p D0R |0 0;0x t8\ X d\(p\ 0B,00.S  R R0.St`R <` T dt0S  Z R=  | 0  |  ጹT0  u  03Pt ~dt0S  Z Rr  | o0 40@hQ`K0t0 cH t@ _P t [` <D0K Pjp0S T x p060D0| T   d00S  0Pt 3\d 0A,0l0(0p0\;0t %x tG0 6t 0x =0`60 <D0K@P!pQ T  &D0 |0 m` <D0KPt p0|SD0 x t060x \P0t@ 6t@ 0x 0P060 D0t ꠕnP%= 00  $00 0-L P @P004  0 0 -LM0K@ ]P00 0  -LM"0K@ LP0   -LM B`0$0 ,` (  h0PSp 0S\, K2U L : 0P$  $K^H*? p-00LSP@0 0< 0S  `P  0P kph0S 0S p-` Pd0,0d Q L0L@ 0@T  T0@0 @0@ ,00@$( Z }Z }[| } | wp -L  p`P Rx x0`@0Q `<;$0 :$0 " -L8Mx0Pp @P (KPp7 U@` ~0` 0``@ T$0040  01@P(K@ H H :Y@P x0, P9 L4 0R "  V P<; , ;00k000,0 H@ 0 4 !0 4 !0 4 "0 4 "0 4080 0$02 0$02 4$ 40`^\8 2@SQP  0 400 0,0 0 @400 0002SL0 #PP80S 0 4s0 x0 0 40,0080 0$ 00020^t 8 0Bp \n:0L k0Qh 8^e 4@,0!< 80x D 0,<0r8<00 L< 2!?04 H @D000H0`T }80D 4t0LP QT  3R 0D 0 D x 2tQ0 08l0l0^0P S@C[P@l0 4p0u0@4 C`\ d0ud @0RX O@@0 40,0P 0 S,0,0 |QKP00B &P< P P@P$00104P0010h0 0 b删 x0m"0#4X0 <0! .X@ $ 0@,00@0H&0%40| e0  x0x40+H#13 Ү@Px,0H@ %uP 0|0,00 +0 ,娩0,0 y\ uPH uP0 uP nԗ???`%= -LM⬐K@ | P}`P$  0S    `P$ -` 0S0S K`(K ZpY ,0K}`P W Z 0*<@0,0 0C(` 000)`PP00S` x0d" 0Q`P $08 lm. 00 ` V$0I 0S`V R<0 0@  8400 0 0CAx0s00< 0KP,  + `u VP010lp  00 ` 8V _ 02`00吠P 0P,0KY ,ZazY ct0Z`,0 |z [| {z3vjE0  B40R******** 00 ;0 000   -|`| @!0@`$dP#r"XX 0' @(?0# O $ Y `@&0#@8^nCCX좙N 0-L M Px @0 80{K0 p-0L@`t $0DYP4P%(,0(0%T"$Yp$?h?@t? -LM0 pR 040`V  PR00` X0@0b4` c SPQ 0P] -LMp 00匀0CSD0P`S u*  x 0D0,  0S40@` X0b5 ` PVQ @)P 0@0@H<yP`0@0v@lY 0s0sY눘?0<0< 0 < -L@- -L@- -@00 LR`Pp pV  -LMP`V `GP 0@ B`T`Px 0 `Ա p-LM80@SPP Kp `K4'0 00 4 0 00 000rp \h0 0h0i0lj S00nM0 -0L@O'o -LMء0 ,0 @`t0pS( x0RP# :qO , 0R\(K踐K x\ KUPP 0 !0 04ĀKP0K00  DP @P &0 00 &0 0(00  K0PP0  0LKN KO0K0PO0FKH KP0[ 0P0K0 JK0s1렕no%= -LM0 ,0 `t0S4p( x0R# :N, 0R(K@K 0@PK@Kx00 p I&0 00 0  000 `X 0H `0Cd0 PPPTd@HwH@ w H 0#40$[ 4[#40$[ 4[#40O [ [4[#40$[ 4[#40$[ 4[#40x tr= !4 0 0 $[ 4[#40$[ 4[#40O [ [4[#40$[ 4[#40$[ 4[#40x r ᜧP \ KSP)  [b0#80 [ t0#80w  @0S 00,y LKN KO0Kr0FKH KP0[ 0P0Ke@ PK K 0@ PKD @ P P0  0(8~00 JK0 Nꠕno h0,T\tpP/ Hx 0@00L\lY_H/0 .R| LK00 \0 0 tQPB `0S 'Ht 7 KP00 0 0p \Q%  LK4LP# x X \l (0h0 ) T\Qp| L |  | T R0S |  x \@ BKu7K up0 ,0d 0( xp 5pP BK u0S | oxl00h 0( 00lxSpP 0S TVL墮`\Xd x2p 0Q@P Q | Epx  0S\0d 0$0XQ | 3 R| X0t@T6 `X H `0Dd0PK 徨pP%P $4H0@x0pst 40  0x0s $,$8  0P~pK@0S 0P|A$U UU렕nlp%=Ę???? 0-P@QLⱿQ0h -LM@P `Pp0s0s 0s$0sH0sL0s P0s@0s 0s0s00S qi 0 P(0sa 4 0R P \0 0 P40 ? 00s 0rp 0th0 0 h0 p 40 Q Ph0h000h0h00 00Dp 40 Q hPDh0h0 0 0h0h00 00h(0s (n05r00s -LM0(@KP4p`"0 004 0 0v 0000h tI Pg h0PL240 h0 0J004 @ 0 0400H@ x 40 N0 408 <0,0( Dh0@ 8D04 d0$04x \0 00@L0P@ 000 Kx0S 0S`X H a0C$0@2"@1<@00   / x0s@0! i0lj 0| (0~i 80yp 0rh04 0h00 0d0nu0m -LM@| 0h4l00 0 <@00    0 0@@坿Km -LXML T 0 SP 4 @0UP Ph00X0 Px0 0S P(KRX0L4c cb SUaQUs8` 4p L0P h d0 \@X`@ dPQ\P H xD u` X0@P0b# c8! S Q3P< @0   0V: X`d0 ` `6, P0K.QT刦PP80K0@0Ud @0jh@HD0cS0! d`PS0!\ lHS@1@!L P0MUCL0ST> @0Wx0X@Pp@ lP L l8B \AQU<&`d0 ` `6, P@K.QdT0@K @P,KP8 K0PP`0K,08K&PpPUX^OTL0$  JP 000EC -XLZM0 ,0 p!  pAl! h04   KKrl `0S! T1 T 0@0NTlAPd h  T!20 d1 vAh 0 dp1t 2Rx1 Wc@ P L! @@tA l!P pt!x0b0a1 KV Sd00X\ 1 գPa8< l2| \Y1Q 0`! \1 0UP!X1 pR/KO?KNOK@P K81RK卥P @儁@08!H| cX!X! 0S 0PSW Q S0x p40 40Ȍ \p@04 .1KXP KK ;-K-[00\%(@Kl0S/:MKl! P !hAT d 0L\d 0 @` \! @ hA X! H| 0 ` P @pR0S S@0`1 \A @XA @`q\!rKV 1 R0dA0d0l` p0T!00b0p1x P Qڌ0 0C, 0R(Kx0sy 0@t! P1 LA 0X!MKX 0@@@`a \q 0 4(00 s<1xSX `H a0C"0n2O@ >04 .1KXPQ-[(0K 01BR@0@`1 \A @XA m @~KV xl\} pt!x0b0a1 KV SX\ d0rPa80 `2| PY1Q U P!P{A0 0z@0RU RU*ږ0KK,-1K k-1[!00(@Kl0SC:MKl! P % 0h!`@pR d10CSd1 `hA@hA PUlx0s@0041 41 0U.1K U0KK,-1Kj?@KV K>KXnK?VB? @*@t 0OX ꠕnxn@@%= -LDML  P 00H HT 4SD  SX g |1QT H Px0@0 @PZ X UP00S@0 X0 O @P` P `VX FP 000 RE:A H Zx < 0EB @pǏ p XPDPd`0@X0@031@ a< QT>Q< @PTA 0CH0PYPX @ PT  8 " T0P$H8 x0PHP@ 0SXP X(K0S*{ X Y  HPX H0Px0P<0  0@  D <d0X0C 03>0CX  4 0 T  8 9^ n\Zn0 0^ZSQVd0 `  X D` \0b@ 0l5 \ Q\0 |uP`0dP` P `5>VNP1V0\R3Q ʪ Hx0 0SYV D d0Lppp>, <Ho,0@p,0P`Sh 0s\ DP0\ dP`0iZ! /H x0Rp9HxL FLL,0 HP f X 8P+D 0d S) ,iH X0\006P0SJ DPXlRD,Kd0 L墢PX ,兝Q,u,˜4U^Y0srX0SX 0SD `0X c51 a0 QVP t P $h@0Sl0 l0p0po0  0- LP X0$ 0X00H0=j -@L P   P 70007 -QLMP P- K@K00, kP0S0H@K00, [PQ0 Q=j=j -1L@T6 W@1 0pS0pQ*ڴ 0SP#00S PU R |`0S l0S Sh 0˺ R W@0D0Povj8cj+o -pL@` P&P <@p ` 0 0 0e0Mo8? -pRL PP` U @W@1 3mpWP`MD?0 (m -APL0p 0 )@PP 0`S :0S  0s $0S(0 $ \ZP0S@n -0R,(SLpP ` VA  foP t@TRZ,@(PY `#P <Z,(@Y 0-80LS@P0S  R00Q0 0008? P PP MMP?h? p- L 0`S t0 PUPU 0S 0S@^h>ppo -0L@pTP. `0S0 ePV 0R`@TV 0S 0@S S(2'P o0  0- L@`&;0PS,6Tw 5T <5T, 5T 5T 5T p5T <5T b5T 0T 5TL0p0zP d5T :0CT .H5T @5T 85T p(5T o5T ;T 5T0S i34T0p;0 /4T 0T0p00 0CT0p04TQ4T $4TP hpH4T 0T 0CT@0p00CT 0T~0S{ 80@Sp Lr0CT 0T 3Th pL 0 P0 0T0\0CT 0T 0CTR0p:0O0CT6*2T3 2T0 pDi0S< i0S52 0R 0R 00 p (H0p0$Q0pp 0 P 0p00@S0p@@ 0pD00p0=00p0S0<0w@p0 p 4001 @ps s1  i=0p0<0p0P1s<1  P 0S0p 0p i0p0S0@0 QpH0T :00Sp0T 91T p0BpP080kB @~fwBfB{BlB sB@f@nB@wt@|B@vB fB@hB yB}BzBjB@oB@pBxB@vt=jBBqB@mB -@LD0S HQ\0X0\0L r\(X0\0 -L MS00 S @p\P4 ` R400403 0@0 @ @`p0K@k00 j0,0@0 尡 4:0pS$P X 00S * P 0  $  (K@n -LMpQ`)  P 0 PR@T@T 00= 0 000( P 80 <0S101@T+ -L@M 0(K( 0 $K01K $@ 1[!0 !K -LM@ 0  $K1K$@ 1[!0 !K -LM@pTP` @T 00= 000( 0dP 40 %<0@ST8<0  00- L@0PS=00  0- Lpe0PS`  0R` X0 0rX0> $0S;1 $ ^!\C :0S \K | 0(X$@L\":@T* 0  0@   `0 @ 0  0$0pP` #P0S|`Qs`m0 0 0 0 @n? Q-Lp`V Q CiQ Q `QE ?*00@ Tu 0iTP0 ;1u17`t @P b`P 0gT& 0Y#Y#  6zP ` py Q0 0Q Q000000` ah 0 0i 0 -LCMq0  0 $ `Y @R` P52` P`$ 0R& K,IK J/K0_`P(h 0S=t(`81(0@ R0#1K0@ (`L!렕n%=0@-00 \ PllP \@0 SP 000< 80P 000nS0 n00Q Q 00 84 004 <0-00 \ PllP \0 S P 00 000 00A S@-2*Qf 1@ 0S'p)+p)+)+)+)+)+X)+X)+0@S 2S K S 0S0S Q0A0@S. )ڀS S) `S 0S0 S 0S @S00Q00Q`S pS SS SS S0S:00:PSS 10 S R=j -LDM@dKP@pgT@D` @0S񟗾1+1+1+1+|1+l1+d1+\1+-+-+-+-+T1+-+-+-+-+-+-+-+H1+01+-+-+-+-+-+-+(1+1+-+-+0+-+-+-+0+0+-+-+0+-+-+-+0+|0+-+-+$0+-+-+-+0+0+-+-+-+-+-+-+/+/+-+-+-+-+-+-+/+/+-+-+t/+-+-+-+l/+T/+-+-+.+-+-+-+.+-+-+-+-+-+-+-+.+-+-+-+.+.+-+-+.+-+-+-+-+-+-+-+.+-+-+-+-+-+-+-+.+-+-+-+-+-+-+-+.+-+-+-+|.+t.+-+-+l.+-+-+d.+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+-+0 W*W$ KH$0S; K W0܇0a2W 0\ :0S b0 bS \* 00a``000 0 0 K10D`0 K10D00WW 0P :0S b0lS P*0 01@0 WG*W$ K$0S 001@0P:01V{ n0P:01mWeWj 0P:0Sc b0bS] RP010W:0 0P010|0S4 0< 8oP 01fh0S 010c_]`[01@U0R0 K10D`L0 K10DF`DB@0@-P@ R( 0S%\ ) \ ^ \@ 0 0\0 S 0  0S R 0 000@ 0 0  R P,  R/ 0\ 00 S 0  0S0S 0P@ 0S@@0  @0@ 0 0 0S00S0@ 0\@@  @0@- R 0S^ 0Sk0 0R 0SI0SD \  R0 0 \0S0  0S R( ^ 0Sm R 0S 0R 00 S00 S0 0S    R 0 000 0 \0S0  0SR 0S@0T 00 S @0  0 S 0R 00 S00 S0 0S    R R 0SP0U 00 S P0@  0 S@ y -`LV@3 ^=0S`PVPU p` 0S`` TPR 0T 0RU 00SW `PV p PU` 0S``P p P 0S0SP0SP0S  P 0S0SP0SP0S PQ00SQ00S,, 00S0000=jo R000  B o -L$M@0Q0  %2 @00S@0<5  0RK@00CS@0ʼ%8005 5 2K4 K ^렕ni %= -L$M␡0P(0 p8#(`HK503K5P @T@T 0S 0Sሄ@T`00@T V 0 03K5( 0R"$K0HK03Kx5 P P  P B렕ni Rj%= 0-L(`@PQ \0000  `00`0Q0hi=j 0-LPP) @S& S嶧B0 0B@T 0S X B0P 0B@TPP@0A=j0@d? -L`pFbH0PU ,0S @A@PUhpn 0-L,0P@T @T0h=j 0P c [ p-@LTP `P`@@T@p 0-@LPT P@@T0 p-@LT`P@P  R0T 0 PPPu@p0@ 0@@P -L M<@KP`p a81,` 0 P 0S@ 0S  @TKT00 ,n8Q =jo 0- PR0000 0@ L 5 P  0h0 -LpP@88!`0hP 0pq@P 0S@0S`L@h]o=j 0- L0@SP 00  0@ 5 P  0h00S0 000000 p-`@P LP 0R a phA됙?-Q 0P P P-@0 H0 D  p-0L@`T$@T ~ZP 0 RP U 81 SPUppp=ji$ 0-H0L@PT $@T RZP0000=j 0-<0L@PT@T 0;ZP0=j -pL#W`P,PU) PU7 0SXQ 50@^)*0 0# 0 0#^ YP Q  YP PUP^ -1LM@ T$ P$@T YP0SP 00P$ 0R! K@`T SP4pK`` 0Y cP@T PEU0=jn&= -LMЀ 0R$0 Q   Q$ 0R  K@`T RP4pK`_ Y bP@T PEU렕n&= -L(MP R0`,0 2Q  R ` 0 0S0C`R `QP `, 0 Rb(KP0@1XR5LK0  z_pW7 VD0c`V  pbP@" 0Y@p `FWVP0S <Kh XbY @ XVP0 0fP 0@ Eb<K9_  X@E0/S8X09S@P 0@T$@T WP000@p 00   00 ` =j 0-81L0M0Q@ T $@T WPP @ T(@K]0 (0K'K@P <Pi@PD@K l] @P <P@U@P 0RK0=jnș?D=8&= -0LS@ S 0SQ 0S 0Sh< WPT 0S  WP 괱= 0-0P@0PL GP$ P$00 =P( P(00 3P, P,000=Й? - L@ R! !  110C0C11ai 10P RZ -LP`p@QT 0@SpW@0@Sp@0 0C@0 7iH0T0H0P U -L@p0QQ 81\P 0 R P 0 R=j -L`0pPUPU 81W5 @T@T 0 R0S SVP@=j p-L M8`KP@ \(P v PKp=j Pp-LP` p@Q Q P @P 00 0@ 0S0C 0 @@\ $0\   pT+ p-L`l0P@T %0B8R#8 S51S@T;0ph=jB -@Lz%(hd -5@05L~ i%`0 he 0-5P0L5j @T d@T  R! !  110C0C110h 10P RZ4%0h p-L$M`00 0P@T@T 5 %d1S KH< K@T 0RKp렕n=ji P&= -LMX, > 81`VH `VC 81, R@T@T 0SPU 0 pR*0 0# 0 0# WY  P P 40 P(0 Q 0 =j=j=j=j -L0LS@  6PL  $V 0L0ahL+BQ -0LSp 00C SP@ 0S0 C RQP@T`U 0S U0S9 0`V`V "UP &UP0gS \ 00L S0gP ^0P@@\00L SL0!l/@!b00RPXP0S =jgfff p-L@`P@ EPP@ 0S-@ 5@Pp`pK@ p-LMK`e@PP PP xPP P 9 -LxM␫PU, `p@ p;U h;Ua \;0S"`P <;U ``, 0R(K:UK 0UP :UI P` :引UY G:U1 N0CU0CUN*0CU> 0U 0CU~ \ @ 0 `5 0# x`05 @ `PF```f`9U: !f0CU0 0CU 0U% h9U`P1S  `4`y 49U k0CU 0U| 0CU_?P`e P` L@K S 0K5_`8UR 70CU 0U 0CUu[`PCLPK 0K_`Pt_O[m 8U 60U[h@@`P(1S@  h0`TU i5R7U h7U?7U+0CU*0CU5zh7UM m\7U-w`PP`?P @0T 81Ro  Ḁ`0@0T`0]@TZ 0 0 0S0 R4 40640 0 40 0R 00B 0K`㰑B`P `PPK@ 0Kk^`POO@ #Y@ R`P0l0 `P8# `  41  ! `  08 C(` "`PoP~ȕ`il0`0d [`@KO@ R@ 0K3^`f`PN5w l x$q< 0 \%x   rL`P4,$5Q6 PU3 0S00-d0S S S `S S S@ X0 X P`c9`P`P )6`1%~1`0!81`0-`2U h0`0@.5 @!5{@8#` 8 05 ` )8#'2U 2U`P 5`P 1U 1U01` ` [` @p8# P `p081j`0@ ` `V^`  PU`0@ ` `VI` mPKꠕni$ii$zi i$xi Fixi i Ji\&=i i Ii i$i Hi i$i 8Noq=ji ~i i$Fi@6i(Ki -ԁL@\g P 1S 1 RQ[ P ta%0S 0S 0R0P 0@P0A!R 1 1! Ro\00RR  qP`P  GW  P PH`P  6W P$000$07=j=j=j=j]?=jpn? -L@000  0@{`hj=j -L@|00S0 0000@hV=j p-1!S0#RL:5 `0 P0 00   `00`0p`0  p0`0 0 @0 l@\0@P `0S ph000 0@@0=joo p-L0%LQ`U @ 02phnp=j -PL 5`";5!T2T"1!p,}2/, R 010  0 ` a aR0 10  0 @T 0 RM 5 Q 0 0R0B 0OWQ0  0 0S0C 04 %01$(,0@T 0 R 010Q@Tt0 !h0 R404 H040 0 40 Q+9+9+ oNop=j=j=jpn=j8No -LM2pS20 Oe00S P, h0C00 0(,0  ,0(@`(000 0 UPe0h 05U0d00H0 a0 p@B  @0PU0doU=jT+ -L M<@< 04 P.  { Khj?o4U+HH-0#" A0: 0 A  AQ0A0Aj&=0@-PR@ 0 0!\!""0"!0&=@-pR` @P@@ 0 ,>#!^ """!1# d&=&=   -"LR@ \0700"R p-@LT`P5 T T U Up/p0S 0S0S @T T Tp3000 00   00Tp@Tt Tl Tp@0^  0@ 0000 0Tp=j=j=j=j -L M@9*PK0pK `P5BT+@T(  /NP )NP00CS0 R07004` )20C2 NP2 0C2\ Y`$K S -L M@p*K0K` DPP*0[<P$K600[ BT@T  MP  MP0007 @P"  6T 2T00 p2 S0"00+.B 2 02MP2024P7P -\ \:5S0d0\-P01P0h040\0\ (p2i 1i i i -0@2l D0C"2X 00/0020SL L @42Ε@42jPXj 0-2L@01pSl0 P0e 1d hfP0e S020D 0h6}+ -PpL`]81W(0 %g 0*   R P 0S  RP 0 LPL  LP11<<110 0@0@00@0@0@t04 !48#H) 1# 5  $3TT # Td 3T00S 0Sj A_i LP i5_㖕41 2T& 2Th'p2@P p0Si HB@ D0RW< 1 00Sa<`10`@  @ 5w51@P p0SV At|1@P p0S7 \A0S H1R0T4\ a`P  [ kp\H00H0^L0Sp!m000 0@@0000 0@@0c\000 0@@0t=jo5݆op oNo -LMp@AAP`2@ Vo^(KT 4 P:  dX 4   \Q 3 QXA@@@ R+++4+++++++++++++++++++++++++++++$+ ( PPv 804 0C@8001/@6K R@0K  Q@BK `PP @ *K Q  QXH 6K Q㲁@\!1`RB]1017@v 00K $P12K@f0K 0sP 1  5  ;@T? 02KP08!Pd 4 U QA@9<0!0 1SQ<P10Q!00@  !0@ 0 0@0@zI@0< L`0P2Kl 0 ?e1j?ʚ;Q0X0ᬁ0 Qp-LP` 0CQ :R  R R /pt0Q p%0CQ5@@05V (00p0h0pp2i i Ё+ -Lp`P DP 5AUp 4 20S00 0@0@0O   R R 00]/Q`e@ D0RH00H0\ 7PQ`\40  3A0 < 1 00S၁<10@  @ ̀0P` @0S |P`0@ | 0 OP`P`m000 PP 1?pNooo(? -00L @P  o p- L`@/PP(  00/0 h0%0 1!0 Td0f e +bD 0p4@P2 pD?++o -@Lh>j- 0  \  \ 00SP \`0S S S 0S 21C 0>j p-` LPP0#U T @u T0000 0  hTp QP-@L`Ppp m Tk 1R% 1R`  0S_0pS000000p 0S 0S P` P qP;   R08 PpP`PPp X`1`!  ;p @P@VP 01 @P@PV $`RP00S`` `0P`5i 6i( -L@`p  PP 0` pP0  0/L? 0-L @PP 0  T.0P P 0 P/l?? -pRL` @PPU@ -L  0P m/먋+o? 0-dPL@XT   !@ T0 *so 0  0S-0S  0 00Sp@- 0@PcUe\5*0   0`Q  ^ T 0SQ 0S p?R00S eQ 0SP 0S pr3p p@- `P0Q!U 0Q 1 !@ T0 0# 0 0 0#\pp0 Pj -LMp, ` 0  ``0S@ T00 R *0Q 0Q  R 0@0S`0#0S0SATg@1@0T 02 0Z@T`PU"0Z,PU 0 @P  @T 0SY 1 !]PPU,0S@ OP@@0\à@-0@    @ @0 -L` P@@Qp >* 0 RQ 3  \0R 000Q ^f 2 @@@ 0  PP0S:  0   @ 0 p pPP00 -pL0S`0S 0@T  0 0S@0SP U 0Pl P 0 -L@p`M0 XpP0@@ 0 0 @P<0 40\ 0, ,0 0$ $0p 0jj̝++l++(+ 0-0LS@P 0p 0P 00h0 0-0L R (0Q0 R0PS0h - r@P 0L 0X0X Q*00Q8P 0$- -pnoȚ?jjjo?? p- L@PT0`0 nL00 00 0P0`@p *P@,o? -0 LR* EP -LMⴒ`0RPPP@@U%U〢xx2 E)L e$LQk*0PSh 0RS BQ:`aU"0S`1 pqQM@!``07Vp9WX00S0 Pp \10@0K KH1, K0D,0pS: ^!Q Q\ 0d 100 0  DEPpdK 0 00`0 R 0d1000<+00N Sojj@jo'=,? -LM `PpP @  RX@U TU @Tp R P 05 0S PU 0ES 0 Y Rp T 000S` 0 P 0SPP0 PP 0p0 00R +  00CS 00 ^ڿ0S  \ R0S P P  0S|\+  p P @ 0St @Tz  dlDPf p \0SP 0S:0S   0SPX `  0`V  `| Q R 0S +p50S  Q0A 0 >\0P0\P Q  00CS 00S 0hd *T*p0D0  ( 00갛???ԛ??\?o -LMP < @ 0`Q40 8` 0` 0<, K,0SB Pp- p@Q V Q 8CRPP0pS @+PQ (K T00S p0 S <0 00 0 V 8 ` 0 0 8000, @R? V 0 0@S@ @R4 00T00Sp@T! H8S0P ,0 SPO 0UM P`Pp@T /P0UP08#x0S5 R 0AS0AS R0 040 DP8 l ` 08#800 5QS 0 00pSp0 S 00 0@SU} Q 0 S R 8CRQ; 0 Sg PR 0S 00 0 P@MP PEUp@T@ r@Q R#3p0pS 0$|)P)L?,? Qp-L@`ph0 P PPUp0U PhP 0R Qr r0R@QPr0SQ * 0Sr0S Q1 \  -L@@PA- 2\ \@pQŸ2 00l0a6# a c$"cb!0b0a!6# a c("cb!0b0`# ` a` P%"^0a@0b@7#0lc! c a$"0a0b6#bc#! c a("0a0b#b`! ` a%"^0a@0b@7#0lc! c a$"0a0b6#bc#! c a("0a0b2#bc! c a"^0a 0` 7#0bc! c a$"0a0b6#bc#! c a("0a0b2#bc! c a%"0a0b'#Q0 |0x00b0l6# bc! c a&"0a0b"6#bc! c a""0a0b1#bc! c a'"jy7 p-L@L0`SPP P0  hpj - LRp` <0S 40 P 40 0 R 0S 0 R 0S P@0HO$H`UT0D@`fPUV00S@ PU P80080HDjRj -@L `P pP 0 0 R @PPU 0 S 0:: S c@P0 Q 0S R 0 S PUX r0rS f@P@P T 000 R@Pr r0R Sr -Lp`@r00S *@P @V PW 0P 0 R@P @PP PP -rXLPpr@`F PZ 0SJ Vn 0@S``@@ 0S T  0R0S @T r`Q; WX00S 00P 0PPP R 0 0S/ 0S Q 0`0P0SPV``@00PP0 0RXp`P pGW0T@&x? -@00L` R000 h0  p-@LTP` X0X >dP P 0< a!0S00@@p7p@j@jo0 o - QL`Pp0@! S 0S -PW5RTZ Q+P+t+++++++++++ +++(+(++-P PA @ EP @0 P PzPq& 0S( ePwePV X8P0 0 0P i}_dePPPP9P 0S  0Pꈜ? --1LM@0 T, p 00 C `@T4  0 P!0R!R 0SP 0 ?P P  ?PV  0[TP 0  fP Q`@TV P0 fPrQ(Kd0S   d0S  `oʚ;0 R0%3 %'@joP (0 P0 Q@jo 0-L@PP P0 A0o - L0+-00 R310 P0 @jo\ o 0-L@P0P  00<0 R  R 2S@j -\L`pP@P 4 #P P%U0pS*@j+ -< LR@ g00CS 5 40 40 r040r040 -0L pR㐀` PP%U s@P P P #P4 #P 0`S*o@jd+ Ȱ-P2 S R 2 S,00CS,0 R0000 0 @jp@-@` 0 PU1! \ *0 00\: Up lp@D 0-L@0%PP "D"0  0 =0 -0LSP' @T=@T =P,00,0@Tp, "0R8@#xT0W0 `P =,0T0r,0  @ 0``@00 ``p@jP -`pL jPP# 0@T \ x0$ @TP0S 0Pl 0S opn\ o 0-l@LTP#>l@T  R 0 0 0 R 000 0 0  0S0C0 " l@T0o? -`p44!L l@ T\ P@T 0S R 0 0 0 R 000 0 0  0S0C0!  P7 pP `l R0 0l ` 00  000"1j1jo? P-L 0S 0C 0 hzf#? -@PL0 80CQ840Q 0 $ Q00C0M@P 0S0C 0 [ ODh 0 (hK"-#+#oo??? 0-L MdP@TX0T$ @@0@@ 8y,a00K0#@jH?ooj+$? -p0L @R  7P 0@ 00@ R 00@jo P-LPP:0A `P0  @P ̀Pp  p !,B  !&B`@P0P  80P($0 0oXo@jo -LTM0P,0 upKt D A@lP 0P @P 0 @TT!` 0p0`p 0 0S DA  0lP @ t,(K,@ 40 800800 S 8 ,0K`P ,@ 80p080,@T 40  p DA 0l0  d 00h0 <0S 0 \ @0 X <04  o -LM,0 Q0A00S0C0`00`SP 0S0C000S9*  p.@P9  @0 \AW  VAdP 80S0C80$0d040, ;Pd T00X R XRX  0)AF -Lp`PS@T 0 R }P@@P @"@P P 804 0C80 0 R @@T 0-80LS@P 4P 8 R 0800P 0SP 080P P4P 8Q &44P30Q  R 004PPP 00 q4 -LHMǟPp, d @{`P/`  000 0WQ W W, 0`0 dIǟ, 0`R(KZ Q 40  @0 R4 @040  < 8 40 <0000D R0 00NK4,4X0`0 0 P @P7`  00Y40 ~100l0r0Pr 7`   @PP )P  PF @0  @P= 40 = 0dP 80S0C80Ń0d0h R800C80 h P)40@ 0R40 0S  $Z000 ` @g80Sb080` ^` [` X  `P P40740 0RX0 f {P4,P  0 W0 0@ 0<0: r0 X0 0 PT d PG0S  Z@8008040 L  @y007 P dP ;` l @ 0Sh0 q l LLl80l0r 80r hX I?  P ^P IP4040774040TX (P\ # 0S0C 0 40 hP>dP;  ` ,P` 4x40 r0 X0 0 T \ 80S\0C80>TQW@0S h 0@ 0S0C 0 0@ 0<0 0 S l m  l e g00CS540040 r04 < <4 r0ꠕnoo'=P?d? -<1LHM$1pW- PU' 0 0X" R 0 0 0 R000 0 0 `V L0S0C0PUpW B A(Kl@KD]>0 0h  r 1joo? -LHMpPU$  R 0 0 0 R000 0 0X  `V 0S0C0|PU R000 Kd@KD>0 0`  r so? -2LxMP 0T0 , 080 Qp` d @KD=0V0h0 唀 dP  0_/NKl  T0K @Vpu 0, 0R(K _? NKl  T0K %pPT@T 80@ 0CR80 M@0S  @ 0S0C 0< @P 0<0 0 S    T02Q'0S$ JP7p @ B pP800C80 @0S| PZ I0S3pApoPT@T 0 80S080lZv nIs렕n? '= -LPM`PKpDd 4=d@ d0K\ T 0 X 40 r <`p@0 0mTd 80SK080d4 -<0LS 4@P  # -40L h0S  - LR@ <0S 40  - LR@ <0S 40  -LXM p x `@Pt@ 3@& 0 t0 &30#P00S, 5 00 R' @PP 0t03 R00SI TU000!000pKD<xpK t0l hp d T (K 6P,,@0T P,A@,P 0S 0S40 0A@P   040,  0P, `@qopKDH<(0K#x`pK8 <@ l hp d @` @,PP 4`P0t03ooo -L M@ 0t4X%<l0l Q  0S0 QPK?\ oopno? 0 000 p-@PL,`;T*^1 @0 CS  @ Q00T0#Sp p-P`0L;00 p -L Mp 4  , 4  RJX 0 Z0 PP 0`@PD 0 10 0BR0U ` P;@ TXU00  S@2 ,0S/ 00S 0*0S' 0T P ?P @0 S,  4  R R000 ղR000 Z0 P P00PUP U 000004 @ (K 0B; -LHMlKP D7;1pWX5R pWR  R@T 0 X P_0S `V 0S?0X0 @T/ X6 0ST 0`0 0 L P?0`S P 0S  00$l0 0=P 000@TT@ L@ `@ pW(K 5d081 0Dl0 0 =P0 00=j -L(MP@P`0AS`(KHK `: 0`T<0 H D 4 @ T pdP H0L 0CPS +++|+ +D@QPAL\``LW0P<0@ X < : 400hS `300  `L=@`U @%T Q0P U`P  ``0 8pBK K ,0K21C0b ?A1c0o+lpgfff -LpMⰁ0`S( @2 PKD:< 00 D\0   @0|0 x 50p0 7S0 `;0pS PU 0S( 0R1$K 40JpK"9"0J0KP  HK3dp 4 L r0(0 080<0< 0帠 0<P00000렕n('= -L M 0@0 S++++XP,P @FP00S@X/ , @@  9,Pp @Z `Q 0 70 0BR0`0 (IPP$p W@00P0, 0 0(KP@,P P@,P P@,P ; E1@{EfE 0-40L@0PP | 0YP 40040X0S  0>E 00a0h@jBgfff -L`R@pP TU 3E@@TS S *@-F0 0 80@0T@S# S U *@EF0 0 000U 0S @0`v P@ @8`U 0S @000 -LM`@p4TPQ T< T  0rp {$K <ehQ@` 0S p@ 0pP;0 Q8080? Q 0001 0  X0@004 0 a `R \0p40 pU P Pd`00C0 00C 0 #(00C0000lp+L o@j --L M0 pR,0 a2@T] P@T. 0 !0R1S R SP  1P P  1P0`Q 6 0BSd(+(+(+(+4+4+U' 0 `0aR  R  40040C(K` 0 XP >W0S  C 02 8p040`U"  0FP0  0 `0aR  R040 40 0 NXP 40040K0CPn8 r 0RhN0Pc4V0S  PUoʚ; -p0L PRp`P @0U P D1$$ $0 phL o@j@j@j -L@PM t x \p `(KPPp UlKD97 t URUT 0 Z  lKX ` L lPp > 5U0$00  l0 08! t R00 S W&  00tlK` d0 h HPp  504 000r x0  0 l0 08! X4 0 00p 0PUL o@j@j@j p-0L PRp`P @5d081 0`0,P0@$ $0 phzL o@j@j@j -LP ^@P @00 `p0Z 0帥,嶠T 0 @0 0mQL o@j@j@j --LMLP @ 0U, X0 T@ @  0SDGPP 1 0S p}B, 0R(K `V0S+pWV V(p P7p  0A\ 0Q8 X  X  Ve\W @t 0C!` @#2 40P 0CP$0PN=@ 0C! ̇ P P10"104 P PP10N  0\30S<000S \ -8LS@ 0CS8 05 8S05p@-@P`0#U@T$b0#PU0t0# ^# 0S0R  ^P0,0,P#p(=P0L0Q00P0S>S  f-R+ +++ +D\ 1 R(= p-0 0 p8LS@`) l8PS (+4++`+++l+++:0 00CS++++0:0p080p080p080pl8S 000;08X 0\<0<0\8 8|"R f-41 \ Q'= Q-L QQ20@S++++++p+x+7P"  P P nP P,$`0 lH L? Q-L QQZ$P> 6P? P? PG 0@*S+$+L+$+$+$+$+$+$+\+$+$+$+$+$+$+$+$+$+$+d+$+$+$+$+$+$+$+$+$+$+$+$+$+$+$+$+$+$+$+$+$+T+HP 0P   `P lP`@ 7nw`? -LHM@ğ0@P"}`,0 }- 0<K 1p h h0S]h  h #0S: 3 0y`8 Z <0 "0Ql0 @l @0Sl0 P P 0 P`8 p<[\v;0[Sq< K0 R  P(K 0C< K0pQp <0[S%@<0[@S0Q w1rGrT@k8(,0`Id(=?f`? 0-8L P& 08#QQ B0S108# Q t 0S1 0P0Q@@O0(00 @ C0fd -X@LQS QN Q` Q`  V`!0S6  &pP VK  *z  P<, P PP@1 R P48 Sl8娨4S UlX %00S\8<\8 H4``V0 Q2 RP\8<\8P 0S8X p ``PdfJ -@L&I7*"" R222 ch -LMp 82i 1 0u 7/!P0`00` VP O0S 5IP> 0 `0`  V P\AL1 R!  41S 000,dR̞?f@Aj?0 0000  0@-1 @T^* T(0T^  T00S 0 000008S  0S00 000S8 0C8 @0 R 00 0S0 :[0(0CR 0 8080 0̫`8.  0X?\/ 0 `? 0d/h? 0l/p? 0 2", ,@P&,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,  \8 01S]="!B10b> 00 0 == p-XOLTP`@@T 0R! b'P V Z'Pp -LdMP,!@0|  ,0 p` D'P.xK  7 rK7 5'P&lK 6 LK60XXL00 0C 0 x )0C| P, 0R(KxK  6@lK 6`렕n$,,?\)= -LM0a b0^( dpc ^( 0R)$KV#NK 0F89 eHPK1 6#NK 8K6 ~ 0.|렕nt)= -LM0娑Pab0^, d@c- ^, 0RU(KVpfL@H$H"00 G-@D@H$hOK  w!008#_ #<" a0b1p :6   Br@ 000S0 LPK '6OK <K "6  0 pb  렕n)= -LM`V, @ p& 0PK0K`V0[ 0p0K    K V@@K 5, 0R(K렕n)= -LM 0`  4R$ pP# R R $ 0R, KOK # QOK QOK 8PK ZQ 5}렕n)= -LMx0Q@4`KPp $0 r5 0, K%$ 0PR KW렕n)= -LNMPPP$ `pVOK   DPK  65$ 0R KVOK 0 P+ 'DPK " 5렕n?)= -LMXO`TPp@@T 0S 4%PP 400l8S  ?H kP @P 40@0\/@D \?@\/0o@ -LRM`V, h l p!  p2 K0!(KH@^K  `V$ 08 p#Hhl!10(K@ p   YK VL@K 4, 0R(K t렕n *= p-\8L`P@9 0K 0 9 ; 0R>:0 "#A10a> 0 00CS/,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,0 0  0)S0 SCLR0S 6p1S]/phphphph  0@8S"!B10b> 0 0 0C-LS,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,6h6hIhx h -0L0C@S ,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,h|# O 00CS,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,g. -XOLT` @ RD0D0D0\?@ D0H 5#㦬XOT^p)#W 21C! c. QpP@  #W  h # -LHM(0` ,0  00C  0@p$@`P 0h d0 hPK`0@p0 l@ ,p@#$0@`P H#H$8!,pp`\ \` : \  >0>5l080S* @4PK 2 ) X K0 80VKW0K2  PK2 JK23XK  BD@K1 "P  w3`p唀@@, 0 R (K\@ >0>o5렕n*= -L(M0p,0 @0 @00P K080 PNKO0K~2  HKz2 BKv2 PK  B  3P S6PH 0 0 L0P 0 0 B0  `!4 0<@K040 "880 "4<0   ( G  ,2 0 0  00 0@0@<, 0 R(KH> 0H>4렕n0*= -LP@Z00 0-LP 〫@P O@0 0 -LXMBP h d0 ^, 0 WK` W0Kl p 0 SV K UK @1 OK1 IK10 0S 0C KB0KApK{ 0 S 0 0S00000p 09K 8K90K1d h"$d@0x WKlt0 |0 *|*X*4x[@ <2K.0K倠[h0[ lLXtYKXK1K/PK-0K$$h0pK9@K@(Y0 0 x1 J40` YPK 0 0# 0Q`   0 0# 0Q  `l00 O1l000h@p `lۨ, 0R(KAK <1;pK}0 SG0V0K`^^)렕nD*= -LMF 0 ,0 P  0Rc0@0 @a  0SPP  0@0 @ 0@ $H,, #H8P`0@pL#D< P0 `0@D p4R  *04@P@ (  2P0Lk\ 0T@K 0P S  b K @DKd@K @ 0DK @0@00t K6PK5@K80 0lS | 0 oڨx@ 儀@ | 0\ |  X< Pa 0| 0aUP!0Up`$@@U ( K L0Q 0#0, QY0#,0AڠTKT Kx08#̠DK#8t K@x0 6K50KU|eP |  @34Py 0kR 07 0R@ @ Y TKT K⼧PT0Ed@E 0TEP0#U 04@K|0 32TK PU0K2A, 0Ra(K; H31L0 0. >0>2 $ 0S0 10PP =*31L0 000S 000010PP 0S: 8>08>2200 >0>22 2@ 8>08>w2렕n\*= -LP@00 0-zLP @P  a@0 0 -LtM 0  ,0 00 a3P   J1P 0 iR 0 @ 0S p+0 O/P`0P`P`@P "4 <00 `3 00 "8 80 040PP "40  jLK0H>'1%1 H>0H>1?렕nt*=G-p#00`400$M400 0 0 0  Q0 @  "$""40  0 4,4 ! 0 0$ ""40  0 4,4!  0$ ""40  04 4! Ƞ,Ƞ0 0$ ""40  04 4! .0 $ ""40  0 4,4! X$Ѝ*=8G-#p0 Q0 B ("( 0!0##4 "0 "  0 4,4 !0 $ ""40  0 4,4! 0 $ ""40  04 4! Ƞ,Ƞ0 $ ""40  0 4,4!  0 $ ""40  04 4! Ƞ,Ƞ 0 $ ""40  04 4!. 040# 0'  040# 0'!h0 08#X 87 ("H0('08# )Ġ87_   `P@0 4#0#00*= -LM\8`p 0 LP 0 031C0SlY Y\85\8 J 0PTL? 0PTL?N0,0P80,8 0  (?B@n:, 0-LM8@SP 88 R 1S00 08h -L(M@p`Q<,;,;,;,8K00S0,0K00S00,0KPPK0+0K)0K*0K  K0  g@ A@T g(K8K  ',2K #,8K  ,2K ,8K  ,2K  ,8K -L\M8Ft 0x p ,0 h l tT  0RkhT 0 @j h@00S  P` | |0@$$,0@H p#H80@ L#D<P`x0|@ 0@|D p4Rd ` *t0/@PX@ 1 t -P 0 BkR 0 X 0S X hT +X00@00l@!!R x@d0 `,X!8X8U.h"H l0x@El0⠐!1 0 1dP@K8#8  lX T@0pdXGtTP@\  0@a0g T@! l0\ dX\ p.P@ 0W 0pU` &/P`v kX RPP B;i.1L  t\ @PK 0 .- 0l \ X80P[l04@K!T0X P^xdK0 l0 !!t-, 0XRd(KE pt>0>-| $X h00Sh000d`,XX.hE =X .1XL0 0pt8>08>-X-X V+lxE⠐2pp>t0>u-Xs- X 0S:tj-Xh-p@>0>dKX [-X tV-X@ xp@t8>08>L-ꠕn*= -LP@ģ00 0- LP@IP l8S0 0 1!1!0 0 -L,MP T p L 4.0PH0  T ,PH0 0 R H 0S TH < < %*00 @0@H#4<<_  0 03 00 "880 040 @ 40L !R^ \ P`0@0LPCoS 8@K9 ? LhT< 0bY[H@0`pD @0 D@b 00gT@! @D @   dL0jY@`p @D 0WpD  0VP-Pg PY P P U`` P   P L0CoP"88 KL0 1; ,1LP P0H@0 * Ph-P3 0 0 0PLP!0<T @ @0L 0@P 0$$$$ P @  L0H 0 0 0 T,H(KP TH>0H>,H ,0H0  =H{,H1HH L0 0PTH>0H>+ -L,MT pPP 0P,0 L T0` 0R<@K ) 9K)  LT ,0PD0 T *PD0 0 BkR vD 0S D  (D0 @  fZTPITD@PH  0@a0h T@! L0hH dZH +P@ 0X 0Up `,Pp? kZ RPP`` B;+1L  H P@@K 0 *0L %@0S"TL+, 0DR,(K =D+D1D L0 0zPT8>08>0+D.+D PT<>0<>T#+D P T8>08>+=렕n,= -LP@00 - @LB㶡P  -L(MP `0P L ,0 0H0 ,PD P )PDD 0 jR 0 D 0S P@D P 'H0\ 3\H01D0, ,400<@K30 ' 9K'  H0eZHD@`P @  0@a0fT@! @@   dH0`Z/P`@ 0V 0`Up +PpN jZ RPP  B;*1L   Dp@ (P%@@ 0 ##Ƞ#\0PH0D 0 0 0 P=*, 0DR3(K00 ŠiI+P 0p 0LPH>0H> *D*D =D*D1D L0 01_@L PH>0H>* '렕n,= 0 S00RSS   -0.0RL >@0#200   N000N "" N04\0N\8 2S0S > 0>0S > 0> -LMl8@S 83 0S00 =$  0 p-LlȐ@\P p`8  8S 0S=0=p` 'P =0=p> Q 00S:` BV  1R0x 0| 0 0  C B  R  0 00<0!0 8Sh<`10hD( D(> 0-LM@KP J& ~P P P K0@K \3& gP00CSLS,TS,@S,@S,S,S,,=,= 0-LM@KP & FP 0ST,T,T,4T,T,T,K0@K |% .P0ST,T,T,4T,T,T,T, ,=,= -@pAPL,0 P0 Y 0 0帡i:P)0 Ya: 10YV:`A8s P#`A @8# P 1 PC0S@  Y:: $10Y /:`B(r00" P `B@#8#(P 1Y: 04Y1: 20Y :R0Y:;0(00*0~0\ >(0> Ld0\ >(0> W 0-\PL0@  0S0 -00S 040;00 - 0L S` "!@21C0d!P2Sp 2S? t022S  Q oX02 - 0LSp00 $("8k". bSf@5S 21C0bAP2S2Sbi2SVㄅd5S @d5@Pv'0f T0@f@d0d5 - 0LSP@ 0>lȐ 0\p`0> \  8S 5h!4 0D? - 0LSP@ ,>lȐ 0\p`,> \  8S 5h!4 0x? -L,MPlP =0=(Kp8S ^ 0$P 0  L } 8 p0Y40 `: 0Y:0D < H @ 0 S@`  S| `pY: 0Y*>0>H0S 0SD0H  U(>0(>PL 804$@0<0> @0Q>q @Pl"0002 R 3 \87\8 \87\81Q3#531 R\ \86\8 !000 o5 \1\TA@08 #8808 S808>0>UH` 2SD` | SyR>0>s+@K s# PhPf0Sc0< S < ]< R |P @ 000t0\86\80D < H @ Lf\A@?,= -LM@lP p8S ` 0 PPp:0P:0SP p1:2S P*U 0SW 0 SS : R >0>>0>;6P0S\88S 0 0  0S00P  P p-`LQP@ RP   "p 0@S  p -LXMlȐp\x |0  (Kp8S @P0"0S 'P>0> t 0QX0 PP "P 00`\ \0 XT : 0X5:l d p h ` SpP  SlP 0P`X-: 0X%:00SdP  2ShP  SR>0>+@K P" P0` S ` l d p h ` >0>l0S 0SpP 0 S: R >0>|;\@Px(0BS P @ 0 >0 >bR tX d!$> 0$>00x0\ xkK`Sx 0 :X @ 0xY9l h0xH^\86x0+ d0S `?H` R `?(L KvPx00`4[SC +x0J !x R !D"x0<0| P0T x 0|0 c 8xp p \ 0\ 0xx0 x5dL KBP~dx00(>0(>tȗH0  4[S *j@0 <0Q)a<0@#[ #[  0@S  ^ N 80S\8 ^( Q& x jP=H @0xRR0 00#[< 20[0P0C0S20K}  x@PPg20[.,= -LM `QpP@D >l(0R> KČ$408 B#8  8  -LlM #R0 (K8 p !0&`0 " $PT #0P0 X :% 0X\ %p:\0x0 t0 ` |0 p0 l0 h0 d0 X0 0 S pP  S xP  5|P 5:S P`X: p0X*>0>xQ 0S| R 0p S`1r'R!>0> p8S `\ Q>0>`010 5. @ |0PP `P l8TP S 3  p R  rpHT 0S :Q ;@:0 |0 I  'E 0@ 0  -: 5>0$0#ḃp0X tt0x @l8S  UR; 2S8  2R ` c0S hP _ *S[R 0X0 V2S tP R SOR>0>I+@K D (P>0S dP : R7S50lSl /`8 YQ x t ` | p l h d X )l8S \8 hP `?TdQ `?600`p8SP8SMt0XS ,1 R \86\88Xt30( ; 0 Q(5/3l0S:  6 ]`P P\86\8 L K5P00dPH00@  <008 < #[  hL K)Ph@ ,=f -LMpW( F`(K(0S(  Q 0 e! 0@`W1(PU ,#@P,  PfkU; z"1L (0S 000C `b 09"@P  P !(!(!!!! -LMP\, ` |2S  @2R h>0h>o!l(|00 @R|0@ pVZ D0P0W0SJ\8 1RG  o 1R 0@?  P 8SV4 p`!1R8<0!0 1Sq<p10q!V ! 0 0@0@/00@0@L 8, o(t 0#pP 1<1C!00 @0@00 @0@ꈎʚ; -@L 04"48#hV1ھ 0R p S"PP # 9g@ 0S%@P=0=0S0S `F=0=m ꪪ -LM` 0PSp :@00S u,@u,Lu,tu,%PP=0=#2K 01R0S= 0F0f8#8 $#$"K  00 nPP  $K2K  ,K  2K2K  ,K 2K  ,K 0SFKjꪪ 0-@LԞPi 000h' -LM`1p>M#28 ,0 @P0M(K2>0Q 0, S PU @0 0@0@5 `00 S0 00#   P00  P4 U 8 0  000 @4`J`@P Rԟ@Po,> ` -L MlhpV<0  PU=0= X P  㵩(Ko@=0= @ 0R80  U=5, %02=5:0S@@T 80 S00P 0 @0S p8S T10#00"-80.   0S=0= p8S <0 0 08 lhV} @ 80R  @\ \gR=0=bl8S@>0@> p8 S 4 t6  4 RR R 5 40@SC S= 4,6 ,A繽8< pP`6 00@P  1g400 <0(Ko/p8S `' P;8 SG >0Sc0  0=0=0 0@X0@/(K`8 ~ 8S{0 u0Su0u0.000n=0= PM P _ l8St|,8|, x,t|, x, x, |,R =0=Rp8S ' 0 P =0=Rp8S `'  P< 0!0 `0`S \8  |3 0@ =0= \86 0@20@=0=w  <P=0=n P  ^2 "% ,0 (KoRPR=0=00@  PPu0Su0.0C0 0S 0 BQ00S*<0!0 8S<10D( D(0S5 m 0j  P=0=? `p8Sl8S 1 0Rx |   00C00 3 2C 0%R &80  0,0 (Ko O P/ | H P < 00  P 00 0.=.=ܟ?=j -  jLMp 8#800  bp1*"*RX,  P`M @d20\`, 0 d%0200V0 j = 000d 0R 0, j dő "0h00 0 0dő*2 0R j  $0 00C:0(K -`rCLM gŞ8\P# &80 083 <   - 00c:#: Sʲ00h:#: Sڜ>0>@gV@8 00h:#: S  0$KmJ -0` L p# @T  048#  10T:0BPU @0 4#2""0EPU@ 04#2 h -LM̂P` p0 0 S-  0 9 280 c0@Č, 4 0Q00 l \8  <   %80  040 2(K!0S:>  &8 480 c1 Q051Հ5X8  S @bV>00V. t,0 O0E8@S\!0P 004 0C0- :0(40 0 Pd PP2S  P(8  0b0 %,0V0 <   x 04 0b:#: S40 (Kob@0Q5Ţd㤒%8dUw''T<- 0S00\ \0S_0S **SSD-P\2 ڰ\- ʀ\# \ 4>04> \ 0\ @\\ \\ \0Ga0 -LM, 240 4P,08 eV>@0p!"0 E- 0 0cʠ,ʠ \Jʲ 0j:#: S6 0b8":#:SXP`M @d20\`  0 d%0200V084 b!00c0:#: c ʠ B0Რ,ʠ48P0n@ 0d00" R 0 0@0@,(KoG, "00  d50P00 d5" Q 0  C84 b dő "0t0 00 0dő* 2  Q804P, e  0 00C:0(K 0-P@L !( '$0:0; B0 [0C\%#53c0t0d >u & 60 0&(0 l (p08t (780bd -`PpL! @' :0 0;pp0 0\4[BCR8-S0T 3535t0c0u >d 0l 6 d0&06(l 8p0(0t ȗ x0Px00x08Sx00x0bd -LM✟?\, p #|?\ =p?\ d?\/ X?\%\85`0& 004/Ζ@P 00 5`?\ .>\ ]>\' >\ >\  0`, 0R(K>\y x>\ 0\H |>\`8@ h>`㳀ᴁX>\/ EL>\ D>\ <>\=倖`P>P  P1r'R!{ 15>0089p8Sl8SI 8p R 4`=\ 0\ =\@=Q`P80 L=\z D=\D <=\<:`P= RU `89 \8 ;4`\8{<\ <\ <\l5+`k<\ <\ <\\M@K! z p8S!8 LKM0K! m`ND< @R`hG`E;`P?\Ș  0S774`4`\8\83p;ݕ`P-@ P\8;\8l8S p8Sj\8  ' P4`:廕`P `8 0S\8 <4`\8\8^<000=@00Pp0S d:嚕`P0SS0`021Cc  `PpW@P`\8 :0 0`?00`? 000d?00d?000d?000d?000l?S S S S00 0h?00h?000h?0`0`7 `p8S' `\8`900{\8`#500(00rp8S3l8S`f<8`P`l8S] 5A0AS2`XT( p8 T( ST(  88 20C (A`=7`P7MK! `P1M0[ SN F M [(LK4`" 0"-j`7Ŕ`P`8@ 208S74`` 6峔`Pl8!S \84`20\8|6堔`P0S \8 5\8 @4`06協`P`8 W 0S\864`\85{`PW@P 8T` 8S SX S` 0d5Z`P!*`l8\S >`15G`Pl8SL @ P PX x0 `l(R  \8KU  `s4\) 0\eP# P@P 0{S`̠K|P 000J@PU 0|PSQ:|`E  | d`P DP  `;8pLK:0; M0K`.\8 5\8 C 4`$ = `00CSN@` P R4 0S1 R b0a ! c. Q  0S00000ac00   `P `P P R @ \8 B<4`\8-`o00`?0do`?`?0`?S0`?0 d/0d/d/ d/0 d/0 d/R0d? 0S S S S `?0l?0l?0h?00h?0h?0h?00h?h?S 0h?\84`6\8 `{\8;\8 N`m0Qi 8p Q4`d0` 8ꠕnii 6i(i8i4lpi i8i$i4i i5i iiiiii|i  ? p-LP`d%R @0@S md% T0d50`V0Pp p-l8LS@P9n0S' u0S.00C0\8&0 R$ 0  2S 0 9t#92! !00p2S$f(? -pLP@ 㑈0p1 -L@h腈 -0P00p00 0`@ X1\A00x|L B G0SS0 h`J 0<0hT -LM>Q` 'H1pW:tX!^3 9 S02 @">)t")"1110S'  2S 00 08\(0C1|200 0mml= xf -PL@ p[`J \[ V @[0S  w[00[0 m*= a0=[@ -@L`Pᜏp# )@P @Ph -LMxP08』#  @P)D\>0\>X@" (8R0W `pVl8S ᷎ 0`S m覎 -(8LR@P808(8R p-PL.#M`@P|Q php -LQ@ 08tP$P h޺ -LPp`@P p0S  0S 3 #0S R@D:0S  0-LP@P 40p0؎000/0d H 0@? p-PL`Î@@D@T8S p㷎@ph  p-@LP! k 02 8 \ PL 㘎l8`S 8S08# Zph+->- p-L@`5PP >0 >   ''7 8p p p p-L@`PP >0 >  p 0-@PL$  0p1pP 0h60 㑆 p-08!1L (8!1(8 0Q( 0@(0 0Q0`0 >BkPPt `8 p0B [Ph0P2 X phvHH$P<4_,`,x,l,U@ 8PSPV 0RU`@V(  Hp2f\8 0108l(R9 [0S  12l8S\8  8S(PT(0S  0T8 0CT8X80X8b$ 0RV K T8  DK`P p 0KQp$@U0@$@Er`P\  r7 S1 0K $0RS1\ 5~ {}B\ 1r' R! P:墹렕n???f-= -8]p`LpP`V5n`|1GwT@ \8 0  8p RhcQG^8 p` -T(L@'l8 S\8X>00T(T.\8X>5 T. \8XX  P0N(0(00 (0L0X8h舡???f -0l( @RppTLP`> T3 T 00SX U p@HPᨉU. I000堉0PS S R  '2PHRK 00SP,d,<,<,W 0S00l8SX PPX X '[[ 2S  R RR 'p34 P'p3~?-==j -l8LS`p 0 X̉000#ĉ@PUl8SS,PP [[ q2S  Q0l8SP 0.RP P PP 0.R 0.R 0.R .= R% 0S 0 $(, <4!4"<#Q#:Q@Q`Q Q0 0@S QQQl8S S \ p0  ˌ,40\00S 000C0@- 0000t 0l 2@ 0 0220 0 " 0\#40@fj-=*0 0 > \ R 0   .0 0.0C 0@-800p30C0"\"h"D@P` 0-`8L P@*  0 0S#> R 0? 0S%<0!0 |0SxP<P10|P @0u0S 0 0S0 R>  000 0 p--0P @0 ` 0 #4L0  "L  0#40/ ?#80/"$ ?0/ p 0-20P0 @P@D@L 0 p-/LR9 ϑ0S 0S.Q` R 0S 0qS R0Pf 00?0 ?@S?S00@ p`ϑ` 0-0P0@PT@#@L 0 0-0@0@ LP0 p-8L`#X @P   ;0 B 0P p -(Lp"h PP @  K0 B  0`i  e -(L"Hy P  0 0 K -(L"Hg P  0 0 K -LhHU PP&$x 0 $L&  p@开 -LMSPp" +@Kp 0 0  00CS,|,,|,|,|,`,|,|,|,|,|,|,|,,.@K 300P@ `6?J&40`P0`T]Z&40`|&40`  04"#400<00Pa`8 R(K00P @`  00@`  00 (@"h  08#h&4  0`@0P`  00`P  v08  #hP00P00P{ cp? S0C0P 0 0R  SP M08  #hPw B00 (P"hif-=c-=?ԡ? -"0L@M+pK0`P 8$  00  0d0C0`-= 0-00@0PL00C0d0C00 p-@ TL`PP T000p; <1ph.? p-0L` P@P 00 P  0#40 b p -L hP @P&x . "(0T0+0C0@"4& 0p 00b0 0 -L H` PP$x 00$,0CW0@p p 0$$@ 00 00b0 0#4"B 03#05C40 -0Lp @S`P% P" l d00!0C0 ?@Ì,40O2 C40  0#40 b R0 R S * S 7S,4 0,ȠL,4 0,Ƞm -L[ R\8P P\L@`:V 0\8%1 -\8 0  00c0 0p0  k0   _0  z\0  p0  r 'y  -LppP<0Ā` 8QA0+ Q00 0 P@P (0 S0  00c0 040     0- @=00 8PLp0  0 -("x![@0T``DLW ;40T 1 #   P `P(  W'40p 0 0#4[@000-[0 S@W003 00c0 0p@  W003 /*   {{  -0@L0p0 -P\L:0[2` lRppQ@@\L&" 0< R 0  440\ 1 #       cpP pP @00 岀T P' L 㶁 #" 3#4!0 ?\8-  [@| l8SK0 R5 [0S*\( 0 00`0c0 0;: a \( \(%\(Cf=j -t2堈 PlRL[``pP: \@@\LS 0<O ^I 0 E 4 40\      `P1 @ v8#  ȕ 3[#4 0: ;  l8SA 01 RD [0S5\!* 0 0c0 0(0 D\ 99(0 R\ \ Nu 0 R f -LMQp`x PX P @ @PP`0!P21   * &' "`8  VV?0B 0@005l8S> <0!0 7S㴧<10ว'0 5'$Kl8S  PR 0"A'p`pPkt0 00d <V 5 @0 @   MP  b.=.= ?? -LM@ P 0iSS2 0 S;@PH>0H>! 6K   pPL>0L> \8! |2S3"[Rl>0l> T]W 00@(K00SpP,(,P,(,08\(E0@0 P30`U  ```"[  @PH>0H> @0PS00`3 < "!0< S2 < 21C0b10"R`< 0<<0021  ,2  "[2R P < @ 1 "!l8S񟗁,, ,, , ,X,pxPbpPM 08pyP00  ' 0K \8  1  0@00l8S pX00' 0K    00  0K  '  7P0@0p/x000AW0 L>0L>ꈎbL? -PLAAP@`p Q_2 P& 0iSS"`V0 p`8  0S 㲁ᫀ!1R<1 0107 0m誣<p10!RA<@10A!00@  !0@ 0 0@0@5  |? -LMpQ@P \000@UG ڰUJ PUz Ue P>P0P>|U  U 0U("(`P U7 U((0 `PH> P0H>U `P 0 PPX䈄Y`P8((#8`P l8S ("(h`P 5 !0 0x ("(C`P 5 !ڟ0 00`P 렢?̢?? -LMl8SS, 2l1S5  0@,Hp` 0@P DP`  0@  #Dp0t>$K, d1S* 0$ ( x>0x>,0 8 P8  0@,Hp` 0@  PD`p 0@P #D p<P`0@!(#Lp4,0 (@dh! ,@0l1 8 R 1S|>P0|>F E0@$@Ap`D0@#D <P`C B0@!(#Lp4  $Kk -LMl8SS0S (K  0@pH,` P0@00 ,@ 0PK` 0@  D` 0@ P #D p< P`0@!(#LpX!4pR t>0t>\1S Px>0x>⟪0   00C8#8S0 \ 00005 !⦞ ,00 H,?? -L,Ml8S8 $K  0@,Hp` 0@P D0P`  p 0@ L#D(0t>8 X1S*80 H Px>H0x>8@ H >P4 zH(  04Pa b04P 044.J@"!Bb> 00.D 00 , D I8 ,@0 9$@H0$9F E0@$@4`D0@Ap#DPC 4 p0x> 0$ H L0 Pa b0cP4epX:d d`0X8 %< % *0PpX`): 0X%:0SR+@K  P0S0t>{X1S:<Qt L <04  0Rk 00X @0 GX` IL0$ 900$9F E0@$@`D0@ApPLC #Dp<P`(B0@!(X D#Lp4 ,0)40 (9<@4 K L@ PD 8PUf 0S 00L 0   D0D8S21Cqpc> 00 00  IL`0$ 9  8` 0@$P`D`P \` @P``0K8P 0@D@8#D<P`  D  0@D@!( #L4P`  ()8`~ p L0 PH  l8SBLx200Sx2;  0@p,H`P 0@pDP0  p` @P h@ dP ,hP$$0@`P H#H$8!,pL`@0X1\A% d0 L,YfL 0|2  ! 0 0}.=,?? -LMl8`SSP0S KpPx>0x>z1 S p ]O x O P' 000l8Sx200Sx2 5 0S00KhT0|2!c L00@p 0Kh8?? -LMTJ l8S, 0J, 0R(K`1S8  0@,Hp` 0@PD0P`p  0@ L#D <P`0@(!(D#L\!p4Rp: t>0t>X1S*(9   @B P0΃! lpKJ? p P@#P  @x>0x>T@ P ZP a b0cP4epX:d d`0X: S 0PpX*: `0X%:00S0S^ PP Ro@K a P0SP  S83P pIQG R 0SA  Q 1S `@5 pQ  0R  00 0    XP^  KP 0S  0S8[S h? !  0@p,H`P 0@pDP0  `p 0@ L#D <P`0@(!(D#Lp4 0X\!`1%  Tş0L 0  PPk 0  04P#  | P r@K  P0S0SP @@T@T@ PP K0Sp F E0@$@Ap`D0@ P #D<P`C B0@!(#Lp4p]O &1q刁x1PQ Z  Pp3#  `VX  0R@@"!Bb> 00 0  I0$) 900$9F E0@$@`D0@ApPL #D<P`C B0@(!(pD#L4 ,0)  ()0@   P@PUZ `0S9 D0D8S221Cqpc> 00 0 I0$ 9  0@`$P`P ` @P`0KP 0@L#D<P`  0@(!(D #L4P`  ()`~ p  P@h 000  L0  lQx200Sx2w0|2qꠕn.=,.=8??.= -LPMtPlPP, `@p00CS, 0R2(K!00 0BτlK/JP)`Px>0x>V00`@ 7pQ 0 R 00 0` WP5a N$0 0kꠕnH.=8?? -LM P` 0@lHP 0@p PD0p ` 0@ P`80 4@ 4`L8!D<`P0@ H#H$8p!,X1S  t>0t>(K\1Sa b0cP4epY;:d d`0Y40%0t>Ox t0Jo t L00 <xx X1S>:噥렕n.=8??d.= -P0o0@0@pL0P 0 0@0@WG iNA0bS 0bS<0Sp>0p>0S; S=  040\a0b $c Q00\0S 0D 0B8S0SS#R 0Q' 4'  4 8  $cpP8>08>0S0S1S 0SRpP   0S   y   | x t -"0LM'`K0p?0P0@   00 0C 0 "40040 "880 "4<0 !D  .= -"0LM@'pK070P0 `0 00  .= -"0pLM0 0'PK00`@ \ 00 @  1S0000 t .= p-@ TL`PP T0 00p; 1ph:@? -L` pP @a @T2 0=! 9P0 0 0S000 0RR$  1Su 0S q "40 0@ C Cq0CB#4Ac B a0b + ?PCuB!1RE<0!0 1Sq<p10q/00@[0@@0 yt0S00#$ @ T0S  0 400 0  Pu d>!1R17@01@ ꈎ M-LM0, 8 #X40 0@ (P( Z c @ R;8#(@#< 0 ,k1 0h!"8 0h!"4 0h hg14 0d!h"880d!h"4<0d! Y? 0@d1hA,@%,( ?$Kk400$D<@ #\#pT l#4<[@<8@ FEpDPCB040[A0!z0  $K`? -LM` pPK Pc _1 0\!"8 0\!"4 0\ \[14 0X!\"880X!\"4<0X!!D 0S0 c 0 5 ?$Km!. X00LK 0#40  00:4#(#< $K,?? -L M0 0S` 02="!Bbo0呎 Sp 0 00  0 CP,  ,0Pc lV?0 @X1\A$< 0\!c@"8 0\!"4 0\ \[14 0X!\"880X!\"4<0X! 0S\  10, "4F0E04D0 "88C0 "4 `c _1 0\!"8 0\!"4 0\ \[14 0X!\"880X!\"4<0X!!D 0S c0  0 0% ? Kiz! @004! K5@408?? -LM0 0S` 0pu0S^ S0 0S0    'P l Pc R1BS brV?0 @X1\A$< 0\!"8 0\!"4 0\ \[14 0X!\"880X!\"4<0X!!D ܹ < 00cS3 (!0e)$ 0 0%  ?(Ko"!B10b> 0!u0 0@ 0@(K(  "4F0E0 4D0 "88C0 "4  UD7-7-t6-t6-`6-U U 0w! l8S S w S SoP# @P 00 0R@PMnl8S 0 8 R' '  770C0C77u 10P RZ 10P+  R( (  D8D80C0CD8D8YW^ Wf00 0]5[y!P808M RZj0 0<W:00 01l8u\8, 00@ $l8S|1Q Fy000 l8m000 0p8'O0 pJn@# PP > R >C0 0ml8000 l888)??,?@D?H?d?l?t??=jģ??/= -LMlX ȠU@p.h, :U p8VS0 D>0D>p8VS\8)Y5 5E8S808>0>p8VSPP8S; 0P 508  Ȑ000(|8`]/  !⨍ȗ \|000t✍ 00X 'pP  ''S0 0  8p p ???ؤ? -LM@480 0PpX 2S  21C0d1 0"i:2S  cR@eV@)d5S @d5@P0e T0@e@dUe0d5 -LMP@`-mV>4 @c4p  ' 0hxlꫪ -LMP@`m 0pS0C 0 S hcl*>( 0c  ' 0y꣋. -p21C0g1@LM _*>h t0P &h 2XN0/:0O00 `.p  8<- 0-LMT0@+;:0 ="  7P 8h p-@LPl2`0S2,0,  * phk -=pS@bO ``PL i8 $) 岳N @( #`8  =S1NO PP Y8N @0 $9(#0   hHD@- 0-LPCl@k0h藘 p-8LS@` p0S8P000P 000p 000pH -LMp8@S\8 l8S `P XU0S 2P びpP 0 p( JR  0<0hp@-P \S`0/ S0, S(p$ 00S 100 0P@J0Q@0SA PLZpV \0R*@p0 0- @0 0000 PL 0PPT L;H0P0 80B9a$!B30b03@L0H0耖C5010   [0 R!0S S01000 % !!00 p-0`00@L@HPᦒP 0S S 0 [0Q *0 QR 20a0#20p -RL pP@pPT @t&  P E` -LM4@ ,Kt 0@ @ PKdG-/= -L M0@ (KJ 0 @PKXG-6=D  tQ 0 S"0!B /=-<JQ !0 S06=0@-@ !X 0lS  1\0}>EN-E8 BS(00"S: 2 1C00 2 1C004=GD  tQ 0 S"0!B /= P0 廿h? p-`PL @H岿TP4嬿@T(ph觿 奿Pph蠿ꜩ?$@b?D?? -@PL D唿8吿,匿$0 h脿蠩???ĩ? -L Mp`vL@0\48 0`Pki ea0<\<Q 0lV@dS@XODdH DIHK,B??,?4? i 0CU 0CUlA^ @0PP' ZO] 0M W  0P, 0R+(K5P 0CU ^5U0 0U0- WR V  pSV`^@%000@4080`@00X0090HX0805h0H00I0 pB]0P4U %4Ur 4Ui W 1S  Pp4Ux0S) H4UV1PH4UlZ0CUh4U= 0UXP3U 0U0P,0\0u< 0R 0`V 0S 0`5p ]H@ P@ 0\@M 80S0C80S00T 0 00@0:P <05@P 8 @ pP. P@0P100S PU 0@T0@T 0U嫇81P8@<0S 100p8No -LLMH@PT p``KHpD40P 00 \ 00X0  T <04 40ӉKr 0 p-L@` 0 \ P@ @00@30(00pphQ -@@00L9PHP㠉l0 # T̋V R 0 0 0 R000  Q00000 S5Vh,>(Jo -@0L @Q0(0 Q803@0 h괱= -LM@p P@0`<\00 3 R 3SA80S>? 40 ^E 0PS5岐0S P 0 j Y0801 0 4)4 S*TPo0S@40 dP @0 00 080ᾓK(K04  00#0l0F  ^TP>hBϠd,  `PUPE,10C8#8S1y, Sv: 0AVP044$ 80P P0S P10  l1l!08#8,0 ,!XH,@^7PUPE108#8X1*, R': 0AP044$ 80Pq@ 0RPS @0 QN 0e긁^ 긁(KoQ000 @Xo j8No$JoAjAjAjAj -L M@0P 0` RG l0 J 0S&0S/"\! `1Q 0S<00 s 0%,80S/  p80@0@P0 K180S Q0 1P 0800(0`c? RL0S0hO@@ 0 KH@xpP 80S 0 P1 8Nolp? -LM@C^ , 3P7 3@ 3 3 2 2 08U,  0Z3 $#$("ȁ  10S!0 0 0 #@D"DH$H00 1 (Pcp $<&$ 4(!4"H%<@ @@1S0 (@cSp04%4, $&8,$#8!8$,000!(@cSp04%4,& $8,$#8$,!8000(@sS`Ʉ04%4, $'8,$#8$,!80001``,S 0 Q<l0(KD0 003Aj(JohDjlDjpDjtDjlp? 0-@LP 0+eP  0#eP  010:8?4? -LMP`! \\ \ 0(K0S p04"48#8g00S03#!4@K,0   ,08#8# 0@ 4KK.K-K@P 70, 0 @P( K2pP ,0@ @@0,0 c , 00b0!,0 $!$0 忩h? p-LHMPP` 400S Kp\@KD# 0 X0  P 00T0 4 0, r 傈囩댭? -L\M0`Pp(0 4 400S T00X0( 0R+$K|@KD 8Kx  Pp 00t0 4 L r 0PQT 21C0D 10\  0 Y 렕n`LoAj?9= -0L wzp3CjCjJo -LLM `᱆PP$K40ppWPl@KDh 08 (0Kd < `P(LLᮅ(P<0 0?P ᣅPៅ P dDj- 0-PL@P9 04$48# X04"48# Q\00AQ\<0 h0 0QST JQ :<0h QX0Q:SX0h_0T0T0Cj9= -0LP 0CjCj -L MQ`@P`  K0S S *` 0` @n`^` 0[P Kilpp0 pmX`P PUᘉPڂPfCjJoCjCj -LMK vp  0C`$#Bb20aD c @ Cn<(4"4 KE.Mb -LM 0@p@A`0d` 0p0#!dP0 0d0  0pp K -L(M0p,0 PP  P   0S A<, 0R(KU` <p 10CH0 S0 0QP QL P- P L0`S " HPS PdU`0S S@ U@UT# DSS  /  ' H04"40`8#8 $ #$ ! 0`0 0`0H LL 1P <R1P0PQ 0 0 Q L1PU0PU 0(8A婁T<Q} 0% L0S SsDK0 ;0K< K 0( <K80 ʄPD  T00T0AOP  0 0bL0 0@L0P@D @P80S0C80<@ƃ<< 렕n8No@No9= --LMP 0,0 @04"48#hdVʘ%000(K 0$V$Q0dp 0pP 8%000>PP 0%000 0 0 d 0 0(SFԔ1 0  @AQ:X-t-------8--0-----T@vʲ1#V0 0VR00Se 0)S 0 0 21C0#10\ 0(  ^3 R VU0s S#0# 00Q tleP 00\  0S 05 LP0  010004K 0 0 0MPQ4 M2 R1 | 000T@ӈڰ0002 R x2 R1 Vp000T@o1_02 R $2 R T#V  10VR  00 00K0 0(0嶈0P 1 RXcT񟗮꼱---------------- @%@#@!@ 1  (00P00000b\00e SCV00VPP000  001L0 09JoCj`LoAjCjCjCjCjCj@DjCjCjCjX- -PUX#0`000L0Sp  AR00U0S1 !  @ 0R:0SS S S S S S S S S |"000  P 04"48#8SWQ    0\QP1! 1 R@P 0S!ԑa(0 (0 0b0(U]! 0U0 0P0 U00 UX5 00 01@ 0NS<: 0 0N 000Q 000A ("(04"400  0:0:00:0i0S 0("(04"40 ;!SE 忤Jo?? -LM@P  P hn p- LM@T`@PK0`0P@1 0T PPd@PK![0(( b!("( 0P0 xjj Dj -L0MȡP@( ` p;l0- @TT P<  0Pl0l0`@  LK# 0L ( 0RB$K0 Pl0l0`0 Pl0l0`T@Kq 0P`HpK 0 H0KG K 0 KAKBKCKHpK y0 H0KG K|렕n9= p-L MQ` 0SP Kp XŸA0`TbP 0BS Ꜻ-l-l-l-l-l-l-l-l-l-l-l-l-l-l-l-l-l-l-l----L---l-l--d-d--P$R 0 P`-iPUJ p1 RFP X 0PKphth 4 0$A 0@h@PT2 @0S0傀@ 0 @h0PP }  0U  0PKphg ` 0Kphnh0`Pg y@cNoDjnNo$OoXDjdDj\Dj`Mo@NoPDj p-` 0 @ !PB bL 0!0e 000e00 000p p-PL+U` @ 0E #10`p)lEj -@LP``P @ 0 0pD 00 PL@k0U: 0U0 *00Ej(l -@`LPpP 0S 80S0C80H0 0 ,`0:P @X@Oo8Oo -0LM@( ,0K,K0 +K1K!PP 4 10 S 80S0C80;K00 R|0p`V&`V# 81W@T@T 0 0R 0 uP80S0C8080S0C80~=j -LM1@lPGP| 0SDs(`GV  0R| 80S0C80ž000 0 00 y`V 0 $#$("(DRD #0}pP 0#!DQD#ap00C0< 0RV P`L"0 S0!0 (" P3"X$00$0: ,00,0W P3 .P P 0(1 R P 40 80S0C80Z00(Kh!(00(0(KoXH!(00(00S(P3 7PW G400 0P 0 RZQ (P@Q ,0 (0S4000``PP0 `L00PL0  0`~=~@Oo8Oo`Dj@NoHDjLDj -LMtp00@K`P 0 0 00K/ K,` dP 0RK<0Sz렕n9= -LMq00@KP` 0 (0 00K/ K,P cP <0U h1 R 0R V1<1 0% 0RCK1  0S' 0S( <#<U0Q 0Q 0S8!(0R< 0S 0S <#<U4U8#8U4U8#8U y렕n`Dj8No9= -L(ML 0 01CX@ (@PT0D0 " Tp XpW00W0SDTR 1T gXP@TD0S 3 R(KW @R0W`B: 딓L  (P @jlp! -P p04 48`G#8SLC*0S010@ fQ:*E@P3 0 0000 B0p P p   P@ ⻵p 04"408#8 $#$  0 0  0 㣵pn -LMP< 0p01 cX80 ʦ(0(K 804"48#8P, @4 0 202x  x "4H00H04 04"48#8Sk@`P 2`80 @@S00!1,(01(D0 408`04"4:18#( 0 :04 0 $#$("(Q0Ա40:0ı0c 8#8 $#$ 4 0PO <0 S04"40 <410?C 00-">0 0, c,8#8 $#$<0 S  <41 202x 0 x G` <00<0 00pW708$<00<080-@Non --0:L P` 40  0R& 80S0C804000 0 00(   Q r \* XP <`Qh @P L0 0@L0P@40  0Q<0  0x Qv r!0?@p, 8 00 F 4^00x000Y 40 c("(04"40 )Y `\0@0x 0 0 %(0)* @p ,0 8 0 '+,p!< 0S;0H Pn EjTDjXDj -LMQR@`p %02K R RP VPU00U0SRF R R @00`eV00S RU 0BP U 00 〭<( 4"4!<0 t <(4"4!<0 0 6S-t0 p aX pʃd XXp I r0 S X Rm0!0bS70ODH0@)H0L@DṧpP IX00S; ٧1 0X0 0ѥX0X0x ᘦ 00 0x 0S0 (p# (t00t0ဧpP HX00S 0X0 0X 0P0Px0S x0 0 |0 @B t0 1R B X40 <(4"4!<0p <4("4!<\0I 0`#P7P` 1Q!0\ aT7`2 S 0S0S"("(\0 04"400 cQ0ՠ0 & 0Q 1("(" 0 0|1S S S2p0 2 8#8 $#$("8S 3|< .|1S' |8 &|( !K^0 :0X! 0RKphXyPT 00|, | Qh pn p/p,pX:= p-LD@P`TP 40php -D@LPpT Pg 40 T0 00h0W0P 7S -L0Mp0<`K@ 0 04KPxPXt06t0 @LD@ĵp0t0yL p-6| SL@P@`` 000<U8#D00S8#ph06 00 0<pN - LLmPPpM @p41@P0.@7 Ja@@ JT  J 0-S00 t0|020 '"(8CQQ?&ڀQ0ü6p0 $1 1h!l!l  00|1|1 @0@0  w x DPl pEj(}.:=m.EjEjB?RjTDj -L4MğPP,  @L0 P T X |!|0D @ H0H0 0`0lQ@ ϡPN \$0D\ \K TP0\  PT0\ 00@ 0P@ 0P 0 0LP0 ,<4P $!$P 4!,.

,0A 07 `-`+0 0 0r /0`r0 7` R` R 0S0S0S 0S R 0S0s Q `P `V &`1P 0S  ·PQ `P ` 7`$9j<pEjBЮ? 0-L MQ@P K00S S *0 `@P#3^D 40PK0h1$ 0PK0h1Fj/p$*o 0-LP}@n0h --LMP0p@Y,0 *Zz (08 S0 8` X(K(`T 4 `Ph 㷛`P7`R P Œ'"(04"4 0 80! 0(  310#101!0S1 202  ( 8"(#(,( .( 8#8"P @"@" ("(0xq4"40,00,0H (@0C>@ P`A`Z 0 8 4G(0S9` 4 4>Fj/p - QLp`@P 0u03Q0S3Q񟗁.... ..P..........Ȗ......l0   0m 0 mū PZ 8X5Pl0L P-Pl0   0m蹀PUl@PPUL2L PPl0 (2(2  w x l0Ll P[l0p P  nPhP-PQll0 T 0S 0S$0S(0S$ 8Pl0  0S  0S$0S(0S9P %l0@< ,80Ht0P00p@PfUeb MP־PW 0m}PL(0S@CP?0pFjFjRjTDjܮ?= -QLM 0S K0S0S P0@ SAP T \  0 0HP\0P @0S   0e,Ej-0p. -LlM(0@Qp,0  PU , 0R(K`VP0@Sp jPf P 2 R X 0| S 0x0 t { H0KHK0 GPKH`K@K |  0 0HK$P2p0 Zh |x 0R:l@KŠd`K0 |x@\PKⷊ0 c0KdK|  L 0h$PWI [&[tHKp0@p (p HKH K@0K0  @KHK0E$P| t o @KHK05$P aCHK@ Kp  pp tHKp \0Pp I[@K&[0(妹Pi/ꠕn-V 4l 0S@0   hK 0啒 @h0HK.PᔔhP㑔 00 00h0 @0 P P \| ^ 4l 0S@0   h Kn>V 0l 30S@0    hK0]SHK@ h0PB @⤧ @0S!  0S 00 0 " L  (0 0(0 3VA@HKH@KGKdKK 0D0 d@KcKK0`0 0, ㉁P80 2  P000x000 oP#0R&@G@0S 0* PV 000ߓ: $00"!\$00B hp}PU}0<00! 000^5 0 9(@  0@ķP[8 R 0R( R 0R @0@0S  ( TPK00  0 01Q/pn|?0pʚ;:= -L$0倽Fj0p-Q@P P*R 000P$, 0,80pFj -LMP)0Kp @႒)0[ !#R)K R / (0/0(0(K%aVT l5,  , 001S %1S ,5,  , 0701S1S1S ,1S Q ( ˕Pk$700001S41S81S 0SN S 0SD S00S S000(1S 1S  ᙕP @ @ 0 000 ("(04"4#0庐(1 0 ! o04 40)[Z Z ᜒP#(0/0(0l00S 00S0 0 0@`000(0C8#8 $#$"2 I 0  B 0 )`[V V` cl"(0/0(03 00S Sx) +0K♑`0+ K*K*0K  0*[48( <"4!<#,## 0000 1S S0 R0 0(0C@0@0@0 R00C@  00C@0@0@ 1 00K(H00,<$"*)0+ K00(0C@   00K000,<$"*)0+ K 0嶐0+ K*K*0K *0[0 +0K0  00080pTDj -LM4 8  +0K`+ ["2S S (00(0婑(K( 0P "2S S | f 0PP`P + ["2S0 4* K~0S000們 04 8<,<$"*4* Ke0SY )Y( 0S:Y )Y p 0S 55h3 R1 (?T30 PU)PU& 810P@T@T W 0S 0R Z 0S ~P$00$0"w040`O0@Y0@~ )YuP\B8 R DP  0m@ D0pRm< 1 00Sa<`10`@  @ 1@P `0S[ 4 t 04 8<̠<Č,ʠ*K) K)K/ P&  048<!$!0!̠ 0)0[p:("#! !4!(0 Kp*K PC័X`P6000Pt@H00H0卐 00 0K000 @@g80p?Fj=jpooNo -\0LP1  0 ($ 00 0^ Fj80p --\0LM R1   00 0 ~ K 00 0=B=G-Mhp`@ h@$ P` L$`\,` , .\ p &`PX  ,$,X. .  lH$p th $d0i ̠x|P la !Q`#<`<4P, x0 ` *L#Ƞ0`!|@$0p $x@0P(@%P @,P0|`P#Tx0&D#d<0*!40 "0 #T4,  (8! pq "0. *@P 0p qS`A8` 0#!( !0  "0# l"p0tt唃l l@匓 la"< P !Q`p`T LDPp0`p!L##t0$`!t@0$X$d@ 0@l0@#D0*̠0 0T0l L0!D0, "0*Ƞ #夒  HP QP!$x`@P0Pp Lb@ "*0%PQ @@ a H儀 0# "X !  "0#x!| 0쁟쑟'x h@|P.<b0*( p `FA %40!!x!!,!P*=B=F=:=J=0 0@-@$ 0@0 0 0 #EgvT2ܺ -L@M@ hK ph( 0 @ 00# d ,0*0 0#`a0"00# \@dȟ0! 00#X@Dlŀ0 0 0#T@$(0, 00# P@ b* 0.0 0#L@0"00# H@ǟ`0! 00#D@̀0 0 0#@0n)+C0,0O B0#  <`G' 0.@0 0#@8@@dE0"00# 4 0$00#0`ǟ` 0! 00#, ǀ0 0 0#nd@& 0. 0 0#  -P@0" 00#<@|0!00# ` h@\Ɵ0 00#lƀT@<0,00#@@& 0. 0 0#  +,@0" 00#aX@0!00# `D@ş0 00#̀0,00#\@% 0. 0 0#  b)H`E0"@ 00#@@dF4@0$00# ` ş0! 00#ˁL0,00#n$ P.0 0#  T0b&P"H@`0"0# ğ<0 0 0#lȁ0! 0#d@d$0, 0#  HX0b. 0.0#L@, 0"0# ğ@0a 0 0#4@ā0! 0##h0n 0,0#\@  * 0.0#P0`0"0#D@ ß0 0#ll΁0! 0#P#,0 0,0#`@ 4 b( 0.0#h@000# L@Ÿa0 00#lˁ000#T@"0 0 0#  % 000#\@|` 000# @@\Ÿa0 00#d@<ȁ000#H@"0 0 0#  ,Ab- 0@00#@@PQdK0P00# PP4aX0`00#``Xe000#<|` 0 00#` \lˀ000#D@? A10N@b@P, P0@ R?W@pG 0 ^?W@P0 W(K (Ko`|@, [| G,0!pc?WP -L,MT  1>?0@0c80 X1"0 @ D <0 08#8H L0 T^!\8 0!pT..l<@ #48 <, D[2K30KT80-KL[ C1PK4KP .KP /K0pKP4K  {U'DP  0#<0 "( 0#40  Q Xu, 0R(K(5렕nFj$c=< 0@-@0@ $0$ 0 0 0 #EgÉܺvT2 -LRM@ ` hK ```aD  h! \ DAhp\ 0"hQToD0#@ d0 `e[@̏J " 0%`0# ` flL i``  & 0$0#p苎dKp\ȅ0 0#X h 4D0`  n (T1 0,X0#pl1 fk{T1P  l1 'lˠPꪉ] 0. Th0#l1  `0 @  *g{ l1  @0<` !Pa n`PdL0%h` j0# 8nP 0 `ae[ #`L 0$` 0# X䝟0 hc;4p|0 Lq |Hp &ˎ }LdK0 p靊 0# pT PlP )fk` p|0, ,0# lˠ 'H |@PY 0.茊0#H@@|0nidIP0%0# l1  H0 g{ ( l1 a  !0`j` 8`|d`e[h0$ 0# АdKLa al͎ )0 0#  @0lc;`0 j0`p *` P X{` 0,pfi0#pH Plˠj[ &8@p 0 .gz "00'@  L0Z48y<0b-d1 LP0dLx n x0fk 0 ̀l1 d1l0g{P x雊0,0  X0 e[ 0  x lˠt a@ t艆X dʟ 00 @!@a@*L1idK 0L jȇ  ` 0 0t``al@qd n 0  h hYt  0P 0P P|g;@p <1  L1Xylˠ eZ @p  0 p T 0*fk jp g|ภ @P0 ਟ0 0 < e[꫎@   00 H1g{ 0 pmvmznܼNS @L❀fm 00@0#@D@H0g{  0  Pl PM舂0na0 P0#    P T0` 0fk00#̎00i$ 8Pl1 X0  P$0 PĐlq dK 0'b,p hQdp` P} 0P `p h 00lˠT1P $Z g{0q 隁 0ppfKXa0 $!@ 0 @@Pa018Ba  n @ 0@ a0g{ e[lp @  0@p`dI 00 0 nb)h0Hr `la p `0 01lip 0  la dKa pPcH0gy  `0`h P 0`l 0` P80hh  e[ 0P 0T P 0 g{XT˄  0 aP 0PP0a8@  0  hDL1fk e\ ᜐ@ 0@ 0h@ lˠ K Xp! `0 l! !0p l0e[p  ab*  pL0<` ༐  0` 0L!`dK 0}  Hࠕ00! b+ ! T1` ` 0e0i  0 `, 0``L0lʀg{Pp a  T P\vfl0   0p0p, pP0ig} @,1lA l1@Pn 1 @  Pfk @P@0H` 0Wl1 0P荁Pl1  00lˠP g{ 0 eZX0 pP `  %8Pj0$ 0#Wh0 PdKPHahnਐ0*0#  gT0 !P`Xj`@pì 0. 0#  (xT1 %`pmnpX` a0,0# @ @lL0 &pe[zlˠ dK 0  0# fk '88 h0  (` T j0$ 0#a`0g{dKHP0* 0# h )@Y@0 P i `LP !lɀ` Y0jfj 0. P 0# &PnPP ` 0,a0#@@ d0yflˠ ``dLp 0 0#]jX1 %pp`gz` `L꩎0$  'e[ 0#` H0d g{p dK0pin0* &0# P1h fk (  ሀ hpPj ̀ 0. 0# !0hq 0`[\b,0b;(! 0`Xq n0,lˠ@ a{  0#T@I`!  0P!` ꪎP$0 P% 0: HQ 0 (夀,`L;] 0p0Da % 0dc (K -0Q^q?`p@PfUpLpV@@Z* Q :@ @0Z* Q* ao}@ } @@Z`* -L,M01>?0@0c80 \1T 08<0 0!D @0 ^.L H0 T0#\pT<!!l##4<30K, 80D[@0-KL[80 .K2K8T N1PK4KP /K0pKP P4K  U'DP  0#<0 "( 0#40  Q\ /m, 0R(K=-렕nFj0c=< 0@-@0@ $0$ 0 0 0 #EgÉܺvT2 -/LaM0 @ lK,0 s1Ahp PaA ad`lnDi4 i80|/0%1  d0 ac 00#l1 p `0(p0 nd-c Hc1@l ` 0(T` 0\,@1 P\0P Q\clD0%X0H@aqbacT\Οc< Ȑ X0' &@0 P,1 T0Q T "aDc, 0% P0H͌@`lcTc< 0* (0X A1 L0 PLx  "d Qc,lDnad<͟H0% &@ H0  "aq@cTcQ? `P0`?SpP`0L`@  gokm@@pb em y?0YP@p q?0Y@P 0 -L M0`P(0 p0K  !62 b1 R<0Q0^ ~?@ Q R W 1  !1P:f( 0R$K I&렕n ?Lc=Pc=G-p1tANO0xA|Q]`QaRoaqp\qhqlfptq唁!x|Qad\\\X !d P _!i!wPQ吁WPaQ^iP#tQp(y`ifWq倫$`at(ᐡi\ |` kX PY ≑ Vጁ xpP唡Qန(媤Rt .HPpP`脐P%`&|p)* dh3ሑ*A) 0p"#l0P`00#@$0@\0! "TX b?  CZ 8@ D0 L)*0pT0P`P0! "80)`*  j 圡dPZ=~1A^_`>pZb1AAa0@,00@bZP`P`$P(`.   p!f?p(P`P^?`0  - 818<,!$00 @! p$(P,` 0Q004@ލc= -pRLP`& @D1>0A W@;@ RpG`@D  Q*H0 0@WH0L@W耀cW.:P i@1@ T@D 9 `phP i@1 0S@DRH0 0@H0L@Ph@1 0S@DRH0 0@H0L@SH0 0@H0L@x -RL`p. @D1>?0A @c X2:PP h@1@ @D  pj?X@<@H@ ?X@D @pXP h@1@ @D Ph@1@ @D 0-PPL 0@ ohPih@0@0D@H0L@0\c= -0L@$M80 4@ < @L H <HH8 4 @ p ` P8K 衟 80K @ 0!D#L"$4%T'\1t0 , &dp xAP H 0KL0` ੡@ 1L N@D@ 00K @ 0!H#HD8%X"('X<x&h0@ @DH0L@" 0 pPP0P<0PP <~g<H00@<@P`P`(KoPPp`g<@pPPg0P0< `PPg -PLM, 0 . U00@P0` 0 @ $#4!,<p,0$Dh@d0dP`` 0@(#8!(8$HP`0^``0(Ko` -PLM, 0 . 00@P0` 0 @ $#4!,<p,0$Dh@d0dP`` 0@(#8!(8$HP`@^``0(Kok` 0-PPL 0@ 9gP3g@0@0D@H0L@0f= -PLM`( M 1A@pt1 lA0@$#4!,<$DH1@A <1 4A 0 @q(#8!(~8$H? ⨁@D( 0 8PP0)?PP@+8f@00@0c8( 4<"$$ (  Qo_P@8f0P0P@8`fP@@`f 0-PPL ( fP@f@0@0D@0\g=G-: @M;0@$P$8$0$$ Q|4q aP,. .`.8.\0.$ a04p Q,@$ @$`$8$\0$$ a3p Q,. .`.8.\0.$ a3p Q,@$ @$`$8$\0$$ ad3p Q,. .`.8.\0.$ a 3p Q,@$ @$`$8$\0$$ a2p Q,. .`.8.\0.$ a2p Q,@$ @$`$8$\0$$ aT2p Q,. .`.8.\0.$ a2p Q,@$ @$`$8$\0$$ a1p Q,. .`.8.\0.$ a1p Q,@$ @$`$8$\0$$ aD1p Q,. .`.8.\0.$ a1p Q,@$ @$`$8$\0$$ a0p Q,. .`.8.\0.$ a0ql A=P0,@$ @$.@Ѝ  $(,048<DG-4@ M;0@$P$8$0$$ QqA= aP,. .`.8.\0.$ a04p Q,@$ @$`$8$\0$$ a3p Q,. .`.8.\0.$ a3p Q,@$ @$`$8$\0$$ ad3p Q,. .`.8.\0.$ a 3p Q,@$ @$`$8$\0$$ a2p Q,. .`.8.\0.$ a2p Q,@$ @$`$8$\0$$ aT2p Q,. .`.8.\0.$ a2p Q,@$ @$`$8$\0$$ a1p Q,. .`.8.\0.$ a1p Q,@$ @$`$8$\0$$ aD1p Q,. .`.8.\0.$ a1p Q,@$ @$`$8$\0$$ a0p Q,. .`.80.\0.$a p0qP*0,@$ @$.@ЍD<840,($   - L cm|g=H0@-@P!0 Q8 #Ƞ 0 ^D0 -L M((K0`"x0i@P 0 8#X "U 0AM00 2K40 @4pK70 40 0X5@P)4 0 8#X00 U0@X(K -LM((Kj"x  <0 @  j@P <@0 8#X "U 0A]@2K40 00 P }@ 4@ 0@v4K0 00 4@00@0`V 8 8 `5P4@ ^ @ 4@ 0@W4K0 00 4 0 8#h00 V0P800S80 4@(K p-LH`P0$H phJ (-"xL` @P08#XU@ (-"xL` @P08#XU@ -LMR`* p0K 0(8,< 0$4 00 , a00, p###Ġ""H"TZ0@P `(K -LMR`* p0K 0(8,< 0$4 00 , n00, p###Ġ""H"TZ0@P `(K -LMS`4 p0K0 0#0P 0(8,< 0$4 00 , 00, p###Ġ""H"TZ0@P `(K -L0CMS `B0K4 pb`B0K 0  (8,< 0$4 00 , 00, ###Ġ""H"T 0 @P 0 0#0Q0S`F0 8<, 0(4$ 0 ,0 00, ###Ġ""H"T0@P 0 0#0Q(KG-P0X\P@0T 0c|àE,80a5, ,E娕0q  A `&0`g`0D`&0& as1LE#8##0A5 nP%0H P%0e as1#A#̠ #ğ0@@$@a 0L@$0 as1#a#̠ #|ğ0`&```0P`&0& as1#4##0Q4 n@$0T @$0d as1#Q#̠ #ß0PP%Pa0XP%0 as1#a#̠ #xß0`&```0\`&0& as1#0##0A3 nP% 0` P%0e as1#A#̠ #Ÿ0@@$@a$0d@$0 as1#a#̠ #tŸ0`&```(0h`&0& as1#,##0Q2@$ n,l0 p$ 0cgqA!Q!1!ĠA 00#0` \`#U0 p0 0cr#xA" "lQ"40  .`40t .0. bs2##̠#(0Q1 A aP&8 x0P% 0c er#@"1"̠ A" 0 0#0a|< p# ` r x@"1l"̠"d@ 0#0l0`#&<&(&' 'Ƞ'p0 `ċ=ć=ď=ē=G-0Pp8` <@ W0 tTᰕW< |0 0cr#E"805" "Ep1  .c80x .0n bs2<ş#A0# #$$ 0! @@$@b40t @$ b0$s2##̠#(0 Q4 .l0 p0p. 0c r#T"1"̠"|T 0#0l0P#, l0 e 0cr#8ğ"0A" "4$0  @@$@a(0h @$0$ bs2##̠#(0a3 a`%$0d `& b0s2S#|# #$tS 0! .a 0` .0n bs20ß#Q$# C#$ 0! PP%Pb0\ P%0% bs2##̠#(0 A2 l.0X .0 bs2Ÿ#Ax# #$l 0! @$@a@0T @$0d bs2,Ÿ#Q # #$ 0! PP%Pb0P P%0% bs2##̠#(0 1 l@$ 0L @$0 bs2#t# #$h 0!, a0H ,0l bs2(#Q# #$ 0!PP%Pb0D P%0% bs2###(0A0 n,0@, a0s1|@#( p #A#d 0! n < ( ,,H,T0 @Pē=ċ=ć=ď=G- RM0 00P@ ^0 <0^0 `80^0 p40^ 0P00\ 0@ |0x@TT`0|dxdX ,8!0LH .Hh,,4 "x0  "x " "t !4 0t xt"<"$,  8!0! !!x!p,8p0!|p.4 ,0  "p.< " "x "l 0!l0l@#40$  "$< " " "h X pt \@`d T0 0P0 SfdO/ O/ O/ O/M/ O/ O/ O/M/ O/ O/ O/dO/dX0  Ƞ `tV` \#l 8p , @^ 0 (KT 0SQ<PY 8GjUUUU=ğ==C -L MP@`pP DHL.$ . . Ƞ,Ƞ  D,, ,4..D, @.$ @$.`0PK p@$,4  0 ,@  v 3 0,40!0 0##$ 4# ""# !"!!" ! 2!26:0#`p4 P!@!4 ! $ 0 (K3333UUUUp@-0` R" 0@Tڌ0 P 0 U 0S 00\P ppGjGjGjGj -00ML@ d0 @mK1p -LM,00,0 < K <0  PU1p -L M TP0@L 0D<@20 ,80@1K ?1p0?h0p8?,1p -PPLD d0SA P1p\ a 10 ^ 0S 010  \00 P   L `0 0@0@ PmedGjGjGj -H0LM0S  0 K1pc/ -PL@Q\pp%`0S! 21C0e0 !   \P0@0਀ 0 000ఠ  @GjGj -0@LQPPppp`0S 21C0d0 !   \ 0  ഀGjGj -LM⸡00 SP@ {1p`^1 @0S% 0"0 V U 010 R010 R Qt 21C0d10 R @ ^t`VX p(KV ^21C0d(K⃁ @ pP ,P0@`@00 000 pGjGj p-@LP 0` R_pQ 0ES21C0dA1 R U 00  Q 0 S Q 9pPVWU( 00  PGjGj 0-@PL 8PQ 40,80.8Q .0h 0,1ph0p -Lp.`P DWW PW80U408@ P.@PP8  h0p,1p -0Lvq0SK RڌPPU 0S00S  0 0ऐ+>PU;21Cel `P2 0@"!B c!V0@cV10 㤐  lE `0 .l0kP0P 0AcV lP gPGjGj -pP0LS`P @VP#:21C0f A 0S0C0000SP P0  0S /wOGjGj -LMpP_ <0S\ 8QW ^S 1P `U:4 R 0004 R8,K P,0K0@#0(0 $K21C0e 00C0 0,0S  0@/00@0 @  P p(W80(0 Q8GjGj 0-LMPN0| 0@Q *"d0!B a! 000@0P  (0 K0_GjGj1pm/-0PGjP0S0SP0S SQ 0S R0000 0 00 000 0-@LP$PL<PLL0 0-$@PLP R0000 0 PL$0 -L M4 0 , L PP ($ 1>< @040K0 @@P@  00$@ @,(K| p-0LMQP` KpL 0@00K K`P0  000` $@  (00(0 ,00C,0(0 ,LbdcGj -L -LM 0S0,0 0St/Tv/t/Dv/t/QR 0,0 ,QRL hg00  0 p101$2d0 0(00S {Q0S$@PP0S@p(00a L 7$ Uء VP, P0S@pP,  X 0@0$0@S (lM$LTL,QR QR 0 P, 0S,0 A0T1 (0P` 0SP`0@0! WP, 0,0 t/D? -8 4(0L0(#Q 00,0hx -LML4pQ P, 0S Q \Pm` S3#@p0CX@@ 0C@S0 0L@0 3PRpP 0,0 N RZ 8Q4H3  'VP, ;Z  ,0 00<  @010Y 0 S 0 000 0 00 000$  (0100"00`< 00@4PP Y 0 S 0,@ UP,  ,2 PL, , ,0,0 0S 80 FS 0, 0 00S Z D0@0 0!,00S *21C0bt!10 @ 0S P,  (@0,0B,0@0!, ,0 ,0S00S,0 ( R, Q 0 UP, Q 0@ U, 0 S Y 00 0 00 0ct \ h X $w/GjGjD?x -LxMds\, ^@$2 @3^ 83^ , 0 R(K3^ 1C^@P =P  50S~/x~/p~/h~/`~/T|/T|/T|/T|/T|/T|/X~/P~/T|/T|/T|/H~/T|/T|/T|/T|/@~/p}/b0StPK$P@KeR$bRVJ  0t0 p 0R0R+*hP p0QrKhLDP L0QfKDLLaHaDa@a 0 p)`V 0SY( 1lK@ TL,, 0RD(K #10S% 0S lK$ ;LlK  lK$Y  l0K[` 0 pR\`   Q ("( lK$lK$C렕n$= -L\M0ɟ| |@, `x pTPPxW 0l W x0@LBl00 -A@LBlu00 -z@LAlh00 -@LAl[00 -$@LAlN00H -@LAl@00 -@LAl300 R@R-L`p l >PQ @z p-L`@Pl z9!Ppp 8 -LM 0pP@$0 4`K3 0#0P\)  0#0#0QA#0P0 Q3@R 3x 0#3JA$ 0R K [T렕nD=   P 0-LMP KH !4<"D\0 @  G=z K0 -@L GG00 -@L GhG R-L@p`l A! BPP @ G p-LM`0P0 000S0A Q B,@K 0*0 0#0Q@ 0RKp렕nT= p-L@P`l H pp  ` p-L@`Pl 4X%(pH h 1 0- LP@ lP PP00 0- LP@lP00 -@ML0,LK - ML̀@0@>K 0X 0T -LMhK@P@KpF 0  0S2"Wh@ @0 < 8 dP @l P A "0@ xŸX  @ P TP >\P.@K` KP(d0ST0T0SEVSl `P @ 0X 0 PTP WUAl lP 0 S  @l.0 @SWR(KI(1!@0 X T@ @ HP0l 0 >P W- H0S$ `pK0@ aF000l`e0 pS 0PU :@LF000l`R8 5, 5Kj?Kj -pLP 0   R`@0 0` 00BN@ T000@-pS`P @0 000   000 000  " @Tp@-`RP @0 000   00 0000  @Tp0@-PQ @  0 000 0@0PU0@-pR`% P 13 RP@0   "  80#440# ># b1#  @ 0@^ 0-@P LX 0#40 "( 00  0#40 "( 000d= -(0 $ , 08 40< 00JE -@Lz IE02 -LMD4PK0` p$0 8E 4[  Z 0R300%0[0%0K–\@ 4[  V 0R300%0[0%0K 0Q1 0Q11 0#P1@1!@0#T1 z>$ 0R. K1 0#P1  0R300% [x00#%0K  0R300% [x00#%0K렕nl= -pLP`@~Vz_1 0#P1`F dV@  Mb0`R1!~ M20VS  21!0#P1z_ <`h@ } -LDM⬀0dPK`$0 p%@ND!MD@0\0#0@@T v r [=$ 0R Kj렕n|= -LDM܀0@R@$0 P`(ap P 01dPK@D! D@060#0@@TF 6"=$ 0R KpCA+렕n= -LDM⬀0dPK`$0 p@C\ C@0\0#0@@T E As<$ 0R K렕n=0 -LDM܀0@R@$0 P`(\p P00dPK@C C@060#0@@T <$ 0R K\pC@렕n= -LDM⬀0dPK`$0 p@iCX hC@0\0#0@@T<  v<$ 0R K렕nĪ= -LDM܀0@R@$0 P`(Xp 00dPK@(C 'C@060#0@@T <<$ 0R KXp C@E렕nԪ=G- 0M0|l L\ ̠<Čh4x HX $'4%Č&'\(l * p$́  00Q >0  0$5@ 0p RT001Tx?>   cp i  0S0X d @JTb001^ pQ?>   cpG C  0`0CW^ Bb   R 01Q 0110l1X100`1$ő\ 1 0R 02S\0 P3Ѝ 1 >0   r  R 10 01 -L$MH L  p ?ᧇ0OO^P`1`>PL 0  BSLaeH L08`0?>   cpH 02ᠢ!08PL0` p2RLH `08?>   c 02L!07PP| 00`1ɯ D @ QL,0S PQH 08 bS180 1, !1!40 L00 0,<0 h1< PoQLL `0Oς  1>0PO>p@P` Q 804 \0 0S. 04  0 S ^,@ 0O QD  RH  0| ?(KLH,0p S0QJ 0H 0 U KjH=$=8?P??? -LM ,  @_ 0|4  0v0  ?n40 0jD @ <  IEP<4p0@P400W D 0TALCB<4BaGT@!V`Z4 P80 tt80PQ, 000+EP#, W<#E,Q!, , R Y, L#20T 0V0ZH3,p WYULØ0T 0V0ZH3, QoUYL20 40S02 e04@ TUYUYL#40\R04 QGU<0<000D`D}~,@D`TPL#2 P ^04pW00pWPT PL# Q04@T00pWPP (KC cB SV@QVS 4 0 0    B ? 0@3C L" 0p0C0\2Qj d08<S c>Q SPQC ` 0 02R^ , 2P000 H0 0P; 0IP L 娀 ?D @0 A0PO`sPK&,D K `p \ \ D K ` F.0PX T `KX X`T0,, @?ȄHp00C0 0,RT0T!00C000 0<K(KP00 X 0  H , Q?8 `p0< 8 P`<8`8! a, QV.QV1 4P@p3#U T -LM0 @00_Bd @PR 0 b4Q0 RPQB  K An@P  <H 0S 3SKi iU -LM `@,0 Sf"C P, ? |1HP 0O0@ CT1 AR\0?00S:p* 1R\0?0: 0  00 W 0p5 p;0@4DL# 00* 0 R0 ,j(K 0l@=S X   B ?>0S@3CL# 20C 2 0 1jU ?IJ?p? -LHM\ 8 0pSPo0@0T8Z8Po0LO P` 0OVʲ 8@<4 S?ᜃ0 @8\00 P4 7H 0O0@ 8 ?σ8`00p S 08'8S`0`0`QωX 0 !00`D  @0 @@40R<0 8 0>8PT0ZPp$P`p6^`0/ 1> R,6@^`0?0 0,p0P`W $ 0 $ 8 b4 D0@4 DL# 00 068Q`0 80/0cQD0@@< P088P`0%X3Q@_`08 0P+8@004(KoiUJ\ 80 0L=D!} \P 0,4 08 şR\p00p  0(K8p$8 `$80@_ P L×8 n     ? 0@3CL# 000\@4Q d0@SA 4R 820PuWiA8`@dA80vA8 0P YA80mA000 `3RT0T !000l84S}`06C cB SWAQWS3 P`080!P 2 8R`0 0 0 8"   8P ?0@3C0L" 000\`2Q- d0@_X@ TP S c6Q SPQCX K  1R] 208p, 0PP0 Z8X K Pd ` 8娀 ?L H0 G8@P0`OdKs&,L K lp h h L K 8` F.lKP( `0', @?ҁP000 0,RT0T!000\p8 0 8X P , 0 P 8X Pu 0\8 0 ,(1jU ??0?\?H?Th??? -L,M D `DL@ pP(K D P4 H 0S 04/ GP00a0 S0X$Q\q\0/ Q C2P  4pR\0/ 72PP 3 ^\0`ω1/p0@00 ,@ f 0p@WXlshWP ?b0 , 83,@^\00 N1/0L@ 00 R!H \%2R> p2^ 0L1/0 H010  B ; 0@4D@@L#0 0 Q0C0p 4agWd0D 00KLeH0NL@ H 0x00K<0 x ? 0 SʲRt0\pD 0(080 ? P  oPOP`p?<?`0d/ , l1 \00.Q`8``i0pH*7x H0R P-yPx `R\x00x0j   ?> 0@3CL#@000}0\ L10  ZD0 01jU ? ?T̳?? -LM4 8 8PAP(K48 P, H 0 $h0Q 0 S 0S R BQ0N 0R P3,d02SQ0 Po 0 8 0OP>  0l0p0^  0@0S  P 0  Q`10 0O0@ ``0`8 V@p 0@_4, 0.T/ Q8@ @d_0  `00 c SQ QQ0O@0 <@ < O>P@` ` PPU`%<0`ï^P`1>AU80pV,f D1j0? -L0M L `LLH PPT P0 00S  L PD H^U #0O0@00S T08U ZO 04 R40 p F0SFp W^ T K D@ < 8 Z?n `0 , 0 K 1>0 108\` 2Rψ0O0K` 0@1 >00Sc 0@ <0 T Z p T K p|Q8 4 }Z8PK` 1ψR` 1> 0 #0P @` ^$  j$ 4 D0S@4 DH0L# 00j 040Z0C40  j! 400400L8@K0AD*e@@ 0 0 R#A4b 0@ <0 S 0@ <0 @K(K80,@dYn \^ 1/X`0 0O0@1>0 AR!0 \ `! 400C40 i! 40040T0 RY3 1> 020$  B$ 4 D 0@4 D80L# 0 ^0C 0  0Rυ0O0` @1 >004d0@ d! 400C4000 c! 400C401jU -LM080 00 @P4P @ß 0dx (Kj  V ,0P* 00 ,0 $< V H#0S0C0ß0 K 0P`p40 8 L0 Pl0p 0 R RPn 0   R P 0P`04 H`U 0 Rl 0  P  00d0X0 0 QN 0P R R QK 0P  P  Q9 0P  r 3R QM @uP 0 Q P0S su0P0r 00 ,0 |H#0S00~*k _ l0S sY0l0V0h R 0l  r 30l R 0l  l  0 Bh  0h Po}@ @SPQP#00d0  c6 0SQd " 80O`p X_000K n ieP' 0 S@P0(0SK ,D`H K@00,KQeP,0 H0@_0 ^,%b0+`0b00H00 f4@000Q 0l/Kj -LM $5S. @pd`  02 f V@ SQS K @0@ P "{  10Pp7 K X\\{\ (K^4KKx0KD P0K Po0@@ 8K0K3 P4Q@K00@ P p00 80S 2 K Zo㼠  @K0@ P?@zŸ0 ZPp_ Z1P` OP`0R` R80@P0p0Sp A0S_ ,)a ^0S] 0!aZ&`pQ d0 c> @SPQP#00d0 c6 0SQd " 80O`p X[000K n BdP)  R @P0p0SG ,_D K@00,K*dP,0 H00  Z,`0_0`00H00 Z,@000Q 0l/Kj00 R 0  0S Kj M-L4M00P S@0,0 0P0 SH  `3Qt 0a0S QARQ< D?@Ğ@c.d 0Py0@0S@TP 0 Ry P1 0ppe @T HP00,K  cP@ ,P ^0,0 P@(K,0 < b4ɯT L0 P  0(P@ H@ ?y @P 0PPD@ .< 8 N P 0 R P0 0 0 @0@P@0\00 H8@d0<s c>rc, SqQP 0P  0^(0 ! (pǏSvP0@0  @H @ß0U@ {H@<4 Sʯ H R|Hd <@D4@D_@Ĝ0e.H@#y 40`S H00ßD P@Q4 0 Pl P 0; VP@ 0 R P 0 0 @0@P0Q00 H 0@d04# c4?\l=?H??/P?t??? M-LM`  0 00SS p0S `3Q 0a0S QARQ< D?@Ěc.d t@0d P&x0@0S@TTD`  0'PP"<4 S<7 0 6@ Q> 0 R5 00@0@000 (K#3 P 0@ 0P84S 0 ?wS h00h0P  0&/dl=?H?? -LFM P 8%@  \?00R 0  P4 UR00 0a QUQY00 @QP Pb0b1re R1nQW@yY0g00Yu,K 0KP Q, 0 B1, 0 PP \K `p 㬠K 0^ 000@K@%aP 0HP, 1P 0 R0 @&& @00S*@@5L 0`UP崠85@L 0 0p`V\ ^ 00 _P  0<`0lZ \KPR < @0 0PU, U yZK 2 Yrd \ P l 0 A2 oSQS 0su0 0O$1 A 0@1 A  ȟ%,AP h @!_0@Pp@ PZ^4\^J \ 0 @@@c^0 00 [PؠPEZP @^  @00PPPI^0 0000;000Y00;000Y\'0@   ,0PS 2K@00^0 00P;000Y,0@S!Q"@P00\@KԠ00\PU To0 #00S@0@   0 0 $,1000 @ 30 0`@0p! 0S#Q d0300 H<,+00@@07[P 1 @K0@PQ000ܠTK ؠ 0s Vp 0c P0@ 00 @[P E qVB00P @ @b b3a R`Q R\H:D 0`( 00@_0lpnL? -RLMM@ @0<0@@,00@408@ DP 0 S/ 08 4! 00S ,0 Hb#,0<@ ,S P 0 \ 0P`0Q ,a 00P @@b b3a R`Q,RVi\00  85@0L 0@08 4 0@0 @,PS|0! (/20! ( U-000  0 ! p0t@ P 0 R0! ( @ 0 RC ! `00@Pp 0 RZ 0N_K`P`0 !A `gPP@0A#O 1"1?0P HA`p-8PP`# P P 0 r3p1>0 R! "A@e0 0@A0#O 1#"1?0P01 FA` -L$M p4 P<0 7\ lQRl \@ R^Q V0 #4000400,K0 QPP<,0Q<4 ,85H 0 <0, (K,L( 0 0S80 & 0H D 00@@,@^3*.D RH0Q84 Q0085@0L 0 U0H D  -L렶?\5XX SS 0 R@0Rh0 S8P0!RTTcKjC-0 LS03Q% 5p00P5,5MS ڬ4S9Ӭ4հ4S@0Ӱ4Ѝ0t0/Oq,,REQ `PNo,P`PLH0` 0`O/0U4e85X< 8P 0` 4 @( X0<0 8P 0` 4 < KBb<@$0#= ,K ,0P@S ? 0P@ 㗀W@ =S P@(K |p[0?Զ? p-00LS@P0 0h0S  i`P p0  P _ip -LM, 2 !\5SS0 74d 00  8@_d t,`p`p<@D_@,c`Vp` p, ,0C@$0(@[`4P8`,P0`b0(KTT? -$0L Pp   a@P`@0 S@`V a@P  <僀0 0 @ -LM$0 bp PUMT500#0(PPP@ $KPH㸜0@x @ C 0@@d 0Q ~PvgL囜㘜㕜$0 B:$0 -L@MRx0\ X 0\L0 0  < < IaP (KXhPD7 X4\ @\0< @@pd\ RYX $0 0@0 \0}PƟ(0K8 #H`0 0PxPR8@t8 I Z` 00:00,G, T`/:LP ,6H@ \%R  VWP x0@@,PG\ @ \0R< r}\ ~P0S PX BwP 5-0RP5 @ RX$0 L5@s00!T  O P  YP h P0\%4RPP00 0 0P ,0Hh h0 S, 00;00,&GP0, 0 40 40PA4= S54ŀ4 @0@40@x00 40 B 00   0 R x ,0H0 1@ɯT   00 R 0$ 0pǏ0S#  x0@S,0 x x@ 0P` \=P R ,>@(0c c9b SaQSP``(K@ 0 R) 1 0pP`( B b5A R@Q2  Q   00St p0  R 0@ T |  PK | \ t@ 0 R @0 0ppp ,0P`P`WX tK0t p | @Q00( hß2 b91 R2Q0@( "0 P8`H0 0@8< H0L@qu2 ,00,0<PP =P cV ROPx0@H, 1 0R00 @  ' R$ 0$ 0pǏ0SR @\ ,0!P` P`Q0S1 0@0$ p@0SR\ 0@H ,0P` P`Q0SR @PP 0 0,0 S1R U 0@H, 0 0Q @PP0$ p@0Sʭ0@0! (Po010X ɯX1 !0 ((pǏnlp -L M P0  000S P K-\0\ 00P P 0 S0SD4p@4p R0S  0 -hpP L`@" 0 01 R R 0S0S 0S00PPD4p@4p -0儐倠L`@p0 0PP 0S0SP 6]PPlpD4p@4p - 0L0 ラ 0BD4p@4p 0-PL@F 0P\\0 -LM@PQ 0Sp sQ 0S\0S00S L $0@ p0  0P! 0 00 0p R0(@ 0@p0t@0 000   -L@M 0H QL I 0YIDpKP`(1@L,K 0 @`tP+,0S(\% P 0L (Q  R0.SR 0.SH0P 0@P`Y X0P(K0YXlp -L8M0P( @= P@: (p0\@ K07@`P0 `pt@P(L0( R-0[.0[S"[0R4 0R R |Z(04L( K 0@P ( T (QjZ$K@(@lp..? -L0L(\;;nP0D@ 60Ql L0( R0000000@0 @lNl@00H @0R2lH8 wm060*0|Q `d 0LQL `  lNl0@ 0d ;;S dP D00b00,Mj8?@oH?- -LM0@ KP00 0-LMP@0 KP 0 R 0S P 0R TF00 8 0S l -$ L0S00@pl 0-L PD @NP004  0 00 0S 0` X  R R  0S 0000 d  R E00CSت0Ъ0Ъ0000(0<0 l00 00 ;0 <0 00 00 1s s s 4080<00 080 080PMj0Mj@Mj< R00 0S00<0@Q 0 R0040 bP ,0 000P! 001@Q!0001 0,0000@Q 0 S 1 91 -LEMŸ` , @00i N?KpP81P 0S_  0S00t 0 R 0 0  p  pPQ  pPK0*000`1"810  R00  0 0#50S Q00t 孎PT  0pP9MOK  8 0ppP,0 E S810  0S00tt 0 8iS gS, 0R!(K ZS| TS00 00810 8HS zP 0;0 ꠕn :jo= -LMPp@0 0"&!R0 :R4, 0 R00(p U`P 0 00, 0TTP`0$KS40040\$ \` 2 1C0 00 \` PKR- :j;j p-L M0 0S 0P`@P dP@EKp0P` -LM0p,K嫳0 R 000  0 * 00 0S00p00 0 0 R00t000 0 R00(0p0H0 0 R 0  0 0 R000 0(0 0 R000D0,0 0 R000(000 0 R000@040 0 R00 00080 0 R00$0H0<0 0 R00d0X0D0 0 R00l0P0@000S;$0 SL084 $0$  0 Rb 0 dkTLPP`0 \0T0X@$K00 0 R^ ,0 O 0$@0 0 RN ,0 O(0,@\0 0@\0`@0 0 R4 !0O004@000B0? 00,0 00 ,  \0 0@\0`@0 t 0 0 h0OdkT0 @0 0 0 ,00 ,001j 0-LM08 PR9K⢲0 R6 00 00 0 RU 0 O 0$@0 0 RE 0 O(0,@\0 0@\0`@0 0 R+ 0O004@000K00 000 00   \0 0@\0`@0 H 0 00 0 0 00 001j p-LM0`8 PR9 K,0 R7 00 00 0 RV 0 O 0$@0 0 RF 0 O(0,@\0 0@\0`@0 0 R, 0O004@000oKp0 00 0 00  \0 0@\0`@0 H 0 00 0 0 00 001j0   q0   p -LMPp00匀0CSB0S q$ 0`x0 D ,0 K0S@0@h`P0s0s<H&@`r㟍@2`004`;00㒍@1`?0h⯃0h 㰃0 h⪃@-@ 0 \00L0(0Q S\  0 p @詞\(h0S  @g -L@P"L <b@ Tl)0d RV @c@0@)d R) @ 3c@0)Q20(d R@0 <a @<cL1D Pr H@! Q\ RQX  T[P!R8JFDTL &@P0  NK `>@POHL80PL1 P PP P1L 0RT0RN  0ba8!0p03R0S;P30S T!T 0 0 0@T0DA 0H T1 0: S000 .R <b@`<KoH1 0S0X! \1 @! <b @O 0aT!P0S^ L 0 PL1  004400S* 0Q PL!L00p00S P! 0 RPP00p00S@R P1 0: S00SV P0S(B@P 0 LT 0RfXQ L! 0S  L8%0QQ@L!000 RL1L  000000LL!000L 0@P L0 0C0 RL  000C0C00L!000XT\Q@OT!H 0 RTT00  X"6"6@!PL P@P7\Q7 @!RL1  B P00C0 R L 00C0L000P! 0 RP1P  000C0C00PP0 0081 P@0 P@PnI80 m8zI00 0 0 OK <@PJ<\o PT!`Uo \1Sj mV[IU<XIJAP 0: S00P 0 JMOK T 0@P X1S L0 0C0 RL  000C0C00L!000L 0mI$'0!QL! P H1S@s b4T\Q XP 0T@!0@L40T T@000<xL1 00C0(P00C0'ꠕnخ=й?????`Mj -LMq@`P 0 vy \00 p00R] P 0 \w 0, 4 0 ,QppYpkP (K 04Kpd  dk 0 R00t`` 0 R00p@@JPO W 0 R00t 0 R,00,p4P4KJ 0@-  -%\00p00S\00t00S  NP\00t`` 0 \00p@@u0h tp0,0 4 0 4K 0pP  P 4K 0pP, YR0000Q 0S 0;0Pb 0S_ 0;0Z? -@P 0` R00p00LQp P+Q 00S  ( 0 R00tւP  0:0*0000004  040#0S}O -L MPp0 S`0s0s0s $0sH0sL0s@0s @(KD0sW L0$ % 0 Q00p00R ᠂@P 0 RQ 0X 00S 3 R@L0$ \ @Q 0X D 8#8RQ  d0X0#8#888d0X0 0 R$d0$X000d0X00#00D0 R@ 0 R 0"X  R R q L0$  0F@Pp 0 R 000 ,@ 00S@v S S  0@Ph 0,@Se:` (0sv L0$   0S00p00Q @P \0J  0q]@PC00s000(0s L0$  0 0 00(0 0@P(q@ L0$ P 0@ k0d J @0d 00.Q D0 D0d0X0W00 S*0X d  R ] 000 ,@ tqi0sV`00sn -LM`@ 0 P00tp  00DK0 R 0 P 0p X  R R 02& L0$ P 0 d  R  0-L^ P 00S \ R 1S1  01S  RZ(@@ 0@@"00000 -L` pPQ @PQ @T@a 0PP QP@6S@S  0PP@ -L M @p0S Q#0 HPA(k,6倢 0& 0,K6 X+P2(K,0aHPQ8 8000 ,  00* 0 R0,& 10C1,'(K ;<,0S$}, & ;uT?t?(? -LM;  ?H? -LM @`0PQ $0: q Kb,6r& 0 K6 *P$` 0H \1 100 1 , 000 v' %;6 됺?\??? -L`M` @P Pp, !l`(K: S1 (@ (0P  0P ,  L0 `P30PQ !R/I0 0S00505 0d0 oY ,&0Qp0 0^  \   0˄ 무?? 0H4p1j̺?? -LM @p ` RP  Q 0R 0W p!:(@l6 `Pڰ6 $ 000W $`ꐵ??0 -LM @偂,Ɣ 0PQ(K 6 6,K )PW,60 RR 4 $0`a00 ,0HpY P _ 00ab P 0S =  0S7  \P 0S P0 0S'  RU 400cQ`e PJ 00` PO 0\HD,l$1P!000 , B 0 0C0&,&$0"}U 0Z1S101P!P P 4a0I ` ]PP ;40\ 02 P!H?4??? -LM P,剢@P40 (K6 6,K )P0 Y,0@TH% (!\1@0! 0,0C040* 0C R0,& 101,%( 0(0T0 0d qa P 00`A@ 0Th?d#p P0`  ;400,#10??X?x? -LMRP`0 0 0V0 8K 0KP 8 0 B18 0XpW/ HK  㘐K c# ,K6o(P ,80H QAB T  0~4K  0P  4pp40 06'0 63O0@0 <H 00 @ 0%P  2Q(K 0 h  q< ,%T0 <4K 0 P x4@ @80( K20h4  PA0 ,$6 PPP;'0 6 3O0@000(K,$h UGA0( R 6,K 'P w,00(0 4K 0 P  4 P(0006 & 0, &402O0@ ,0<Hl,0@,~"H0K S`# *@` 6Q` R0 `0P80SK 2@6&, 00P;00,O"80@SVv 04C0 00 0m,>"j  0q4K  0 P [40K0H0 6~&, &402O0@, <H,0 @ ,$P 3 D0K0 H0Kp "(K@6pD,K'PM, h0H  ,#!  0K6 &@P100 0 ,#q4 X 0 0 0D0K 0 a 6 &0 63O0@,{#00<H00@P0!@ , ? -LdM \0  00 R x X 00 L Zt 錐 P|  00t04@| ,K/l0KPx :,\:! (0( 1S@ Z* @ T'P|0S#ڰ10$ ,( P0p`e | ^ ,(0 ( 0P 0e 0@ Rx(Kd0 L10\X, Z L0Kxpp0 p Y@[ TN W&!p 00t 40/v%00p M p0H`,\00Y0S( Z& $0PU"*@| R0 ,0 S1 |0T H, 0 0Q@@$0PS,p 0L S,0 p W (0 30@O/P(00 3)O0@0 Xd0d  ,  , 80 0@80<@@P  x@ i0@elpn@-0 : Sl0@@0@- : S R Q0 0Q@l L0S d  0 6d 0p0p -L4MH L HP T0 D PF D 0F$!0 S T^T lHL0/$00D}8@ %2 P `,00,08H0 0@H0L@8< 00<8 9Q00P0O0@W @PT0HS࠳@ 0 < D tD0< &@"D@&0"!h! B !0 <@ DL6 #`@ Xࠣpc4 *1@@4 PU  RD0&L0,K"HbP0,040 4 H48 4 `FX p@DT 0?^00S <^( #t40@(K@1S D F D 0B,KH $00P0400 <,0^4 00 ;00t q plpnĻ? -LM@LP$  @(K4`Kኟ0 00 T@ 0 0M!0 000 00P(` 0PEpA$M@I,6 6@C,K6 5$@P10,00L RHP@$e`0P : 10:7+Y , @UP \0 0@\0`@0,, 1j -LMpRP }00 0BRSvRv '  W(   X 40 6` 6PP7 c SXQ,K/ 0PPN 0 F*s0t,0fH},0<@2 , V W0``1 aN0 ` PRQ0G0/,K0 `P  rs ,V 000  0(K  L0( 0OT R~0Sz((   f0O0 @030@ `2 PT1Q&  PCl n(K< d4 0<0:08(峢iPg렕n=?? -L8MH HD D 8 PT D00@T T T  8 T p X@ 6O/ P` P0`@ V4 P D00S  P R 000 Ru:q TP L 8  0  Q< P( Dl, @H6@0aX@@ ΄0 PRj@0& 0Sh ,0t03U0SuT000Qo @@06&iX!X<< 4 0n<H < ^UQ T,K</ 0IPPK`@0T@P2U0 T;PP9T0D Sk0S*P(K04P0Q T 0EPUdP,,Ty83T0 6 P`U. P4P H 0S 0ST0 0;0U 8 HPK 00T40 0c@Q  T V P L? K4K L0S `0=@K.0<0K8 62K 0C3K L0S `01K0@ 0 0. 00 K/ K@  ,0@FpP L0  00Q!/,pP 0! B! 01000, ,z000  7pP ,00m olp`? -`@00LSPCp+L L0R C+pU  DpP.0!R# 00 CpU  C !0 00 0pP 0! B!H Cp~C  pP o -LhMP @, 0 L L0pR` ^C,0T x+,Pu+SC,0, (K\ L0R0 0 ,0   P\  DP08h t !R| 00tt 0 o0: S\ X  ,,0P`0 hd 0h! !h h0 0[PP Y 0 8CPd0S d@+`+\ Rh@ 0000CPh0! B!h 0*00S$ B*,*b,0`,00 0 0N 000K h 0-Bi0 .Rd 0BM  BH  BC0 0iAP 0B`X 0R^ \T0 Qp SQl  Zd R,*`h :P0 ; ,K !P,0P`0 d dQ d `0Rh0R> 啽 0%A, 0p03R0S+P#0S t0hS 0 0 0t h 0X  0\ 0+\P0Ql0 p T0  0hB  0@d0h 0R ` 0   0 R `0R d0Rd0 0: S p0S `h MPp0TQ00S ` 0! B!`0*d@p Q10C1 10C8#8S1k d 0d 000,)00 0 0N 0K j0PI h@0YL0 e p R`L R)Y0)A+[`0h 0RBl R `02!R !`` 000` 0Ph PH l0S `@0! B! 0婼pQ+p堼` d rP d0!R\ Rc V勼B\t凼l0SP 010C100000(s[)oL@HK! B!00 00 0 0 @0 0@/CP60[S#[0R    0T  0X 0C0< @ 0 0@ Cй?x???ؾ??lp..? -LM@ 0PS, `p0s0s0s $0sH0sL0s@0s (KD0s! L0$  0R dP 000 0D0   0000 00l#00D0 R0 0 x L0$ x娀 0 y㬐SX cP0 S R 0000R㨀 0S 0;0Q 0S 0;0p 00S Sq So  0p;P(0s L0$ d 0R cP \0y ,0 ?Pr00s000(0s L0$  0 0 00(0 0PY`v0 L0$ 2@ 0R mcPI R 00S  O@9cP 8  0:0000   40 0L #L0$  B^q{0 S  cPRMꨀ0j0s6f00sz -LMp0`$KPˈ0 00$0 00T|!0 000  00 0:#:0 10 00 (0H0 0 ,( 0 40 0 <8 0  D  0000D0 d0@000S;$0 SL084 $0$  0@+P L0  \0T0X@K$  \0 0@\0`@01j -LM 000 %K p- Px0 @L0 B`P 000Hq0(@'00`D(`pL:jN -L !Q 1S 01 0AS 10 ! 10A0(&?4? -L !Q0P? p-@L !ƌ\`"S  QP P 0 y  `p Q0S  0  0 00`p t??? -L`$0 L0b#6H@ SpTQ&0@ P PA TP\PH@0!PR00R0S0 !P ' \ -LP@!ƌ0C  0S0 !hO咹̿? -`LVP`PV@p$4 0SPP 00 0A S 10  ! 1 A 00CS0 UX01SZP `FPU -@Lb [P  0R000 00 0 p-"fL@P  00b0fS 0S 000  p?? -LMLp, ,P0, a@T; 0S"4PU(0 ( 0O,P ,P(K l30A0C0 ( Q~ x3,00,0 PP  054P?, 忸p?x?]U U`NjNj 00 0M0Ѝ -LM4<0 ( @8  L0@(K800<40 #40#"B P0 , 09 0cP` 2P0#0 e` p,0 @ :@P`, @0X Y@| 04 0 p  08 0 P<pX@ L8 0Y0 @08 L 0L0@ q78cj? -LM 0@S_} 0St\`/\0 R000  (\hFR0C 0{Nj? -LM(àL pWP`P1W 1W V0S0:S0 :@P`  0ppap_\PUPU 0S05 00$/ 1| 3\  RP?\ R  R 0S \Q &000S0 00pP \00T\ 0H0 0\000$[S{08cj`t(t(NjNj?Nj 0-@PL TP000 )S  0R S0000008pPQ |0wR R -@0LPp @0 + @P4 0$  cR 5404 (@ @W( @|0` ^RP |0  0|0|0l {|00 00 @ @P R @ 00X= -LM` K@P P. T$pK2%* "P $0T: $0SD0S h$0#&R :0R*0a"!B10b)JVKn ۮ,p? -pL@P`lR hDR -LM0p00 `R 2 801001'(0!Z (B000PUS 0 `"0{@TA V 0 HalPS000@T 40S m@P@ 0@)PP2  0 Z0 00|K(0@(C(0 0,0 1Y;(T(K  050!zy0 '000M5 0 0 841041)T000,00"D00{-T  , 0  08plp??? -LM@ϟ @,? \ : P L H0 PKzP <8\ D0Q  S 4R00  0 ( !  (\   L10 k \dP0<.L @$0 a 0l!vWp!#60C LSPWP  Yܐ   @KHa 0 <@ P0S00S= Y WP``PP @T (040S0Qd V1Sf < ,0 a f 0O0@P@Y 1   gZp:0p`P0 0S' 0V E 000   @P 40S(0! P0 ` VP zV P00 KAP0E 0Y`E0 V 0P p"\00S40 w 0 \ @0  0PK K P P@ T (K +0, 00< 40  ,P` 0 0cP@ @0,K 0 0K ,0S4 2 Z-@`PE 0Bs V4  X'$< 0004P0 E 00Q8 0 0 E (@` VJPP0 W0PKQ  @P04 `Rv  @)p000 @R000 P00 Œ8 L0P  0 PKIȟp h0R m3@lLpP &000P0<0RD8 \ 00_PKPKP < 40PK@0009L0D < PK40 &37' 0Sd'1014pP  0d'@P 0PK h p0S 0002@Q4  4< 40#1X 6 801001ZypƟ< 14`0140 @ 40S(p  (p P00 Œ8 L0 Pf (0CE 0PK şp h0R 2@0S 0@&pP3 &V040`0C40 @((@&pPA0`\PK  0Iğ 000gPK b`PK\@PP 4| 0&`P^P4p (0%4( !PK0U3Sp h0R (00032@2  0&`P 4(p%H4 4(0(40  @0 06* 01*4` BvO{%(A<L 0 cH000C0m4pj "101b%04(0(r4l%00 <L 0 cH0(p X2PK 8A04 4Ÿ<0 00, 40 LPPb0 P` ,K,00p 0Q40KPPo U0!v@ P6!%PK  0cP0(v49 10 14(0 v4( 4%PK !0F000l1@k v4K  0PK7`1@_$(4jPE$(0=C PK 0u48=???lpL?@?(?n4??PK`P`YP@TI4(0 u4$4(@<L 0HcP V  PK0u:$(0  !(0 Q-L`pP#*@JV  0P T   @- 60@004@ 50@80<@ 30@ 0$@ 10@(0,@ 006@P0T@8p -LM KLH0#&R*0R*0a"!B10bdp,p -0L@TP" Pp` :S0 Q *Q@T 00" 50S0SP@pTV T0 RZ 0 $0m$0`U 0ꬥn4Oj8p 0-@L$P0$P8*38Q0Oj -RLP`8A $$     0ol0$0F.  . Q!$, -L΂n^P`Up*S N@o $Pe 0b,0 h$ hdpOj.  . Q$: -L(M@ .  ^P U< p#: (K$ P e!fV8  @,K , 0S0R*@VX $0 PP$ @TF (18P  14@K0@ 4 0@ `7%P)4 R @Q00000 0J8 >4 R|< e<@ UP 80r8t0$8 A 00DXjOjdp -`P@`N@ RL@ppK. 01@KOj -p0LM R \0+ KK% I녡+4D K8ppX? -L M@ p< Wv 0G#[*qop1Gp`00W40 O J$J>00>0ㄑSP1X# X00 U0S: 0^P UZ3W@2 ,K40<  P0d,S0!@ 80 b0@|0`" ,00K  |0# 0PX80pcW@(K0|0|L 0s|0 JP000JOjX= -L M0`SpP6 0SB0SS4KP40 0 $*@,KH wP 4,!&R* P0R*0`"!B1 b 0 00  000 JU _ #0 00S(K0rp@Shh 0`S00jS r Cdp,pt?:p>00  0 -L0MD  DL 4KT4 0 @ 0 S00R<0 VD 0 SR 8 < : 04\? \< .s`p0,K@ 80,  p00P0!4@,pT 8 `,:,0 @T D <0\` 8v,:,0 @Th4KM#(KHAR0S 001@ s0S 0SR4K2#0C! S, 0 0 0Q @ T00 rRD 0D `S p pD0RpV@ "f D0 4K` p"PO ?dp:p:pT?lp -LPp`N0t@R 0R 10 P jRw%dR*m%Oj:p 0Ex1Ⱥp? -LMP40Nl@T`p(KX,K, Ph0   5P, 0 7r0<:p'? 0 p-LM΁X0h@K! .`'0 @P0 ` PKp<:p 6 0 -LMh0~h(K!pL` 00  0@P0 `P41W ,00( 0cP`$8 0:P@zG`W h 0 @P(t0| D0tS p,W00S,(K, `,,  a0$<:p'Ojlp? -L M|0@`pP .  . 0K PPP] p|0 PDK0|0|@ 0{q|0 .HP000HX= -.L$M  8 00(Ǩ0!Y`# 0@P(0 `BP0 ,(KZ1P ,00`0ap`p X1hp  a(RP4K@  0 4@ z!P7,P0U/88 ,0Z0S$ :@`p4@ P00000 0 (3Z0 8c,0Z0S(,8 0UOj8pdp -L\MahKqP 0RZU 1   P *PqP 0Rhh1   PP@*0@ @@@4 P@UP0 10 R 1@T0 0 oxPZ  ooPT1P@* T  T0 q80 @l  P@RPlQOj:p:p? -TqLM@0n0T`@P0 0 Pp @ P 000T 0 00 0P  K0 @P'' ??8? p-LM1P0 @`0 h0{ d0R0 T b 0K@P0 C P 0`Kpl<:pdp'Ojd? p-PLMP*@`Kp P \0#&R*HƢ0R*0a"!B10b "JUxdp,p?P  0S *P P 0S0SP0SP0S  P 0S0SP0SP0S PQ00SQ00S 0R4 $0 $0cc0S  0R 1P 0R 1 0-LP@@T0-t ^, 0S \ $0Q35:h0S \ 0Q5:$0 Q :\ 0Q:t\ $0Q*$0Q: ^00t0 -LM@ Kp`PP U *P 0U:80\ P 0S 800 S$ T$0$0$ 000p00p0 -LM`p400 P|@h@$U+ ,P`U' ,L H@@8040<  @0FT0D  PF T F0T0,PUK????L? p-@`LP$ 0 q= UpPP+  @PP@ 0/B000cStPPP@H0/B000cS 0p$????VUUU?@? -p ML`8@0P(,0!0 @04 0PV (0 1P- X KiL K& Q Q= (0- !0B@@0S0S W Kiҟ@T OP P Wl X@TH?d=?4?l?@???L:p??`???<:p??0T <-0p04 |0t (,hlxnC? -LP` pB 0@ 0-L@ 0P0S0T 00@00@0@0 -LMp ,@PA 0`0 K蔻p -L$M` @P@0 C4 00Up1p!T@1W1!, KP C`(K, W40   0R 0PW 40$P: 0 hC``L 8 (0R<0 J @ G 2 RC $0W0h0hS00 A lH 4 D D4PP @T @ 00CSX1X1111X140S0Q(0P00:S00 E 44 4嫟8 0S00SD4T00CS0$0W0h0h00 < ,R @0 , <0 40l0@<@P0 @P` \*0 ` B]$0 W0h0h00 (Oj? -L0t` p# W G40 PS!:V 0S 0P40 PS!*u -L$M@0Q0 `40 *0 040S:XQ , KPU,P 04 \00R03Sf \TP(KxP0U $0 0p0K P09 Q, 0V08 $ P:8 R $0P*0V?0S 0V9 P 0V6 R2 0V/, $p0 00K PP ,P0tP4@  40p@ pP 0S 0Q8 00\*\0 50p0K P,0 VP8\u $8 0 0p0K  PF80V0,0 8, R 0V, 0V0,0 , R r 00 0S0 00C  pL 0 40 Q3\1 0S 0Q~$P0 |U$,P*08Pp -$0R@LA>00 0- P@!J3>0 dPtuLeT$0 p-PL M0*00XPU@`XPE\P 0t@`ld 0\X`@cH DX0@[$Kph耐$l<:p?4jp?кp ?Xp$ 0 lHL"&$ 0 lHL"&0D0$  -T0L@  Dh8hG((\  P1\@0CP1hFXpкp<:p8p p-|0L0PU rG`P\@T P10P1\F0T0p0 P p@PTPp 0 _@PX0. <0X0S0?XXnP LdDS@P0T00APXj<:p8pOjкp=8=t=$%n,OjX?Xp,?P  0Q5:P -Lp` R 0SPU 0S0 0`R 0S`0S[ @TP# R0 0@ T`@0S0P  0SPP`P@T @@ PR3 Q 0S R 0S 0R 00  S`0n0S0@  0S@@@`_PU Y R 0 00 0@ T`@I0S0P  0SPP`P:@T 4@R 0S!0Q 0@ "0S0P  0SPPP@@T  @ 0R 00  S`00S0@  0S@@@`PU   R 0Se0P 0@ P0S0P  0SPPP@@T @ A -LXp< @TI@0S`X`V  0SP W`U@ 0W@@ 0R@@V @@TZ  `X `V 0Sh` p-P@L `0QeV ph_p -L`V4 0S1p@PT5 T R* @TX P0 Q 0p +0S0P  0SPPPp@T `V 0 00 0 0  R PD ZG P@0T 0p @0S0P  0SPPPp@T 0S`0PUP  0S`@PU 0`0 0 0 l0S@00S0  0T` @T @ p-@LT`P @ 0S #3* R0T 0 PPPv"@p0@ 0@@P 0-L@PX i0Q 0hb0 -LMP Kp`@gP  0S $0S(0SLPUW$ x0 Sx tp0 0  0R p h0 0C0h0 @@0PTS x0 St 0x0h00Ch00 0  -`L@pP @(0 Sb$@  ,00@,00@L0S HHh00h0 ` P0Pb40  (0S 0S(hI -`Lp{P{(0 S$pb  ,00@,00@L0 pS HHh00h00  P0P!40  (0S 0S(i -LM04 Q 1Rp1p!W`1`!, KP00 Px ,0@x0 R0%x0%0 0Y0,0 1 0W.$WD: `cR (0S$ 0&6C0D0S24 ! 0S t0S0t0h00Ch0  0l0, 0fl0 ,@ @Y,00 0(K|0 (0 r $  $ 0 $w yx $ l0 $ 00( cc40(040,@ 0S:t0S0t0 #dpOj -LM|0P`@ V ,@`TK|0@0|0M `$K0|0|$#0pe|0 #<P0V00 |00|0, ,p`W  80S D0S$0 0bQ,|2 H R|0 `; `$@T D0S |0@;`X 460X:W 80S D^ 4    01(\. 0D0pV|00|0 ;,@W `@0W0V0S D0S $ 80`V|00|0|/d ;`a $@@sD ; ;|00|0|dW 80SD00CD0@W,@T@T 80S D00CSD0 |00 L;-X=8p -LMP`p|0@! 4 00Wp!V0!W`1`!, KP|0$;`(K0|0|$0vd|0 );P000`X,@ T( W%D0S 40 80(0S Vf$0W^:D80SD $WQ Ry 0Pv:@ W|0 00 |00:, X W` X WD0S$ 80`P 01;0>;|00|0Y 0W   0WD00CD0 R,@T@T D00CSD0@Y 6 s 0Sk:`T6 0W2@T S:W*D0S $0W@V! T $0V:$0V*D0AD0@ TM|0JS:`- 0D T,@TD0S @T 0W $0W* {|0@ `':`Ve@|00|0|b0:` |00 :`|bP0y:0:|00|0 |b`X= -SLMp@`|0P 9P |0  0|0|0 !1c|00004 00XP1P!V0!U`1`!$ KP$$  $ `VPp$ Q$   0U $0U* Q$ Pp$ Q$  |0P $  0S* ~$ 9X= -LM| 0@  4006p( -,` V)wPL0D@S (P 00Sh0(0h0(0  P0P` VN 4  0S @@T T@L0S r(P 00S40P 040DPh0(0h0(0  @0@SL R 0D0S0  0PPL D0S# R ` V|0l l 3 (K | | 0Gb|0 8P0| 00[R 4 <0040<0 80$ 0 | 0@@P880$ 0 -4 嬕媕X=?? -L4M`@&p PD 4 H0 |0  (K 000D H4 D0 `YP+|0 8  |0P 8P |0  0|0|0T$a|0@r8P 0T0Tw H0Sp y 00& 00 , D$0P @ PP@ D4 H0$0,0P (H0404( 4(040 040408p040<0R@,PDL H  4 @ JHL@h00h0  P0P@ :H4l0 X Y0 l0R$ @0 60x0\ |0PI7ED804 P}@ "@wpzD0 0 aq0\{ (0HSwQ 0,0c< 8  Xh8Pd40a80S^<0 S[@00 SWP0,SSD0SPLQ 0SJ0T 0 TCQ 4@ P@:HY 00S @ @$04  0$0 l040l0{$ 0RxP%v4$0 0$0l04 Q0l0h $ 40(60bX=Oj̺p0j p-LM00@. S 5`8.P 00 ``PKp  -L M|@p`P $0K PPC|0 $P, K0|0|@ 0c`| 7P0006X= -p0L0CS@p004 0h5 0-@PLP (00S0@T L0S40 (0@T0 0-L M0@0CS0%|0P 6P |0  0|0|0| _|0000h0S;00DԉK004 P0K P X=p -$@L0PSp` |  0$$Fh| 0P2  | = 004 +|0P (0Q0p4`|0- 0|0| 0_|0 P6P000 | |\ 0_|0 =6P| 00 0| 6h6X= -L4MT0 00(KP 0,PT 0P @ ,00| P0L0 @  6P |   0|0&|0B_| 000 0 KP  @0  0Y|0`t0P 0 pWD R4  0 H0 8 @0 Q00S00@,0@,00@0004 4 0000<0808000< 0< 0D0@ @ 00L0SL0H0 0 8H0\&6H000ZP PP HP 0  0 $W04 S# 0Q @ @ 0 0W4R`} 8P$0Wq:40 V @0 @pR0 40V 00d`cT @PP 00,000i 0  f $00aLQ$: P*L $ 00(P(q0@,00@zT000P0,@ TH0sPT X |0 @|0 HQ  H(P0,T 0(K0H @0 ` 0 '0  0 `c# 0 H RPT X |0 0`<`  @? < P Dx0t0 Y0x0D0 00 WS U000  $ 0@h0 0C0 h000 %<0T X00S T|0T4@Z@|0: ;< RT|0@ P0,@ TH0@T|0; T@l @x4P T |0  T0|0T |0]|0 @Se4PT000]4 v@? >0 |`< oI4@0E4@W4p3PY TP000S0H0 @0 FX= -SLMp@`|0P 24P |0  0|0|0 !k]|00004 00XP1P!V0!U`1`!$ KP$$  $ `V@p$ Q$   0U $0U* $ @p$ Q$  |0P $  0S* $ 3X= -LM|Pp`@u 4 00W0!Vp1p!W@1@!, KqPp , 0S:Q@ 0W40{<0 Q  w 0S *40o<00Sm R208`S 888<\ ,40   D0SD00CD0,4000 0 $ |0 ,D `00Z00S$@T- 0S**$0S 0|0| 0\| T3P000~,, $  0@P T|0"3 (K  ,pX= -LM|Pp`@7 4 00V`!W0!V@1@!$ KP@$  $ 0S4:$0S*Q 0S $0S(0SL0S40 `( @|02 0|0| 0-\| 2P000 k$Q $$0S040$ 0($ @,00@@X= -L0 @1P  1S/000P 00 50S#02 000P0,0 0l   `  l0000  c 0(0 $$0 R*000ꬥn8p4Oj p-L0. R 0^ $ 0P  0-LM@ʠ,ʠ\ 0^+ @l^ >0^ 0T.Ơ0 H R$P 04d 6R0  0P 88`0S*#88p -L $ -LQ 0 0$0` P P0#00@-@ʠ,ʠ\  0R lR >0. R 0^ TX2X2X2p2x282@2$ 0@R$ 0@$ 0@D-0 " 0S  ʠS,ʠ\ 0R lR >0. R 0Q$ 0 0@-@ʠ,ʠ\  0R lR >0. R 0^$ 0@ -LM ^0 ʠ,ʠ\ 0R lR >0. R 0Q$ 0> -L MP P  0R% P`R >0. R 0UpW0U$@|0`  0P|0/ K0|0| 0"Y|0 /P000$0K PP|0 $P /X= -L0MH X :#: S$@0D >0 0Z<0 * p 8 4 ^ 8.P T 4 U XD8 0P4 J0P0 0 , K2Ps ,@TL@ / 0<\+T$ <0S0L S` 0R]:40<Y!(000 ( ( 0 0 R" Y0 Y0,L0, Q 0<\P/H X8 TD8 塮T3.4(KL Y@  Y@0\0 , H aP 0S000 R 0S,0 @,` @dP P00Pj/H X8  040 4 -L$MP@00 8 Sp` (K 00Qm, KP,00$0Q40 h $@0 S1Q* , R ,00C,0,(0 ,XW>=10 |0P. 0PK $@00.=!.Q .\,*0 40 0YP $|0|.0|0| 0W|0 .P00PK00$@8000Q,0 40  50 X= -L MR4 pP`@  0@00S @(K @ :#:S40 0Ƞ,   e 4 \T#00|, 0 ', P` 0,0  4 00`Y@P[W |P .P |  0|0|"0HW|0|00Y l2 H40#&Rx R 44 60 Rm:4 0@P 40  0 00S7 0@#-00 0 RW T, ', &0\j 0e,0Ȍ00 , P`&0 -0 0 -0L-I x@40  FP0 0 Tx40  400  40  00 @ 00S@ @0,@ >0>00!I-X=8p -LM0 0 ,  ` P S 0 oܤ Zk00 S0 d (X 0U]0@`VpPU >0^PUP  h:#:SI0QF0SC04Q, ? A q: 0 `p0 $00 6@ Q 0@T9 `p  00,K`  0 P@_ T,000 R,   B(0,  ,mU@(K[P @ 0, 0 S,  @S @$ 00SS@@E S\hSf 0   Q j O  @, \  {$0 \v*  S, qA. L `p0 , 00$`,K 0@S+ S x0 PH , (0 B0, F0 `p 0  J F0$Q000  S0WʆV@V $6 0K0 @Pl0L 0S  @, <00e0, 6,T` p@ @ 0 00 M-LM0Z,  (KYzpP` ,:p@ Q P`ZY M-LlM00S@#vzD0 | x0 p XKl`Kt p 0]0@ ,0 0  0 0 0, K0 tK0 Px F,Q *@@R (0 ( G, @RRP@ZP  000000  ,@QQ, 0OpW0 6OtK Xt p 0ʡWp@t0 K@Qx(K0@-P@ R( 0S%\ ) \ ^ \@ 00\0 S 0  0S  R 0000@00 R P, R/ 0\00 S 0  0S   0S 0P@ 0S@ @0  @0@000S 00S0@ 0\@ @  @0@- R 0S ^ 0Sk0 0R 0SI0SD \   R00  \0S0  0S    R( ^ 0Sm R 0S 0R00S 00 S0 0S    R 00000 \0 S0  0S  R 0S@0T00 S @0  0 S  0R0 0S00 S0 0S    R R 0S P0U00 S P0@  0 S  @ y -LXp5 PU?P0S `X`V 0S @ W`RP 0WP P 0RPPV 00SZ   `X `V 0S ` P 0S0SP0SP 0S  P 0S 0SP 0SP0S PQ0 0SQ0 0S0- @0 S0 UTR p-@LTP `P`@ @T@p 0-@LPT P@ @T0 p-@LT`P@P  R0T 0@ PP P@p0@0@ @P -LTM@ < `K Kp@-d0 P0U#F"``@ 0T !P01Rb`0^p8Oj,p 0-00LS@(0P PR0 00 0  (E00C0(0 00 0000000  R 000( ,00C0 R 0  0 8p<:p 0-@PL(0hf -@L(h -(0L@ & R4 000(  00C000S(0 R0000 0| 00  0@@ RH0 0 ($ $00000 8p<:p -00L0CS00@008@0 (000 00C 0<:p8p 0-L@\ $0X(P 0h~Q(PA (Ps A000A 0-(0L@ R 000  0( g 00C0(0&0   @@(PD`0   (0 D0 0hC00  @ @<:p8p -L$MŸ`@0@VPU8 4 <0 /<0@PPOTF` 1@ ?S,) Z 0s ,0 S(0 SH1H!D0QBP`0@K  0 @0 ,@ PP @(KR0(D0Q Po0RO 0@VUO0@< 8 K (P$IV 00 QS\o8pnlp<:p|:p(o -prL@T]`2$ RXX0S ^> 0\  \*RA 60 0 0 R0 < \*Q0C"!B60 0A0C Q0 T: `D^` 21C@PDP sV@4Q 0 Sࠃ$  $0 \:^埃T `DV` 21C@PDP JV@ʮ剃A 60 0S00T `D^`"<0!B@PDP (V@8Oj<:p4p,p?(? -LhP \0*0  0P 0@ 0P C8pL?` -L MP0P`p00 4 ' @:#:S BU0,0 0 GZ%ƠJ, Rp'vŪN4@$F ,00!"&(Ko(K|? -LM0.`p,@K 0@(@  , ,@T P000(Hs R000(0  0  0 ,@PT$KDXj - LM ׁ 0S0x,0 @ `0 PpT0 `p0 0,  S, 币(Ko贁8Oj?,p?? ? -LM,a0PS  A* pW$ >0n`0gV@P0U,>0 N@ U $`KdP% $J AU^hh@0>0>0 0!U EC@Oj,%n0%n̺pdp(?T?? -"LMŸ0 @0, 嬒 0 @@w.#^ pt 0b\0L"6!v21C!@cw Pᅡ0SR  0`cW@"#s:21CcT E V P0& PƠʌ008 , @00D  H00L  P 0^:0^H! 00 0PUT0  c21Ccl0S 0pf`cV@* P 0, >0>00 00>00-0| 0P0X0 $  0, @ (00`\0T(XL(Kg0冁,儁<:p8Oj0p5,p8p,%n:p0%nTP! @TV p80 #R 0Q:p '88 880 a0lS`1@P11TV@808 V0b#6P  Q00,000Q KpG0C0C+zP @m+0+ED0GKL4  0C@tt p$ x4 PD Hd )Pdt0 BKA00CAx+FP hddI=\@]0 N ||7 (d렕nPOjn8p8p(j?0?=P? p-`QLP@@Tp -LMp`0@,P@fTK0$@K0@ $ @ ` PV@P$(ԳP R000 0  U @T:p8pDXj -70#L0`M)x0 000p  t xP| D W0X$80 S+:S %0 80 S :SQx  t`Q$ ZP? U$X |}lKi@ lK ptQ  PS|k@(K@P3P#D0Qx0S,#t0  0OF*p#J 6|Z0 2"`,0 Hp`` 뼂@`c 6Q<080 t0SM d2d"D0h2\@0`"000 @ Pp | @0`h  l00l0 x0S0 k |Pp@`*`(VZJ|(0Kp# p倀| Kԯ00x;@@P00 6|ZpW$`Yj Z *ދ| 0`Sm0S PX\Y_ 8Z p|lK|Z DXjholp<:pn!Cen@ PK2 -L`@Mt0q0 t0  p<09L KpPPp0 0p08p00  -L M0 S0d @\0!@@@tO0P  0x@5[h d0@-[KhD0P 0b,bn8p8p?0n`Q80 a0@P$0S- 060>0. V  b 0 K@P0 P  ah` K f 0 0f#&B 0S* 0 0c#& ? P-0L R.  . 0h a$? 00 0 -L,M0T P ` Zf @<0x"0c-0S[ R@@ TS p 3ZPJ 0R00}T0 0@0@T0 B? 0!@00KP0 0 H` Dp < , L 80 @ 4 V 0S.0 PK0 0@@. T@ 0X0X0Sb@( TE0 0C0 S/ T(K" Sf0 PK0 i0@@0  Z00R0S ` 0S|%, 4@P  T{D?lp -LM> -L M@H \?pP` 0 \p:@P`0s OP,  (0  X 0  0\00 p0\P P(K(㧯,000P0\`p \:@`pPUY   U  R(,  (0 r0!,;,PU (a,PP 0 P. R, PPU ,K 0PPP ,@(P,,000, (0 Q+, (?,\?P? -0LS0S\_xpD0 0@`,PXWd? M-LM 0  0 0U@` | x t 0 |t\7zx0KpP` [P(߮:@p Q P`|@T 0x@K0`@ P P,0 P ` K;P a ( a  D0(@㠮( { @V 0Ql :PK`@P|`\P ` \ Q 0S @0000$K+0S0 =0(KS`p00 @P`@P |` VPK`P`0xP t` ڀ0 |@ 0q|tP  (  0 S0@0   (=0"+PK`2@P`P ` Ps  0 S0pK p`K, K0 ,` 0 xPK``PK` P`^P    `Vm 0^\ ,0Pq (0S(@G @ 0Q# 000^0 =ڐ,0Pq0 S@ 0R01 R00 ( G0(@㽭 \0Ux QQ`VB)0!s) T]P]@   ㄭ0pKj x@R,???? -LM0`p @0U `p KT0 Z 0-LM0@. 00H00 0 PE0S P0000| *0S 0 Sj00    Q$0$0$000 K0K0h=)]?? 0-LM 0@C^ 940 0P405  0   0 S 0 " P0  0 )0S    R$0$0$0  0 0K0hK00 K0h(? p-LMP8414a@0TH=L0S @T U0 0S3 0 0 R(0( 0@ @T@T|(@T 01 P 0S0  Q$0$0$ 0<0`(@TKphO- 0pp p -0LpWP  `0V0  04@0 0 6 `lp -LpMp 008"0 )0\{  0SQ 0 0 0  0S 0  0$0p0$<0@60\0< !0K  P"pPK`t 000P`@P0 80S 0  0$0p0$<0  (0 0@0 K' 0x0  40  L( K0 P$0P0( @(`0 @Qd&x , 21C0Q@xH?plp\OjXjhd0 ppT? RQ-L P P 00S00S000[\? 0-RQLMP! K<,4#:0K K < 4#:@@KP  [R 0*":("088[? RQ-L P00P00S00[? -RQLM@ 0K̠<Č,ʠ KK [*"<("400[? p-`PL@ Pz00P30@ p p-`PL@ Pz00P30,@ p -L0M`PV, pX 0S , 0 R(K0S P HK0FVSD0  T L0 (8#"xuT2@0P0 Z l0` ' T R ,0S00SD 0L00^00S @0S p0:0S\  sP@0S W 3S @@0S<0S80S40SX 3SXQ PX @,@K sP @40S80SH0S 40X sP 0Sz0S0Stg@Kt0XVpX },@K sP P oHß0 d0Kc K04 4 dK 5KL -@P   QiPa 80S0C80Ť@KDodK KP Ÿ(0 P'/P ' K PG 0S0 0000Y1 R O1 R  00O[ 1P0 t1 R 0 O80S0C80k,h80S0C80Ŵ,1 R  00O  KP 00S 00YU 0 RE OAa,X0 RG  l00O=%04"43KJ,Wꠕn\Tj1j,pP?=|?==nnԱ=??? ? -LM؈pS, `@ 8#QP 8Q 48Q 8QUB  `CP, 0R(KL8Q0CQ*0CQ ,8T,0CT*8T 0T&1O-P7Q 7Q7Q 0Q7T 0T/Z !7R/PU&P7T 7T5 1CT4 1CT/ d7Tb0CTC*U1CT@ @7T< ,0T9 7TI0CTX:Z 7T 6T 6T 1S  P-PU  0Py|Pql6T :`60SQ 0S0S 00S? L '6T $0CT5T0CT*"0CTM1CT n5Ts 5TP75T 0TUm ZO p h5  R:p D5  R:q%00000q$00P0P004T . 0CT{ 0Tj r 10aR001#050%pa 10bP001#P3P#050%1P3Tn 0Tk 0CT.g 4T 0T;@mx2.vP3T8 0T*5`=PPK`@mp PK K(KK 0 00 PS@P 0T H$P( 0P0}d0l@@ P<Un^Pi K`PUm p @P4Kp Kd@K|KK0P 00 P@0[d 0@0K@["tp0  K@ KT0 P VSP ; 0S00 \00\0T$/'@mx2 SvPP %04"48#P R 5R00\00CS\0x Uu%04"40K K]VPl0S?MP$ꠕnliHLi0Ni0WiHPi iildiHX?Ji(KiUii eiHi"i ix%i i Mi >=Ii i Qi 1jRi Si !i ? -LMM$0YZ,0 0T X1  4Q 1CQ 1CQ -d, 0R(K0  0Sq0Sn1SSj1SSf Rc3Xb 1CX_ 1CX0I P P@QN@0`SI0SFpKxcl  bl K^l@T00   1FSK00KTp X 0- p\`K ;l\P<0X@P80T@40P00  \P X@ T P ePP  ~<@Kl0)P2X  \Kl P! pWIpWF 0SP1S L`K kLP<0H@P80D@40@00 \K LP H@ D @ oeP|1X3 S_Kxk  k(OK( k5 NK`` k|| kT X 01!KkT00   `$NKk(( k5 `F` k00` LFkpKx`k  kK k.ꠕniixii =? -LhM0,0 FP!T @0S6T`VW` p0S0S 00S- W`H`KEFkU,@@KD%D0 H0KGKCK5)PP <0SU , 0Rp(K R000 P0& 0S0C 0 p V00 0S0C 0( 0S> V00 0S0C 0 ((  (@P PKDj40\0 r@|00 儠 删 ( 0I*@KDj40\0  0 0   r 5*'00 R  0 K#렕n=,p\Tj?|= -LMq q3Q^$ `$ 0R^ K\_0S\ .SZ ^ 0  PM .PK P 0   0 a?R0a 0tPK0Kd0[ K T At [R A0BS 00 R@KXdjB K [4PKSj00 <0 %04"4  0 Ej}# 0 a0ꠕn= -LlMp@K0`X 0 +j h0 `0PK j0 000#0 QK M#렕nnn= -LM 0夐K0 x,0 i dT@KpPK`K@p0   pK哀K\pK[KxpKwK40 00 @ RPL, 0R (K<0 R 0  )J#렕nı=4=\Tj?= -L@\\ 0SQ  R dPGPp P %P P P UP#P P GPUU` cP  cP U U00 0  00  0 00  00#0  bi  bPOjOj -LM@pPPa0S4$KT P X1@T T tP08@TP;`0S 0 ~I`0S 000 sI0 mI0S 0 @ P `p tP@ P`pXI8`0S 0004 LI0$H\Tj=j??d?D??? -"LM0PAK @0x,0 h  b5%#00KH2 >K4 KK 0 _ r`K 0 0K K唀 吀 )@  yZX @sP 5d0S 0 000匀K`hP pd@KKK4K0 0Q0@0[A0@0K@ [ @ KP T NP , 0 R&(K KP 0 R tH Q/Z80 R 0 $Hp!렕n=\Tjx??Ȳ= p-LM4ad 0R@0 P *h0 S*1 R 0 sH 0R&Kp0BSh0 S:7d0S 58J0 R 0 XH|0 R ?P L$!H,KPP ꠕn\Tj??Oj=ı= -@L㸩0000#0 -LM`\@pe:,Kg<,$!$P(,, %pK0SpA SK 0p 000 00 00Rp' R/ 1p"[2[[0[0!0000 0!00VTP 0T* 0S @T`00V00S 0 0dS1!Q00Spa @Q"J 000 00 0000!0000! 000 @TP Z J0 000\PZ0`0W0VWx \ p  W 1 1Q00Spb 8#8%P @ @0TA @Q"J 000 00 0000!0000! 000 @TP Z J0 000\PZ0 8#8%XU\EPEJ0PPZX( 8#8%8S? p-LHMPP` 400S T00X0Kp\@KDH^40 ,0 X 00T  P r >? -LLM `-PP% 40pd@KD$^040 `` 00\0 r  0KpP LL2 PD0 <0PK$P PRjM3 -0L p3xRjRj*n -Lp:RP`@ P00T0SjPPS *P0S j 0 ]PPS T *PiT(P R(PP Q ]PP -pRL M@kP `VPPj P 4 ; j14 R(KX 0W0 0 `@  u] p`gT  Yk* 0.S  \R0,0 _V0 ^* Y 1P11Y*p@0S .S p W@:00 0R0D>S@ALaL 0RS00L S0SA Na0NRS00N ST` ALaL0QS0L P`0 P-\QPNN0`@T Z0.SP P00S U* , , 00 Rl,0S 00,0 S`00c 0ah] -Lh 0S 0Sw 0Sm 0Sc 0@(0C8#8 $#$L0" @@L 04:(  40 0@@@&P x" 00@0@x2P`00@0@x"00@0@F `d$ae`gV gP0L 00 T0 [L0T@ [S00S0C00 00S0C 0 000S0C00 00S0C 0 0v`Ae[ 00ST 00S<P: 0S7 1 0( 0*e ][P+ꠕnp Rj|p= -QLM@PpU UTP0 SRL00SSHDXE,p LYA@> ;` ?T4?R2T0HP4 R0I\/ T& R$ T"0X0Y`P TP,0pcXj Y X`Y@   zTP X0j S -L M0(  @ $(,L<4,4"| W@P( 0Rh$K1T* 10SPD@KZ0 C0KD K<`K0S6 pP 4080S0C80?1@T @T00ST0X0W*< x20Sh  h S*S0@P Xp00S0 $!$#KS0S S:0렕nRjRjRjRj,p(= -LM@P`p$@0 p9K&n? -&LM0`,0 0ꠕn|Rjnn=|? -L M@ ,  `0Rpf x" 0@,W@-P>`0@ 8$H0S x2  ,] (K 0 S4`  K:XY @,: 0<@ -PP. ̟! !=0@@8DH@Ti JTe T TL,P x2@0  <@T^괆3p3X3d33; R+P(8,H`0@(8,H,0S 00KbP 0 0R0% *l )1, T;@P $(T5 Ty 3:T T ; R, 0Px@0,Ks,00S x2@08 8< <@T t 8H 0@8H<\W8 >0@*084HTV T,P x2@0( (, <@T[ :T,,,0SO x2 00@0@, ,, @ 0,o0PT,00S x2@0  W}T :0DSivT:WT ,0S x2@0x x| ,d(0^@P eX,00S x" @00@@0D@<0S]F,0S; x2@00 04 ,.,00S x2@0h hl <@T9'WF,`'0^P ^,00S x2@0` `d <@TW),&0b^P  &0,00S x2@0H HL <@T,|&0F^PO  >,00S x2@0P PT <@TW,&0(^P\  <50S W W,%0^P PP 5 8X,#0]pP 1 0Y 8p U[P8 8 Q@ PQ80 QPQ81<8  @0080( @PN N80 0 0f(00 X8(~04 p(0<  "p8X`0@84 4$D8X 0@ 8$H$|p\Tj?|? 0-PL @R 0S0S R  uP @0$ S00 00#-Rj? -LG$0 0  0dRjRjtRjRj -QLM# @P`p, ( K@P 5", K  @pf`0, K $K -`Lu4X0@!0c48R0!0c4<M0P 0c4DF0 0c4C@@D0@ 00Q0 00Q DDP@10 R d0H, 00 S0 L 0C # 0 *TpPP$TP@ꫪ1j -, 0LRP"* L0S, 0S*4@pD`@` T@X4<0,0 H8@K00 sӍ, 0S:j,1j -LRj(Q0( ,S  3S001 001 R0P 0-L MQ090L+S+83ԙ3ԙ333333333333ܙ3333333333333333333333333333331\0 0_K0-0 K0ht0 K0hLX0 K0hDT,,0 PK0hTSj?=(pdpx -L8Mlr@PP$ ` 1$ 0R KQ<R꬜33333333333333333333333333333333333333333x3330333333333333333330Q:N0K +VVN0[0M0[ 01PڢQ: V0KV%[00SVV0[0(Q:L0K( VVF0[00Q:N0K UVN0[0M0[ 01Prp +렕n=? p-PSLMPK0C`@0%T  @0FPx@x -LM 0@4(`p V `!b3T(P 0T +T $KZ*0V':*0K U(0[S )0[*@[01PX3T0V:&0K U3T%0[%0[1001&@[PP<T -LM"0K@ pvU3T!0[!0[00QQ?WPU@; V1` T ` `TU* 0TU PV@ -L(M0@,0  Ply /  DK)0D gPll 0 R 0 0( P @3T 0T6 P PP p3T0000aa 0V 3T T#P00P0 @UU2@P  t, 0R(K<T<T U+T+Tl0 3  l0 2  )0fP0P0P0 @xU@@K \I@0[S` SS ZZ 0SV l0.  )00 fPllfL@Kv ,1fPW 048< ̠<Č,ʠDK= )0D jfPllT (@P  00Qwl0 1  )0Qf0SUl??0[0S SK?0[0S -렕ndp= 0-0L0@SP ڀS S T0S00 0@0@ 0S 1  T0T@00@ P @P00 0dp -LM`Rp"@3 1:S? S VM*  hp  `bV @0SV;0 `bV(KV0PU:0 =0K nH00 <4("4!<^00 >SM: 0V R*KSH"[04"48#8 00@P  TT+00h u`*0p@0@P0h @Pd,0T0h `@0p@P@PS,00h dp -LM@` 0)S0p(P 0 0Q( Q0%(":P*0@P  (K( ,0KYP , 0R:0( ,0KYP , 0R0% *8J(0 EP00@dp|? - LM(0,0 4 < ! 0S 9I 0@9I0S @ >倮   #=0@8H<0S x" 0@<P`0@ }'RP00`S0 P0`0@0@0S x2  < lS(K ("XP< 00@X0@ x2  0`1 0p  ,P` Q0SS Ph 0Se0Sb0S_0%`P0`0@0@0S x2  $ <0P 1 0@#P (f諟#= 0@8H\'= 0@9IRꘫ8H 0@8HH 0S$0S00@0@0Si x2  $ <_Q0SH 0S= P 0SG Q0S 0s 4P& P0`0@0@<0S x28 8< <0S x2  <  0!0S 0S0S0S<0@p0@0  0400 P`7 <0 (0BS]:(R 0S 00< (00<0S T  0S 0S0s) 0S0S 0s P00 @WP0T@ x2@ @D 8V X@@0V00S8 <K21C010,K \8`P 0S @S<,0 RP0`0@0 @0S x20 04 <0S0S 0S$0Sm <5u Q Q ^ ^ p5 ^ :00@@0 W^ 8g0S 40C> 0@p x" 800@80<@<2 0)S(WPk 40`s! T2 R@ 00S ST*  =P!0Sh00S S<,P ,MMP80`0@80<@<0S x2H HL Z H00@H0L@ }%㉠ X|P <剠%Z, ej,0Se 0 _0p8pdp0Rj`Rj1jRj8?Rjl?TpTp - 0L(S``MpP3M7Q PQ@ QPQ100@000 00 (A(  ( ` @` 0-0L@P OP 1 0'S 0S S% 0S S  00h(QP000S000 00S0 0 000S S 00S Sʚ; -@PLQ000: R5h/ p-PL`@M U  U U -p0V 0 00p0V 0  Q 50p0V 0 00p00p 0 p Rj -pL@Q@0h00d0 p-q``q.QLP@P{00/U00S00=U00S0d00U00S P 80S0C80@0 0P{001U00S 0P{000#U00S 4P{0403U00S 8P{<0P80 80S0C80 0<02U00S `P{0`0p -L @`Pph \0DS=^\^ #0DS/0D+S133P343<333333333333<3333333333333P343<3333333333333 #450S * 0S 0S 0S0S0S PU 0S!P 0S0S0S 0S  U0S 0S l0 0l0U.T @4 Q*Q (4 Q Q{ P  @? P U U00⃁U#T 2T TP { P  ? U U 0U0SR @0S3{ P8n  > ePd U U U0S/ WRz0Su 0St S 0So0{ PC > :/TQ4UX0 S -Q0S+ UE UJ00UF1b{ xP0  > U40PS  h+U)0 S d" 7 l0 0l080S `PW 4PS3, ' 1" 0S0S0S 0 00SzH0 R80 Q,<$!$ , l  =j=j -LM@0pSP` @  @LK{ p0 -@PL {h -`0LdlSpdl {PP" @ 000S { P  =00S 0{0A PX07 0=40S 0{0A PX4  4=`0S 0{0A PX`  `=8P 0{0A sPXPP8 8 = -QPLM@pP K2U80S P` U @ R00S000PU@ U `0 R0S0)S B 0 yP000PU@ 4P -LM@0TpP+ `U` 0S{˿PX P  00 PP@ {㮿p{ ٿ@lp -PL@p` Pk 40P280S0C80d00$<0 0 \(W A x20Qh  Q Q: 0X h Q* P L6P\ W0 SPP8T[l0P0 0l00l0P 00l0*P\1P$ꠕn=س=  R-L@p`0DPP T V @  6P; xC1C77 (R-LPp( B(0EP @@0S1` CP  0 0 7HAP 000 0 0 0 -LMP`UCP1 @0 0P <(4"4!< $K= 0 6 000AP @ ZCpP ; B1B77 0 @0 0 000  V60@hBPp -LM @4 8 4<,$@a8#$@D  X00(@0 pR@m4pBPP@e P  GA@P`1 (@`` \? @ 4 ,0K0@PN40,("Ƞ0l08#80 #0R!$ ,000 g4<0#$ 0L08#8 $#$"  0DP!  R4 000,0) , )<)00p,08 Q 'B@PP7@(Kn -LMDϟ 5WD 0Q#  K !`P AAAA|KP A Q 0S dΟ, 0R(K4Q  K !i`P8Q  K !_`P`Q  K !U`P0Q S 00 S 0  0 S 0@@TP00(@CT081#81 2$1#$1"15 5:U  `P ꨀP y`P`` R U 00  0 <000S U 0 0   000S U 0< 0   000S( U 0+ 0 0  P P0S|K`P G@ > " B4  L#0S  0S0S0S( P0@ |0K-`0  |P 80S0C80ʽ0S(  X00@ ʟR|KX0\@  i W 80S<    d \0 $(8:0S    R *8#4"<# #$# 00s 0X@KPT40 PKW0K=XKKK 0`PP L0 0@L0P@ 0S x" P00@P0T@ R 0S W 0S 1<10 SK<0K@K@`P Qٕ PW h0SK ^C  5 \ \ ^ ^ \F \\ ^: ^_ R 1@0100 K! 0K'PP`D1 @01 W l0 0Sx20Sh  h S:0SB R@ S:0 0G P`|P n`PoPVAV  00@&0@0S) x2PX0 0@X0\@00 0S\$ 0 00@ |K-`P  P0S<1<<1P x" 00@0@5Sp0 0 @P0@P3` x2P 3`X0 0 @X0\@400 0P|@K$3@ @ 0S\\ Qn: 04j 4Q0 0S  ,00 (0`P0S x" `00@`0d@P00>U ß`x0p0@Px0|@ x2p pt  0b `XP 0V0 >W h0S  P(`00S000 00S0 0 00S x2Ph0 0@(`h0l@ 00S S00S SP 0S 0SN P0S 50SN00SJx>P 00Sj! 041 S  c1  00S[!041 00S SJV @!p000 @p0t@P00S S9@T@T  +P0S 0S  (V  `00@l `0d@0S x" h00@h0l@ 0S0S,00ꠕndp=?=j Rj p-LM@P 0`R :P" 0S* 0 @0@P0f @Px 0KCP  0R0% *T5D0@P0  x0 01 xdp|? -LMP8 `ܹPw 0=pPo >P @@0( 0@0 0`0Y0 0* B:Vw  :`0 0@80P0PPPPPPP :0S7 ( :0}4K 40 :180Pp1`00@ Z0@0 K4  x2  80S S) S Y00 S(K 00S P PZ x2 !Z x2  Z x2B  !` ':  ":z=|p*n= -pL0SM0 @` T& `@V P`P( R  BR0( 0 UT` `@VTVi 0$0VP<+n,p 0-0@%x04"40 dPL04!40$ R 0 *P 00S 0hTj,Tj -LM 0R0%@`P .:U:  0S u< 00S0S6 S1@0S 00S P 0S 0S P 00S0C 0 0 (0K,BP ( 0R0%P *2@P $(50S 0S0S0S0S P 0S 0S P0S 00S5 $#$"   4Ă,4! C\5 $#$ `V.0S$0S!Z? (0S S q41 ( `V p F)P 00S0S 0S  6)P0SFg`Vb`V  #)P0$0(00S1R 0$0(5 $#$"  60|?|pMbTj<+n 0-L@0%P04"4  0(P 00S 2~q00 ($ 0$0(00h)Tj<+n 0-P0P@LMKP0`0 00P9/ 00@8<+n*n*nd0GS S S SS 5S S S p-`@L(P/0V00@ 0`p -LM< D @ 4 <P@ <0000 20 pW,p  0,0 <P 00< S8 $*T R<0  08R#21C<0,Z, pW< Rs D0,@ S @3@#4埸(K <. @  PPL00X 80$0< ( 0538 r0,0 H10aR001#,05,0%\040P !0 T`V ) 8`V! 8#X"B0 08P#(:8 00@   `08V#(21C<0#Ͷ$ ,@0<@Tj? -LM`, ɸV0P0@PTp* p@U(PT(p" V(0 X:(,.0 0  @0U01(p10 0 %"@(PTVp@ ,0pS @3@# p S-PLp@P`Q`R00SPRV  㵰P P U U*P X w 0p03X0SP V  0P |[ -P!Ll@p dP P 9T 00S G 93000  00  00@T 0 4, 90  -?? -L0St0   00PH0@ <<0@P$h7h TjH+npp4H? -L˷ p8 0`V x2P@T 0>CS0`Vh @0$E D 1o0( #5#3 04p=jTjMb P-L \  R @T 0 S *01 0 S00@ 0(, ~ | t?? 0-@PL` 0S[ 0SQ P d1 RMX1P U 0SCP0 Q3[S%04"43K6H00S1<$렕nliHPi Ji(KiLi0Ni0WiHTj,pUip?p?= -0LS6 1\"\ 0SP0 0 ( "0 , "0 0 " 0 4 "0 Rx0 R  }P 00S0 $#$("Q 5STj Rjpp -LP`VpP0H0@10 0$hB0 00$B1j -LMp0SP@ P` 0@  0@TE 40 `0 XV>  < H@VT> "0 00@0@% 18SS C8Ss 01P$50 S `VM @`P 80< 0CR80= A@X  5`P@x2 P0 `; @0 P   `P@ƳPdP 40 `40@00x"0 0Ba'0 `@[` 0Pd40 `d01h \00  18p8C0,04 0 18d`Tj(?BMbPTj@Tj -L,Mȕ0P,0 P`0H001 1BaA0 i蔮P 000010!$10 %1 Q `V p p<00 0 P0 p0S 0S 00l0 d0Ba  040( DTjBMbPTjHTjT?@??p? -d0@Sh0L0 l0Q QX0 R :00 @00 R*h#h 0R 0Oj?vx2 0-|LP 800T0@  0@$f0< #5: /#3 00 000uMbd0GS S S S S 5SS 80 P0S0SPd+n < -L Mp`P> 0P @C00@ (0000 @.0@0  0  R0 p00  0| B 0S0C 0 @ 00C0K Kh$?l??d+n(p? -@PL P000h? -@PL P 0Sh000? 0-0L PR0k@P y R0 P00  0| 0S0C 0 00C00UTjd+n(p 0- @P L(0h8E4 -LM  PK$,  #e@/P d 00 @00S0S @00 0 pp    0: 0`000 0HKd`K""\PKPHKGKdKcKQR S ,04!45K4%KT P0 X @ ,@K "K 0K^P @K  ,(`w0(0@0 +0Sj S 0S ^ 0S~ ˠ@,* *4*(:0 0( @@̺ 40K K0@@Y x"P`00@0@x"00@0@2@X\$P PX\$ 80S0C80 ڼ, 0Rg(K; .1>y.1 <1 KK嘐 8 00S0 0 0a<1 R9P 80S0C80?G. 00S Sw e0R| 000 Ru e@ 0 @@ 0P 0"1 0 e  "@("(04"ă[l@ 0X /ꠕnn|p\Tj?(= -LMPK$0 , !0S e@6.P d 00 @00S0U0 0S @00 0 pp    0: 0`0@0 HK@!dK!0 UG0KH Kc0Kd K \`K *Q R R 0 (S@dKK !KdK 0KP @@K *(` x0(0     0 *0S S 0Sk +@"40 0( :@@ᑹ 40K0^0 K@@Z x"P`00@0@x"00@0@\2@EP PPT$ 80S0C80y, 0R~(K1 <10 K0K嘠 O; -1A3-Py Pt @@K A*@@K z P e@ 0 @@ 0P 0 1 0 e @("(04"$t 00Sk0 0 0g% 04"45K,4\`KP %KXP T0 P@K 00S SRp0 R P 80S0C80,( 0렕nn|p\Tj0 s 3X R7 Pd0S TLKD 4 R \K  y@0 00Si <K _c0S[ L [ \K sPPp" `pUQ lK@IX2 e0 00S, b0S6 \K¤ Ae0@KEK0 0KK9@P 40  00 R `pP<K P{ 4 <0S 80S40S00S -(a0S m[0[0S%04"45K3?1 R ZH0SD0S@0[S <0RPP@S@ !80S40S00SL0%% P00 Ġ"Č0 <K\ KK`@ 0<K @t0%  `@R000 <K\ K`y<K|  PPl 0`p pjꠕn Rj\Tj {<@00S0 R  p0 R&  0@@Un 40 R ؙ 0\ꠕn$Rj\TjTp8?p?1j6MbTj?Ĵ=|pX?|????\? ?? -LHMP`@0p,0 <K X2 RL2 RJ,, 0R(KX 2 R 2@P 3ᇙ@ℙ0 0m<0S80S* 0R0% =:P1 h@KJ P d\? 0 A= e0 00T8 1 R <KRe0 D<40S00S 0 R -0@P $( @0K"P @ 0R0% *X; @ 0@ <K@ar(렕n$Rj Rj\TjLp???|p|?Դ=-Q P-R 8Pvp 0-)RLP@ :R PP0@0h膲S @0h>@0h --\LM0p,0 0 0 0 0 Y P`0U @K3 0 P @ < 0 :R) ( *pP: @ y @0K  P4 00 ?Y @K 7<ȟ, 0R(K 0S0  0(0 pPW pP700 0 :RH0 0 @,K0傫PW  (H R 40<00 p0  0#$#̠`#8 0v00 0 :R0 q 0\:( 0K!P P@0( l020 K` 0 :R ,6@0P 04 h0S100 a0S x2A0 0@0@\ 񟗥t444L44444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444܍44l4444Č44T440S x" 00@0@ R 0S x" 00@0@0 #0 0@0@0S x" 00@0@0S x" 00@0@0S x" 00@0@0S x" 00@0@0S x" 00@0@0S x" B?0@1 A0S x" <0@1A0S x" 00@0@0S x" 00@0@t0Sq x" 00@0@f0Sc x" 00@0@X0SU x" 00@0@J0SG x" 00@0@<ꠕnp=|p -L,MP Q, L @P`0 8#8^[ؐ4܏444 44(4<44D4؏4А4444444-0L0 XL, 0R(Ks-V P h00=A 0@S 0L0 }90L0 U-_T 0SHK @G0[S_ /0L0 0@S2 R 0S 10L0 V 0L0   x2pt w+PL eTBPL _VP0 v@0 ?P x 00 P|_~0 C|T80L0 tHK O 0@K G0KHKJ  0L dT000Y 1 R 0S LK,pH0¨P+ -?[:0S 0S 0sv S0S,'BPg 0dPL0S10L0 8~g@ 0L0 ꠕn=jT?hRjlRjp==H?0^P peW0^*"!B0  0pP  >0> 0 c/!o0#6610  !0^L$1Q*2h1C P 10!R P 0 0 p0^;*21C P 10!R P0 00p0!0>0^ P`eV0^*"!Bh0  0p`P pp mjjjjH&H& -0`1@L  ! 001 $!0Sa <0S[uo 0RN*2h1C   P 10!R P: p0 p 0R/*21C   P 10!R P0:0p 0R*21C   0  p  ppmOj4j 0j ,j 0S I&H&@-@\   0 S  0 \T 0As0 -LWMP  ᙋ0`0S0@+  @0S00f+cYU ,0K pW0/Sp G(K\2 ,00 SPC/R 0u/S @0 tKL H0  0Ct0 l D p` KP/00%Y0`, ,0 0@fP?p   P 0p@0H0 0CtKLp l t0 p` D sKP p,0K p`BW\=W@ 0LKP 0 p 匠 SKPP0`K 0mlPP 0 aKdlPP !p1R!l1RPW`Wpu -LM  4 0 , 0 P  0$00 00S (K ŸK01lP0UX# R 1  Šp2 l nPy0LŸ0 @ P< P< KH0 8 \ X0 DP L T P  s0P 04K \K0K,0KlPpL0 pcW]0PP`\ 4Q0 0 S+ 40 0C40 phW*`U 40SG XDE0S U0 0-  P1U0O 0ApbW40 `P0,0S X P|0 m b R ? 00 ` Q000lp -L`pvF P@ P! P9 T00PU0S+ cF P@00P P P00W l`FpGW@ L@T0gG F`p(p@ @0d?@`? 7("B 1@W b`0`WK W300 0 0  0 0 0  0 0 0 0 0 0  0 0 pG0 W `W 0 R 0,8(2C"B0 cbR  0 R p0\d0LL'82C00c08 P @@ R,B B[q p-@PL 0AN("( 0$H,8L2C! @\` 0%H c@`R,B BR,B B,0QA>A0AQAApq$=0@-Q@; R,P0 0,0,! ! 1!4##!#$" " 1"4##!#$""1"4# # !@D#$""1T"#T (P0@T0,0!," 00$=Q  0 " p-L`P@@Tp -PLM0@`. 0IK$1  0K0R0pK Pd@0 Pd@0  Pd@0` `&$K` S-L@P`0 @R1SVPQ00QppW(,0\h0p(S\0 p,00L  P  %9$0( 4`,p$P0p@8 5, 50% -@PL$Q ,0S 00$0 -L@MPX \ `0 (K$pW 0 0,  P, P`4`< (0  0AS_꨺4 4H4 44 4 4H4 4 4 4 4 4 4 404(4 U, `F0P U, V\,KX0`P@,` ,0H0PU8s, `F0PU, kV\,KX0`P0S0 8P U, `F0PU, V\,KX `P( 0Q1:=0VPT0 # BL !0@UᲠ:,0`F,0 T 020CL01 @PT粠V\,KX `P a4`0P =("((8#R  < 0 K0̃"(<  \`d \(PERQh U, `F0PU, V\,KX `PH << 0 h(̟0 \ 0 Q7h威PEP 0 000Php0P0 S.l0TL T l L T0H H/D DP L0 Pv  X; 0 < 0  ,0H,0(8S0b00l0 $0 #44$p@0,0% -$PL4p^@F (\ 0@c T#*0 ``T*:d @T*00(0S, 00000R00#3,05$ 02,0(00@c T: lb (0,00 d W`4d P(0,00@$`0 (P4 -pPL`@$PU 0S0 S P#( T b4 (0,00 04d ,@0 S E B0P 00 -LDMPT  8 8(K$X PH QL  \ 0 @D@ P0P 8p<`<@ 8 S4t4\4444444d444d44444444D4L444 4D4444V_ L`F0zL Z0Sp6 ? 0 0VK L `F0zL  Z0\"'X?P  Ud 'w\`Pd JRh ? 0 0V# L`F0zL Z'4,<'<$00 0 p80 0Sv  8T\aH  D00L@P(08pS<0S  l@L0T l0 T/^p0P(P8 7 0 07 0 0`l0pPX0Xd 0P P8 < 8 0 0G-|M00\`0 S\ 0 |0  2R0 Q2B@P0 RPU0@ @@@ |ЍU p0 RpW@0 00SJQS03<X 000Q\ 0|0 Q@ 4T $D@0 ^U010!W0!P808 0200@(0@L @$0, 840p  0@ , `Tp$(ń0@p@`p0 4 01# 1 l!c0  ll 0S@BpB @0 D4  4Q40A0 0440|0 2R0C8#(@Ts 000|08"C^B4 0@ T< P`0U |0S (aR  00 cRU  0( 0 [S 3 "R8 080 0  0bC1 @00@@0@d0U0P0S PV pp$(,80>P 0[SP# 0C 0;4^)  P0 4 @0S80 0  04L0#04 0 @!@00 4P @0 !0084 0@00400@̠$0(@,=p=,==P$ R 0SP-$^ 01 0C$ 0 B0P- $P | 0  !400  0-@PL0$Q P*UEU IU[U(0S 0,$D0S 0,$@0S 0,$80S 0,$0,qU0$00gUqU 0UG-p,l A?@0CR0Mx8|P0A?00`0`0, \0 00@ R 40 0 0t%Q!\!  00 RY*PUW  0 ^@ 0@ST@ 0R 0R`  0R' 0R" 0R 0R 0R 0R 0R  0R ` R 0l#PD 0@H08XT0 H4."D H @ H0D 0@@U*0*S -PPL@$`Q00V0SQ0Sn 0Sh  :TRpp Wb0S *R(0P(@ ES\ IS [S gS. Q TRZ:Q Rt0ST 9QN )21C00@S90PPpp,P~0(0,0Sq00 0S x8 0 80 #4 0 8q000S 8 P T  06 T XP ZB0SiS= 8080 #4 080 #8 0; 0  0  "4< 0 "88 0 04 0BL0S0c00s3Y& 00S#l 6;CRP' q c0#2cVl0S 8!OL `800SS@SP  BR# 6 0S   0p W p  0 S,0S ^* n8-8 0 \p,0S ^:W0[0 p0$0S   0$ p0 0W p  0 S,0S ^b:x 0 \p,0S ^|:W0g000Se 1 R !"* 0   1S 0 S,0S \#@ 0 \ ,0S ^* n880 R I00 0_U n88 n888!nk 0SF~[00hg00nI00+ n8s8R n8k8z b8 000C 0 }0 0^a , 0R  S $0QPS 000 0 0  0#4 0 0#8 0 0   R  0S[   0 0S  0  0#4 0,0S6 E0 0 r 0   0   0  R 0 0S!0 00 q00L0D 00pCL   BD@8 8RʟR0l==B -LP@P$`V q@0 T00?Uʄp吐"!B 0h 0 P  0 T h 0 @ |P pl= -`tL\EPPUl8 H 0XT 1#D04 H00 @ H0D 0`p0Xd0x` 0\*,0lpA?C0ChQ 0BSZ``0Sxlp\`0 SdTTT4aLD4A  !t@(4, 0! 0A9!0P933;ӗӅ@! 0@D00tx0l#3LPlptxpTlp:8 H 0XT 1#D04 H00 @ H0D 0lpxLQx0NUp0`0hlp= tBPPXbtPUZB UPh0S 28l  @RP 0C!@ 909hP\l P80 `Z008 l0\00 RtZ\ R80 b0$ l0\00 Rh0S( ||18  0@R0`1  @9H!0900CQ lptp@ lpt0Slpt0 @hl0t \l P80 `0 l0\0R0 R S xp00c Sx0`0 lpQ`Z = =  -LPptDQQl8 H 0XT 1#D04 H00 @ H0D 0pWl` ,0l`A?C0CgQ 0BSl```\spDCD3a83L  !3, 0! 0A9!P0922;ӗӅ! 0002 t`0 BQl\t\PZ0L`0l08 `l` 0HX T2#D04 H00@  H0&D0 ` p BR` l``l`^j \ R80 b0 l0\00 RYxx1 8 0@0`1  @9H!090tl` 0CA`Rtl`l`8 `0`0l` H0XT 1#0H0tQX Q!\l P80 `X00l0\00 R XR5Q3l``-X = =  p- 0!PCUQL@`tP7l0\0 Stl0 P0`Qt08000 al0vl0\0E0 R l \,0 aA?C0CR:Q800_l0\0.0 RpRt0p03VQS \l P80 `V00>l0\0 0 RVpVp 01P? "# $P 00S P0S p-PPLp$`V (0S ,0S 0@0 @0@040  0R b R0q0*0R0,  ;@8(@)L0D, 00 < @CL   BD`21C 0 0|` H@l@\@t@x h@p l= -L M P\p` (K0@R1S  P(0 S0082(0,0S,2,0qV`f, V , `F, 0HSUV00V0S Y00é?Z00ê?40 0[-(V `@P@ 0Πh10 €0 $@B, 0A 4 TP 0`,40Xp00 L00(8, 0(@L 0(0#`D 0 (80!S  @0S D0S P 0`\ 00$P儐删(Ko404 00 0R_8 5, 5= -LM@ 0 0=K?0`=Xl l 0Q09  d0xQxA H0LQ40 , ,0 0 | \0p@-P0P ;L0`&N,;<0 @P` B[$0K8;`p@TjTjTjG-X1p0\;^M0100110\[`1@ 0T'+ 0 P\[3P`1!0 \[\1!@0T:`P@0 R P0`T 0\+Ѝ0<0 R0 P\[PXA-\p10  W@? `P! 0 00P`  ^`  P0EW#10 R^ \^ V P! 000< 000 \( +-Ӳ0Ѳ000²0Ѳ0| G- M0@SR 0 0`1V0ಐ Z < VCP 008#800 "$ 0 c\ 0C0PU0:0. $e0nPuʰ 0PU00*Y   Z  0000C^ Zb \" 10. ppP0gU\058#800 "$ 0 c\ 0C00`F3pP0gUo#058#800 "$ 0 c\ 0C00tsPUJhF058#80 0 0"$ 0`!Q@ V?3pP0gU+= 0%r0P UڬF058#80 0 0"$ 0`!Q @U Ѝ<F0 5 0KŸ 2 % 2pP0gU-1 %qP U>ڬ F058#80 0 0"$ 0`!Q @D0 5 0I$4!058#800 "$ 0 c\ 0C0p0P Uʰ F0 5 0+-058#800 "$ 0 c\ 0C04p0P U[F0 5 0 0@-0@P 0CU0 0 ! 9090 0@S0p p 0<010)EQ )<0803ӗӅ1(0   = = G-4@ MP %!0t`P0fUl058#800 "$ 0 c\ 0C004 Q*03 0CⲐ Yp 3+ 0ण` P0fUڐ058#800 "$ 0 c\ 0C0 0<3QU ,3  e^`aß0>8#800 0"$ (0a"(R#A IX223pӗqӅ!0p` P0fUw\058#800 "$ 0 c\ 0C0 02QUw 衟2  e^`a\0>8#800 0"$ (0a"(R#Al1  QV:0L{`P0fUD4058#800 "$ 0 c\ 0C00 0 Ѝ0 5 0[00 5 00x0 5 0X 0 >0 < 0 >0` 0 5 0 === ==x= -LDMh 0& p`W6@d <d @0 SU 0 5 d  \ˁ\@ 0S0#d0Yd1!0Lşd \ @ ,5 B,UX 00b0 0S0d0h 00?@T  @TQ=0! ğ`K 10\ B ` Xğ` 0Q0CC!10 \K \  000@  0S 8#8  2 P 0 0 `{3p Rʠ`   B10 \ h pP T  X 0\0 \3 \㳐43 ! \ಐ0PU1> 0 L` A010 W`` 0 P0S0\0Yil 0Tl X0@pװ 0#!T R 00" PU`QO G@2 R 0> 0 0 Q0CRA 00 B 000`0 0C BS`0 W> 00L0 # L R 1> 00P!Q@@PE 0Sc0 N!! p^L Y BL pI H K 008#\d0S P@ 0^ `(K 0S08#x 0 ` 0R(K0 rC dPU@(KP=TX< 0@-P@0S S t0 0"$0C0 0< 0 #40  0 -bLP@ Utx058#800 0"$ 0a\à A 2RpgPL+0Რ08#800 "$ 0 cZ"0C0 0!a0P 00eS% U8h0 %PQ XH<0>8#800 "$ 0 cZ"0C0 0g0  ;㳠 0 0 0 % 058#800 0"$ @P0a\à AX 0 >0 =@-0@0Sڀ  0#4 0 L L000S00 0 0000 -0L@ ^pP`=0>8#800 0"$ 8 a#8S2 A0 0!< 0 ! !0U0 0 \  0 >0 -LM`pPP00 @2RU+&(+뤅@010> 0 R@DT0pş  d5 0 ^ !0S  W R0QS3 U@ T000 4 0$00S (Ko40S 9 S Q<S Q Q00408#800 0"$  8 a#8S2 A0 S@ TJ048#80 0 0"$ 0`!Q @Z㈂P10 10> 0 ("(  0#40 P0b\à B U  B p P0 10> 0P U ,0P&M C@   00u00S%(K00H048#80 0 0"$ 0`!Q @00058#80 0 0"$ 0`!Q @tJ0 4 0mT0H . H4A0 5 0# Q= ==0 ## p-L@MXPKX T0 H `l @0D ( 0 , F@P Kp,P@ T@D@00{@? -LM  <= f|F(   -LPC5C5C5C5C5C5C5C5D5 D5D5D5$D5,D54D5(KQ P8 @ , K00KP ,0Z<0 D Z XHA8466c40 <0%J+J 0804\!0l\80   0 R0PZ Z,0<  080Sd080Q :#:N@ :c @40 00@  A?dp?lp -L@`GPPT T pT *p00 p@-P0T0P@i螿PP? 0- <LM00CP@ S LI5pH5pH5pH5pH5pH5I5H5H5xH5xH5,61??3 0 008 0  0   00#2+!  R|I5I5I5XI500 K0"881 00  Kt8 0A100 0L0 ?UU33 p-L`p P 0 Rx L l i`@P000k00C0iL yXn ?pVj 0-PSL@2~s 00H00H00 R-L@ R-L@ R-L@ -L M4  @,  R uRu B,  tR RQ^10Pj400C`s0 40 0 U. @ :    .p h  00 Ep6S @ Q q U:*P400Cs40 (Ku, RPE @`04 @D 00` tU: PP t cP 81X,P D 8 p????@?@(????? -QLM@|h!ph`P$@ H4,D hD?h??????,? p-@P`L@? `9 08plp p- 0L S@@0P  "!`P 0 0!! pPP00 S00@@@ `@P8Vj p-@0L@P  "!`0S R0000 0 0S 0!!pll@P`P R0000 0 @T P {8Vj<< -00LM0  @0,K@ 剜KhVjP5 -L@' h~@P50!  -L@? -L\? -QLMp2>00nN0@`d0PP " 0d 0T0*pJVZ W(0K$ KLP(J0VL00Z 5 K Ojdp -0Lp3 0-@PL|> `S  X0$$  H000 # $00?=??|? -L,M`ʟPQ 0S @0S @Q9% (K @2S% %.9!  p@A0DS, +4 3D 4 P0 @9L 8),9 < 9)TH 8 0 @ w #0DWS񟗣[5W5W5W5W5W5W5W5W5W5W5W5W5W5W5PV5W5W5W5W5W5W5W5W5W5W5W5W5W5W5W5[5W5t[5W5\5W5W5W5W5W5[5W5W5W5[5tV5[5T\5W5W5W5TW5@\5`[5W5W5W5W5W5W5W5Z5Z5Z5Z5Y5Y5Y5Y5W5W5Y5X5X5pY5X5X5W5W5hX58X5W5V5W5$X5W5W5 P0slA0AS Q ,Q, 2 8@TL%40S %%vD T |h4%0%(0 0@%$%%( 0 4 D1?3  ?#%| v%pdk`@pT 04 Z DW p@T w04p@TD @%:0!2 H+%t%%\O8OSp<#B %$40S 3  Z p%p1?3?3t3t#0JS$Jt %L30St 2t  W <%60S %08| thKA; @@ l DW!p `@,   dc_LHZkV\THy<%(as5e'T=$=L??d=====?@@???@??԰??P 0Pjax X1PP0OPa2 7@08!0*4  40L0C0$KTpnwjdplp`p`pdp0^ 00\R 00$0(000Mp@-`R0 0@PU ^ 0P@PU T0p@ЍT -LPᠠZp` @ (0@Z -LP Zp` @ ,@Z -LPᠠZp` @ 0@ XZ -LP Zp` @1@ \Z p-LM ` 0  @K P`P@ 1P% :8 ^  @ ^ 8: S@21C* "!B 0 :0^ 0 Kp -LM@`Tp*  R $ PR @0PS L   0 P  @R(K @ x -LM< \$0P 00c80 0匢Xpw `tŸ Zy0 K40K 0 0S 40 Ro >*"*0L,  080< P @,T> 0\:00Q^ (KP 00b, :#: :cS1!\, ,8  000`Q!0S P 0pW@21C0,0,0X ` 21C0 0@T\ 8,0 0 S0@ p 0 , KDp 8("(8Q, "*46*, (00S 0p dp  -L$M$( 8 R`4 080 0 VR"PpPP%4V@1,K080K  `V 00pR00SP 00 4 $00( 0(K -LM`$(p Q,0W80,  PP p 3U00S 0S  @,K(K QR , 0 00$( p0$K -LM\@P$(`3*KpȌ$  K$K pP$0 0 $P(0`p0. . H Oj -LG? ->0LMd1@ 4  P0 @A 4 0R0  800` p,0 P00U:& Z0SjzGW2 3 04@P! @@X/ Z0SjzG,04 0S,0 <o@(K$i 0 Ojdplp8? -LM0(KpR(0 $ '`00^*P0.Ơ\|@ : c21C!\ c050:00$00$  $ 0S`V k/ K,p -LpP 00S $0 Q Q T5\555X2X囱} 0GS55$5(55@TU W: WE Pf@TU 0Sc0` S`1`!WH0U@ $W W PfU @0Sc0` S`1`!WH@@ 0D 0D` 0 8@$DHzlp??x?pT?00$0(000T -Lp@@`  ,P(TP `00  000$0(0  P0@-@P# T!00Q:P  RR*> 00 0 bR !. .0  00 >00 >a 0Q00> 000 -LM@dPQ X3\P b D S] 2"S0#Op  劰ᇰp1E偰p1@8 |p1 8w2XRR0S  Z$ "10@T "$Km`2 R[ x2x R `` A0B%L@I Z$K0Cp1  >; 0 !!p(%0J S񟗚ꐅ5555d5d5d5d5d5d5d5d5p15 tp1 5d p1'P}H$Km<1 0R0 \a0@PLŠB%0P @`pݯUگp1  կMѯ $Km˯VA=@p|??\?x?@pp4= @nx@@H@ -LM8@\ 00 H U -x!LM0@00 0.!0 S=41HpPw81@  0pfh W&:$`N @0 P 0,P P080S! 0S0 B/ x:  0pfX0 RH  0  0pf08plp@`p 88#4 S #00S - - 88L#Đ<0 40@ Q: UP@lpwj - 8LM8#tP`pB` 0P0V0S @Qv Wꤓ5T5055555555555\^!0z`P `0S a0S^  Q# h`0S`` `Q@1H#R) 5PG  h`0AS .00 ~ 0 `Q! h`* 00~0 0CS xP:W8@0Sxp pO`pl @pTpdp@-@ 0 @@00D| 0^D@ L0H000L0H0 0404550055 0404dp-@P@0S 0S0S00 40C4P0 Q L0H00C0CL0H0550C0C55dp@-@@\,\) 0Q0RD0 0D0 0@0 @"  4400C44 0Q  L H0 0CH0L H L0 0CL0H  %5 0C5%%5 0C5%dp@-x@Q0000  00 0 0S00  0$;n- 0S Q000000 0 B 0S H Q 000000  0$;n - :8LP#  Pp# 2C 0S0 0*"%`Q000l 000000*"%`Q ,@@0dp 0+ 00!10pp-T!0;00,0;0 0 xXj0p@-X0@P R 0S \ Rp@-X0@P R 0S \ Rp0-0L 0 00 0A0/ B 0 0 0 x0x p0p p0?00?X0 0p

0>0S,0 = @8 >0+0<0'*FDv1T, `46TS# <': R<PP4 8#8TS#0'6 ?  \U>0 0@Q1HDTx,(K4' 00 0!zJD1L0L 0 80 @00 040 ,$ pp0ppDppPV 1  0K@ B0P @0 , @"PH0PiUW,*,,,@2C 0S0 *"&1L0010PJUV8 $*(":1 0"P44 <8 40R <@0(< pP8吥(K,匥P:n9nBOjp\pdp0plp @( @ -3sLMP00L 0, P U3 0So`@P %1?^ 0"!B  APP0 " !B 000 Q P PR UYZ @: JT * P \J?T:LbLR0< :#&R?:0R<*0a"!B10b 4 @\0\- 0P0T 0$ D00D0  0g0$ 1 S@ #&R:0R: 0a"!B10b @\\ 0P0TD00D0  ,plpP-0 R0P  0S 0S  R00L00 08   0 000p>ndp$;n 0-0LS@P 0SP2000T( 00S $0 T 00 R 0S 0S  R00p00 0\   0 0 00P00lpdplpp>n$;n - 0LS@ 0L0000lp -LM\0S:(K M08 Y)#:8#*a$#8@40 T( 40Par0f0 R 0f03\ 0 $>"*01\06Y0C<,85Ldp:#:S&P3P#$PQ,KPi '*(":10"P 2C 0S0 , 0  !%*2 P*:#:"*S-*2"$@Q  0 P5 80,0 %*(8":10"P 2C 0S0{ , 0  !%*!@0Ppm P61!$ Q0 ,KaP f 0P 8, **(8":10,@1\"? 2C 0S06 0 00* "5 *  4 21Cf  000 0+ ;0  0P 80,0 D,K PvOpdp,;nlpL:n<:pn$;nlp -LM@4 ` 04 SPa4  U030#T,0 0` %|*0` $!*! $::4p6Sp1P!h 0"!BQa 00S] W\:#ePQ O tŸ &Rg:0Rd*0a"!B10bP 4  0 %R55SSH0SL L R0R01!0XD0`0óD0D0` 1Z?   :D0`00D0,0S'0 0 0 ,0 JW`@40S, R 0 0S5 0  0S 0,  (K00,0S0 S  0S 00  0S \0 (Ko&<0H=0S 000,p4=dplp -LM`PP "&R :0R*0a"!B10b080 8 p@@@@@V  JY 2 (K**(":10"P 2C 0S0 Y : #50P0 40  0>0S8 d#&R:0R*0a"!B10b8 R D08 7\ ,  \a < g<p%R5 SH0SL  0R01&0QUD0`0óD0gD0`d P0`00Q00S8 0@V 6 Z,  , 00S000$ $,0Pv %VV 5 RR 0RO ,04 00S 8Qa %RW5S8SH0SIL R0R01$%0ATB 5V  888D0`00D01VY  < <D0`00D0W@] 8D0W @T,40\4 ZP  0$*ʠ !0R 80L 8 58 D0`L RMM5SAA0S \ 0SY  3DQ0S| 30w  < n<Pv0Si 43 dW 0P,0 ,P V 2 Z2, , \ P) < _<p%R55SSH0SL L R0R01X"0ATD0`0óD0D0` "Vu  < (<D0`00D0 P0`00P00S 0SU  0S ^ 1DV88D0`0D0Vx< <Pp P I 0!VG   Y B 8 0S 0P08 @ 0PS `00 W 0H 0@ 0S `0P  < < ,0@(媛,p,pdp~p@g00^0L PU@`H@ $@K,0$ $ 40ZUzj- K嬗@Xjdp\@H -8q@L8P.W8!.@ 81:40x4`81L@F@8!L FX 0800`F`0 0 04<AZ0@L0"[[[2[x h[[$[3[xhXjp@-c@bP`T !L2pQ:P: -LMz -L MKrK K0-@"P#040 $ R ((0"4Svj40 $ R ((0"4Svj 0vj 0  ꘕn -l LM0S 00L&H0H@ @@@0oP ,0 $R0;n|=xjxjzj Bd@ P0-L |1R t1 0hA00XQ 00D!S SS@ 0S SSQ00 R R 0 -R R0Q @a0AS5|555|5|5|5|5|5|5|5|5|5|5|5|5|5|55X 0Q00@ @ + DSBOnpwjwj@ -LMeP@, K00KE90嬧,`.VǟP@fwǟ$F@`xǟx 0E`PdŒD0 T0b#6`P0X7 @T:00C)0`0*V0c140 ! I@9#9S &@0^:6BAD@L*t0 1`0b*V0PX} I$ITyƟ0 C\ fs:00C *0Ͳ0 C\Ub:0ܥ0C05 *㻲ş 0B10a\0tJ:0 0C0t5*㤲`ş0 0B1\<0a03:0 0C05*㍲ş 0B1\0a0:0 0C04*vğx 0B1\0a0:0 0C0l4*_Xğ 0B10a^0:$4L*I#oSA Eh2T PC  ^Z @C0pßS@ ^㘣N@PƠ`@&l0@  0e@ Ÿ: @: @: @": @4 9@hB{o  @P: TL2 $\2 0y<YŸ0>0>0 a"&2 !A   t1!1X8O⎹4T∹ ⃹X!X1X T1T!P1 L !0 4 "w 1 00 :b0 @|0 (Kdߑ@zj@pp dpwjp\p@hppPpxpppTplp`pp$pB?p!p `p|=jlpUUUUdpn5j5j< jdpn8@ @@ -0L @R  @.L0  "!  尐宐V/Sh姐? ~;B? SRu v;B? S?咐PXj1j@@@l@ 0-LM@P |)}s8`P: P0c 0KsP$0$f廪 xj@wj@ -L{'o 0 h:8?PXj -LM$@K0P(0$p0DP `yP@ V 00;000  $K(P(Tⶸ0 @0@,((P0 009000 01@ڨP&BQ  @ШP phr 0phig60 @ ]ZxVpShP60,XK LG60,@@@|@@|?t?@h@p@@@P@<@$@@@@ -0L0S S S@ 0TLH @Dg[P 41Cc:n@ 0-40L0p0CS Pࠃ @^   00060 ^ 6 6\6666D66<6 6 6D6<6P6$0( R0@(0 @@@@X0SC @0A P$RFD1R;B0CS0h@0A $R2 1R:BSV@@ A04R SV@@ *@0A $R@@@ A04)0"0H@Qt0@uL  R  pPm  PPe 42 0a0  p$0 @ @ @}P OP\s0@,0  Y0 040  8 0<0 P 0 8 <040P  0@,H, P`0@D00P `  p4 0@ P#D p<P80` !(< 0@p#L4P` P`  ف@0s PH K `P`(KY0P`0P`P`㺁P`ᴁ N= -L M0S` Rp 0@ 0SZ2 K <00SG  03PP7 04SP1Z00 00S< :<00S8  R00 0S 0 480 00S# 08 <04@P(K  0PPPPP0 SP R00 0S 0 480 00S 0 480@P N -LPp`Z@P P 000$ 0"U0 P$  0?P -LpP`6@P P 0000$P ` %%%Ġ_0 P0pP -LM0*S$ SD AS S08 <04@  (0, $  S (S S |508 <04@ 0$ $K0 480 @ P``0S<0S P` 0@,P (` ,H`P,0Kp0@PD0` p0@ L#D <P`0@(!(D#Lp4  0  8 <040H@ -0LS@`L~PP `G ^00 R00 @ ` 00  0#40   0 0`P=00;000` P`70:0 0p0pA00, R00 R 0( P0 00 0 000000C2Cp  P 0$0  ^`P ֨` -0LSPpF 0SpB`P p=  00 P600;000p PpP0:0 00 @ @[@F Z ,0Sh16160606\1616160[0 R 06 P n P p 0$00[0( $00b $0[ |  Y 4(e0[0 Y 4(]0[00[0 ٧pP Qpl@ 0-Ld\P P1\ H1\00 0`Q 0$ P 0ă \ #\  0S Q Pa$xhl}=pxj -LM0R pO , 4 P`,  VP- 0`S0SY8 P P4 ڜPG0 0  ќ84000P 0R ,P ,(K Q-Lӂl@ -LM< 0p,0 @P= 8`P XßX ^`KD PKk=@KL f\ b 0 P@如2 s 塂"20 嗂x@T \ 0SY 0CS1p=6`=6=6D<6Px20  P Xv=6=6=6>6=6=6=6=6=6=6=6=6=6=6=6=6=6=6=6=6=6=6=6=6=6=6=6=6=6=6=6>6[x 02 0SP U0S Kx 0PS@ QQ 0A_S3|0@!08)0 , 0SPx0P @Rx x x x ĠGE꼠C긠A괠?갠=ꬠ;ꨠ9ꤠ7ꠠ5꜠3꘠1ꔠ/Ђ[렕n@n@n@4n@Pn@Dn@Xn@n@|n@?n@=0"0Q_C 202202  202,04@KS!2$022003 S2ձ02ű0 4P [_pPX 80S 2 71 - 1_a2 `  #X1 -]`Rr0Sn$ #P 1!2:2B2<2  NP 0S:9{P 000   M뼠 :zx埀xP8 60 RezP`< : fP` X 6pxj==36>666u?@-Q@0 2^2S00? 0R@ -LQp`0P/2\,2 S00?& 0R#@P 2` ,\`P2 00 0SxPP,#`"# -PQL`0p2U2S 0S @ P 0@ PP 0S  -0`L2SpP P@ "PP@PR -L M P`0p[P  iP 2 L 0S@ 0S CP@(K>0 !0Q;zP 0 0P)08 <041S,0  p @,0@S 0pS Z 1 & y y=pxj' p-0PL2`S@2@Sp0Q 0Qq0s q0sK r  r 0Z Q 0-LP@0h4 0-L@P T,P T0Z0Z0 -00 LQP`p p@ 000P @pR -3LSP`p p@ 3P@pS0@-qr@P\^  0@00@0@0 p-0LM` Q08`000 2S020 23 0S0 0~03S0 @00h~040TKP H~xh4~00$P~PXjpxjn@@0H6n@n@n@ 0"640 0p0CS_0S 0@ @0A $$R0A00' -L`Pp@P P 000 0P0$P0VB000%$00@0P0p P 0-L@P P }>0P0 0-PL@P P  00}.A0 P0Ps0 -LpP`@P P P 00 00G0P0p`0000~PQ N -Lpu`P @  0L 0'̠''D;0(T @0pP[@.@  p-L`PR@P P  0, 0f0C P0`@Pp@  -pL@` "xPP p 0@P p  0 0_0C$p P0  $0#$ 0 pW 4w 0$ R pΝ0u -L@` wPP p# @P p" 0$000 R0 P0  $0#$ 0 pW 0 $ BQ p◝w0u -pL@` wPP p @P p  0| 0_0C$p P0  03 0$ "4 0puW Ow+^0u -L@` zwPP p# @P p 0$0p00 R0 P0  $!40 00mp@W00  w0u -@Lp HwP @2 VPP @) p$00 0` S$,S6S6 T6lT6T6S6S6@U6U6LV6V6W6[ 0  00$;0,@T0#30v@@\0 @00 30 0  Bל0$@:0@T00 [0 0030 0 $+ @T 㳜[0 0030 0 $+ @T 㛜 @\0 @00 30 0  B⌜0$@:0@T0000[00 0""Ġ " 030 0 $+ @oTr03 0 "#  0 #200Rb[0 0030 0 $+ y@LTO000K[00 \0#?  0f@9= [0 00$ ;0W@*T-0#30 !  000  00\00    0$:04@ 0u -L@PT v`P e &@P \ T0$0x10 R0 `0  $!40 00 XDP@hpǛ0T00 T"" 0T00 T"" 0T00 T""  0T200 T  0T#20 TT T(0T, $ 0T T T8 T<040 TTT(0T, $ 0T@3T 0PTsu0u0SLY6PY6TY6XY6\Y6p -Lp P`@P P l 00 P$`\ C0W0000&4 0`PY p-ML@`0 PPP0\3 : c 0PKp -L M`S@P VP K 6T/ `o0FSPCho@'H6T:6x6T3 p6T3/ T@ m@Q QU @@P @uoP ` 0@@P&0"  04"400S@  3o@T @ NoP @@0@@P0"  <(4"4!<0 2  04"400 S0S00nu@P 0@ @g@`0F,S0o 0P`@P 0 $ R !Η@0nq4@me/@g @b @] v@W 3T D3TM@PL@ 0@/@? Q@82T 0T.  0@( 0 @t20S @ 0PY@P \@ Y (2T 1T 4@ 0@1T 1T@@ 0@P00S 0"  04"40  BR !"@n 0@00 0S!Q0RPZ!  00002  <4("4!<0^LZxjc@c Q Q@c ccedA c@qdQ ccc cmhdpd dc c c cQ`dc c k~rdA@-0Q0 ""D0@ 0p@-0Q""H"T *(,d @P` pA-0Q#l#x# 0""H"T 0@P `p0G-,MLQ.#L$@( #H#@@. 0@@ "$"h"DL h`@ ##x#T0. 0 @0 @0,ЍR \ \ 0L_S BR00 0-PL2  0x@P  5000 +0C0 fP0 000h5꠆ -LM@PP<0 r,8 8#)"Re0!R8 ` `( ,P@ Z ?K0 20 Q, Y4 9p00 B  @0@P4`0@P/` R.+ Y#8 `P+ ,0@ 0ʌP P@@<@$ P 0@@T 8 00(KQ ;nxj' p-LM@`  lPP @  0`@ulx p-LMP  `@l@P P @ 0PPP @Zlx 04<S-P08 <041 (0, $! -LMP  plP=  0@Pd`P 0t"lZ   YlP& 0 @PM`P  l0S`W S Q 0S QP-` ` 0-L@PP 0qP0hQ -L M0   ,0 L lP * pP  <`KՑ@ a0 P<0K0 K2 K1 K;@K/PK  p1@0$P @ @\ @ k@ , 0 RA(K 0@,Hp`0@ PD`p0@ P #D p<P`0@!(p#L4P `  0 8 <040 #000000J렕n Np= -L M0  pLk`P  PP  *@K N%0*0K 博 000 $ 0 `xKX %k K08 <04@0 @0@ 0(,0 $00 N 0-0L> h0 @\PP 0P0S0S0h0h= -L0M0P<0 ,0 00 40 80 pPE0EkP Pp`' @@K P 80K @@@PP @0S 0S 202" ` 0SYPp` j@ 0 0S<0S< 0 S  S  S (KP000jP Pp` S  S  SR0D#P<3 0 0 0P0@00 W00U ? V0 `0S<00S S_ 20"S P0 V 0 0D(040 P @0@<0 8@ 40@$0<@K00P4< 0L ᔔ20  YC 0@Q Z  0 U0$!:0 0 0H0 000< l1$ t00@0@p@P0 00 N000. (K (Ko7 ;0 00H0 0< 0$ t00pP2 0@Q  R0S0  1,P I(Ko R 8#8 S  0 @0  %`L6 p-DL!88#P!L`P 0@ 04000< ;00@ G@᰺V ph:G02004040pKp Iph"G#@ጺyxj 8 8-#DL$`yLPP 0@ G0p2P 9L@T0 !22 022  CAIPF K 2<2.axj - 88@#tLMP'-L`P 0䀖@ FP 2 F P0 OPP p0W Z,p ppS 2WP , 0KPQ0"22 02 OF0" W-.202.hPP W2"02P 2P02..0 Pxj - 8 8LM#T%KPp 0@ p 8F P0" 0" p\  * 0 P 20 Rp(PT00` @u(  0 *, 6P,xj 0-P@L(OQ%0O061j -LM`2`x2t"0 S2p<24XS2֡(92ơ ^,p 0,"0Q000IOi"$ C0?0" X 2P P@C 2;T@`Z@0 0m0 d0`i0@G8iL(@K   ^P(0S!  0A%P' 0O K  @  0 t(0 1\X 0%PDni<ki@pxj6=@̔66@0IPP HaP P P `NAP GP #PX APx P_ HP }U JxPl -Ux .U ,0E@Tl9i* (0ES-0ES|-U| TTxpW ~0S V9 P a#P AP.U,U``  /U  ,0E@T..UJ =;'P =7'P VLU .U =-3P =)4P T|0,S 0Pn .U1 V/U?P}@my wUP \Ps,0ESp?iP\ml ?`PHmf ?P4m` ?PZmYPV,0ES|0,SPHPL?P ?PD@l@ >?P:GP6@l2 0JUHU KU0MP MP MP$GP0l#LU MU&P"?PkUPF P2 MP0E)US+U*UCP L0ESH0ES+xkO|\P' OxPU@tNpB 4kOjP<f Xb1P V E[yPWQPS\P OP@KkEAP*@A@P|j :P 6@ 2.{Pl@*P@%\Pt !P@ kHW 0(S  HP )`P00NPP@PV@\P|iN`P@PV@\PHi@~NpPu$@P @sOP OPzF@vX1Pphx j8P 8P MP  TP  TP TP P8P[ @8P` ,8P 8PD 80 S>Pg9=;P7@`3@T, @}T%!y@vT"r@oTkPPg H0ESbP^Z Pg00LUQP@MIEA=951pfLU*?&PHfLU7 MU\ LU!P@* PeL0EpW0E)US@@+U*U T+U*U0PP Wk?g P\e00`P~]PzE4Pv&PrXPemzPl@P PdP`\XTdY N,0ES?iPh ?lP "P@d ?P(d.U,U /U?P@c HP@~|0,Sc?u P pAlBhtc |0,S?_ P'[pIWP0c@P MULU NUMULUD NUPA?`P ?;jPb=5pPbMULU7 NU5 9X)1Pe 2!P|b b0@SabP ?jP@bV@\P0b @@ XPbH &M10 S0G10Sa)?> P-> @;D10Sa %3P%010Sta YP +EA P0,a0A910 S00S`c 00! S `W ps@s@u@u@s@ s@s@ t@dt@t@t@4u@t@u@$u@1J tu@u@t@t@4P:1@*6 P2b- @P(c-@?P0Pc0=bP\#@PxcW PcYPc [|QPqN@xPlt Pcg=n0P =j1PBf> bp:^p6Zp8d 0?T P ?OP)@Jtd #V@Dm@PdgG@:P 62P@.d =(fP'@$Pe=hP)@pP(e P@ % P!pe~ * Pep rPe 3@Pe qPe?P@eK /@l php f= b yAuBTf/ o\fk0P\hfgzPpfd PU|f`\@^ fZ\@ fT 0,0P L0 PR*H PL U 0SH D D0 0RP D0 (KD0 T'p=P662P-- -L|M0pH0 @2D@ `{~G@` pG< "8 D`H0@4 C<`N8`ᒦ1!oHafAL 僁!P \ 儁!Qd 偀 ጀ ` 兀 ጡp 匀L X 兡t 僠ᔠ 匀 唀P 匠 \ X厐`d 0h t p0 x 倀H0 匀 hD0 0hT0 <@0ijh800hl0 x40  0h|0 0 pcT 2l|@PBRb0 0 P @`0K/0K.K,K-@K+PK*`K4 (0K`(00K`c"(P@ P @P 000](K00gfffv@ -L!H L P 4 L P 8 @P < H@@D LPp PP` 0 00 Hv@ p-LM00 KP@4 `0K(0c K"(@P @P 00 K]Kp00xv@ p-xLP@;]0`00 X04 @0P P0D H0H H08L 8@P`  phv@6P6 66Hp 0-LMP@KdPK0 p-LM@ PK `a} P@ N0 Kp -LM@0K 0K @K 0-L@KM000dP0  `0K v0K 08 -LM@0K 0K @NK -LM00p娡P`%K @ 0PQx0p1x R6\6\6\6(6(6660x0`VDP00& K0P,% [R- R&0[-&0[S*0@d0h@%[ $!B30b 03dh% [31C03Od0h@% [31C03Od0h@x00x0&0[S ݄dhHyj0G` p-LM0P00 #\ K0b`P6[  !\ 0 600@ &Kvl@ <Fv08A@@|aaH22 P@o 38@T@L[x\@[00x[xv@v@6@w@v@ -L up3u@ -QLM0P@)0KQ0)0K)4 `()K0"(*Kp 0@` pKP &2*[0 Œ4 0("( 0*K`` p600(K Q0 0)0K)0K p-LM00P`V000K0K4 (0K"(@0K @ 00[0PKp -LM0@`SP  K0 `K0 P0f"pK0P P P0 0!Kp PPP -LM0`004@P%K&KU0L00C0HP%0K%0K4 (0"( p 0 pP P&0[US20T0@808 <040@ D08`(Z00$K6668w@ 0- PL @ငP0,= 0- PL0@u(0( 0$0 0P 00,=686666 0- PL0@\(0( 0$0 0P 00,=6|66660  0-LM@TP(Q*0R840D d00 8 -L`[\w@ -LZ[w@ -LT[w@ -LN[w@ 0-N@0@@P@@eLg廷0 0h3dpOj -LMp\<W9*0Q`5 0`0 . nN0@`dkPP # :#: 0T0*pJVZ ߮W(0K$ KDP(J0VL00Zo KOjdp p-LP`ðP pN@@N^P@@e0 phʳOj -LMp@ኰP3>00>N0 @`d PP " 0d 0V0 pjVJZ  ~W(0K$ K\嚯P(jV0JL00Z0 K 00b 00Ojdp -@L pP,` , ,<0?c `p0p x3l0L#H3d d0T#P3\ \0\#X3T T0d#`3L L0l#h3D D0@p3t#<(r5\55\z5X{5 |54y5~5 r5}5Lu5|58|5 -4L\MT04@0c?0<@ \4<D P0\4@< L0\4< H0\d04@0c?0<P \4< \0\4@< X0\t04@0c?0<T \4<X p0\4@< l0\4<$ h0\04@0c?0< \4< 0\4@< |0\4< x0\4@< 2\4<\ 0\4@<` 0\4<d 0\4@<h 0\4<l 0\4@0< \40< ,4Q? <0 \U? 0  p l0|"0!20 2"p1p!2"h1h! 2$"`1`!(2,"X1X!024"P1P!t82<"D1D!@2D" (1`V pϏ@K048  0@` < 8 0@ ,P 4 7 `V40 <,|`KLP T<$D@x| o d 0x t pp l` T@ X 7(Kp5\5X{5\z54y5 |5 r5~5Lu5}58|5|5(r5=6pw@808 040 0, ,0 0$ $00 6666666 R!800P500\!400 -LMP@ p 0`40< , P0 S 000P 0# Հ%$    0-LM(0K@P K00P  "!4 (0<\40< K8P 0!!40< ,40< \00 -LMp,0K`P0@  "!4<,0 \4P0< \@0  "!K 0S00yj0@-tQt@QU 0R PQPI R0ĠC00P0 R 04! 00 Q0@ TP 0R 000R000R000R0 00 RT0 , !160 !!0pLppp06@0 - -L@@00S0  "!p -0L  "!d0@S s0 S #0 000 R㼓ʀ0  "!᠓ 060  "! 0!!R0!!  !@160 !!0 R "0 000 Rؒʀ0  "!ἒ 060  "! 0!!0!!  !@160 !!0 R " 000 RO 0!!0!!  !@160 !!0 lQ d! 000 RP7 0!!0!!  !@160 !! 1 6 0 !!0  "!ᘐ 060  "!0  "!T 060  "! 0!!yjp8ppLp0!!H H160  !! 0 1pLp8pp -0L@p-0  "!H0C  0  ! 0!8ppp -0L@  "! R"10L 000 0 4 R@ 0!!p - PL@`p.8 {PP& 2! 0W` `4p@  @  0@!! B 0@0 PP0  "! Vp x@P-0P !!,160 !!pLp -鐑Lp?o`s>J"1d!Z0 !!@160 !! 0 !PU PP 0@  PU0!! & ?o`sZ|0  , !T 160 !$ 00, 1oppLp8p8pp -X0LM RK@K%#000S  P T1jHpXx@ p-(1LMP@`;Q0S4  KP 0 &S  R0 @ 0 ,`TKp Q  (K31C01( $0 %V | 0d#@Ph0 T`0 XB(`P>T @ 0 <8T8@`03T>Hpx@E.x@x@x@xx@>x@ 0-L@ `0P|?0d0D!s "Q 0 b 0h> > 0  0 06 &06&0C68 l0@ 0@"T0 (K nHp$n 410*0`PRhA0S 0P  S0 NK 0$$L04 P T0*4\@dplpt`0 H`X``h`|`x``` $3 d0l "3*pt`0 L`H`P`T`\X```LPDP<P4P,Pdpp,z@`plyjy@y@y@ z@Dz@ -40LQ 0ip3dp 0- @LP P 0  4     4P@0 -RL M@0 , 40 OPDpp W? 0  P0("(R R ! ` % `Z0  Ph0 P` P  ,4000S(KV 0 p-LM@ `$0KP K0 0K$% P$0 OKplz@ -L(M` @0  P (0340 5|*0P<0 QWÙ0 ,0 10 40PUO 0@   00 cp08 #0R00 <0 cp, WÙ ,K80  p@ 0<00<0 80\  ,0pN0 40PU< \|30|30 <0\~N(K8#8@ 0P 4 ~ 8lN|30|3 4 u4zjz@z@\@z@z@z@z@ p-<0`LP@ ,0 phF4zj7 p-<0`LP@ 0 ph14zj@ 7 p-<0`LP@ 0 ph4zj,7 -L@ `TpP  R T 0;P `0  0 8#8ST M4zjz@ -L@ `TpP  R T  0:P `0  0 8#8STM4zjz@ -LM`PV@p  0SPV0Q: 0L0S:1  M0S $K0 @;PP`0 0 0P  0HQM0 ,IM EM4zjz@0{@T{@{@ -L M3#@P `D0@@@:#0 @@@:q08O0 0 0&30S 0S30S 0S00|3 x0n\0 K|PKhLDDL|,L,$Ll{@{@4zj 7 7D 70|@`|@{@|@ 0 000$00 ( ,07777@ 0] -@0L  vL>nt|@ -LM Pp 0 4<H`, L,0K T0(0K$ K$D@$0S 0H< L@($@L KPP ( @ @P 0S L0S 0H<   00H< ||@hp -0L`PVp# 0S @1@S 0   08P `V\,L0P @T 8!L4 0$T0 0 zj|@hpv@tzj{j -\0LM 0 K00   00 0 0 s00 0 0O+ Kzj7 -@LKq K|@ }@00  -$ L@K h2*lp@x7 -40LQ 0ep3lp0  -LL}@ -LL8}@ p-LP`kP pN@@N^P@@eᤥ0 phrOj -LMp@2P2>00nN0`@dದPP " 0d 0V0pJVZ 'W(0K$ K\CP(J0VL00Z0巨 K 00b 00Ojdp00s0{j p-LM@4P 0 0   P Txh%KF`04 `,0P x xhK \}@Z!|}@R 0S p 0P p0 P p-L M8`K@P GkT080K@ 002K2K0 K1 K\0 ,0 H@P DJ2[2[   JKpJ0u}@~@}@ p-L M !@0PSKp8`K k(3@  U002K2K0K1K8 KX0 ,0 @P @J2[2[  JJ0u(~@x~@T~@ -L@0  hꘕn -L` P P@ P PNK0pW JP ,jj( 6Hd@00;00000Evv !00~@*~@ -Le j<(00谇>(< p0@ 0@ R-T % 0>0>@>00>00 > 0><01H q !3- PPP 4HmMS/q~@ - !L80PdqV 0 @)0-zh) 0-$1LS@ڼP$1 0C$1@#h$1SP0 -LCM⤁1 a$ @0!0P$1KR&7$'7'7'7'7'7>@@3SDG<00 @)a0,$10$1$ 0R: KQ  IOK  <p :@0 @-@3S0@3ʀG|0Sdp`p00 ;004 Dp@rG00 ;004 $!렕nX@T?L@B,@<@@@(> p-DP!88#L!(`P040 (304000< ;00@ !@ኖwV ph#'p 0<(oP040@3[ph"p@cP{j 0-@LP(,\Q0,0P!71j Q-L@ Q 18%6 P:P K: 18#640J/g' B -LlM08JO$1 x x ( a 0 40 !0 03 =PWωQK0 R0 S 00 0C(P R00|F < 61`S00x Fu? @3 ( (( @(H@ 3.@H_,C0S%0PsFsO0@tPK[ sb f0 8#8 Ϡt Kh 6K;P xxXFxLU\X" 0P\ D  0e,00Q( 0Rx$K2P0C0C0`0 0h `@PpHP`#H8P `,S0c0%sO`F0@tPK tPK jf,0  Ƞ,Ƞt0KU ?n Kh0 Kl;P xE0   Qf 0  Ƞ,Ƞt0K ?n Kh0 KS;Px xEtxE0 0 _,C0S%@ PETx\ExT]렕n B@@@|@1j7%7@@L@t@.*@pr@0> -LP`0>@>0>400( ^01< q P P 1S17172727(27S , 0R7(KEEE41 (010AS0!0cS01 $<S0!,@P`< 0,1KKOK  < xDtDhD`DXDHx00{jn{j|j|j@@4@(@@@@@<>8 00000S0C00000 000 0003 4 0  <040 0 @00 p-L `@PKO50 000 0 B4 p8ph p-0L @` P 0(05000 8 ph3K$ -L$M# 200l1 7 =7`=7;7;7t<7<7=7=7@ ,04P#00 \00!03 04S\00#10,@0 00  8N0#8@ @ H2000,00,0^@ ,04P00 \00!^=  0  2 000 #, 8 < @ ,0s4P00 \00!# 0 4009   1000i8< 00i10 > 0(K@,0 =4PLŸR00 y00! (Ÿ0 A00 c A0008 < 00i10 > A00H 3@E 8^B4@ 0  @1@SdB@ ,03P 00 00! (\ 40S 0  0A<8@00i10 0 >@0400:@e3oA3 0004 \XPH}<,(ȯ@7d@@@(@p@x@@H@X@P@ -LMp 200l>@ TP 04 @`=Up20 3P( 00  Z0@6 0T R P0000r P 0  A000RU@ 0@@0@000h$KP 0  00 00@000R000I0$ 0P` 0 0@  0@$ 000$ bQڰ0?\{P000  0 @@{Aȯ؁@8@@\@@@ 0- L0P@K0hȯ p-PL@8`2P+ 00 00000 0 (0 S0$0@00 @ ,00( 40 ,0, ,00 4000ppC7@7@37 -L Ƞ Ƞ,p 0 Py!@PD 1m8!`,dhf6.` 1Q0#S200a1?0 10>>p 0>06N1 Q`f``3 ;`3`#  `#0!h3P0t#3H H0pp3ls#o0>#10#{jC7@7@37 -LMP \`Qp @p @T V4 0`D @?ZT(  }?(|j|j@?@|@ - 0L00S@ 00S00 00S 30 0  -L M<`Kp@ P_0<0K0 60K@?4 K7@KSK00 5 K4P3[ K -L M@pK0@ `_0  @ 09 K!@0K080K4  9PP 0l3K0P ,` 4P@ 9 K ^0@0K18 K40 9 K3[} 9 _09 S" 6 04"40(Q(A 04"40Q. 04"40PX93(( SSM9 'NEFX -LP@pA@`  0S $L@ -0LSpP@(`0\ 06 `P 0 S0%Ll2@l 00# T@ 0`00S00P0X0S0dQ S@@ `@#`d@ -@ LP |0 0 - 0LS@ 00 0  000000 00sS 0S  p-0@` PL0 P `p,>n$>n0   ,>n$>nQ - Ll0p0X00 SX0S -0@L0X@ -@0L R 000S 0S  0$>n(>n,>n -,L\ \ $>n,>n 0- 0 @@ @ @ @RLP t0S pl  0t@0R Q 0 0# 0@00 SQ 0 0  00 0 0 00 S  (-"H 8TL`P#x. 0T% 0CT 0S :h 0@Sh0 0 : Sp0Tx0S \0 R00h 9h :| 5j -LM`0 Q Pk U Rd0Ra0 0@ QP  00KPPP0; S Q Q Q K 0<0 0PUQ W \P\ 0l@L00Tq@P ;; S" 0 @0E8 U:S00P 2UP 30E8S0E8#X8UP 00Q108#XQ0 *@K AO ;q0 9a0 0[0 0U0 0O0 0I0 0C0 0=0 @070 010 <+  0pC p>0Sa00 RLPhWD0W@ ;g80Q= 0Q1<  p-0LM R3 00S 0S, @P`0S0C00  0AoQ*0 R>;  S0S0C00K K 4 0 Kp$>n(>n|j >n,>nPH 0P 0Q \0SX0S  H|j-00 Ƞ Ƞ,1XP H|j -LD M\`@ %(4\ :40S P 4\# 43\i B3\ 3\ 0p0  0lP K3\ 3\ 3\ t3\@< S0< S< 0S@hP43\= 3\ 0\s 3\0SJP2\ 0\x 2\2\ 2\M 2\|0P       00  0P0 0       0 00p 00lP!0p : ]PPB q0P0m 0R 1  Z^P`PP8Z0P     00 M   0P0  Bp0| 0|PP{ 2  `dh Hh0(K 0 (0 $@ PP3 W W WW @W W@WWW@ W @|jW WWp|j -LM\ 0\ 0\ XP, 40 P0\ 0p XQ 00S00XP 40 r 08 Q}f~fvt|f 0-LMP@@0@0CS088@- @.@H|j -h0L Ƞ Ƞ,A0S 0400=00CS0H|j -H0 (("LX@T 00XsH|j - (L(" PP#0AT PP 0SP \0SX`VP 4pW0H0PP X`APH|j p-X@LT` 0 ! PaU  2`# PG0S0Sp04 ph, phZ:0000S t@ Q-L9萄@ p-\0LSPx0SH1  X@T% 0S" S0`0CS0000 R00G0S/0S&0 31C P0Q!ژ 0 S00 S P0 pP;904 00(>nB@vj8cj]7@ -l1` 00x 0P SpLpW9090S3 1h0h0 P hl 0 p0 0 Bt 0 @P/h0 |0@00 R8WyP lh8 $h00 h^000P8$9|jĄ@,>np|j|j@@(>n@̄@0Q 0`c 4S @08#<@8oS: S>; SP 00SD> -L@Q c7c7c7 d7c7000000<000000000000000000 -<00000@ L  pW`V 0S \ R P0 U*\  (0- @L hpp p-LE`P@T @T' Q0000 00001P 00S0@Tz v P0  zppp@@ p-L`P@T @T' R0000 0 0000P 00S0@T;7 P(@T0  7pp|pH@ -HL@ @0P0 000P ..7j@@j7x@P@@0@-D0P <<<@P880@P 0@bpppp|p7p -LMP@~0@DR00}/#`B1-T-0 0=2$KTKʸ-봁p0`S0 <20<20 @20@210@X0\P`pd`00 qd0d2S: 4 0@ P(@X0S: 008 R 0 +0 <20C<200="Rh00`"R 000008$KmT A-00=r0S d8-00=r00X 8004=r$Km(-j@@@PXjP7xp @̆@@0S0="R00 00 0`80  80 -80 @00L< PD0< 0D0 @0 -D0008D0 L<00D0 <0@  -D0L0@80 00@-00D 00 00@  4@ 0D@ 0-L  P 000  P @% 8VD04P0D000@-D@P @  4Q D@00 0Q0-0R00\00^00P<0 R2 1C -L00 00P0S0000P0S0S80"00- 04 P#*0 \*0S \0S  -@0 PL(0  00P0T -0L 00 -Q  <2<200C<2<2 L<2S 00-0^  0S 0S  ^ 0@- 8 ȠPQ@#,Ƞ R 0 S0^ ^00 -L@? 04 - 0SL*@T 0S0P $++ +d@@@@ -@LP 00P t+00ć@Hj 0-@LPA0H0 @H0P00@0@0 0-L@*P/@0 -P@L0(`nMb@ 0-LP@P 00h -LHMŸ 0`S, p P0PU@@eU8ePe0 080P0w) g K9PPd [e0[e PP @ 0PP @T ew, 0Ri(KiP0SPT00  0 \+Y P @   0@PQ! P ? _0^0Ki0^KT K]K[KX0KWPK\PKZPKYPKPQ0[ 'PPpe TP8P P0W 0@@W  PP @TJ@TZ0VKjPV0[ ꠕn@d> -L\ef\0M 0\0 R0\0R `0 S08 40 P0 T XK 0P @P `\e nP\| `\0 A\0`0!m` d0X3 gWe@Ta "P@eUp7<7@ -L M`QP M0S@)pK$0[S M0@S P K 30 -#0LMAD(0K0CP(K #@K'K&0K%K$K"K!K`@P  K p2 @P0 0pW@W  @ -#0LM`AD$0K0CP$K #K"0K@K!K `KKKpgP K @2 P0 0@TT -LM4 @P0 de `PPx 00$0010 l30  4 T0C @2356 00 `Q 0XS d 0S`  R0 02 !   $ 0PP9\j @<@ -LMB4( @DpT TDd@ P-L 00 .>$@T>n -LM0K0K⠠P.KBD/K -KNL`(pK0,PK+@K*K)KPP(0S @ 0DĠ)K*@KP(0 0$K -LBMTpQ@P` P(K!rJKI8 ,K 0P,0pVp?0@CVT JK 04("8  00X00S"PH`d  Tdu 7@ d7Pep g6@ d6` 08 Y, 0R(K*렕n|@@@@@|> p- L@` 㨿P ;p -`LPVp $@T&x bQq TZqHVV ,NqGt?@̉@@?0@- @ 0 XPX ăP Q0 S $0R ^0 0>X>R R0l4C -00LX`V( 44c pW0P0@0 PR@ 0WPf8Pf0Pff߾0 0X0 -00QLX X Zp`000 PU \P P @[\0@PpZ` -LMX p4 000 P 50 @0S0 0S ,4  0S'`X00 @B P P0  DPZ P X0S 4 ` 0S(K O 0S 0  E  M K fP> xP 04  0 00  0`PP6 X0S  !0S00 0  ,  %0S00, x0 l 00 P00 < ~00 ( @@\@,@@x@ -LLM`0`,0 P 0P%P8 0S;_0`KTpK`0K_K0 ]0KZKYK^K\K[KR@[0p03T0SbPT00TT8Pf0PfX f㪽0X0, 0RR(K 44f ʽP @f ýP 0\ 2XH0S 00S 0S~X K1PX pP< 00S Tk0B 0Q1 0CĠ YKZ0K"Z B<f yP8 <X 40 `P :y f.2q[00B0S Sf LPa T>p00  P0S}?d0 00  00B0S0 S1 C00 ^pX p 0pT  P t0 h0 R0@0/X 00ꠕn̋@@7@\@$@>@7x@@@@ -@L_ 0S 0 S Q0 ሀj0   @   ,D  -t0L \ |0x  -t0L \ |0x  0-t0L@\P 0x|  0 00h p-@0@0LQP`' Q 0CQ Q  t0V  ph0 000000p000ltmt 0- p0@0L0 S*$0S (S 0(090S PPt00S |xPl0< 20000 S0舀j6j -L~ 00s ^ 0 Q-L@q Č@Ќ@ -LM@@Q LDH04  DFP K7 -L MP@l81 RR` 0S w@ ?2 KR @P (pK$K 0 t0\  0x| Pp$00Cs$0 (0(0 p$ ,aP  X6j܌@@ 0-LMR@P 0S $t00t0{K0@^$ R0K h0  c t @0t00t0 l0P 20YLH+> 0K6j -LM`!p00Q@ R Kt0pa`V 01H0S HP`.>P t00t0d0P 0 t0\ 0Kx|` 00 X@T |@\`0  @\X` cA \p`0 @ ꈀjh7 p-LMt0P`\ x| 0@  0 y.@!xxl0 20x6j -LMpPW@` (Kl `P 09`Pt0 \ 0x| 0 0 P`.(1@X1 1X1 0CX `z`0X& ;1X`0X! 0X`00S `0`0``P00e`6j]t@yt \tzt  0-LMTQ@@i0@0CS088舀j 0-p0LA0SP 0000l40  0P0CS0ꈀj6j 0-p0LA0SP 0000l40 0P0CS0ꈀj6j -0L @  0 hB<6j 0-P@PL@P -@@PXP &XXPDP 40S DP\P 40S 0\00\ -`@LPpXP10@0CS0 W t0 0B)t0 3Dw0Q ڈ 0SP00S PU@ 0@׃ 0҃W -00Pvj8cjp7 0- 0LSP@  $ 0 (080 T 0<0 4 0L0 P 0d0 h ,0t00 x 0|0t-000 00 000hʹ@@@Bp77@ -@L*00CS0h0 008 - LQ@`pt0 l0  t0 0t0@ 3ڿt00S x|舀j6j - L $PQ0H<0 R< H@\  D0%< %0 0b 0l00l  3 05 0% # 0-1L."0  R@ 41020!0D0 1s s 0 P00S S Sd080 00SPD080<ھ00@100800蜀jHjЀjj 0-@ p-h0L   QT@0 j0`0CS0pmp蜀jD -IMLPM@T, pQp 20!00Co 0P P PpB H, 0R(Kp0S 0#0 0L0" "#3n 0"0 00pS` p S R@0T0W0S T@#T@!PK 7 .pP ܻpH@P-p 0"0 0L0" !#31 0!0 00pS( H@p@`T@! pPKHD0PH<%@H%PA  0R0W0S: P:D0@`T@!#PC P #P@ P H@0.P pg 0 SP1[#U# T JNK@DL0D @D @P pP4U D ῺA Ἲ#p=pPp Pp p-h0L   QT@0 0`0CS0pMp蜀jD -$1LM 2, 43 2#0pZ, 00 D0` P  00S S@*67<P f 0<07Zp 040P@TP+U@꜀j -L0M 0"  \ }0 QUy 3 RuD 4Q\P040X 3" 1 <  D00_ 0S\  < 0C?V 0SS 1"0<0X00 = D0p `L 00S28888XA  0D9 f Ʋ8 <8 6p< hŸ@0@ @P <f|8{6(K0 ;PXȐD0401L0X  0P 0$, ,0!C@b@A@ f s@<@HD@ 0P/0 `Pp0P@4 . T1,P8#004!2 \0P  0 X@L@0 4 0 00`S<f00 0PQ0U 1Q "Q0PP0R@PJ&PU@DZ t꜀jH7D7 -LM0@P 50S QqP 0S P1 R  @@ K P!Kt@PD`,!/!0[S4p!0[pS.0P( KdP("KPP"0[S(@ 50"[ 3à1"0  0(0@ ^PI@@4> -L1 g2S p-P`L@ ~@d0Pp -L` $Rp |R60h t44p0S* QG ^!1P!B00^88848X8 p0S:0 $ (U **0DS;@888888 0U T񟗾888888 8H8P8`8h880 @0PU  p T;\888(88 8H88@80888 pX0 0C\ X0 d `50t4 4S 0t4x4#ptX0 0X0\ Te  G50t4  p[^ 0 ^8 #8t$,R10 tt$H^0 x40 ^8 #80:^ 0 ^8 #84.D,<*@(8&L$P"H d0(l0h hyh @4pp@ p@lPh 4lP7pl: p8 0 $@\0`/ h x4$S 0|4h 04Q t4! St0t4P0x4t40CP0110t |, h 4l0d 0 l0d 0,0h 4lhd0d@"tDl xDVȍ@@؍@@@ 0-PpLP d@̭Tp@0hŭ -LhM ` dPPpK l@P <0S SZp0S$KD0SlV@P -LhMp t 4`KP?@P @0S<p0 St0 SX80K 0SX@(K -LhMp Pp@`KP p0S<0SW,p,4 00*Pig0P$K - 0Lq 0Q 0s00 00 0\00` -LML0S  $@T0K@&K@ -LM40@4 00 -LlMp4P^ `@ cS 0RKK K34@K004 0@q렕nD> -LM`4Pp00 40pPP 40@ 0V3004 4 0PP᢬ -|1LMQP d1Q& 1CQ KD1Q400Q* Q< Q@0 0 & 0$K KX 0$ S;#0 0 3Q Q Q@0 0  D0 0  0P D0 0 4@ 0@T@p0 KT` VH0 0 H0 0  2UDUU@ 0-50L0@ 050l PBUlPPP\TPYLP LLP8P 8{8PDP fDP0 -LM50`0P@050l  Rl  @KHP f(40D@PH@ 80@ z@P@0jP< @ Xq  4L0P@ 0YPP 0TPTL* @8'Df«50p050PlpP8pLp PpTP Tp"8 0-LM@P0K  -T Td0DS Q020C0 !1*h0\ 50K08  < (@ Q-L@|Q xD@P@ -P8LP\Pf`d\ p p`@h0!R h 01dp@\` Qp-L@` pdQ` `P h0!R Pdd` QP0p0p p-LhM0 d0 @P`Kd0T@P:Kp -LBM P0004P`p  @ X 0S@00SX 0@SP~   00S~@ 0@S@0s 2R~ (K$ Kf0( NPo($\`< @P_P0d TP2TL"L @<f ުPh~ 0Td@H0uCKp H0($ 6PpH0PHWH0PT08` H0 1<K!4P h0P180PW @0 $(P0 $( P0$ (P m0p0 Kf0p0`0p00S S Sm0@$0 v$f xP( $ 0tE0p0 p0  Q`@0$0 0T0H0@0j@@O?@@8#8`@@Ȏ@j@jqj @ - LP@ P 0S 0 PPQ<0P R 0-0 ((L"!@0S1s s 0D0pP80< 㹱00@00pP800j,j  0`p 0RCK,1Q $1Q 1QQx xP0x0000 xP 40 Q000 0KP Q 4 @0R0 K%P|0-0|00|00|0ꠕn}fpUAUvtnU~fp> 0-LM` @.Q@@v0@0CS088j 0-0LS@D0PU 0 LP 00L P0 0-\0L Ƞ Ƞ,A0000P0CS000j -LMp|0@`, p 4 @0@R@PK 0PP@ P, 0R6(KxPP0S0-| P |  0PS&P |00|0 ắP R@0T0U0S T@#T@!PK P&, PP $ ᜯ#PPꠕn$@> 0-\0L Ƞ Ƞ,A0000P0CS00C0j 0-D0 (("ALP-,PLf(xP0j 0- 88 #PL*0AT 0S P0PPP ",Df 2|0L0|0xP0j 0-PP@L -,|0 lxP  0hY0|0~l xP0 0-50L@0Q!ڌ 0 S00 S P0 ur0㞯0P0CS0PPvj8cj18 p-0LM<00P00@4 K Kw`0 *@0 $D0 D 0H@ Kp18,@0S-0S00 R030 Q ^ 020 020 0-LM@4P\ 00 0 8ppT0 Q-L <0Q 00 0 W@W 0S 0pp -L@xMp @ P@K`P# @0S< p0#8St0S 8^X L80K10|p  x0S(K80S000S480K^000P@ \ 0 ` @ 0 ` 0 ` X@ p-L@Q?L`@P@ :- 00@0@p -L(M0pSP @X} x^z `|0 0S$K  S <002A` ^ BP? \< @ R \ 0S 0S  P0$K0,"C`@\\ @P \ 0S  0 S  Q0$ K0C`@\ 0V 8S@">">Lj"> -LM@K K 0EPK R00 1p@-QA 1CQ 1Q p00S0C0p@T)^&Q# R `VPU1T^QRT Q V U 0SS0SSp! 10! 1 0! 10! 10pA !01 !01 !01 !%W A W@00 -LM P `p 0S`r "30,0 0,0 $0 0@<0di1`SS1S Q qAW 0!0ll(0 !0dd(0Spp@AHP0D S00 d24p0@S0  000 0S 0 pS ,@0 0(KoR 00CS(K1S0000 Pt 0-LM0@S P 0 0S S S \K L 0P  >K00( O?@@@ v7@@@ -LM` ! 0@000p000 00P,K "0PP(K, 00@00$ "0PP S p, 0000 S @0 4 4P "0 P0P S ,0< 0S0000#0008 8P !0 P ,00S0 -LM@K K 0sPKY0S 0r0Ss 0Rr0 ZR R0S0w000S 0{ z0 0$S$0w00 p-LM8P00 K^X`!KED`!K K0@KK`K`K`KPK`K`P[Kp -0@SL  1S01 1S P 01kP P1 0C110C1 L@ -LM@P  K8#T0 0 @000 <Q P. p-LM8`0@ FTN!0L0QPSM@N@O@P`RL0@Kp0S0 00 0 B 0 R00 -LQPp` 0 1 s@N=00 00 00 00 00r` &r 0@P00 <Q A p-LM`PV800@0NĠL0MQN`O`PR`S` L0@`NKp -LMP@U`p10@0<0NĠL0MQNPOPPRPSP L0+K -LM@P  K0 08#T0 0 00 <Q PW -L M0`S@- 0BS*S8 T8PT8|T8T8(U8T8T8  0K@, RY0S 0S00S S S 00 b0K\oT T 0R0 R &D 0@@P  RTXpWd  00 b0T T00 =T1  XGT%  ,;T[00 TK0Q0  0T700 @ 0  0T5 T 00Q q 0@0 \PH 0PP_ i[m f _ 0Si o%d00 05@ 0@H:S 1S @@|@@А@@@ p-LM0PS@E 0BSY8Y8dW8X8W8X8XZ8Z8Z80S /%T00@0CS0000 0PP KphB R 0PR 0($ 0,0Kp 4RC@ 0OT\ @`840# <S  j i(h0$k00AH@X@USBUUSBS@@@@L@@h@ؑ@@@ -LMpY 00 4  1M HĠN=0S 0e U0 Bd0g 0C!f00 CR  , C h0C$P0HHLjki Pmno@, s`p 00q0lrpk4 # 0Ԁ0 0ؐ000䐊D d 0@P00 <Q A(K ꐂj p-L`@P0PS 00 U@@@0@S +0@0T`pQ1 S P U -LP@`@`P@_Vጤ0p0CS00S Q @@0 @УaVp @T pႜ0W1 ypA - 0LS@  !P  P 0S00CSPPP  -p P0 0L40 8  !n@P 0X0 Y 0\0 ` 0S4`P X0S 0S 03X05:S PS 0X0YP XQ Q #3Q0@S񟗒c8c8a8c8c800CS(d8d8d8d8d8c8T#0LT 0S P0S@ #0P=  X0S 0@S4mP|  Z0P<  X0SQP> 0@S<0S =Q X0S| S~ 004 D0pPS4< @0iPLX0St 00`@P`@> VX 0BSP2 X RW .:R,1T0Y 0BS7d88d88d8d8d8d!`!}@!{T!yP!w0Y0R0Y0N0Y0J0Y0FP< YiniRX@Y@\@`@Y0PX0.BDiYi=>0S=}`0T04> H0P Ȓ@̒@,?@@@#>@ܒ@@4n@T@`@(@ @"> -@L0 0 4JS00X0ĵX0ĥ -L@40S 0 0$ R 0R  R0Y00Y0 0-L M8P?00ED0KB0K KK@K0KKKKPKK04 -8LMȠ,Ƞ#83 #> -@L㘢00h -@L㎢0S00@S010,0RR00,0,00 ,0S P, P0,0 h0,0 -LM@Q` ( pSJh8g8g8i82 %㼠 00 " 0>40 01 0@0 T0%(KQ, 0 R*$0Q'0,00 ,0S P, P0,0 (Kog`0,00(Ko+0(0 0 !0,00,0g8t@<0S8<0Ţ -LM @P4`0S3$pW00 00 0 ! $T@  0 P0(Ko0+ R  RW\0,0(KoSg T@$ 0AP(Kg8@ p-LM` 4 0PS  0RKp0 K@K PK 0 B1@K L4 Q0 rx"렕n@(> p-PL 㥙@`@ @0lm02408P40012` 902`pf8f8j p-LM`2 <2PK0@!2 00004  00CS0x;xT:6 p-LM`022 < ;PK@ 200004  q00CS0xxT:6 -L(Mb@T=0KKP4KKK. K0@KP@K@K@K@KK -LM6`pI $K=004K40K3KC0 & K00K.K-K2K1K/K=0P4K4K@D0,K.K-@K3PK2@K1@K0@K/@KjP08 R06=04KP.K\@ 03K-@K2@K1@K0@K/@KOP64K,KP6L -\ LR`p@P<0PS 0\ <0R@ Q-L`p \ Rpp@P<0S P\ \ pPR@0b0 -LM 0S  0 Ƞ8,Ƞ#8 uP (> -LMP@` mP d-0b0(K, KpP 4 08 Ƞ,Ƞ#8 F6 8 2 ,,;0P4帀K\0 2@>K ` Xp PP L H0 d D` P6 = [>0[4S\00\0  >0K 0S/t8s8s8r8s80[S\0w0\0@PtpK [10ERt0 T  !B200 p0 l p0 l !1 \ <R@Pʃ1T0 P0p0 tP lP 0S;p@0@S,2P  0S00S0@pSWXtK 0< \0 S0 00 I0T0 0T0 0T0 0T0 p 0la T[,S+Sj(ȓ@@(>j@$@P77,?p@h@\@T@@<@@-@0 , 00\#^? 0-@LPe30# 0 0-PLDP 3hS CT Wh0@Te0 0-LM@PH ?P  K0HT 6>P u HX \? @fPP ^ T̠\34/ PV꼔@ܔ@0{8@P}8 -2AML@`x3Pp0 l|Sx 0x#C40tx3`7N``  t&P  4DK303'y8@ p-@LPDZPh3S 5  `0  BQr0Cp P0`FQ0S*DP 5 ;%55;5p 10R!!  10C1 -@PL DP DhS p-L@D P_ `dh3S 3 30S 2 Sh#KphFp0 -PLD`p@P ڝ8W;H8 WW" 0 0@0@n hW i0 0@0@ K p 2S0Pi`4@ p-LMP0 0@0@`X㔝0 K@t17t 1S&ݜKpp)? -LD`P|P 8@ U UUpp#R 00@`0@ 00@0@3 03PU\hC 0fsP@ 0-t3P@SLpS|S DPt OPx 070 -@RLp` @ ; 0 0P PPPP/7; 1 #7; 00p@ -LM`DpPP 8@ U UU(K3 03P(Ua ̠A\0L  @'{ 00KPe 00 00S0 0@0@CT 0븣+KA c)0[PU)PK00 0C00 0 00 0@00@刜4  [7P tP   ^4Л\0 0@0@P}8@ 0-@PLS 47P 3S DP qP 070 Q-LDP -LM 0S  0 Ƞ8,Ƞ#8F P P)> -@L ☕30CS3h<3 0 3妕 -L M@Dp`P K@0FD@*0K>0CGT*K" K)K(@K'K%PK$0K#K"@K!K&pKP -L M`D@pP K@0DND)0K?0CHT)K! K(K&@K$PK#0K"pK!K'K%KP -@L {  h p-L M@D`PP Kp?0DF"0KB0"K K!KK0KPK PKPK`KP [0[ p-L M0PD`0K@P Kp?0DF!0KA0!K K KK0K@K@K@K`K\P[ 0-LP z@@T T ;>  ~$ f& ~b;> (0hi~ Vb'@ 0-8P=@L8 XC ?\P P=\PB\S`P PA`PF0`3dP PDdP0d3P 03P I03|P 0|3tP =0t30h30  \ZP  p| \`KP s <m (d<P t@ԕ@@@4@T@ p-@3LP%DⅿD₿㧚8`@O a000S 0@ݺၹ30CS3pcG -8LLp3 @@ TP, ` a P`=QP@@0$gX  I P` 8<8 iQ8<8 -LPD8P8@@ ,po @6T8 1 *7P. 7P0 H q j `\3S 8@0;8KhIT @h9,h3P h,ꔖ@@ -PL`D@pP@ 㿙x1T 0CT'  00 @4T- ,1T $1T0/V@% = S" @S+ @X 5l3@505O0 R00@5@ 4@D@ 9l3  ~l3   si 5i 6i( -@LpP`: &< %_ ([@@T ( T hY̖@ -LPD@`0pP   %5@ (1@@T ( T &W@H$)̖@ 0-@Lg  30S7 \ 36S$ Q J DPP;> 0 08#8 0hg, $  0- L P# @@T #  T !0h@ p-L`@PP@4U0@p -LMP`pDS }@P  K2"3#CCCC ccm$ K:@P4 08 Ƞ,Ƞ#8F `$;>H!b0C p/p0PS00ST#0@S$Pf   0PP# PX#HP3SP T3SM X3SJ *@K}P H. 414!8!,1,!1!0` `[1! 3 1_0p@$#(3 dA 0sB 0B_#R  0;ᖹ E,]|Y lT"0"@x8<8 @P)>(@@8w8z8\888(u8t8x8|@P@2S -@PL ,墿P ,hۼ -`3 @SLh#\p# ,,P` 妿Pd `̿7 -x3 @SL#t# ,Px 勿P| x屿7 0-L=@P ; c1P ; 000@ -LM`4 ,P@?P08@ U UU(K PlUq $ H04  t44 ,0KP岿,p 0 0@0@  pp@tP  k ԸF,Q /08, #x Q@ 0Ks[2[, 0'AS, Q :08#xg, ePP0 0@0@b H8@ Q-L, -LM P  0 Ƞ8,Ƞ#8 P +> -L,叾P h觗 p-PL8`=8hUHP DP>HPDHcLP 9PDLPJ0L3PP -PIPP0P3P 03xP 0x3hP 0h3`P 0`303pTC XTC QHP TC |GTC d@LP TC @6TC (/PP x@ė@@ @0@T@ -LM?`PB 0,8#8႒Ⴁ @ j"K2KT,K d@@Ld30 0pP j@hS `d3L/  p%`yP ;(K0K2Kd,K zpꂒႡ j d3 p303'8 0-@L3S 5  P0  BQr0C0 P0 5;50PEQ 0S*DP 5 ;%5 10R!!  10C1 -pL,P`dP [V VV& 0 0@0@TS iV i蜔8h;8  ` 2S 0 0@0@i臔0Lxꜘ@ p-LM0 0@0@P`TX70 K@`寽` 1S^[Kp踘@ p-3LP4LP¾HP㿾PP㼾,ù,3`0CS38@O [h00S 0@ṳ30CS3p6 0-@LP[30# 0 0-PL3S CT  ^0@T][0 -LM`,PpᖼP @0?0(0K(0K:,CJGĠHC6 (K%K#K"0K!@K'PK&pK$KbP K 0-LMP@0( P,(4S  0P,  H0P,  08 0CP,  0P,< H0P, 0P (0P" 0-@MLP 0@xK 0q 0@k0h @e,(O1[#4S>  <00@X,B 0 @O,K9 <0@@E,/ 0@<,& H0@3, 0|@*,  0@!K0 04@,  0  " -LM`0PpT3,c @P  08 Ƞ,Ƞ #83ί3?SCC匌3S3CC3.TP h$K!X30 p/p!0`<40S@00S@#0@S0P   0P<# PD#,# 0S;94> υ0p O0np ] *@K,0@ 0υ|9?0RM1 ,  0P`a1!81!1!1! 3!1o0p@$#(3 dAt!t1s@ 0@Z#R'  .9ᔴ C *Y T*@K0@&0@0"0"pv8t04n+>8Ԙ@8(@6 `0?D@'?`888L8t88p8@88ܘ@`8@,@@ -LMp00K`d (0 :,xP ( 0RJ$K 0$2K1 [20[ t"pxP'x% @P OPᒲ$0K Q 0 U A @ P:P  0< 8@0 0렕n+> +> p-LM@_`0_7Pf p7P 0P93 P`3 PZ3 EPT? ?C ,3 R09>( 00 ?V0< ?⹾P TCy PKph$3#4#0@ ?➾PP TC^ Kph τ0 (7PTKphH|3x/ PxB8@0;S8Kph߽T,Kph֐@@aP@8l@ -LMP@`pi1T# 0CT,  00ʲ@4T Ა K1T 1T0/@4T5@"@% = S$ @S8 @50@5 0 R0=(@@ 5@X34@DX3L"K 0o"0[! [04 @f}X3  "K0HY![" [80$0 Nei 5i 6i( -p0pLM@   8@ 3#0S 0S S" S036?0 A0S  S 0 8P (h?  ș@ p-@PL ,坸P_ ⓐ`iW3S php -@L?30CS3h藽3 0?3 -LMP,@ph`PX $KG4%0K&pKh 0`&K 0H @40`T T`! @ -LMP,@3`PtW K"`K!`K 0`"K0| y @d0`rT ?!["0[X  T  @ 0-LM@ ?ѼP  K0 2>¼PP  L̠3,/ P'{꼔@ܔ@,8 -2QMLP`x3@p0 |Cx#0x#C40tx3 7^``  tNP ? 4=ԴK303'D8@ p-`L@傷P 5  P0  BQr0Cp P0 5;5pPEQ 0S*DP Ԛ5 ;%5 10R!!  10C1 -@PL EP h~ -PL`p6@P -8W;H8 WW" 0 0@0@ h8W ik0 0@0@  p 2S0{iY M4@ -LMP`pP K0 0@0@\0 K @t~7t 1S+Gp)? -t3 @SL|#p# `Pt ڶPx t7 -@RLp` @ ; 0 0P. P|PPP7; 1 7; 00p@ -LMP0,0 @p`xP 8@ V VV(K303P-V[ ̠A0 L @家 ,0K` 0,   0 4 S,0 0 0@0@C 0L먃0 0 @0@ ,00@0 0@0  _7P tP  ゙ 0]P0 0 @0@,8@ - @L#;7P 3S 凸P P 7%7 Q-Lܵ -LM 0S  0 Ƞ8,Ƞ#8 P j 0-LM?0@ PK0KF0K0K@K@K@K@K@K冹PK04@ -L MPp@S P K!1 @/@1!3#ss KJ@P !0PS00S#0@S P9   0P# P#m&@KC`>P ^ 0 8!0 1!0@ 0p`ቫ H哷z 0=@8l8(@@88D8 8ܘ@ p-LMQP` ?0@0 0K 0K0@EĠF K@K0KKK0KPK`KڸPKp -LM`pPP KG@0HD (K(0K'K%K#@K&pK$K"PK!PK常P p-L M@`ɴPP Kp?0F"0KB0"K K!KK0KPK PKPK`K嗸P [0[ -L娴P i@0``pk`p@_@P@Pm@P@PoP 0 0@0@ p-L M0P`0Kq@P Kp?0F!0KA0!K K KK0K@K@K@K`K?P[ -LM@QP K@0  K0KKKKKKKK"PㆿU@ 0-8P=@L8` X4P P<啶PAS P P@ 劶PE0 3$P ԵPC$~P0$3P 03P A03|P 0|3tP 50t300  SP { pu \ DP l <f ($5P t@ԕ@@@4@T@ 0-3L@~={㠋8P@00S 0@ޫႪ0jZ p-LM`<  <8 0@\(3  ?bx0@Q(3 P P@ \P@++!(0U(Ph00 8 @D ?4x,|;;1(# (#=j -LP.P8@@ "p" +ogd @%T8`   >7P( 7P w$ #  "  3S 8@0;8DhB@h:,h4P h-갖@@ -PL`@p˲P@ d1T# 0T  00"4P@ 5@(@ % = S2 @S# @ 5@h3505b0 R @ @ V0!@@Jh3  ` `h3 ` i Qh 0-@8=PPL8X "P<̴PASP P@PE03 P PC 嵴P0 3PP 0P3HP x0H3<P 0<34P l04300 8 2労P  p) \#{P  < ( lP t@ԕ@@@4@T@ 0-LM@  ?P  K0 ?ⱶPP r L̠HL3,/ PHj꼔@ܔ@,8 -2QMLP`83@p0  7P H3S 凲PH PL 070 p-i3LSPp·`,P f0,38@ 00S 0@ᩦ0i3pR -LM 0S  0 Ƞ8,Ƞ#8! P +> -L@ 嗼P/.fP  hҺ@ p-LMQ8#H`@0?0 0K 0KP$4& KPK0KKK@KK`KMKp -L$MpBK@P/50[6 [$Rt(K,K0 K=P,P e ̠8Č#Č"̌ 0P ٽ  P,EX!0\F <̠ČL8 ČD"̌#D!L  0@P (,P,<4("!4l̠ <($Č"Č%̌ 0aP L ,~ &巸8p@@̚@@@@D@ -L MpB]P K K⓯@P j0PS00S#0@S ^P   0P # P#` 3S 3S< , 0P 3f1C ~P,& eO@`^P ~ |0| 8!t0t 1!0@ 0p`ᩤ0i3ᜅ,`~l@(@|@ܘ@@@8t8\8@ p-`PL@ -P b!P0 @/D0@ R phM(ph6 0phՖn@1j8 -@0L"MK K0KKKKK K Kܱ K -LMP&/00P00 `@p3 488S  P @,Vp `0 0   Ki0!B!O0,0,Õ(0 0P"  Ki -LM8P@` K㑅@υ 0p@8/  00 00 s@ o7P {7P z3S 8@0;8Kh辄LKh跄4|Kh谄lP Kh訄ꔖ@@ -P@hsLW`@ zP$ ?s`P 4 (Kph߂+ KphւKphςKphȂ<38 / `快88@0;8Kph貂τd ? @P  ,eKph虂ܔ@@@@88@ 0-@8 =PPL8X P< 墭PA S(P P@(嗭PE0(3P PC勭P02@P 0@38P N083XP 0X3PP B0P300藹 ꑹ  `P  pꂹ \(QP y <s (BP h@ԕ@@@4@@@ -`@,sLWP@ 㭂0T 0T  004P@  @ @ 5050 R@0@@ F@ i -邡ႂLM0j`@PT3p K/00 T\  @00 0! Q " $K0j 0T @j@Xc0"!B PT3(/LL  唪PP $Kl30l3,>'8 0-@L,3S 5  P0  BQr0C0 P0 5;50PEQ 0S*DP v5 ;%5 10R!!  10C1 -LMPp,C`T K܁8V;H8 VV. 0 0@0@p V) $K 0] P L `$0S 0 0@0@ 2S0~0 0@0@(4@ p-z3LSPp㉁8`@ 00S 0@ǡk0z3Ԁp> 0-LM @P "PP  0 Ƞ8,Ƞ#8@  峪P 8P 80S8,> -LMp`r P 08 Ƞ#8,Ƞ 厪P?8@Kᡪ᫪P pS ᢪP 0$S0S? 0SpᑪPw ,0S@,0@S!P(0緩P 0S(0!# ,0@S3S 壩02 `R@0S2s喩P  @ 00S0"30S偩@|屩P0pʬ@Pr #$#0`S0@0S$#0ScPg   0@0S#0S3s $3spW3s $3s ㊀Z` O?K0K0C 9POKX 2$KO0` @KM< $8 #44"<,K ,0 032`@ 1!8!1!1!0@ 0P`ᯞ 0z3 Z0Sp ]$K233SCR MIG0 $00B SAB Qa0B7 BSW B? 2"0 P2O T&H"<,>*@<888 @@Ĝ@?@@l@H@ -@L7Zy30CS3h3 073hyP0 p-@LP0`̧P 5@00"00p3F`30\# p 0-PL0嶧PX3xS TCT I0@T30h`F0 -qLM0P3@0` pC;QA40+ @/033H   ҧ303#3@0CS3T   d0⢤ K< a<0>r3038@ p-@LP0DPx3S 5  `0  BQr0Cp P0`FQ0S*DP 5 ;%55;5p 10R!!  10C1 p-@PL 0P3^ ~`Ex3S \3 `30S P2 Sx#PBph=~pt -PL0`pڦ@P ~=W;L= WW" B? 0@1 Ae W i~< 0@1A B pP2St]i}3H0330CS3ṫ4@ p-LMP0 0@0@`X~0 K@ 1S)}Kpp)? -3 @SL#|# 0P ${P 塦7 -@RLp` @ ; 0 0P PPPPX7; =1 L7; 00p@ -LM`0pPP&U& UU h0l0h0弧PCUK 0Ÿ0BD0  @U303妨30CS3'(K,0K P劦,0S 04 C, 0  > 0@1A R"0 0@0@h@g 0h3D0330CS3Ϫ꿠0R Pf00 @0@, t@ @} =7P P    i |z0 0@0@8@ - @L#97P 3S 0P ,P 7壥7 0-LM@0OPP K034038 D0!P  YP30CS3Q4< H0 PP ͳ HDP<D3,9. Pqŧ꼔@ܔ@8 Q-L0 p-LM@PP` 0P Kp@ĠF@0  KK 0KK`KKKK3 030 KȨ3P0CS3 -LM@P`P 0ϤpP KLN@0 ' K#K(0K%pK!K&pK$K"K3 030(K☨3P0CS3˩ -LM@P`pP 0埤P K@$L?0 KK$0K!K#K"K KK3 030$Ki3P0CS3ᜩ -0PLM @ K@b0P[ -LM@PP`p 0_PU x @ JGĠ0 K KpKp  >   7O p-LM@PP` 03PU xK @      K0 k% [0[x -L M⬁0`0$0 PC= F-,pK }%[ 0%K$P= @P P K?0 Q0 U A( @ PP =<=P H $ 0R K; =<=/  0Y렕n0> 0-LP0嗣@P 0  ||T @ 0h|' 0-5@=P5LUPADP 0P1DڥP6DPHP %P5HϥP0H0P 03P 03P 03P 030x30ڱ hQԱ TKD壥P ˱ 4Bű 0 RtZ@5@ 14@D@ @ (@ @i 5i 6i( -d0LPt`$00z3p0CS3.=@3N (A㒟t0S @OyP̥y -LM 0S  0 Ƞ8,Ƞ#8 ,P 1> -LM`Pp0` Ȯ@P 0ɡ$K2C3C7Sr2CCS3( K™@PL(0 40 0 Ƞ8,Ƞ#8t?>4L080@0<0 `R>S4 0@S4>P/ 00S@8<0S80s$ <0s! @0s jy.@K 0pP  xhy@LqDnF0h  tP1!=1!!20" d303Nh#t` l3P# 0Lc~  0p}@T#R  kvњP |倣 gxN"0A"Y?@8@91>8@@D@@Ԫ@898H988L888QM -Lp4,1P@ `L{0S* 4{x@ D0R,< 1 00@Sq<p1 0p@  @ x|P`0 | 0@P`P`000 0PP0%xH00H0w00 @0@ooNo -PL@px!1`R101w7<0!0 1SA<@10A/00@ 0@ w 0-@8=PPL8X P<ƢPAS P P@ 廢PE0 3P PC寢P034P 043,P r0,3 P 0 3P f0300軮 2굮 ,儢P  p#ꦮ \ uP  <ꗮ (fP t@ԕ@@@4@T@ -M3LSP` 8@ R RRpp\30\3|PVhPCf 0\sP@ 0-LMP ?␤P Q K0 ?⁤P B @ 1>@ P3@P + Tˠ,034/ @ϟ,#꼔@ܔ@9@d9 -2AML@`Pp 3: S3 O\\  娟P  0dKD30D3H9@ 0-@LM3S 5  P0  BQr0C0 P0 5;50PEQ 0S*DP 5 ;%5 10R!!  10C1 -PLMC`Tp v8W;H8 WW" 0 0@0@ၭ hW i+v0 0@0@ ^ p 2S0iv  4@ -3 @SL #$# OP ɞP 7 -@RLp` @ ; 0 0P PnPPP7; 1 7; 00p@ -LMP0,0 pM`Q 8@ R RR(KP30P3 P=VL ˠ4A0 L @增,0K , 0 0 @0@, 0@ @)v0  7P tP  㖁 0quPC庬 040P0 0 @0@Sd9@ - @L(8#V7P ,3S 呠P,  P0 7,/7 0-M3LS@8@ 0uP7P 7P 3S 8@0;80hu@0hu,0huP 0huꔖ@@ p-PLM3`S p0 0@0@(91S phWp)? -p@MSLU`@ |u0T o0T s0CT@ t505 @t  Rh @@Ѹt@ @@ @@ ni 0-N3LS@0Au8P@ 00S0'0N3t0 -LMP` +P CR!1 `/`$ KPP$ǝ0`S00S#0PS$廝PA   0P" P#2S+ 3S( 3S% t; 00! 1>p!80 `5 00P`@!0@`(_Nct8 (@(@9\999|@ܘ@ -LM 0S  0 Ƞ8,Ƞ#8 P `j -@L7n30CS3h觡3 073n -@PL 0{P 0h贙 p-@LP0`lP 5@00"00p3G;`30\# p 0-PL0VPX3xS TCT =0@T30h;0 -qLM0@P `3C ;R' @3H /  z303˞3@0CS3T ᵪ T,0J K<b~<303#9ܝ@ p-@LP0Px3S 5  `0  BQr0Cp P0`FQ0S*DP C5 ;%55;5p 10R!!  10C1 p-@PL 0尛P3^ s`|:x3S \3 `30S P2 Sx#Pphrpt -PL0`pᆛ@P }s=W;L= WW" B? 0@1 A W ir< 0@1A pP2St]ir3H03嚞30CS3e4@ p-LMP0 0@0@`XR-s0 K@ʛ 1S)vrKpp)? -3 @SL#|# 0孝P 'P M7 -@RLp` @ ; 0 0P{ PPPP7; 1 l7; 00p@ -LM`0pPǚP&U& UU h0l0h0iP4Uk ̠AD0 L @303S30CS3(K 00KP7 00 Q00S0 0@0@ᢟh@# 0 h*KA 2)0[ 0 0@0@00 @0Ct00 0 0Yr V7P P  }  / q3D03呝30CS3\0 0@0@%9@ - @L#9&7P 3S 0応P 9P 7]7 0-LM@0 PP K034038 D0ܞP  P30CS3 4< H0ǞPP  HP̠D3(9. P,倜꼔@ܔ@%9 Q-L0ϙ -LM@PP`p# 0帙PU?0@0(0K(0K FH0%K# K$ K'0K!K&`K"K3 030(K₝3P0CS3 Kᱞ 0-@LMDĠ DKD\0KKPK@KPK0 -LM@ NĠ0KKK@PK -LM 0K c P K -`PLP@p 0PPU T T Qt0T 0d dZThT T4 $ 7l1>@BF -LM @0K@K@KMP [0[K -L`0PB= @L, h d$sWc @ PPp% P00 @@Up#  PP =<= L mD m;=<= 1W  ( @P t l m @Pt =<=i  P@&* -LM@0K @c P[K p-`PLP@ 0fPU @pT T Q0T 0|x n@T@pT T< H( H7@1>BF 0-LP0(@P 0L@ :qT @ 0h.q.' 0-5@=P5LUPٛDP șP1DrP6DPHP P5HgP0H0P z03P *03P n03P 030x30r hl TD;P c 4] H,P 4@ԕ@@@t -pL`o_@ @-T $k  5 a 5  W T7PnE 5 ; "7Pnn= 35H0S D0S 5@0;5nP㊛P n/@@. -`LP0@pP@ oh1T 0CT%  0tp@4T+ Xn1T 1T03.⦔@5 - R" @R) @= @50560 Rt@5@ 4@D@ @ F@ =@i 5i 6i( -d0LPt`$0~0{n3p0CS3=@3N 5#t0S юumP]r -LM 0S  0 Ƞ8,Ƞ#8 彗P 1> -LM`Pp0` ]@P  t0\$K2C3C7SOg2CCS3( K@PO(0 40 0 Ƞ8,Ƞ#8傗?>4ߖ080@0<0 `RCS8 0@S4іP3 00S@8<0S80s) <0s& @0s# m.@K`.0`1pP  Fmꑤ t@ THӍ 0 O tP)1!=1!2 0"d3 03Nt`h#l3P 0Lc  0p5T#R  \P x lF"0̓"@`"9@291>4@@@@|@@`!949,$9/9+999l949R00Q00]Q(0R 1RH00U@XPQ X0]S  -L M4!00PpABdHD*0K*K!0C" K'K%@K$K#0K!`K)K(PK&K"pK K -LMD0 Q!00K# "0C KK0K400@@C K@KK0KKKK -LMTS0^4pS@0NTGd!0" $K$0K#K!PK`K"K pK@K@KKT0STS0SSR R R -LMLp@` P@ K4P0ED!0 (K #@K(0K'K!K&K%K$PK"K姘@P ~ -LM(0KC̠C$C0K00K@K: KKK0K  000K0K< S00K  S00K  S KPKS00K00K]0SR RRd͗h0Si0 So n0$R Hp @000 000X<<0ͩd@ -@dLP #Pd͖P 0d0 (idP  `ꌞ@@ -LM`@q d0S Kh80Ld0 @˘P?9 -LM@0@,PK00`px႕P 0S T$S0S00 S00 S00  hP$K@T 0 S0S0s@ -L+8#+ -LMRL0L`i@0pATF@0 $K$0K#K!KPK"`K pK@K@K<K -L MH0`Sp]80S] Si ,@H44K0NT@0  40K3K1PK2K0K/K.@K-@KPA ;@J   LL< S@ KS@0L@0D@ P 4K1K/K3PK2@K0K.0K-0KP0@1K2K 0< 0@20K1 K20K10K@00@  4K3K0K/@K.0K-0KԕP (K( K R" ʖR0 !KR0 R0,0 (,K(p S@  S@ R  R 0R 0,0 }0,0 zKR  R K R0,0 o0,0 l0,0 i0,0 f0,0 c0,0 ` -RLM` R R KSppt0@0NFT@0 $K$0K#K"pK!KPK `K@K@Kf Spp 0 -L8M萟H0\`,0 @`K0A4p @[0K`K_K^K]K\pKZKYK=PP , 0R(K=̠X K00 P 00_0K 0C`K\pK[0K^PK]PKZPKYPKP렕n1> 0-L<P\@010< < 0000 0-L@ @QP @AD{ 00C00A0` `0S -@DLP 0D0 Q-L@ DP㠙0H0 -L8M @Tp`(@ \ (卑P(040 S < < 00 8080X T 0S@V00S00#X  R00S1 T 0@S (dP $ǽ0H0$KX0s3 T0s: 0@@S00\0 <\KnD (@ 4 0H@ 8 0 < L@ ,` D 埽 ԛP( KLP   P卽 D剽  0僽 $`@ăjP77@@4@؟@X@ -LM 08 Ƞ,Ƞ@#8 嗑P Q,00K 0R 0[S  0S K ㇛P KP z $0R0S2>[Re00Qf00d0SH0R RRDMf e 0f0f f0f0 0 0f0f0f0f0<`<0f0f0T 0-dPLU@ DP PDRPHf_DP0u ,o D>P h@@@ -LMd0@S?@0s D0Sf L_LH<@ D0 @HP$hPU30$`K0D @p"K K$pK#PK!0K0K0K0KlP0 0!K KKKK"0K$pK#PK]P K0 0 $pK#PK"0K!K KKKKKPQ9 -LMh@^0Aa@0 K0KKK@K@K@K@K@K/K -QL!0M# 0K"0C KK0K800@@C K@KK0KKKK -LMX\0~Xs ^S  8p@0NTGd!0" $K$0K#K!PK`K"K pK@K@KK0^ \0\0s  0Q0\0Q X r 0q03R0#S0Q0X0R R R 0-LM8P@0E@0 K0KKK@K@KPK@K@K宒PK0 -LMPp@` P@ K8P0ED!0 (K #@K(0K'K!K&K%K$PK"K冒@P ] p-LM(0KC̠C0K`C$00K@K: KKKP0K  000K0K< S00K  S00K  S K@P 0\0s X0s KpS00K.00K Q-L@ `P0d0 0-@DLPP D嵐HfP^0D0`P ᾗ0`00 -L4MpP0@00pD T0 X0 x@P  60d0(K0ŽP9 0ŽP 0S 0@S?0Ch0 h@4 Ԏ@P4嬎0`80 R)0S&4壎P  @ 00S@ 0 4L0ꀜ 0d0 0d0 0d0@0sZ 4<0SF r0`80 R@00ST 0@S 4cP   00SX X0sG T0s> 0\0X04\0 1,H 8p 4 00 < L D @ ,P P" * 塺0d0i固0d0c LP4  区0d0Tx冺0d0N\K` `0ՙ`GPy0d0A<s0d0;؟@`@ @@jܠ@8@@@P77X@4@ -LM 0S  0 Ƞ8,Ƞ#8( 偎P ;>Ra00Qb00`0SH0R RRDeb a \  0b0b0<<b0w 0-`PLU@ DP ˎPDuPHf]DP0蘛 ,꒛  DaP h@@@ -L M#1@R#R1K Qp ` 0 3 Q p ` 0 G Qp ` 0 K Q- p ` 08P00K@0EDK(0K<0C(K K pK`K'K#@K"0K!K&K%K$PK匐KV 4 (` RR00QS00 -\0SL@H P PPSR0XV0 0R0R00R0 S00S0S0 0S0S0<<S0hE 強Dh0@ -LM0&K(K!hP 0@p%K'K(pK$0K#0K"0K!0Ke@P&0 &̠0$@K#@K"@K!@K(pK'0K&K%KT@P K 冷X@ 0-@( LK RPT ږ RM %ʖ RF K RB 0RF #KR? R;       < S$ SP00 R 0R R KR S  S EP 0    0-LM@K! @0PK0@K@K@K@K0KKKӍ@P  K0x@Q@Q0SQ550055QP0SQ550055PR R R 0-LM0@P 0KKK0K0K0K0K0K0K劍@P H 忶K0蔡@ 0-\PLU@ 0DP ZPDP HfYDP0' (垶DP  啶@@h@ 0-L M?0@/PK0 K0KB0@K@K@K@K@KK0KA@P  vK0谡@ -LM\0@S @0s D0SV00P KV0.pP `K0 嚃V0PUf L 0 pYLH4@` dD0 @P @ 01U B@f9̡@ Q-L@ XP㰑0\0 0-@DLPP DfHfY0D0XP o0X00 -L4Mp@0@00pD L0 P0 )PP p $0\0 K0sPZ 4 ⓉPP ] Ե0\04c0`80 R0P0s[ L0s^ @0sO 0504QPT0 h1̠@ < @ 0p , (0 4 D 8 $@ P0 , 壵0\000SL 0PS4-P   00SP  S@ 0 4L0偵0\0 z0\0TKl l0ɔX\m0\0Hg0\0~4a0\0x؟@@`jܠ@ @@P77@4@X@ -LM 0S  0 Ƞ8,Ƞ#8 qP l<>RN00QO00 -LMT0PSD@R 0Sp` PN 0O0 KigRR K@ Ki?p 0 `p@ 0 S0 $0@|@@ 0-TPLU@ @P P@9PDfW@P0\ ,ӴV ʹ@%P h@@@ -LMT0@S<0s @0S Kf HWHD4<< d@0 @+P < ⛴p9̡@ p-LM8PK K"ED@0` 0 K@K 0KKPKKKEPP@  xKp@ ("(!% , R   R  R *     Q  M0SM Q  L0SL Q   K Q0-L@P  Q &0Q Q Q  T 0hQ KQ Q T ( 0hv Q K Q  Q KQ   0-@LP( x0R R R Q-L@ PPl0T0 0-@@LPP v@"DfV0@0PP +0P00 -L4M`0<@00LM L P @Pp ) 堳0T0 K0,PR 4 L@P  即0T040P80 R(<0sR P0sU L0sF 4PDT T@TKH!H1@ 0 ,P ( 4@ 8@ $` 徒P00SL 0 4<0 0@S4P   00S SP 0 4D0 B0T0< 0 4H0 l50T0X/0T0D)0T00#0T0@ @jP77 @@X@@4@ -LM 0S  0 Ƞ8,Ƞ#8 4P <> -@8LP b080 Q-L@ 8P}0@0 p-QL!0M# 0K"0C K0K 0 `K K0K0K0K0K@ PK0 ㍉P @TKp p-QLMP !0"  0K K3 #4K0K K K K K@ `K0 hP @TKp !0"  0K K p-QLMP !0"  0K K3 #4K0K K K K K@ `K0 8P @TKp !0"  0K KR- R R VmL@ -LM 0S  0 Ƞ8,Ƞ#8 mP <> -LȄjT@P77@@x@RT00QU00 -L8M U0$ S C0KB K0C BA0K@ K60 `?0K> KD0CD B@P4K=0K< K6@K5PK4S ) Sc  SF  S07@K40K3PK40PSF@  00Sp0@S94P @$ 0R K SP @S S040K3@K;@K:@K9@K8@K7@K 0 30K 02 K10KN n08@K7K4PK0 K/0K;K:@K9@K?0;0K070K` 08@K4 K30K:@K9@K4 H0K@P0娆PP*H@ 0 ;0K0C70K5 K0 8@K40K0 K+K:@K9@K3K2K1K/K.K-K,K 070K4 K3@K; K:@K9@K8@K040K0C3@K00K`P@ 0 CKL0 0D@LKH @@A@H@ zz렕n@<> -@0L@M 0K ?0CKK0K@K@K@K@K@K升PK -0L@M0K 0CKK0K@K@K@K@K@KuPK -RLM R KV0SV WV0^8pS@0NTGd!0" $K$0K#K!PK`K"K pK@K@KHW0S W 0-LM@0@SLR RR"K00S PfL@ 0 V0 S *S<K0h虘HK0hv 04SUT >0U0U0 0U0 U0< -L8MTK@p40m00  4 08 Ƞ,Ƞ#8咃4PPH 0SE 0 80D L P P 0S@00SL 0@S4؂PB   00S5 SP 0@SP0sB L0s? 0@4`W@V@0 P!1@ ,` ( 4P T@ D < 8P $p k< K$ 0S%  0SUD 0 4P0 t0@00SH@0@0 $=>jP77x@P@|@(@Q Q  Q0 /(0$ ,B$= L{.-08 ?0R<  C4 08{.. 0-@LvYL P0CQ 0S0hX0/  { // 0-@LYY4 ,0RP / {0hX// 0-PLBY$ 0S 0@@X0/ 0-D0 L@.Y0P 0000Sz0h|X'/ 0-@0L@Y0P 0000Sz0hfX'/ p-t0 LP@Y`P H 0000SphJXz0 '/B p-PL@XP`0 S Rph.X00   z.. -`LX0pW @/\ P^|t 0 {pW<0  0 oW0  oW /lp//@ -DpL`@P 0$@'B 0-(P@L00h'B p-@LdX`0` R /\PH 0004 0z 0 R0  phW//@ -x0x`PL@0Tp0 @ P80!P 0$00C 0@'... -pL eP\\!0`00`F00S"<X0@").RWxPUW0@00 SzP@W0S 00CS0M00k0\0 00@0,000$0((/0j@B 0Mꨐ9 -@LPW/lpP100hV 0-0@P00L000. 0-@]QL  0 S |0  000S:R   B 80   0h*y  000h!y. p-L^ @`P  ^* ^&0 ^"1 P 0S pl0P T0 ^ 0 R 0Cp/<P'... 0-LQh@PT0  0CR0 00 \'.. 0-l0PLQR RR R 08@8 000:00CS00h((' p-0P@ LR pVT` TT r \T phVphV<@< 000 00CS0ԃ(4@(' -LM`0p 0 0S"R" RR9 R7 R@ 1QA 0%͠ %L @~000500CS0#K 0K  R0 QF Q? 9CSh9X9H989ؖ9ؖ99(9 0 |y@ 000矁00CS0jfb C n('(|9@@@ 0-L@ 0P0 0ĀP 0x+h P00CS00P 0D dx, P0 @B @ -|LM ml1lA (` P 0ṂP z 4@!00CS0K =$0 㞂P _ ֪@0 0=,0\ PMpP E t弪@h@h %͠0 +P  p}:@(''@'ܔ@',9@( (|9 0-P0| Sx0@0L \0P %}@0P 0,|0S70''''',@ 0-|P| 0@Sp0L \0P %Y}@0P 0,S0S70(((' (4@ p-0P@ LR pUT` TT ḋ /T phbTL 2S0phVT<@< 000E00CS0(4@(' -L e  C0?`% V Pm%-a$K0S=P*@K0RK"K2K2R4 0R0SN2K?2K*@K02K00C SB9999ܠ9Ԡ9̠999990("02K0"K*@K2K 20S` 10SV S*@KK!PK0`20pLK&W?F K4KxP`V000000 R  Bh1! M 00@] P `| 0@P @ h0 RQ 0*@K2K0"K2KE      '$'<@(##'''9. -2LM ?Rp` 2RS 0RD Bx"=p 0 00@0TP2P"@]00P4B4Ÿ   @"|- 0@? S+ 1 R 1R4 -d0CRD 0RI T1 @1 D$K0S@? *pK2K"Kh1 *pK2K"KP1P= R(1R 0R0AS9999999أ9999999̣90 00 00p p <8# $ '.''9'( -QLM0`(!(N$K1p 0 ?% X00DP\Z,0 @  eP 0-0  T{}P 0( L 8%=@>@...''''9@`@ -LM?p`0 \`,0 M \@1Q  A1(A(Q0 J0 10Q @A0 p0pᴠᶐ,0@0000 ]@00P}@ p  @z i\0@P@(K(Ko='..'.'''9. -2L PRh x R 00 0000ScSR|P400,AP {P%}|P00UQNQsQ@p0ꏈ ꉈ ꃈ |} hw Tq @(/t(..'''@T@@ԕ@4@@t@ -LM@P` ᯆP Ǧ KzzpP8 1!@! 0 `p0C `d!(0CP\1p p p- 0S @Q 0 S  0S 䈅j?#=?c1P20`<Pr0` -|LEMpp, xP o<, 0RI(KG=^ L0p 0 ̇ p0@0 1  -LM%PA0AS`0  oPŸ pW}  0 00S0N O. 0@ BT0S*8S 0A BT>0S*IP  0p0C 0O 1R0' '  $8$80C0C$8$80 $0  0$ >P05 !P  0p0C 0sO$Q H5;5 1R0! !  11D0C0C11P  s[$ K@P P  g[FO5;5 p-LM PP@` r0 0T TT T0 Kp0K mx0S0 0@0@Ott  0P0C0S 088;8O0*0 0@0@0z -LM5 A0AS%P  K0w`PpO00 @0@BM0@`V@ 0S  0$KxAB$ `zV@1SNW` p-`RL@P0PS00 0S 0 00S w00U@p -0BMLP00@p`pVPt0yPh `K pEw01S 0 0$ BL 0! UL! 01H 0 0HLD 0 0@0@|N@  s7PB G0S 41pp 0 p0 !0@0 1 ,K -FmPx0x @pULpG?CxP D+v@0P E< 7P 7|6  Q-L 0u` -QL`@pPp8 Q Q  |0yw ᚾP A=A` sphS A0A-0 r<`8 -L M@pH`#T'Ġ$$H0K/ K+K)K.0K-PK,pK*@K(` M|p =x 0K P \0 @`vx (0K@`*vuL$K`  -0LMp Q@  0R,K01g _K3 0PP  H`K(3 T0`PP yK {n  @> -2L`u0PS@0@0Sp2 0SX2uP   0@0S,2 0SPP}mp '1F P,}1 0 0!001!@XXH80` 058 P@?*. *㠎P`1U@=08 0``010!8,1!1$!$10@!0!k1!" F0 0 B` X0G TG @ 0  @00@0 @000htx孡d@jq'=0909Ȳ9<|989L99P\`@ -p1LMh!p`A$ p0S@ R K$ KP;$0 SP@! `$0`0dS$0   S@ȠK8#蠑ࠁ,Ƞ@ 0PP}PP JDK8 #HCD@ h0@gPP0  0,4V?Cy\j@(@ -L M@03 @@K -LM 0 @K@/P[K -4LM,2 (B`( $ p 0S@Q$K( KPP  01s K$p P0R0O R3 R? R= 1d~ 0R0O$C.K0 PP 0A P 0  @~奠q 0.@K@P (0 S@181#1K#8!#8! PpP T(00dpPP(0 $mCj@(@`H@ -L M <#83  K p-LMP0@!`0P .P Fx1-sKpA-$ sP\π P6 P0S04!4000 P P 0S PKP0[SSS0 # > R K 0P 0 R p0 R g0P P[8 0,[`@j(@dn91j9 -L M0 @" @K -LM@`P&pKUPD0} P!0[S S X0 K` -L`M|K`@P  P, p0@A$|0KV0Cy Kx@KvPKu0KzKw`K *@ 0@@ P, 0R (KG4s0KtpKV tK y렕n A> -L M@Ƞ,Ƞ0@ }K -L8M0TpKP`0 $0 @㪿,0' PKRKT0KQ@KS@K;: JK3: 00*0K*0K& Kp0⸎0 /0)K(0K0'K%0KP $ 0R  KU KKPU0[Sx렕nA> -0LM @RP `Ktp _0 S K U0 0KP [PP -@LPI5p=`5uP {s'tp\@P sstpE< JB EiH 0-8L@@0P`0A[nP0PMsD0PIs00S ᔏah0` -L|MĂ0PKp (0 !χ 0@P ( 0R$K蔠Kl ξT2T" 0Q0Kh @2 K@K@K @K K K@K21Cc!0 0K#0P+ K0KKKK@KPKP9S@K SPK00KNK@``KP21Cc P U `)KIdPE 0*KK,@K)PK+PK l @P  >@P@PP 0PQ@P 0H@Py| 0?@Pp 0P7@Ph 50P/@`qw렕n`A>* + (A> -LMpPH5@%gP)yP!818ABm ` 0ruP" G5@0;5GH@ 0G K啝呝LP B=0 FuPp pFM0E-X< ` `psP Gd@@6 9 -PL@`p6H10&S69H9H9H99H9H9H9H9H9H9H9H9H9H9H9H9H9H9H9H9H9H9H9H9H9H9H9H9H9H9H9H9H9H9H9H94949@(@3%1 @VG 4P@5A0AS@4@D50590 R0= S @S @ (00  0   -L@J4P 5A0AS 4@ -L8M쀟0XpK`4 @P$0 ")00NKX0KVKO@KT@KS@KR@KQ@KP@KWPKUPKP0)|0& KQt0.PK d0@-K- K*0K4 0C7%0K(K'@K,@K+@K)@K/$ 0R K(v렕n 0-0LPboPA=0S S 0P PIG@0u0hF0h `0@ 00CS99999999 P P@7P,@nPX@l`0 $H0AhSw9999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999990 0 Rf Q Q0-L@P I  0@AT  08#0`08#0@jPj8909@9090909090909H9P90909090909X9090909`909h90909090909090909090909p90909090909090909090909x9090909090909090909090909090909090909090909090990909090909090909090909090909090909090909090909909090909090909090909099      -(L`P@""4"̠00S0p a0V V 0  04Ƞ8,Ƞ< *;"*#"#? ## 000 0 000000BFhV Ƞ ,4V 0 8000L0Ba21C0aT  Q  R ,{0 0 颋.P99999999999999999840,($ ,?,?,?,?,?,?,?,?08 Q-LA=Tm R0-LP 0h^ F=@0C 00h @B B-0@ A=mP 0E 0hpqꤧ@~ -LMA mP# mE`? p0K ,K0KEMT P0P/K0@N+K0.K-K*PK)KZmo>D So(KX9 0-LCMP0PS m000U00 -LM!T KA@Cd@p$K$K#K!@KPK`K"@K0KpP Z{ љK@ p-LM@ KKA=!"T`  K:C 0KKPKK@K@K{pP 9{ 尙Kp@ 0-0 @L$8P0 $ 0 $0h 0-0 @L$8P0 $ 0 $0h   0 R   V p-X0(  Q@P PL0@`[o  ph -d@L y8#H,"(r(R -(k(R  hcfdh -LM!T KA@Cd?p$K$K#K!@KPK`K"@K0KoP z K@ E-0-0 PL@0NB B⮊[@Q \00HS 0\ 0R B0HSQA=kP 0E 0hp 0-L MA=KPB=C@!0KB0K KKK0K@K@K@KoP[K0Iz @ -,L@8    hD -,L@8   hT -LPp`@x  @T`h舘T @46%CA("(0$(1 0p,? -@0L @R ,0 )0 @ hV, !0-"(LXP@Mi @T(C0T Z0@@ -LPp`@ML @T$h%T $hO-? 0-@LPT T 00CS 0hV p-`LPV@ V@@x0 AQR@ P@  ("(0(  ("(phV p-LP@@CdT nP dT8志p,`@0 @|@Tp8-?A> -L@033`PPO P@l3l#0Pp1p#S,99p9p99l9(#$3!3yDp V ""2! "8S 8S F V  F#NwVCiD2!\ (""2!#)D !!1!#@ !1!#)D }VP! -wT!rP1!m#@  f$1!a#)D [0V  T O K0!F#)D @ k -:8 6<0!1 - -XVB>B>hC>C>B>PB>B>0C> -LM!T KA@Cd? p$K$K#K!@KPK`K"@K0KbmP x 嗖KX@ p-LMPK 0@[0 0[0K[!Š  !!R0!aP P` 0 `/0F-&  0F- <0xTV 0-0h 50LSP0CS005 0h(;00 @0@0lp? 0-PP#C B-04 ß  PhjPࠁehß, 0R(Kp3 PʌX 4!R Rڬ8S S0 x q#H0820 003\mX 4t4@D l@D d@H$H@H$(D.8 < 81S'` y74D(G 0@0'PS@ @ GŸ0 0/.000b0 q @B `P?HBM04@00 ?HC-80 0<8\p '.0 8P/! X 0 P Pg9jP@ J 44@Df @@H$D啷 p-LM5`=@SP x 10R''  $8 0C$800  P  J hPo1  050(AR?@q8S q B 1AS T1 RL0A@T;0S*DP  pJ K@P P  dJ *P Q00 0@0@x0 Rʁ. 0@ BT0S*0 0  P 10R!!  10C15;5xxl4 0-0BMLP004@PA=BiPp f<P40@ T08屓 0 媓 084 x@@ -LMA=`p@)pKiPP  00 fPf (KĐ  )0K pfipP f 0+0+] 8 0 pfi@f` -RL@ ZZ t AZ& 0 0@0@>0`p lP@ 0@H0 @ mP=0Ci꼨@4l` 0-0@A-Lh0P eP 㻿PP ;߿ 1  `0 0P 08,ݒ ْ@@/?$/? -LM`LS@0 @DTD@D@>dTd >SdT[  "PP@ $K8p0(OpE-00 N^H Qg 021C! c.  P0~UA=g1P@, !СA= 0  j@P s TP@1A}p  0j@Po@P T=s @743P + @ A !ˠ0B-$ XegP@ (R B 5RN n   <50;@05(R  @] B@WPPA>"VSXLDt@$@H@@P@ԩ@,:D@ -pA]L`@dP@ d<1PT- x10Sl1TI 0X]@4T@ D1T# <1T  ᫣4P@# ;A=f505 0S05@ @@ @ ኣ4P@8S 5A0AS@@ ^0X]@5A0AS @i ϖ1i i i -LMȢ0R,0 P` \\ \? "ˠB0L  @df, 0R(K >Kd0!#R0 0@0@0@ TD D H! pPo ;H!1 ሽ1=g p00p0pD0T 48<#8:#:0 0;@A@ 0S) 01  D 1p 0 K p0C 0DG= 0 $1 1 0H! 1 /? -@A}P,PL`K` <KgE Hg0 ``dh -A=L@^cP*10P 8R`::|:|:: 8S (R8sH<1@ (0C8p8pA=$cP <^g8p8hS '8SS#pP  |P ᏼPhS8 A =hd(h@f.? 0-A]L@bP 0b8S 0h>e0 -L@V4P 5A0AS 4@  p-PL:0` /0 2AM,_f00S 0@ẀY@P b00@P \dep@P Udet9p <Uf0  E NfPhX\` -L MA] goP 4(Ko}AM@ 0c`Pc3#0PS@0@0S2 0Sڸ2bP   0@0S|2 0Sh2 r 0 r TT2T"0  <0 d(2(" E  {d GQ0,0  1!`|p@Y0 ,p158 㠨嘈圈⪸6 㥸 @{t1/XN>0@T1T!8!L1L!1!,0@ 0`⊸&X1!1#2!I}G  X0A 0 D0C @<0D BD0(K(Ko辎 (Ko踎(Ko賎8@HLD:x|:9PVT@q'='=<9 9p9<94::4+(&\@@|@ -LM 0S  0 Ƞ8,Ƞ#8 bP C> - 00 LR s  0 0-$@0 TLP,00  0@T P0 P 00 0-$@LTP P0 0@T0 0-$@0 TLP,00  P0 0@T0 0-$@LTP P0 0@T0 -LMQ@ 0?.C""0 @@ -PPppL* 0 $P `U 80S T V0@T404040@BjTW H0 ST404040@2j娎@ -LM`sx@V spp0$ 0QH< P$ R 800 QPR 40PP  X00 S P<0W)< < 4<8  4   4 @Kd d0, @@ 0 lP $000S$ 0040$0$40HP(00(0(K ?p : :@@ -LP00S 0 3@Ń 0S 0 S ?>#R 0-X0L @! 8T0 $4T0P $84X0Q;+S  ; S80  ;0R 0 S0@@@X  (RPH0RA0R #R!&R #X00X0lcLTJ] -X0L@lc 0-X0L @TP= \0 C K -  !`0   [ h v D\00L  00h]L0& ]\0  L( 0]L0& ]\0L0"]\0  L0# ]\0  L0# ]\0X 0@ X h00<0L 00p]X0L0 h X0+0 Bc]`0  LX  0h0X 0C+ S]`0  X 0@ X h00<0L0 0A]`0 x 0-TL,0@ 0P 0P n\g0St0 gP S tx 00PPx0S -TP 00LR`p @$<0 T ,006@Oh6, \00Q0S 0-(0LP06X0@08X0 T0$4P0T 0h5 p-X0@L$!;98 T8}7P7dU 8 T0$4` PL0S X0  p8;T$8p 0-X LP@ `0   @  P0T$8 8T$8 <8T>X0.L 0\ <#3  `0 + ;8#(0T$8 8X0@ `0T*, ,0$8 8T$8 <80 X000 XvXS0@&7}T 8 T0$4 @ @000l@X0 _`}.b0Bh@X: 0-LTP 5& 0 08 $4T0@8$ 4@h d0R 0h Sd0 P0d@Kp0 -T`L0@' 2 1C P ^{Y$8 80T$8 8X0@80T$ 8 $84  X0  hp@ -Tp@ P0P,@`L8 T0$4T0 P8$4@,0 0,0T0$84  00 P, 0P 00S0P 000 00P0P8 T0$4T0P8$ 4X0@@ ' 0PVP0P(0S  \0P`0  8 T0$4T08$ 4    0PVP0P  0PVP0PP0P 0PVP0P    0PVP0P@ 0PVP0P 0P0PVPP0P0P -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300  00000000T0$8 4 8 T0$48@T0$ 4  006000T08$ 4@0000000000600  006000 006000@ 006000  006000 0-@L8T0 $48PT0 $4<#38T$ 80 0-(0PL@ " 0ES(!:@!:!:!:0% 8T0 $4V>0$T8 8Z)00C0 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sp -LP D> p-`L@P  x(0pL0 P8 TP0 X0h T$8 40 \pphD>@D> -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300  000000008 T0$48@T0$ 4@Ph$:\#:\#:\#:T$:\#:\#:\#:\#:\#:\#:\#:@$:\#:\#:\#:,$:\#:\#:\#:$:006000006000006000006000006000 -@L8T$ 08 0-(0PL@  0ES4%:L%:%:(%:0%W&00@0 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sp -LP D> p-`L@P  p(0hL0 P8 TP0X0T$8 40 \pphD>@D> -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300  00000000T08$ 400000   0000000000660000 0-(0PL@  0ESl(:(:(:`(:0%X00r0 L0"S 0 L0"S 8T0 $48;T$ 80 L0"S+p -LP E> p-`L@P  p(0hL0 P8 TP0X0T$8 40 \pph0E>@D> -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300  00000000T08$ 400000  0000000000660000 0-(0PL@  0ES+:+:+:+:0%<000 L0"S 0 L0"S 8T0 $48;T$ 80 L0"S`p -LP PE> p-`L@P  pM(0hL0 P8 TP0X0T$8 40 \pphePE>@DE> -@T08 L$4@ R\ &RZ X0`0B%S&-:-:-:-:-:-:-:-:-:-:-:-:-:-:-:-:-:-:-:-:-:-:-:-:-:-:-:-:-:-:-:-:-:-:-:-:.:-: &R& 0T$8 88 T0$4Tp08$ 8@0&S 8T0 $4:89T$ 8 < T0$8 4PT$8 08T Q-L| p-T` @00@,0P8T0L $4T0@8$ 4 ,00,0 0@0@C0@ @0@pX0 @0@ @0@ @@0@0@ F0@0S p96@0S0@8 T0$4T0@8$ 4 00<00p p-(0L@`P# 0BS,1:D1:1: 1:0% i0 8T0 $4T98$ 8(ppBp L0"S p L0"S 8T0 $48;T$ 8p L0"Sp 0- @L8T0$4T98$ 8P}U 0T0$8 4 P0 -LP E> p-PL`@  DŽ(0$L018P0 0T@?>C2@0 0 X  8@0 SC S  T0$84  \ T0$8 4`phhX0  8T0 $4T@8$0 88T0 $4=8$T= 80$T8 8P0X0 T0$8 40 S@098$ T8P0@0E>@tE> -@L8T$ 1<8 0-(0L@P0  L0"SU U U )000% Lp080@ p-@LP`(0L0 P8 T@00X0( R Xph T0$84  \pph@pF>4@ - 0LT@P0 3@50  S R ? `@Z -$0Tp @0 ,@0`L8 T0$4T0 P8$4@,0 0,0T0$84  00 , 0 000  0000008 T0$4T0@8$ 4   ! 000000 tP oP8T0$X 4 000 0008T0$ 4 00@ 000  000l@\A -(0Lp L0,S@R R R 0%  T08$4! 0%!R T0 8`$@8P0  0T$8 8Z˃p@ 0- 0@ LhPP 00 3@5 ? 0ӜP  ΜP00F>\Al@ p-L@P`hP  宂(0xL0 P8 T`00X0T$8 40 \pph吂F>@|F>@ -T` 0P00,T0L8 $@4 ,0p0,0T0$8 4  00 0, 00 00300 0008 T0$48@ T0$4 00000 0000000000 660000 p-@L}8P$`T0 8@40 p 0-(0PL@  0ES=:=:=:=:0%> 00'0 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sp -LP F> p-0L P3 LP@`( 0P?> S0P0w  忁(0L0 T`8 0P X0T$8 40 \pph?( P 0 3LF>F>@F> 0-0BPL@ S ?:?:?:?: L0"S0%(y00 L0"S 0 L0"Sbp -LP F> p-`L@P  tO(0lL0 P8 TP00X0T$8 40 \pphfF>@F> 0-(0PL@  0ES|A:A:A:pA:0%E00.0 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sp -LP G> p-`L@P  pԀ(0hL0 P8 TP0X0T$8 40 \pphG>@ G> -TP 0,00@T0L8 $p4T8 $4,0`0,08T0$ 4  00 , 0 000  000000 0000 00 -@L$8T 088T$ 1<8 0-(0PL@  0ESD:D:,E:D:0%rA00[0 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sp -LP  p-`L@P  p(0hL0 P8 TP0X0T$8 40 \pph@0G> -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300  00000000T08$ 40000000000@660000 0-(0PL@  0ESG:G:DH:G:0%*{000 L0"S 0 L0"S 8T0 $48;T$ 80 L0"SNp -LP xG> p-`L@P  p;(0hL0 P8 TP0X0T$8 40 \pphSxG>@lG> -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300  00000000T08$ 4 0000000000 660000 0-(0PL@  0ESJ:K:\K:J:0%d000 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sp -L;P G> p-`L@P-  tu~(0lL0 P8 TP00X0T$8 40 \pphG>@G> 0-(0PL@  0ESL:M:PM:L:0%i800R0 L0"S 0 L0"S 8T0 $48;T$ 80 L0"S p p- 0`@LP~ 0?.C""}(0L0 P8 TP00X0T$8 40 \ \0 `0  ph4ph}T0$8 4`@@G>4@0 3$ A5S ?>S @ -T@ 0LP 0, 004Õ0_ p,0S,0`0,0430p , 430` , Q' <#0B RSQ4300 ,00000000004300 , 00600 0060000000  @  \0  006000 , \0 @- 006000006000<3 SS430CPp \`,0p 006000\0  006000 00000 -TL0h @4Ô0S`\p,0h  )430S`h \@,0h  -T0X Lp Z @(}Ty 430` ,: S@@430S@0 \`,70 430S@0 \`,<0 430CPh \`,0h \0 44×0p 1\430S@h \`,0h 430S@p \`,0p 430CP` \`,:` 4×0p 00\X00X0 -LM(0p R R0 R  N L0"S&  L0"S5 @430` ,Pd0h 0Sd0X0d@0X0( L0"S5 0X004Ú00 ,0q,Q,  Qb Q{ 430S@h \`,0h 430S@p \`, 88p 06S\ 430S@p \`,x -@Lk@0S 8T0 $408T$8#8 88T0 $4 08T$8#8 88T0 $408T$8#8 88T0 $4$0 08T$ 8 -Tp@ P0P,@`L8 T0$4T0 P8$4@,0 0,0T0$84  00 P, 0P 00S0P  00P0P000T0$8 40P0PPP0P0PV0Pb6P0P 0-(0PL@  0ES[:\:T\:[:0%&w000 L0"S 0 L0"S 8T0 $48;T$ 80 L0"SJp -LP G> p-`L@P  7z 0?>C2@0( L 0P80TP 0h0X T$8 40 \pphIG>@G> -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84 00300  00000000$8 0T8T08$ 40S$_:^:^:^:^:^:^:^:_:^:^:^:^:^:^:^:_:^:^:^:^:^:^:^:^:006600000000000 0000000000 000 -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84 00300  00000000T0$8 88 T0$40@8T$ 8?< S00000 S00 000660000 S00 000  S00000 00 -@LP0X (  `0>T$8 8@0TS<<$8 88T0 $4$8T <8$8T <8\0 <C30; 0-0PL@ 0T$88 R0dI> -@L8T0$ 88T0 $4;8$8T#8 8T$80 88T0 $4;8$8T#8 8T$8 0 88T0 $4<88#8T$ 8 0-0PL@ 0T$88 R0LI> 0-0PL@ 0T$88 R0I> 0-0PL@ 0T$88 R0H> 0-0PL@ 0T$88 R0H> 0-0PL@ 0T$88 R0H> -@L8TD0$ 88T0 $48 0-@L8T $98P#00U 8 T0$4P 0: -$0p L@@00C*S,h:|h:g:i:g:g:g:g:g:g:g:g:g:g:g:g:g:g:g:g:g:g:g:g:g:g:g:g:g:g:g:g:g:g:g:g:g:g:g:g:g:g:$i:儑P6X0 'T0 P3    @0S 3  8@$PT0 8`40 D0SS]MP HPT05P#"XX0  d5X Qo!$zX0  $8 08$8 0T8T 0$8 8$@8PT0 8`40 $P8@T0 8`40 X3P3<$QQ ,4Q \3@ `38#8S $8T 08`3$88T#8 88T$ 083ZQS3K>3E)3=37$8 ;T8 0T@$8 83#T$8 28;T$8 83T$8 08Q*00 R0SJ "G$8T h28T@$8 08<$8 8$P8@T0 8`400 X3YT$81 8$P8@T0 8`40 $8T x18$8T :88T$ D18T$80 8$P8@T0 8`400  0T$8 8!$P8@T0 8`40 $8Tt0 8$P8@T0 8`40 (@,@W WWW  Pp -Tp@ P0P,@`L8 T0$4T0P 8$4@,0 0,0T0$84 00S0P 000 00P0P00 P0P8T0$4T0@8$ 4@ 0P0PVV0P0P NP0P -Tp@ P0P,@`L8 T0$4T0P 8$4@,0 0,0T0$84 00S0P 000 00P0PT0$8 4< S>  S,  S>  S 0PVP0P S&  S=  S6 @0S0  P66P0P0S8T0$ 4  00\0P0PVP0P0PVP0PP0P0PVP0P0PVP0P0PVP0P0PVP0P -(0LPp` R R1 R)  00R. @0S5 S S5  L0"S1 8T0 $48;T$ 8L0 S=  L0"S, X00R0S D0SS0% P 00SuLt:\u:\u:Xt:\u:\u:tu:\u:\u:\u:\u:\u:\u:\u:\u:\u:lu:\u:\u:\u:\u:du:0 8T0$4T0@8$ 4~d0h 0Sd0xdt|0$6S8 0T8$8 0T8 0T@$8 800S S SO$8 0T80T  0$8 83 @ -LP I> -$0P L0@p`PY0  W   s(0L0 8 0?>C2@0 T` D 0 X0|2P0xX0 0h0h0X00X0P T$8 40 \YL0"+DX0 P L-+0D寍PX3\L  0mD埍PX L# 0DL#,0DL&*0DL0&!,DXL00@ DL00-{DT0$8 4`_P P3#(x0(Rp0P0y h0Rd0P0t \0P0qL 50UD0J(@I>@\H>,@WtH> WH>hH> -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300 000 00000T0$8 48T0$ 4 ! $ .  0060008 T0$48@T0$ 4   006000006000006000@ 006000 0-0BPL@ S {:8{:{:t{: L0"S0%@00 L0"S 0 L0"Szp8T0 $48;T$ 80 -LP |K> p-`L@P  tXr(0lL0 P8 TP00X0T$8 40 \ppho|K>@pK> -Tp@ 0,@00`L8 T0$4 P8T0$4T0@8 $4,0P0,08T0$ 4  00 0, 00 00300  00000000 0000000000 660000 0-0BPL@ S ~:@~:~:|~: L0"S0%~00 L0"S 0 L0"Sp8T0 $48;T$ 80 -L\P K> p-PL@`N  q(0L0 P8 T`0 X0h  T$840X  \\0 pphL' 0BL' 0}BK>@K> -dT`0LSP, 000,84!T0$4T0@8$!4p,00,00S ,0 00 6qT0$8 4 000 'q8 T0$48@ T0$4 000000000000000660000\j7@@@ L>@ -|1`LQPp@(0 0GS ꄂ:::t: L0"S0%  pL0!S  L0"S0% 8 T0$4T0@8$` 4@d0h 0Sd0P0d@p\jL>@7 p-L`P@p0 R$(0L0 P8 TP0 0h X0( R pphxp T0$84  \pph bp@\jL>4@,L>@ -0 3B5L  ,0UP ? `@ -D0LSp8T$ 08$8T :8T$84 8$@8PT0 8`4; 8T0 $4:8$T#: 8$8T 08$8T 08$8T 38T$8: 8$@8PT0 8`4; $@8PT0 8`4; 8T0 $4:#:$8T: 8$8T 38$8T 28$8T =8T$8w0 88T0 $4:#:$8T : 8$8T `28$8T H28$8T 028T$8< 88T0 $4:#:$8T : 8$8T 18$8T 18$8T =8T$80 88T0 $4:#:$8T: 8$8T 18$8T 08$8T 08T$8< 8$@8PT0 8`4; $P8@T0 8`4; $8T 08(he A` -L@3h 0-D0LSP@X0T 8 T0$4@ 0$T8 ;8: -@LP0\ X0,B# 0;8T $88T <$88$   L0"S 8T0 $48;T$ 8 L0"S 0% P0T$8 400S-$:t:t::t:t: :t:t:t:t:t:t:t:t:t:|:0% D0SMT08$ 4 d0h 0Sd0@d@@ 6S) 0S, MS 0$8T 8<$8T 80T$8 8^`U0 +0S, @T08$l 4B -LP HL> p-`L@P  5m(0$L008P0 0?>C2@0 TP D 0 0h X0 B40 \ \0 `0  DP0pT0$8 4`HL>@ - pLT08$48?N T$4$0 0P$} 0I+S,T:::T:::::::::::::::::::::::::::::::::::::::::, olZZ q8@$PT0 8`4: $P8@T0 8`40 ZZ =$P8@T0 8`4: 8@$PT0 8`40 $@8PT0 8`4: $P8@T0 8`4< b$P8@T0 8`4: 8@$PT0 8`4: H@L@ -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84 00300  00000T0 $84 R00@000 R00000 R00000 Xk00 660000T0 8$40 0S  <00p@ -Lh -RLpP`$ R5 R \ 00R , W00R0S L0"S5  L0"S 8T0 $48;T$ 8 L0"S 0% s 0Sd:L:D:<:L:L:4:L:L:L:L:L:L:L:L:L:T:Up@6S$8 0T8$8 0T80T@$8 800S 0$8T 8 p-`L@P  j(0L0 P8 TP0 0X0h T$8 40 \\0 pphT0$8 4`xL>@lL> 0- LP|@ (0\ 0| ,0\00 -PLp `0  P4 P @ 00?T0S @ 00?T0S 0S $X@ R 00 -LM`p 0K@PP R  =S  R 4W 00 R000K 0-LM 0KP@P   K0R-4.\ 0S0 S 0S 8 <S S 80S  8 000p - 0LS@ 80#,R R#80S #8 00 P0 0@ p -L M,Kp 00KP`P( Z)0  12[((18,0 0 @T 0 P@,  X p(K -L M,Kp 00KP`P( Y)2[((8,0 0 @T r0 P@, 0   X p(K -LM` 0K PpP V   R @ 0 0TVD1@K 0 ' -L MP`pVC <0 81 R9P@< 0@(TP<0  <@0 0 < 0<@< 0< K $0K&P `VK<X t<$ L0  0 <$  P0<@$  T0<$ H0<$  T0p -L MP`pVD`VA <0 @P<0 P(U@<0  <0 <0< < K $0KP0 R <X< `VK<0$  L 0 <0$  T 0H0<0$  P<0$  Tp -LM0` P  YD (3>*@ ,0K]P@XYN (K0K4K8K,0 pP0Q ,0S$ *80 P 4 0TP P,0@ 04 0TP,0@ YSP 4 0TP 04 g0 ,0 0400 @0  xJx00@$&&Q020a00#40 540 %0 P Q 4 Rm 1 *0*Q020a00#40 540 %0 P Q 4 RE$ x1 *0*Q020a00#40 540 %0 P Q 4 RPV QT 4 RQ 0mTPM 04 Sg$ 0B04 Hg0 ,00 @0 ,0TP 04 `.g H009TP 04 ,g0 8@@@X@ p-LP5D`P PP @ T0P0p -LM K?K,K <0KP ,0 h |0 0|0 Q$ PK0@PS P <  < @P pQ\ z P0@S0P0`P0VP0< (3:V[    -Y`P  0@ 0 0PY`ʠ\F KT T0`E@#` 00 :: -LM\0, S`<@E\0S?0X  P 80Sp 0("(R R  !ZP  pYpP U0X  ,0 P00SP  -\PL0pS` @0 \@ P0Sj p-L0P@`qeP`000 4 080 < 0@0 D 0H0 L $0T0( X ,0`00 d 0(\40 h08LlV 8R ,NP$0 PphF@:p:ԝ:p -LBMp0`QP 0  NK48̠0  xe, (le 0RK(, NK<e84̠ 0e>렕nt?@P?L> Q0-L@P Q Q@ 00h@@@E0 0-0LP@~P  0q( (QP00 p-@LP`  p p -LM@ P`,0  1 0  0   p 00  W% ,0S$ 0,0  0  p 0 W -RL M@PpA?QX@  ,   `<  0  8 0 X04 00 P<QF,D z @0 Q (KdX] 00@8@P` H D HpK pPw`0@0K 0 S SM S0S00 R 80 0b00 R 0 000 @ 4 0  0  40 0p80 0b0'SZyd40 rQ 꼷@ط@ -L M@00@2K R-LP@`ca O / 0  p 0 < 00c0 3 Q000S  Q0 00   0   0p0 c@@- @ @ @@ -L M@00@vK -L MP0`@ 4K0K 0QpP00S,a P  40R !Q30 QP p(K 000 0S 0 0@ 00 Z3 00 0@  R4  4 0S 14 5,0K00 0Pp\@ R,00 0S00 0 R400Pp 00 0@p,0 S!0Q ᆀ.L>< 0P8#=Q0S Pt>L 8Q#Ƞ    Q 0R S0RSS> -LM0!Ƞ8 p 0 <0 !l*ȠP4 ,  , "0Sn 0VP0S P0S@XT ,Q$ ,0 <!a O|<00! `(KoaP@T 0S 0W0S 0S @40 <!a8, 0Q0R0S <  { |0S( T \ < ` ya |<0 `00(Kooa Ƞ,Ƞ4 <l l0eaP<T `p\a<0< `0pTaR>|@ܸ@D@`?@̸@@8@@h@ p-X0LP\` 0 T@0 TpSbd>n(A -P0L @R 0 T0 $9bd>n8A p-LM`@PT x0SKp0K"0 0P80  P -a bd>n\>nXAHA8#8 S- H 00S P\^ 0\> -0L8 $0CU0S, 0" $0@`P! Tp$0! `L@0 P à@ 0" T0 8 T0P@! T`$<<0! 0P@; T`$<<0; 0 0P@ T`$00  -L@MP`48T0 p 0XP@ 0 0  00  00 00 00 3101 0P; X8 @0K8KP@KHK0  @XPZ7 <0D4  0 0,K$P9 X8`Q 000YlZ  40<L (K@4K::@:l:: 0-L @P 0 pQ h 00p00 -Lx0 | -x0!L|$ -Lx00!|T -x0!L| $ -Lx0!0| T -Lx0! |\ p-T0L`0C@P #20010 %p p-P@00L$ ` p  @0@ &$ 2$0$ &$ 2f?i?l?q?A-08 `P@ ^0@ 0rPh0h 0Q T T01T"010008l?f?q?i? @0 80!$0 0!i?f?q?l? 0-0LSP@ lP hQl0P hZ0hilW hEl0W hN -L 0@ 0 @c<0@$21C0a 1 0 !  $ 0-L0@P 0 @c<@0T021C0a 10 ! 0 T0 -20 1C0aL1x0D $ -80L L ax@0D T -20 1C0aL1x0L $ -80L L ax@0L T -80L L ax@0T \@-@4x 8#8S  \ Ƞi Q 0 S 80S! Q0 P 9jh>n44 8#8S !8S80S9 p-x0LP|!$ x0!`| $ 0x00|!Tp 0-@PLxQ0| Tx0| $0 -2`001p" P5L@ x0| $ 1x0| T5%$x44!0 |\ h -@"|!BP1L0bx0` 2ᇓ  00 !20@ 5   1(Z   $0   $ 0@, R @0  0010 %0",0 @0  0@ PY@( 0PY@ $AA -`Là p" P x| $0 #x 00| Tx@! |0\ 0i[ -遒ၣp LM@P`   0P, f(\0000    0 $0 ,  00100(P@P"!B0,5 0P(P 00 P% B 010(\  $0  B 0 @ 5, d0%0!D0,(K, 0X dA- e -2@001"L M`5PSp (K,0K(080K 0,pP  0TpX=00 0 8K,  04pP=008 0 pP  0pX 0pX% 0pP  0ppX 0   pP  0pnXꠕAAܕATAA -pL`@P30  0 t0S#PUO aP3003 -LMp,0 Pt@`ph0l hl0 0X 0  0  P#0 0X 0  P,0  0 0(K$@X 0  $WvAЖA -8 LR`p+p@PPLR@"ڰ5Sx0! |$8  3AGP8 p $W8 PLR@A -80LS@-Pp80PSp$x0 |$0S`3 GP 8Wx0 |T80PSpA - 1L@0@ ,8#8@ p\0` ,0` \80 PU@`$PU@` 3B@ @FP80 0=W80P$A -0pL0@ ,80 PU@`$PU@` 3B@ @FP80 0 W80P$A -8 LR`4@P5S)#200%10Rp 0 0QQ+ 0Q( <Q% 0Q" 9Q :Q x0! |$8 PLR@9FP8  4V8    hMhbiMuA -x0|`L ,8pQ&@PPLQ@ڰ5!S;2 3EP8 $0~V8PLQ@$A -80LS@-Pp80PSp$x0 |$0S`3EP 8KVx0 |T80PSpA -`u Lhl8 R$@ PPLR@ڰ5pS5 3EP8  $V8 PLR@ A -P `lLh~W plhy8 R$@P 3]EP8 8 PLR@ ڰ5SU UPLR@ p-LM`0 P$p0 4@0$0 0 P $xhU 0$ 00 P $<xhU,0( 0  ,0xhLЖAALj -LM1 P$$!`p0ba p  aH1@!  0 P $ odU04 <0N>00 P'4@@0  !  T 00   P@T10 $ L ( L04$,o*U$o%U?DAjhAA p-4LSP`p @(0 @TTp -pA Lhl|8 R@ PPLR@ڰ5SX5#20010`P8 PLR@ JDP P Z8 -8 LRp@``LR@ڰ5S#20010PP8 `LR@DP P X8 -L@tPhD -d2 @LTH` D2p\4{ <\r0@ ,0PSX:D:,:X:D:0 i]T iXT0S@   M0S> 000`@VT330033c 'T0#P P T iT iTT  0T 0 $  $ 0 $ 0` $@P\AAAHA@A4A p-1PL$+` 0\ $+ 1\ $+ <\` 0$+,0S:::4: :0 phS phS 21CA@c@$0 T 0 (  ( 0 ( 0 P (@SUT330033ph phgSpP\AAA -t0 L@PG XpX`$ H0\J $ <\h>P#20 0p-L!0 00P0@!Q%`&KPP p% Sp?A#200 1t p-Q`L`@ń`KPP 05p%Rp|AAA -0`L0PSp  0\h@0l hPl0 h p-0L P0`S 0 ,Pph@0l h0l P -B"100a`10LxP\"T,100`10x }"100a10|0pS<:(::<:(:0 idR i_R0S@   T0S> 000@XT330033j .R0#P P'R i$R iRR  0T 0 $  $ 0 $ 0 $@?P\AAAHA@A4A - 0L@`0 PP0pr@D@ 0SP :0S:  Dh  @ 00  0080 p -LMP` [2p 0 >00 @L 80 ( $ 0@ P zQ$K00 pQkQy0t0 S0 4 !A> 000\ 0 506 l1l!<X0d 8 0(K$P9 0( ( @p(  `@1,Pp* W  0Q80S P@ʯ80PLS@P #20010p5S X\ QPQW @QQPܘAA@8:/;@::0ADAAlAr@A -L`P@p3& Wh儀l 000 # '8Q 00B90908 809 80h40 lpWOi# 9080Q #:088 # -L@`p4# 000  083 08P 00B8090908 \^ x!0| Th| 908PU Ѷ# -P@h0Ll@ p# 000 %8P 00B8090908 \^ x!0| Ti; 908`V Ѷ#038 0:0S0:0 -LMPph0l@ 4 h0lH h0lD , h0lT 0 8 8`#' 000 rO8@080T8@00C9090T080@ 0,0 0  0Xoh00lT h@,0lD h 0lH h@ 0l@ 80S 4x!0| T(Ko 03   90 ,0.8 08@, 0  T  @8 0 00<  :0080 80 80 8@yo?l? -LMP`h0@ lph0P l@h0WT X l, ,0 - 000  :0 S#5!2!50 008 020, 0, 88\080900 808 0CR900G^h0l@ h@P 0lhWT X  0l, R ,x!0 |T(Ko 90800 Y 0  Ѷ -LM`ph0P lhlX h0Pl\ h` l@=0h!2# @00@ Pc @% 000  :8! d00 0 0 083 0. 0d8Q 00B90809008  P@TόY x!0  |Th0lX h@l00` (Ko] 9080Q,0 0dж#ѿ 0d,t?{? -L$MH 0 R h0l@ 4B40h< D l!02018 L0 L 0H4 D0 , 0@ #+ H000 aF003 0S 8P3P#0<02 < h0l@PH @ (6H @ 0,Z㏏0 , 4 RLH0 RU h<0l@ h@l80D (K 03 0S 9424"002<0< 4  0*4 0 RV :1!1 D  0<1Ì8 < 8 4 04 x4!0 |TH0 RLh@ <0lh@l80T h0lO 010 BL 8 < ;80 0<04 "Œ< U:0 0 <  28,0 < 8 9404 0<04 "Œ< ~??????? -L M< h0l@ h0`lD h0PlH <h0l@T H H0<  < 01D T" !0 0  @P04@ , 8P 00 @` 0D 801P %₡140@0 4  F5003`VOh0l@ h@80lD 0`!Q h40lH h00lT ,0S Hx 0|T (Ko 90 , 08 , *8 30S:0 %90@ 08 0 ,*ƌ8 , :\h0, l<0  020:0 ?? p-L`@P3P UOphL303q -LHMP VW$7 0K$P "L(K 00 (H 0&Q 6Q d0CQ   D 06,p6QJ0CQS:  0D   L6,pp0S- @x|,K  0 @@PPtK 0p 000 0@ @@PK5%00\ 0 405 0p%60X <05P8 [0CP <0CP  l 5\0H ,008080$SH 4$L0P D 4 < @ 8 @ <2001T 0p 0L0 00%5@ 䐊 pCP @04X 40@0 2\0  `10a8000T0/0 PX\ P0@TplU  U !00 @ PP tD@ .KU4 01040\ X0!c83 01@a<000T0&.0 PL000T0/0 PP vLRBx04@CQ1P%0CP*z>CP01` \080!1` d0D@ J8pD@ J8pD@ {J8p0P 0P0` \00P 0PAt55:=:ęAA:p;3::\:pA0j0ADAAAr@@s=8::AHAAp5 - L@`pP 3  0UP/^ x!0| Th& 0:0S0:0… -Lp0t#QQD d3QA `@P* Z 0:e03 (3  (Ƃ83#00P0U05 h  !` lPUOV x!0| Tmx0| $hl@P ;: Q-2 dQ1 :0S. 03Vʠ 0e91 0 0(Ƃ W1  v"R:0SQ0v2 Q :0Sv"וR0 v2DžQ41 ( 020x0| T 0    9x ! |\O0 K  00S0v2Sv"R:0S0:0Dž00S0:0Sv"ׅ0R:0 8M0M????r?? -LMPZ `lh@ 00CS<";$";$";$";!;I(Ko !ܡ0 , @p3 pWOX  x!0| T||!|0 , 0DSGTK \!\1\0 ,0  h0  !@ l3  03 0bY3:# 01  h!@ l 8 R90S0B909 0, 1 800 1:Q0:0ą P0PP00 , 0  00 , ȚAHj\jhj܌jjjj(j4jjjČj -LMh0T lP,"00 e` p0 @ 001.0#A#0 0^8 0 ^2 03:@!001P0S8֕I 0`!Z 0 hlpWoh0lT Y  x!0 | To#9 80P808SP0@00909 0R8 @@hl/B{0P :0S0:0ȅv2S0v2ȅh@l0K ,0 g00,K o@8r?? -LMB0 kh0lD 0 24 , @pP3Z_p4 R 004x! 0|T(Koh0l h 8 l000! #*80 \8000C9090,80!h@  1l h8  0l#  4 04 :L08 # #4  0*984  \??? -Lp`@ 3 F81!0P h  !D l0 0  !E hlXOY:Zh@lPA 0 # 00A #x0@P|pA@ T`$0 8 R 9h0h 0 2P9B0S9 x!0  |T??!?? -LMP`20`,0 @lp0 3 0,,\ +;+;+;+;+; FpWO h!@ 0l0 R  0x!0 |T(Ko ,980 S8 80RQ8,, 0 00 81 *0#8 0 9:S0C0090903H hl 02 :0S0:0ą, 0LS,;,;,;p,; PUF,0:0D :04 :$0  A<?7?0?*?$? -LMp`P@,` hlW 3@@p 8 80D!1h! l0`VO,0S  x!0| To 980 S8 80RS0C00909,  0&, 103 h Q la: , 0, 0080! 1 :\0:0ą`?t?D? -LM010p,0 `UP@3  0v90 90S`80 4 21 PU@h0lL 0u290,0v`P  Q10Y  x!0 | T?? p-L@P `3  0 ` 0 `PR @0 100b 10t UphN ? -LM 4 8 hl ! 8Pp`9 000    @0 < J : 03R  :0S0@ 0 100T0Cp T:00":0,",Ÿ 0 8 0Ō<@8 pPUo !  0o8P 4 x!0| T(Ko < @9 AX1@ @ X@D@00  p H0 ,4  B8 08 <@8 A@0 @ \@D@, 0  p ),  ,4#"` B   0:0  :0S0@u0@s00   0@0:0e? ??? -L`P@p# 820 000PQ$9 1 00hSlWV T  0pWOX  x!0| ToCW[ X 9 0S0A9003 h!s l:\(60S007 00!s 0hl l!s h 0!l0s h8hly pP0:0:\070 (?3?-? -LM`Ph0H lh0lP 0"0c2#p@X3  \2 n@ d, + 08q 00 C9080\ #qq,  02\ 00B9080908 Ѭ1a 0 # 00!@DtZ  x! 0|Th0lH h@l 0P   03 6 b"q0Q! Q& Q : 008:0Sv2S0v2Ņv2S0:0ŕ:` 008 :D 008:, 008rK?P?H?C?6?=? -L M`p0h0l00 0H ,0 hPlP 0<Ÿ0c2àh@ l@ 4 @Pe0 08 00 I 0,1#QP^ 9080\ 0>\ 00B9080908 X1a 0 #< 00!PEuOY  x! 0|Th0lH h@l 0P (K  03400(::Q0:0ą` 0`20804 zB3803 t\?a?U?A -L MPph0@ lh0@lD h0lH `8 h0  lT H H41 (KH 4 2 !H 0`0<` l 4 0 , ,000Q q0Q p3Q`3Q T3Q L3Q 0Q @0Q 0CQ 0Q 0Q e?Q >Q q0Q: RxR::<R0 D0v"2QQ:0S0<D  00 j h :X"80@D 188 @ 4, 04 , 3b4S,0`S  81,`⏏, I 8zH9a<  < ,0Q4\:h0l@ h@<0lD h80lH h@l 0T (KoS0<:< : 0@ D 0, 0Q3@ 9 `4x!0 |T0:0D 0 t@ 9 H 9b<00<0 {%&$vJ$K$$v? 0-@LP3 0 3 h0 0@ 0 R 400h  @ r  -LMp @x2hl$ P  $ 0A P @ @U @@ K@*@t0 S01A0\000506 1!`<0X0d 4`8` 0$K$P7 0$ ( @P$  p@01,Pp U! i@0 R 80SP80PS AP 3B@@A@@~DG@P \`,7  0\ܘAlAr@@A8:A;::0ADAA S2 k` 0-L @P 0 pQ hU`0p00 p-LM@`S1 x0400@D`PP$?TT:8A 0-@LP74S 0h0h2#0010P7 p-80LSP`@3 80@S0P php -LM@pPU`c T 0ph0 0!   0Pp pPP! 0!  N0PP Pr`P $`? 0 (K$lS?0 00 P  0 0$(>AЖAhAA0ADAlAr@@ 0-LMP@  0?4S8 4S 0 $0( 8h6 -LM8 80S 4040  2ሓ4   80 !81`4X@ `6P2pP@4  0h@l)T4 0 408 S 00P% `@>,0K0K 4 @5S(K  40l%(i>|AA?AAAAA:A -LM@hPlQ 8 "80S"4 0P @ rc  !|1xUP@0L!Q U5ň50010%R> U 5 001 `p05 0 5S(K 60010@,0K0K @ 5S P U0 0Q { 0%(=%=|AAI:ЛAA -PL9@``p=0 <00 tp8^80S@ _80@SA -LMp`0 @P T 0t0=2 0P K 0PPPPt' 0  Q#* 0x|@P @ Pp3t0P0 H0H H0D0P L0D`K0m=(j=tPf=lA:::HAAA -LMP`9U= t0 S0 C0CSP_;`;`;X_;X_;X_;`;0601X0<x1 R080080`P80PlS`( iP #20010pA0K  ,0K@}Ŗ \  0" d5S B80PlS` $( 0 0@Pd `:9d (K0S060060A@8:@;: -LM0`XH< PP+ xPA 8P> 8P 9P :P h0lP 4 0PP P' X8P$ P8P 9P :P 4  4 (8PP 8P 7P 7P 9P :P 40 8   8 8< 000 7R 0RR700t0S 00l'A>000\ @4@5,7,'QQ  0& 7Q# 9Q :Q 6QPPQpp06Q <Q \R6Q00SW6 6@060T&T6QQ H6Q <Q 86Q 9Q :Q4&0&0X  <08 6RR 0CR 880%5QQO 5QL <QI 5QF 9QC :Q@ 80Sp`Ph lt5h@ d5l80pSP0$5QQ0(5x| \x0| $x00| Tx0| $x00| T80SPp8 P 00$,4QQ 4Q <Q 4Q 9Q :Q 4QQ:74 ᇣ 0010<80 5S| 0#QQ# d3Q <Q T3Q <Q D3Q 9Q :Q PC0K<8 ,0K@ ,3,#L0P B C0K<8 ,0K@5Sx 0"2QQ% 2Qa <Q^ 2Q$ 9Q! :Q DP 0`"QQ:74 < 804 O0!1QQ9 1Q6 1Q3 1Q0 9Q- :Q* F80p\SPH0l!h1QQ \1Q <Q L1Q 9Q :Q hl40P (K 80p\SP 80<80p\SP0CRIF0CQ07' 4)% 780p\SPʰ060s0CQt080Q07xthMhbiMibuA3M8:0M8Mx;; sE s :0:::ЛA -LM8 "80S"4p4  00S S S S S 4 0BSL6 <6t0 S0 (#(3\ $#000X <04504  SRn6, R}08 8080`P- xP! 0 2C0010 |Ÿ , K00K5SF @@A0 @@1!-J80PlS`S!P hl8P %W68P 80PlS` R5 R7 R5 R3 R1 0BS40RS l@hP[ 0 0[ (K8 0BS060ǕR40S00606080SR 640ASh@lPQ 0Q h@lPU 0U hPl@Z uZ 0~0 0K 8 ,0KjA@8:8!;:ЛAA -LM`< 4 5<t0 S0 40S0004 00R;00H#H3\ H0h@lP8#040X <85S .00S 6h@lPP "00P *h@lPC 0C h@lPM  0M h0l h 8 0l h0l  840S]80SGPp %`580p\SP: ?P 0S #20010<0  B5S 4 P1RLA0K@<,0K  @C5S P-5S  0 <80p\SP(K 4 0R000C60K40S006060Dh@lPK 00K 8  40h 8 80l 5SA8::#;ЛA:: -LMP94 #t0 S0 \!\1\ X!000840<56X (18R:0004 V80S4`p80plS`+ P #20010 0 5S @0K  ,0K@Ŗ\  0h80plS`(KXA8:H&;: -LMpr4 t0 S10 !00\ 0hlT h@lPA 00A x!h040X <85 l Dῠ8 l@ h@@0lh@ 80S4P`80`\SP+ P #20010 0 5S x@0K  ,0K@ŕ\  080`\SP(KA d:T(;: -LM< plJ hi<08 9040 P 4`A@T 0S 0060033<t0 S0  3#00\ 0S3000 40< 850SHy;Hy;Hy; y; y;w;h@lP@3X0P !0P *hPl@R 0R 84'80STP` 80%380`\SPD4 aP V VB ᆣ 0010<40 d5S 4B,0K0K<4 @i5S! P V80800080 80 hlJ 805S X80`\SP(K< 40 80h@lPP1X0I 00I h@lP1X0R 00R zhPl@W 0W 0 Q00 060%2U0 606@ @hQP0000  006060 h>n:v@A8:,;ЛA:4*;UA : -L M`@ 8P$2p,Q00 Q00 2$K%4PS2tPYPPi t0 S10 !000401\  5 X0 B0P<80 P娥@*PI X1X!  L2* @2<( K,0K0 1!0 l5S )%P5S 09Z2T2 ,K(0K~hl 0L>2D;2tPAA8:.;|AAAA(A:A4AA؜A -LMp [Hl2l" 00 P 00 @( H0 0Tj 0 $ @ P00i1 110 S:ӌ0Ո00t0 S00 40 d!A> 000\ 0 506 D1D!X0080d <8 P"80S"4`80`\SP! P #20010@,0K0K  @5S X80`\SP(K 00@  00@ (1F;PA@8:/;@::ܘA -`Lp@p1,k1t0 S0  1 B00 16 \00<00 4 5X08hl| 00hl h@lP 00 80S@P80PS e5LS@ 380PSDA@8:0; -8 L"80S"4p`@P P 0@ PP1Jt0 S0  !00 |!Q7 t1QF 0CQd1\06 0<0T1 X04 85|80S@P80PS w5LS@ 3Y80PSlhq 0hL0 0006 \0T0 006 T h0\0X0 00P06 \0hls 0.hl{ 0)AHI8:3;@: -LM8 8 p"80S"408 40 4 4 4 $!QQPPD 3QA 3Q> 3Q; 3Q8 808 $( 0 h0@ h0 ` <S  8(0S X3&P H3P 0P \2R:0R60RP0CRH0CRV:00000#20010840 x5S A,0K0K84 @}5S8 40Bd1Rz 1R |1Rs0CRp*90CR060lP"5S X5St1R M:=B 0CSI0R 0CRAi0CR 0CR99:h00 l@ |0R 0R'T0R X0R =B 0CSA8:$P(o&$.0D;<;ЛA&$:v'$qʄ -LMp 9, 5,t0XㅀS00A0\000400 `6 <80X0580`S P 3B@@A@@LP(0K,K  P80`S$KA@8:A;: -LM8 80`#4@ 0, (4R 8t0S0 ,0 t@@ 08<00 4@5@ 8PpPß00K8, K5S"8p\PPu PP 02C40 0010,0K0K8 5S 08 G5S 0010 N PB h0l h@0l  ; ht"P0l@@ T 0%<,058 00, 4 RY 00 5S 0 1! M#8p\PPt0S5 P3p PUOZ!80pS'ڇ2#0010@ P3   P0 + 050 80pS(K0 +30300 5S5 0@d+0 t@T+t0S 0 @0+ \00 Ah>A:AܝAAXA AAA8: Q-LP QC QpB @@`h 0`lXV@ 3Q* 3Q' 3Q$ 3Q! 3Q 3Q 3Q x3Q p3Q h3Q `3Q X3Q P3Q H3Qs <:+h@p@`h0 l`XV@0"Q0 2Q< 2Q 2QF 2Qh0 lhl\ h0l` h0l hl@ wh0l hl hl h]l hXl hSXh0lT Ph l0h@l0\ hl` 0yhl0 h@l 0jhl0 -hl0 (hl 0#Zhl0 hl@ 0`GhlT 0?;Б;H;;Q;|U;\;l;u;@P;l;}; W;8Z;|AP -0LS D+뤞A -LM`h0@ l |2"209R@7 P"0@T u29 S0!u2%0K&0K900}"0x&[Pp @Pp3F@T_W  x!0 |Thl0@ mp!0 u8\1\!0%KQ&K4 &@K8@80S5t"R%K&0KtƕS0!t2%0K&0K809t0 0&KQ%K %@KtB3d43 0t0 0Qp0p 0Qt2&K%0K8%[ n0$ K0S erl?f?q?i? Q0-L@PP Q 0:@ /^0ea: f0 p-@LB03P`S_ _ ᄛCHQ L: 080T*4p -LM p0P P^ P0D .Q@p34 0-LQ@`4 04PST4TS 4TS 84<$T0@4D$H4L$ 0-LM@\# Q (PU $0 B  $  8 00 008 -l"LÐ0PTP\EL" 2,p\$^P`"0 \3"RB.+0\3^!0 \3P!0C.\2@S0*3p0Cl!S00#A.\3P0!<5-\2SS45$ <5S45 Q00+\S0S03 @5\2S453x ,#4L \(8$8888 ` ` 8 p,8(8 p-3L`,0\#D5P1h"B/\Q D5S3 z?\"@0QŖ-F/2,P\Q0@0!E/\3"R. +0\|3#6I5@R@ SDH @  SDH @  SDH @41t#R2 @S S0 #0,\3P .0\3P 5J/\p3*,#<*\2S3<  0\30 H5\n ((((,(2S 0 02@ 0@02 0 0  0 202 -3L@ ,#1 \ -3L 0\ -2LS 3 0\3 0\ -Pp(0` L@L8 8  (#8880L  0-0L(@PL  800 - L<(L0  - L(@0L0   Rp@-P`00  0AS R 0ASN0@0 @ 0@0`00 p0`00p -LM3S1 3 ,(3)$F(V,DfHv$(3,,LFPVDH3,,TfXvLP3d,,\F`VTX30,,dfhv\`3+,lFpVdh3+,tfxvlp3+,FVtx3`+,fv3,+,FV3*,fv3*,FV3*,fv3\*,FV3(*,fv3),FV3),fv3),FV3X),fv3$),FV3(,fw3(,GW3(, gw3T(,GW 3 (,g w3',$G(W 3',,g0w$(3',4G8W,03P', 6T0D8#H @* K5S: 101[Q % 00a 0"[00b05`e0 00W 0 0@0@e0   tP  m0 t30^ 00ee(\ 08 00 5% |A -LME`T/ 0 R&p0pS  5(PU $05$L005\0 @ RET 055S05P K055 -LMEPT8 0 R/p @Q (0Sڌŕ(`V  $0  Bŕ $P K00Q %00@0p RʈET 2055S05 -LM\Đ@p  p 0` PP  <00 0(K 000p p *,PP  00 0 04PP  00  0\Ę0  P00PP`  (0 8갟AA,AlA -L MA0P@ P `K0\$S%@p0` @Rŕ 00 0 `Pp  L(\ `  $0  B `AРA -D0@ L@ Ph A -L MPP%@t>0\$S%Ep0 Rڌŕ?0 0 ? 0 `Pp @ p5 KH0 X0C xŅ|ŅLŅ(@ T  l5\ DA -LM%r1G@`PU  H70 ;JP5705; 00t#0CR9Ŗ 0P-(\  $0   (\ 0 00 P*> ,0@(\ 0 0 0 505 .J!HhA p-l0%0LRP`@`<0%0ER`@S@P p p-p`L@=PP p0U0C5U5Sp vpA -LM30CSO K K![  1[ ; S 1[; S ($ S1[; S@@@ p-LM05@S2S x3S 1  8%R R:  R08%85_`K  1[S  1[S  ![  10 1K&8%3 S8% ~"P P1[< 1Kx_`K  w1[: 1K3S8%["P cP1[< 1K8% p-@L `71!!|1|!tÔ8!p1p!LA0`1`0 0@K^F P0d1,1(!30CS- 0# 0 0& 02S 0 00 0  ph 2dS`0 0+@.@| 0w@;;;,;;#&0.+ p-LM_@006>P<R PH;x"0BRS5R3 3*,t3?;C0C?;c? "]>@R 0C/000 /  0 4#y2`P V  xPlx K00b![D00 1K#x$xAAA -L M`p P (KECC·JJN  @0 P @PʸP  Q. !20S( @S@@'T `4 0 D`͇J 0MK^  P `嚸P X0AS`4 ` y͇KNK^  @P0 P@ P`rP `4,K$PP D[Pt, (0@,  0p1,P DT ?=g82S _`4K 00KyP 0 `ė 0 03h 0\3L 0\;@A\ApxAAA|;ܓAr@@v@ 0-`4PL ĕ;> ,`D0 `4, \0 /P "R4#803 0BS020 A 0-8P=8O0L8@tQrT+/70h p-LQP0``4 0@DYU]p p-3LP ,0` 05S 00CSP1 R000005S& 0S 00phkpSN@S. 6 0S 0$!B30b03O0@0850 0CS0%0@0@x0x 0S0"0BRSR3-,#6-\42 p-LM@Po"0 005Sx  30CS00dS& S0 S#0 R 0S x2&S 00x  Kq1[ 0<0x@hF24 0-L@P"9O0h -LM쁟2 S@( Y 3,,8P 2S-< P8P#0,\2S ( 0RN$K3,,#0,\{;>  "RPʯK ʯK` p` 9Vp" 03,,;> P #0,\ C 렕n? -3L`^! ,x58 X# U+ p U' t%20 0!X PP("x *P0–@d\`  \b Up6F 0@Q6Fm88 0-LP@0h -L`MhTM 0`R 2 S x%21C0 ` 0l Ŗ  Pt 505z-l0( 0CRi 6xUSR| t`@ x p t%,0@Ŗ50  d3 A R @0 0pP PPlx (0 Sx m ^ ,\pK0 0 Ph = R( pdP = RdP  t5Ŗ 5("80x2 Ah0PUpP @W0 0dp | x%5%05l$70t0 2 S t(KX(\ \ $0  B 0RU570t 5X(\N \ $0 B F 6SxUCl= ( a("( 0` 0l00(\ l $0  B 0 400%p2 SX(\ \ $0  B 0 R 3–@x\p 0 \ 4-00j8#80t`@p 488 -LM5P=@S` 05S 2 S X(\ \ $0 B p@0  BQr0C2 S X(\ \ $0  B W 3^ x5 \P0@DQ 0S*DP 0p5 10R!!  10C15;588 -3L` ,2pSP 8@0. @505X yP 3P J/5\ON@PSJ@505Pe 2S  0C( -@Lp&2 0C S ;;;;;;;;;;;;;;t3 S0(#0*\= +7wPP xht#d1R 3#,3 ,#03#6&  38 <\d1 6`P hP h8O@0;804hȢA AA Q0-L@P Q Q@ 08@0h.-8@ L0 0-PL$0 S 00S;$;$;;$;$;`;$;$;$;$;H;$;$;H;$;H;"@D$00| 3 006S`0 00#336S40 0#3#0 3/00DA 0-@L3P , 0505050`A -PL@p`1T; 0CT"  00@4T @1T 81TK.0 H@4T5@@5* 0 R0W@P @ @ 2S ὿@@ @05~{@i 5i 6i(A -ELM@P ?O  QT"Rd4 0Ód4Rj3, #<03/ @ +H%<Ä<@DńĄQPJ_ "0BS[;;|;|;|;|;|;|;|;|;|;|;|;|;p;p;@;p;p;p;p;;p;p;;2t3D0Rx3B"U02=?0? 0PBT%Y~t%"0 2>00P> hI82, 0"<0$0K c  2[ " 2"t3?0 0P 1t3:t355XP #Z X@ P,=nP#  4Z$B03\~P 3S 0 60,4m|i03T^2S0C 6d;;$AAȢA;'?@A A\A p-L@`d.PP 4Tu.pphs%H3Q 0Ta\YUphꐤAr ?-6R 16R Xt6R0CR0#0%J*X6R0CR*0CR Y:0RV0 0!0 0CS񟗱;;;;;;;;;;;;;;;;c0CR5RP0CR*0CR0CR*0CR A=B0CS&000`0 0\00CR:000 \0h00CRN0CRm*0CRb0CR/*0CR .0CRU* 70CR _0CR0CR*0CR  R 0CR0 0l4R/0CR*0CRi b0CR 0R000d04RI 0CRs A0CRo 0R003R 0CRb 0CR 3RY B=B$0CS 00|3R {:B=B?0CS00 L3R.0CR 0#0%n*0CR0CR:0 0r3R0 0!,00Y 00V2R 0Rs 0 0Z:B0CSk0 0R2R 0CR` 0 0G0S0 0A ST0 0;82R pC=B/0CSH00, 002R B1R 0R  !1R%0CR *0CR 0R  B R*1R:001R :0R 0R0 0X1R  C=B0CS 00,1R  C=B 0CS^ 1R 0R 0CR0 0D!0 0D!0 0D!:B&0CS0 00R 0R  p0R  L)}DP -LQ@ 0A S!C-x1R" l1R' C=B0CSQ'0 , & 0 1 80CR 1R 0R000R 0R0080CR!00S 000  ,%R R R00 0 \@P{DP 0-0@LTP+?JG, 9:0+\0 ,0 -0L@ ,(0S<;0;$;; 0S0 \32 -0P1PP0L@`p` ,0S ?Q0d0 0000000 B - L0BS0BS0 ,P0S<< ,a8^ 4@0!< \0 ,0@S!@0;  0\0 ,81S -LM LR, \㔐Ppo \j X/`\@0;! 0\0 ,0@S!@0;  0\0` ,V LR` `@\TdU@ -pB0s03LX\`P @Q*$ 4 0( Z @P 0( <408#8 X 0 \DU@P 0 ,V00 V -L0KM@c P1[0 0-0L0CS@0dP0,, 0,\0,, PU0 -LMpKH >P4, ;0 0 P%Y! A`0 FP2[00I8#8`0VP@ \ *0K  Q(K 0-`0LS@" 0S% 3PMPU 0 , 0 \0 ,2 0@03P 'PU 0( ,0P[ p-h0SLP!hd0SphP0D ,@ 0 \phA\[ 0-40LS@ 00 , 0 \2^0 ,d ̷PU 0 p-LPPp0,, @0,,  0@ T T @`0o/!"+,@T d0R V0  0 0R0a0P0 IAMT -LM @0BS`)@K*@K0BS (K0S 0 ,UF 0(0P qdK ) [P* Ked?YX*0[=#=*0K* [P X$ 00PAp0\) K0d)0K ) [Pd 0#4*0K 0000 Y'@* K%*0[0 *0KP 0 0 00 P00 '0!,Pڶ0PU 0 ,@w0U_< S  7 \@긶l0@T 0 ,40T  :0,0\< p-L`P@꒶P0T U00 4 ,0@ @pp蠆, 0-0LP ,80@S S 0S @0 \0hB0 @ 0\N0@0 \0@0 \0 ,20@0 \0 , 0-0LP ,80S& S 00@0 \0 , 0 \0 ,0h0@0 \0 ,ص 0 \0 ,ǵ0@0 \0 ,ᵵ 0 -0L00 @ \0 ,h蚵 -0L00 @ \0 ,h肵 -LM0!@ ,X 0 pKP0'` 8#X0 ,0`0P$0 X -LM0PH >r4B,8 0R0 0  R0 0  D0B `K 00 0 0 0  \0 ,e@ 0 0 0  \ 0-L@P08#XH0U #r 0U00 -h0!XSL@hd0Si}i p0,0 TȴpW gP<  0 \\[ 0-LPP 00 , 0BSR8@TB T4 0 @0 \0 ,0@0 ,30#@0T # 2RS  @0 \J0 0 \V00@ 0\ 0 \0 -L(\P@!h"x V:@0w03 fW0SP H0S 80SI SM S- @H0S]P W@  0,0 X  1 0\T@P  W #$!W0W 0m'P 4SVQ #g!$bW `, 4`4V0*@p -LM0PSD1:8#@`"pK! 0JP`)"[V"40 @0S #x00S 0 , 00#0 0 08 p-LM`KP 0@Px1[80 0 P0![00x 0-LM0@ ,0P0CS)\*<\*<\*<\*<*<*<*<*<*<*<*<*<*<*C20000 00 40, 00040,0Q00,0 00,0 (Qp-L@"hP40S6 S!x0 :380 \@0T) ʮ0 ,@ 0S p x ppd㩮D 0pp -LM`pPp?0SS0 ,0L@0 \0 ,x 0 \0 ,g0 S S 0CS񟗣<<<<><>*K@ `P22[99 2Kp`P*X3,h`P",D"[``P002 KP3[=3S e<4e<,e<$e<e<`ꌀn}P{2y`1Xw*K@ 0PO2[9#9 2K'PZ00^BK  !ဠ@BD2 KP@3[0@ 8}S!Z!TX0j8#8C!'" 0 0C?8#.2 K]P3[0S񟗟 e0 SPK0 1[  [p @R>0A8 B#p -0 1K    ,| pp h \? P N[/s q!y012 0-LM@PPP  R K:P P8026 P坠 00CS0S S#P1[9 1KPㅠ PPrP(' 0-LM0PS@ 8 0BS@T7 R R 0S q@P0 x0s@7Tl K@PT [c@ 0St00CS+V@P+P@P Rt 0BSR!C ?!; 7!3 /!+ 'h!# L! 0! !       ot 0BSo @P\ @PV R`t0t0S SY-RD@PB F1`#$%'5439`1DP` p-LM1@S xP x0吟 0BS{ 0S 0BSR)0BS K P00CS 0.\0S S KP![x40 1K|PPK P0 S S| 1[ $R00:K1K R:1K:1K![[P0S X0P`S0XS0C0< S   P![ 0  00VT0 V V;1K![ 1x0,, <4<,\ pR R. 0BSO0.,0S SZ 0CSL 0.\0S S  P0.,V1[ :1K  KUP1 KMP)![10 1KP![10 1KPK7 K1P ?![d10 1KP![<10 1KP P![00 1KP  P![00 1KP:  KP1[0 1Kx KP1[0:;1K![3:1K![/: -L M0`0CSdd-@P  KH$ K@P2[?0 $2Kw@P0 ,0SP @0; \Q QQ QQ Q Q Q01Q 0SS= S; SS_ S] S[ S SS1S0& Km@P2[#; 2K@P ҝP@P 0,\ a= \@P@P@T @PzP"pK 3@P o-@P k"["10@108#X U^Q00CS&PK @PPp :R P2[;2K2[ |R 0K2K R@02K R`02K0"[@S0K2KP2[;2K"[x@P% 0St0S+p 9R'  @P 0S2[02K2[t pRK9p R90; 90< 2KK@P 0S S e@Pl0S ( K2[0 2K1 Q>Q.2K`@P 0(@ ,P& K@P"[ȟQQ ;2<<K2K2K0AS2[2[:L@0ÓL=Ã2K2K 0 \ 0SS S SS SM *K Q@P"[70 2K@P"[@P⯜0SI BKP(pK 3@P o-@P<k2[60E8#X 0SSS  @PW @PQ @PK2[P 2[r @P 80E@P83#X 0SSM SK S U@P#0"[S00K2K2K2[0 U2Kc@P*K @P"[50 2KQ@P2[92Ks &0K@P2[\%9#S ;@P,%5@PA S[1SXL@P& K@P2[#; 2K@PE 1S 0S>$D@P&PK t@P"[d40 2K@P0 , 5 \ U@PP2[0 2K@P B@P"[30 2K@Pw 2@Pq2[0 `2K@PhSmH@`2[0 2K@PT @PN2[ ;2K*K @PB"[20 2K@P8&PKU @P02[0 U2Kz@P' @P!2[!Q "K Q 0`02K2K"[0S0K2K"[Z@Py@P>t0S  L@P F@P 0 @P2[\ 0  K3@P @P2[p0 2K#@P @P0p R2[2[;;2K2K"[@P00CS<0S90S6@P1S^K: A A A40R? -LM0PSD1@:8#HP`>( R Q ( 9 Q7Q|  p0S6  R]`00CSZ0.<\ 00CSA(0@0Px+Z/0\0PP+0.\ K$1S ( Q0x0x00ASY R 0BSQWP0 0&@K0x0x00Sx0 P2[pB$ KP2[p  @ptRh<|<<<CS S ( `!h!@_;`'  APTP A@M0 A0 T A A A ATB -0LSP 40S 00CS0 0\0,0\ 0+\0 @, AU0 , p R R 0BSR RM 3 \eP R= RP RM$(0A S  Q Rm Q Q} Q 0 0\0 ,0S 0CS0%, 8d%\@"L50Sn 0l@  0\0  3\02 s Җ0 , : \0 ,}㺖0A S  Q R 0H$, :$\ Q QK0,, <4<,\Qm0#3\d 8 1S  3 \4l0 3 \'`6<j0 1\O 0BS0,, ` 0 ,\0,,@ }/`V 0 R0*0\0"0\ P& 00C S @  0AS0 , @T{P c0 0 , : \0 ,T40SR00CSP0[,,   8[,\<P80qS40P , +''0p XP_eeee NaT[ -L M `R? 0BSPRR*@T1S 0DST   R 0BSppRpG Rv W.PQ@0;! 0\0 ,0@S!@0;  0\0P ,U: R  0BSP P@ R PP> 08 0\@0DSG 0,\0 ,</ 40[,, 3[,\Q0 Sp0[,, ?00[,\D 0+0CS0vǓ,0@-, 22-\T0 ,0@ ,0EP5 \ 2 \20-,0@+,2$2 4-u\ 01 1K X0,, "0KPPo RB[q 0D8s0BS11A@2K2K 1T3 NRP$<ꔥAA4#|?nFReset vector called, LR = 0x%08x-DM4`O- @0tP @!1 ! ,OiDЍN  0O   ! -- -iZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0 Q@-: R (2 R R -PPPP RrPP B PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R- RP1P P1P RrP1P  B P1P B  R010 1  B R0q0`0q0`0q0`\0q0`0q0`0q0` R 0\6 R B0-81, Ġ%̌T$\D#L0P  R0 Ġ01#̌  R R B0-81, Ƞ%ȌX$XH#H0P  R0 Ƞ01#Ȍ  R R B0-81, ̠%Č\$TL#D0P  R0 ̠01#Č  Rp>nl>nN  0O   ! -- -i > >>> > > >>4x5x7r x@t xxxx4x5xxxxx6x 7xT8 t4j 5l@`@`7j @`6j@`4z`<<4t5r@`X@`TT``\\Pdd@4zll5~~4|X4zll5~~X4|r\jr]jr^jr_j\rj]rj^rj_rj|`@`H@`DD@`LLxx5r6r           xxxx(C|zwi_do_hostdecryptwi_do_hostencryptwi_attach??,?L?d?|????? ?  ? ( ? ( ? ( ?( ?< ?< ?< ?L ?L ?L ?L ?h ?h ?h ?h ? ? ? ? ?< ?< ? < ?! ?" ?# ?$ ?% ?& ?' ?wihap_assoc_reqwihap_ioctl 7nVV V@T Tx)?0)?8)?t)?4)?4)?$)?$)?$)?4)?)?t*?0*?8*?@8(*?<4*?@<4*?K #(-2>'()*+,-./@ABCF'()*+,-./@ABCF/@ABCDEFGHIJKN'()*+,-./@ABCFMNO`abcdefghik*++,,--../-@@A&''(())**++,,-rt2661_rx_intrrt2661_tx_datart2661_tx_mgt@02D0H0L0\0;51.`0,***|00 0 l(000400000#0  00 `4H< 4s"$4D#(444!,-./0 8  "%')`56<=>KVXZcfk3 3 3 3 3 3 3 3  3  3  3  3  3 3 $3 f`(3 h`,3 i`03 j`43 k`83 l`<3 n`@3 o`d3 h3 l3 p3 t3 x3 |3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3  3  3  3  3  3 3 $5 `(4 `,4 `04 `44 `84 `<4 `@4 `d5 &h5 (l5 *p5 ,t5 .x4 |4 4 4 4 4 4 4 5 B5 D5 Frt2860_set_keyrt2860_txrt2860_rx_intr:: u <<4400$,,0,,H((`((l((,?  04P H ,Fs"D#4 ?LGdthtt@tx@l@tp@@?XD + $3A,B8EF IQ7RbSjTV[\gij5@p  A ! {X,              $ f`& g`( `, `. `0 `4 `6 `8 `< `> `@ `d f h l n p t v x | ~                    bwi_encapbwi_rxeofbwi_mac_fw_alloc7 dKZ-B"5*#    a.@:4@x}CCCCCCDDDFFFGGG G%G CCCCCDDF G G eS./`xZYXzRC./`xZYX zC0&* ZYXzRC   MLKJJIHGGFEEDCBBA@?>=<;:987654210/-,+)(&%#! MMMLLLKKJJIIIHHGGFFEDDCCBAA@??>=<;:98765421/-+(%!  )ZYXCQR bwi_rf_workaround)ZYX +RCz i )) i ) I i i I) i) I I)i)i(h(h(h(h(h(h(hHH( h !H!!!("h""#H###H$$$H%%&h&&('''G((G))'**G++,g-G.g/G2&5F6&788F99f::f;;E<<===E>>>E??@E@@@EAAA%BeBBCECCC$DdDDEDEEEFDFFF$GdGGG$HdHHH$IdIII$JdJJJ#KcKKK#LcLLL#McMMM#NcNNN#OcOOPCPPPQCQQQ"RbRRRBSSSTbTTUBUUUBVVV"WWWAXXYaYY!ZZ[[[a\]] ^^_`a<1??????????*?7?D?P?]?i?v@@@@@@@@@@@@ @@&@2@?@K@X@e@q@~?????????????!?.?:?GT@<wlbQ@;53-/**'%!!%'**/-35;@Qblwzuqlgc^YTPKFB==========================BFKPTY^cglquz˓dfX&ئ͟8ʴ)ǎi+jlbsCv ViDz#((?-җ1h5u85;5=f>?@?r>e 5=5;/u8h5#1E(?- -(1#4T8;i= >C??b?l"?+=;85&Z2X.dϚ)m$bwi_phy_init_11b_rev2"̔##$# n bwi_mac_testohci_root_ctrl_startehci_root_ctrl_startsr_checksumsr_raid_inquirysr_meta_chunks_createsr_meta_native_probesr_meta_native_attachsr_rebuild_initsr_hotsparesr_meta_validatesr_meta_native_bootprobesr_meta_probesr_ioctl_createraidsr_boot_assemblysr_raid_read_capsr_rebuild_threadsr_crypto_read_key_disksr_crypto_create_key_disksr_crypto_calculate_check_hmac_sha1sr_crypto_decrypt_keysr_crypto_alloc_resourcessr_crypto_change_maskkeysr_crypto_ioctlbioioctlhotplugclosehotplugreadhotplug_device_detachhotplug_device_attachdb_fncalldb_commanddb_print_cmddb_examine 88888 9 7 6 97 5 9 423 9 2 9 1 0 9 9 \/|\/O|/-|db_show_regsdb_printsymdb_write_cmdextract_entropyarc4_initrandomread n;AvXaM ְdx & %&&(%&0%&%8%%t(\%coredump_note_elf32coredump_notes_elf32coredump_elf32elf32_load_fileCopyright (c) 1982, 1986, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. Copyright (c) 1995-2011 OpenBSD. All rights reserved. http://www.OpenBSD.org X&PX&X&W&W&W&XX&HX&W&W&X&8X&D&4& $$$o?!@@q?4B?,o?4o??@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~!#$%&'()-0123456789@ABCDEFGHIJKLMNOPQRSTUVWXYZ^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{}~Ͼ󨷵ǎԐѥ噞᷵ǎԐѥ???????????????????????????????? !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????msdosfs_lookupUd***P*t(**t(** *t(*msdosfs_createmsdosfs_mkdirmsdosfs_renamemsdosfs_readdirbpfwriteifpromiscifnewlladdrif_getgroupmembersif_getgroupifconfif_clone_listif_group_egress_buildif_downallifioctln; &C vkkMPG&"֊/aK+d 5ӆ1 q^h,`@yFgKrޔԘJk*OņךUfϊDx%K]?!HpcwucB0 mL5&/ᾢ5̈9.WUGz+2ўfD~T; ʌ)k<(yv;VdNtے lH]nCĨ917Ӌ2CYnڌdҜI%ϯʎGooJr\$8WsQ#|!>ݖa B|qؐ_jiX':'8+3"p3-"< IxPzY e1ƄÂ)wZ{m:,ieee80211_wep_decryptieee80211_wep_encryptPPPPPieee80211_ioctlieee80211_ibss_mergeieee80211_end_scan  0ieee80211_node_attachPP ^/ f ^/ ^/ieee80211_recv_4way_msg3ieee80211_recv_4way_msg2ieee80211_recv_4way_msg1PP ??$?0?@?L?X?d?p?x????????ȥ?Х?إ?????@?ieee80211_newstate8A?A3pA0 ?G(A9$x@!?08A0d?40 ?`?RDX@UL?p?T?| ? P?5|?X$?R(?,?@70?6ԞA7?74? 8?|@?72Xq'Of ɴ:}Jc1`3QESbwdk+XhHpElޔ{R#sKrW*Uf(µ/{ņ7(0#j\+ϊyiNeվb4ъĝS.4U2u9 `@q^Qn!>=ݖ>FMT]qoP`$C@wgB谈8[yG |B| H+2pNrZlV8ծ='9-6d !\hT[:.6$g WҖO aiKwZ *C"< Nj򹨶-ȩWLuݙ`&r\;fD4~[v)C#hc1cB@" Ƅ}$J=2m)K/0R wl+pH"dGČ?,}V3"NI8ʌ6 Ԙρ(z&ڤ?:, xP_jbF~Tؐ^9.Â]|i-o%;ȧ}nc{; x&Yn쨚Oen~ϼ!ٛ6oJ |)11#?*0f57NtʂАا3JAP/MvMCTMўjL,QeF^]5st.A ZgRے3VGmaךz 7Y<'5ah,4$8_@r %⼋I<(A q9޳ ؐVda{p2t\lHBWЧQPeA~S^':k;EXK0 Umvv̈L%O*D5&bZI%gE]u/LFk_眒zmYRڃ-!tXiI)ɎDujyx>Xkq'Oᾶ f:}Jc13Q`SbEwdk+hHpXElޔ{Rs#KrWUf*(µ/{ņ7ӥ(0#j\ϊ+yiNe;b4ĊS.4U2u 9`@q^nQ!>ݖ=>ݮMFT]qoP`$֗C@̞gwB谽[8y |GB| +2HprZlN8Vծ=9-6' d\h!T[.6$:g WґO aKwZi *"4$8,@_r% I<( A9q ؜Vd{a2p\lHtWBQPA~Seä':^;kEXK0 Uvm̈v%LO*5&DbIZ%gE]/uLFk_mzRY-tX!I)iɎDujxyXk>'qᾶO f}:cJ1Q`3SbEdwk+HpXhEޔl{Rs#KrWUf*(/ņ{7ӥ(0#j\ϊ+yiNeվ4bĊ.4SU2u 9`@q^nQ!>ݖ=>ݮMFTq]oP`$֗@Cgw谽B8[y|G B| +2HpZlNrV8=-6'9 d\h![T6$:. gWҖOa wZiK *"$8,4_@r %<(I A9q ޳؜Vd{a2plHt\BWQP~SeAä:^';kEXK U0mvv%LO*&D5bIZ%gE]u/LFk_zmYR-X!tI)iDujxyk>X'qOf }:cJ1`3QbESwdk+pXhHElR{#srKWf*U(/µ{ӥ70(#j\+ϧyNieվb4Ċ4S.U2ኤu 9@`^qQn>!=ݮ>MF摵Tq]o`P$֗齉C@gwٰB8[yȡG ||B 2H+plNrZV8=ծ6'9- dh!\T[$:.6 g WҖOa ZiKw *h8,4$_@r %(I>>>KKKKyyyy xxxxZZZZݨ33331111YYYY''''____````QQQQJJJJ ----zzzzɜ;;;;MMMM****뻻<<<q//^SShѹ,` @ȱy[[jjFˍپgK99rJJLLXXJυkл*媪OCCMMU33fEEPPD<KKܽa ppB>>|ĵqffHHaa_55jWWйiX':'8볘+3"iip٩3-"< I·UUx((PzߥY  ڿe1BBhhAA)w--Z˰{TTֻm:,ccƥ||ww{{ kkֽooޱőT00`PggΩ++V}׵bMvvʏEɉ@}}YYGG AԳg_Eꜜ#Srr[u=&&Lj66lZ??~ÃO44h\Q4qqثs11bS*? ǕR##FeÝ^0(7 / $6=&''Niuu ,,Xt4.6-nnܲZZ[RR;;vMַa}))R{>//^qSSѹh, @`y[[jjԾˍFg99rKJJLLXXυJлk*OCCMM33fUEEPP<!KKݽa܋ pp>>|Bqff̪HHaa£55j_WWiІX:''8+"3iiһ٩p3-<" ·IUU((PxߥzY e1BBhhиAAÙ)--Zw{TTm,:cƥc||ww{{ kֽkoޱoőT0`P0gΩg+V}+׵b׫MvvʏEʂɉ@}}YYGG AԳgԢ_Eꯜ#Srr[u·=&Lj&6lZ6?~A?̃O4h\4Q4qqثs1bS1*? ǕR#Fe#Ý^0(7 / $6=&'Ni'Ͳuu  ,Xt,4.6-nܲnZZ[RR;vM;ַaֳ}γ)R{)>/^q/SSѹh, @` yȱ[[jԾjˍF˾gپ9rK9JJLLXXυJлk*OCCMM3fU3EEPP!KKaܽ pp>|B>qĵf̪fHHa£a5j_5WWiйX:''8+"3iһi٩pَ3-<" ·IUU(Px(ߥzߌY  eڿ1BBhиhAA)-Zw-{˰TTmֻ,:ƥcc||ww{{ ֽkkޱooT`P00ΩggV}++bM櫫vvE@}}YYGG A쭭g_E꯯#Srr[u·=Lj&&lZ66~A??Oh\44Q4qqsbS11*? RFe##^0(7 / $6=&Ni''Ͳuu Xt,,4.6-ܲnnZZ[RRvM;;a}γR{))>^q//SSh,@` yȱ[[ԾjjFgپrK99JJLLXXJϻk*O媪CCMMfU33EEPPxD<<%K㨨QQ]@@?!pH88c߼wuBc!! 0mҁL &5/__5DD.9WU~~zG==Ȭdd]]2+ss``OODf""T~**; FF)kӸ(<y޼^^ v;dV22tN:: II Hl$$\\]½nCשּׁĦbb917yy2CnY77ڷmmd՜NNI੩شllVV%ʯeezzG鮮oպxxJo%%\r..8$WsǴQ#|tt>!KKaܽ pp|B>>qĵ̪ffHH£aaj_55WWiйX:''8+"3һiip3-<" IΪUUPx((zY  eڿ1BBиhhAA)Zw--{˰TTmֻ,:cccc||||wwww{{{{kkkkoooo0000gggg++++׫vvvvʂ}}}}YYYYGGGG𭭭Ԣrrrr&&&&6666????4444qqqq1111####''''uuuu ,,,,nnnnZZZZRRRR;;;;ֳ))))////SSSS [[[[jjjj˾9999JJJJLLLLXXXX着CCCCMMMM3333EEEEPPPP<<<>>>ffffHHHHaaaa5555WWWWiiiiَUUUU((((ߌ BBBBhhhhAAAA----TTTT @6MD5FinalRMD160FinalSHA1TransformSHA1Final؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHG"(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDlɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~[/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxqg jgrn<:ORQhك[ 1Ѭߘr/Ḗ~&jE|,G$l iciNWqX~=t XrX͋qJT{YZ90`*#`(yA8۸y:`l>w'K1/x`\`U%U攫UbHW@cj9U*4\̴ATr|*oc]ũ+1t>\3֯\$lS2zw(H;Kkē!(f a!`|H2]]]u#&܈e>#Ŭom9BD . Ji^Bh!la gӫҠQjh/T(3Ql n;zP;*~ev9>YfCoEå}^;uos D@jVbNw?6r=B$7H ۛIrS{y%P;LylO`@ž\^c$johSl>9oR;Qm,0DE ^J3(fK.WtE9_ ӹyU 2`yr,@%g̣饎"2u<kaP/R=2`#H{1S>W\o.ViB~(2gsUO'[iXʻ]=!lJ[-ySeEIҐK3~ˤAb Lw6~д+MەqՓkю%ǯ/[{AI~-%^q h"W6d$ cUYCxSZ٢[} Źv&ϕbhAJsN-GJ{RQ)S?Wƛv`+t恵oWk *!ec.4dV]-SGjnpzKD). u#&İn}ߧI`fqilRdVឱ¥6)L u@Y>:䚘T?eB[k?ҡ08-M]% L&pc^?kh >\D}W7: P tAu8/;21>8TNmO Bo ,y|$ryVw.?rU$qk.P̈́GXzt}K:zfC cdG27;C$CMQe*P:qUN1w_V5kǣ;< $Y,n<pEㆱo ^*>Zw=Ne)։>%fRxL.jxS<- N=+6&9`y#RnfE{7(2åZl!Xeh;/ۭ}*/n[(!pa)uGa0a4c\s9pL ު˼,b`\ndi#PZe2Zh@*<1! T_~}=b7w-_h)5ǡޖXxWcr"ÃF T0.SHُ(1mX4a(s<|J]d]B> EꫪOlOBBǵj;Oe!AyMjGKPb=bF&[$ti GV[ Htb#*BXU >ap?#r3A~_;"lY7|`t˧@n2w΄PU5ai Z .zD4Egɞs͈Uy_g@Cge48>q(= m!>J=+hZ=@&L4)i Av.khq$j 3ԷCaP.9FE$tO!@MpE/f m1'A9UG%ښ ʫ%xP()Sچ, mbhiHפh'?Oz|Ϊ_7әxB*k@5 ٫9N;VmK1f&tn:2C[Ah xN جV@E'H::SU kKмgUXc)3VJ*%1?~^|1)p/'\,(H"m?H܆AyG@n]Q_2Տd5A4x{%`*`lc´2Of#k>3b $;" r(-Exb}doITH}'>AcG t.no:7`L knU{7,gm;e' )̒9 i{f} ϑ^و/$[Qy{;v.97yY̗&-1.Bh;+jLu.x7BjQ满PcKkؽ%=YBD n *Ngd_ڈ鿾dW{x`M``FѰ8Ew63kBqA_^;Z4ٷ,Q+:Ֆ}}>(-}|%rZLZq)GW;()f(.y_xU`uD^mm%adâW<'*:m?!cf&(3uU4V<wQ( gQ̫_QM08bX7 z{>d!Q2Ow~㶨F=)iSHd$m-if! FEdlX [@X̻k~jEY:D 5>ʹrdfGof,ҏ"W##v215VbuZ6ns҈bIPLVq z2E{Sb%ҽ5iq"|˶+v>S@`8G% 8vFšw``u N˅؍芰z~L\HjiԐ\-% ?2aN[wߏWr:j?$.Dsp"8 1).lN!(Ew8fTl 4)P|ɵՄ? Gy ~tn,fy3jXDD1Zs"*ˁc8:$zi HIĀ@8HުL H_%A@N$A UeQr% 9jyMc@hV 틕Z Vqק)N-fcqw*7 5Wa"ɠBր[t!h!hl iwW~@PճMװx QV$AV ʔUWnྵa$ XK'aU{whkldMDfd~i/IO70j5,s@IvM;B(HDLns) _ɋ}oaOw.+rץ<}+FYYEEهTNoHm| ǥcs_DVj͈prͳ]ny` E`1©\1BN"r\,rN@%/N2g@#x\n܃"ukMxnXO DH?{vw#Vu*F_( +8=6 JRft;QZylu eX&hJpFS(l\v0k)h76*g$ k%ֿh,DUueI40" WIbuU~bڨv^FESGml,gHL|3ەCh\SU2` ߝWc9^28aI37~^b<#NygCHKJf-ۄoH Ja)Yfc(` 0qt&@3/C~A^ l( ؒ0~of˜os*`ژ46K-%#= %IH6Jo8C@TzWOpA:Z„TU|5YŗZ:G:%Sj~=eI&TwQ[P]vlDȨ!帊iX`[ŗY)L;]J5ULkD$5鰽bעT/I18T(q)9H[/u@g+3-fVo*ɛ`( ')dMP˲,\26K_A !PNhذy\CPIMAC8wn\e0Rԋ@+>`xT7}02m-yyS"wuXȃoxkcZ\3]ùzv٣Byqj3ƚ`'PC=+mvN%ύHf6AN( aϩI=߹_d: }+p?PO+Zbbyj.H@,Z@"ғ-ES4n)olIIBr~V>olbfLTq*+9)XLVRf.S9v.i硦>iFt+LVvuOx39]O#2]2=&K/~~<O^?vf)o=E4ӷ+4grN=U"g`k8=ü0}8QcÐӝXyTGָaYwSW-XVcNx.F~eyUڑ0@5㶼P?!@=LXI6QpӱڍyKoqK 0ݻ맕d5w$,ϩ/ tцB*v:-7ޚ, )p@ :$7ѴyN] h1 HZ޻Bf1畏?r 3uQB}\cmd!@ WS1zݨ]3CoFq"8ԚέiGb[UgfN G[oLĎnrWxzdD]Ջ` l_9 ]c2֋~ pIPӻߘ)* mS~H~X.t;/RG'~[!<8zvOB9`55'{ɸ6g {pqT3^-ZId, =4pBwbO&Ҹ$d%FN`7>͕xE_{ ۫v"{.1ן%$r_m L=mPO%os#(ĴyI%4aĘnzn|l6AT޾'VAJJ{` ,8I%vK$%Gv XY f 0NndQ& #Phꃢ@0 /kz%?/?!M@`Iɟ'Կ@uИcnafŽ"o;h(Yy#P_w@CV/|-ҢɡHl4ma/T"2*kT:V"AӢ@f/9/Mҹ-?JDvR7,YQoz Zh{.T"5Y/mKdPIf-徐"3;䎴]4K@E?1.eUʱծ-mԢP @"8On ׿r[O/LVSTIiFXEŅc]ՊSW9j7=T*_}x:vbj Bz)^'rgP8ƌDŽZ*'JkѢ*V`C u\B&Ʉq-ls5&5 M{n0f&%HVV^c ϲc|E pPr(pH# yM;-AB G&LjMG\^ |Y#јr8S#/nqFnEV 9q +A|iCHy}B{BIZݿe\ [ ~iC?9zaz UQry吝5rNcZպ60ę _}֡{/6Y DYD̃Aѱ* ;{ B[A%zzӤ0XޘN?wiy{$[Ĭ%5P_aT1bcKU !h]Yfsc=4·~!+g\ab906;Wd/`:5F- 'zy㠌l0^7%oo;j tE'4:NiOM>dY58EfCr3c%N? (Υ'R¦սTUdpfM w&ۄgC!`X0TroSUGڿ]bVhkʃ;n-Ӧ\= wL3{9+^S_aodC x^c"&gI{ڷ"%-U^7rRyL H[k0 cq/޹ S E!5(T<)c)A|-nRPf4,0P1`sY&D\dwR3A+ٺ|o!PaH?ek«dv&4{^% ;MM1$~I,;jx`]sVz\/1Co0TyXR^/2zj0>՚1B°I #ڸ(0q_`ɣaM/Ǚ."płNؼ40y;'ƸaiH?;(ZC/v7ܱӧßn>ƼB7Q(heRwj-K'5.n\ )^XOX{iT̨g&H`K`8# ~8lI `s5GƱVL>#8d^BFzk Od^AE#\;]>rC|m~ll9`qpsv#E@]%=`GK6DήPQH<p}}d^(O= &g.yr?U+HԼ?^!@WNFRWs3NɷdŸW1O g_?@k{C=K۵cUȗn-J(JqoCCl< _P/~׿PZG.Q>pX.0_|r *,]I鎸P'WIoyR}}Yr@EEt]>uOiVA#. '`vteyvvwHNma}/ 4H<0(Ow Vܒ M"7)}V'|@|硴f^aÝ <є`AFv\;x,WGl"}NC~8<=Q8d{h'فI]j~vh]9K9 ;#Im<Eub'z\aBΒ~Brrp }ȡ[(Ob<51)BSjO[}m(Ki\j#MŌ?,-ҖXRg[HJI \EkӉ7`:SRqDIK @sg4|~q6UO/Т`?mPьGnU?墼38Wg} =3{r3O̫]ňv{{uWBdBc+ri/n+_mazgaq%9̸L!gуb>ܷν8\ =Dmn`I:T`H'W+8$ ږ%Eh;}E `P/(b4 ٠m+1+dZ0RXBA\1>26F3S75 {s{OJWdCQz(~c5_ yCdcdJ$_(͸O@C " 0 O7-{$MgQLq_-_d !S^>'_aB%rqK=;&o~~TLmDl߫I&Ǡ36~?Pa w8Pr.PwWFgOT3ɏ1 i5M\=fȦ[]oڑo/"F}F9mOCCN!и  ?X(>nH&p׋wt|% - y#;(8itb߷@!{7Ȋ@ YVvO@/{U MVi35'#WȯVeka^u˅nwU2?-ɿ[%;з$;mc fÀ(82 Tɪס2Zb,gTzuw11&o6F HjyZVLj~CRv/ t,t* M|k .TA5B=!&|,aRe1i%& !\1cr ^Iy p1 d>>̶Ոî 0rlqn/kءDVÈ9/ű1(x⤣2}o~X$Ū{s0a!-!)۳*)e\,0?Б\,ԩT _w:^VxV޾\!uQųåҶw#)Ei/z毲p[v F98/gsD)k)/Ifingӛ/~p%Q^$Slj>!DYܷ)eyCy9A+MWN )zkS< ~U3rŅ?~                               A@@@A@@A@@@@A@@@A@@@@@@AAA@@@@@@@@@@@@@A@@A@@A@@@A@A@@A@@A@@A@@@@A@A@@A@AA@AA@@AA@@@AAA@A@A@A@A@                              @@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@                                        0 0 0  0 0  0 0  0           0  0 0 0 0  0  0  0          $$  $ $ $$  $ $             $$  $ $ $$  $ $                  0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0                            ((  ((  ((  ((  ((  ((  ((  ((          """"   " " " " ((((((((    """" ( ( ( ("("("("(  ##%%&&))**,,//1122447788;;==>>@@CCEEFFIIJJLLOOQQRRTTWWXX[[]]^^aabbddgghhkkmmnnppssuuvvyyzz||cryptof_ioctlswcr_combinedswcr_authcomputeswcr_encdec66666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\aes_xts_cryptaes_ctr_cryptZAES_CMAC_FinalHMAC_SHA256_FinalHMAC_SHA256_InitHMAC_SHA1_FinalHMAC_SHA1_InitHMAC_MD5_FinalHMAC_MD5_InitAES_GMAC_Finalaes_key_unwrap H!x-ML.RN8D( `hz=Skc|j9{Б/Uڅ?AZX_f ؐ53eiEVmv° GJBnI[#Q")yq~ ruo7ӎbwO$26󦻬^lW%㽨:Y*F?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@4l00^000\0 Z0U0U0LQ0PR0Q00 ufs_makeinodeufs_mkdirufs_linkufs_renameext2fs_readdirext2fs_direnter\=10410021 11p-1,1*1dC1$+10Oj0j OjDXjDXjDXj Oj:pvmmapbsyBUSYWANTEDTABLEDCLEANCLEANCHKRELEASEDFAKERDONLY ZERO PAGER1FREEINACTIVEACTIVEENCRYPTPMAP0PMAP1PMAP2PMAP3\sys_swapctlin6_pcbnotifyin6_pcbconnectin6_prefixlen2maskin6_prefixlen2maskin6_ifpprefixin6_delmultiin6_addmultiin6_ifloop_requestin6_update_ifain6_controlin6_lifaddr_ioctl0123456789abcdefin6_ifdetachin6_nigroupget_last_resort_ifidin6_ifattach_loopbackin6_ifattach_linklocalin6_ifattachin6_selectsrcfrag6_inputicmp6_redirect_outputicmp6_mtudisc_updateicmp6_redirect_inputicmp6_notify_erroricmp6_reflecticmp6_rip6_inputni6_inputip6_nexthdrip6_savecontrolip6_setmoptionsip6_getpcboptip6_ctloutputip6_outputnd6_lookupnd6_ioctlnd6_rtrequestnd6_freend6_na_outputnd6_ns_outputnd6_na_inputnd6_ns_inputin6_ifaddnd6_prefix_onlinknd6_prefix_offlinkdefrouter_delreqdefrouter_addreqnd6_ra_inputnd6_rs_inputrip6_outputrip6_usrreqrip6_inputudp6_output0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-     A@!  @a`10  @`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O      A@!  @a`10  @`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O @@ !1Aa  0@` #+3;CScs54545 455 55 5 5 5(?8?@D?P?`?l???@   L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c            (08@P`p   0@`  0@`PC5@C5|F(^5^5E(X?4A\?4Ah?4Al?? TATA p?TAt?x? ??????????p ??p 0??p `??p p??P ??P ??P @??P P?? ?????????ԞA?ԞA?ԞA?ԞA?ԞA ?ԞA  @@u@@@u@(?,?@0?,?8?@80>@9P>@:p>@:>@:>@:>@:>@; ?@;@?@;l?@;?@;?@;?@;?@;@@; @@; 4@@; L@@; l@@; @@; @@;@@;@@;A@; A@;8A@;TA@;lA@;A@;A@;A@;A@;A@;B@=4B@>XB@>B@>B@>B@>B@?C@?,C@?DC@?dC@?C@?C@?C@?C@?C@? D@? (D@? HD@? \D@? tD@?D@?D@?D@?D@?D@?E@?,E@@HE@AhE@BE@CG@DE@DqE@EE@FF@G0F@GDF@GdF@GF@GF@GF@G G@G,G@H\G@IG@JG@KG@KG@KG@KH@KH@K(H@K@$@c@c@eaQ@X@W@0@ w@Q2@U@4@F s%^^uhub_attachD|77d707ucomopen7d7477ugen_do_writeugen_do_readLT78`7d7ugen_set_configuhidev_set_report_asynct<)8`%8#8x$8uhid_do_ioctluhid_do_read)828428)8= >R^ >  >] > >>IF>>J>R|>7 > > > > >K>>@#>>>>>> >>H@> N> _>>>>\8> > > >E> >m>K>A0>[>h>0> >>j>>?>nz > V!>Jj!>!>abcde f g h i jklmnopqrstuvwxyz1!2@ 3#!4$"5%#6^$7&%8*&9('0)( ) *!+ , --_.=+/[{0]}1\|2\|3;:4'"5`~6,<7.>8/?9:;<=>?@ABC D E FG HIJK,L!MN-OPQRS T/U*V-W+X Y1Z2[3\4]5^6_7`8a9b0c.ehLiMjNkOlPmQnRoSpTqUrVsWtuvwx yz{|}~ mMqQ@zy2" 3#6&$7/{%8([&9)]'0=}-?\./0+*1#'2#'345 6,;7.:8-_d<>| .'`0+*~5^q,?azw&12~ "3#!'4{"(5[#-6|$7`%_8\&9^'0@-)].=+}/0$1*2*3m4%56;.7:/8!d<> bBeE hH iI jJkKlL|,?nN~aArR,sSzZyY2 "3!'4"(5{[#6$7%!8&9%!8'0-)}].-_/0$*2`@#3mM4%5@#7:/\8=+g= aAkK~xX}iIpP& eE ,; c d tsrqQ'?ljbB|oOuUv.:yY{!\"12< 3>!(4[")5]#@6$+7%-8&/9'*0, _-=^.%`/z0w123n4m5$#6gG7h8fd/ 2"@ 3#!4$#6&$7/{%8([&9)]'0=}-+?.|/01'*2'*3456,;7.:8-_d<>\ .'`|0^~2" 3"5%#6&$7/%8(&9)'0=-'?.^/{[0+*}]123@4#5\|6,;7.:8-_d<> 1!2" 3!4$"5%#6^$7&%8*&9('0)--_.=+1#~2#~4'@5``d\|2"#6&$7'%8(&9)'0--=.^~/@`0[{1]}2]}3;+4:*5\_\|-+?\0345d<>| .'`|0^~.\0345|d<>.\`0^~xje.> u i d c htnbrl'"poygk,<qf;:-[{.]}//?0=+3s4-_6w7v8z9: ;<=>?@ABCD E 1!|2"@ 3#!4$~#6&$7/%8(&9)'0=-'?./[0+*]1}2}34{5\6,;7.:8-_d<> q,?azw&1|2@ "3#!'4"(5#6^$7%!8&9{'0}-).-_/[0$*]1`2`3m4%56;.7:/8=+~d<>\ aAbBcCdDeE fF gG hH iI jJkKlLmMnNoOpPqQrRsStTuUvVwWxXyYzZ#6^6,$7&7./[{0]}3;:4'"6,<7.>8/? aAbBcCdDeE fF gG hH iI jJkKlLmMnNoOpPqQrRsStTuUvVwWxXyYzZ#6^6,$7&7.--_.=+/[{0]}1\|2\|3;:4'"5`~6,<7.>8/? eEzy1+|2"@ 3*#!4#6&$7/%8(&9)'0=-'?./[0!]1$}2$}34{5 6,;7.:8-_d<>\ -'?.^`~0!]/[34{2"@ 3##6&$7/{%8([&9)]'0=}-'?.<>/+*012345\|6,;7.:8-_d<> .+*/2\|4eE !1@-2_ /3#!;4$":5#,6^$.7&%=8*&[9(']0), -?+'.xX%/{0wW}1qQ|2qQ|34"5`~67fF8\ qQ@1!2" 3##6&$7/%8(&9)'0=-'?\./0+*~1}]2}]34{[5|6,;7.:8-_d<> 1!2@ 3#!4$"5%#6.=+/0[{1]}2]}345'"8;:c.d\|/? IqQ@2' 3^#!4+$"5%#6&$7/{%8([&9)]'0=}-*?\.-_/0~1,;2,;34i5"678.:d<>| /1,;`2,;`3'aAcCeElLnNoOsSxXzZ bB{cC& fF[ gG] iI jJnN}qQ\vV@wW|xX#zZyY>1'~2" 3+^!4!"5%#6/$7=`%8(&9)'-./QP01qp2qp3$4506,?;7.:8-_*d< bB{ fF[ gG]kKlLmMnN}qQ\vV@wW|zZyY1!~2" 3#^!4$"5%#6&$7/`%8(&9)'0=-'?.+*/0123456,;<7.:>8-_d<> mMoOpP1!2"@ 3/!4$"5%#6?$7&%8*&9('0)--_.=+/[0']1<>}2<>}3;:~4{5#|\6,'7..8d /^^[0]4``{8aAcCeE gG iIkKlLnNoOsSuUzZ cCmMrRsSxXzZ1!2" 3#!4$"5%#6&$7_%8({&9)}'0'-/?\.'/0*|1<>2<>3+45@6,;7.:8-=d][ .~/"^4'`eEqQ@2"#6&$7/{%8([&9)]'0=}-\.-_/0'?~1+*`2+*`3456,;7.:8d<>| 4^    =8<8<8H>8`=8=84A8`?8>8(?8J8J8|J8,|L88K8J8K8_8t`8^8^8\8P8W8P8O8R8(  v      W 1 Q `  lf8@  0 2 A@ A   @  @ @   P0 P  A   h }  } } } @  85   f8  L+ L e8L2 D   O  {`e8o  A umass_scsi_probed\p8p8po8o8fGg ---0000 0@0P010`0p0aLfLLLLiF  @@@ @ @AA@:F:FP 43W  !      @ @ @ @ A n@n n@n @nn@0Df @  Q k k"k"k"k"k @^z BF 9 |(8 8T88axe_setmulti B  w *w W UP  <1b0 0{&"79n= wF@W wn a- 8888p88غ8p8ع8@ 'W W@ @EEE }WQ  k"BFFeeeZZ Z 0xd8h8882V{%1" `"'`~%ZP `|\88880w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-udav_setmulti 9 998hF F hF fF `x9l99t 9<7979l69 *9url_int_miibus_writeregurl_int_miibus_readreg@@9WP P Q@lE9A9;9;9uftdi_openPO9M94M9dM9`VV !y`V'V%V&V3V4VPVIVVVVVVVVVV}  H(02135HPPQ nY ol\k] ih^_mZ[Xj 2``` ``x     tq?=:>9;<8pq8     JKLIؼټ`ؿۿٿڿHIJprsq"`r``xȽPW8P3 & & & & & & & & & &     < < < l F F ! ========== = = = = =================== =!="=#=$=%=&='=(=)=*=+=,=-=.=/=0=1=2=3=4=5=6=7=8=9=:=;=<===>=?=@=A=B=C=D=E=F=G=H=I=J=K=L=M=N=O=P=Q=R=S=T=U=V=W=X=Y=Z=[=\=]=^=_=`=a=b=c=d=e=f=g=h=i=j=k=l=m=n=o=p=q=r=s=t=u=v=w=x=y=z={=|=}=~=================================================================================================================================0 B9 !PPPPPPPPPPPPPPPPPPPPPP PPPP PP PPPP PP PPPPPPPPPPPPPPPPPPPPPPPP: :  R !R !R !R !R R "R !"R "R ""R "R #"R $R !$R 1$R A$R $R "$R 2$R B$R $R #$R 3$R C$R (R !(R 1(R A(R Q(R a(R q(R (R (R "(R 2(R B(R R(R b(R r(R (R (R #(R 3(R C(R S(R c(R s(R (  >d l,\9X9 X9W9G W WnPnPA   !^y 4Xhp9{#{{{{ rS#S&@'ah 33.U 1(Ex$ #hpe9b9hb90b90    `lp9m9\m9$m9   &  l! eX`y9v9lv94v9D||9|9y9y9 B  Q  umsm_umass_changemodeX9ԇ99T9=beeK #(-2>'()*+,-./@ABCF'()*+,-./@ABCF/@ABCDEFGHIJKN'()*+,-./@ABCFMNO`abcdefghik*++,,--../-@@A&''(())**++,,-   Pp < A@@A@@ @$@4@@H@T@`@m@h@@t@@|@@@@@ @0@@@@̺@[Aк@HGA@@@.A @@@@@ @ 0@!@D@\AX@P@X@`@t@@@@@@ @@L>Ȼ@M>ػ@M>@N>@0@N>@N>@PO>o?O> @ P>@ dP>pm@ P>@ P>(@ lQ>4@Q>8@Q> ?,R>H@\R>P@@)g\@:gl@%h|@2h@6h@rh@3iȼ@riؼ@q@q@q@ q$@0q4@4qD@5qX@6ql@#r@@@@'@ؽ@@3@5@E@UP@WP@WQ @WR,@Y8@PYH@QY\@RYp@`@`@U`@V`@`eԾ@be@ceAde@ee@Fv @pw@0@8@H@\@l@@ @P@Q@Uп@V@X@Z@$@8@L@\@l@@@@@@@@@ @ @@ @@@@$@ ,@ $@==4@==@@==L@==X@==d@==p@==|@== @== @==@==@==@@@@@,@<@L@\@l@P|@E@Hl@@@Q @BX@@@@@ @@@ $@00@@<@PH@T@d@l@3@ t@3@`|@3@p@%5@E@I@Q@a@@@@!@#@1 @3@5$@A0@C<@cH@sT@u`@!l@1x@D@G@@@ 3@R@R@)R@7R@9R@CR@FR@GR @IR4@KRD@LRP@MR\@aRh@cRt@R@R@R@R@QT@UT@WT@aT@q@ @ @@@@ @x(@x!4@`8D@xPP@xU\@Yh@Yx@u`@x`@xa@xp@xq@xr@xs@xt@x@x@x@x @x@x$@x0@i@@xL@X@h@x@@@@@P@Q@_@@@@ @,@P<@H@T@`@dl@et@d@@@@@@@@@@@$@4@D@T@h@p@x@#@%@'@2@5@.B@0B@q@B"d@B$d@@@ @(@rlA;0@;8@;@@;H@"P@"l@"@"@"@"@"@"@"@"@"8@"P@"d@"x@"@"@"@"@"@"@"@"@"@"@"@"@"(@"(@" <@" P@" d@"@ x@" @" @" @" @" @" @" @" @" @"0@"p@"p@" p @" p(@"p4@"p<@"tH@"tP@"tX@"td@"tl@" tt@" t|@" t@"t@"t@"t@"t@"t@"@t@"At@"Ct@"Et@"Ft@"Ht@"It @"Pt@"Qt @"Tt4@"UtH@"XtT@"Yt`@"`tt@"bt@"ct@"dt@"ht@"it@"jt@"kt@"mt@"x@" x@" x@"@"@" @" @" @" @" @" @" @" @`,@8@`L@5`@p@D/@T!@k@k@k@k@k@k@k@k@k[Ak @k!@k"@k$@k% @k&0@k'<@k(H@k)P@k-\@k.h@k/h@k0t@k1@k2@k3@k4@k5@k6@k;@k>@k?@k@@kA@kB@kC@kE$@kF$@kG$@kH$@kI$@kK0@kL8@kO@@kPH@kQT@kR`@kSp@kTp@kUp@kV|@kW@kX@kY@kf@kg@kh@ki@kj@kk@kE(@8@8@[A푠@홠@ @(@0@ <@0H@`T@p`@l@x@@@ @0@`@p@@@@@@ @[@!B(@Cu@8@P1P@P1`@T1p@P>@T>@p>@6A@7A@DA@EA@FA@GA@HA@IA$@JA4@KAD@PAT@QAd@RAd@SAp@TA|@UA@VA|@XA@dA@pA@qA@rA@sA@7B@BB@CB@6C @7C0@AC<@BCH@ECT@GC`@HC`@ICl@LCx@MC@SC@TC@XC@aC@bC@cC@eC@gC@hC@iC@lC@mC@nC@pC @qC,@rC8@sCD@tCP@uCP@vC\@wCh@xCt@yC@zC@{C@C@C@C@C@C@C@C@C@C@C@C@C@C@C @C@C@C@C@C@C@C$@C0@C0@C0@C0@C0@C<@CH@CT@CT@CT@CT@7D`@TEt@BG@DG@IG@LG@MG@NG@OG@PG@QG@RG@SG@TG@UG@VG@WG@XG@YG@ZG@fI@fI@nI@HJ@IJ@JJ@KJ@LJ@MJ@NJ@OJ@PJ(@TJ8@iJL@IK`@JKp@KK@LK@BL@DL@EL@FL@GL@IL@ML@NL@PL@QL@RL@SL@WL@XL@YL@ZL@dL@fL@fL@FM$@LM$@DN8@EN@FNL@GN\@HNh@INx@JN@KN@PN@QN@RN@SN@TN@VN@dN@gN@hN@AP@BP@CP@DP@EP@FP@GP$@HP$@IP$@JP$@KP$@LP$@MP$@NP$@OP$@PP$@QP$@RP$@SP$@TP$@UP$@VP$@WP$@XP0@DQ<@EQ@@FQ@@GQ@@HQ@@LQ@MQH@NQ@OQ@WQT@XQT@YQ`@ZQ`@^Ql@lQ@ER$@FRt@GR$@KR$@LR$@HS$@KS$@LS$@MS$@NS$@FT@LT@RT@`T@bT@dT@HU@IU@JU@KU@LU@MU@NU@OU@PU@QU@RU|@SU|@mU @JV0@KV0@OVL@RVh@SVh@TV@UV@VV@WV@wV@0X@1X@2X@3X@4X@5X@8X@@Y0@AYD@PYT@QY`@RYl@TYx@UY@WY@XY@`Y@aY@bY@dY@eY@iYl@tYx@uY@xY@zY@{Y@|Y@}Y@~Y@Y@Z@Z@Z@Z(@Z4@Z4@Z4@Z4@Z4@Z4@Z4@Z4@Z4@Z4@ Z4@1Z@@3ZL@4ZX@6Zd@7Zd@8ZX@9ZX@?Zd@AZx@BZ@aZx@bZ@`[p@b[|@c[@d[@e[@p[@r[@s[@t[@u[@a\@c\@D]@H],@I]@@J]T@L]p@M]@N]p@O]@P]|@R]@W]@o]@r]@H^@J^@K^@L^@M^@O^@m^(@O^@@o^P@hd@ht@h@h@h@p@p@q@q@q@q @q$@q4@qD@q@ q@ q@ q@ q@q\@ql@@q|@Aq@Bq@Cq@Dq@Eq@Fq@Gq@Iq@Jq @Kq @Lq @Mq$@Nq$@Oq$@Qq@Rq4@SqD@^q$@_q@`qT@bqh@q@q|@q@q@q$@q@q@q@q@q@q$@q@q@q@q@q @q$@q|@q8@qH@q|@q\@ql@q@q@q|@q@q@q@q@q@q\@q@q@q @q @r8@rH@rH@@r`@Crp@Dr`@Erp@Frp@Grp@Hrp@Irp@Jrp@Krp@Lrp@Mrp@Nr@Orp@r@r@r@r@r@r@r@r@r@r@r@r8@r@r@r(@4x@@5xX@yh@yt@y@y@y@y@y@y@y@y@ny@@@B@Z@`@ @0@@@ÔT@ɔh@@@@@O@S@@@@@0@H@`@t@@ĕ@ŕ@ƕ@@@@@@@ @8@H@`@p@@@@@@@@ @(@0@8(@P@@XX@`p@h@ʠ@ʬ@ʸ@@PG@C@ @@@@@@@@@@@ @(@0@#8@$@@'H@)P@*X@+`@,h@-p@.x@0@2@@@@@@@@@ @i&(@iH,@ib0@ic4@is8@i8@iH <@i` 0@ib 0@@@L@X@#l@#t@@#|@@#@@@@0!@P!@R!@D@D @D@D@;Y@`@ `@p@@ @@ @V(@0@8@9D@:L@;X@<`@D @E(@Fl@Gt@H|@I@J@L@M@N@O@P@S@T@U@V@W@X@Y @Z@[@\$@],@^8@bH@cT@h`@ih@jt@k|@n@r@s@t@v@w@x@y@z@{@|@}@~@ @@$@,@4@@@L@X@d@p@|@@@@@@@@@@@@@@ @@$@0@<@H@4@T@`@l@t@|@@@ @ @@@@@C@C@C@C@C@C@C@ C@!C@"C.A$C @%C(@(C0@)C0@+C8@3C.ADC.ASC@@WCL@DX@D`@'Gl@Xt@X|@X@ X@!X@"X@#X@%X@`X@aX@bX@P@Q@n@o@x@y@t@K@@K@ @K0,@tcsg8@}@@}L@}X@?d@%p@% |@%!@%"@%#@%$@%%@%&@%0@%1@%2@,@,@,@,@,@, @,(@,0@,0 8@8@@L@X@d@p@|@@@@@@@@@@@`@`$@`,@`H@7#\@7@\@7A\@7Bh@7Cx@7E@@@B@D@@@B@C@F@G@H@I@P@p@s@ @1@1$@$14@11D@21T@5d@15t@qNC@ @ A8GAF@@ @20@30@40@@@p@@@@@@@@@@@(@@8@@H@@\@@p@`@ p[A@8GA@@@)8GA+@2@3@4@5@@,@CD@i8GAl[Am[Ad@@0@`@x@@@0@P@@ @ @3@6@?A?AC$(@/4@xD@tT@rd@qt@@@@@@R@@@Y@Y@Y @D@E$@F$@G@0@@@X@l@@@@@@ @@@p@p(@p@p@pD@8P@\@p@|@@@@@@<@x@x@x@x@x @x@x$@x8@ H@P@X@2`@ffh@ffx@ff@@@@@@ @ @@@@@@<@D@!X@"h@#x@$@%@&@F@e@(@(@(@(@(@( @( @( @( <@( X@(h@(x@(@(@(@(@(@(@(@(@(@(@(!@(@ t@`@@@@@@a@3@@@@@C @K,@K8@KD@KP@L\@Dh@Dx@DGAD@D@X@J@u@2w@2(w@2Xw@2'w@28w@2Hw@2hw@@@@#@H$@8@@@H@P@X@`@h@p@x@@@@@@@@@@@@@@@@@@ (@@4@@@H@T@`@l@x@5@ 6@.B@0B@>B@$ @$0@$P@$Q1A$@$%@$@$@$@$ (@$!8@$"H@tqX@tPd@tXp@]x@]h@]i@]x@]@]@]@]@]@](@]8( A]((A8ALA`A8pA?|A?A?A?ĀA?ȀA?A?ARATAXA'A'AAWAWAWAWAW(AW8AWHAWTA\AhAtAAAAA6AAAAAFP ApAA<,A<<A<LA< \A<(lA<)A<0A<1A<HA<TA<A<A<A<A<A<)$A<*0A<.8A<LA<2dA<2xA<2A<2xA<2xA<2xA< 2A<"2A<#2A<%2A<02A<12A<22A<32A<42A<52A<62A<72A<82A<92A<:2A<;2A<<2A<=2A<A2$A<C28A<E2LA<G2`A<I2tA<J2A<K2A<3[A<3A<3A<3A<3A<3@AAAAAA A(A0A 8A3 DA3!DA3"PA3@38GA3wAT\AT5tAT5AAAA AAAAA A"A.<@6A>AW AAp A(A<@8ADAPA`A$tAAAA.AOI"APA`AAA A,AHA !dA "lA&PtA'P|A(PAIASA(A5AA9A@AAABACADAEAFAA,A,A<AXAXAtAtAAAAAAAAA A AAA"A&A A A&A'A) A* A, A0, A2, A5@ A@T AAT Apd Ard A8x A: A< A@ A A A A A A A A A A A A0 A0 A` @ Ab P Ad ` Ap A AA A A  A  A  A A A8 AP Ah A A A A A A A A A A A& A'0 A(0 A)H A0P A1X A2X A3d A4d A5p A6p A7p A8d A9X A: A;d A<d A=X A>d A@ AC AH AI AJ AK AL AM APX AQX ARd ASd ATd AUd AVd AWd AXd AY A^ A_( A`@ AdX AeX Afd Agd Ahd Ait AjX AkX Au Av Aw Ax Ay Az A{ A|A},A~DA\A AtAtAAAAd Ad Ad Ad Ad AAAAA A A$A<ATATAlAAAAAAAA,AAATAAAAA(A4A@ALAdAxAAAAAAAA A$A ATA<ATAhAxAA AAAAAAAAAAA A8ALA\AdAxAAAAA0A1A2AaA A"A#A%$A&0A'@A(LA)`A-hA.pA0|A4A5A7A<AKAPA`A`AaAb A A0A8A@AXA lA xA A AAAAAAdAAAA!A"$A#0A$<A&A'HA(TA)\A*pA`A!A#A$A0A1A8AHAHAAAAA A A AA A0A0A0A0A0A0A0A0A @A"TA$dA%xA&A-A:A=AFAGAIAJAKALAMANAOAPAQAR$AT0AV<A$HA$TA$`A$lA$|A$A$A $A!$A"$A#$A%$A&$A($A@$AB$$AC$0AD$$AE$@AF$PAH$`AI$tAJ$|AK$AL$AN$AP$AR$AS$AY$A]$A$A$A$ A$A$ A$4A$A$HA$XA$dA$tA$A$A$A$A$A$A$A$A$A$A$A$A$A$A$(A$A$<A$LA$A$`A$pA$A$A%A%A0%A1%A2%A3%A4%A5%A6%A@%AA%AC%AD%AE%AF%AG%AH%AL% AP%AQ%$AR%<AS%HAT%HA`%TAa%`Ab%lAp%|Aq%Ar%As%Av%Ax%Ay%A{%A%A%A%A% A%A%$A%0A%<A%HA%XA%hA%xA%A%A%A%A%A%A%A%A%A%A%A%A%A%A% A%,A%8A%8A%8A%8A%8A%8A%DA%\A%\A%lA%lA%xA%xA%xA%A&A&A&A&A&A&A&A&A&A &A &A &A&A&A&A& A& A& A&A&A&A&A&A&A&A&A &(A!&4A"&DA#&TA$&dA%&dA&&dA'&dA@&xAA&AQ&AR&AS&AX&AY&AZ&A[&A\&A`&Ab&Ad&Af&Ah&Aj&Al&X Am&An&Ao&$Ap&0A&<A&LA&\A&\A&lA&lA&lA&lA&lA&xA&xA&xA&xA&A&A&A&A&Ap'Aq'Ar'At' Au' Av'Ax' Ay'$ Az'0 A|'< A}'0 A'A'hA'H A'X A'h A'h A'x A' A' A' A' A' A' A' A' A'!A'!A' !A'0!A'@!A'@!A'@!A'@!A'@!A'L!A'L!A'L!A'L!A'\!A'p!A't A'!A'!A'!A'!A'!A(!A(!A(!A(!A(!A (!A!("A"("A$("A%(!A(( "A)(0"A*(@"A>(P"AO(`"A0(p"A1(p"A2(p"A3(p"A4(p"A5(p"A6(p"A:(p"A?(|"AA(|"AC(|"AE(|"AG(|"AI(|"AK("AO("AP("A)"A)"A)"A)"A)"A)"A )#A!)#A")#A#)#A&)#A()#A))#A*) #A-)#A.)#A0),#A2)<#A4)L#A5)L#A6)L#A7)L#A8)L#A9)L#A:)L#A<)L#A>)X#A@)h#AB)h#AD)h#AF)h#AH)h#AJ)h#AL)t#Ap)#Aq)#Ar)#As)#At)#Au)#Av)#Aw)#A)#A)#A)#A)#A)$A) $A)$A)$$A)$$A)4$A)4$A)@$A)P$A)\$A)h$A)t$A)t$A)$A)$A)$A)$A)$A)$A)$A)$A)$A)$A)$A)$A)$A)%A)%A)%A)%A)%A)(%A)8%A)D%A)P%A)\%A)\%A)h%A)h%A)t%A)%A)%A)%A)%A)%A)%A)%A)%A)%A)%A)%A*%A*&A*&A*&A* &A*,&A*<&A*H&A*T&A*T&A*d&A*d&A*p&A*&A@*&AA*&AB*&AC*&AD*&AE*&AF*&AG*&A.&A.&A.&A.&A.'A.'A. 'A.'A . 'A!.,'A".8'A#.8'A).,'A0.D'A1.,'A2.P'A3.P'A0\'A$1l'A2x'A@3'AA3'AB3'A4'A4'A4'A4'A 4'A 4'A 4'A 4'A 4'A4'A4'A4'A4'A4'A4'A"4(A#4(A%4(A&4(A'4(A(4(A)4((A*4((A+4((A,4((A-48(A.4D(A04((A14((A24((A34((A84P(A?4`(A5xA5h(A 5x(A5xA5xA5xA5xA5xA5xAu5(Av5(Aw5(A5(A5(A5(A5(A5(A5)A5)A5)A5()A5@)A5L)A5d)A5p)A5p)A5p)A5p)A5p)A5p)A5|)A5)A5)A5)A5)A5)A5)A6)A6)A6)A6)A6)A6)A 6)A 6)A 6)A 6)A 6*A6$*A60*A60*A:<*A:L*A:\*A:<*A:l*A:|*A:*A:*A :*A":*A%:*A&:*A0:*A4:*A5:*A6:*A7:*A8:*A9:*A::*A<:*A>:*A@:+AB:+AD:+AF:+AH:+AJ:+AQ:+AU:(+A`:@+Ab:P+Ad:`+Ae:`+Af:`+Ag:`+Ah:`+Ai:`+Aj:`+Al:`+An:l+Ap:+Ar:+At:+Av:+Ax:+Az:+A|:+A;+A;+A;+A;+A;+A;+A ;+A ;+A ;+A;+A;+A;,A;,A ;,A!;,A";(,A#;(,A%;4,A&;,A(;,A);(,A,;4,A-;,A.;,A/;(,A0;@,A2;L,A4;\,A6;\,A7;\,A8;\,A9;\,A:;\,A;;\,A<;\,A>;\,A?;\,AB;AD;AF;AH;AJ;AL;AN;AP;AV;h,AW;x,Ad;,Ae;,Av),Ag;,A@,A@,A@,A!@,A"@,A#@,A$@,A%@,A&@,A'@,A(@,A)@,A/@,A0@,A1@-A2@-A5@$-A6@$-A B0-A!BD-A"BX-A#Bp-A$Bp-A'BX-A)B-A+B-A,B-A0B-A2B-A5B-A6B-A7B-A8B-A9B-A:B-A;B-AP/A?P.A@P(/ADP(/AHP(/AR4/ARD/AeT/Ae`/Ae`/Ae`/Ae`/Ae`/Ae`/Ael/Aex/Aex/Ae/Ae/Ae`/Ae`/Ae`/Ae`/Ae/Ap/Ap/A p/A0p/Aq/Aq/Aq/Aq/Aq0A q0A!q0A"q(0A#q<0A$qP0A%q\0Aql0Aql0Aqx0Aqx0Aq0Aq0Aq0Aq0Aq0Aq0Aq0Aq0Aq0Aq0Aq0Av1Ax1A1A(1A<1A H1A\1A\1Ah1Ah1Ah1Ah1Ap1A1A1A1A1A1A1AĄ1Ań1Aʄ1A˄1A1A2A $2A!82A"H2AAX2Ah2Ax2A2A2Ax2A2A2AR2AT2A02A12A22A8A9A:A;AP2AQ2AR2AS2AT2AU2AV3AW3AX 3A,3A@3AL3A~X3A`r8l3A`s8t3A`w83A`83A`83A3A @3Aa3Aa3A3A3A3A04A4A{P4A{`4A{`#$4A{a#04A{b#@4A{c#L4A{e#\4A{f#l4A{h#|4A{#oA{#4@{#1A{#@{#4A{#4@{#1A{#@{#4A{#4@{#1A{#@{#4A.04Av4Av4Av4Av4Av4A4A@@@.A.A @!@@@.A.A.A.A4A4A4A4A}4A}f4A} f4A5A725A7d 5A7(5A7 45A<5AD5AL5A@T5AAl5ABl5ACl5ADl5AEl5AFl5AGl5AHl5AIl5AJl5AKl5ALl5AMl5ANl5APl5AQl5ARl5ASl5ATl5AUl5AVl5AWl5AXl5AYl5AZl5A\l5Al5At5AX[AX5AX5AX5AY5A5A5A 5A @15A25A%5A5A6A$6A@6A\6Al6A x6A 6A 6A6A6A=6A6A7A7A7A*6A C07A@CH7AACX7ABCh7ACCx7ADC7AEC7AFC7AGC7APC7AQC7ARC7ASC7ATC8AUC8AVC(8AWC88AZCH8A`CX8AaCh8AbCx8AcC8AdC8AeC8AfC8AgC8AhC8AiC8AjC8AkC9AlC9AmC8ApC(9AC89ACH9APX9A@Pp9AAP9AP9AP9A@`9AA`9AB`9A`9A`9Aa:Aa:A a :A!a0:A"a@:A@aP:AAa`:AEap:ABp:AK#:A+:A+:A+:A+:A+:A+ ;A+!,;A+"<;A+%X;A+2l;A+ x;A+;A+;A++;A+y!;A+'%;A+8%;A+;A+A >AC >A >A0>A@>AYT>A0\>A1d>At>A">A@@>A@@>A@@>A@@>A@@>A@@$>A@@%>A@@?A ?A ?A $?A [A  8?A "H?A (\?A +h?A -t?A .?A /?A 0?A 5?A ?A ?A ?A ?A ?A ?A @A @A  @A 0@A35[A3F8@A3tH@A3}H@A3@3[A3%(A3L@A3XX@A3EAPFAQFARFAS,FAT8FAU8FAVHFAWHFAYTFAZdFA[dFA\pFA]FA^FA`FAdFAeFAfFAgFAhFAjFAkFAlFAmFAn GA~ GA,GATA?`AflAgxAhAiAjAkAmAnAôA؂AAAAAA A,A8ADA`PAa\AhAtAtAxAAAA A AȃAЃA؃AAAAAA A@$ApLA\AlAAAAAAĄA1ЄA1؄A2ABAAJmAPAP@AP@ APe,AP > > >  >> ! >> >;2X;";0H;.H;vH;pH;qH;4H;qH;ʄH;$H;!$H;J$H;K$H;$H;$H;$H;$H;$H;$H;$l;$l;%H;%l;%l;&H;o&H;S&l;Q&l;R&l;'H;'l;'l;'l;'l;'l;'l; (l;!(l;"(l;$(l;%(l;((l;)(l;*(l;P(H; )l;!)l;&)l;()l;-)l;.)l;:l;:l; :l;&:l;&l; ;l;!;l;&;l;(;l;-;l;.;l;l;l;l; l;(Pl;@P; t;t;At;it; ; x|U;@XN;CH;FH;HH;IH;;1};5};@};1:ql;ql;d1l;l;$Sl;l; l;l;I1Б;I2Б;Б;7SБ;rSБ;I3Б;|z;Uu;Б;Б;Б;s;r;)R@n;Dj;Dj;Dj;Dj;Dj;3M`;8M`;0 `;0M`;hM`;hb`;iM`;ib`;u`;uR`;ur`;3;3;q3;u3;v3;w3;s3;r3;=;5;=;5;w5;q5;u=;t5;p5;s=;\;\;\;\; \;^;^;^;^;^;@PB;APB;BPB;JPB;KPB;8Z;e8Z;8Z;8Z;8Z;S8Z;58Z;e8Z;n8Z;8Z;H8Z;`8Z;l8Z;Y8Z;Б;Б;Б;TБ;UБ;6Б;>Б;fБ;gБ;~Б;Б;Б;Б;Б;\Б;]Б;^Б;_Б;PБ;QБ;RБ;SБ; Б; Б; Б; Б; Б; Б; Б; Б; Б; W; W;IC|U;iC|U;vC|U;C|U;C|U;nC};yC};zC};a#tS;c#tS;e#tS;f#tS;h#tS;PQ;t>E">> p>>9$> T>l>x>>fL> Z>>-??{X??w! ]G4" eB"   w! ]G4"    XD31P@0qw!! rq! 2r!qq! 0          JtT4$&(`& 0&0 0 `"0 0    @DHL  @DHL  error %d timeout on SCSI command 0x%x INTRF single step dsp 0x%08x dsa 0x08%x %s: DMA IRQ: illegal instruction bus fault parity DMA fifo empty, DSP=0x%x DSA=0x%x: last msg_in=0x%x status=0x%x current DSA invalid %s: scsi gross error %s: unexpected phase mismatch %d %s: phase mismatch without command parity error %s: selection timeout without command %s: unexpected disconnect without command %s: unhandled scsi interrupt, sist=0x%x sstat1=0x%x DSA=0x%x DSP=0x%x %s: script interrupt (0x%x) with invalid DSA !!! %s: command with invalid status (IRQ code 0x%x current status %d) ! error, DSP=0x%x %s: reselect with invalid target %s: reselect with invalid target %d %s: target %d reselect with invalid lun %d %s: target %d lun %d tag %d reselect without command %s: reselect with invalid tag our reject message was rejected scsi message reject, extended message sent was 0x%x scsi message reject, message sent was 0x%x unhandled message 0x%x %s: extended message too big (%d) MSG_IGN_WIDE_RESIDUE: bad len %d invalid retval from siop_iwr()invalid retval from siop_wdtr_neg()invalid retval from siop_sdtr_neg()reselect failed %s: done without command, DSA=0x%lx unknown irqcode %x != NULL%s: siop_intr() - we should not be here! istat = 0x%x, dstat = 0x%x, sist = 0x%x, sstat1 = 0x%x need_reset = %x, irqcode = %x, siop_cmd %s %s: unable to load data DMA map: %d siop%s: %u (%d dBm) Unknown PRISM2 chip%s: Firmware %d.%02d variant %d, Symbol %s: %s%s (0x%04x), Firmware %d.%d.%d (primary), %d.%d.%d (station), %s: unsupported crypto algorithm %d %s: wi_do_hostdecrypt: iv mismatch: 0x%02x%02x%02x%02x vs. 0x%x %s: wi_start: dropping unassoc dst %s %s: host encrypt not implemented for 802.3 %s: wi_start: xmit failed %s: wi_cmd failed with %d %s: wi_scan_timeout: %d tries %s: invalid data path: %x %s: failed to allocate %d bytes on NIC %s: device timeout %s: init failed %s: wi_mgmt_xmit: xmit failed wiiocwiscan%s: tx buffer allocation failed %s: mgmt. buffer allocation failed %s: wi_cmd_io: busy bit won't clear %s: timeout in wi_cmd 0x%04x; event status 0x%04x %s: received packet of unknown type on port 7 %s: received packet on invalid port (wi_status=0x%x) %s: oversized mgmt packet received in hostap mode (wi_dat_len=%d, wi_status=0x%x) wihap: failed to copy header %s: oversized packet received (wi_dat_len=%d, wi_status=0x%x) %s: Error decrypting incoming packet. : unable to read station address address %sWaveLAN/IEEE nodeIBSSwlanLucent WaveLAN/IEEESony WaveLAN/IEEELucent Embedded WaveLAN/IEEEPRISM2 HFA3841(EVB2)PRISM2 HWB3763 rev.BPRISM2 HWB3163 rev.APRISM2 HWB3163 rev.BPRISM2 HFA3842(EVB3)PRISM1 HWB1153PRISM2 HWB3163 SST-flashPRISM2 HWB3163(EVB2) SST-flashPRISM2 HFA3842(EVAL)PRISM2.5 ISL3873PRISM2.5 USBPRISM2.5 ISL3874A(Mini-PCI)PRISM2.5 ISL3874A(PCI-bridge)PRISM3 ISL37300PPRISM3 ISL37300P(PCI)PRISM3 (USB)Sending deauth to sta %s wihap_disassoc_req: unknown station: %s wihap_assoc_req: from station %s wihap_assoc_req: bad ssid: '%.*s' != '%.*s' wihap_assoc_req: rates mismatch. wihap_assoc_req: capinfo: not ESS: capinfo=0x%x wihap_assoc_req: WEP flag mismatch: capinfo=0x%x wihap_assoc_req: polling not supported: capinfo=0x%x wihap_assoc_req: already assoc'ed? wihap_assoc_req: returns status=0x%x Sending disassoc to sta %s wihap_data_input: no TODS src=%s, fctl=0x%x wihap_data_input: incorrect bss: %s wihap_data_input: dropping unassoc src %s wihap_auth_req: station %s short request wihap_auth_req: station %s algo=0x%x seq=0x%x wihap_auth_req: new station challenge: 0x%x 0x%x ... wihap_auth_req: algorithm unsupported: 0x%x wihap_auth_req: returns status=0x%x wihap_init: sc=%p whi=%p wihap_ioctl: i shouldn't get other ioctls! wihap_deauth_req: unknown station: %s wihap_mgmt_input: len=%d MGMT: assoc req: assoc resp: reassoc req: reassoc resp: probe req: probe resp: beacon: ann traf ind disassociation: auth: deauth: unknown (stype=0x%x) ftype=0x%x (ctl=0x%x) wihap_shutdown: sc=%p whi=%p wihap_shutdown: free(sta=%p) wihap_timeout: disassoc due to inactivity: %s wihap_timeout: deauth due to inactivity: %s %s: power management is disabled, cannot do WOL %s: no auxiliary power, cannot do WOL from D3 (power-off) state %s: can't map mbuf (error %d) %s: tried to map busy TX descriptor %s: unknown imtype %d%s: tried to map busy RX descriptor %s: reset never completed! %s: PHY write failed %s: bad phy register %x %s: PHY read failed %s: unknown bus speed, assume 33MHz : unknown ASIC (0x%04x): %s (0x%04x), %s, address %s %s: can't allocate tx listseg, error = %d %s: can't map tx list, error = %d %s: can't create tx list map, error = %d %s: can't load tx list, error = %d %s: can't create DMA map for TX %s: can't allocate rx listnseg, error = %d %s: can't map rx list, error = %d %s: can't create rx list map, error = %d %s: can't load rx list, error = %d %s: can't create DMA map for RX %s: no PHY found! %s: watchdog timeout RTL8100RTL8100E 1RTL8100E 2RTL8101RTL8101ERTL8102ERTL8401ERTL8102ELRTL8102EL 1RTL8103ERTL8110SRTL8139C+RTL8168 1RTL8168 2RTL8168 3RTL8168C/8111CRTL8168CP/8111CPRTL8105ERTL8168D/8111DRTL8168DP/8111DPRTL8168E/8111ERTL8168E/8111E-VLRTL8169RTL8169/8110SBRTL8169SBLRTL8169/8110SCdRTL8169/8110SCeRTL8169S%s: probed fifo depth: %d bytes : unknown uart : ns8250, no fifo : ns16450, no fifo : ns16550, no working fifo : ns16550a, %d byte fifo : st16650, no working fifo : st16650, %d byte fifo : st16c654, 64 byte fifo : ti16750, 64 byte fifo comattach: bad fifo type%s: console %s: can't establish soft interruptcomcninit: mapping failed%s: %d silo overflow%s, %d ibuf overflow%s comprmRT5222unknownRT2522RT2523RT2524RT2525RT2525eRT2526%s: could not write to RF %s: could not read from BBP %s: could not write to BBP %s: timeout waiting for BBP %s: could not enable device %s: could not allocate protection frame %s: sending mgt frame failed 0x%08x %s: sending data frame failed 0x%08x %s: could not load old rx mbuf%s: could not allocate beacon %s: could not create desc DMA map %s: could not allocate DMA memory %s: can't map desc DMA memory %s: could not load desc DMA map %s: could not allocate soft data %s: could not create DMA map %s: could not allocate rx mbuf %s: could not allocate rx mbuf cluster %s: could not load rx buf DMA map%s: MAC/BBP RT2560 (rev 0x%02x), RF %s %s: could not allocate Tx ring %s: could not allocate ATIM ring %s: could not allocate Prio ring %s: could not allocate Beacon ring %s: could not allocate Rx ring ralRT2529 (MIMO XR)RT5225RT5325 (MIMO XR)RT2527ral-rt2661ral-rt2561ral-rt2561s%s: error %d, could not read firmware %s %s: could not allocate beacon frame %s: timeout waiting for MCU to initialize %s: could not load 8051 microcode %s: timeout waiting for NIC to initialize %s: MAC/BBP RT%X, RF %s %s: could not allocate Tx ring %d %s: could not allocate Mgt ring RT3053RT2820RT2850RT2720RT2750RT3020RT2020RT3021RT3022RT3052RT3320%s: timeout waiting for DMA engine %s: could not read RF register %s: could not read from BBP through MCU %s: could not write to BBP through MCU %s: timeout waiting for BBP to wake up %s: can't map DMA memory %s: could not load DMA map %s: radio is disabled by hardware switch %s: timeout waiting for MAC %s: could not allocate Rx mbuf ral-rt2860%s: error %d, could not read firmware file %s %s: MAC/BBP RT%X (rev 0x%04X), RF %s (MIMO %dT%dR) %s: could not allocate Tx pool %s: reset rx ring timedout %s: can't allocate DMA mem %s: can't map DMA mem %s: can't load DMA mem %s: can't select regwin %d %s: invalid max txpower in sprom %s: no tssi2dbm table for 11a PHY %s: bwi_rf_calc_txpower failed %s: only BCM2060 rev 1 RF is supported for 11A PHY %s: only BCM2050/BCM2053 RF is supported for supported for 11B PHY %s: only BCM2050 RF is supported for 11G PHY %s: unsupported PHY mode %s: %s is not implemented yet %s: unsupported 11A PHY, rev %u %s: unsupported 11B PHY, rev %u %s: unsupported 11G PHY, rev %u %s: unsupported PHY type %d %s: too many MACs %s: %dth MAC already attached %s: MAC rev %u is not supported %s: can't select regwin 0 %s: no BBP id for device id 0x%04x %s: no number of win for BBP id 0x%04x %s: bus regwin already exists %s: no MAC was found %s: no bus regwin was found %s: MACs bus space mismatch! %s: config PS failed %s: can't stop MAC %s: invalid IV image, ofs %s: invalid ofs (0x%04x) for %dth iv %s: invalid IV image, val32 %s: invalid IV image, val16 %s: invalid IV image, size left %d %s: load IV failed %s: load ExtIV failed %s: firmware (fw & pcm) loading timed out %s: firmware version 4 is not supported yet %s: invalid firmware (%s): invalid size %u %s: invalid firmware (%s): size mismatch, fw %u, real %u %s: invalid firmware (%s): type mismatch, fw '%c', target '%c' %s: invalid firmware (%s): wrong generation, fw %d, target %d %s: base tssi measure failed %s: TEST1 failed %s: TEST2 failed %s: %s failed, MAC status 0x%08x %s: %s failed, intr status %08x COMunknown regwin type 0x%04x%s: %s disable clock timeout %s: %s wait BUSY unset timeout unsupported rate %dimpossible lna gain %dunsupported lpdunknown PHY mode %u%s: zero tx id %s: wait for TX ring(%d) stable timed out %s: reset TX ring (%d) timed out %s: can't create %dth tbd, %dth DMA map %s: can't create spare RX buf DMA map %s: can't create %dth RX buf DMA map unsupport modulation type %u%s: invalid rate %u or fallback rate%s: prepend TX header failed %s: can't load TX buffer (1) %d %s: can't defrag TX buffer %s: can't load TX buffer (2) %d unsupported modtype %u%s: zero length data, hdr_extra %d %s: can't allocate %dth RX buffer %s: can't create txstats ring DMA mem %s: can't allocate txstats ring DMA mem %s: can't map txstats ring DMA mem %s: can't load txstats ring DMA mem %s: can't allocate txstats DMA mem %s: can't map txstats DMA mem %s: can't load txstats DMA mem %s: %dth TX ring DMA create failed %s: %dth TX ring DMA alloc failed %s: RX ring DMA create failed %s: RX ring DMA alloc failed %s: TX stats DMA alloc failed unknown LED event %d%s: %s invalid channel! %s: can't set channel to %u bwi-airforceucode%d.fw%s: error %d, could not read firmware %s! pcm%d.fw%s: no suitable IV for MAC rev %d b0g0initvals%d.fwb0g0bsinitvals%d.fw%s: no suitable ExtIV for MAC rev %d %s: PHY calibrate failed %s: can't initialize %dth TX ring %s: can't initialize RX ring %s: can't initialize TX stats ring %s: invalid MAC address: %s unknown phymode %d%s: can't drain TX status %s: intr fatal TX/RX (%d) error 0x%08x intr PHY TX error %s: EO_ATIM %s: intr noise bwiuhci_alloc_std_chain: maxp=0 uhci_device_setintr: 0 interval uhci_device_isoc_close: %p not found uhci_allocmuhci_abort_xfer: not in process contextuhciabUHCI root hubuhci_device_isoc_enter: xfer=%p in frame list startstop%s: cannot %s %s: controller did not reset %s: interrupt while not operating ignored %s: host system error %s: host controller process error %s: host controller halted uhciohci_setintr: 0 interval ohci_device_isoc_abort: early return ohci_rem_ed: ED not foundohci_add_done: addr 0x%08lx not foundohci_abort_xfer: not in process contextohciab%s: isoc TD alloc failed OHCI root hub%s: %u scheduling overruns %s: resume detect %s: unrecoverable error, controller halted %s: blocking intrs 0x%x %s: reset timeout %s: SMM does not respond, will reset ,, legacy support version %d.%d%s %s: unsupported OHCI revision ohciehci isoc xfer being freed, but with no itd chainehci: isoc xfer suddenly has 0 bInterval, invalidehci_check_itd_intr: not valid itd ehciiawehciabehci_check_qh_intr: not valid sqtd ehci_open: bad device speed %d%s: Error opening low/full speed isoc endpoint. A low/full speed device is attached to a USB2 hub, and transaction translations are not yet supported. Reattach the device to the root hub instead. ehci: opening pipe with invalid bInterval ehci: zero length endpoint open request ehci: isoc descriptor requested that spans the entire frametable, too many frames ehci: unexpectedly ran out of isoc itds, isoc_startStarting ehci isoc xfer with polling. Bad idea? EHCI root hub%s: port reset timeout ehcidiehci_abort_xfer: not in process contextehciaw%s: config timeout ehcidb%s: run timeout ehci%02x%02x%02x%02x-%02x%02x-%02x%02x-%02x%02x-%02x%02x%02x%02x%02x%02xinvalid data offset%s: %s: illegal block count for %s %s: %s: illegal cmdlen for %s unknown optional metadata type%s: unable to start backgound operation %s: sr_startwu_callbacksr_sync%s: chunk sizes are not equal; up to %llu blocks wasted per chunk %s: no in memory copy of metadata %s: could not allocate metadata scratch area %s: could not write metadata to %s sr_shutdownsr_down%s: roaming device %s -> %s %s: save metadata failed %s: could not allocate memory for metadata %s: could not allocate memory for foreign metadata %s: sr_scsi_cmd NULL discipline %s: %s device is being deleted, failing io %s: sr_scsi_cmd got active wu%s: sr_wu_put got active wu%s: sr_rw: failed to allocate vnode %s: I/O error %d on dev 0x%x at block %llu %s: insufficient boot storage! %s: failed to write boot block %s: failed to write boot loader %s: could not save metadata to %s %s: sr_meta_rw: invalid metadata pointer %s: sr_meta_clear can not clear foreign metadata %s: not enough memory for metadata buffer %s: could not read native metadata %s: not part of the same volume %s: not all chunks are of the native metadata format src_dev_mm == NODEV%s%d%c%s: discipline does not support rebuild %s: rebuild already in progress %s: %s not degraded %s: no offline chunks available for rebuild %s:, sr_rebuild_init: can't allocate vnode %s: %s partition not of type RAID (%d) %s: partition too small, at least %llu B required %s: partition too large, wasting %llu B %s: %s is already in use %s: rebuild of %s started on %s %s: no offline chunk found on %s! %s: %s volume degraded, will attempt to rebuild on hotspare %s %s: sr_hotspare_rebuildsr_hotspare%s: pending I/O failed to complete on failed chunk %s, hotspare rebuild aborted... %s: %s is already a hotspare %s:, sr_hotspare: can't allocate vnode OPENBSDSR %sHOTSPARE%03d%s: unsupported state request %d %s: chunk not part of array %s: invalid foreign metadata %s: not valid softraid metadata %s: invalid metadata checksum %s: %s can not read metadata version %u, expected %u %s:, sr_meta_native_bootprobe: can't allocate vnode %s: not enough memory for fake discipline %s:, sr_meta_native_bootprobe: can't allocate vnode for partition %s: native bootprobe could not read native metadata %s:, sr_meta_probe: can't allocate vnode srdis%s: could not create workq %s: could not initialize discipline %s: chunk %s already in use %s: invalid metadata format %s: can't attach metadata type %d %s: disk is currently in use; can't force create %s: failed to clear metadata %s: %s was not shutdown properly already assembled %s: one of the chunks has corrupt metadata; aborting assembly already assembled; will not partial assemble it %s: trying to bring up %s degraded %s: volume level does not match metadata level! %s: %s offline, will not be brought online %s: no free target for %s %s: scsi_probe_lun failed %s: volume %s is roaming, it used to be %s, updating metadata %s: unable to create sensor for %s sdwd%s: failed to allocate boot volume! %s: failed to allocate device array %s: failed to allocate ondisk array %s: failed to allocate hotspare %s: found duplicate chunk %u for volume %u on device %s %s: not all chunks were provided; attempting to bring volume %d online sr_locksr_hs_lock%s: controller registration failed%s: bogus rebuild restart offset, starting from 0 %s: resuming rebuild on %s at %d%% %s: rebuild exhausted wu_r%s: rebuild exhausted wu_w%s: could not create read io %s: could not create write io sr_rebuildsr_yieldsoftraid%s: %s: %s: invalid chunk state%s: %s: invalid volume state transition %d -> %d %s: i/o error on block %lld target: %d b_error: %d %s: invalid target on wu: %p%s: wu: %p not on pending queue sr_raid0_rw%s: %s: too many ccbs queued %s: %s: %s: invalid chunk state transition %d -> %d RAID 0%s: sr_raid1_recreate_wucould not requeue io%s: retrying read on block %lld %s: sr_raid1_intr_cb%s: permanently fail write on block %lld %s: is offline, can't read %s: sr_raid1_rwinvalid volume stateRAID 1%.2x %s: %s: invalid volume state transition %d -> %dio error: disk %x sr_raidp_rw%s: can't get wu_rDisk %llx offline, regenerating buffer %s: %s: %s: invalid chunk state transition %d -> %dRAID 4RAID 5%s: sr_crypto_rw2%s: sr_crypto_finish_io%s: cannot open key disk %s %s: %s is not a key disk sr_crypto_wu_get: out of wus%s: i/o error on block %lld sr_crypto_intr: no wuKEYDISKCRYPTOold_state = %d, %d = %d, invalid new_statesr_raid6_rwDisk %llx offline, regenerating Dx+P Disk %llx & %llx offline, regenerating Dx+Dy +Q singleDisk %llx offline, regenerating Dx%s RAID 6RAM diskfictitiousrdattach: out of memoryrd%drdattach: device name too longhtplevhotplug: event lost, queue full Not set. All breakpoints used. Already set. Too many breakpoints. No breakpoints set Count Address %5d the kernel did not panic Bad function Too many arguments Argument missing %-12sNo such command Ambiguous Bad modifier Count missing ddb> procscalloutpoolsmountsvnodesbufsallbcstatsbreaksextentsmallocobjectpagepanicpoolprocuvmexpvnodewatchescrashdumphaltrebootpoweroffmachineprintexaminesearchdeletebreakdwatchwatchstepcontinueuntilnextmatchtracecallpsshowboothelphangmandmesg.strtab[ %s symbol table has bad start address %p ] ELFbad e_machine.symtab[ using %lu bytes of %s ELF symbol table ] bad magicsymtab unalignedsymtab corrupted[ %s ELF symbol table not valid: %s ] ELFAddress missing Value missing : %*lx%*ld%*lu%*lo\%03o= 0x%lx %-*s%-*lx%-*ld%-*lu%-*loSymbol not found Syntax error Divide by 0 Negative shift amount () Score: %lu/%lu ^R Bad character in number Bad escape String too long Bad character Faulted in traceback, aborting... Starting stack trace... End of stack trace. -%#*lx-%*lx-%#*lo-%*lo-%#*lu-%*lu--db_more-- %-12s%s %s+%s [after %6d] [%s:%d]invalid symbol table nameSifting table %s: Unable to find symbol table slot for %s.No slots left for %s symbol table%s%s %s bsd[ no symbol table formats found ] After %d instructions Breakpoint at Stopped at RUN AT LEAST 'trace' AND 'ps' AND INCLUDE OUTPUT WHEN REPORTING THIS PANIC! DO NOT EVEN BOTHER REPORTING THIS WITHOUT INCLUDING THAT INFORMATION! Unknown variable No value radixmaxoffmaxwidthtabstopslineslogNo watchpoints set Address Size %8lx %lx All watchpoints used. Too many watchpoints. Unknown size %s = %s Nothing written. /mnt/etc/firmware/%sRRIP without PX field? SPIEEE_1282IEEE_P1282RRIP_1991ARRIP with incorrect NM flags? RRIP with incorrect flags?isoinodefhtovp: lbn exceed volume space %d fhtovp: crosses block boundary %d fhtovp: bread error %d fhtovp: directory crosses block boundary %d[off=%d/len=%d] CD001%/@%/C%/Ecd9660_mountroot: can't setup bdevvp'scd9660root_devicetag VT_ISOFS, isofs vnode cd9660_strategy: spec%s@%dOpenBSD#!/dev/fd/%d/dev/consolewarning: /dev/console does not exist warning: /dev/console error %d initexecinit: couldn't allocate argument spaceexec %s: error %d init: not found no initswapperfork initcfpendcannot mount rootcannot find root vnodepagedaemonfork pagedaemonreaperfork reapercleanerfork cleanerupdatefork updateaiodonedfork aiodonedscheduler/sbin/init/sbin/oinit/sbin/init.bakbqquiesbqqueuebqdestbufq_init: type %i unknownbufq init failbqinitinitclocks: unable to register softclock intrcloseffdlockfileplfdescpldup2: fdallockqreadkqueueplknoteplwaitinit died (signal %d, exit %d)thrdyingthrdeathcpu_exit returnedppwaitunable to allocate kthread_qWARNING: thread `%s' (%d) exits with status %d lockmgr: make up your mindlockmgr: not holding exclusive locklockmgr: locking against myselflockmgr: non-zero exclusive countlockmgr: pid %d, not exclusive lock holder %d unlockinglockmgr: draining against myselflockmgr: unknown locktype request %dNo KMEMSTATS compiled in %d,malloc(): allocation too large, type = %d, size = %lu malloc: allocation too largemalloc: out of space in kmem_mapphysiomawnusage: show all procs [/a] [/n] [/w] /a == show process address info /n == show normal process info [default] /w == show process wait/emul info PID %-10s %18s %18s %18s COMMANDSTRUCT PROC *UAREA *VMSPACE/VM_MAP PID %5s %5s %5s S %10s %-12s %-16s PPIDPGRPUIDFLAGSWAIT PID %-16s %-8s %18s %s EMULWAIT-CHANNELWAIT-MSG%c%5d %-10.10s %18p %18p %18p %5d %5d %5d %d %#10x %-12.12s %-16s %-16s %-8s %18p %s PROC (%s) pid=%d stat=%s flags=%b CONTROLTINMEMSIGPAUSEPPWAITPROFILSELECTSINTR SUGID SYSTEM TIMEOUT TRACED WAITEDWEXITEXECPWEUPCISPWAITSSTEPSUGIDEXECNOZOMBIEINEXECSYSTRACECONTINUEDBIGLOCKTHREADIGNEXITRVSOFTDEPSTOPPEDCPUPEG pri=%u, usrpri=%u, nice=%d forw=%p, list=%p,%p process=%p user=%p, vmspace=%p estcpu=%u, cpticks=%d, pctcpu=%u.%u%, swtime=%u user=%llu, sys=%llu, intr=%llu chgproccnt: procs < 0procinit: mallocprocplprocessplzombieplucredplpgrpplsessionplpcredplidlezombiedeadonprocplimitplcpu_switchto returnedidle%dfork idlestunrsensor_task_unregister: unexpected state %dsensordevpausesigwaitusersystempid %d (%s): %s write of %lu@%p at %lld failed: %d /var/crash/%s%s.coreissignal sigaplhashinit: bad cnt%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%s:%s,sysctllksysctldlkthrsleep%s%s(%d)Timecounter "%s" frequency %lu Hz -- Insufficient hz, needs at least %u Time stepped from %ld.%09ld to %ld.%09ld dummynanosleepdenied attempt to set clock forward to %ld denied attempt to set clock back %ld seconds ?%9d %2d/%-4d %8x %s ticks now: %d ticks wheel arg func boredunexpected %s wq state %dunable to create workq thread for "%s" wqdestroywqtaskssyswqsmashed stack in %ssetrunnablepreempt: cpu_preempt not yet implementedfailing resume cannot be handled resume %s config_defer: can't defer config of a root deviceconfig_defer: can't allocate defer structureautoconfconfig_detach: forced detach of %s failed (%d)%s detached config_make_softcconfig_make_softc: allocation for device softc failed%s%dconfig_make_softc: device name too longexpandcreatconfig_make_softc: %sing dev arrayconfig_make_softc: duplicate %s>>> probing for %s* mapply: no match function for '%s' device>>> %s probe returned %d >>> %s probe won >>> no winning probe %s at root%s at %sroot device %s not configured not configured unsupported /dev/%s%s%ccannot obtain vnode for 0x%x/0x%xcannot open disk, 0x%x/0x%x, error %dcannot read disk label, 0x%x/0x%x, error %droot filesystem has size 0filesystem type %d not known.. assuming ffs use one of: exit %s[a-p]root device (default %sswap device (default %s%s)root device (%s) not foundnetbootroot on %s%ccan't figure root, hope your kernel is right (%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx.%c) swap on %s%d%c dump on %s%d%croot device (%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx) not founddisk_unbusy: %s: dk_busy < 0 disk_detach: disk_count < 0dklkdisk_attach: can't allocate storage for disklabelwrit%s%d%c: %s %sing fsbn %lld%lld of %lld-%lld (%s%d bn %lld; cn %lld tn %lld sn %lld)%s: NULL extentextent `%s' (0x%lx - 0x%lx), flags=%b FLWANTEDWANTEDNOCOALESCEFIXED 0x%lx - 0x%lx extnt%s: start 0x%lx, end 0x%lx %s: region not foundextentplklog page %p, nmissing %d POOL %s: size %u, align %u, ioff %u, roflags 0x%08x alloc %p minitems %u, minpages %u, maxpages %u, npages %u itemsperpage %u, nitems %u, nout %u, hardlimit %u nget %lu, nfail %lu, nput %lu npagealloc %lu, npagefree %lu, hiwat %u, nidle %lu empty page list: full page list: partial-page list: no current page curpage %p pool(%p:%s): page inconsistency: page %p; at page head addr %p (p %p) pool(%p:%s): page inconsistency: page %p; item ordinal %d; addr %p (p %p) pool(%p:%s): page inconsistency: page %p; %d on list, %d missing, %d items per page pool(%p:%s): page inconsistency: page %p; %d on list, %d missing, %d expected usage: show all pools [/a] %-10s%4s%9s%5s%9s%6s%6s%6s%6s%6s%6s%5s SizeRequestsFailReleasesPgreqPgrelNpageHiwatMinpgMaxpgIdle%-10s %18s %18s Allocator%-10s %18p %18p inf %*u %*lu %*d %*s %*lu pool_put of NULLpool_do_put: %s: page header missingpool_get: PR_ZERO when ctor setpool_do_get: %s: page emptypool_init: too much uptimephpooldma%d0123456789abcdef%llo%llx(null)0123456789ABCDEFbug in kprintf: bad base%s: table is full panic: splassert: %s: want %d have %d spl assertion failure in %skernel %sassertion "%s" failed: file "%s", line %d*FOUND**UNKNOWN*0%o0x%x%3d free slot (for add) %3d %s count %d disable (pseudo device) Unknown devno (max is %d) %3d at ??? %s flags 0x%x %s [] ? Unknown argument command args description [count] number of lines before moredev add a device8|10|16 base on large numbersdevno|dev change devices enter ddbattr val|devno|dev disable devicesattr val|devno|dev enable devicesdevno|dev find devices this message list configuration leave UKC[attr [val]] show attributes (or devices with an attribute)[mins [dst]] set timezone/dst toggle verbose booting don't know--- more --- Error unknown state already%3d can't enable free slot %3d %s disabled %3d can't disable free slot already Unknown routine /%c/ Value missing for attribute Unknown attribute change (y/n) ?out of memory. flags changed %3d can't change free slot %3d %s changed Unknown pseudo routine /%c/ %s ? Not same device type No more space for new devices. Device not complete number or * is missing No device of this type exists. Clone Device (DevNo, 'q' or '?')Insert before Device (DevNo, 'q' or '?')Unknown command, try help Argument expected Dev expected 8|10|16 expected DevNo or Dev expected Attr, DevNo or Dev expected timezone = %d, dst = %d disautoconf verbose %sabled Unknown command User Kernel Config UKC> Continuing... addchangeddbdisableenablefindlistquittimezoneverbosepollselectpipeplpipelkpipeclpiperdpipewrttckoutqload: %d.%02d not a controlling terminal no foreground process group empty foreground process group runningrunnableiowait cmd: %s %d [%s] %ld.%02ldu %ld.%02lds %d%% %ldk ttyrub: would panic c = %d, val = %d mbuf %p m_type: %hi m_flags: %b M_EXTM_PKTHDRM_EORM_CLUSTERM_PROTO1M_VLANTAGM_LOOPM_FILDROP M_BCAST M_MCAST M_CONF M_AUTH M_TUNNELM_AUTH_AHM_LINK0m_next: %p m_nextpkt: %p m_data: %p m_len: %u m_dat: %p m_pktdat: %p m_pkthdr.len: %i m_ptkhdr.rcvif: %p m_ptkhdr.rdomain: %u m_ptkhdr.tags: %p m_pkthdr.tagsset: %hx m_pkthdr.csum_flags: %hx m_pkthdr.ether_vtag: %hu m_pkthdr.pf.flags: %b GENERATEDFRAGCACHETRANSLATE_LOCALHOSTDIVERTEDDIVERTED_PACKETPF_TAG_REROUTEm_pkthdr.pf.hdr: %p m_pkthdr.pf.statekey: %p m_pkthdr.pf.qid: %u m_pkthdr.pf.tag: %hu m_pkthdr.pf.prio: %u m_pkthdr.pf.tag: %hu m_pkthdr.pf.routed: %hhx m_ext.ext_buf: %p m_ext.ext_size: %u m_ext.ext_type: %x m_ext.ext_backend: %i m_ext.ext_ifp: %p m_ext.ext_free: %p m_ext.ext_arg: %p m_ext.ext_nextref: %p m_ext.ext_prevref: %p m_copydata: off %d < 0m_copydata: len %d < 0m_copydata: short mbuf chainm_copydata: null mbufunknown type of extension bufferm_copym0: off %d, len %dm_copym0: short mbuf chainm_copym0: m == NULL and not COPYALLmbuf prepend length too bigmbplmcl%dkm_apply: len %d < 0m_apply: off %d < 0m_apply: null mbuf in skipm_apply: null mbufWARNING: mclpools limit reached; increase kern.maxclustersm == NULL in m_pulldown()unixsoaccept: !NOFDREFnetclssoclose: NOFDREFsockplsbcreatecontrol: message too large %d sbdropsbappendcontrolsemi-panic: sbcompressnetlcknetiosbappendaddrnetcon2netconacceptunp_disconnectunp_connect2unp_attachuipc 1uipc 2uipc 4piusrreqCurrent Buffer Cache status: numbufs %lld, freebufs %lld bufpages %lld, freepages %lld, dirtypages %lld pendingreads %lld, pendingwrites %lld bremfree: lost tailbiowaitbufplbiodone alreadyneedbufferbuf_get: dup lblk vp %p bp %pgetblkbuf_needvabufinit: can't reserve VM for buffersnchplwtf? leak?vop_generic_revokeallnameilf_findoverlap: defaultlockfplrelookup: null namerelookup: lookup on dot-dot vp %p lblkno 0x%llx blkno 0x%llx dev 0x%x proc %p error %d flags %b AGENEEDCOMMITASYNCBADBUSYCACHECALLDELWRI DONE EINTR ERROR INVAL NOCACHEPHYSRAWREADWANTEDWRITEINPROGXXX(FORMAT)DEFERREDSCANNEDDAEMONRELEASEDNOTMAPPED bufsize 0x%lx bcount 0x%lx resid 0x%lx sync 0x%x data %p saveaddr %p dep %p iodone %p dirty {off 0x%x end 0x%x} valid {off 0x%x end 0x%x} tag %s(%d) type %s(%d) mount %p typedata %p data %p usecount %d writecount %ld holdcnt %ld numoutput %d clean bufs: bp %p dirty bufs: flags %b vnodecovered %p syncer %p data %p RDONLYSYNCHRONOUSNOEXECNOSUIDNODEVASYNCEXRDONLY EXPORTED DEFEXPORTED EXPORTANON EXKERB LOCALQUOTAROOTFSvfsconf: ops %p name "%s" num %d ref %d flags 0x%x statvfs cache: bsize %x iosize %x blocks %llu free %llu avail %lld files %llu ffiles %llu favail %lld f_fsidx {0x%x, 0x%x} owner %u ctime 0x%x syncwrites %llu asyncwrites = %llu syncreads %llu asyncreads = %llu fstype "%s" mnton "%s" mntfrom "%s" locked vnodes: %p %p, %pall vnodes: %p, %p,brelvp: NULLbgetvp: not freevflushbuf: not dirtyvflushbufvinvalbufvinvalbuf: dirty bufsvinvalbuf: flush failedvwakeup: neg numoutputsoftdep %d vclean: deadlockvclean: cannot reclaimvclean: not cleanvgonemissing aliasvgonel: not cleanmissing bdevvgetvfslockunmount of %s failed with error %d WARNING: some file systems would not unmount retrying syncing disks... giving up done kinfo: vp changed VNONVREGVDIRVBLKVCHRVLNKVSOCKVFIFOVBADNONUFSNFSMFSMSDOSFSPORTALPROCFSAFSISOFSADOSFSEXT2FSVFSNNPFSNTFSUDFsyncer vnode syncermount: lost mountunmount: dangling vnodevn_lockspec_badop calledspec_ioctltag VT_NON, dev %d, %d spec_close: not specialspec_fsync: not dirtyspec_fsyncspec_read typespec_write typechkvnlockdead_badop calleddead_write: lockdead_read: locktag VT_NON, dead vnode dos2unixtime(): month value out of range (%ld) detrunc(): can't truncate root directory, clust %ld, offset %ld deextend: file too largedenodedeget(): pcbmap returned %d extendfile(): attempt to extend root directory extendfile: pcbmap. .. doscheckpath(): .. not a directory? msdosfs_sync: rofs modmsdosfs: reducing max cluster to %d from %d due to FAT size RRaArrAatag VT_MSDOSFS, startcluster %ld, dircluster %ld, diroffset %ld (LOCKED) dev %d, %d, %s msdosfs_strategy: specmsdosfs_rename: lost to startdirmsdosfs_rename: lost from startdirmsdosfs_rename: updating .. in root directory?msdosfs_write(): bad file typebpfattachbpf_mcopybpf: ifpromisc failedbpf_detachd: descriptor not in listbpfifa_update_broadaddr does not support dynamic lengthegressif_attach_common: malloctoo many interfacesifaddritempl%s: can't handle af%d looutput: no header mbuflo%difmedia_add: can't malloc entryifmedia_set: no match for 0x%x/0x%x ifmedia_set failedcan't establish softnet handlerrn_init: radix functions require max_keylen be set rn_initrn_init 2Mask for route not entered rn_addmask: mask impossibly already in tree rn_delete: inconsistent normal annotation rn_delete: inconsistent dupedkey list rn_delete: inconsistent annotation %s %p at %p rn_delete: Orphaned Maskrn_delete: couldn't find our annotation rn_addroute: t->rn_p is NULLNon-unique normal route, mask not entered next == NULLraw_usrreqrt_timer_remove_all: rtq_count reached 0 rt_timer_add: rtq_count reached 0 ifafreertfreertfree 2rtfree: %p not freed (neg refs) rt_timer_init: already initializedrttmrplrtrequest deletertrequest1 RTM_RESOLVE: wrong ifa (%p) was (%p) rt_timer_timer: rtq_count reached 0 rt_timer_queue_destroy: rtq_count reached 0 rtinit: wrong ifa (%p) was (%p) rtentplroute_init rtable_addroute_outputrouteunexpected mode %uUnexpected mode %u%s: invalid channel freq %u flags %x %s: invalid channel (NULL) Bad IBSS channel %u%s: bad channel ignored; freq %u flags %x number %u Pairwise key expansionPMK Name%s: Michael MIC failure %s: station %s disassociated by peer (reason %d) %s: station %s deauthenticated by peer (reason %d) %s: %sassociation failed (status %d) for %s %s: received %s from %s rssi %d mode %s 80211scanfreeing bss nodenot in ap mode, mode %uunable to setup inital BSS node%s: no memory for AID bitmap! %s: no memory for TIM bitmap! -%s: tsft offset %s%llu %s: ieee80211_ibss_merge: bssid mismatch %s %s: my tsft %llu beacon tsft %llu %s: sync TSF with %s %s: rates mismatch, BSSID %s %s: sync BSSID %s -> (from %s) %s: creating ibss activepassive%s: end %s scan %s: begin %s scan invalid group data cipher!invalid integrity group cipher!management frame too large: %unull node%s: sending %s to %s on channel %u mode %s %s: no node for dst %s, discard raw tx frame %s: failed to queue raw tx frame %s: station %s deauthenticate (reason %d) %s: station %s disassociate (reason %d) %s: received msg %d/%d of the %s handshake from %s group key4-wayEAPOL-Key frame too large: %u%s: sending EAPOL-Key request to %s %s: sending msg %d/%d of the %s handshake to %s "0x%s: no recent beacons from %s; rescanning %s: bogus xmit rate %u setupassociatedsynchronized%s: %s with %s ssid .5 channel %d start %u%sMbshortlong protection enabled %s preamble %s slot time%s newly%s: station %s %s authenticated (open) %s: open authentication failed (reason %d) for %s assoc_reqassoc_respreassoc_reqreassoc_respprobe_reqprobe_respreserved#6reserved#7beaconatimdisassocauthdeauthactionaction_noackreserved#15INITSCANAUTHASSOCRUNauto11a11bturboaearazbgbhbnbrbybzcacncocrczdodzegf2fifofrgrgthkhnhrhuidiqisj1j2j3j4j5jmjojpk2kekpkrkwkzlblilvmcmkmomxmyninlnzpapkprqarusasgsisvtntrtttwuaukuyvnyezazwAPL1APL1AAPL1_ETSICAPL1_FCCAAPL1WAPL2APL2CAPL2DAPL2_ETSICAPL2WAPL3APL3WAPL4APL4WAPL5APL5WAPLDAPLDEBUGETSI1ETSI1WETSI2ETSI2WETSI3ETSI3AETSI3W,ETSI4ETSI4CETSI4WETSI5ETSI5WETSI6ETSI6WETSIAETSIBETSICETSIEU1WFCC1FCC1AFCC1WFCC2FCC2CFCC2AFCC2WFCC3FCC3AFCCAFRANCEMKK1MKK1_FCCAMKK1AMKK1A1MKK1A2MKK1BMKK2MKK2AMKKANONEWOR01WWOR02WWOR0WWOR1WWOR2WWOR3WWOR4WWOR5_ETSICWOR9WWORAWWORLD la_rt=%p la_hold_head=%p, la_asked=0x%lx [NULL][ ifa_addr= ifa_dsta= ifa_mask= flags=0x%x, refcnt=%d, metric=%d rtentry=%p flags=0x%x refcnt=%d use=%ld expire=%ld rtableid %u key= mask= gw= ifp=%p (%s)(NULL) ifa=%p genmask= gwroute=%p llinfo=%p Route tree for AF_INET (not initialized) revarparptfreearpresolve: %s: route without link local address arpresolve: %s: can't allocate llinfo arp: ether address is broadcast for IP address %s! duplicate IP address %s sent from ethernet address %s arp: attempt to overwrite permanent entry for %s by %s on %s arp: attempt to overwrite entry for %s on %s by %s on %s arp info overwritten for %s by %s on %s arp: attempt to add entry for %s on %s by %s on %s arp_rtrequest: bad gateway value arp_rtrequest: malloc failed in_controlinvalid argument to in_lifaddr_ioctlIPv6 pcb passed into in_pcbconnectinpcbplin_pcbinit: hashinit failedin_pcbinit: hashinit failed for lportinterneticmp_do_exthdr: m_getptr failureicmp_redirect_timeout: bad route to timeouticmp_mtudisc_timeout: bad route to timeouticmp_erroricmp lenipqeplipqplip_initaeshmac-sha1deflate%d.%d.%d.%drip_attachrip_detachrip_usrreqsynpltcp_pulloutofbandm_pulldown malfunctiontcp_output REXMTtcp_outputtcpcbpltcpqepltcp_inittcp_usrrequdp_usrreqipip_input: should never reach herelibdes v 3.21 - 95/11/21 - eaycryptopcryptodesccrydevcuio_copyback: off %d < 0cuio_copyback: len %d < 0cuio_copyback: empty in skipuio_copyback: emptycuio_copydata: off %d < 0cuio_copydata: len %d < 0iov_copydata: empty in skipcuio_copydata: emptycuio_apply: len %d < 0cuio_apply: off %d < 0cuio_apply: ind %d >= uio_iovcnt %d for offcuio_apply: ind %d >= uio_iovcnt %d for lenSoftware crypto device cannot initialize!DES3DESBlowfishCAST-128Rijndael-128/AESAES-CTRAES-GCMAES-GMACAES-XTSARC4HMAC-MD5HMAC-SHA1HMAC-RIPEMD-160HMAC-SHA2-256HMAC-SHA2-384HMAC-SHA2-512GMAC-AES-128GMAC-AES-192GMAC-AES-256Keyed MD5Keyed SHA1MD5SHA1DeflateLZS1.2.3start = %d, len = %d, fs = %s ffs_alloccg: map corruptedbno = %lld, fs = %s ffs_alloccg: block not in mapffs_freefile: range: dev = 0x%x, ino = %d, fs = %sdev = 0x%x, ino = %u, fs = %s ffs_freefile: freeing free inodedev = 0x%x, bsize = %d, size = %ld, fs = %s ffs_blkfree: bad sizebad block %lld, ino %u uid %u on %s: %s bad blockdev = 0x%x, block = %lld, fs = %s ffs_blkfree: freeing free blockffs_blkfree: freeing free fragcg = %d, irotor = %d, fs = %s ffs_nodealloccg: map corruptedffs_nodealloccg: block not in mapffs_clusteralloc: lost blockmode = 0%o, inum = %d, fs = %s ffs_valloc: dup allocfree inode %s/%d had %lld blocks out of inodes %s: create/symlink failed, no inodes free dev = 0x%x, bsize = %d, bprev = %lld, fs = %s ffs_realloccg: bad bprevffs_realloccg: bad blocknodev = 0x%x, optim = %d, fs = %s ffs_realloccg: bad optimfile system full %s: write failed, file system is full ffs2_balloc: block too bigffs2_balloc: unwind failedffs1_balloc: blk too bigCould not unwind indirect block, error %dffs_indirtrunc: bad buffer sizeffs_truncate: newspaceffs_update: bad link cntsoftdep_flushfiles calledffsinodino1pldino2plupdate: rofs modffs_statfsWARNING: %s was not properly unmounted WARNING: R/W mount of %s denied. Filesystem is not clean - run fsck ffs_mountfs(): obsolete rotational table format, please use fsck_ffs(8) -c 1 ffs_reload: dirty1ffs_reload: dirty2WARNING: soft updates isn't compiled in ffs_mountroot: can't setup bdevvp's ffsffs_fsync: not dirtyffs_fsyncffs_write: nonsync dir writeffs_write: typecheckpath: .. not a directory First bad Second bad %s: bad dir ino %d at offset %d: %s bad dirufs_direnter: newblkufs_direnter: compact1ufs_direnter: compact2mangled entryi_ffs_size too smallufs_strategy: specufs_readdir: lost in spaceufs_rename: lost from startdirufs_rename: lost to startdirrename: EXDEVufs_rename: same fileufs_rename: lost dir entrychown: lost quotaifree: range: dev = 0x%x, ino = %d, fs = %sdev = 0x%x, ino = %d, fs = %s ifree: freeing free inodebad block %d, ino %d dev = 0x%x, block = %d, fs = %s mode = 0%o, nlinks %d, inum = %d, fs = %s ext2fs_valloc: dup allocext2fs_alloccg: map corruptedext2fs_mapsearch: block not in mapcg = %d, ipref = %d, fs = %s ext2fs_nodealloccg: map corruptedext2fs_nodealloccg: block not in mapext2fs_indirtrunc: bad buffer sizecheckpathrec_len is smaller than minimalrec_len % 4 != 0reclen is too small for name_lendirectory entry across blocksinode out of boundsbad directory entry: %s offset=%d, inode=%lu, rec_len=%d, name_len=%d ext2fs_dirbadentryi_size too smallext2fs_direnter: newblkext2fs_direnter: frag size%s: nonsync dir writeext2fs_write%s: typeExt2 fs: unsupported first inode positionExt2 fs: unsupported optional feature ext2fs_statfsext2fs_reload: dirty1ext2fs_reload: dirty2%s: file system not clean; please fsck(8) ext2fs_mountroot: can't setup bdevvp'sext2fsext2inoplext2dinoplext2fs_mkdir: blksizeext2fs_rename: lost from startdirext2fs_rename: lost to startdirrename: linked directoryext2fs_rename: lost dir entryext2fs_rename: mangled diramap_unadd: offset out of rangeamap_unadd: nothing thereamap_lookup: offset out of rangeamap_add: offset out of rangeamap_add: replacing null anonamap_add: slot in useamap_lookups: offset out of rangeamap_splitref: split at zero offsetamap_splitref: map size check failedamap_cow_now: non-resident wired page in anon %pcownowcownowpageamap_wipeout: corrupt amapamapplamap_pp_adjref: overshot targetamap_pp_adjref: negative reference countanonpluao_set_swslot: uobj = %p uao_set_swslot: attempt to set a slot on a NOSWAP objectuao_flush: strange, got an out of range flush (fixed) uaoflshuao_flush: weird flagsuao_detuaoeltplaobjpluao_create: kernel object already allocateduao_create: asked to enable swap on kernel objectuao_create: hashinit swhash faileduao_create: malloc swslots faileduao_getpageuao_getudv_faultudv_detachudv_attachuvm_fault_unwire_locked: address not in mapanonget1anonget2flt_noram1fltamapcopyflt_noram2flt_noram3flt_pmfail1fltagain2flt_noram4flt_noram5flt_pmfail2uvm_init: page size not setkm_free: unmanaged page 0x%lx km_allocvakmthreadvallocwaitkm_alloc1wkmallockm_pgrmuvm_km_suballoc: unable to allocate space in parent mapuvm_km_suballoc: unable to create submapuvm_km_suballoc: submap allocation faileduvm_km_init: could not reserve space for kerneluvm_km_pgremove_intrsafe: no pageMAP %p: [0x%lx->0x%lx] #ent=%d, sz=%u, ref=%d, version=%u, flags=0x%x pmap=%p(resident=%d) - %p: 0x%lx->0x%lx: obj=%p/0x%llx, amap=%p/%d submap=%c, cow=%c, nc=%c, prot(max)=%d/%d, inh=%d, wc=%d, adv=%d OBJECT %p: pgops=%p, npages=%d, refs= refs=%d PAGES : <%p,0x%llx> PAGE %p: flags=%b, vers=%d, wire_count=%d, pa=0x%llx uobject=%p, uanon=%p, offset=0x%llx loan_count=%d [page ownership tracking disabled] >>> ANON DOES NOT POINT HERE <<< (%p) anon backpointer is OK checking object list page found on object list >>> PAGE NOT FOUND ON OBJECT LIST! <<< page found in uvm_pmemrange >>> page not found in uvm_pmemrange <<< checking pageq list page found on pageq list >>> PAGE NOT FOUND ON PAGEQ LIST! <<< vmmaplkuvm_map_clean: weird flagsvmspplvmmpeplvmmpekpluvm_mapent_alloc: cannot allocate map entryuvm_mapent_alloc: out of static map entries fork: encountered a submap during fork (illegal)fork: non-copy_on_write map entry marked needs_copy (illegal)uvm_page_physget: called _after_ bootstrapuvm_page_physget: out of memory!uvm_setpagesize: page size not a power of twouvm_pglistalloc: Upper boundary 0x%lx not on pagemask. uvm_page_physdump: physical memory config [segs=%d of %d]: 0x%llx->0x%llx [0x%llx->0x%llx] STRATEGY = RANDOM uvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: pmap_growkernel() faileduvm_pageboot_alloc: out of memoryuvm_page_bootstrap: no memory pre-allocateduvm_page_init: lost %ld page(s) in inituvm_page_physload: page size not set!uvm_page_physload: start >= enduvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX uvm_page_physload: can not malloc vm_page structs for segment ignoring 0x%lx -> 0x%lx uvm_page_physload: tried to add RAM after vm_mem_initsize 0 uvm_pagereallocpagersegpgdaemonpagedaemon: deadlock detected! pmrwaituvm_wait: failed to free %ld pages between 0x%lx-0x%lx Ranges, use queue: * [0x%lx-0x%lx] use=%d nsegs=%ld maxsegsz[%d]=0x%lx free=0x%lx #ranges = %d uvm_pmr_split: lost one pmr Flags: 0x%x, will panic now. Current UVM status: pagesize=%d (0x%x), pagemask=0x%x, pageshift=%d %d VM pages: %d active, %d inactive, %d wired, %d free min %d%% (%d) anon, %d%% (%d) vnode, %d%% (%d) vtext pages %d anon, %d vnode, %d vtext freemin=%d, free-target=%d, inactive-target=%d, wired-max=%d faults=%d, traps=%d, intrs=%d, ctxswitch=%d fpuswitch=%d softint=%d, syscalls=%d, swapins=%d, swapouts=%d, kmapent=%d fault counts: noram=%d, noanon=%d, pgwait=%d, pgrele=%d ok relocks(total)=%d(%d), anget(retries)=%d(%d), amapcopy=%d neighbor anon/obj pg=%d/%d, gets(lock/unlock)=%d/%d cases: anon=%d, anoncow=%d, obj=%d, prcopy=%d, przero=%d daemon and swap counts: woke=%d, revs=%d, scans=%d, obscans=%d, anscans=%d busy=%d, freed=%d, reactivate=%d, deactivate=%d pageouts=%d, pending=%d, nswget=%d nswapdev=%d, nanon=%d, nanonneeded=%d nfreeanon=%d swpages=%d, swpginuse=%d, swpgonly=%d paging=%d kernel pointers: objs(kern)=%p warning: resource shortage: %d pages of swap lost swapdrum_addsw_reg_strategy: swap to sparse fileswstrategy: vnode type 0x%xswap_off: swapdev not in listswap0x%04xdisklabel regionswap_on: miniroot larger than swap?swap_on: unable to preserve minirootPreserved %d pages of miniroot leaving %d pages of swap swapmount: no device swapmount: no device 2 /dev/%s%d%cblkdev0x%xswapctl: miniroot copy failedswapctl: copystruvm_swap_init: can't get vnode for swap deviceswapmapuvm_swap_init: extent_create failedswp vnxswp vndswplkuvm_coredump: user process with submap?sbrk: grow %ld failed, error = %d uvm_deallocate with null mapuvn_iosyncuvn_getpageuvn_getuvn_cluster: offset out of rangeuvn_flshuvn_flush: obj=%p, offset=0x%llx. error during pageout. uvn_flush: WARNING: changes to page may be lost! uvn_flushuvn_termuvm_vnp_terminate: io sync wanted bit setuvn_attachuvnsyncNULL pointer passed to ip_ecn_egressNULL pointer passed to ip6_ecn_egressNULL pointer passed to ip_ecn_ingressNULL pointer passed to ip6_ecn_ingressin6_prefixlen2mask: invalid prefix length(%d) in6_are_prefix_equal: invalid prefix length(%d) in6_ifawithscope: output interface is not specified in6_savemkludge: no kludge spaceCouldn't unlink in6_ifaddr from in6_ifaddr in6_unlink_ifa: autoconf'ed address %p has no prefix ADDDELETEin6_ifloop_request: %s operation failed for %s (errno=%d) in6_purgeaddr: failed to remove a route to the p2p destination: %s on %s, errno=%d in6_update_ifa: a destination can be specified for a p2p or a loopback IF only in6_update_ifa: prefixlen should be 128 when dstaddr is specified in6_update_ifa: valid lifetime is 0 for %s in6_update_ifa: the prefix length of an existing (%s) address should not be changed in6_update_ifa: failed to remove a route to the old destination: %s in6_update_ifa: addmulti failed for %s on %s (errno=%d) prefix ioctls are now invalidated. please use ifconfig. nd6_prelist_add succeeded but no prefix invalid argument to in6_lifaddr_ioctl%s: didn't unlink in6ifaddr from list in6_ifattach_loopback: failed to configure the loopback address on %s (errno=%d) %s: got interface identifier from itself %s: got interface identifier from %s %s: borrow interface identifier from %s %s: interface identifier generated by random number %s: failed to get interface identifier %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x %s: no ifid available in6_ifattach_linklocal: failed to configure a link-local address on %s (errno=%d) in6_ifattach: %s has too small MTU, IPv6 not enabled in6_ifattach: %s is not multicast capable, IPv6 not enabled in6_cksum: mbuf len (%d) < off+len (%d+%d)in6_cksum: out of datainternet6icmp6_redirect_timeout: bad route to timeouticmp6_mtudisc_timeout: bad route to timeout(src=%s dst=%s tgt=%s)ICMP6 redirect sent from %s rejected; must be from linklocal ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s ICMP6 redirect rejected; no route found for redirect dst: %s ICMP6 redirect rejected; redirect dst must be unicast: %s ICMP6 redirect rejected; neither router case nor onlink case: %s icmp6_redirect_input: invalid ND option, rejected: %s icmp6_redirect_input: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s icmp6_notify_error: in6_embedscope failed sanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d ../../../../netinet6/icmp6.cicmp6_reflect: source can't be determined: dst=%s, error=%d ICMP6 checksum error(%d|%x) %s icmp6_input: unknown type %d(src=%s, dst=%s, ifid=%d) ENOBUFS in icmp6_error %d icmp6_mtudisc_callback_registerOpenBSD-currentip6_nexthdr: m == NULLip6_input: packet to an unready address %s->%s ip6_initcannot forward from %s to %s nxt %d received on %s cannot forward src %s, dst %s, nxt %d, rcvif %s, outif %s assumption failed: hdr not splitscope error in prefix list (%s) nd6_storelladdr: something odd happens nd6_storelladdr: sdl_alen == 0, dst=%s, if=%s nd6_init called more than once(ignored) ndopts == NULL in nd6_optionuninitialized ndopts in nd6_optionndopts == NULL in nd6_optionsuninitialized ndopts in nd6_optionsduplicated ND6 option found (type=%d) nd6_options: unsupported option %d - option ignored too many loop in nd opt unspecnd6_lookup: failed to lookup %s (if = %s) default router list contains a non-linklocal address(%s) a router(%s) advertises a prefix with non-link local address nd6_output: can't allocate llinfo for %s (ln=%p, rt=%p) nd6_rtrequest: bad gateway value: %s nd6_rtrequest: malloc failed %s: failed to join %s (errno=%d) ifp == NULL in nd6_cache_lladdrfrom == NULL in nd6_cache_lladdrndp info overwritten for %s by %s on %s ln->ln_rt == NULLln->ln_rt->rt_ifp == NULLrt_llinfo(%p) is not equal to ln(%p)dst=0 in nd6_timer(ln=%p)nd6_setmtu0: new link MTU on %s (%lu) is too small for IPv6 nd6_dad_duplicated: DAD structure not found %s: DAD detected duplicate IPv6 address %s: NS in/out=%d/%d, NA in=%d %s: DAD complete for %s - duplicate found %s: manual intervention required ifa == NULL in nd6_dad_na_inputifa == NULL in nd6_dad_ns_inputnd6_na_output: source can't be determined: dst=%s, error=%d nd6_ns_output: source can't be determined: dst=%s, error=%d nd6_dad_timer: called with null parameter nd6_dad_timer: DAD structure not found ???nd6_dad_timer: called with duplicated address %s(%s) nd6_dad_timer: called with non-tentative address %s(%s) %s: could not run DAD, driver problem? %s: DAD complete for %s - no duplicates found nd6_dad_start: called with non-tentative address %s(%s) nd6_dad_start: ifa->ifa_ifp == NULLnd6_dad_start: memory allocation failed for %s(%s) %s: starting DAD for %s nd6_na_input: invalid hlim (%d) from %s to %s on %s nd6_na_input: invalid target address %s nd6_na_input: a solicited adv is multicasted nd6_na_input: invalid ND option, ignored nd6_na_input: duplicate IP6 address %s nd6_na_input: ND packet from non-neighbor nd6_na_input: lladdrlen mismatch for %s (if %d, NA packet %d) nd6_ns_input: invalid hlim (%d) from %s to %s on %s nd6_ns_input: bad DAD packet (wrong ip6 dst) nd6_ns_input: NS packet from non-neighbor nd6_ns_input: bad NS target (multicast) nd6_ns_input: invalid ND option, ignored nd6_ns_input: bad DAD packet (link-layer address option) nd6_ns_input: lladdrlen mismatch for %s (if %d, NS packet %d) nd6_ns_input: duplicate IP6 address %s nd6_ns_input: src=%s nd6_ns_input: dst=%s nd6_ns_input: tgt=%s in6_init_prefix_ltimes: preferred lifetime(%d) is greater than valid lifetime(%d) in6_ifadd: wrong prefixlen for %s (prefix=%d ifid=%d) in6_ifadd: failed to make ifaddr %s on %s (errno=%d) nd6_prefix_onlink: %s/%d is already on-link nd6_prefix_onlink: failed to find any ifaddr to add route for a prefix(%s/%d) on %s nd6_prefix_onlink: failed to add route for a prefix (%s/%d) on %s, gw=%s, mask=%s, flags=%lx errno = %d nd6_prefix_offlink: %s/%d is already off-link nd6_prefix_offlink: failed to recover a prefix %s/%d from %s to %s (errno = %d) nd6_prefix_offlink: failed to delete route: %s/%d on %s (errno = %d) pfxlist_onlink_check: failed to make %s/%d offlink, errno=%d prelist_remove: failed to make %s/%d offlink on %s, errno=%d prelist_remove: negative count on %s nd6_prelist_add: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_update: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_update: nd6_prelist_add failed for %s/%d on %s errno=%d, returnpr=%p defrouter_select: called unexpectedly (forwarding=%d, accept_rtadv=%d) defrouter_select: more than one router is installed defrtrlist_del: negative count on %s nd6_ra_input: invalid hlim (%d) from %s to %s on %s nd6_ra_input: src %s is not link-local nd6_ra_input: invalid ND option, ignored nd6_ra_input: invalid option len %d for prefix information option, ignored nd6_ra_input: invalid prefix len %d for prefix information option, ignored nd6_ra_input: invalid prefix %s, ignored nd6_ra_input: invalid prefixlen %d for rfc2374 prefix %s, ignored nd6_ra_input: bogus mtu option mtu=%lu sent from %s, ignoring nd6_ra_input: bogus mtu mtu=%lu sent from %s; exceeds maxmtu %lu, ignoring nd6_ra_input: lladdrlen mismatch for %s (if %d, RA packet %d) nd6_rs_input: invalid hlim (%d) from %s to %s on %s nd6_rs_input: invalid ND option, ignored nd6_rs_input: lladdrlen mismatch for %s (if %d, RS packet %d) rip6_attachrip6_detachrip6_usrreq invalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchincorrect data checkincorrect length checkneed dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versiondb_fetch_reg: botch address 0x%08lx not a valid page address %p is invalid branch_taken: botchFaulted in DDB; continuing... spsrr0r1r2r3r4r5r6r7r8r9r10r11r12usr_spusr_lrsvc_spsvc_lrpcund_spabt_spirq_spframetrace: pid %d not found at %p scp=0x%08x rlv=0x%08x ( rsp=0x%08x rfp=0x%08x%sr%d=0x%08xBad frame pointer: %p Bad user frame pointer: %p frame address must be specified frame address = %08x spsr=%08x r0 =%08x r1 =%08x r2 =%08x r3 =%08x r4 =%08x r5 =%08x r6 =%08x r7 =%08x r8 =%08x r9 =%08x r10=%08x r11=%08x r12=%08x r13=%08x r14=%08x r15=%08x slr=%08x mainbusmainbus_bs_free(): Help!mainbus_bs_alloc(): Help!cpu, rrx, %s r%d, %s #%d%s%s#0x%08x[r%d][r%d%s, #0x%03x#0x%02x{r%d-r%d}^f%d#%scpsr_p%df%d, c%d, c%d, c%d, c%d, %dr%d, c%d, c%d, %d[%c - unknown]und%s %08x imbimbrangeswiblxblmulSnmsmlaSnmsdumullSdnmssmullumlalsmlalstrtdaWldrtstrbtldrbtstrldrstrbldrbstmYnWlldmXnWlldrsbldrhstrhldrshswpdmoswpbmrsdpmsrpFmpF2bxclzdmbkptSdn2eorsubrsbadcsbcrsctstDn2teqcmpcmnorrmovSd2bicmvnadfPRfghmufsufrsfdvfrdfpowrpwrmffmlfdvfrdpolfpbopmvfPRfhmnfrndsqtlgnexpsincostanasnacsatnfpuopstfQLvldffltPRgdfixPRdhwfsrfswfcrfccmfPRghcnfcmfecnfemcr2#zmcrmrc2mrccdp2#ycdpldc2L#vldcstc2stcNo support for this CPU type (%08x) in kernelcpu.branchpredictcpu.cachecpu.nocachexscale.branchpredictxscale.cachexscale.icachexscale.dcacheUndefined instruction in kernel real mem = %u (%uMB) avail mem = %lu (%uMB) Warning IRQ's disabled during boot() WARNING: not updating battery clock _bus_dmamap_load_raw: not implemented_bus_dmamem_map: size botch_bus_dmamap_sync: mix PRE and POST_bus_dmamap_sync: ARM32_BUFTYPE_INVALIDunknown buffer type %d _bus_dmamap_syncProcessor failed probe - no CPU ID %s %s (%s core)%s: IDC disabled IDC enabled DC disabled DC enabled IC disabled IC enabled WB disabled WB enabled LABT EABT branch prediction enabled%s: %dKB/%dB %d-way %s unified cache %s: %dKB(%db/l,%dway) I-cache, %dKB(%db/l,%dway) %s D-cache %s: %s does not fully support this CPU. %s: This kernel does not fully support this CPU. %s: Recompile with "options %s" to correct this. unknown CPU (ID = 0x%x)%s: SA-110 with bugged STM^ instruction ARM600ARM610ARM620ARM700ARM710ARM7500ARM710aARM7500FEARM710TARM720TARM740T (8 KB cache)ARM740T (4 KB cache)ARM810ARM920TARM922TARM926EJ-SARM940TARM946E-SARM966E-STI ARM925TARM1020EARM1022E-SSA-110SA-1100SA-1110IXP1200i80200i80321 400MHzi80321 600MHzi80219 400MHzi80219 600MHzPXA250PXA210PXA27xIXP425 533MHzIXP425 400MHzIXP425 266MHzARM1136J-SARM1136J-S R1ARM OMAP3[45]30ARM OMAP3530ARM OMAP3630/DM3730CPU_ARM2ARM2asCPU_ARM250CPU_ARM3CPU_ARM6CPU_ARM7CPU_ARM7TDMICPU_ARM8ARM9TDMIARM9E-SCPU_ARM9EARM9EJ-SARM10ECPU_ARM10SA-1CPU_SA110XScaleCPU_XSCALE_...ARM11JCPU_ARM11CPU_ARMv7wr-thruwr-back**unknown 3****unknown 4**wr-back-lockwr-back-lock-Awr-back-lock-B**unknown 8****unknown 9****unknown 10****unknown 11****unknown 12****unknown 13****unknown 14****unknown 15**rev 0rev 1rev 2rev 3rev 4rev 5rev 6rev 7rev 8rev 9rev 10rev 11rev 12rev 13rev 14rev 15step Jstep Kstep Sstep Tstep Bstep Cstep Dstep Erev 10step Gstep A-0step B-0step B-1step B-2step B-3step B-4step B-5(IXP1200 step A)(IXP1200 step B)(IXP1200 step C)(IXP1200 step D)(IXP1240/1250 step A)(IXP1240 step B)(IXP1250 step B)step A-1step C-0step D-0step ?step C-5step 0badaddr: invalid size (%lu)kernelFatal %s mode data abort: '%s' trapframe: %p FSR=%08x, FAR=Invalid, Fatal %s mode prefetch abort at 0x%08x trapframe: %p, spsr=%08x r0 =%08x, r1 =%08x, r2 =%08x, r3 =%08x r4 =%08x, r5 =%08x, r6 =%08x, r7 =%08x r8 =%08x, r9 =%08x, r10=%08x, r11=%08x r12=%08x, usp=%08x, ulr=%08xssp=%08x, slr=%08x, pc =%08x Fatal abort data_abort_fault: Misaligned Kernel-mode Program Counter Non-emulated page fault with intr_depth > 0 uvm_fault(%p, %lx, %x, 0) -> %x UVM: pid %d (%s), uid %d killed: out of swap Vector ExceptionAlignment Fault 1Terminal ExceptionAlignment Fault 3External Linefetch Abort (S)Translation Fault (S)External Linefetch Abort (P)Translation Fault (P)External Non-Linefetch Abort (S)Domain Fault (S)External Non-Linefetch Abort (P)Domain Fault (P)External Translation Abort (L1)Permission Fault (S)External Translation Abort (L2)Permission Fault (P)mmrwxscale_setup_minidata: can't find L2 table for VA 0x%08lxpmap_map_chunk: no L1 table providedpmap_map_chunk: no L2 table for VA 0x%08lxpmap_map_chunk: can't find L2 table for VA0x%08lxpmap_map_entry: no L2 table for VA 0x%08lxpmap_map_entry: can't find L2 table for VA 0x%08lxpmap_alloc_specials: no l2b for 0x%lxpmap_bootstrap: No L2 for L2 @ va %ppmap_init_l1: can't get PA of L1 at %pCannot allocate L1 KVMCannot allocate L1 physical pagespmap_bootstrap: No L2 for va 0x%x, pa 0x%lxpmap_bootstrap: out of static L2spmap_bootstrap: WARNING! wrong cache mode for L2 pte @ %p pmap_bootstrap: WARNING! wrong cache mode for primary L1 @ 0x%lx pmapplpvepll2dtblpll2ptpplpmap_enter: failed to allocate L2 bucketpmap_enter: no pv entries dump to dev %u,%u not possible dumping to dev %u,%u offset %ld dump area unavailable device bad device not ready area improper i/o error aborted from console succeeded vunmapbufvmapbufcan't init serial console @%lxunknown option `%c' cpu not recognized! OpenBSD/armish booting ... initarm: Configuring system ... physmemory: %d pages at 0x%08lx -> 0x%08lx initarm: out of memoryinitarm: Failed to align the kernel page directoryWARNING: powerdown failed! The operating system has halted. Please press any key to reboot. rebooting... boot device: lookup '%s' failed. boot device: %s cdDiagnostic Failure on Component 0x%02xTagged Overlapped Commands (0x%02x = TASK TAG)Decompression Exception Short Algorithm ID OF 0x%02xASC 0x%02x ASCQ 0x%02xCDBParametersError in %s, Offset %d, bit %dActual Retry Count: %dProgress Indicator: %dprobe%s(%s:%d:%d): %sCheck Condition (error %#x) on opcode 0x%x AT BLOCK #: %d (decimal) SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO: 0x%x (VALID flag %s) COMMAND INFO: 0x%x ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s DEFERRED scbusyunknown error category (0x%x) from scsi driver scsi_done called twice on xs(%p)unexpected xsh state %usyncxspendxsscsiiomvscsi_xfer pool exhausted! scxsplscsiplugscsi_cmd_rw_decode: bad opcode 0x%02xNo Additional SenseSoft ErrorNot ReadyMedia ErrorHardware ErrorIllegal RequestUnit AttentionWrite ProtectedBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare ErrorNo Additional Sense InformationFilemark DetectedEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnCleaning RequestedErase Operation In ProgressLocate Operation In ProgressRewind Operation In ProgressSet Capacity Operation In ProgressVerify Operation In ProgressNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Not Ready, Rebuild In ProgressLogical Unit Not Ready, Recalculation In ProgressLogical Unit Not Ready, Operation In ProgressLogical Unit Not Ready, Long Write In ProgressLogical Unit Not Ready, Self-Test In ProgressLogical Unit Not Accessible, Asymmetric Access State TransitionLogical Unit Not Accessible, Target Port In Standby StateLogical Unit Not Accessible, Target Port In Unavailable StateLogical Unit Not Ready, Structure Check RequiredLogical Unit Not Ready, Auxiliary Memory Not AccessibleLogical Unit Not Ready, Notify (Enable Spinup) RequiredLogical Unit Not Ready, OfflineLogical Unit Not Ready, SA Creation In ProgressLogical Unit Not Ready, Space Allocation In ProgressLogical Unit Not Ready, Robotics DisabledLogical Unit Not Ready, Configuration RequiredLogical Unit Not Ready, Calibration RequiredLogical Unit Not Ready, A Door Is OpenLogical Unit Not Ready, Operating In Sequential ModeLogical Unit Not Ready, Start Stop Unit Command In ProgressLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorLogical Unit Communication CRC Error (ULTRA-DMA/32)Unreachable Copy TargetTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureHead Select FaultError Log OverflowWarningWarning - Specified Temperature ExceededWarning - Enclosure DegradedWarning - Background Self-Test FailedWarning - Background Pre-Scan Detected Medium ErrorWarning - Background Medium Scan Detected Medium ErrorWarning - Non-Volatile Cache Now VolatileWarning - Degraded Power To Non-Volatile CacheWarning - Power Loss ExpectedWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedWrite Error - Recommend ReassignmentCompression Check Miscompare ErrorData Expansion Occurred During CompressionBlock Not CompressibleWrite Error - Recovery NeededWrite Error - Recovery FailedWrite Error - Loss Of StreamingWrite Error - Padding Blocks AddedAuxiliary Memory Write ErrorWrite Error - Unexpected Unsolicited DataWrite Error - Not Enough Unsolicited DataDefects In Error WindowError Detected By Third Party Temporary InitiatorThird Party Device FailureCopy Target Device Not ReachableIncorrect Copy Target Device TypeCopy Target Device Data UnderrunCopy Target Device Data OverrunInvalid Information UnitInformation Unit Too ShortInformation Unit Too LongID CRC Or ECC ErrorLogical Block Guard Check FailedLogical Block Application Tag Check FailedLogical Block Reference Tag Check FailedLogical Block Protection Error On Recover Buffered DataLogical Block Protection Method ErrorUnrecovered Read ErrorRead Retries ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block ReadNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite The DataDe-Compression CRC ErrorCannot Decompress Using Declared AlgorithmError Reading UPC/EAN NumberError Reading ISRC NumberRead Error - Loss Of StreamingAuxiliary Memory Read ErrorRead Error - Failed Retransmission RequestRead Error - LBA Marked Bad By Application ClientAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRecord Not Found - Recommend ReassignmentRecord Not Found - Data Auto-ReallocatedLocate Operation FailureRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorData Sync Error - Data RewrittenData Sync Error - Recommend RewriteData Sync Error - Data Auto-ReallocatedData Sync Error - Recommend ReassignmentRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data Without ECC - Data RewrittenRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With L-ECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteRecovered Data With ECC - Data RewrittenRecovered Data With LinkingDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationMiscompare Verify Of Unmapped LbaRecovered ID with ECCPartial Defect List TransferInvalid Command Operation CodeAccess Denied - Initiator Pending-EnrolledAccess Denied - No Access rightsAccess Denied - Invalid Mgmt ID KeyIllegal Command While In Write Capable StateObsoleteIllegal Command While In Explicit Address ModeIllegal Command While In Implicit Address ModeAccess Denied - Enrollment ConflictAccess Denied - Invalid LU IdentifierAccess Denied - Invalid Proxy TokenAccess Denied - ACL LUN ConflictIllegal Command When Not In Append-Only ModeLogical Block Address Out of RangeInvalid Element AddressInvalid Address For WriteInvalid Write Crossing Layer JumpIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBCDB Decryption ErrorSecurity Audit Value FrozenSecurity Working Key FrozenNonce Not UniqueNonce Timestamp Out Of RangeInvalid XCDBLogical Unit Not SupportedInvalid Field In Parameter ListThreshold Parameters Not SupportedInvalid Release Of Persistent ReservationData Decryption ErrorToo Many Target DescriptorsUnsupported Target Descriptor Type CodeToo Many Segment DescriptorsUnsupported Segment Descriptor Type CodeUnexpected Inexact SegmentInline Data Length ExceededInvalid Operation For Copy Source Or DestinationCopy Segment Granularity ViolationInvalid Parameter While Port Is EnabledInvalid Data-Out Buffer Integrity Check ValueData Decryption Key Fail Limit ReachedIncomplete Key-Associated Data SetVendor Specific Key Reference Not FoundHardware Write ProtectedLogical Unit Software Write ProtectedAssociated Write ProtectPersistent Write ProtectPermanent Write ProtectConditional Write ProtectSpace Allocation Failed Write ProtectNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedFormat-Layer May Have ChangedImport/Export Element Accessed, Medium ChangedPower On, Reset, or Bus Device Reset OccurredPower On OccurredSCSI Bus Reset OccurredBus Device Reset Function OccurredDevice Internal ResetTransceiver Mode Changed to Single EndedTransceiver Mode Changed to LVDI_T Nexus Loss OccurredMode Parameters ChangedLog Parameters ChangedReservations PreemptedReservations ReleasedRegistrations PreemptedAsymmetric Access State ChangedImplicit Asymmetric Access State Transition FailedPriority ChangedCapacity Data Has ChangedError History I_T Nexus ClearedError History Snapshot ReleasedError Recovery Attributes Have ChangedData Encryption Capabilities ChangedTimestamp ChangedData Encryption Parameters Changed By Another I_T NexusData Encryption Parameters Changed By Vendor Specific EventData Encryption Key Instance Counter Has ChangedSA Creation Capabilities Data Has ChangedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedCurrent Program Area Is Not EmptyCurrent Program Area Is EmptyIllegal Power Condition RequestPersistent Prevent ConflictPrevious Busy StatusPrevious Task Set Full StatusPrevious Reservation Conflict StatusPartition Or Collection Contains User ObjectsNot ReservedORWrite Generation Does Not MatchOverwrite Error On Update In PlaceInsufficient Time For OperationCommands Cleared By Another InitiatorCommands Cleared By Power Loss NotificationCommands Cleared By Device ServerIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledCannot Write Medium - Unknown FormatCannot Write Medium - Incompatible FormatCannot Format Medium - Incompatible MediumCleaning FailureCannot Write - Application Code MismatchCurrent Session Not Fixated For AppendCleaning Request RejectedMedium Not FormattedIncompatible Volume TypeIncompatible Volume QualifierCleaning Volume ExpiredMedium Format CorruptedFormat Command FailedZoned Formatting Failed Due To Spare LinkingNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorEnclosure FailureEnclosure Services FailureUnsupported Enclosure FunctionEnclosure Services UnavailableEnclosure Services Transfer FailureEnclosure Services Transfer RefusedRibbon, Ink, or Toner FailureRounded ParameterEvent Status NotificationESN - Power Management Class EventESN - Media Class EventESN - Device Busy Class EventSaving Parameters Not SupportedMedium Not PresentMedium Not Present - Tray ClosedMedium Not Present - Tray OpenMedium Not Present - LoadableMedium Not Present - Medium Auxiliary Memory AccessibleSequential Positioning ErrorTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyEnd Of Medium ReachedMedium Magazine Not AccessibleMedium Magazine RemovedMedium Magazine InsertedMedium Magazine LockedMedium Magazine UnlockedMechanical Positioning Or Changer ErrorRead Past End Of User ObjectElement DisabledElement EnabledData Transfer Device RemovedData Transfer Device InsertedInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetLogical Unit FailureTimeout On Logical UnitLogical Unit Failed Self-TestLogical Unit Unable To Update Self-Test LogTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has Changedcomponent Device AttachedDevice Identifier ChangedRedundancy Group Created Or ModifiedRedundancy Group DeletedSpare Created Or ModifiedSpare DeletedVolume Set Created Or ModifiedVolume Set DeletedVolume Set DeassignedVolume Set ReassignedReported LUNs Data Has ChangedEcho Buffer OverwrittenMedium LoadableMedium Auxiliary Memory AccessibleiSCSI IP Address AddediSCSI IP Address RemovediSCSI IP Address ChangedRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureATA Device Failed Set FeaturesSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorData Phase CRC Error DetectedSCSI Parity Error Detected During ST Data PhaseInformation Unit iuCRC Error DetectedAsynchronous Information Protection Error DetectedProtocol Service CRC ErrorPHY Test Function In ProgressSome Commands Cleared By iSCSI Protocol EventInitiator Detected Error Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorInvalid Target Port Transfer Tag ReceivedToo Much Write DataACK/NAK TimeoutNAK ReceivedData Offset ErrorInitiator Response TimeoutConnection LostLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureErase Failure - Incomplete Erase Operation DetectedCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedMedium Removal Prevented By Data Transfer ElementMedium Thread Or Unthread FailureVolume Identifier InvalidVolume Identifier MissingDuplicate Volume IdentifierElement Status UnknownSCSI To Host System Interface FailureSystem Resource FailureSystem Buffer FullInsufficient Reservation ResourcesInsufficient ResourcesInsufficient Registration ResourcesInsufficient Access Control ResourcesAuxiliary Memory Out Of SpaceQuota ErrorMaximum Number Of Supplemental Decryption Keys ExceededMedium Auxiliary Memory Not AccessibleData Currently UnavailableInsufficient Power For OperationUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change InputOperator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedFailure Prediction Threshold ExceededMedia Failure Prediction Threshold ExceededLogical Unit Failure Prediction Threshold ExceededSpare Area Exhaustion Prediction Threshold ExceededHardware Impending Failure General Hard Drive FailureHardware Impending Failure Drive Error Rate Too HighHardware Impending Failure Data Error Rate Too HighHardware Impending Failure Seek Error Rate Too HighHardware Impending Failure Too Many Block ReassignsHardware Impending Failure Access Times Too HighHardware Impending Failure Start Unit Times Too HighHardware Impending Failure Channel ParametricsHardware Impending Failure Controller DetectedHardware Impending Failure Throughput PerformanceHardware Impending Failure Seek Time PerformanceHardware Impending Failure Spin-Up Retry CountHardware Impending Failure Drive Calibration Retry CountController Impending Failure General Hard Drive FailureController Impending Failure Drive Error Rate Too HighController Impending Failure Data Error Rate Too HighController Impending Failure Seek Error Rate Too HighController Impending Failure Too Many Block ReassignsController Impending Failure Access Times Too HighController Impending Failure Start Unit Times Too HighController Impending Failure Channel ParametricsController Impending Failure Controller DetectedController Impending Failure Throughput PerformanceController Impending Failure Seek Time PerformanceController Impending Failure Spin-Up Retry CountController Impending Failure Drive Calibration Retry CountData Channel Impending Failure General Hard Drive FailureData Channel Impending Failure Drive Error Rate Too HighData Channel Impending Failure Data Error Rate Too HighData Channel Impending Failure Seek Error Rate Too HighData Channel Impending Failure Too Many Block ReassignsData Channel Impending Failure Access Times Too HighData Channel Impending Failure Start Unit Times Too HighData Channel Impending Failure Channel ParametricsData Channel Impending Failure Controller DetectedData Channel Impending Failure Throughput PerformanceData Channel Impending Failure Seek Time PerformanceData Channel Impending Failure Spin-Up Retry CountData Channel Impending Failure Drive Calibration Retry CountServo Impending Failure General Hard Drive FailureServo Impending Failure Drive Error Rate Too HighServo Impending Failure Data Error Rate Too HighServo Impending Failure Seek Error Rate Too HighServo Impending Failure Too Many Block ReassignsServo Impending Failure Access Times Too HighServo Impending Failure Start Unit Times Too HighServo Impending Failure Channel ParametricsServo Impending Failure Controller DetectedServo Impending Failure Throughput PerformanceServo Impending Failure Seek Time PerformanceServo Impending Failure Spin-Up Retry CountServo Impending Failure Drive Calibration Retry CountSpindle Impending Failure General Hard Drive FailureSpindle Impending Failure Drive Error Rate Too HighSpindle Impending Failure Data Error Rate Too HighSpindle Impending Failure Seek Error Rate Too HighSpindle Impending Failure Too Many Block ReassignsSpindle Impending Failure Access Times Too HighSpindle Impending Failure Start Unit Times Too HighSpindle Impending Failure Channel ParametricsSpindle Impending Failure Controller DetectedSpindle Impending Failure Throughput PerformanceSpindle Impending Failure Seek Time PerformanceSpindle Impending Failure Spin-Up Retry CountSpindle Impending Failure Drive Calibration Retry CountFirmware Impending Failure General Hard Drive FailureFirmware Impending Failure Drive Error Rate Too HighFirmware Impending Failure Data Error Rate Too HighFirmware Impending Failure Seek Error Rate Too HighFirmware Impending Failure Too Many Block ReassignsFirmware Impending Failure Access Times Too HighFirmware Impending Failure Start Unit Times Too HighFirmware Impending Failure Channel ParametricsFirmware Impending Failure Controller DetectedFirmware Impending Failure Throughput PerformanceFirmware Impending Failure Seek Time PerformanceFirmware Impending Failure Spin-Up Retry CountFirmware Impending Failure Drive Calibration Retry CountFailure Prediction Threshold Exceeded (false)Low Power Condition OnIdle Condition Activated By TimerStandby Condition Activated By TimerIdle Condition Activated By CommandStandby Condition Activated By CommandIDLE_B Condition Activated By TimerIDLE_B Condition Activated By CommandIDLE_C Condition Activated By TimerIDLE_C Condition Activated By CommandSTANDBY_Y Condition Activated By TimerSTANDBY_Y Condition Activated By CommandPower State Change To ActivePower State Change To IdlePower State Change To StandbyPower State Change To SleepPower State Change To Device ControlLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackPacket Does Not Fit In Available SpaceIllegal Mode For This TrackInvalid Packet SizeVoltage FaultAutomatic Document Feeder Cover UpAutomatic Document Feeder Lift UpDocument Jam In Automatic Document FeederDocument Miss Feed Automatic In Document FeederConfiguration FailureConfiguration Of Incapable Logical Units FailedAdd Logical Unit FailedModification Of Logical Unit FailedExchange Of Logical Unit FailedRemove Of Logical Unit FailedAttachment Of Logical Unit FailedCreation Of Logical Unit FailedAssign Failure OccurredMultiply Assigned Logical UnitSet Target Port Groups Command FailedATA Device Feature Not EnabledLogical Unit Not ConfiguredData Loss On Logical UnitMultiple Logical Unit FailuresParity/Data MismatchInformational, Refer To LogState Change Has OccurredRedundancy Level Got BetterRedundancy Level Got WorseRebuild Failure OccurredRecalculate Failure OccurredCommand To Logical Unit FailedCopy Protection Key Exchange Failure - Authentication FailureCopy Protection Key Exchange Failure - Key Not PresentCopy Protection Key Exchange Failure - Key Not EstablishedRead Of Scrambled Sector Without AuthenticationMedia Region Code Is Mismatched To Logical Unit RegionDrive Region Must Be Permanent/Region Reset Count ErrorDecompression Exception Long Algorithm IDSession Fixation ErrorSession Fixation Error Writing Lead-InSession Fixation Error Writing Lead-OutSession Fixation Error - Incomplete Track In SessionEmpty Or Partially Written Reserved TrackNo More Track Reservations AllowedRMZ Extension Is Not AllowedNo More Test Zone Extensions Are AllowedCD Control ErrorPower Calibration Area ErrorProgram Memory Area Update FailureProgram Memory Area Is FullRMA/PMA Is Almost FullCurrent Power Calibration Area Almost FullCurrent Power Calibration Area Is FullRDZ Is FullSecurity ErrorUnable To Decrypt DataUnencrypted Data Encountered While DecryptingIncorrect Data Encryption KeyCryptographic Integrity Validation FailedError Decrypting DataUnknown Signature Verification KeyEncryption Parameters Not UseableDigital Signature Validation FailureEncryption Mode Mismatch On ReadEncrypted Block Not Raw Read EnabledIncorrect Encryption ParametersUnable To Decrypt Parameter ListEncryption Algorithm DisabledSA Creation Parameter Value InvalidSA Creation Parameter Value RejectedInvalid SA UsageData Encryption Configuration PreventedSA Creation Parameter Not SupportedAuthentication FailedExternal Data Encryption Key Manager Access ErrorExternal Data Encryption Key Manager ErrorExternal Data Encryption Key Not FoundExternal Data Encryption Request Not AuthorizedExternal Data Encryption Control TimeoutExternal Data Encryption Control ErrorLogical Unit Access Not AuthorizedSecurity Conflict In Translated DeviceXS_SHORTSENSE scsibus at %sscsibusprint: qualifier == SID_QUAL_RSVDscsibusprint: qualifier == SID_QUAL_BAD_LUdirectsequentialprinterprocessorcdromwormscanneropticalchangercommunicationenclosure servicessimplified directscsibusprint: device type T_NODEVICEvendor-unique targ %d lun %d: <%s, %s, %s> ATAPISCSI%dremovablefixed %d/%s %s%s naa. eui. t10. serial.~ offline: %d targets, initiator %d, WWPN %016llx, WWNN %016llx%s: unable to register bio scsibusPLEXTORCD-ROM PX-40TS1.01MICROP 1588-15MBSUN0669DEC RZ55 (C) DECEMULEX MD21/S2 ESDIA00IBMRAID 0662SIBM 0663HIBM0664H3171-S2KZ-CDFRSS2FQUANTUM ELS85S iomegajaz 1GBMICROP4421-07SEAGATEST150176LW0002HPC3725SDCASSONY SDT-5000 3.WangDAT Model 1300 02.4Model 2600 01.7Model 3200 02.2CR-2801TE1.07CREATIVECD3630EAC101FX320Sq01GCD-R580B1.00MATSHITA CR-5741.021.06Memorex CRW-26421.0gSANYO CRD-256PSANYO CRD-254PSANYO CRD-S54P1.08CD-ROM CDR-S11.70CD-ROM CDR-N161.25UJDCD87301.14ATAPI CD-ROMSCSI CD-ROMNEC CD-ROM DRIVE:260SCSI opticalSCSI disk%s %s(unknown)%s: %lldMB, %lu bytes/sector, %lld sectors, thin%s: WARNING: unable to establish shutdown hook softintr_establish: unknown soft IPL %d"%s" at %s addr 0x%xiiclm75alm75lm77eeprommax1617xeontemplm93lm81lm87adm9240adt7470adt7476adt7475adt7462adt7466adt7467adm1033adm1034adm1030adm1031adm1025adm1024adm1023adm1028adm1022thmc5047m192sch5027emc6w201asc7611asc7621ne1619ds1780adt7460adm1027lm85adt7516lm63lm86lm89lm89-1lm90gl523smadt7461adm1021adm1032g781g781-1max6690max6646max6657max6642tmp401sa56004xw83791sdw83627dhgw83792dw83781dw83627hfw83782das99127fw83783sw83791dw83l784rw83l785rw83l785ts-lf75375asb100gl518smadm1026se97max6604mcp9805mcp98242mcp98243adt7408cat34ts02lis331dlit8712lm96000emc6d100sch5017it8712f-amtp008w83795gw83793gstts424e02%s: addr 0x%x %02x=%02x words %02x=%04x: %s%s: ricohrtc_clock_write: failed to write rtc %s: ricohrtc_clock_read: failed to read rtc %s: ricohrtc_reg_write: failed to write reg%d : RICOH RS5C372[AB] Real-time Clock ricohrtc: F75375 rev %d.%dVcc, unable to register update task unable to read reg %d fintek: PCA9532 LED controller pcaledi80321_mem_bs_free(): not implementedi80321_mem_bs_alloc(): not implementedi80321_io_bs_free(): not implementedi80321_io_bs_alloc(): not implementedpciiopaauiopiiciopmuiopwdogi80321_intr_establish: IRQ %d out of rangei80321intcresettodr: failed to set time WARNING: preposterous time in file system WARNING: preposterous clock chip time lostgainedWARNING: clock %s %ld days WARNING: CHECK AND RESET THE DATE! clockstattcr1: I2C controller %s: unable to subregion registers, error = %d iopiiclkattempting reset %s: unable to map VERDE registers%s: unable to subregion MCU registers%s: unable to subregion ATU registers%s: unable to map IOW registers: i80321 I/O Processor %s: unable to map PLD registersiopxs%03d:%02d:%d %04x:%04x WARNING: unknown PCI device header. mem %02xh %s 0x%08x 0x%08x NGOK [%s] Resource conflict. No available resources. fixup failed pci_addr_fixup: fixup failed. (new address=%#lx) new address 0x%08lx PCI I/O memory spacePCI I/O port space[%s]----------------------- device vendor product register space address size -------------------------------------------- System BIOS Setting--------------------------[%3d devices bogus] PCIBIOS fixup stageirq %diq80321_pci_intr_map: no mapping for %d/%d/%d (%d, %d, %d) board id failed Thecus Nx100I/O Data HDL-GCertance CP3100 addr 0x%08lx intr %dobio_bs_free(): not implementedobio_bs_alloc(): not implemented: failed to map registers: %d %s: unable to establish interrupt at CPLD irq %d com_obio%s: standby command didn't complete %s: standby command timeout %s: standby command: drive fault %s: flush cache command didn't complete %s: flush cache command timeout %s: flush cache command: drive fault ST506wd_get_params: bad return code from ata_get_paramsST506/MFM/RLLESDI/IDE disk__wdstart: bad return code from wdc_ata_bio()device faultdevice timeout, retrying %s: soft error (corrected) %s: IDENTIFY failed : <%s> %s: %d-sector PIO, LBA48, %lluMB, %llu sectors LBA, %lluMB, %llu sectors CHS, %lluMB, %d cyl, %d head, %d sec, %llu sectors %s: enable look ahead command didn't complete %s: enable write cache command didn't complete %s: freeze lock command didn't complete wddump: try againwddump: polled command has been queuedwddump: device timed outwddump: drive faultwddump: DMA errorwddump: %swddump: unknown error type%s:%d:%d: bad state %d in _wdc_ata_bio_start _wdc_ata_bio_start: bad state%s:%d:%d: timeout waiting for DRQ, st=0x%b, err=0x%02x BSYDRDYDWFDSCDRQCORRIDXERR%s:%d:%d: not ready, st=0x%b, err=0x%02x wdc_ata_ctrl_intr: state==RECALpiomodedmamodegeometrysetmultirecal%s:%d:%d: %s timed out %s:%d:%d: %s drive fault error (%x) %s:%d:%d: bad state %d in wdc_ata_bio_intr wdc_ata_bio_intr: bad state%s:%d:%d: device timeout, c_bcount=%d, c_skip%d %s:%d:%d: intr with DRQ (st=0x%b) %s:%d:%d: read intr before drq error not notifiedno media/write protectedaborted commandmedia change requestedid not foundmedia changeduncorrectable data errorinterface CRC erroraddress mark not foundtrack 0 not foundbad block detectedwsevent_read%s: event queue overflow wskbd at %swskdetwskbd_detach: %s didn't detach mux %dcannot load keymap: console keyboard%s: attach error=%d wskbdwskbd_get_mapentry: %d(%d): bad entrywskbd_load_keymap: %d: recursion too deepwskbd_load_keymap: %d(%d): bad entrywsmouse at %swsmdetwsmouse_detach: %s didn't detach attach error=%dwsmousewsmux_getmux: no memory for mux %d wsmux: attach out of memory usb at %sendtaskusbatskusbtskunable to create usb abort task threadusbtaskunable to create usb task thread: USB revision %s, not supported %s: can't register softintr %s: root device is not a hub %s: root hub problem, error=%d pre 1.01.12.0usbusb_desc_iter_next: bad descriptor usb_desc_iter_next: descriptor length = 0 usb_desc_iter_next: descriptor length too large usbd_start_next: error=%d usbd_transfer: not doneusbsynusbrefusbpalockusbdetusb_detach_wait: %s didn't detach out of dataiface desc0 lengthusbd_fill_iface_data: bad descriptor(s): %s usbdly%s: device addr %d (config %d) exceeds power budget, %d mA > %d mA %s: port %d, set config at addr %d failed %s: No free USB addresses, new device ignored. usbd_new_device: cannot find HS port%x.%02xvendor 0x%04x"%s %s", class %d/%d rev / addr %d port %d configuration %d interface %dNORMAL_COMPLETIONIN_PROGRESSPENDING_REQUESTSNOT_STARTEDINVALNOMEMCANCELLEDBAD_ADDRESSIN_USENO_ADDRSET_ADDR_FAILEDNO_POWERTOO_DEEPIOERRORNOT_CONFIGUREDTIMEOUTSHORT_XFERSTALLEDINTERRUPTEDXXX%s: illegal enable change, port %d %s: port error, restarting port %d %s: port error, giving up port %d %s: strange, connected port %d has no power %s: port %d reset failed %s: device problem, disabling port %d %s: hub depth (%d) exceeded, hub ignored %s: no ports, hub ignored %s: bus powered hub connected to bus powered hub, ignored %s: no interface handle %s: no endpoint descriptor %s: bad interrupt endpoint %s: cannot open interrupt pipe %s: port %d power on failed, %s uhubucom at %s portno %d%s: lost %d chars %s: read start failed , %sucomlkucomugenwbugenwiugenriugenrb%s: secondary, not changing config to %d %s: setting configuration index 0 failed %s: setting configuration %d failed ugenBAD LENGTH %d Main bTag=%d Global bTag=%d Local bTag=%d default bType=%d uhidevwiuhidev_intr: bad repid %d uhid at %s reportid %d%s: could not read endpoint descriptor %s: unexpected endpoint %s: no input interrupt endpoint %s: no report descriptor %s: iclass %d/%d, %d report id%s%s: no memory uhidevuhidrea: input=%d, output=%d, feature=%d uhidno usable key codes array%s: was console keyboard ukbd: %d button%s, Z dir, W dir, Z and W dir %s: mouse has no X report %s: X report 0x%04x not supported %s: mouse has no Y report %s: Y report 0x%04x not supported ums%s: got polled xfer %p, but %p already pending %s: CBI bulk-in/out stall clear failed, %s %s: CBI intr-in stall clear failed, %s %s: CBI reset failed, %s %s: CBI bulk-in stall clear failed, %s %s: CBI bulk-out stall clear failed, %s %s: Unknown state %d%s: BBB bulk-%s stall clear failed, %s %s: Invalid CSW: sig 0x%08x should be 0x%08x %s: Invalid CSW: tag %d should be %d %s: Invalid CSW: status %d > %d %s: Phase Error, residue = %d %s: transferred %d bytes instead of %d bytes%s: BBB reset failed, %s %s: BBB bulk-in clear stall failed, %s %s: BBB bulk-out clear stall failed, %s Bulk-OnlyCBICBI with CCIISD-ATARBCSCSIUFI%s: using %s over %s %s: isdata not configured %s: command protocol=0x%x not supported %s: bus attach failed umass%s: Unknown status %d in umass_scsi_cbumass_cmd: large datalen, %d %04x%04x%s: failed to set configuration, err=%s : failed to get interface, err=%s %s: device is neither visor nor palm %s: init failed, %s GenericDebuggerHotSyncRemote File System%s: no proper endpoints for port %d (%d,%d) uvisor%s: open rx pipe failed: %s %s: open tx pipe failed: %s %s: open intr pipe failed: %s %s: aue_send error=%s %s: usb error on tx: %s %s: %u usb errors on intr: %s %s: no memory for rx list -- packet dropped! %s: %u usb errors on rx: %s %s: reset failed %s: abort rx pipe failed: %s %s: close rx pipe failed: %s %s: abort tx pipe failed: %s %s: close tx pipe failed: %s %s: abort intr pipe failed: %s %s: close intr pipe failed: %s %s: tx list init failed %s: rx list init failed %s: MII read timed out %s: EEPROM read timed out %s: setting config no failed auemii%s: getting interface handle failed %s: couldn't get endpoint descriptor %d %s: missing endpoint %s: address %s aue%s: usb errors on rx: %s axe%d: abort rx pipe failed: %s axe%d: close rx pipe failed: %s axe%d: abort tx pipe failed: %s axe%d: close tx pipe failed: %s axe%d: abort intr pipe failed: %s axe%d: close intr pipe failed: %s axe%d: usb error on tx: %s axe%d: watchdog timeout axemii%s: couldn't get ep %d no valid PHY address found, assuming PHY address 0 AX88178 AX88772 AX88172axe%d: rx list init failed axe%d: tx list init failed axe%d: open rx pipe failed: %s axe%d: open tx pipe failed: %s %s: media change failed axe%d: write PHY failed axe%d: read PHY failed axe%s: cue_send error=%s %s: read MAC address failed cue%s: kue_send error=%s %s: warm boot, no firmware download kue%s: failed loadfirmware of file %s: errno %d %s: cold boot, downloading firmware %s: failed to load code segment: %s %s: failed to load fixup segment: %s %s: failed to load trigger segment: %s %s: loading firmware failed %s: could not read Ethernet descriptor %s: no memory for multicast filter buffer %s: usb error on rx: %s %s: too many errors, disabling %s: open interrupt pipe failed: %s %s: abort interrupt pipe failed: %s %s: close interrupt pipe failed: %s extra ethernet descriptor %s: no data interface %s: no descriptor for interrupt endpoint %d %s: interface alternate setting %d failed %s: no descriptor for bulk endpoint %d %s: could not find data bulk in %s: could not find data bulk out cdce%s: udav_send error=%s udavmiiudav%s: upl_send error=%s upl%s: url_send error=%s %s: %s: bad register %04x urlmii%s: failed to get interface, err=%s %s: couldn't get endpoint %d url%s: Invalid notification length! (%d) %s: abort notify pipe failed: %s %s: close notify pipe failed: %s no %s: data interface %d, has %sCM over data, has %sbreak %s: no endpoint descriptor for %d %s: Could not find data bulk in %s: Could not find data bulk out %s: could not set data multiplex mode %s: status change notification available umodem%s: failed to set configuration, err=%s uftdi%s: failed to get configuration descriptor %s: failed to get device descriptor %s: failed to get interface, err=%s %s: Could not find interrupt in %s: failed to get second interface, err=%s %s: reset failed, %s uplcom %s: failed to set configuration, err=%s umct%s: uvscom_intr: abnormal status: %s %s: uvscom_set_line_coding: %s %s: uvscom_set_line: %s %s: uvscom_shutdown: %s %s: uvscom_readstat: %s %s: cannot open interrupt pipe (addr %d) uvsopuvscom%s: this device is using CDC notify message in intr pipe. Please send your dmesg to , thanks. %s: intr buffer 0x%x 0x%x 0x%x 0x%x 0x%x 0x%x 0x%x %s:notify serial state, len=%d, data=0x%02x %s: ubsa_request: %s %s: failed to set configuration: %s %s: failed to get interface: %s ubsa%s: unhandled set request: reg=%x onoff=%x %s: no proper endpoints found (%d,%d) uipaqumsm%s: this device is not using CDC notify message in intr pipe. Please send your dmesg to , thanks. %s: umass only mode. need to reattach %s: truinstall mode. need to reattach %s: no endpoint descriptor found for %d wiusbthrwitxlwiIDLwi_usb: received USB_BUFAVAIL packet wi_usb: received USB_ERROR packet %s: %s error=%s wiTXsyncUGH TX UGH RX write_record buf size err %x %x invalid packet len: %x memsz %x max %x %s: %s: error=%s %s:%s: invalid packet id sent %x %s: already detached %s: open pipes failed wi_usb%s: could not get card cfg! unknown-device%s: %s loadfirmware error %d %s: reattaching after firmware upload atuatu-rfmd-intatu-rfmd-extatu-rfmd2958-intatu-rfmd2958-extatu-rfmd2958smc-intatu-rfmd2958smc-extatu-intersil-intatu-intersil-extatu-at76c503-i3863-intatu-at76c503-i3863-extatu-at76c503-rfmd-acc-intatu-at76c503-rfmd-acc-extatu-at76c505-rfmd-intatu-at76c505-rfmd-ext%s: could not retrieve Tx statistics - cancelling automatic rate control %s: could not write MAC register: %s %s: could not read MAC register: %s %s: could not read BBP %s: could not read EEPROM: %s %s: could not allocate tx xfer %s: could not allocate tx buffer %s: could not transmit buffer: %s %s: could not allocate rx xfer %s: could not allocate rx buffer %s: timeout waiting for BBP/RF to wakeup %s: could not allocate AMRR xfer %s: could not open Tx pipe: %s %s: could not open Rx pipe: %s %s: could not allocate Tx list %s: could not allocate Rx list %s: could not queue Rx transfer %s: could not transmit beacon %s: could not set configuration no %s: could not get interface handle %s: no endpoint descriptor for iface %d %s: MAC/BBP RT%04x (rev 0x%02x), RF %s, address %s uralOUI 0x%06x model 0x%04x rev %d at %s phy %dmii_detach: phyloc and offloc specifiedmii_attach: phyloc and offloc specifiedmiiautmii_phy_setmedia: MASTER on wrong media: %s, rev. %d nsphyDP83840 10/100 PHYqsphyQS6612 10/100 PHYinphyi82555 10/100 PHYi82562EM 10/100 PHYi82562ET 10/100 PHYi82562G 10/100 PHYiophyi82553 10/100 PHYeephy88E1000 1 Gigabit PHY88E1000 2 Gigabit PHY88E1000 3 Gigabit PHY88E1000 4 Gigabit PHY88E1000S Gigabit PHY88E1011 Gigabit PHY88E1111 Gigabit PHY88E1112 Gigabit PHY88E1116 Gigabit PHY88E1116R Gigabit PHY88E1118 Gigabit PHY88E1149 Gigabit PHY88E3016 10/100 PHY88E3082 10/100 PHYPHYG65G Gigabit PHY88E1000 5 Gigabit PHY88E1000 6 Gigabit PHY88E1000 7 Gigabit PHYexphy_service: can't isolate 3Com PHY: 3Com internal media interface %s: ignoring this PHY, non-zero instance xlexphyrlrlphy_service: attempt to isolate phy: RTL internal PHY rlphyRTL8201L 10/100 PHYIP101 10/100 PHYlxtphyLXT970 10/100 PHYLXT971 10/100 PHYluphyLU6612 10/100 PHYmtdphyMTD972 10/100 PHYicsphyICS1890 10/100 PHYICS1892 10/100 PHYICS1893 10/100 PHYsqphy80220 10/100 PHY80225 10/100 PHY84220 10/100 PHYtqphy78Q2120 10/100 PHY: Generic IEEE 802.3u media interface, rev. %d: OUI 0x%06x, model 0x%04x %s: no media present ukphy: internal PHY dcphybmtphy3C905B internal PHY3C905C internal PHYBCM4401 10/100baseTX PHYBCM5201 10/100 PHYBCM5214 Quad 10/100 PHYBCM5220 10/100 PHYBCM5221 100baseTX PHYBCM5222 Dual 10/100 PHYbgebnxbrgphyBCM5400 1000baseT PHYBCM5401 10/100/1000baseT PHYBCM5411 10/100/1000baseT PHYBCM5421 10/100/1000baseT PHYBCM54K2 10/100/1000baseT PHYBCM5461 10/100/1000baseT PHYBCM5462 10/100/1000baseT PHYBCM5464 10/100/1000baseT PHYBCM5701 10/100/1000baseT PHYBCM5703 10/100/1000baseT PHYBCM5704 10/100/1000baseT PHYBCM5705 10/100/1000baseT PHYBCM5714 10/100/1000baseT/SX PHYBCM5750 10/100/1000baseT PHYBCM5752 10/100/1000baseT PHYBCM5780 10/100/1000baseT/SX PHYBCM54XX 10/100/1000baseT PHYBCM5481 10/100/1000baseT PHYBCM5482 10/100/1000baseT PHYBCM5722 10/100/1000baseT PHYBCM5755 10/100/1000baseT PHYBCM5761 10/100/1000baseT PHYBCM5784 10/100/1000baseT PHYBCM5787 10/100/1000baseT PHYBCM5706 10/100/1000baseT/SX PHYBCM5708C 10/100/1000baseT PHYBCM5708S 1000/2500baseSX PHYBCM5709 10/100/1000baseT PHYBCM5709S 1000/2500baseSX PHYBCM5709CAX 10/100/1000baseT PHYBCM57780 10/100/1000baseT PHYBCM5906 10/100baseTX PHYamphyAm79C873 10/100 PHYDM9101 10/100 PHYDM9102 10/100 PHYDM9601 10/100 PHYAm79C875 quad PHYacphyAC101 10/100 PHYAC101L 10/100 PHYAC_UNKNOWN 10/100 PHY%s: %s: enter updown%s: %s: link %s : RTL internal phy urlphyrgephyRTL8169S/8110S PHYnfe%s: unknown CICADA PHY model %x %s: unknown PHY speed %x ciphyCS8201 10/100/1000TX PHYCS8204 10/100/1000TX PHYVSC8211 10/100/1000 PHYCS8244 10/100/1000TX PHYVSC8601 10/100/1000 PHYmem address conflict 0x%x/0x%x io address conflict 0x%x/0x%x bridge io address conflict 0x%x/0x%x bridge mem address conflict 0x%x/0x%x dev %d function %dpci_mem_find: bad requestpci_mem_find: bad 64-bit requestpci_io_find: bad request%svendor 0x%04x product 0x%04xunknown vendor "%s", unknown product 0x%04xunknown class 0x%02x, subclass 0x%02xclass %s unknown subclass 0x%02xclass %s subclass %s, rev 0x%02x) rev 0x%02xmiscellaneousfloppyIPISASethernettoken ringFDDIWorldFipPCMIG Multi ComputingXGAvideoaudiotelephonyhdaudioRAMflashhostMicroChannelNuBusRACEwaySemi-transparent PCIInfiniBandserialparallelmulti-port serialmodemsmartcard8237 DMA8254 timerRTCPCI Hot-PlugSD Host Controllerkeyboarddigitizermousegame portgeneric386486PentiumAlphaPowerPCMIPSCo-processorFirewireACCESS.busSSAFiber ChannelIPMISERCOSIrDAConsumer IRRFbluetoothbroadband802.11a (5 GHz)802.11b (2.4 GHz)standardvoicedatanetwork/computingentertainmentDPIOTime and Frequencysynchronizationmanagementprehistoricmass storagenetworkdisplaymultimediabridgecommunicationsinputdockserial buswirelessI2Osatellite commDASPundefinedOZ6729 CardBusOZ6730 CardBusOZ6922 CardBusOZ6832 CardBusOZ6836/OZ6860 CardBusOZ68[17]2 CardBusOZ6933 CardBusOZ69[17]2 CardBusOZ711Mx MiscOZ711EC1 SmartCardBusOZ711M1 CardBusOZ711MP1 SDHCOZ711MP1 XDHCOZ711MP1 CardBusOZ711EZ1 CardBusOZ711SP1 CardBusOZ711E0 CardBus3c9853c9963CRDAG675 (Atheros AR5212)3CRPAG175 (Atheros AR5212)V.90 Modem3c9403c3393c3593c4503c555 100Base-TX3c5753CCFE575BT3CCFE575CT3c590 10Mbps3c595 100Base-TX3c595 100Base-T43c595 10Mbps-MII3CRSHPW796 802.11b3CRWE154G72 802.11g3c556 100Base-TX3c556B 100Base-TX3CCFEM6563CCFEM656B3CCFEM656C56k Global Modem3cSOHO-TX3crwe777a AirConnect3c940B3c900 10Base-T3c900 10Mbps-Combo3c900B 10Mbps3c900B 10Mbps-Combo3c900B 10Mbps-TPC3c900B 10Mbps-FL3c905 100Base-TX3c905 100Base-T43c905B 100Base-TX3c905B 100Base-T43c905B 10/100Mbps-Combo3c905B 100Base-FX3c905C 100Base-TX3c9201 100Base-TX3c920B-EMB-WNM3cSOHO 100B-TX3c980 100Base-TX3c980C 100Base-TX3cr9903cr990-TX3cr990-TX-953cr990-TX-973c990b-TX-M3cr990-FX3cr990SVR953cr990SVR973c990BSVRVoodooVoodoo2BansheeVoodoo3Voodoo4Voodoo5GLINT 300SXGLINT 500TXGLINT DeltaPermediaGLINT MXPermedia 2GLINT GammaPermedia 2vPermedia 3Wildcat III 6210Wildcat 5110Wildcat IV 72105000/6000 series RAID7000/8000 series RAID9000 series RAID9500 series RAIDFE2500 10/100PCM200 10/100FE2000VX 10/100FE2500MX 10/100PC4800 WirelessPCI35x WLANPC4500 WirelessMPI-350 WirelessACCM 2188 VL-PCI2051 PCI2051 ISAATP850U/UFATP860ATP860-AATP865-AATP865-RAEC6710AEC6712UWAEC6712UAEC6712SAEC6710DAEC6715UWMPX 5030/5038EN2242EN1217RhineIIrtl8139AWA-100M1435 VL-PCIM1445 VL-PCIM1449 ISAM1451 PCIM1461 PCIM1489 PCIM1511 PCIM1513 ISAM1523 PCIM1523 ISAM1531 PCIM1533 ISAM1535 PCIM1541 PCIM1543 ISAM1563 ISAM1573 ISAM1575 ISAM1621 PCIM1631 PCIM1644 PCIM1647 PCIM1689 PCIM1695 PCIM3309 MPEGM4803M5219 UDMA IDEM5229 UDMA IDEM5237 USBM5239 USB2M5243 AGP/PCI-PCIM5246 AGPM5247 AGP/PCI-PCM5249 PCI-PCIM524B PCIEM524C PCIEM524D PCIEM5261 LANM5263 LANM5281 SATAM5287 SATAM5288 SATAM5289 SATAM5451 AudioM5455 AudioM5457 ModemM5461 HD AudioM7101 PowerAL981AN983AN985ADM8211 WLANADM9511ADM9513AIC-7810AHA-2940AU/CNAHA-2930CUAIC-7850AIC-7855AIC-5900 ATMAIC-5905 ATMAPA-1480AIC-7860AHA-2940AUAIC-7870AHA-2940AHA-3940AHA-3985AHA-2944AIC-7815AIC-7880AHA-2940UAHA-3940UAHA-398XUAHA-2944UAHA-2940UWProAIC-6915AIC-7895AHA-2940U2 U2AHA-2930U2 U2AAA-131U2 U2AIC-7890/1 U2AIC-7892 U160AHA-29160 U160AHA-19160B U160AHA-3950U2B U2AHA-3950U2D U2AIC-7896/7 U2AHA-3960D U160AIC-7899BAIC-7899DAIC-7899FAIC-7899 U160ServeRAIDAAC-2622ASR-2200SASR-2120SAAC-364AAC-3642Dell PERC 2/QCAIC-7901 U320AHA-29320A U320AHA-29320LP U320AIC-7901A U320AHA-29320 U320AHA-29320B U320AIC-7902 U320AIC-7902B U320AHA-39320 U320AHA-39320B U320AHA-39320A U320AHA-39320D U320AHA-39320DB U3201200A1200BABP-930/40UAABP-940UWASP-3940U2WASP-3940U3WWaikato Dag3.2Endace Dag3.5Endace Dag4.22GEEndace Dag4.23PhysXAT22AT24AcenicAcenic CopperBCM5700BCM5701AC1000AC1001AC9100AC1003AMD64 0Fh HyperTransportAMD64 0Fh Address MapAMD64 0Fh DRAM CfgAMD64 0Fh Misc CfgAMD64 10h HyperTransportAMD64 10h Address MapAMD64 10h DRAM CfgAMD64 10h Misc CfgAMD64 10h Link CfgAMD64 11h HyperTransportAMD64 11h Address MapAMD64 11h DRAM CfgAMD64 11h Misc CfgAMD64 11h Link CfgAMD64 14h HostAMD64 14h PCIEAMD64 14h Link CfgAMD64 14h Address MapAMD64 14h DRAM CfgAMD64 14h Misc CfgAMD64 14h CPU PowerAMD64 14h NB PowerAMD64 14h Reserved79c970 PCnet-PCI79c978 PChome-PCI53c974 PCscsi-PCI79C974 PCnet-PCIGeode LXGeode LX VideoGeode LX CryptoCS5536 PCICS5536 ISACS5536 AudioCS5536 USBCS5536 IDEElanSC520 PCI751 System751 PCI-PCI762 PCI762 PCI-PCI761 PCI761 PCI-PCI755 ISA755 IDE755 Power755 USB756 ISA756 IDE756 Power756 USB Host766 ISA766 IDE766 USB766 Power766 USB OpenHCI768 ISA768 IDE768 Power768 AC97768 Modem768 PCI-PCI768 USB8131 PCIX8131 PCIX IOAPIC8151 Sys Control8151 AGP8132 PCIX8132 PCIX IOAPIC8111 PCI-PCI8111 Ether8111 USB8111 LPC8111 IDE8111 SMBus8111 Power8111 AC97Hudson-2 SATAHudson-2 SMBusHudson-2 IDERS780 HostRS880 HostRS780 PCIEMegaRAIDMegaRAID Series 428MegaRAID Series 434ADSP 21535 DSPAD1889 AudioSafeNet ADSP 2141TC9021BanditGCOHareHeathrowPaddingtonUni-N EthUni-NUni-N Eth FirewireUni-N AGPUni-N GMACKeylargoPangea GMACPangea MacioPangea USBPangea AGPPangeaPangea PCIUni-N2 AGPUni-N2 HostPangea FireWireUniNorth FirewireUni-N2 GMACUni-N ATAUniNorth AGPUniNorth PCIIntrepid ATAIntrepidIntrepid USBK2 USBK2 MacioK2 FirewireK2 ATAU3 PCI-PCIU3 AGPK2 GMACShastaShasta ATAShasta GMACShasta FirewireShasta PCIShasta HyperTransportK2U3L AGPK2 AGPIntrepid 2 AGPIntrepid 2 PCIIntrepid 2 ATAIntrepid 2 FireWireIntrepid 2 GMACARS106SARS0303D1000PV2000PV2000MT2000MIARC-1110ARC-1120ARC-1130ARC-1160ARC-1170ARC-1200ARC-1200 rev BARC-1202ARC-1210ARC-1220ARC-1230ARC-1260ARC-1270ARC-1280ARC-1380ARC-1381ARC-1680ARC-1681ARC-1880AX88140A/88141ASM1042 XHCIRadeon HD 6310 HD AudioRadeon M241PRadeon X300 M24FireGL M24 GLRadeon X600FireGL V3200Radeon X600 SecRadeon IGP 320Radeon IGP 340Radeon 9500 ProRadeon AE 9700 ProRadeon AF 9600TXFireGL AGZ1Radeon AH 9800 SERadeon AI 9800Radeon AJ 9800FireGL AK X2Radeon 9600 ProRadeon 9600Radeon 9550FireGLRadeon 9650Mach32Radeon 9500 Pro SecRadeon 9600 Pro SecRadeon 9600 LE SecRadeon 9600 XT SecRadeon 9550 SecRadeon IGPRadeon 8500Radeon BC R200Radeon IGP 320MMobility M6SB200 AC97SB200 PCISB200 USB2SB200 USBSB200 IDESB200 ISASB200 ModemSB200 SMBusMach64 CTMach64 CXSB300 AC97SB300 PCISB300 SMBusSB300 USB2SB300 USBSB300 IDESB300 ISASB300 ModemSB300 SATASB400 AC97SB400 PCISB400 SMBusSB400 USB2SB400 USBSB400 IDESB400 ISASB400 ModemSB400 SATASB450 HD AudioSB600 SATASB600 AC97SBx00 HD AudioSB600 PCISBx00 SMBusSB600 USB2SB600 USBSB600 IDESB600 ISASB600 ModemSBx00 SATASB700 USB2SB700 USBSB700 IDESB700 ISASB800 PCIERadeon Mobility IGPMach64 ETRage ProMach64Rage XLRadeon 9000Radeon 9000 SecRadeon X800Radeon X800 ProRadeon X800SERadeon X800XTFireGL X3-256Radeon Mobility M18Radeon X800 SERadeon X800 XTRadeon AIW X800 VERadeon X800 Pro SecRadeon X850 XTRadeon X850 SERadeon X850 ProRadeon X850 XT PERage128Mobility M3Mobility 1Rage P/MRadeon Mobility M7FireGL Mobility 7800 M7Radeon Mobility M6Radeon Mobility M9Rage 128 MobilityRadeon 9500/9700Radeon 9600 TXFireGL X1Radeon 9800 ProRAdeon 9800Radeon 9800 XTFireGL X2Radeon Mobility M10Radeon Mobility 9550Radeon 9500/9700 SecFireGL X1 SecRadeon 9800 Pro SecRage 128 ProRage FuryRage 128Rage 128 PXAIW RadeonRadeon 9100Radeon 7500Radeon VEES1000Rage MagnumRadeon Mobility M300 M22Radeon Mobility X600 M24CFireGL M44 GL 5464Radeon X800 XT PERadeon X800 XTPRadeon X800 XLFireGL V7100FireGL V5100Radeon X800 SecMobility FireGL V5000 M26Radeon Mobility X700 XL M26Radeon Mobility X700 M26Radeon X550XTXRadeon X550XTX SecRS300_100 HostRS300_133 HostRS300_166 HostRadeon IGP 9100 HostRadeon IGP 9100Radeon Mobility IGP 9100Radeon IGP 9100 AGPRadeon 9200 PRO SecRadeon 9200 SecRS480 HostRX480 HostRD580 HostRadeon XPRESS 200Radeon XPRESS 200MRX780 HostRD780 HT-PCIERadeon 9200 PRORadeon 9200Radeon 9200 SE SecFireMV 2200RD790 PCIESR5690 HostRD890 HostSR5670 HostSR5650 HostSR5690 PCIERS400 HostRC410 HostRX480 PCIERS480 PCIERadeon X300Radeon X600 (RV370)Radeon X550FireGL V3100FireMV 2200 5B65Radeon X300 SecRadeon X550 SecFireGL V3100 SecFireMV 2200 SecRadeon Mobility 9200Radeon 9200 SERadeon X800 XT M28FireGL V5100 M28Radeon Mobility X800 M28Radeon X850FireGL R480Radeon X850XTRadeon X800 GTO SecRadeon X850 XT SecFireGL V5000FireGL X700 XTFireGL X700 ProFireGL X700 SERadeon X700 PCIERadeon X700 SE PCIERadeon X700 PCIE SecRadeon X700 SERadeon X700 SE SecRadeon HD 5800Radeon HD 5700Radeon HD 5670Radeon Mobility HD 5470Radeon HD 5450RS100 PCIRS200 PCIRadeon X1800Radeon X1800 XTRadeon Mobility X1800FireGL Mobility V7200FireGL V7200FireGL V5300FireGL Mobility V7100FireGL V7300FireGL V7350Radeon X1600RV505Radeon X1300/X1550Radeon X1550M54-GLRadeon Mobility X1400RADEON X1550 64-bitRadeon Mobility X1300 M52-64Radeon Mobility X1300Radeon X1300FireGL V3300FireGL V3350Radeon X1600 SecRadeon X1300/X1550 SecRadeon X1300 ProRadeon X1450Radeon Mobility X2300Radeon Mobility X1350Radeon Mobility X1450FireMV 2250Radeon X1550 64-bitRadeon X1300 Pro SecRadeon X1300 SecRadeon X1650Radeon X1600 ProFireGL V5200Radeon Mobility X1600Radeon X1650 ProRadeon X1300 XTFireGL V3400Mobility FireGL V5250Radeon X1700Radeon X1700 XTRadeon Mobility X1700Radeon X1600 Pro SecRadeon X1650 Pro SecRadeon X2300HDRadeon Mobility X2300HDRadeon X1950Radeon X1900AMD Stream ProcessorRadeon X1950 ProRV560Radeon Mobility X1900Radeon X1950 GTRV570FireGL V7400Rv560Radeon RX1650 XTRadeon X1950 Pro SecRadeon RX1650 XT SecRadeon 9000/9100 IGPRadeon RS350IGPRS690 HostRS740 HostRS690 PCIERS690M PCIERS690 HD AudioRadeon X1250Radeon X1250 IGPRadeon 2100Radeon HD 4870Radeon HD 4850Mobility Radeon HD 4870Radeon HD 4890Radeon HD 4670Radeon HD 4650Radeon HD 2400 XTRadeon HD 2400 ProMobility Radeon HD 2400Radeon HD 3870Radeon HD 3850Radeon HD 4550Radeon HD 4350Mobility Radeon HD 4500Mobility Radeon HD 2600Radeon HD 2600 Pro AGPRadeon HD 2600 XTRadeon HD 2600 ProMobility Radeon HD 3650Mobility Radeon HD 3670Radeon HD 3650 AGPRadeon HD 3650Radeon HD 3470Mobility Radeon HD 3400Radeon HD 3450Radeon HD 3450 AGPRS780 HD AudioRadeon HD 3200Radeon HD 3100Radeon HD 3300Radeon HD 3000Radeon HD 4200 HD AudioRadeon HD 4200Mobility Radeon HD 4200Radeon HD 4290Radeon HD 4250Radeon HD 6310Radeon HD 6250Radeon HD 2600 HD AudioRS690M HD AudioRadeon HD 3870 HD AudioRadeon HD 3600 HD AudioRadeon HD 34xx HD AudioRadeon HD 48xx HD AudioRadeon HD 4000 HD AudioRadeon HD 5800 AudioRadeon HD 5700 AudioRadeon HD 5600 AudioRadeon HD 5470 AudioRS100 AGPRS200 AGPRS250 AGPRS200M AGPS5933 PCI MatchmakerMyrinet LANaiAST2000AR5210AR5311AR5211AR5212AR2413AR5413AR5424AR5416AR5418AR9160AR9280AR9281AR9285AR2427AR9227AR9287AR9300AR9485AR5210 (Early)AR5212 (IBM MiniPCI)AR5210 (no eeprom)AR5212 (no eeprom)AR5211 (no eeprom)AR5212 (emulation board)AR5211RefIDE-2015PLL1EL1L2CL1CL1DL2Vortex 1Vortex 2Vortex AdvantageAVL2301AVG2302ALG2301ALG2302ALS4000Dual SerialQuad SerialBRI ISDNFritz ISDNFritz v2.0 ISDNPRI T1 ISDNRT2890F5D6001F5D6020V3F5D7010F5D6000VME 617VME 270655015601BCM5752BCM5752MBCM5709BCM5709SBCM5716BCM5716SBCM5702BCM5703BCM5704CBCM5704S AltBCM5706BCM5708BCM5702FEBCM57710BCM57711BCM57711EBCM5705BCM5705KBCM5717BCM5718BCM5719BCM5720BCM5721BCM5722BCM5723BCM5724BCM5705MBCM5705M AltBCM57712BCM57712EBCM5714BCM5714SBCM5780BCM5780SBCM5705FBCM5754MBCM5755MBCM5756BCM5750BCM5751BCM5715BCM5715SBCM5754BCM5755BCM5750MBCM5751MBCM5751FBCM5787FBCM5761EBCM5761BCM5764BCM5761SBCM5761SEBCM57760BCM57788BCM57780BCM5787MBCM57790BCM5782BCM5784BCM5785GBCM5786BCM5787BCM5788BCM5789BCM5785FBCM5702XBCM5703XBCM5704SBCM5706SBCM5708SBCM57761BCM57781BCM57791BCM57765BCM57785BCM57795BCM5702 AltBCM5703 AltBCM5781BCM5753BCM5753MBCM5753FBCM5903MBCM4401B1BCM5901BCM5901A2BCM5903FBCM5906BCM5906MBCM4303BCM4307BCM4311BCM4312BCM4315BCM4318BCM4319BCM4306BCM4309BCM43XGBCM4321BCM4322BCM43224BCM43225BCM4401BCM4401B0BCM431358015802580558205821582258235825586058615862BT848BT849BT878BT879BT878 AudioBT879 AudioBt8474 HDLCMultiMaster NCMultiMasterFlashPointGPPCINITROX XLNITROX LiteNITROX PXCinemasterNx10 10GbEPE9000 10GbET302E 10GbET310E 10GbET320X 10GbET302X 10GbET320E 10GbET310X 10GbET3B10 10GbET3B20 10GbET3B02 10GbE643106554565548655506555465555685546900069030CL-GD7548CL-GD5430CL-GD5434-4CL-GD5434-8CL-GD5436CL-GD5446CL-GD5480CL-GD5462CL-GD5464CL-GD5465CL-PD6729CL-PD6832 CardBusCL-PD6833 CardBusCL-GD7542CL-GD7543CL-GD7541CS4610 SoundFusionCS4615CS4280/46xx CrystalClearCS4281 CrystalClearVIC PCIEVIC ManagementVIC EthernetVIC FCoEAAR-1210SAAAR-1220SAAAR-1225SAPCI0640PCI0642PCI0643PCI0646PCI0647PCI0648PCI0649PCI0650AUSB0670USB0673PCI0680SiI3112 SATASiI3114 SATASiI3124 SATASiI3131 SATASiI3132 SATASiI3512 SATASiI3531 SATAGigaCardEX110TXSmart Array 64xxTriflex PCIQVisionQVision 1280/pSmart Array 5300Smart Array 5iSmart Array 532Smart Array 5312Smart Array 6iSmart Array 641Smart Array 642Smart Array 6400Smart Array 6400 EMSmart Array 6422Hotplug PCINetelligent ASMCPCI HotplugUSB OpenHostSMART2P RAIDISAPnPNetelligent 10/100TXNetelligent IDENetelligent 10 TIntegrated NetFlex 3/PDP Netelligent 10/100TXProLiant Netelligent 10/100TXEmbedded Netelligent 10/100TXNetelligent 10 T/2 PCISmart Array 5300 rev.2Smart Array 5i/532 rev.2iLONetFlex 3/PNetFlex 3/PBCompexeRL100-ATX 10/100PMAC 9871356k WinmodemSoftK56 PCIHSF 56k HSFiMUSYCC CN8478MUSYCC CN8474MUSYCC CN8472MUSYCC CN8471CX2388xCX2388x AudioCX2388x MPEGCX2388x IRCX2388582C599 VLBCY82C693U ISAFEther CB-TXD 10/100FEther II CB-TXD 10/100CG-LAPCIGTRTL8192ERTL8190PC-Bus II-PCICache Coherency FilterSoundBlaster LiveSoundBlaster AWE64DSoundBlaster AudigySoundBlaster X-FiSoundBlaster Live (Dell)SoundBlaster Audigy LSSoundBlaster Audigy 2SoundBlaster X-Fi XtremePCI Gameport JoystickSoundBlaster Audigy DigitalPCIE-PCIEctiva 1938Cyclom-Y below 1MCyclom-YCyclom-4Y below 1MCyclom-4YCyclom-8Y below 1MCyclom-8YCyclom-Z below 1MCyclom-ZIQ80310Cx5510GXm PCIGXm ISACx5530 SouthCx5530 SMICx5530 IDECx5530 XpressAUDIOCx5530 VideoDM9009DM9100DM9102DM9132PCCOM 2-portPCCOM 4-portPCCOM 8-port21050 PCI-PCI2104021030Zephyr NV-RAMKZPSA21140TGA2DEFPA21041DGLPB (OPPO)ZLXP-L2 (Pixelvision)Memory Channel Cluster Controller21142/3Farallon PN9000SX21052 PCI-PCI21150 PCI-PCI21150-BC PCI-PCI21152 PCI-PCI21153 PCI-PCI21154 PCI-PCI21554 PCI-PCISWXCR RAIDPERC 2/SiPERC 3/DiPERC 3/SiDRAC 3 Add-inDRAC 3 Virtual UARTDRAC 3 Embedded/OptionalDRAC 4 Embedded/OptionalDRAC 3 OptionalPERC 4/Di i960PERC 4/Di VerdeDRAC 4DRAC 4 Virtual UARTPERC 4e/DiDRAC 4 SMICPERC 58139Viper/PCI550TX530TX+DFE-690TXDDRP32TXDDWL-610DGE-550TDGE-550SXDGE-528TDGE-560TDGE-530T B1DGE-560SXDGE-550T B1DGE-530T A1Memory ControlSmartCache/RaidSmartRAID (I2O)SmartRAID 2005SPCI-SCIDMX3194UIS64PH ISDNRT2860155P-MF1 ATM (FPGA)155P-MF1 ATM (ASIC)25SS-3010 ATM (ASIC)SpeedStream 1023QuickStep 1000 ISDNLPFCLP6000LPe121LPe1250LP952LP982LP101LP1050LP111LP1150LPe111LPe1150LPe1000LPe1000-SPLPe1002-SPLPe12000LPe12000-SPLPe12002-SPLP7000LP8000LP9000LP9802LP10000LPX10000LP10000-SLP11000-SLPe11000-SLPe12000-SLP11000LP11000-SPLP11002-SPLPe11000LPe11000-SPLPe11002-SPEndace Dag3.6DEndace Dag4.23GEFlash memoryMemory StickSD ControllerCB-1211 CardBusCB-1225 CardBusCB-1410 CardBusCB-710 CardBusCB-712 CardBusCB-1420 CardBusCB-720 CardBusCB-722 CardBusAudioPCI97AudioPCICT5880ES366H ModemMaestro IISOLO-1 AudioDriveMaestro 2EES1989ES1989 ModemMaestro 3ES1983 ModemMaestro 3 AudioES366H Fax/ModemES2838/2839 SuperLink ModemES2898 ModemRoadRunner HIPPIRoadRunner Gig-EFreedom GBusWL11000PSST-64PSST-128PSST-16PSST-4pSST-8pXR17C152XR17C154XR17C158ATM PCA-200ATM PCA-200e801 SoundMPC8349EMPC8349MPC8347E TBGAMPC8347 TBGAMPC8347E PBGAMPC8347 PBGAMPC8343EMPC8343PW008GE5PW008GE4PRIMEPOWER250/450 LANioDrive v1.2ioDriveioXtremeioXtreme ProTMC-18C30 (36C70)GL24110P03GL24110PGL24110P02Pulsar G7370 ADSLPR103WinTVPN672TX 10/100Visualize EGVisualize FX6Visualize FX4Visualize FX2Tach TL FibreChannelTach XL2 FibreChannelJ2585AJ2585BDiva Serial MultiportElroy Ropes-PCIVisualize FXeTopToolsNetRaid-4MNetServer SmartIRQ82557B 10/100 NICPluto MIOzx1 IOCMercury Ropes-PCIQuickSilver Ropes-PCISmart Array V100Smart Array E200iSmart Array E200Smart ArraySmart Array P800Smart Array P600Smart Array E500Smart Array P400Smart Array P400iSmart Array P700mSmart Array P212Smart Array P410Smart Array P410iSmart Array P411Smart Array P812Smart Array P712mSmart Array P711miLO3 SerialiLO3 SlaveiLO3 ManagementiLO3 Watchdog77516500781179517814/7851/785480658165815479567955/7954HB6 PCI-PCIHB4 PCI-PCIMSVCC01 Video CaptureSH7751 PCISH7751R PCIMCACPU - Alta LiteCPU - Alta MPISA w/PnPCPUAuto LANStreamerGXT-150P82G267582351 PCI-PCIMiami/PCIOlympici82557B 10/100RSAFireGL2133 PCIX-PCIX4810 BSP4810 SCCCalgary IOMMUEnvy24 I/O CtrlrEnvy24PT/HT Audio77201/77211 ATM (NICStAR)89HPES12N3A89HPES24N3A89HPES24T6WDT 50x Watchdog TimerINIC-850 (A100UW)INIC-1060 (A100U2W)INIC-940INIC-941INIC-950VirtualBox Graphics AdapterVirtualBox Guest ServiceIPN2120IPN222050265027502888498853Twin Turbo 128Twin Turbo 3DEES ISA21145Core HostCore PCIEHD graphics3400 PCIEMobile HD graphicsCentrino Advanced-N 6005WiFi Link 1000Centrino Advanced-N 6205Centrino Advanced-N 6250WiFi Link 1030Centrino Advanced-N 6030Core 2G HostCore 2G PCIEGT1 VideoGT2 VideoGT2+ Video80303 IOP80312 I/O Companion6700PXH PCIE-PCIX6702PXH PCIE-PCIXIOP332 PCIE-PCIXIOP331 PCIX-PCIX41210 PCIE-PCIXIOP333 PCIE-PCIXDH89XXCC SGMIIDH89XXCC SerDesDH89XXCC backplaneDH89XXCC SFP82375EB EISA82424ZX Cache/DRAM82378IB ISA82426EX ISA82434LX/NXGDT RAIDWiFi Link 6150WiFi Link 130WiFi Link 100i960 RP PCI-PCIi960 RM PCI-PCIi960 RN PCI-PCIPRO/1000 (82542)PRO/1000F (82543GC)PRO/1000T (82543GC)PRO/1000XT (82544EI)PRO/1000XF (82544EI)PRO/1000T (82544GC)PRO/1000XT (82544GC)PRO/1000MT (82540EM)PRO/1000MT (82545EM)PRO/1000MT (82546EB)PRO/1000MF (82545EM)PRO/1000MF (82546EB)PRO/1000MT (82541EI)PRO/1000MT (82540EP)PRO/1000MT Mobile (82541EI)PRO/1000CT (82547EI)PRO/1000CT Mobile (82547EI)PRO/1000MT QP (82546EB)PRO/1000MT (82545GM)PRO/1000MF (82545GM)PRO/10082559PRO/100 VEPRO/100 VM82562EH HomePNA82801DB LANV.92 ModemPRO/Wireless 2100PRO/10GbE (82597EX)ICH8 IGP M AMTICH8 IGP AMTICH8 IGP CICH8 IFEICH8 IGP MPRO/100 MPRO/1000 PT (82571EB)PRO/1000 PF (82571EB)PRO/1000 PB (82571EB)82801FB LAN82801FBM LAN82801GB LANPRO/1000CT (82547GI)PRO/1000MT (82541GI)PRO/1000MT Mobile (82541GI)PRO/1000MT (82541ER)PRO/1000MT (82546GB)PRO/1000MF (82546GB)PRO/1000GT (82541GI)PRO/1000 PT (82572EI)PRO/1000 PF (82572EI)PRO/1000 PB (82572EI)PRO/1000MT (82573E)82573E IDE82573E KCS82573E SerialPRO/1000 PT (80003ES2)PRO/1000 PF (80003ES2)PRO/1000MT QP (82546GB)PRO/1000MT (82573L)PRO/10GbE CX4 (82597EX)PRO/1000 AT (82571EB)PRO/1000 AF (82571EB)PRO/1000 QP (82571EB)PRO/1000 PT (82575EB)PRO/1000 PF (82575EB)PRO/1000 PL (82573L)PRO/1000 PM (82573V)PRO/1000 PM (82573E)10GbE (82598)ICH9 IGP AMTICH9 IGP MICH9 IFEICH9 IFE GICH9 IFE GTICH8 IFE GTICH8 IFE G10GbE SR Dual (82598AF)10GbE SR (82598AF)10GbE (82598AT)PRO/1000 (82576)ICH9 IGP M VICH10 R BM LMICH10 R BM LFICH10 R BM VPRO/1000 MT (82574L)PRO/1000 QP (82571PT)PRO/1000 QP (82575GB)10GbE Dual (82598AT)10GbE SFP+ (82598EB)10GbE CX4 (82598EB)ICH10 D BM LMICH10 D BM LF10GbE SR Dual (82598)ICH9 BMPRO/1000 FP (82576)PRO/1000 QP (82576)82577LM82577LC10GbE CX4 Dual (82598EB)10GbE VF (82599)82578DM82578DC10GbE DA Dual (82598)10GbE LR (82598EB)ICH9 IGP M AMT82574L10GbE KX4 (82599)10GbE Backplane (82599)10GbE CX4 (82599)10GbE SFP+ (82599)10GbE XAUI (82599)8255282815 Host82815 AGP82815 Video82806AA APIC82559ER82092AA IDESAA711682452KX/GXEE Pro 10 PCIEE Pro 100EE Pro 100 Smart8255x82437FX82371FB ISA82371FB IDE82371 ISA and IDE82437MX82441FX82380AB Mobile ISA82380FB Mobile PCI-PCI82439HX82806AA82870P2 PCIX-PCIX82870P2 IOxAPIC82870P2 Hot PlugICH8 82567V-382579LM82579V10GbE SFP EM (82599)10GbE BX (82598)PRO/1000 (82576NS)PRO/1000 (82583V)82576 SerDes QPI340-T4 (82580)82580 Fiber82580 SerDes82580 SFPI340-T2 (82580)10GbE KR (82599)82576NS SerDes82599 T3I350I350 FiberI350 SerDesI350 SGMII82580 QFX540TSFP+ FCOE (82599)FCOE (82599)80960RP ATU82840 Host82840 AGP82840 PCI82845 Host82845 AGPI/OATPRO/10GbE SR (82597EX)PRO/10GbE LR (82597EX)6 Series SATA6 Series AHCI6 Series RAID6 Series PCIE6 Series HD Audio6 Series SMBus6 Series Thermal6 Series DMI-PCI6 Series USB6 Series MEI6 Series KTP67 LPCUM67 LPCHM65 LPCH67 LPCHM67 LPCQ65 LPCQS67 LPCQ67 LPCQM67 LPCB65 LPCH61 LPCC202 LPCC204 LPCC206 LPC82801AA LPC82801AA IDE82801AA USB82801AA SMBus82801AA AC9782801AA Modem82801AA Hub-to-PCI82801AB LPC82801AB IDE82801AB USB82801AB SMBus82801AB AC9782801AB Modem82801AB Hub-to-PCI82801BA LPC82801BA USB82801BA SMBus82801BA AC9782801BA Modem82801BAM Hub-to-PCI8256282801BAM IDE82801BA IDE82801BAM LPC82801BA Hub-to-PCI82801E LPC82801E USB82801E SMBus82801E LAN82801CA LPC82801CA/CAM USB82801CA/CAM SMBus82801CA/CAM AC9782801CA/CAM Modem82801CAM IDE82801CA IDE82801CAM LPC82801DB LPC82801DBL IDE82801DB USB82801DB SMBus82801DB AC9782801DB Modem82801DBM IDE82801DB IDE82801DBM LPC82801EB/ER LPC82801EB SATA82801EB/ER USB82801EB/ER SMBus82801EB/ER AC9782801EB/ER Modem82801EB/ER IDE82801EB/ER USB282801ER SATA82820 Host82820 AGP82850 Host82860 Host82850/82860 AGP82860 PCIE7500 HostE7500 Error ReportingE7500 PCIE7501 HostE7505 HostE7505 Error ReportingE7505 AGPE7505 PCI82845G Host82845G AGP82845G Video82865G Host82865G AGP82865G Video82865G CSA82865G Overflow82875P Host82875P AGP82875P CSA82915G Host82915G PCIE82915G Video82925X Host82925X PCIEE7221 HostE7221 PCIEE7221 Video82915GM Host82915GM PCIE82915GM Video6300ESB LPC6300ESB IDE6300ESB SATA6300ESB SMBus6300ESB AC976300ESB Modem6300ESB USB6300ESB WDT6300ESB APIC6300ESB PCIX5000X Host5000Z Host5000V Host5000P Host5000 PCIE5000 Error Reporting5000 Reserved5000 FBD5000 PCIE x85000 PCIE x16E8500 HostE8500 PCIEE8500 PCIE x8E8500 IMIE8500 FSB/Boot/InterruptE8500 Address MappingE8500 RASE8500 MiscE8500 ReservedE8500 XMBE8500 XMB MiscE8500 XMB MAIE8500 XMB DDRE8500 XMB Reserved82801FB LPC82801FBM LPC82801FB SATA82801FR SATA82801FBM SATA82801FB USB82801FB PCIE82801FB HD Audio82801FB SMBus82801FB Modem82801FB AC9782801FB IDE6321ESB LPC6321ESB SATA6321ESB AHCI6321ESB RAID6321ESB USB6321ESB PCIE6321ESB AC976321ESB Modem6321ESB HD Audio6321ESB SMBus6321ESB IDE82945G Host82945G PCIE82945G Video82955X Host82955X PCIEE7230 HostE7230 PCIE82975X PCIE82975X Host82945GM Host82945GM PCIE82945GM Video82945GME Host82945GME Video82801GH LPC82801GB LPC82801GBM LPCTigerpoint LPC82801GHM LPC82801GB SATA82801GR AHCI82801GR RAID82801GBM SATA82801GBM AHCI82801GHM RAID82801GB USB82801GB PCIE82801GB HD Audio82801GB SMBus82801GB Modem82801GB AC9782801GB IDE82801G PCIE82801H LPC82801HEM LPC82801HH LPC82801HO LPC82801HBM LPC82801H SATA82801H AHCI82801H RAID82801HBM SATA82801HBM AHCI82081HBM RAID82801H SMBus82801H DMI-PCI82801H USB82801H PCIE82801H HD Audio82801H Thermal82801HBM IDE82801IH LPC82801IO LPC82801IR LPC82801IEM LPC82801IB LPC82801IBM LPC82801I SATA82801I AHCI82801I RAID82801I SMBus82801I Thermal82801I USB82801I HD Audio82801I PCIEICH9 IGP C82946GZ Host82946GZ PCIE82946GZ Video82946GZ HECI82946GZ PT IDER82946GZ KT82G35 Host82G35 PCIE82G35 Video82G35 HECI82Q965 Host82Q965 PCIE82Q965 Video82Q965 HECI82Q965 PT IDER82Q965 KT82G965 Host82G965 PCIE82G965 Video82G965 HECI82G965 PT IDER82G965 KT82Q35 Host82Q35 PCIE82Q35 Video82Q35 HECI82Q35 PT IDER82Q35 KT82G33 Host82G33 PCIE82G33 Video82G33 HECI82G33 PT IDER82G33 KT82Q33 Host82Q33 PCIE82Q33 Video82Q33 HECI82Q33 PT IDER82Q33 KT82X38 Host82X38 PCIE82X38 HECI82X38 PT IDER82X38 KT3200/3210 Host3200/3210 PCIE3210 PCIEGM965 HostGM965 PCIEGM965 VideoGM965 KTGM965 PT IDERGME965 HostGME965 PCIEGME965 VideoGME965 HECIGME965 PT IDERGME965 KTGM45 HostGM45 PCIEGM45 VideoGM45 HECIGM45 PT IDERGM45 AMT SOLQ45 HostQ45 PCIEQ45 VideoQ45 HECIQ45 PT IDERQ45 KTG45 HostG45 PCIEG45 VideoG41 HostG41 VideoRCU32 I2O RAID3124 SATA31244 SATA82855PM Host82855PM AGP82855PM Power5500 HostX58 Host5520 HostX58 PCIE5520/X58 QuickPath5520 QuickPathX58 GPIOX58 RASX58 QuickPathX58 QuickDataX58 IOxAPICX58 MiscX58 ThrottleX58 TXT6321ESB IOxAPIC6321ESB PCIE-PCIX82830M Host82830M AGP82830M Video82855GM Host82855GME AGP82855GM Video82855GM Memory82855GM Config82854 Host82854 VideoE7520 HostE7520 Error ReportingE7320 HostE7320 Error ReportingE7520 DMAE7520 PCIEE7520 ConfigE7525 Host3100 Host3100 Error Reporting3100 EDMA3100 PCIE7300 Host7300 PCIEI/OAT CNB7300 FSB/Boot/Interrupt7300 Snoop Filter7300 Misc7300 FBD82801JD SATA82801JD AHCI82801JD RAID82801JDO LPC82801JIR LPC82801JIB LPC82801JD LPC82801JI SATA82801JI AHCI82801JI RAID82801JI SMBus82801JI USB82801JI HD Audio82801JI PCIE82801JDO VECI82801JD Virtual SATA82801JD SMBus82801JD Thermal82801JD USB82801JD HD Audio82801JD PCIE82801JD LANP55 LPCPM55 LPCH55 LPCQM57 LPCH57 LPCHM55 LPCQ57 LPCHM57 LPCQS57 LPC3400 LPC3420 LPC3450 LPC3400 SATA3400 AHCI3400 RAID3400 SMBus3400 Thermal3400 USB3400 HD AudioQS57 HD Audio3400 MEI3400 PT IDER3400 KT5400 Host5400A Host5400B Host5400 PCIEI/OAT SNB5400 FSB/Boot/Interrupt5400 Coherency Engine5400 IOAPIC5400 RASPRO/Wireless 2200BGPRO/Wireless 2225BGPRO/Wireless 3945ABGPRO/Wireless 2915ABGWireless WiFi Link 4965Centrino Ultimate-N 6300Centrino Advanced-N 6200WiFi Link 5100WiFi Link 5300WiFi Link 5350WiFi Link 5150Turbo MemoryEP80579 HostEP80579 MemoryEP80579 EDMAEP80579 PCIEEP80579 SATAEP80579 AHCIEP80579 ASUEP80579 ReservedEP80579 LPCEP80579 SMBusEP80579 USBEP80579 PCI-PCIEP80579 CANbusEP80579 SerialEP80579 1588EP80579 LEBEP80579 GCUEP80579 LANi960 RD PCI-PCIPRO 100 Server5100 Host5100 PCIE5100 FSB5100 Reserved5100 DDRI/OAT SCNB82371SB ISA82371SB IDE82371SB USB82437VX82439TX82371AB PIIX4 ISA82371AB IDE82371AB USB82371AB Power82810 Host82810 Video82810-DC100 Host82810-DC100 Video82810E Host82810E Video82443LX AGP82443BX AGP82443BX82440MX Host82440MX AC9782440MX Modem82440MX ISA82440MX IDE82440MX USB82440MX Power82440BX AGP82443GX82372FB IDE82740 AGPUS15W HostUS15L/UL11L HostUS15W VideoUS15L/UL11L VideoSCH PCIESCH USBSCH USB ClientSCH LPCSCH IDESCH HD AudioSCH SD/MMC82450KX/GX82450KX/GX Memory82451NX Mem & IO82454NX PXB82802AC Firmware Hub 8Mbit82802AB Firmware Hub 4MbitI2O RAID PCI-PCIRCU21 I2O RAIDRCUxx I2O RAIDRCU31 I2O RAIDRCU31L I2O RAIDPineview DMIPineview VideoS21152BB PCI-PCI21154AE/BE PCI-PCICore DMICore QPI LinkCore QPI RoutingCore ManagementCore ScratchCore ControlCore MiscPowerstorm 4D50TIntense 3DExpert3D5526 FibreChannelPRISM3PRISM2.5Prism IndigoPrism Javelin/XbowPrism GT/DuetteAEONGV-BCTV3AGX016ITT3204 MPEG DecoderIT8211FIT8212FIT8213FIT8330GIT8888F ISAJMC250JMC260JMB360 SATAJMB361 IDE/SATAJMB362 SATAJMB363 IDE/SATAJMB365 IDE/SATAJMB366 IDE/SATAJMB368 IDExDKTIHSSIDS3SSIDS1HSSIcAppian LiteParallelDual ParallelS3 805Leadtek WinFast TV 2000Leadtek WinFast TV 2000 XPLXT1001EG1032EG1064PCMPC200PCM200PNICPNIC-II8031K56flex DSVD LTMODEMLTMODEMVenus ModemUSB 2-portUSB QuadraBusFW322 1394FW643 1394ET1310LS242 DVD DecoderPMAC 98715PMAC 98727MX86250Smart 16/4 PCI RingnodeSmart 16/4 PCI Ringnode Mk2Smart 16/4 PCI Ringnode Mk3Smart 16/4 PCI Ringnode Mk116/4 CardbusPresto PCISmart 100/16/4 PCI-HS RingnodeSmart 100/16/4 PCI Ringnode16/4 CardBus Mk2Collage 25 ATMCollage 155 ATMi740 PCILibertas 88W8300Libertas 88W8310Libertas 88W8335Yukon 88E8001/8003/8010Yukon 88E8021CUYukon 88E8022CUYukon 88E8061CUYukon 88E8062CUYukon 88E8021XYukon 88E8022XYukon 88E8061XYukon 88E8062XYukon 88E8035Yukon 88E8036Yukon 88E8038Yukon 88E8039Yukon 88E8040Yukon 88E8040TYukon 88EC033Yukon 88E8042Yukon 88E8048Yukon 88E8052Yukon 88E8050Yukon 88E8053Yukon 88E8055Yukon 88E8056Yukon 88E8070Yukon 88EC036Yukon 88EC032Yukon 88EC034Yukon 88EC042Yukon 88E8058Yukon 88E8071Yukon 88E8072Yukon 88E8075Yukon 88E8057Yukon 88E8059Yukon (Belkin F5D5005)88SX5040 SATA88SX5041 SATA88SX5080 SATA88SX5081 SATA88SX6040 SATA88SX6041 SATA88SX6042 SATA88SX6080 SATA88SX6081 SATA88SE6101 IDE88SE6111 SATA88SE6120 SATA88SE6121 SATA88SE6122 SATA88SE6140 SATA88SE6141 SATA88SE6145 SATA88SX7042 SATA88SE9123 SATAMGA PX2085 (Atlas)MGA Millenium 2064W (Storm)MGA 1064SG 220MHzMGA Millennium II 2164WMGA Millennium II 2164WA-B AGPMGA G200 PCIMGA G200 AGPMGA G200e (ServerEngines)MGA G400/G450 AGPMGA G200eWMGA ImpressionMGA G100 PCIMGA G100 AGPMGA 1064SGMGA G400 Twin HeadMGA G550 AGPMGA P650 PCIeMGA Millennium G200 SDMGA Produktiva G100 SDMGA Mystique G200 SDMGA Millennium G200 SGMGA Marvel G200 SDPCI32PCI509PCI511PEX511GPS170PCIConnectX ENKSZ8841 10/100KSZ8842 dual-port 10/100 switchRT3090MN-120 10/100MN-130 10/1002IVDC-PCX1MiroVIDEO DC20Media 3DMiroVIDEO DC10/DC20Powerstorm 4D30TGUI AccelMPC105 PCIMPC106 PCISM56Raven PCICP-114C104HCP-104ULCP-104JUC168HDMA4 serialDAC960P V2 RAIDDAC960P V3 RAIDDAC960P V4 RAIDDAC960P V5 RAIDAcceleRAIDeXtremeRAIDZ8EMyrinet LANai 9.2MTD800 10/100MTD803 10/100MTD891 10/100/1000MV1000NCP130NCP130 Rev A2PCI-GPIBNET2282 USBNXB-10GXxR (NX2031)NXB-10GCX4 (NX2031)NXB-4GCU (NX2035)IMEZ 10GbEHMEZ 10GbEIMEZ 10GbE MgmtHMEZ 10GbE MgmtNX3031DP83810 10/100PC87415 IDE87560 Legacy I/ODP83815 10/100DP83820 10/100/1000CS5535 HostCS5535 ISACS5535 IDECS5535 AUDIOCS5535 USBCS5535 VIDEOSaturnSCx200 ISASCx200 SMISCx200 IDESCx200 AUDIOSCx200 VIDEOSCx200 X-BUSSC1100 ISASC1100 SMISC1100 X-BusNS87410PowerVR PCX2I/OPCIE-XHCIVersa MaestroVersa Va26D MaestroMagicgraph NM2070Magicgraph 128VMagicgraph 128ZVMagicgraph NM2160Magicgraph NM2200Magicgraph NM2360MagicMedia 256AV+MagicMedia 256XL+MagicMedia 256AVMagicMedia 256ZXXframeXframe IIMA301GA620GA620TNm9805Nm9835Nm9845Nm9865Nm9901Nm9922CMI8338A AudioCMI8338B AudioCMI8738/C3DX AudioCMI8738B AudioHSP56 AMRNSP2KNetVin 5000Universe VMETsi381 PCIE-PCIFalcon PFalcon SEF100253c81053c82053c82553c81553c810AP53c86053c1510D53c89653c89553c88553c87553c151053c895A53c1010-3353c1010-6653c103053c1030ZC53c103553c1035ZCSAS1064SAS1068SAS1064ESAS1068ESAS1066ESAS1064ASAS1066SAS1078SAS2116SAS2308SAS2004SAS2008SAS2108MegaRAID SAS2108 CRYPTO GEN2MegaRAID SAS2108 GEN2SAS1078DESAS220853c875JMegaRAID 320MegaRAID 320-2EMegaRAID SATA 4x/8xMegaRAID SAS 1064RMegaRAID Verde ZCRFC909FC909AFC929FC919FC929XFC919XFC949XFC939XFC949EYellowfin61C10263C81553c1030RPacket Engines G-NICPI7C21P100 PCIX-PCIXPI7C9X130 PCIE-PCIXFNW-3603-TX 10/100FNW-3800-TX 10/100NX82C501 PCINDR4600 PCIBS21 10/100E-mobility WirelessImagine-128Imagine-128 IIImagine-128 T2RImagine-128 T2R4NV1DAC64Riva TNTRiva TNT2Riva TNT2 UltraVantaMCP04 ISAMCP04 SMBusMCP04 IDEMCP04 SATAMCP04 LANMCP04 AC97MCP04 USBMCP04 PCI-PCInForce4 ISAnForce4 SMBusnForce4 IDEnForce4 SATACK804 LANnForce4 AC97nForce4 USBnForce4 PCI-PCInForce4 PCIEnForce4 DDRnForce2 ISAnForce2 SMBusnForce2 IDEnForce2 LANnForce2 USBnForce2 AC97nForce2 AudionForce2 PCI-PCInForce2 FireWireMCP04 PCIEnForce2 400 ISAnForce2 400 SMBusnForce2 400 IDEnForce3 LANnForce2 400 USBnForce2 400 AC97nForce2 400 PCI-PCInForce2 400 SATAGeForce 7800 GTXGeForce 7800 GTAladdin TNT2GeForce Go 6800GeForce Go 6800 UltraQuadro FX Go1400Quadro FX 1400nForce3 ISAnForce3 PCI HostnForce3 PCI-PCICK804nForce3 SMBusnForce3 IDEnForce3 USBnForce3 ModemnForce3 AC97nForce3 250 ISAnForce3 250 PCI HostnForce3 250 AGPnForce3 250 SATAnForce3 250 SMBusnForce3 250 IDEnForce3 250 USBnForce3 250 AC97nForce3 250 PCI-PCIGeForce 6600 GT AGPGeForce 6600GeForce 7800 GSGeForce 6800 GTGeForce 5300 PCXQuadro FX 330GeForce256GeForce256 DDRQuadroGeForce2 MXGeForce2 MX 100GeForce2 GoQuadro2 MXRGeForce 6600 GTGeForce 6600 GoGeForce2 GTSGeForce2 TiGeForce2 UltraQuadro2 ProGeForce 6200Quadro NVS 285GeForce Go 6200GeForce4 MX 460GeForce4 MX 440GeForce4 MX 420GeForce4 440 GoGeForce4 420 GoGeForce4 420 Go 32MQuadro4 500XGLGeForce4 440 Go 64MQuadro4 200/400NVSQuadro4 550XGLQuadro4 GoGLGeForce4 MX 440 AGPGeForce4 MX 440SE AGPGeForce 4 MX 420 AGPGeForce4 MX 4000Quadro4 580 XGLQuadro4 NVSQuadro4 380 XGLGeForce 8800 GTXGeForce 8800 GTSGeForce2 Crush11nForce PCI HostnForce 220 DDRnForce 420 DDRnForce 220/420nForce APUnForce AC97nForce ISAnForce SMBusnForce AGPnForce PCI-PCInForce IDEnForce USBnForce LANGeForce 7300 LEGeForce 7200 GSGeForce 7300 GoGeForce 7400 GoGeForce 7300 GSnForce2 PCInForce2 AGPnForce2GeForce4 MX nForce GPUGeForce3GeForce3 Ti 200GeForce3 Ti 500Quadro DCCGeForce 6150GeForce 6150 LEGeForce 6100GeForce Go 6150GeForce Go 6100GeForce4 Ti 4600GeForce4 Ti 4400GeForce4 Ti 4200Quadro4 900 XGLQuadro4 750 XGLQuadro4 700 XGLMCP51 ISAMCP51 SMBusMCP51 IDEMCP51 SATAMCP51 LANMCP51 AC97MCP51 HD AudioMCP51 USBMCP51 PCI-PCIMCP51 HostMCP51 PMUMCP51 MemoryC51 MemoryGeForce4 Ti 4800GeForce4 Ti 4200 GoGeForce 7900 GT/GTOGeForce Go 7950 GTXQuadro FX 3500GeForce 7600 GTGeForce 7600 GSC51 HostC51 PCIEGeForce FX 5800 UltraGeForce FX 5800GeForce FX 5600 UltraGeForce FX 5600GeForce FX Go 5600GeForce FX Go 5650GeForce FX 5200 UltraGeForce FX 5200GeForce FX Go 5200GeForce FX 5500GeForce FX 5100Quadro FX 500/600GeForce FX Go 5300GeForce FX Go 5100GeForce FX 5900 UltraGeForce FX 5900GeForce FX 5950 UltraGeForce FX 5700LEGeForce FX Go 5700MCP55 ISAMCP55 SMBusMCP55 MemoryMCP55 USBMCP55 IDEMCP55 PCI-PCIMCP55 HD AudioMCP55 LANMCP55 PCIEMCP55 SATAGeForce 7300 GTGeForce 7600 GoC55 HostC55 MemoryC55 PCIEGeForce 6100 nForce 430GeForce 6100 nForce 405GeForce 7025 nForce 630aMCP61 ISAMCP61 HD AudioMCP61 LANMCP61 SATAMCP61 PCIEMCP61 MemoryMCP61 SMBusMCP61 IDEMCP61 USBMPC61 USBMCP61MCP61 SMUGeForce 8600 GTGeForce 8600M GTQuadro FX 570MGeForce 8500 GTGeForce 8400 GSGeForce 8400M GSGeForce 8400M GMCP65 ISAMCP65 MemoryMCP65 SMBusMCP65 IDEMCP65 PCIMCP65 HD AudioMCP65 AHCIMCP65 LANMCP65 USBMCP65 PCIEMCP65 SATAGeForce GTX 285GeForce 7000MGeForce 7050 PVMCP67 MemoryMCP67 SMBusMCP67 Co-processorMCP67 ISAMCP67 LANMCP67 SATAMCP67 AHCIMCP67 HD AudioMCP67 USBMCP67 IDEMCP67 PCIMCP67 PCIEMCP77 MemoryMCP77 PCIEMCP73 USBMCP73 IDEMCP73 PCIEGeForce 9800 GTXGeForce 9300 GEGeForce 8800 GTGeForce 9800 GTGeForce 9600 GTGeForce 9300M GSQuadro NVS 150mQuadro NVS 160mMCP77 SMBusMCP77 Co-processorMCP77 IDEMCP77 PCIMCP77 ISAMCP77 LANMCP77 HD AudioMCP77 USBMCP73 HostMCP73 MemoryMCP73 ISAMCP73 SMBusMCP73 LANGeForce 7100GeForce 7050MCP73 AHCIMCP73 HD AudioGeForce 8200m GGeForce 9100GeForce 8200GeForce 9400GeForce 9400mGeForce 9300ION VGAGeForce 320MGeForce 210MCP79 HostMCP79 MemoryMCP79 PCIEMCP79 SMBusMCP79 Co-processorMCP79 USBMCP79 ISAMCP79 LANMCP79 SATAMCP79 AHCIMCP79 RAIDMCP79 HD AudioMCP77 SATAMCP77 AHCIGF108 HD AudioMCP89 HostMCP89 MemoryMCP89 PCIEMCP89 SMBusMCP89 Co-processorMCP89 LANMCP89 LPCMCP89 SATAMCP89 AHCIMCP89 RAIDMCP89 HD AudioMCP89 USBGeForce 425MOTI107OC2325OC2183OC232682C092G82C557 Host82C558 ISA82C568 IDE82D568 IDE82C621 IDE82C70082C70182C82282C8613G+ UMTS HSDPA (F32)010L100L110L200L210L400L800Lx10H100H200H400H/800H800H200HV2011HOX16PCI954OX16PCI954KExsys EX-41092OXCB950OXmPCI954OXmPCI954 DisabledExsys EX-41098OX16PCI954 ParallelOX16PCI952OX16PCI952 ParallelQStor SATAPMC/GNIC2ToolsRZ1000HSP MicroModem 56Virtio NetworkVirtio StorageVirtio MemoryVirtio ConsoleCMIC-LECNB20-LE HostCNB20HE HostCNB20LE HostCIOB30CMIC-HECMIC-WS Host (GC-LE)CNB20-HE HostCNB20-HE Host (GC-LE)CMIC-GC HostGCNB-LE HostHT-1000 PCICIOB-X2 PCIXHT-1000 PCIXCIOB-EHT-2000 PCIXHT-2000 PCIEHT-2100 PCIEOSB4CSB5CSB6HT-1000OSB4 IDECSB5 IDECSB6 RAID/IDEHT-1000 IDECSB6 IDEOSB4/CSB5 USBCSB6 USBHT-1000 USBCSB5 LPCGCLE-2 HostHT-1000 LPCK2 SATAFrodo4 SATAFrodo8 SATAHT-1000 SATAHT-1100Verite 1000Verite V2x00T1/E1/J1Dual T1/E1/J1Quad T1/E1/J1ISP156x USBSAA7130 TVSAA7133 TVSAA7134 TVSAA7135 TVPS5000PT80C826PT86C521PT86C523PC87550PT86C523_2PCC-ISESPCI PC WDES1849I/O 1076I/O 1077PCI 6520PEX 8112PEX 8114PEX 8517PEX 8518PEX 8524PEX 8525PEX 8532PEX 8533PEX 8547PEX 8548PEX 8612PEX 8613PEX 8614PEX 8616PEX 8624PEX 8632PEX 8648I/O 9016I/O 9050I/O 9080Cronyx OmegaPDC20265PDC20263PDC20275PDC20318PDC20319PDC20371PDC20379PDC20378PDC20375PDC20376PDC20377PDC40719PDC40519PDC20771PDC20571PDC20579PDC40779PDC40718PDC40518PDC20775PDC20575PDC42819PDC20267PDC20246PDC20262PDC20268PDC20269PDC20276DC5030PDC20268RPDC20271PDC20617PDC20620PDC20621PDC20618PDC20619PDC20277ISP10160ISP1020ISP1022ISP1080ISP12160ISP1240ISP1280ISP2100ISP2200ISP2300ISP2312ISP2322ISP2422ISP2432ISP2512ISP2522ISP2532ISP4010 iSCSI TOEISP4022 iSCSI TOEISP4032 iSCSI TOEISP4010 iSCSI HBAISP4022 iSCSI HBAISP4032 iSCSI HBAISP5422ISP5432ISP6312ISP6322ISP8432PWDOG185008580RT2460ART2560RT2561SRT2561RT2661RT2760RT2790RT3062RT3091RT3092RT3562RT3592RT3593R1010 IDER1011 IDER6021 HostR6031 ISAR6040 EthernetR6060 USBR6061 USBRTS5209 Card Reader80298139D81298101E81388169SC816881698192SE818081858188CE8187SE5C465 CardBus5C466 CardBus5C475 CardBus5C476 CardBus5C477 CardBus5C478 CardBus5C521 Firewire5C551 Firewire5C552 Firewire5C592 Memory Stick5C822 SD/MMC5C832 Firewire5C843 MMC5C852 xD5U230 Memory Stick5U822 SD/MMC5U823 SD/MMC5U832 Firewire5U852 SD/MMCRS56/SP-PCI11P1 ModemViRGETrio32Trio32/64Aurora64V+Trio64UV+868ViRGE VX86C92886C864-086C864-186C864-286C864-386C964-086C964-186C964-286C964-386C968-086C968-186C968-286C968-3Trio64V2/DXPlatoTrio3D AGPViRGE DX/GXViRGE GX2Trio3 DX2Savage 3DSavage 3DMSavage 4ProSavage PM133ProSavage KM133ViRGE MXViRGE MXPSavage/MX-MVSavage/MXSavage/IX-MVSavage/IXSuperSavage MX/128SuperSavage MX/64SuperSavage MX/64CSuperSavage IX/128 SDRSuperSavage IX/128 DDRSuperSavage IX/64 SDRSuperSavage IX/64 DDRSuperSavage IX/C SDRSuperSavage IX/C DDRTwisterTwister-KProSavage DDRProSavage DDR-KSonicVibesSafeXcelMagicLAN SWL-2210PA10xNeo-4Neo-8SK-98xxSK-98xx v2.0SK-9D21SK-9SxxSK-9821SK-9843SK-9ExxSK-9E21MIOC3Rad1TigonIOC4ImageSync 1STG 2000XSTG 1764Kyro-IISTG 1764X64GXDVDmagic-PROSC9230186C201 AGP86C202 AGP648FX AGP86C20585C503 System5595 System85C503 ISA180 SATA181 SATA182 SATA183 SATA1901915597/5598 VGA6215300/305/630 VGA315 Pro VGA85C50185C49685C596530 PCI540 PCI550 PCI85C601 EIDE620 PCI630 PCI633 PCI635 PCI640 PCI645 PCI646 PCI648 PCI649 PCI650 PCI651 PCI652 PCI655 PCI656 PCI658 PCI661 PCI662 PCI671 PCI730 PCI733 PCI735 PCI740 PCI741 PCI745 PCI746 PCI748 PCI750 PCI751 PCI752 PCI755 PCI756 PCI760 PCI900 10/100BaseTX961 ISA962 ISA963 ISA964 ISA965 ISA966 ISA968 ISA540 VGA530 VGA551155125513 EIDE5518 EIDE5571 PCI558155825591 PCI55965597/5598 Host6204650 VGA6326 VGA6330 VGA5597/5598 USB7002 USB7007 FireWire7012 AC977013 Modem7016 10/100BaseTX7018 Audio7019 Audio7300 VGA966 HD Audio83C170 (EPIC/100)83C175 (EPIC/100)FDC 37C665FDC 37C922Voyager GXLynxEMLynxEM+Lynx3DMLynxELynxE+Lynx3D910Victory66 IDEVictory66 ISAVictory66 USBVictory66 PowerPirahna 2-portTulip, power, switch extenderFPGA I-Bus Tracer for MBDSZB6120CXD1947A FireWireCXD3222 FireWireMemory Stick SlotRS780 PCI-PCIEasyIOVelocity128PCIO EBus2HMERIO EBusERI EtherGEMSimba PCI-PCICrypto 5821Crypto 1KCrypto 6KPsycho PCImicroSPARC IIep PCIUltraSPARC IIi PCIUltraSPARC IIe PCICassiniNeptuneSBBCST201ST1023ST202140XX4018ANE-344S2P4SSpectrum24 LA41X382C10182C10382C10582C565 ISAMC322TC9021 GigEB2C2 Sky2PCTN3009TN3010TN3014DC-290(M)DC-690CDC-3x5UTerratec TV+Terratec TValueTerratec TValue RadioTLAN3DLabs Permedia3DLabs Permedia 2TSB12LV21 FireWireTSB12LV22 FireWirePCI4450 FireWirePCI4410 FireWireTSB12LV23 FireWireTSB12LV26 FireWireTSB43AA22 FireWireTSB43AB22 FireWireTSB43AB23 FireWireTSB82AA2 FireWireTSB43AB21 FireWirePCI4451 FireWirePCI4510 FireWirePCI4520 FireWirePCI7(4-6)10 FireWirePCI7x20 FireWirePCI7XX1 CardBusPCI7XX1 FireWirePCI7XX1 FlashPCI7XX1 Secure DataPCI7XX1 Smart CardPCI6515 CardBusPCI6515 CardBus (Smart Card mode)PCIXX12 CardBusPCIXX12 FireWirePCIXX12 Multimedia Card ReaderPCIXX12 Secure DataPCIXX12 Smart CardPCI1620 MiscXIO2000A PCIE-PCIXIO3130 PCIE-PCIE upstreamXIO3130 PCIE-PCIE downstreamACX100AACX100BACX111PCI1130 CardBusPCI1031 PCMCIAPCI1131 CardBusPCI1250 CardBusPCI1220 CardBusPCI1221 CardBusPCI1210 CardBusPCI1450 CardBusPCI1225 CardBusPCI1251 CardBusPCI1211 CardBusPCI1251B CardBusPCI2030 PCI-PCIPCI2031 PCI-PCIPCI2032 PCI-PCIPCI2250 PCI-PCIPCI2050 PCI-PCIPCI4450 CardBusPCI4410 CardBusPCI4451 CardBusPCI4510 CardBusPCI4520 CardBusPCI7510 CardBusPCI7610 CardBusPCI7410 CardBusPCI7610 CardBus (Smart Card mode)PCI7[46]10 CardBus (SD/MMC mode)PCI7[46]10 CardBus (Memory stick mode)PCI1410 CardBusPCI1420 CardBusPCI1451 CardBusPCI1421 CardBusPCI1620 CardBusPCI1520 CardBusPCI1510 CardBusPCI1530 CardBusPCI1515 CardBusPCI2040 DSPPCI7420 CardBus5634PCV SurfRiderR4x00TC35856F ATM (Meteor)R4x00 PCIToPIC95 CardBus-PCIToPIC95B CardBusToPIC97 CardBusToPIC100 CardBusFast Infrared Type OLongRun NorthbridgeMem1Mem24DWAVE DX4DWAVE NXCyberBlade i7CyberBlade i7 AGPCyberBlade i1CyberBlade i1 AGPCyberBlade Ai1CyberBlade Ai1 AGPCyberBlade XP/Ai1TGUI 9320TGUI 9350TGUI 9360TGUI 9388CYBER 9397CYBER 9397DVDTGUI 9420TGUI 9440CYBER 9525TGUI 9660TGUI 9680TGUI 96823DImage 97503DImage 9850Blade 3DCyberBlade XPCyberBlade XP2HPT343/345 IDEHPT36x/37x IDEHPT372A IDEHPT302 IDEHPT371 IDEHPT374 IDEPyramid3D TR25202ET4000w32p rev AET4000w32p rev BET4000w32p rev CET4000w32p rev DET6000/ET6100ET6300IGA-1680IGA-1682IGA-1683CyberPro 2000CyberPro 2010CyberPro 5000CyberPro 5050CyberPro 5202CyberPro 5252Santa CruzUM82C881 486UM82C886 ISAUM8673F EIDEUM8881 HB4 486 PCIUM82C891UM886AUM8886BFUM8710UM8886UM8881F HostUM8886F ISAUM8886AUM8891AUM9017FUM8886NUM8891NUS201USR9979023CP5610V961PBC i960 PCIV292PBC AMD290x0 PCIV960PBC i960 PCIV96DPC i960 PCIK8M800 HostK8T890 HostPT880 HostPM800 AGPKT880 AGPK8HTB HostVT8363 HostPT894 HostCN700 HostCX700 HostP4M890 HostK8M890 HostVT3351 HostVX800 HostP4M900 HostVT8371 HostVT6415 IDEVT8501VT82C505VT82C561VT82C571 IDEVT82C576 3VVX700 IDEVT82C585 ISAVT82C586 ISAVT8237A SATAVT82C595 PCIVT82C596A ISAVT82C597 PCIVT82C598 PCIVT8601 PCIVT8605 PCIVT82C686 ISAVT82C691 PCIVT82C693 PCIVT86C926 AmazonVT82C570M PCIVT82C570M ISAChrome9 HC3 IGPPM800 ErrorsKT880 HostVT82C416 IDEVT82C1595 PCIPM800 HostVT8251 PCIVT8251 PCIEVT8251 VLINKVT83C572 USBVT82C586 PowerRhine/RhineIIVT6306 FireWireVT82C596 PowerVT82C596B PMVT6105M RhineIIIVT82C686 SMBusVT82C686 AC97VT8233 AC97RhineII-2VT82C686 ModemVT8233 ISAVT8633 PCIVT8366 PCIVT8653 PCIVT6202 USBVT6105 RhineIIIS3 Unichrome PRO IGPVT8361 PCIVT8101 VPX-64 PCI-PCIVT8375 PCIPM800 Unichrome S3VT612xCLE266VT8623 PCIVT8233A ISAVT8751 PCIVT6420 SATAS3 UniChrome Pro II IGPVT6410 IDEP4X400 HostVT8235 ISAP4N333 HostVT8377 PCIVT8378 PCIPT890 HostK8T800M HostVT8237 ISADeltaChrome VideoVT6421 SATACX700 PCI-PCIVX700 HostVT6655PM800 DRAMVT8251 ISAVT8237A ISAVT8251 SATAVX800 DRAMChrome9 HC IGPVT8237S ISAVT8237A PCI-PCIPM800 PMCK8T890 IOAPICPT894 IOAPICCX700 IDEP4M890 IOAPICK8M890 IOAPICVT3351 IOAPICVX800 IOAPICP4M900 IOAPICVT8237S SATAVT8251 AHCIP4M890 SecurityP4M900 SecurityVT8378 VGAPM800 PCIVT8231 ISAVT8231 PMGVT8363 AGPCX700 ISAVX800 ISAVT8371 PCI-PCIVX855 ISAVT8501 AGPVT82C597 AGPVT82C598 AGPVT82C601 AGPVT8605 AGPVX900 IDEVX800 SD/MMCVX800 SDIOK8T890 PCI-PCIP4M890 PCI-PCIP4M900 PCI-PCIVT8633 AGPVT8366 AGPVT8361 AGPVT8101 VPX-64 IOAPICVT8363 PCI-PCIVT8235 AGPK8HTB AGPVT8377 AGPVX800 PCI-PCIVX800 PCIEVX855 IDEVSC-7174 SATAGDT6000/6020/6050GDT6000B/6010GDT6110/6510GDT6120/6520GDT6530GDT6550GDT6x17GDT6x27GDT6537GDT6557GDT6x15GDT6x25GDT6535GDT6555GDT6x17RPGDT6x27RPGDT6537RPGDT6557RPGDT6x11RPGDT6x21RPGDT6x17RP1GDT6x27RP1GDT6537RP1GDT6557RP1GDT6x11RP1GDT6x21RP1GDT6x18RDGDT6x28RDGDT6x38RDGDT6x58RDGDT6x17RP2GDT6x27RP2GDT6537RP2GDT6557RP2GDT6x11RP2GDT6x21RP2GDT6513RSGDT6523RSGDT6518RSGDT6x28RSGDT6x38RSGDT6x58RSGDT6x33RSGDT6x43RSGDT6x53RSGDT6x63RSGDT7x13RNGDT7x23RNGDT7x18RNGDT7x28RNGDT7x38RNGDT7x58RNGDT7x43RNGDT7x53RNGDT7x63RNGDT4x13RZGDT4x23RZGDT8x13RZGDT8x23RZGDT8x33RZGDT8x43RZGDT8x53RZGDT8x63RZGDT6x19RDGDT6x29RDGDT7x19RNGDT7x29RNGDT8x22RZICP82C592 CPU82C593 ISA82C594 Wildcat82C596/597 Wildcat ISA82C54182C54382C53282C53482C53582C14782C97582C925Virtual SVGA IIVirtual SVGAVirtual NICVirtual Machine Communication InterfaceVirtual EHCIVirtual PCI-PCIVirtual PCIE-PCIEVirtual Machine InterfaceP9000P9100WD33C193AWD33C196AWD33C197AWD7193WD7197WD33C296AWD34C296WD9610W83769FW89C840F 10/100Linksys EtherPCI IIW83C553F ISAW83C553FW89C940FW6692 ISDNLinksys EtherPCICF32APlatform DeviceVolari Z7Volari Z9s/Z9mVolari V3XTX3201-3X3201-3 (21143)CardBus EthernetMini-PCI V.90 56k ModemMini-PCI K56Flex ModemCardBus 56k ModemCBEM56G Modem734738737740740C724F7441221PCI-ST32Genie TV/FMDVDZD1201ZD1202ZD1205Martin-MariettaHauppaugeTTTechDynalinkCoregaRhino EquipmentCompaqSymbios LogicATIULSI SystemsVLSIAvance LogicNSTseng LabsWeitekDECCirrus LogicWestern DigitalAMIAMDTridentAcerDellSiemens Nixdorf AGMatroxChips and TechnologiesToshibaMiro Computer Products AGNECFuture DomainSiSHewlett-PackardPC TechnologyAsustekDPTOptiElsaSGS ThomsonBusLogicTISonyOak TechnologyWinbondHitachiSMSCMotorolaPromiseFoxconnNumber 9UMCITTPicopowerMylexAppleMitacYamahaNexGen MicrosystemsQLogicCyrixLeadTekInterphaseContaq MicrosystemsBit3OlicomSunIntergraphDiamond MultimediaNational InstrumentsCMD TechnologyQuantum DesignsBrooktreeSGIACC MicroelectronicsSymphony LabsSTB SystemsPLXMadge Networks3ComSMCAcer LabsMitsubishi ElectronicsSurecomNeomagicMentor ARCAdvansysFujitsuMolexMacronixEvans & SutherlandNVIDIAEmulexIntegrated Micro SolutionsTekram (1st ID)NewbridgeApplied Micro CircuitsTviaRealtekNKKIO Data DeviceInitioCreative LabsHighPointSigma DesignsVIACogent DataSiemensZnyx NetworksAcctonVortexEfficent NetworksIDTFORE SystemsPhilipsCiscoZiatechCycloneEquinoxAllianceSchneider & KochDigiMutechXircomRenditionServerWorksAlteraRicohD-LinkCorollaryAcardZeinetOmega MicroMarvellLite-OnV3 SemiconductorPinnacle SystemsAT&T/LucentDolphinMesa Ridge (MAGMA)Analog DevicesZoranPijnenburgCompexCycladesEssential CommunicationsO2 Micro3DFXATMLC-CubeAVMStallionASIXIntersilNortel NetworksSilicon MotionEnsoniqTransmetaRockwellDavicomITExpressPlatformLuxSonorTriTechAlteonUS RoboticsNVIDIA/SGS-ThomsonPericomAurealADMtekPacket EnginesForte MediaSIIGDTC TechPCTELMeinberg FunkuhrenCNetSilicomLAN MediaNetgearMoxaLevel 1HifnExar3wareTechsan ElectronicsAbocomSundanceC-Media ElectronicsLavaSunixIC EnsembleMicrosoftOxfordChelsioEdimaxTamarackWorkbitAskeyAvermediaMSIAironetGlobespanMyricomVScomAvlabInvertexBroadcomPlanexConexantDeltaMyson CenturyTopic/SmartLinkENEAralionTerraTecSymbolSybaBluesteelVMwareZoltrixMellanoxAgilentQuicknet TechnologiesNational DatacommPacific DataEumitcomNetSecZyDASSamsungAtherosGlobal SunSafeNetMicrelVitesseLinksysNetoctaveAltimaAntares MicrosystemsCaviumBelkinHawking TechnologyNetChip TechnologyI4ArecaNeterionRDCINPROCOMMLanergyRalinkXGI TechnologySilanSangomaSolarflareOptionFreescaleAttansic TechnologyAgeiaJMicronPhisonASPEED TechnologyAWTFusion-ioQumranetASMediaTekramTehuti NetworksHint3D LabsAddtronNetXenIndustrial Computer SourceNetVinGemtekTurtle BeachXenSourcec't MagazinDecision ComputerQuancom InformationssystemeIntelInnoTekSigmatelAdaptecAtronicsNetMosParallelsTigerJet NetworkEndaceBelkin ComponentsARC LogicINVALID VENDOR IDcy82c693_writecy82c693_readcy82c693_initcy82c693_init: bus_space_map failed (%d): broken match/attach! : unable to map device registers : couldn't map interrupt : couldn't establish interrupt: invalid memory type %d , using %luK of on-board RAM, can't map on-board RAM: can't subregion offset %lu size %luchannel 0channel 1configuredwirednative-PCIcompatibility, %s %s to %s%s: %s disabled (no drives) %s:%d:%d: bus-master DMA error: status=0x%x %s:%d:%d: bus-master DMA error: missing interrupt, status=0x%x %s:%d: unable to load xfer DMA map for drive %d, error=%d %s:%d: unable to allocate table DMA for drive %d, error=%d %s:%d: unable to map table DMA fordrive %d, error=%d %s:%d: unable to create table DMA map for drive %d, error=%d %s:%d: unable to load table DMA map for drive %d, error=%d %s:%d: unable to create xfer DMA map for drive %d, error=%d %s: couldn't map %s cmd regs %s: couldn't map %s ctl regs %s:%d: bogus intr %s:%d: bogus intr (reg 0x%x) %s: couldn't subregion %s cmd base %s: couldn't subregion %s ctl base %s: couldn't subregion %s channel cmd regs %s: port %d: device connected, but communication not established %s: port %d: PHY offline %s: port %d: device present, speed: 1.5Gb/s, speed: 3.0Gb/s%s: port %d: unknown SStatus: 0x%08x %s %s channel: cannot allocate channel queue%s: %s cannot allocate channel queue: unable to map BA5 register space : DMA%s: couldn't map native-PCI interrupt unknown interrupt%s: using %s for native-PCI interrupt %s: couldn't establish native-PCI interrupt: couldn't establish native-PCI interrupt: couldn't map bus-master DMA registers : couldn't map IDE registers : DMA %s: channel %d: cannot allocate channel queue %s: couldn't map channel %d ctl regs %s: couldn't map channel %d cmd regs %s channel %d: can't subregion DMA registers %s: no known timing values unknown SiS IDE type %d %s:%d:%d: multi-word DMA disabled due to chip revision %s: no compatibility interrupt for use by %s %s: unable to subregion %s ctl regs %s %s: cannot allocate channel queue%s: %s %s to %s mode %s: %s ignored (disabled) : no DMA, unused (couldn't query registers), unused (registers at unsafe address %#lx), unused (couldn't map registers), (unsupported maptype 0x%x)%s: unexpected PCI function %d : 5597/5598: unexpected PCI function %d , (unable to map ctl registers): cannot allocate channel queue , %s %s to native-PCI compatibility %s: bus-master DMA support present: ATA133: ATA33: ATA66: ATA100 (unsupported), (partial support)not responding; disabled or no drives?other hardware responding at addresses%s: %s ignored (%s) %s:%d:%d: cannot allocate DMA maps, using PIO transfers %s:%d:%d: using DMA data transfers %s: restore for unknown chip map %x unmap not yet implemented for this chipsetpciide540620630630S633635645645DX651652655658661733735741745746748760962963964port 0port 1port 2port 3: can't map mem or i/o space em_rxeof: NULL mbuf in slot %d (nrx %d, filled %d)%s: em_dma_malloc: bus_dmamap_create failed; error %u %s: em_dma_malloc: bus_dmammem_alloc failed; size %lu, error %d %s: em_dma_malloc: bus_dmammem_map failed; size %lu, error %d %s: em_dma_malloc: bus_dmamap_load failed; error %u %s: Unable to allocate rx_buffer memory %s: em_allocate_receive_structures: bus_dmamap_create failed; error %u %s: Unable to allocate tx_buffer memory %s: Unable to create TX DMA map %s: em_get_buf: slot %d already has an mbuf %s: unable to fill any rx descriptors %s: The EEPROM Checksum Is Not Valid %s: EEPROM read error while reading part number %s: Hardware Initialization Failed: mmba is not mem space : cannot find mem space : cannot find i/o space : flash is not mem space %s: Unknown MAC Type %s: Unable to initialize the hardware %s: Could not setup transmit structures %s: Could not setup receive structures %s: Unsupported media type %s: watchdog timeout -- resetting %s: Media change is blocked due to SOL/IDER session. %s: Unable to allocate tx_desc memory %s: Unable to allocate rx_desc memory %s: EEPROM read error while reading mac address %s: Invalid mac address %s: PHY reset is blocked due to SOL/IDER session. %s: No GCU found, defered attachment failed Could not write PHY the HV address register Could not read data value from HV data register %s: phy read timeout: phy %d, reg %d %s: unable to read phy %d reg %d gcu0%s: init failed, error=%d : can't map i/o space : can't map mem space %s: timed out waiting for BIOS %s: pre-2.0 USB rev : can't map interrupt : can't establish interruptpciide_machdep_compat_intr_disestablish calledpciide_machdep_compat_intr_establish calledpd'(3  }? ? ? ? ?T? ? ? ?$ ?, ?4 ?< ?\@@ ?P ?\ ?d ?l ?t ?| ? ? ? ?  4%)*&'(+,$"IGLKM FH  `BtB BB@VjTVj BBWj0Wj BBHxj\xj BBtxjxj B Bxjxj B Bxjxj BBxjxj BBxj yj BB yj4yj BBXyjlyj BByjyj BB zj zj BBzjzj BB{jB B B{j{j BB\|jH|j BBjj BBP>0j BB>`j BBtj`j BB>j BB) >j BB\>j BB>j BB;">Tj BB;">hj BB;">|j BB(>Ȃj BB*>܂j BB+>j BB+>j BBx,>$j BB,>8j BB1>Lj BBD1>hj BBX1>|j BB1>j BB1>j BB|;>j BB0<>Lj BBX<>j BB<>j BB<>j BB=>j BB@>B BBLA>tj BBA>Pj BBdjxj BB=jj BB=jȈj BB=܈jj BB=jj BB=,j@j BB=Tjhj BB=|jj BB=jj BB=̉jj BB=jj BB=j0j BB=DjXj BB=ljj BB=jj BB=jЊj BB=jj BB= j j BB=4jHj BB=`jtj BB=jj BB=jċj BB=؋jj BB jlB BBGhjj BBG(jB BBG$9$9$p9$_$_$o$p$9$p:$t]$,\$o$p$8$XJ$^$]$o$p$8$:$\$V$C$9$9$<$ @ @ @   )T}$$($W?$$ }$$$$$Ь$(WEVrdroot2.5M@G` v}WEV]m  08`h LN<   LNdC` /mntp  h LN`@@<@T 08` LN<   LNdC`[~ [~ LN`@@<@TU + LNh b+ LN `rA  LNh LNA~h LNA~hM>A LNU  LNU  LNU a#saA LNk}  LNk}  LNk} btAd LNJ/ LNg|h LNbRpx \M+ LN, + LN+ LNcm_O+ LN+ LN<+ LN<i- qW+ LN.9+ LN*+ LNhZnK+ LN*+ LN+ LNhZx I/+ LN+ LNMj+ LNMjeKKcQB %877\hSb@ÁV7?$Yo0A{ejb)kC<8;T|(Na8]j9jv%g#qTScɃ0@•O N#SiB6Jr@lF7R9jE*,:4JNjdT0M2HY;rQAQ:ٓQl{[oB^]ϐĉA;5PDFX!Tn]zRybi7_\+{^cV-aoyܫGWi[^)Ǎ_C('Be9HCw4= D\%\T /etc/rc echo 'erase ^?, werase ^W, kill ^U, intr ^C, status ^T' stty newcrt werase ^W intr ^C kill ^U erase ^? status ^T cat <<__EOT Welcome to the $OBSD installation program. __EOT while :; do read REPLY?'(I)nstall, (U)pgrade or (S)hell? ' case $REPLY in i*|I*) /install && break ;; u*|U*) /upgrade && break ;; s*|S*) break ;; !) echo "Type 'exit' to return to install." ksh ;; !*) eval "${REPLY#?}" ;; esac done fi  . .. bin dev@ etc mntmnt2v:sbinv:բ tmpB usrvarinstbin.profile' install.mdupgrade install  install.sub md_installboot() { } md_prep_fdisk() { local _disk=$1 _q _d while :; do _d=whole if [[ -n $(fdisk $_disk | grep 'Signature: 0xAA55') ]]; then fdisk $_disk if [[ -n $(fdisk $_disk | grep '^..: A6 ') ]]; then _q=", use the (O)penBSD area," _d=OpenBSD fi else echo "MBR has invalid signature; not showing it." fi ask "Use (W)hole disk$_q or (E)dit the MBR?" "$_d" case $resp in w*|W*) echo -n "Setting OpenBSD MBR partition to whole $_disk..." fdisk -e ${_disk} <<__EOT >/dev/null reinit update write quit __EOT echo "done." return ;; e*|E*) cat <<__EOT You will now create a single MBR partition to contain your OpenBSD data. This partition must have an id of 'A6'; must *NOT* overlap other partitions; and must be marked as the only active partition. Inside the fdisk command, the 'manual' command describes all the fdisk commands in detail. $(fdisk ${_disk}) __EOT fdisk -e ${_disk} [[ -n $(fdisk $_disk | grep ' A6 ') ]] && return echo No OpenBSD partition in MBR, try again. ;; o*|O*) return ;; esac done } md_prep_disklabel() { local _disk=$1 _f _op md_prep_fdisk $_disk disklabel -W $_disk >/dev/null 2>&1 _f=/tmp/fstab.$_disk if [[ $_disk == $ROOTDISK ]]; then while :; do echo "The auto-allocated layout for $_disk is:" disklabel -h -A $_disk | egrep "^# |^ [a-p]:" ask "Use (A)uto layout, (E)dit auto layout, or create (C)ustom layout?" a case $resp in a*|A*) _op=-w ; AUTOROOT=y ;; e*|E*) _op=-E ;; c*|C*) break ;; *) continue ;; esac disklabel $FSTABFLAG $_f $_op -A $_disk return done fi cat <<__EOT You will now create an OpenBSD disklabel inside the OpenBSD MBR partition. The disklabel defines how OpenBSD splits up the MBR partition into OpenBSD partitions in which filesystems and swap space are created. You must provide each filesystem's mountpoint in this program. The offsets used in the disklabel are ABSOLUTE, i.e. relative to the start of the disk, NOT the start of the OpenBSD MBR partition. __EOT disklabel $FSTABFLAG $_f -E $_disk } md_congrats() { } md_consoleinfo() { } #!/bin/ksh MODE=upgrade . install.sub while :; do ask "Root filesystem?" $ROOTDEV resp=${resp##*/} [[ -b /dev/$resp ]] && break echo "$resp is not a block device." done ROOTDEV=$resp echo -n "Checking root filesystem (fsck -fp /dev/$ROOTDEV)..." fsck -fp /dev/$ROOTDEV >/dev/null 2>&1 || { echo "FAILED." ; exit ; } echo "OK." echo -n "Mounting root filesystem (mount -o ro /dev/$ROOTDEV /mnt)..." mount -o ro /dev/$ROOTDEV /mnt || { echo "FAILED." ; exit ; } echo "OK." for _f in fstab hosts myname; do [[ -f /mnt/etc/$_f ]] || { echo "No /mnt/etc/$_f!" ; exit ; } cp /mnt/etc/$_f /tmp/$_f done hostname $(stripcom /tmp/myname) THESETS="$THESETS site$VERSION-$(hostname -s).tgz" enable_network manual_net_cfg startftplist munge_fstab check_fs umount /mnt || { echo "Can't umount $ROOTDEV!" ; exit ; } mount_fs install_sets finish_up ELFa(d4l"4 (``[[<<<p:p: w  88444OpenBSD -LP@0! MP@ -0L@ 0pS`0& 0 /R0 R S000  P P00<Q  A P 00  끬00P`u E h0-L` 0 R   1S0B@Ct1P @D0t0 -L P00蜀 -L|0蠀 -Lt 00d, 0 R0 ,d -L Q렄> -L Q렄> -L Q렄> -L Q렄> 0-t0LP d0  a0R00BAq 8@0P 0R0 : 0言,d -L1P``8q8L  _PP  / >0S TP00OU0@0V 0000 00 0U0 0 0 0S0|0~ 0  `$Qe0 f` R*Rb(0 00dle$ee 0-LMPKUP TT0: S h4 K@$?P 0GpqЎ0S000K0蠄m @ -DL7P40  8CPD40S0o DP4000 T0$ |4CP 0d `4H$C0000S|TD $ 4 0S 0@Pc0S 0 P 0PS\hS $0   $0 <0; S 0 @c$ #"S0$c`V NP nyQ?N?&"0spw R 0Sj*0  Q a' \P X "0  dqS\峓0 0G(0 0 0 0  P0 0 0 0000000 0 00 00w` 0 B00y0 0081А(q@00Cs01 1R0R0R 00 l R R *p bQ &0 00$00S1㊧,8>ede(eff̀<$ؖp( -LsMb,Kx$ (0 b,0P a,  B=9, =( ,(0  1@(P  0 0pwOKP PP0p!dpdPPL@ + H R 818R^OKd0 !D@ +@ ` R 0REOK$KQ0d Ԧ(@+$,0(0(@0< d0 0d`K $Kq0dP P峦(`+ $LKC$K謀.A0f?Xf`fhfff -Lh9? -Lʌ@`nj@ -LMpa0@ 0P$ 0$"EpLq  G@Pp: 0,0 00 K3K<P7 R P$p0 K03K,p <p   ]0P@PX`$0 p S  0S@P$0S 0S(Kdm -8QL0~%P0 @c$ #"0iEp8q 0 30`p @0( ၤP0 `V`@ Pl 0S0C0T7NP 0  Z <ȑ |Q0,>f( -LB 09!g8u -MLM\"0`p( ,4 4"wp, R0@!S!긞llllllllllllllllllllllllllll8!vpt1 aARB^KPEPE@PH ,4004 4 J>K 0C8t 4 D , ZP20-S) MРBKAL L P0 m0$RpB.K0 B Bxpppp~0HM0<$Ph $Pugshhlzfg8hg -LM@pP4 'PP 0S nS6 =t`P00QD @ Q? P 0V0S D 0 YppV 0`pY" 0 0 p 0oSP00,K ,0@S00?p @ `M0 p000"S 0(L$P 0 0L4$hhhhh -LM`PP( @(K,pK 0 g(0@S ᛻$KP -0L 㫤<8ui -LMP@`0pC ޢU@ 0S T ! 0(({@i8u p-LP@>`P P@Op lP@ @ꠄ -2L`M2\Ÿ\[\ @ll2` j 0-t0L0PS Q @Q  P,0 r300 R00>Ԁ -萟0LS0 R) ZPp`0@S 0  |P |0@\. W%p Wn AM0 Roܤ> -LMp K`P @PUN  PP -LtM`P#rp/ P0@$S$ꨰ|`P@ (#rp3#Q 3 R(K ᖇP A0pS h>P( PPKp ᠟Po0: S S` 4(BCaMPf`2 Rf (`0 d |PE pPWi q(`@P%PXUN Xd1 RX  w31 RW1b1 ^|1 Z|1 t1SD1 OT1 D1H 1 D( ( | v(0AjPP刌(`v0 Rb 0 R^ vZɠ  w3 (` `HL p}<Ljsܤ>lzؤhkHkjjk -BLM0 j 0`PP\%H2R  0`P $K\%2R004  000\%1RN = 0@8P3o , ( F,,@K0d @P,@ (P @P<@md@d_ .,@K00/`Vp0@0S@0 @, 0C@$0(@,0 @\@`@0e0PZ 0Z | (d  80&`p<(@dl/_@TP0  R0 0, 0C@$0(@/,0 ؀TTk -tMLK 0@CP#81RL0S `f`0R30 @0@c!p(!0E`!` @b@cP @P   0@Q  0@$0(@0 ,0 \0`0D0PZ 8Z 4| jؠSk -PLP@@'P Z&`P @P |PlpP \PDP < 0u$ukkkkkkk -L 0{Fl8u -LM@`CV$ P$pKVh  P 0S -SD01!@!=VP0@0@V@4$l p-LMPP` 0S@x#@#@@ᚹP ( 0 @`弞ӵx TJl 0-\ P0LS@ 0S  0S 0S00> p-`PL& 0S# nS$ 0 @@,P㕷0PP@`00@,Pp4F0oS0 ` I>j 0-t0L0PS Q @Q  P,0 r300 R00> -0PLMP` <Pp$ ` @$K" 8`p`32$@0&T00S-4$ -LM` KmpP 0PP> U @PP@ -L0Mp| 0,  0DSH  `T 7 R P R   0S`7V 00@T0TWS\PP\1L' H700W@ TЈPPL7Q`' V\! 6`V&嶈\!@ 6`V&嫈\! l6`Vd&\堈\! `<6V88T&啈0S`!`! R 6`V$0&先0Sd!d! R 5`V0%u0Sh!h! R 5`V|0%e0Sl!l! R D5`V<d0h%U0Sp!p! R 5`V$0,%E0St!t!R 4`V0$50Sx1x1S TD`V$%0S `V1$l!!|t!pdh4Vd , 0R(K0SJ 3`V($\!@ރP% `V )0D#3` `3V\0އ04SS l0F@KLKL0 \0.0Kχ=P p8PP `3Po0Si!R] 2`V,ß(0 #P讇0S!Q t2`Vl0"塇1 D2`V<<"喇1 2`V"勇1 1`Vx"倇1n `1VX"uePKLK<`1PPVxA@T0"PbRXP!]`W^!1R!P!1 0`V!@1 0`Vl!51# `0VL!*8P0S D1 `@0V<!4@@ul>@lT^klllllmmm$m,m4mlzno`o Vnn >~> > .gp. 0b0CS/[>KQ0C 0C Jp g>K0C 0C6 BP<ϟ@T |6: S(  S ,llK`F `F@ pW@ԭP  P @TDP b>x= =%=^T= p=l= d= R$=.L=H=I=t.0=,@<P.<> =7<,2<.<<)< << < P< << <  < t V5  U,@ P0@X S P P 0; Q  ]|^ \ P Q U e/P 00BR SP 00BR SQRG  00B SQA `RCpRAqa@B 9 R.R600U0pup3S Q &R&  5S 5S]K `)p t8@T2 RS D"; 6q0#0P` ;@ 02 &Y>up@lzdv svT rvTv$@v(xy,`y04 v8v<@8vDHuulPtvy\uyx/@yvvedAw w,yyz$zz {{{({0{H{T{h{p{t{uuu L{{`\gfffX{@z yuv4vAxw{vwwxxxxylyLx(xr|{TyPzy0w@wny SV&0:6 S F %&T)`v: 6!&a 0 . `& @P 0 2" p0! $ ^ 1 6S12S \ 2^0B0  & R 0@, & l& 6 `@P p! 0$@@T@!^1: Q0 &R0:S P3  3Q2S*& R,C 6S<3B@6 L!!X  g6ttR 00 T@|5S%%R005  P0Lc5 0S 05 Q5 5 % & 6|Q,|Q8|@|QL|T%5|Qh|5S%|~|TDPv|t|Qo| T$@T , 0RP(K {9 w9 K@ @b5 K@5 pP9 % R%6"&  P660X*l0 ^PPS00SB %`5R> P;X9:@X2 &0ST#3*&kp  6PX&  \ 6S X*cQP50U&00Q* ^ 000S 0@6 # 06U0 $!4060!40 4 05 0!4 0  40 ,40!̠!4!05#Ƞ##0  %$0""Ƞ"$ %@"̠""    $ !$ )0` (00ST 08 4  (088 [NKR@Dd@D%6|(H 40S66 { &Fp 6P &GX 8Q  ( 520#$ 0 0 P0C"$ "40 && t9  0@!Nav. 4 0 %9R X2 5S X R 0SR0aA006 6 r0CC C C C CCCU B!!!Ƞ C CCC CC  0C0 [0C*00S @T X&U0& U 0A Ah 6U e[NK@D@D68+ᐏP ';00 5 % \6 S(+u 5S,+m 5S0+e %?RR5 c02?  5 % G Q(<Ps 5P n @ S%X<T E I @ .6S UoPPM&z7<Q &Rp5F0%l7%:<R 66  Qk T  Uy,%U78R7 D0M7 PI7\F7d0B7p?7x<7T 047 07 =:&0&7&w:7A 6}0#0P`6 S ^ʠ 6875oL6Pz \6dJ:l6A -LM00PKpa@ 00p ` &P2 `00PU4 @uT <T  0BS0^T0(@ 0 0 K?P@ -P0(P0 0( P 0`%PKd$K 5P@$0 R 00(@< 6d$1d{ȃ|Ѓ P-L o6l6누 -LM( :P( (( Q5 (K!y`P0 0S- =r@PS 00$pK +PcU% iU, lU3 oU: 1Q@ Q 0SP0$ 0 Q (Q K( mP($00dP($00[P($0 0RP($00~FPt *($0$0T9P@ *($0(0b{}{Ȅ؄Є 0-LM 0 P`xX0Q @0D0 x Qu@}u 8hx{$$0 C 0+ 0| B-00 $0 0 0+ -00S 0 $: 00 $ 00 $: 00 $ 00S 0 < 00 00 < 00 0$ 80 0 ( =K 0  $0 $@+0S  $", 0 0 $ -LM0@S 0 K0"0\#0 00 K0" S#0 0`t - LI#Pj8ot < - L;#P\8nt H -LM K00")#PJ8tT -Lthw 0$w` p-L MP@`0KP 0S00Kp 8h p-L MP@`0KP 0S00Kp 8p -0LS@ h?7 0 << 0 -@Lc)0 0 -@LWht0 0 D0$ D0 -LM Pp0`-S,0C000P(K 0(P #@P  0SK0 Q0a@$a;  @x p-L0 `RP @ R sP0 00 0 0 0 p01Q @ Q ZP0 000 00 p0Q @ Q AP0$ 00$0 0$0 pp0Q @ Q (P0 000 00 pp}~, 0-,PL0@S N000@0lp -0L0CSQ 0M - LP^0? 0  P@ ^00 ,00$0 :deȃ p-x`L@PTd0 \SvpHP@Kv8Hvp$Bv0plptYP  -LMxR p, `0 P 0LS 0 vPs@sT   v@Q  v@T] @a R_ ;         0 Qd ~@ X z #L v D %r?QPP  hU c _U YU SU  MU @  BU   @ 9U p 3U  \ -U L    @ $U 0   ( UN0  N U   U_@  U@ U U  |Ul 0`@  < S S 89U      U  U U0S m\0 `p \$ ^ 0 R AdPd␐K 0d'ˉ0 `K0p0' W upsp pG\W KkpKip, 0R(Kr0S k^0d ` R@ xY0S  `R^  H. G9,C ?@083U5  -@4)6% 8! U7 h@4 < S2t 9U3     @U/  /, 1 3 *0S3@T P`K0 0d$  @TP0xtld0/X  R2R4@hU   L@]U ` 579 ;.@? ;~ [ zU: @:pt<dp >Xl F LhU=  =8b B ,^U<   ;V@U  S?  SuJr KX @ R @> ;  48 05  1sts@w'+\$"0! 04t  4jsPIfsPEbsPA^sP=ZsP9Z健uԊ@PԈx 1AQ}ApQaȇ1ى 8DU%͆{, AՈy 9H54$̆  I!@P|@qP`ɇĊT0؉0p|Td -0L <8u4 -#L`M#0㘣p , 0x0 0S`pAdP_ UH#Xp a0@S`h4,`0`K1`x ` Pxt KP4Kx PXqpB "Px t2`0S0 t 7` l h 0SD PKx@K 00 Q/ PP>P `000C S61|K 5|0`SpP $ :o 0l0 00 Ql0S$h0S xrP(, 0R((K` t c` 㨶P  0l0 x4Ps2\xrprch `c2X /0 [2ussdlt@ht@lzgtȋt -0L 0؆<8u܋ -NMLMpp0S( `@pH P2P"L2Q0T INK@D@DP4: S~%@PG B^KPEPE0!@j PINK2@D2`1@D2=*x'P0S> 1 R rPO|1P l.r( 0RJ$KIKAA„P01 R4: Shl00r rYl?00 rKAAᛄP%4R%4Rh0 Rh [7l0S@q0Q넥u|- (tx@0ԋ -LpMP@":Wp1 F0@-SLlllllllllllllllllllllllllllllllllllllllllp4!41,1Q`$!  1Q\ ` \# \ 10pKP.0: S 0 0 0 0 벅 뭅QP @P PQᝅ (0hs  |tx -LP(@`pB@D 0@THXh t0'l 0@8Pg 0 ,0 0 0 p=>P?> *Q-L QP!00(L\ X\hPQèX0PSw84'<XPXP X@ P PXPPXPPP Qx XXdX\XTXsHXPPP T {į Ԯ\, p-L M`0P0 @cP  0 R#Kp 00B0 Sa0BSW0B? K Q02\ 0A@ $0KLA0BS70B忟u| M-LM@0T`pP T0P  t 0@T00 0 a@$K v 0-LLP0@S0@000ST - L@0PT -BML\< M @$ BK L, :L H D L 0'0LD$媲PG L׶P00LpP :^P x 00`P<Vk α;P`KpP ıPc p;@TdKBKJ0PJ _044 PSTH440LD$bPHʟ@, 0PR(KBP=V4 % 0S!T 0S `T@-P44 4$  \%P44 4$   @ xW@$T @$ 44HX0q lW@40@4 j0gHC10e _WP*VY 0SV BKJHtJ 0R0X0SpG @0P 044 S H  5W44\0`P0B.K B B8P 9V`P PH4 86H$ 264$0BSH(̑ W@H$0@ 8lP H\P  0D V@@ (PBKJ0J }044 S(  0V@@ ,mPBKJ0J _044 SH, 0 T V@40@4 ;;SH$( (HPBKJ 0J:044 SH$82PBKJ0J $044 SH0}PBKJ 0J044 SH$4g,PBK@J0QJ 04SHO<OPJ PE P@ P; P6 P1 pP, `P' aB0S0SH8X:XH`0B8̑V BK@J0pQJ 04S   U@$ @$ W @0`Q 04S  dU@R@ VH 0` 4DpP ɯP 4@T000C S 4$ 0 a4 04S   U 4$ H 0 H0ࠀXX XWM n@0 @pP`8 T4 \0 .0@p`8 Uk @@RkA@HX0`4t  B9P0  kH4R O _U@$ @$ ] XU@@ VWT  @0 P`p<$ F T 0 0@pT`< k @@kA@H4t 0'4$Rle U@@ jH4R O U@@ \H0hC1 0S U@40@4  T@$ @$ uX\ut|A B|xذd,V08uvL`p|ıر(HBhBl -LM @P\0@SlPUPJ0p,0 ,00P,0 Ap0@ @00@0  080,@ `Pa0P`0 ` @@0P0 P 0S S/`!1X  0S ,00P,0  S(Ko 0S1  03 ָ P0 ͸ Ǹ ¸徸_00C   l 0⮸BX 0⩸:ijAL (0<BH`h PT p-(@`TL:P0(@e/LP 0S0Ppq%p -1L M @R_1 R 1 RI a P|Vxx a0(KR@ A0BCGpD@EPF`H,KP`@ PpR`1`V (0 (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x   ` h p x aPPP,@@PD(P,P`V,(0St$Kl0ST`h 9PT[(P2P@T(8Q(먬ArdAشedAĴsd 0 p-0008L`@P0S pd P PUDD Pp(p(WEVgdedAĴ p-L`@P\P e/P  V  phs1p $, -L─ M0 `("HPpP@0,  40 0 `("8@@p00@0N 0  0 00C 0SV 0NPj08#HP P0@@4Pa 4B0Q0, @PM 0S# ,F 0S% ,!?10!R ,71 RV, 00CS0U, 0 0(K `1,!X  0S ,8 0 00C3 0 01 0 0 0 00C 0P ("8 Ƞ @,HP``pP00@p@P,0`a 0pݶ, (KoQ, (KoR\|xtBtD - LM,0 g3 嶶 Rp3 !h家d 0 ᩶T 0 ᤶBCD@EPF`Gp@ A0$ P@ P`p唶 0 X02 R00CS00  0( y, u0 q8 m4 iG<PP@ 0 T^7B0S007"0002"000-PB0S00&{2~Tc(@xTY@TQ1 RG G\@0DSA e/P.`PH =0@PD0@0. 1!먦T$ -LM< P 0P@ 0@p" Xli 8 < 2 4 0 , ,0X}y 4 R0 P0`@ Z+y ,0Rea R(o <  P1 P 0p`@p@0 p pZ p 4 R0KZ  R8 2t0 8< 8 P80<" 0@0 @(K W<0@ @00@ 0 @<0P 8  P8 |0Q0K0W0pKYy p QY  @P`P`$0$  0 @P` -rp㠠L⠀.P9`@ 0ᠠ Q PX Q PPW 0-L@P @TP@P  0 -q0LP0xAIP@0 S 0C00?S6 U9 S74+r0?S0UaA!   _ P0S02P 0S 0`00 `00CS`0X0  X0 Z0?S T.ZP<R@0 R 0JX JtDxtt -SLMn UP !dP( uPYs W,[?\3pX 0d[ "PHh,K0Si02P 0S ȟ0`00`00CS`0X0  @PHD DT X0, 0HDR(K*\ \UF H D @ <$ @HT0u0 z   @P LD 0PT80P`HD  0 HD 0 p5  B$ 0S @ TH4 DD HD$4[VP Mt&8 4$ 0 @$ <4 p-\+\PP `0T `"VBK0A0Ac@PV0"S 04 R<\@ K 08$44H D +V -VH$D4 Y0H$ D4 }D|+4[Sm @0@ < HD DT m0E(PK@4TS,%000ӑ%0COS񟗣xLxsssssssssssssssssssssssssssssssssssssssssssssssssssssssssss4xwssswssshws$wssssssvU@P0HD DT 00@H4 DD <Q S25H$ 0S @H4 DD +HD$  H D$ P( 0 0@ < 4Dp,[ 3 8$ 44 )P4( 00@ < 4DR,[@p8D 4T P4(  R0b#5@ < 04D",[p8 4$ PT( 00@ < 4D@,[p8 4 $DP80p,["@ < 8 4$ PT (0$D0c04D,t[-W+W00pgb 1m@ 0!8 4 @n,[@ < 04D,t[-W+W00pIb ,1O8 4 PT<7 PP@` 0`@P Kp 018$44LH D x婡x0 R  DH D d͋0 N@ < gX D H D$ utxt?vY@tČ -LM00S)PP!LPP`pD (1 1P: 0P@`UpV `Y 00 (Kq 00`p0 @P @Pphp p 0q` D0t0P4 0iȎ8uP< -LHM0L X R (KP ,4 RF 00C    ȟ 0 , , 00`##p@P0L# @Ppp@P t Ql h0 K , 00S##`X@LPP0 00C C  L`(X9PŸ@ `0 S@ < @ K @ K R0H D0 @@ H0  S0 00# HK  8 4 X`L ┐)pY  `8@HPK`Q 0 P`8L0X  @P T@ P0`p@@ K = TpWಀP0Op5*  0} 0d< 0sAqP 0kuI 0b0; 0\*P>a`p0` ,p 0 SlDPU{{X @@ XA@788uX -LzM0 ,0 '00'72 A P9`p@ ^ @00 0@  0@ Z 1R 00C2F( A 0h     01 @痃&00@@Te/ K1 0(K1 2ACl6 >0P1  A ^!07!Q 1vK 00@0 @H 0K0@0 @ K!Rژ14p1  `1   c 1 Z ! `  0P@0 0 ^y/K  R0! 1 1Z`yKd 0  @A  K9@ @00@0 Z^^A@A aYI R Q1SC ^@BT:^8Py/K  R0! 1 2(@K2 @἟@a1 A SW%; U U (K0L1 0/SL" ! P ! 婂Ke/5B, 0R(K1P,!K $0BQ0B 0L K 牂zP dZt 0@Sm ^`r!/ 1 P@`p0W`RO {KQ  !  K @ P   R0S    R@PW 0SW/!R'V{KP`p  TUU0T0T V @NU`p!1`S {oKQ0S T20AT .ǔ -1LM R 0, R (KP- 00C BC(  P`ɯ 0 @P @Ppp p @ i!#p@, 0@`pqp h0q H0H@)Q9V @@ 6VA@@8u -L(M280 4 400 , 8` 9ᘀ@\\@P`pP@p@ P04xx! @P0@K0p0pp* w1 P8 84 0P`0 10Z  0 R00^$/ ,0X%! 8P4O p徉q 0gx h0^h L0W(K0@W0 K $4-YD8u\ -QL M, 3 aIZ00,0(Z` (Ko,  20P` p0@ (Ko,0(,  0 TT, (Ko6 88 P,0 (Ko8u0 -$ML4 `)p@@0P\0XX"`p `p0Pp] xi 2 R B0  00蠤(Kf A0 SP40 @P 0P /0U T04 P ༙9@㘀p@ 0`Q 0 , 00K 0S@P`V00 ,@ :,4@0 O09 T 0 TSq 0h0Sy h0ZSQL# 00L U@88u\ -QLM`N aP@U00? (Ur \9@ @0@00 ,@K$P K(` Kh5P5P PPP H<Khƣ 44P(0 Kh8u0 -LMPpd U a@Q00ϓ4 TQR4 "<  0S 9@ @0@084\20    8408#8^8<0 @ 0 @ 0  }P `   R0SRP `  \p XG(K. @2@_<4 8 8Q`P弙ᘀ4O/4xP*80P` @(0 @Qd& VS:VXU W<04aP45P 4P4P @00 0000*PK0@ @00@000\00S a0*PK*0K 0)0KPP( p0|\ `Hâz;U;U05S @8uDrt -L M<G 0PP@@P!0 `p0 `p0 , 0 rT 7<@ 0@,@Q0 PG 0PP@@PDL1` X0K0@TP !p0 `p^pP`+ 7<@  0@ 00KQ V$ 0KP,0``|dTP00KP0(K,0s\\0 (KoIq880 (Ko@U$8u -LnM0e/ K,0 et6tQ0hFh!d*P2 X坖P: Lf@P 啖PD p@PT`U Q 5QP` 50P@!`pV5 R`00CS`0X0  X0UdQ00@@V UP`8#8@00, P  o,@P0 $`p `p0p pw ,0@P0 $`p `p0p p} 08@P0 ll$`p `p0mp px 84@P0 $$$`p `p0Ypy pl 484C 0C`F ! R! _ 0SST 0P`@@0@0Q a H $0p`p@ p@ pQ    11({ |1yP0@`@w_K`0@a0@TḀp+r?K 0S@ $@0Poᄟ KA !_0B 0S" 0H @P2 0<S0Sk* P0xx.Ke/)PO 0<j 8Su8u (dp -L*MMgKJ0J e/ ,0 0: |P |P |P |;| KAA  HPD[( K0S4 (K0@ @0@0 5 S:5 5S:5 ՟K e/ K@ e/ < JJ:K@0@: J :   *P |@P lPuQUQ 0ApS\                                                     Ĭ  t            <            |p`PD ,   ̪ ة p $Ĩ xC  I0``: @P 0SDHK@ @8 8p $`KPP  0 F K y % e/PAP< NK Ae/k 37 RR qI@ y y y Pyǟ, 0R(KDM k$7 Re  P 7 ǟ e/7NNK@D e/0  e/,e/ ( h\~ {-IUN \@@Ph  0᪲ `@0p`p @TP0@ P埝0 0  0吝nU @@ 0 c5 R  [ \WU 0N K0 $E MB '> <: 7 3ğ$00s03S0'M' Ke/P NNK@De/ Ke/ e/   TH 4 R <4 R 2 4$:  @P3 @xxl#00@@T  ,P~ e/WbH(K0S (K (K@V0`@ N \ß(KX3开(KⳀ 廅Ką 弅KNKe/ @2e/  . x  2 R `00CS`0MX0  X0q0 |:K{*KX 7P2 RD2 Rb "P Pl"0000ӑyS PH"0000ӑnSP$"00ӑyP+ @`UPYAG`1 fZMW MNX 7 PPI 0SF 7 1x?  j@P e/O 00L,(6)L e/@PG 29H~6@32 u6jXtt|Ȟ 08uxrdA nhxtlv4@hX3 -X0L R H0P808 0,`B[BpBt -Q@PL0. P0 R 0 0Q@P`0 p8W  0 QFd aB0@ 0PV0@0Q@`pxBpBB -1LM RKxa0S l!00CSP\QT1  L1\*\&81 H@ T\q 0fQ_ 00@TP 0XQ00 AL\ 000SAQ0 0 X0@X$ KK @ XP@4AxBD pBBpm@ -?MLML$LD0\,0 P`040S- S! Q4 0Q Q R30QC00, 0 R(KQڐUA0p0\?KK(@D@DV ?{KL(pGLCpG(0K8 P0(K  0P?KK(@D@D?+]PŸ?+]P㨢00?K@ 3N@PdŸX@'  SPw ?K#N e@ PiE0"8AR?+]PʡYE!)AC1V\ pǏ 0(@K 0?KK\(@D @D PwP[0E0L!@0 !0T01 R DWFPDQBP@+E  @0@09 E  @E @@D  @|UDX @DT xBupBBmP |tB4\ 0-QL@T0 R 0 ]P0 @ 00 \Pڜ0 P ;;Sx0@@0P@L0 D&@0D, 0$ `@xBpBBtB -?MLMt0t` R   0RKHp0S?KK@D4P@D?+\P{pBuxBB -r0LP@4 TP< P002`V%Pyڀ;;S@[h00`2 0SPPU>TA y42 Q P>?VU@@Tʼ!000PD0 SX C0SE C0SA C0S= TU@H{?<1 4t?$o? 0Q 0O Q f P@`@@C0S C0S C0ES0X@0yCT 0P |?@4?00xBBpBlBDptBL -t0 l0RL T@ 0 R PwC G?pBlBB p-LMP K`@P1k0P/T  L I @  0UGPKpT 6  . + @@ & (  BX   -L$MePpfx5tp5 llu d%d5P||(U  %xP4p 5Q ~0STP P T Pd0: S   S  S00  0p 0Z0X4X$T4L4DqB0S0C00Z0 P68U #PB0#h>Um t# P00pn P3Q  0SdL3L# 03 (K# <003 "?;00Zr H2 ARRŸ:0Z P% 2 ZN 8pxŸ?;0P`? 0L L9 T2@P`? uv ;0Z 2?+ "2 P1!1 1!0,H KTP00Z00V;;S\ @1`V 8p ?h1!``0Q 0 vA0 =A0 =LA0 =X0 Y= 00 KA\ 0x =BDBpB BxB4Xm @<d -LM T0St0Sfc0S3 RCP$K sF0S 3 R 0 0R R3 KtC 0 S `#000 R HS0S@ <3 R(00CS00  000`V 2@ᥝP[2@0} +0 0Gr00d2 Rl2 Rd `2 RxL00CS0~0  0(24 a#0Sy B"Ps0: So<08@@k10G@f1!11 R^ XAP[BXDP;e0L9;NK@D84;NK@DbLP*; q0S Fp006P000 @0@0:ulBtaX4pBtBlD! 4\ <L NhxB<D|B -qL R Q3!  0 XRO PAx` wP`V 0SDQ@%@1S!#100P!0!  0 P " PZ `Z `FVڌ ef lR:`0 R PI:8 `00 R  =:DBD D -LM衟 0, ؑ0`PpH@ 00 T0$P1= 0S, Ut1 RI d :PP @ T 00p34P9 P6U0 R5 9P0@00  ,0K8P P@0S 000(K 08PH989(9DD8` -bML,Mⴡ0,0 P70DP10 P,x1 R.㨇b}K(pG$pGTP0  0BS'|)P +P2 DPK`<0KP0( =&, 0R*(K$ P Pb]K(PE R,PE0 <P`D0K(P'P  tuDt -ML M0,0 vP=0DP70 P2/P/5 R /P((b}K*K(pGH $pGP0  0BS (P ,DPK`<0K1P 0( J.?&, 0R(Kb]K(PE R,PE0 <P`D0K7+PXD0SL4 RM(PV'P.DPK`<0K\K(PEPEP0Sx 3 R}( 0SʢS0S3 R LK(@D@DP0Sj h3 R ( 0S0 0S<0S S(3 :KHP P P00S SJ 0CSDPK`<0KX0S B0S 2 Rt"00CS00  0000S3 0S0 42P+ < "t8%1 R 0 0Sc)( 0S^( 0SG@PDb]K(PE,PE0 <(0S dA0S X1 R=@!00CS0>0  000X`D0K'Y< 0 '8v|00 a-zDPK`<0K-|\s\0 k,H0 f, z,w w,uDLD, D<xtH -L%M$MŽK5HU@(KHd%,@ ٳ P-KL' 0Z/S /0 0 0*KL5%K(II "000 P60S \R0S P2 RO4"00CS0r0  000,KI`p-P,xPU~N,PM11 0,4 K@,K`#0S XQ0SV^4KQ..PWb=0Q!&PO`20 ),K+@0 R 00CS00  000P`P,K! )@0 ) )DLDhD<xt -bML$Mx0x@ R  h.P P L0 DPb K@$@ 0RK ipDuD -bML$M 0,0 @P T T 04, 0Rp(K0DPA0 P0SN0 XN!0Sb}K(pG$pG h1h `b}K(pGT1 $pG r-PX r,PDPK`<0KP AP&P0S 0(@P0*wP0S @0S ,-P+P8 D0 00(ouDDDt<40 0? B -T2LMR`u<0S1,4P}""0\ 0 0"Pl1!!0ȁPp P+0@PB 1 V PaB P 0O0@U <01 1 U Pa`n,` pPoP` , `, 00 0Q ,P 0  `P0SPQ~8 @0 0@,0 HBD8 -PQL`tt 0hpcPP@@ W0Pd0U`00<PB 00b0< -ĀL0S` pP@P 0@`Ph0lP/`T0 P<0`  `00BB8 -QL`ڀp P P@@ 0Pd0U`0 0cPʥP eQ  -a=LpM00UpE``a 0 cR#?S OP/0@TP0U0 P-0 0 20(KR 0 P0TK=Pa=p Q 00C h2T 7< 0< 27 0 2B| -LM a a= 0T ^,  r  K PKX0S`pP0 LPU ?`p O@P 00Kڤ\,K  PU ? U?l1 R \1 P0#2P ,\ 0S4  (K6!0P20SKP$ a=x Q 00C 010S ]6l 0d (2<0 RK6$ 0$ 2BP0lX -LM Qa  0p" ,0   KFP|X0S<0 0@W0 m 0 cPL@_1UC@ ,K  00KR PKڬ1 R000  PJ0 RZ0O`VpW' ,Q 0SE  W+ڰ 00 1 R `(KT@PPV0 R  B1V 50T s1<0 }V,0 R hP Q-LP`.Āp 0cP 0OT @  ?PU`V S0U 0cP,0PPB 0-D0DP LP0,@  `0 0hB - LM q00l ?S 0P`PU`@00(KR`1 ȟ 08 80 4@ !,0( K@"4@@4@ 8K8P6 0i00KP`PU`8KP` V0 0bQ  Q 0PU`0V0ʴUP QP -@L0S< 01 R; 5P=qaPP RPR $P PP 0@Pڠ0/0P0 l0PPPH/PP 0@BDB -@2L @RPv("0S "00000aPv0 0bȟ` 0 F!#PY(% &P@T PUJlta0`!0Q0:D0 R 19P/X@P`P0 00 0 0 0S @0  NP0 ph/ <D 00 00T8BTD  -0@ 0RL0 0P00 0 0 R ? Rʂ;;S \< /P4?;/D 0-A!0QS0 L? Q!ʁ P$~ Q0 09P 0@ 00 ~<|.0 h?;.0 P<.0P0DBP 0-`@L0S 0HP0S 04eP000.BB= -Lp`PP0S 00SE  #0X @TOP0 @0S X ⰪP00 0$ 0 000 c#P(@agPP 00T $00PBB 0-`@L0S 0HP0S 04xeP000.BB= -Lp`PP0S 00SE !#0X @TҎP0 @0S X 3dP00 0$ 0 000l "P(@fPEP 00T $00PB=B 0-`@L0S 0HP0S 0dP000-BB  -\qL0`SF D1#41C0b0cQU R$0S A0S U3 P U@ $`@ ᳩ00000ZR @@U 0$`00 L KZ@P$@(@UfPBB9 0-`@L0S 0HP0S 04{dP000!-BB=@ -hqL0`SI P1"#200b100cQU R$0S A0S U3 P U@ $`@ 000000ZR @@U 0$`00 L KZ@P$@(@ePB/>3B9W|Q  @4S4S  P00q& -$L0 03 Py0F#0  0( PnP0N 0 Pe0V#0  0 PZ P^0 PQ n]PDXP? Po000c@`P300S S, S* S] 6b-  0@pa- p0P`@0S@b-P ``6 0q P_ T0 t(h5d (0 P(u0hqDq (,$ -LTMs0 0 PP2b@ @0R2  0@`l@KS<<<A 0z Pt 0s P \2 TL( 0R~K a=0A 0 P 1 4(1 0L P1  0D P1 0< P1 04 P|1 0, P`1$ 0$ P1* 0 Pa=0 0 P`; 0 PL^P YP00S S S S  HPT0 l'|`Zcx(0 H'qu0qt (,$0 \hZ0 h mQ-L uP  mQ-L uP  -2L pRPi nPbb0@ J 2 D 넢  > p2 8 \2 .2 H2a-0C 6 am` &! 2 > @ F 40@@1 N @ V 40@@1 ft1 ^P@n|P0@0Pn000c@07P 0: S  0@P`0@0S@P`   mPP` P`PU`0@Pmh (,H$0 KQ-L tP ( -PL`LPb-0 @ w\1 qH1 k4q e 1 _ 1 $Y0 *S0  0M0a-0C A aM@ ;<P0@0DP0: S 000 <P") 0h$ -!L@$P) 0h$ -L@Pd0deP (0S (08 $(0 RuP ta8 -L@ "Pd0d:P (0S (08 $(0 RJP ta8 -L@|Pd0dP (0S (08 q$(0 R"P ta8 -LpMp@W0 P`0S 0 R KP0Sp00h0 Rh00HP Kd(00 3$]( 0,$BDD|\ 0-LMPQ@0P-0Q   0;0Q*0 R0 RP 8a= 0rP (h 0K0h#P0P 01P0 l DD8(, p-LpM`@KP X0PUH0 Q Kp0 Q q# -PLpM`S@ p0S 0 R KP0Sl00h0 Rd00HPK'00 #' 0|#BDD|\ 0-0LS@P04 00S0 0  000h8 -LpM0P/Sp/00/㬎`K@P+ 00NP 0pP0 RnP:P0T3  /0pG0$Kl? 0-LpMPK@PK00 R |0: S b-P"'0L "PU '0 "  -ML\4M T4` , ( pᤔ ,$00CS1110110 w"ß, 0R(KmPB &3@P Yڌ3 R3 =P0\#" HG"  $3 ,3 P2 R8c4S 2P 2 Ru 2 pB0SF R0P0Q0S<"0;0QY0S8 TB0SH2 R. <2 0a=C}I.K B B$ (K0pC:P4: SB^KPEPE!p@F&! 0"U\1堂P DP 0S8A0S,1 R  B]0t0C @IKAAP40S$D0  d@%4p ! u(,`0tadlDD84a ? -LtMpPK@P1 R! 0R) 0: S/ +PP %0` R "P X  KX%0p k! 0R H!WP0 @T!((0 P0C 0 p-LKtM @`KPDP0: S  0Kp 0 M%0 !hH -0` LK$KP P0P p P#%X0p RD0D P0$ (,0 R00B -̢LP e봒00@T) "0S@T B 0S 0x0t2l P P2P~0P$ 0" 2 `R. qP00CS00@0;t0  R P- U. 0S  @;t0 U@@0S0@q< oP  P@0S10 2 V0@0E 00CS000P p 0 S ʎ lU$\ % $P @BBBH0xtt  -<#L M0`S$$P 30C S1<<|<<4< <<<<<0""2 R D0, K(0K-P0,( 0#0\" Pb]b-0@ PpK| |@Dp W2 * RV  R,  R1    R 0!⤛ P;01 1$K R1    R!  R`1  aL!0!00 +P5#0 0 nh0 0S 00a͠ 00  00~PJz#0SuPCq#X A0 | BBlP4  8 0-0L R0@T P@T 0S0S 0SU 88Sx@T0 PB8u<d0 R00T0 RL0  D0 R80 R,0Q 0 cB@$BB p-@PL` 0SpWPP @P0/S/0C0T 0SD0 00@ `PPPPpipBB -0 0R000000L R0000 R0@00|0 RpUWl0P PT0 RP(/dp`B @-PP:P 00S S R U2 /R/7R+ /R7R10P0C U P 0B0 SA@B0 7pB bTaBWB0 "Q0U S- L Q0000L B 0Q000B 0Q00P000BQPQL0 S0W0 ̕0̅  RL*G-MP : \ 00S S R 0 SY/QV7QpQ/Q 7Q 0AA1/Np 0\Ѝ Rp6p  RP"00NPo0A@N S@'.@a0N ɯb"T'nɯR'.0 0@ pS 0@ p pA- R`PN) \1>A P0 0` NA 0\!00 ` P0@ 0\!00000@\\N@0pXW0@ W@%2>&BP` PA:@0pXW@-@S1Q0 \ \ PT00΅ p-0LM @RPQP Q `K0 }QKpj9<P}xt -0LXMp Q P@ a Ht`K 0@oL0PtK4@K- 0\ 0R Ka=@jHL( (0T@@WPu XL@ -3LpMß@0 ßT S, pP`$T2 R0 CR s00f, 0R(K}p2 R T2@K D2 R@u a *H뀐K 0@ K2PK0C@1Po0 @P @@u!00CSBa }utA |0S'0 CR F0  0@10 CR 0,S 0S0 CR 0R X i 0d 0 "88"$#4 5ua-0x8

g -= /0CQXZ] Q1pZ1@TZ pyP0`VQ T=pPHyPxN:!P @ P,PyP%X= R  !Z `PVJ@yP\ x< p ITi@P <Pp=" P < -RZ < t < ,00 \xLAP040x+8< L< ,+00`D; x  R4 < I: ; +0*00*; *|; *l; *\; *L; *<; *$; : ; ; *000P+00@+00: *000`l: x*x: V): |9P xP=Z+@T @xPPU p xPPJ *^PPxP@9 R  Z PUJ P >P pxPI hh@P |)0Sp)8 X8 t0SH0S 0S P 0S70(KvxPkP8l8D(8 @Lg ('p 60@DS`aaaaaaaaaa```a\`@`a_@`aaaaa@`aaa\aaaaaaaaaaaaaa\aaaaaaa|a\\aLaa0a aaa\_|_aaaalaX&6V HPi4&5  &p  00@JSTk b b b b b b b b b b b b b b b b bk bkj bjtj b b b`j b bPjB  P!1 h" Q<L"0S(!x1 4"0SH$g$gffhg "\!01@Q񟗲\c\cccc@P0 P@ RP 0 1P@0SP1 btaD`tD`dD V (TH<0$`DaDa4C@Cn9h|bXQDB DsXDDlD@4L$  `dpx,lz0Bd(xtt 0D8u@8wP1 R (Oy R0t0 0 0 x0 L@P  P ! Rh 1R B P 0 0/U!d1 4QAH0pK @p 1P@  T1崮2` H@nT 1<姮BP2  `B0X000X0+PP*B0X<00X07PB0XHH! 3 3  $3  2+P20 R @a0BShThThThhThThThThThThThhThhxh Rc3 3 4 4$ 4 $04 <4  DL4 〠 ?\4 @ :l$l4 6t4 1P4 4 +4  &4  !D4P B4  5  5   5Pl,5Pd`5  x5 5  5  5RPI5@tP5   L`5P36  $F$VQ^8 `0@0X6  l,``&0 0 R 07 526  Am@6 @0 S:7m P6 R00CS010  0 <HD'0 0\\'0 0l ,P |w  p )o Hd1 p-0@0?PL`A PQQSp[P$ 0QSA?P0QSp*P0*S0*S S 0S P P 0SQ\ 0!SPPU0]S@ S -R \0]S@^ T P ]P \@\ 00 R /Qp$ p-@PL/Q@d ^`\0Q\0@0CR0QR0@00p 0p p-@P`L 0P@ 00CSp  0Pp 0-\0L@T P @@$l@T 0UP0D8u< -LcMK M <KK(@D ,@D KK(*K, K$8 峎 KP b-K( BŽKHK(B:K(H K@ KKK8  Px3(K -KY X1 p! * p00Q  X #R X[ K*K0* R &R@P \R  U+* R( &R@*K80/S89S6 K00CPaK2@0Q S``V 0eVO PT U:hPEK"(K00a Xp 0S  K@0 S@  X$:0 X0H KQ *K(0 -<[SL:Kh(dNk-<[S<, 0RE(K0 X*0S:K8S K(K:KK A(KT"K KR(/0S K\  K>K(\ 0CK>K@( 0C(j,M-KDu X88uPH -MLM`s0\cP$0 0S0S 0/SK0S.00 @U R00C00S2 ;0S2P  0P 20SSQ SO 2 R0$ 0R KK @  <B0C<0S0S  .P=80Sq  %P480Su  P+80Ss  P"80Sq 0  ,0 P PP"00CSa܃ P!P1 KQc v@0KH0 D@ B@0KH0 D@ :@0KH0 D@ 2s@0KH0 D@ *fQ!!1 P 0 P P P l0 RzD-HT\PP D8`-1^ 1!3E,DH -L` pR @00B S R 9T PP~ .RT@ 8000G S,ćLp0!000!.CDRk?C `0 0!000!>C s 3 S R00C0` 1   !.B0r03R0S `0!000!>CS0`0!000!>C;S08p 0!000!>C10!0v>C 0C0   !.B ` 0!000!>C=S0pGҁt -PPL @T` /^pP 00@T`  `00D S 0,TV`0B .TQL@TOE@Pv W 0S 00 R MR- (CR1 0( zA# 006Z0S&V 0S00L! 0P@!<10@ @@@cR mR000 R000  P000  7AP000 R 0` "A D A, tDD$H p-@PLp R @a0S6 #R. \R' 9P@9 ğ 1"#200b100c!QR 0S  RDP% @ 00 0#R@ u@\BP Df 4 `  [ E/>3=0d p-@PLp R @a0S6 #R. \R' ᶢP@9  1"#200b100c!QR 0S  R4DP% @ 00 0#R@ @\[BP D 4    E/>3= -@QLMp)@0@P`@^ K00\ 0U@V 0Q 0  K0P0 0@!QU`@ p-T`L0S P0@T  0;@T0PUpE -pL0S& 0`SJ2ጠ匀PC0 S@0S  0RPEH Q  ?`VZ?000E EDD p-LPP`p0"#200b10 0c1@T0@S 0 S0S00 00??pE/>3 -\pL0S ` PU 00@x?v?TP0`V(E' -0L^2 0 R.x00S* S( S& 0<%100b1010b 0c1@T0@S 0\< 0S005?h2?(E$qv -MLM440S, `p 1 RQA0Q( @P_BP) 00(00 徠 000, 0R (K0/S BKAAQPp ` EAP (0  $ EEuD E(@t -L@L0S 4 @00@Pg E| -@@L0S (@PP E= -@@L0S (@P9 E= -@@L0S (y@P" E -@@L0S (b@P (E H -LpPP 0"#200b100ca R  R 0S0SA@P #^P 80pP  00@ >oE/>3t -p@LP 0"#200b100cQP 0S P\ A`P 0@0 00`E/>3 -1PLP 1!@ Q0``ppP  R R 0S0HH!00 @T@p qP 0$V00Sp00S@0ڂP0 P  >; HAP 00 tp 00dP 0S 4AP `$ 000EE -0LCP -$L@pTP> !a@T hP @T @@P /]P *]P 00@PhP #=!=T= ]P(Eh< -|0L@`TpP \ AT whP @T ڃW0G0E -鰁LP\^ 1 RS x0C RO0Cx0%100b1010b0ca@pT#0p@S 0P!0S ! 坃0  S;00 S0000 00CS 0"T@@P \P 0 0  0  00@}<8&00t<r<(Eqv  -MLM"@0T,0  pP! @T@T 0S00S3 ] !-h, 0RH(K?@PJ Da 0fQ : P < ! <a= 000@ 0SnK`F`F k#P  TPa=0 S0Ÿ \ H-B @ , EuG$E|< 0-@LPU 0=P t0t@p S7`0P0 08 0$Z0 EG\T$E`  P 0S  PR00S0S 0-B0B N N S0N0B S00B N N Q0000L  0Q000B 0Q00P000BQP 0N0Bp@-^ 00BPB ` @@ ^0@0B ^00B @ @) \1> A0 P A0` 0\!00 ` P0@ 0\!00p000@\p 0@0B-P0!̠#*̠ 0 R0 R*0P  -$6LM0 S, F SS4P 0S S00#lu  @`(,  p-L`\ @0  PTPD&800pph  Qp-LP Y1S0S  D P`P p @Tp -LMPP@ೝ$ U$@00@YPp0K0CSgX$d@0@0 0 88$0@  dQ4  | a B3a-0Ca-BCH!0S\  t230(1 R]B(1PVb͉b0@T3  10@SYllDD<<<<<<<<<<<<<<<<<<<<4P 2 * R @ 40@@`2@J,bP0(1 R l 2V/ 0/0 0p@Nq <@0S@P` 1`) @|Q`< @0S@KPH1   @ @0 :01 0C 0 /S0x0C)0 @0 @2P l0    x0@ Td0 * h4 0@ :000 s$x | H(,0(  Q0-LP00S  H UOP  +@T0 0 -L MP0 P0೓ P#0 0D3D#0K0CSd@#00 @90 "00 @/0  d0 02   l0 02 t0 20  |0 F0 a 0 00bb@<"a= B  10@, SX<hԸԸԸԸԸԸԸԸԸԸԸԸԸԸԸԸԸԸԸԸԸԸԸt1 )x0C ,@0/S,0  00C0(K$1 )x0C 0  * P`< @0S@KP   , ,, 0/S xp\ <@0S@ P@0`)` $x | (,H -LPP -LPP 0-LPaP@aP 00CSt0 @Pd0@ 0H@4 $00 0 0DL| --LP0M0 0  x0 R l@0S `0` \pY LD 7K40 /008<t8uD --LM(@ P  垤K0E -0- LP0M0 0  0@ R P0S0 |,Yp |T`X L YD K080帚 008<t8utMD -D0L @R ZNP bM0 0,E! 0-LS@PpnlPP \nX0P 0m 40 R $ G0Ȟ0E V,EL*QMA0QQ 00 0  L@ Ѝ 0-Lp#  0 -0@/  `aP Q 0@ Rp QP` 0@S  0S0#20Q 0S -L 0wB8u p-LxM`\ |J d1  0DBs@ 0D< 0SPKLKHKDK@K LM@`0p , e1KpA fAKxP39 1p0 T> 0! 1 0! 1 ! ,.}p> D0@3S3p\,,P |hTT0->p$= hRMmPPPy00hz 0R <̀y Al0 P P0 PPCPᠬ@ 0S |0Sx< 00t1 ~0P  0 0S!0Q :0 < 0K@00    B>BS  0 K00$0_K@tt+^?K|A 妲Px!t1R ;@<+]?K@P$ A0 KP hL!:R 0勽*0<0JZ K@0ML!eKR 0qlxJ0 KP ;L!$:R 0<^*000)000ɟ9   )000PI K1L!R \)0:0h(@P 00 tPD)D9"oP ,9tP I Y 0sP80(000P(000Dx(0:0d(0@00pA KP0 K!tRp 0`߼$X K@0K! Rx(a?KpVGW K@0K!R` AX'0 00yP 0 嬗 L 0I0<2S Ɵl1@00  0@PW僿0<2S@%;0000V0<2S0 (@!Ld@ 'dKL d0KcKbK`@ \@ X@ T@ P@ L@ H@ D@ @@ IP@$^ [?K<P=IxPP 0YOK0 G,q@>K 0  +>K >K  >KD00@00   e[ 3 !00 00 0l1  000Y?K0CP P߰PY?K0CP PҰPT߾"000<"10S|2@! 0 Xp+PZ U j弾 c _U Y0U0Q0M埾x圾pr0'  R 0R) [@1 1 A G0     fK0Pʺ0S P]D<4EB  u 1 \:q`\ !50:1Q@(@F@  ᰍ,6" 0 0 坍6P,0 $F 0  0  P凍ᕍ00@ ,0#0<0H 000(KHbD0D  X|P< - @6 80(P@ 0L 0cp`@Q먠@@;P300@ 00`S mP%P P, |` P00P0 S-L30 P/萟0S P,*`$F(pP@뼠,6 R0`00|P$F00׌0#0 `$F0P5P@2*X| -1` LV@p$`ŒP  %#T*V&0 R  05"| P%#0VL0 R @ 05", |4 0-PLL@T d0h0 R \d0T@0d0`0000,0 P|H@\ ` -0L: SpP` RHh PR@l qPq| -PLM@ l1 Q PP1P*<1P 0ES0S PUPQ z W W  W؀0 0`+P( 00P蔀0 0`P( @$K9$ `@0 0 /&8$ 000h 0G X|P p-0 : SLP` V pu6pl0@@0P` 0-LM@ T00T0S0 T8}P'0HP 0 R d0K0 I D84(XjH -L`p1&@B_?. PP1d(P$@P( 0<0V 10 A `   h! $ ((ČdPd 0RX` 0 A8`d00"P|HL@T -MLMCL 0\, |p@  L(,P DC, 0R(K0CL8N6@GTPo#1D 4H <8  #1<8 6"0\P`u!#Znk 0 0@ @ 0᜛LHx2 Ra D8pW8 :O4HLT >L@?8p^@Y RLH00S00   LNK @D@D0PL(h@  Q $t p1DH000yL4 0\ D(000mD000gY<<P*D0P"Sn@00!0002  0b1  ifd1 RP 1Pe!K5A2@000) 00 |tl d\ TLzD8-0*1(Mai(?Kt | x !P j uDsnH4|P<XD4LTlzlx|E$/@P\\pL, d<x|ak -@L`pPWPU#!1S<000!0,!$0PU0$0 @W P $0PU0$0 <8!0 S00CCP5 @Q 000 R 0S R0S0 0S  0 S00x t0 R hX TPDD$ <<H< -T L@M6S `4B0,2%0U 9(&Ry,1 018(&R,6U x 101,&Upx 101PL0S d  Vࠃ^ 0! nP\^P\w 1217 &R 1 01 &RV U pw 1 11 U@`6S |0'@,7@('\0 @00@ `@ 00KX@ T@ P@ L@ H@ D@ @@ <@ 8@ 4@ 6Sh@ pڸ(0S Rᇐ!#*1S 6  t(0p S R:W W00W0SPd 0S6p0S5@&0PoP`P`tQ d0S Q i5&0BO?@PP`dd P P@ Q d  R1  R 0(Q(00 Q R DP` 0 `6#Q P`V 010(Q1(00 40Q`VPS h$d0l$00! 1S d0 S 04  04d  4 $`KXp < 64<0  RN ! #0S ]<00Btp(0 S@`h 6 Sh "(KPah3 R  LC@ 000P0j (< 8}PU; PT (K0 6lB 0 0S1P <00XP1D2!0/ 1 R Wn 1 R e0 F0S1 R 9PQ;PI00@@# P @ 0@S @0@&"!0l 0CS @P p00d0 S t0p0    ~MPj #JFP|< PH<4Ll\lD< -L4Ma1&0R P L H D @ < 8 4 0 , ( $ $p@ 0 0KL (0SP(0@S T00T0SPbPPK H0H@ 0S [ K6pS|X. -pLWP,ڴ`@PT0T @T 0Sh 0 P0T R 0R pW P 0 ((` p-LM4 ( 0AS3//3t3/| Px P 0:90EKAXD AT$  D4i0 D! #Y0\$ 04K` M*& RMQKS60CO ZMNK@D @D /|3$Kb($ (L0X4  T$  X#PX@Q  0  0Q s S["* PPXB( 0R$Kpax2V₂L@0 @ PWBNK @D@D0  6  0SXV0EOo 0, 5"@0 @1 R Pz&s!@ P h0X00 0P0C0  Xw P&  P |x P 0  0P0CX0Jd_ Px1upLTD/4|DHX NX<0<LL  -LM$ ` R0,0 (p0 R 0S 0L 41 R .!KQ `00-1KL KK ]0.A[SN 0@PU ʅTh8(K MK@*P P $ R0S ȟ, 0R(KQ0.S $ 0'$00\ \\PGF  ' X 0 00KKd -1KN]0.A[S PXAP H$ $0SQ(' $7 R'  P 0: S0006  0AS<8T8T866X6(KPMK ᦂ$0@e $ X6 00C0 n~@m Pk$ j$ R{Q  0.SvY P] 0S $0Sڒ^K PEPE0RNK^ @D @D0pW 0h%d-D5 R; Pi$0S00$L0S" `0 5 A Q<<d<<d<<d<<d<<d<<00 $2p P$00C0+$ RC L0SP4! .KA `0-K= KKm\$ R0 0 P8#8C c(K 0$ 3 $   00C0(0K }(K@@@T= X X8$#0S3 \#X00/0-1K0.S{R  P "L0S `0 0S 00h P$  $ 0 SPX$0 $ P| @"00C0u T$0S <"b "\00(0PI Q:<<h9=h9 =h9=h9<h9<00000000000000@!E (KM?K P P-P@L0S X0`  0S n8 P4 P!uP|XXh N\|HD8p4T  -4!401@pPL * 0S& 0pGS!@`V PР0 R tpG0000 00C00020S0S`0SP0 R0S@PP`LT -`LVP50P p Ł1S7 R Q0S R070 X  00C0`V P@00T `V < p-L4MQ 0R0 L0 H0 D0 @0 <0 80 40 00 ,0 (0 $0 0 &d1 `a@H0  K D@ 0ASAAAAxAA< LK 0@S:0DS0@S*Kp kLK ~ 0Q R Q0S R00lLKD _ALKELK( U?D  -QLp `<]P@@(WT` 㑿X ( -LMf0,0 PPU      6Ye(pQ ,6& O P ,6 0&E &l{&h{ rKd{( 0R01K1Kd1Ke   0S*1  11( \* P00P0S 1  1pG1( \:6Q&00R 0 >.9! Q ! E 0!R!0P52 5:1  11^ʠğ0S ,6 1R 0h p JKJD$ 0 l,6 1RJ rK vP#0Sg# 0 W& vPL0Sz 0# G1&vP_1!̑0  1 +`3 0AShDDGGGD ,1   1pG1\0S1 S,6!0  ,6!{  eK P l2&1~001&uP,B H4 eKP 1&~~00&uPA| !zp,6KQ01,&K p,6hAQ000F0S&\"*0 R !Q0 S  1 0`S rKP h, 0R(K! |@1! 0 u000SL]Hu|4P0\ \` 00 EEE0E0E -LF1P ҥ Q-L@ P T> P-L P 崥 0-/LP@P 00+8X/00,+ <+<00 p-LpM/P@P KmP0: S Kp0`rS@~ y P0-L@P0 R 0 R 00hB?t0 R0h0l H0 R <0<8080EEE< --LM0 0  --LM0 0 K --LM0 0 K -L@4< h -LM@08K0P@`AK:P0: S VPP SV H`@P$KP U @`0 R000]K@P l1: S 8C((8E  --LM0 0 38u@-@0 0   0 0 0$  (@$, (@0@, 0000 D@0HD LH0L 330## 330## 330%% |p@-`L0(&SP d0 60PpP0\ lSQ!A\SQ0| -T L@HP4T@; fedA,@ -L`p@EPPP5:Pa0@S 00B S0"a>CPP R R,1,,!!00@ S c.w P 00C %`f?zP0Fx3 @O&6F n  P+z @06$z  -z?P00`Cp t\ P-L@ 00 R$hpH -LM0 Z3 ?ᲇ3s ;@P (K謓k  `h{#3R 0X 0@cX, 40 y"8 @0E8  OƉ 6F&Vy3 ($6y 0( y"00y80S2 4 ,0|B 0S<PUL2   00  0 0 00 ,0,0 00000 330330 33033 @0L@0 D0PD00 550550 55d00d0d0d 0 d  `0d0 1 R0H0C+qP 0 R04 0 / d0\ d0L `P@ 0R@X  aA  T@P\|SX\4(Tl -kMLM0',0 7K@0AA`@`6 P;P6: S 3/PR \먦P%0S~ 6 Rn 0`St0Sn dfd6d&@`v@@ @@@@Y V0SL PJ P(0%%<0000PF%0S 0Se.K B BPL, 0R4(Kp5p@d5 R\U,3S. &(0<%04%S $R2 &ސP0S ㍹J4 R}TAT0Sp<8 p.0S P, 6S!@Ƒ` 6S3Ɠ,6@ \   0P V[`WP `3 00B10@3P LHC`3P D3P (3P 6cS00 ,20!6 S 2" B0"S[ PY &H8 p`\P@5嵋D"D2g`ĉk@@)1 R_b)YP @0S@@0@S H6<4"D0#@1 ]P @0T!1]xW>1\NHJ@t8C(= 1R  }uXDPHT8\\8@h4|X0 D (T L@TH  ?l$D  l h   <ă@-0 @BTx00 Q< 1P 0<000  < -L@ܑ@ 0-LMMpPANK@D0@D\ 0 {Hy 380 ‹ 0RK0 u !  -RSL4MP`p \|1  BR dUR$K TPR^0@ X 0X@K( L (0KT P H D @ < 8 4 0 , L % L 0T0 P LP ,p  0U0 ?00j  jwx @` wD0/ Z D:PPU P0P X@KT0 , PP  00ExX N -L4M00 @K,0 K -L: S S  S  S 80P , S  S  S4T! 0 -@@@0 ܠ`L @@``uPp!p 0XD0@@ q@nPTP  X P}||h! -2L `R^6@p@3 ٶT1 RL1 RH0S?T 1 R9qQ@p0SK00CS0JX0@X0FTI T00CS0)0 R0' 02P0S C P 0S $PP IDC PyTYT nTNT sYTyTXEC@XEC@00HTDLxttt!!!! -0L@SDh@T 0PPp@`8U|0 R0`00@TP PP @0p ,$0 8t`dxt V 0-@PL g!p( b0@S\~l}l}D~l}l}l}l}l}l}l}l}4~l}l}l}l}$~ ~}}\1\ X(L1 (!پp,1,!0S1 R% w=P2   0000 0 000 0000 Rl0 RX0 R00 RJ<0q#<8u#ste $  -LL0 L \ 00 (0 $0 0 0Ex$ -0L0 $ -0L0 $ -$$ 0L00  $Qd d00A00d0T( 0 QPd+ 0-@0 0 S RP+00 -(0L00S 0 $E0S 00S0 $#$("(  @-0S\\ @ T2  R T2  R 0 SR 0-h0L0 X0XPT0 P@0D gJ40, 0h͂0P|@,5i 0-LM@.P@Kkm0[P00KfPPd-\@\ 8J0 0.00 (噂P K0D0L0|@,i l0 0-0L$M08PK @0 .0 {P J[T0Dp 000L0 P0P02KdP@ 0 S,< K0u|,i |0@i 0# -@0L (9 -T L0R S S0RS  P0 l/(0 -@L K.8u0 -40L0S$00S  0 <( 0-0L$M0@P0 00S00S 0 QP 0K<"0 RP l` *@K` kIT0 LQKӁp@<  0 S,K0u<(1@,i1# -`L MPp@Kp P$CI1 @PP" 0S 0u,0 $垁PK|@01,i <1 -L M K,0 Ap("$0PS` LX0000PPpp@ sj nj  @A0SS c020 K0FH1 p-L MK,` 0 AP!0S  0V000 PP0 4j PPBN0S S c020Kp FH1 -LMP, 0P ,`p0  R100 ӑxRP 0G`p@TR X 7PPJY t H0 0D 0s 0D0 V Y SP8O P4Y 00D ST00ӑW0A 200B SR0000ӑW0C00P\T00X0S 70PP0,0 @cT di@(Kv vX1p11 -0L,M0Q5 K0  ! i0<0   <0K< bP `@<0\ 50KHL0 D50K0iP4 0 S AKu|@,i 1# -0LM0Q@0  K Qi cPlÿ Knm*@KP GD0 <3p4  0 S  Ku1@,i1# -|0L0@S h ? R00S L00  ;m,0T, @00 0 0 0 0$xE -1LM0p$0 l1@K Qh0WL1 H /6P JoK`F !kGAP /600:0@p.K>KSP  0㐑01 R  刑l0S 00S Q  R ("(04"400B $0 S$x Ku0FEXtY1#-0 CR 0R0 S䈿00 Q-L X6 p`@ -0CU3@% R 0S,,N0SR00ӑR00Hӑ<@ 4 R @0 S0Sxtvt -@RLP 0S 0 TC 1@0S<p `(<0C3@ R 0S,x ,0So|@ l R @0 S0S400S(>hT>hҾ11xtt Q-LP z$ 1ZA@ x 0(0 S^hQ@娀帐`p0 0 S V |ZtL HH X00`@0D S% 4o:j1T^E1.4$ 22 -PPLD@DDp(` <h!0  $@T/4$xT^ Qp-L`P 00S  R000 ӑxR 00 0 S r 0 QQ 0v03P0SLL  ph4@@Tpv v$2$l,2 -0L(M02`KPp  0 g `~p D@K g p@}p [Q20[S 2 [D0R0<#[ 0 S$Ku|,:i i 0282# -H1LM04@K8Q  0 f !f $P SE1 }P $- 0f`p@P0S  [0  V 0S- -勽0S  l偽PU@ 0 SHdKu0@,ih2|2222xt22t# -\1LMP1@8Kq`P  ( gfV@! V/P  0㚸p@ ;PK 0P !400`PK@P 0 \j EP 8  (0 S$Ku F221$ -LMp02@KP`  0 f @|ph  e0 H2K|p8 0R$Ku|,:i 29i 2$ -L$M蠟0( @K @ @o@0 x\p  00:@KP`㐀  `e| @|pd  XrK|pHȑ( 0R4}$KuDF3@F|,:i 29i 2,$ -L(Mp0D@K$ `|P 0 et Dh x|PT H4` o|P8㑑 0R$FKu,@i$3i$$38$ 0-0L$M08PK @0 o(0 I|P C[T0Dx 000T0 X0X02K1|PDS 0 S,K0u|,i 83@8i H3D$ -4L ,C(0( |p1 @|,yi X3 p-1L$M0.@K `0 Pd0 @{p'  zC00SA[T04K }40SK t墍p001KH0d8 {pP 0 S8Kpu|,:i 2@FDh3DF9i 2P$ -0L,M 000 <@K( d -C0 x{PO0S\, T0 L00@( V  0 S(_Ku@,6i(33\$ p-L M0P0 00xl2d`0K @0S 0", 0 0>0Kp33 4 -L M Kp,`0 $@\P  0 t000S \T>'PpH0 p@h  44'P$0 t@l  K@B$4$84T4T\4T4\4 p-x0LP @ T 10S U lӺhx0 ^H^8S`RV$ 0w@!HIIzpd0SlB0S 0Bc00S  嘺5P #T00SH  4兺x07@ phpd4xttl4x444B4444H5 ->ML1DM 10(0  h@K lich A TYzpP 0S=8:>[KH@K$PEDPE >kOc Kc 0P 4` A 9zP 80S >KK$@D`D@DPj*0S  tP|@80UZX (0 S@$K8u6,@i h5i|5xt55t5p$ -LPp`@P0 ScP 0S@ 0-@PL0 p0 㣋0E5 -L`d00XTp@Pp 4 00 0  2 55 0-@PL0 pE0 i0+6 p-PPL@0Sc00pd00X LM<8@P`RPPPp$6L6x6 -@pL`@1PP@T/ -L(Mp0@ 0 `P  D@K$ |PEbx @l 5yPX L$` ,yP<N 0R(Ku6,@i$3i$$3$ -Lp`PP h0d p0 @Ί80 0P(~@P6.64$ -L@6D008 ,㬊$0067 -L@D008 ,㏊$00H7t7P p-1L(M00 =PP& {~`@ 60P j `m~@T@PK/$ @a @t xPd㣍\ $` wxPD 0 S0NKpu64$7,@i$3i$$3$ p- 1L(M00 PP- +~`@P` P` ~@T@PK$ @:a ?| *xPlLd (` xPL 0 S8Kpu64$>77,@i$3i$$3$ p- 1L(M00 PP- }`@jP` dP` }@T@PK$ @` g?| wPld ,` wPL 0 S8Kpu64$777,@i$3i$$3$ -87LzM0G0  W,0 `0K0 -? wNKp8 ` ? wLK`4 ` ? {wl@K  }`d ? dmw>@K   o`, > 0_wT@K a` > Qw@K S` > Cw@K $ E` > 5wpwp3`v`3  2 "RS XZ 2SP=@@K#W @[,,E# T KZ[Q 5QnOK@D `X8DPK T[P1 o?K  K[mOK| _iK #< x>(4 \vPb[P aQ[U8 >s@/DF(Ev ~VZ (1SWN_K",K0  0S l3 lvp|">$AT1S1S1S Q!000C S0:S Q4 P>`T 0S,,pQ"V @TP"R0S T"0S@d"K 2S*0S' @}"04 ,v"(0 n"0 g"0_"|Z" "R\0SX2Stx1Q! [0 vP01S d10S y 08(10S j 10S  00S p`p@[ ,0 S(Ku|,@i i8i4iiiii$8t 8(848i|H8B@8P8X8h8p8t8874$88>888888i xt9<($ -4LEM0P(0 pU4 4$b4QH4QC4Q>|40Sp  \sU 0S 0SS0Y #P@KWd( p^ < `uPW  |0PlдuP  |, CuPxep @^4 @0R$ $30S  20S((4 @20S))20S z phNp20SP` pA00S U8-P0 ֡`00V pWP`yZ10SAQ 4T0@$0$@SFNK@DP@D/PRKPQK]  G<41d tP/O4[S nKP[ <P [P,.<O[O[!1QppP5Kn %NKP[5K < PDP,< 04 q (0 SY$Ku@|x899t99xtt9,6i(99L53::5$+|Ki0:8:$ -1LM0\pK@8 P`K$0 L]@ H]0tL0 H0 0L0 D d PT1 L0 , H D < 4 6 , P1PL0 00 C R0:S@H P`pK@` 0` P& `0@@T0P0S 僳@K `0K` P `0@@ D0 \@K` ;T0 LspDS  $0 S0 Kuh8\:4$h:@,i8:$ -$2LM0pK@P4 0 \tH A ` \A0K0 J;1 s@PCbBP 00S0xS  0K` P 0 S T0A7S@aA0[S, K Ό@ KP00@KP 0 ; osP㑈h@K$ m\x : ]sP|0t X0 SsP\ 0 SH*Ku|@,i :::;;i4<;i$3i$$3$ 0-0LM00S  |WPKJPP A @0S|8P 0S 00StPU<ӄ 0$8$84t0P;t;@; 0-TPL0@S s<0 㲑 0P@0000HF, -X4L#M0Lp(0 0S0+S P`JOK`` <(mP,@:_307 OK.[ 0:K xrP M01S`@K [072K8BKOKJ_K]8[ <1P,:#_K.r[ 9K2 [rP01S #K=lOK.O[8 9K2$ 8rP01S 828282828282@82Z 10SC OK.[4 9K1 HqP01S) ,[&42S82S L @4P Pd8P Pd}~{ 㸞 (0 S$Ku,[;8@"i ;;%i ;;Ii ;<< <,<8<D<P<d<EQi t<<X<<$ 0-h2LM0\B0 0SH0+S 0孆, ((R9(Ky - 9!qqP *01S nZ 1 10 A(0Kt1t!UqP 01S SZ`4 08,1y<$14 <8#"10 @(0K0 'qP 01S %Zx 8P y00S z l 0 SXK0u,[@|<%i <8"i <<<#i <=xtt% -L0 ,p8(0( pp @|,zi = -L1LqLP`V,(A_0P00C S= pPnX@3  pPd @* pP#0@ pP01ű0 pP0l 00<0 XpP0L0 0 E,[@i zi 8i i t~i  -2LM04 S P pP ^p,K~P dv,P 00 80 |W X 8 0R00C S`Pm @  Pe000C Sa 00S .-Y  aR #O]  !Y  aR #C] p7 7 0@T2P40 L000 +Y P$4 TR00S 0 R@ 0T 0"T0S$@$0S 00 0S 0 PU,WdZ@@, }(KE6t;|@$+8u = -PLM@4  p@0P-S#`㨤娔@ AS@@ aS@c`00SXpGWPW @ 7P $ 7P ?pGW0`,0 #3@ P3pG`@ $@P30,0  3 3  |6#0Wp0t0 @tePTpW` 3QW0SPZWj 20Sa]CP @Q2 R @ 0S   BR X0S= 4Q ZpR PP QD2Q P 0y  0pG 2QP `Q d 0pG 0030pG`ꘑWAŢ 10S(1@0S1E;10SD1Q<r 810S ,0 /6,01,0 nP O01S00S00S ,0\ 6,0 0,0ynP㛃9EE@8=*$E|TX=`=h= 1(%p==%Ex,0=E= -LpM`10@W,0   @KF@PK !MMp@K@ 8W M`P060#0P@U@KF M  M dM W /P0\0#0P@U@K~F L  L GM0, 0R (Ku0 -L\M` @ V^PP, p t x e 0Csb0l0 2P\  [ hKTpK| :(< 0|0(((  lp t0@iD0@00 hKp t0\X0D0 @0A 0@A0#Q 0@ T:V@1@# x@KZx `d x V@@PKl  V $ V hKV@K V ,0 S O(Ku0H0H-D0D 88 Q S RP-DD0 00R4 40R-DD 0R$ $0R-DD( (0R, ,0RHH2-D0D 88 Q PS R-DD0 00R4 40R-DD 0R$ $0R-DD( (0R, ,0R -L^ \ \ ^ \  ^ 80S H0 R^ \$0 ^h} -QLM 8 0,0 (5 R  `00 0 0 0  0 0 0 0 0 0 0 z R H0.S 0(@S@ d Dp@0T  ʡ 0 P10S01 0 80 Tʃ 44 RC 4@T 8PK  $0D@K #0@ ZP}Z3P 0y@P   3 30dß : S SR 0S0\0 @  P1 `V  QQ=H e2 `V0S @T0 | a2K`"0 Sl2 2<, 0R(KSx0 @ u02 R0 0 OS[0 YQI2 R  C> r1 R1 R  @2@TL|u |1R Y@ T000 ^  3 0-Sp mY@K 0! Y0t  x p Y0 l Y0h R0d0  ` s0l Yd _Du08$,tY`d9D -1L@\! ߰pPo ?1 R0SL ᓯ@P 30CShhh0SJH0SPHPA (i$1 HbH0.S% Q0S,X刿00 Pቺ`<0S0v03U0S  ͫ80S d0 R LP0S D]8 tYDDDD -LM@`qSPh TP )7'000 P7  w0〧倗80 p'Rp` 10@GS <\\\\\\\\\\\\\\\(\\\\\\\\\\\\tP@\\\\\\\\\\\\$\$\\l4\\d4&00SP 5 5 %p 5r5  0@jS5 R0S 5 R5 R0S|5 Rd5 R0S 80SLU 0/S 040,%0S 0S S S $0S $4 T  4(K0S S S$4 p$0S4 R $t4T  t| 4d$L4T$$443 4#44 03 3 0 s\3 @3 3#D33 <3 d3`3 X3L3 003#23 20000"00H2 d2 2 t2"h2H" 2@20" 2!11  !001!Q ;8 0|x1 x0S !x1 `Q,Ks!`1 !P1 !@1 H1 Rl!1h!1  T4 KhP@#[R0 ;1 R !0 0 R !0 0 R 0 0  0 R h0 `0  ELF<8@PF Es0(`D4<TF$  ,Pht@`T:  S-L=  S*  SL2 RT@`0 CR` bX0=  X0 S6 I 1 R `0 CR` nX0*  X0*.1 R:`0 CR` AX0@  X0h1 R%\`0 CR` 9X0/  X0(1 R`0 CR` 1X0|  X0=|/@p0RX=p0RX@p0RX/p0RX|p0RX*٧xttt -0LPDp*0 RH0P R 0 R : S=P\@P` 0BO?a 00 J E0(4E,E 0-@LTP `00CS`0X0  X0@T 0S  808 R (Z@T0X jxttt 0-0P R 0L00 R00|0 Rp0 R d0 @T RR000 @T00(LF -$2@0LS 0pp2` R00p1 RpTC ؁PPUK`00CS`0`X0  X0  0P@T+ 0S U0S\`0 CR` 4X0,  X08!P(00S*0S!`0 CR` &X0  X0,㿦0S!`00CS`0#X0  X0 学P 㨦p0RX,㸦p0RX 㱦@ i蕦X 㩦X i褦0(xttLFt -LM(K/pPM P80SZUԡ@ ̡`PU: 0S (0S` 0S7`00CS`0UX0  `X0  (0S@W@0S `0 CR` X 00@X ?@p0RX N@0S / +``00CS`0X0  X0x0 Rl0 R `0 @QD̺PX `X xttt8X0X0PU 0PS D倥8 |0S;`0 CR` 9X0  X00@S`0 CR` X0X0@T 0S Vp0RX fp0 Rh \]p0 RD \T, 9p0RX Ixttt -MLMX , 80S <4 R04 RZi 0Sc 4D R3 R@@K }$ 0@3 R  帹3 R0: S S 0S3(` 8@0Rj ~KpGpG WYpa  D嘹@3 Rb43 Ra 0H@3 R!3 R : S S 2 R9`00CS`0X0  X0Zh, 0R(KB0: S80SdC^KPEPE0P"(NK@D@D8"kp^ (0K 08BEY1 R | 051 R t(q!(0(!"$" g, 8Zp1@P` p0BO?] 00;  (2(!0a8@00^C^K PEPE0 @ 0 e0 @OٸX +c|u80HE@PE,xE (xttt4E`EXE,ElE(E8u 0 0 !8 a Pp8  P`! 0 Y,0pW @40Sڔ!0S`0 CR` #X0  @X0T!0SH`00CS`09X0  X0000 S00 (K |@ wp0RX ㇣@0 R0 R 0 @ Ol b@P 0P 0@nX d00$ 0@ @0庸`Fxttt800:0070040D0 140SDDU 00SHp@PT0U 0 U 00S 0000Sdp$`D0Sx Q 8 R 00S P0So R(KDP000 P0000000`V} 0#@e0003 R 0SH3  0S#/KP   30S0@0S) -P :(P )#P ZP ᨟ H0W00kH ,0R  -Q  l"31C0La1 @KukP6ں3[ ,00cS b0=9 = B 0S!000400 Q- $0< 0bS$0'0$00|,0W003X1 R*Pl!980S 4 @00K@ۛ0"@1 0RK"'S  0)S00.S /S00Q  Q `0P0PU8PU ^ K.00K@塛0!@0!X 0!V- 0S% ^ K.0ޛ0K@{0@T!^ K.0 Λ0K@k0!@! 00S@P ^ K.0㰛 00 P00 0RP0m04000gx%^ K.08┛0K@10@ Uu0FK KKhKKKKDK\LF0L -L(M⼁A0@K$0 `q@0KP0X@0(P D0 T0@0 ) R ࠓ 0 .@0@@@ PP00 00 P0   DK+ BJP0 0)0 彗PT0P 02S  0TX 40$040 Q K00 R uGLFLLGF -"L(M0Sr 0S\ "P@PPP PPPP@X%P`T: S{8P_(@K`$p)$ 0pcP_0)% p,` cP`@ : L0K0P < LP HP DP @P 8P 4P qcp@W x!10@Pp|!0x1 0p1@0 `P `(K0P((!p!0p00P tpګq0 jpЫg0 `ƫ]l0| V뼫SD0X Lp "刓0 0j0e!KgP3Ƞ ,Ƞ("(<3 ",!$ Ġ0^0 `a2 pt0 0````9@8#8 $#$2p` 22@H0KL HP D 0 @@ <@ ؍/W00S@ RC02 (0ᑧ0P (K s t00@@@@?8#8 Ġ#Č ? p|1@0K⩍,0@,̠<Č4("Č!4 <$̌8K 8 40 0 (1 @t00@?8#8 Ġ#Č ? p0t0 0@@?8#8 $#$pD0@ i0R ʉTLDG<|HGXP4RMG R@ -LMP |0 R 00  @d @ @ @ S K }YK80 0L%(0 [%P0 0 H8hG@@0` 'S0-LP@ͦ 0hW(@0dS<Q<PFDFDFDFDFDFxFDFDFDFDFDFDFDFDFDFDFFDFDFDFDFDFDFDFDFDFDFDFDFDFDFDFDFDFDFDFDFDFDFDFDFDFFFDFDFDFDFDFFFDFDFDFDFDFDFGDF(G0h聦001@U 0$ 0hl 0$ |0hapl]0\0hTU001 80hK,ShS S8S0SdS@SDS(S -CML MLw@0 @ 0 PR񟗋IJ`JJIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIJJJKKK(K4K@KLKIKK埥 0RKQ񟗎xLlL`LTLHL 048< ("#健Qm Q XvPsQf *<m 048< ("#^[XUROLIFC͠NPK .0ێP 5 .0юP h+`(\& 04S<P 0PS- Sj H0   D ȟ08 R`00CS`0EX0  X0l0 t4lSh P PP 0R8(0 00@|4 xD $04"4(4 9 R000t 0 7ǟ 0 B0@tD 0 l0u@F  wn aP 0TG #D7$   9(ǟ R0004'00F0000I\ 帢0Q :Q $᭢jw3l uIv?4 d嚢\嗢 0  $0H@ 0@ @@ <@ 8@ 4@ G0KD@ HK0@K00 HK|ş0S |x$ttPpp0 YE0 P4  R b5Q% QaY00XPPPU`0 S PP  0 S > FKAhd , <$ 4!$EK 4A,,.<A`$ \4 5X 4!  T 4  0z pD 0| x s |$x4LD! j 8D0ğ |xP|xD|x P|x$X A 04S *ܡסS 0HSሄ l P UKH@H p P4`U :@TJ4[S X;( K#D@Pd $孡P4UuŸp$4\@P埡(B0 X 嘡@TI T`吡`0jS'V <4("4!L,y0F T@LzX@! T,y0rlP t ,yl$$dP1 RD`0 CR` X0)  X0lUP T,yLI`p0RX)㘌)}\9P5UP q $1  0"P4UP | j ju<V@ xtttODK|HDGDLGWVW$W0W8WDW8uHGKLWTW @@pGxG`GhGxWWdWT^QlUWWWWVWW v4SP -NML?M? $ $ $ $ $ ,  h$       \/p= E0@2S2ToD^D^@ooD^D^D^D^oD^D^D^nLnD^D^D^lD^D^D^D^D^D^D^D^D^jj0jjjiilihD^D^Ph@h,hD^hgD^gtgD^`gDg d.嬆pX>@dXXpH%MP00 p Ο1 1 0`JKI I8^ " 0@D Pt0 R=|= `0Q  8=SjP-0 k4S- -K B B@@@@@F>K@0C @"0C D MPl$0S 0͟0   00 )cRPul,0 c Qp` ̟ 0Sa  ,0 R t,00`- ANP : T̟0Tڴ+00B0S [+0 00000000`@5`@ T @D0XD @;˟@ 0\$ SE>K0C0C5  \ d)* 5\ Qp D-K B B0$ * R44:0  4 4 ˟: 4QP0 ʟ$0R pspW@$R$ 4S P 0s 00) /d:   t)00P@@X04 .PHK 00) 30 ) B0OLpP UFnK`Ft `FP@  0WPGl4 RLKPDPlU@(ɟ0) h$R ɟ0RFNK@DPh(0PXQP9)0POQPsɟ@)$ 5\ @CQP+d9)% 5@:QPq(@o @О|mʞHgSQ @$@T8J(Jǟ0@ g00K @w娗FKKAHJ A H0 J PUT@T0SX'0 08@6t (K@VP PP7PƟ 04 H0K4 4 4 ̤ D 崄Pz $46 R Ɵ0Rڈ&6  0 aBQP6 50S<PU D5 &0:;:0{%0<0v%0:;70o꜕EKAA 6Pb0 R^ `4 RZ%PY6[X%000QDş 5   H %080C ?aPRДEKAA P-0 R) `4 R% )ꄔEKAAVP0`S `4 R 4Pt@@7 0  3yT3P#000CEKA Ap4@ R `4 R0 S LZ`304 taPd#0 00D#0600#0@00bEKAL L0 P od$2R 0Z{R0EK0AA `4 @h n0S 0 R `4h$TQ (tZP2, *++ 0S @A0C2S2lllllllXlllllDlllllll0lllllllllllllllllllllXlllllDlllllll0l40SL!0<0 0:0 0;0 0:0 0;0 090 0:;80'uYs4 X,]H] TTG@8u\Y?.A'dXt X@XlzdZ|X' 8<`]P]X]H` 0[GZ 'u[PG8\\\`d*XGL< YZZ[[X@YPX ]\0XX|X$YZ[Z [Z(ZYY\x\\DZ[L[\[l[\HG\PJ.K B B@@@@@@H1TQ@ N"0 P0( 4p1 N!090sY!0701 0*4 !080~"050yFnK41`F`F@P)' 0lD PNPl1)( 0PNP( \0S22 0 .0@>@$ 4 /׆20G_P-   Y 3PWA03@R ]PKT0 G dC0S? |嗜M:0S6 厜M13p3ڰ=K0C 0C 4 0I3 彘P -\1 0`POMT3F>K0C0C@)& lD NP8 `\ 00) 0t   0,0Q @@$ -34P @p$)+ 5\ Mp[X$E>Kd 0CM2b0l4 {e@Ph5P 4 xx%S00  4). MP [0 Ps `) 0`MP0s 0) `MP ([Q 0)3 {MP h[pl$SPF.K B Bd[P\[(GGKA  A|4 xD 4 D M6 R=;庅X崅l$E.K B B% ) 5:Mp3LG[IHT WTlWtW W W W Wmj긕00W법00W WH W [  [[[$[,W4ZG$0DWPWXZ`ZhZpZxZWZW$WZ(0 S'˴8ɠE>K@(0CX @La 0-8P8@L4 f3  0_I8u<]^ - Lh4^ -\5LBM0pPD,0 i(C 2#=S0S+3@ PRl{{H{{{{z{z{pz@ Td0 T?#C0 2#0@0TT!>C 2"0r03 R0S 00C0@0TT!>C 2"0r03R0S @0TT!>C 2#S0 0RR!>C 2#;S0FxQP >X1@T,D10S CK@ @[pHK D4CK@ c@<$ 8D p CK@@<$ 84 \P16Y0P  %HQ 0+SH HXڠVY X UXH儻BNK@D@D0H$VcT0ulz\^H^L^`^sl^|^^^^Q^^B0 S S  -\0@P@@P0 La<00S 000S +6ᩭ&G% -L}@P+Da p-L@'2P `Z p p-\2 XB 0L`@0DP+P 0S00$2$B0p030,2/@ "P)0S ''''P @P`F 'V 0+S-S0S'P'P@` M'mPLP`T@D00S\PPaP\J00S 00St0Q5+ $5n48PvP.# *p% &\a<a&%ahalapataxaaG&a 000H 0 ;0* - 0 L;0 (*G - 0 Lv;0 $*G - 0 Lg;0 *G - 0 LX;0 *G - 0 LI;0 *G - 0 L:;0 *G - 0 L+;0 *G - 0 L;0 *G 0 0S00 ;<&* 0 ;*0 0:*$&00S 0 :,$&* 0 :* -Ll000CSDTdt4h~h\hh:hFhG0 0:*$& 0 :* -h@L0S X00SL0L H0:@00S40$ 0:00G&8*$&&@ -\0L0SL0L H0:@00S40$ 0v: 0 &<*$&&4G - 0 @L0 0a:$&H p-0PSL`0S <0 S @TpG00SA)& - 0 L&9 h*:* p-LMP`0,@KP @0 ,   0RpKpua_ -L@P h#00Sh18D -L@P 0S0S00Sh8D 0-LP@P00S0h70D -L `pP@P0000P0S00[ -ALMP@ # P PP P P P P P (P |Kplhd`\KP 00 0000aaaaaaaaa -LM K@P![A[R0 @=P jx0t8d P00TX0@P*P W804%$ PP00Kht@$&aaT&Ea -MLM50 0 PP5EK @P@R7P00ըP00) 5NK5 @Dxt5@Dlh5d`5\X5P5PH5@5<5854505,5,P(5$8 5P 5  P5%0P4$040S 40S 44$K0 ASx4A0$0S\40|P 0Sd$00(40K AAH3 <4R P 0S4 #3 K AAP 0S#0030K AA#P 0S P30 CS3~K4c pG pG ||0`xddd#d3PpoPPP#P3Ppf<#<3<$Pp](H$3P   +P C;P 0S20K AA.t2$ P0PPS@  6"$ `$H-00$8 l"h2K AAX 1 P0PPS@ ,2  B6"$ `$H-00$8 !qNK1 @D@DPP@@0P0aS@ V|100Sp1   0 SXKuatDb`&b\& b@&b<&H&bL&4&&,&D&P&X&0&&bbzdf4L8&&b<h@G buD$b  &(bsZ,b[ $(0b4b,40 06S000G,0 20@Q00 L00 L 0- L0 4@ 0   0@0Q@DLP 4HR 0T4ؽ0@0hM0LG -0L Fp0q 0 -0LP 40 0@(4,D 0S (,0P`($,4p TdT d$t $0@(4,D $ 0Epqh$Lb -0Lp`PP#Co0 4@0 $$T(4,D tT$K P  40 4(0$00 4siGL p-L@ 00s$0@Gb -4LMD T?0b 2 0S 0S$$0R3#O*`V R 0s0s* p30S 4 X3 R4S<P(3 3@ 40400@ 0000 00 2 `  0 0 04 D0@ 2 0 2 ` b`2d2 $F6pI\ ($,4rs SR}4S4S 4?t  0Dp@Pq#sc10t q 000T10*bJ"pJ PD#S1 A>0O4D0P00(t,00S Y'0K0 #B00S"00S 00  00`` 0 0 0 2 02 `b0$$R005:h(KL&G h&bGb' 0-0LP$4S0C Q'P% 40@P 4 D 0@4 DT0$4$0R  $0R$$0R*000h0L -0L$0R  $0R0$$R005:p H0D0$$R0$44 D 0@4 D0$4L -1`0LSP 10(,$VZqr V0U00J0O0?  1p 69F%4S4S  *P4S) 4S%p! 0ꀀp 4S4S:0AP0Q 040@00$0h&L' -LP h0 Q  0R 0R Q04 D0$4L 0-PL@ 4 \ (,\00S 0(,pq 0hN0 0@p0Lh&'p 00010# vp 0 00  v p-L 000 x 0P` `庣P @ r 0 04 (0$ 㧣 v4SbPcc(0 $ 00 0 hX`Xd 00Gl0@-<@P @_0\S%"0C0YX<(X 0-D@DPL00C0 0R0 00 00X\dX` -Lp>`P倀w@(0 0S! (0 0 0 00S @0S`XT& -0P0LS6SM`'0 0S00p@Pt:'P0 0b?UT`0`  b@`0 < 0<@0C0'00`0P0S`X\XdT& -|@|0 LR00A0Sz<00 $0 0R0s3`Xl -x0xp t0t`L@P}'@P0 0b?U0S00$  b@0 /hFdT&X\` 0-@L0P PX'p0 l00P0CP00S 0 0(@00P @'0000`XT& - 0L00S }` 0-LP4 $'$ $@000'0000X\ 0-`@LP'P0P0<0 00@P*P0X` p-RL@`T00P P P PM PLP& tB PV  P2 TB9oP eP Pjd`00S SYA00 S vQA0S0S S QA0Sd0S S`1@a|1xp300SRKL10S @1@M,1@c(10B p1 1R0R S P@0S/0S S +P@0S$0S S & 00 S@ \@00 S 00 SS00pPph'ph`Xdl -Ly 00 0X\0PP 0-H@L0PS800 00R:(0P00Gp c -0LMK0  KQ c 0-LP%@@DT*0 p-l0l@Ph0@`@`0/ L @DV V,(phs`d\(c,c -0 0@000L0@p0 d0X0L0 @~044y00hB0c a.@0S0> "(.0SN;7 R >RPZP >pq  l> ( >0S PN0P0?P4>0S $>0S >0S > P =6l>@T"@P:]ip0>0S (>0SX$=(0P 5`;G=H-0S@0eSOpP]P-@T@0eSe @@ ,0S S S SS /S SnM00G SjdPe<@pt,0SP0!W@  +W W R0R00@0#0<<0WA 0<0W= +0S90@@0S@P }&pP+K-K-0/-0K,@KPWL W W W !WB W  *W @W 8,6 4,2 W W P *0#0CS*mP'g*0S P `P Z)0K*pK*K04K40 X@4PT 0DcSꬻxL4,Pн< Lp̾ĽHdغH,8Լ| 0RQ80S0S80S(84  2RQ@80S0S +0S0S0@70S 0S0SX7  0S0S0@y 0S0S0@i70S'0S!#0S 0S0S0@R0S0S@D60S(6 9 \&00$6 %0S  62 @ RQ550S5 t5RQL5@5 ! 0S0S0@0S0@0S0dSd0@ fQP ] [0S0@4 d P< <KG40S@0S00S00q0Sm0@i0S 0R000S0@PL3P0  0S(3P0    S3 0S0@o.2P$$3@T"_( 0S0S0@~P 20S x20S40S0S2\20S0S0@OP 0S0S 21<K<0 R0S0S0@PB1@P P <O 00P| -0l ?1p0Pt 10 PPo Pm ]k0  +0p0P` 00 PP[ PY \WS 0uR5Q309$&%G'&p&&&&p&Gc8&(&L[&&h&&&ccccc,cddcdl&&T&|&&(d(00S000գ?0OD0 R0S0x  0c00 RQ000S00գ?0O0 00 0S ( 0 10S$!$1s@ 00"0p;@-P@p`E5 p-0SS%0P gP' 00dP ^S0gS 0S 0S  0S  \:QfPd 0G 0G -1LM 0P0@,0 `- 00P`( P=pKDKU@@P P`  0@Sd`dV000E@PEU@DDP ,0 St(K8&u(&4_ 0-LM@PK ZP8 P  0S JP 88 -LM@R,  P @- R P&`Pp Pڤ`0 C @R`0P R0  0S0@  0R@S  TP1:, 00Hd - LPh GLd - LPhGtd -LhGI -L>phP -@LPG -LM$C0`P 0S$ h0S DPKD0s@0s /R[@T 22 O00t2 V 0,K0 K00 PP@@p00SGP20,0 > P8  8Ks8W 0   Z 4P, 8 \8KT10SlP ,MP (8K8P yPYP ,TE Y0 T00 p@0 `H@0p,pL0P@`[0p0S Fx0Vd00S08K8P ᱰ(KG`J`d\J&dG&&GG%0_& 0-LP@@P P0h0 -`LP`pWھ`V@ZP PT 0 ' 0 G 0  G 0 G 0  G p-L@P`P U  P V  P php P-L 0hG -00LgP tz h\Jd`d 0-@QPL  P*0S P:0 -LMPH, `K@p@@ Z V 0S*, P0EP W  <0R p,0Sp RpP U:GGX -LpMK@DPHK 07K -L~ 0Pdd p-0LDM0P0 P  07pq \@K@ `P@P@T 0 S Kpu@_ -HHaLp@P#R %RT0TS 0S %R #RP PP@ R묐0ਠ`P@#R %RU0US 0S %R #R P  d@ P R GG 0-D@L0PS0P(000aP0Jee -L M`N, @pP@0S 0S P W @P RX Y"@UXP@ d \00T @贗 P  d,@000S0(KGG$e -LM@pP 0S `PKh W@T@@L0H P`xᏮ @ቮKhY VX,e -(1LMP, UARDpP; %@"@,@`PZ0%S00sSZ,     ,P@00@T:@:T oQ &8e -2LM0S4 8 x2@TdPP TP 0|S00@ 00 P@ @p`Y0%S 00sS  @`00@T:/PUV 00S h10S@ H@)K :P ~B)[80P40@Pp9d=0p@d0S 00CS00`Ӥ0Q-` V g0H v R @᙭Mp@`00~0Sp(K& &De`dxt -L@4 0 pS` R0S000S`PUP@000S 00GG 0-LpMKPᮔP@|0: S@@:K0 p-LpM`P @ P K⇔PPp00S0: S *@ P, PKpJ&dJ -L0Mz1@T?h T0KIPp D0@PP 0p٬T0UN`@D0PP` ~t `0કT0V0S o D0 S00TKXE ᰬᮬ$K &j<00S,0P 00S00CJ&&$&'00S.t& 0S00t& 0-d0L0ST00bp@Pq ,TU 0000h&'p& -Lp@P`WV 000CW 0` S@tPuZ YX``VpWZVXm $&p& -LMp` p@P qV i~ 0 -LM@` pP0 rT @300CW 030SW300CW @0,0 200CWUV 0S 20S UV6P@ T2P P @(2@T@ r 0 R RP`0 "`pP`qXpAq?P  Pt1AP. T"H!0 0S0uv 0 !0S!0S 1 0S:  0S 0S1,00,0 pWZ00S0   Z 00 000 , RT<0 (Ko $@ 0S80 D\$&&J&PetKt&H&'h&p&'x& -81LM0pS` 10S P< Kibp@P+q)V 0AWP 00S aP@P 0p@PqF4 000 0 K&p&$&h&`e0PPJ0PPJ< P000S SP000S0J0JP0000000   -0L`Pp@P `VV'(` W  00P`p0@ 0 @ `000pW 000JJ 0-@PL tP 0T T00 00C0 R( 00C0"0h0GJJ p-L@Pq NP`pp P P@P40`0p@Pp P P00GG -QLMjPh|20Sp2 0 Q PY 0@PP z10S @ T T 0 3A P P p+ A0&{ PlpppdpPBSP`P`p@ 00,0  g1 P+ A 004 00  P 0P@0Sڀ0,  2pp0P@`0U@ZYn(K&J&'&|&& -pLM@Pqj 10S1 010S`0 Y[PPR$p@E `q P PP`09t TP`$  wP 0@T00S Pp@@0P`@P`@ 0 R00S 0 P` 8@ P P pm&Jh&'&|&&& -L MP`;, P,0@cT D ds@P H(Kotppw0x0XW0@࡟,@p(Zy z  V0 U00 1 ,0@c 0E3XpP`q @,0T  1,0@d@ 0@$1pP`q XW 000S (Ko@00CTH0@@$0 0@@(Kxe$&p&t&l&& p-L`@P*P  P p @P$00S ph#& -LP 8hpq0  Bh e$& p-L`upqxlp@PqPph  UT0 phee& -L MKK  K -LM`pp@Pq P |00SRh0 W V @P),0 $K!K&&efL0 0DS@0 80 40 00 ,0 00 0 & P00S 00<0< 80Q0(000000 &4f!hKJ0 0  x& -p娀0L@aPP [`P VPx; `R `MP`@JJhK Q-L5P30@ P,0 `Cp P@ p VPP  @P@P 0`eb0`F@@PZ$0000@PJJ p-Lpq+ PP(p@$ 堀`t TL@P00CVlP A@P@P0@`@00 W000@PJJ -@1L0@S  0SE RXP>1 R0000SS 0CS<4D,L0000T R t0000SS 0DS0D0@0<0800GhK&D&X&4&,&P&0&L& 0-<<0 40 B0 (PL@@`@0JhK -0L4P$ -`Q2LM`0p @0nP"`00020S2 2PB0@0T@DSP PUPELP$20S 2 FR1111!0 0Sg1A0 0CRtP]QVQ"l1000S St100C R0FS|814101,10S 00$\% 000 SR 0R0 W0S V0BS$P,00|0x00SX `00C0@0@ 0pL00`000lK&J&D&X&4&T&JhK,&P&0&L& -0L00@0T0` cpڸ0!0\D0 1@ `@` 0 B\AQ\ 01@lTP  0P@D 0T00x&`KJdK P-L@`p5PU U Ua50S] lt\ h5L\s 0S @ T 0S0S: p\ 000  P`0 Rh0P0 RQ0@^0 00 (H Q-LP`pz1P PU 0 S0S:Q R`d 1U 0Q 00X@R)Q'@PM`@0,!`0p00p q 08 0@PY (X%P&`@0 `0p00p q 0 0@P U T 0'`p(' 0-`@L0S0dS0PP4000P  00000LfpK -2L0`Sp pq WV2 X 0S0S:0S 0S $2X 2 0 0Q 0 @0S@T=S;>Pg1@0]!@0P00p q 0P 0W V0  0U:T80@3 P,0@0 @0P00p q 0D 0U TD 0 P &('pK -Ls@PA`pj@Pt 0u 0 X00S L0XR@PTU0@$&0 50S, -50 S  Ra0@ S-00LA0@S08hf -L M@K0s0s ?00@3KG 0-L MPP @K0 000K0G 'Pp-L7 $P'.P ^P"L1L!@00 0%P 1 !1L0 0P 0  P- 0s0sph0^ ND3s H3s 0@D3HCP0 d00@#L3800 `P0 +P phpGe$&|f &0P 00&$& -PL M P P"P00  R 0ShX0RH0  80< (0K0 K0K0 0K0K0  KGGff -h0L@QP P@h$0  {h&fG -1LM0P@ 0 ) T TVxQ@p `| "00C0 S10R!@m0,STT911 0b 00@0PK  0Sp` Tż ô 1` ֆ@0T@K ap ʆ@K H0`0P LK@ * 0 S0KuJdK`Kf4$ffX_ -@PL ThdL0 Dx@v<t8r4p0n,lhGfQg$gdgggP P P0k& 0-PLM@& P P*0mS MS hS =S sS wS pP hPdP`P\PXPTP@g808 0K10 K0'' 'PPP& P-L0 htK 0-LMPP@KT K@ /0PSP $~0  K0 dhtKQ PP 0P! -LMK \ K(h -LMp`PQ0@-S@000C S U00VX(K(` <B  @00 C0 SU0@0X` KDh -L@0 尅 `h -0L0h! -LP 0   -LP0S -`LPpP`$T X P$T T T-T00@f {: 00P@T -PLM8 B Rp,K4K 00S S }0 8K@EL2 @-P8@  $P  P P}+P00@ S8 z`!`0+SX080 k!00O0 |, 8 0+S0,0 1VS9@DPPP 4@ X^,p 000CS9< X ! !!! X@ 00s03X@ 00$aFQ 800S8 80 S  0.8 800SL0P8K @0S,8 Pp(K!tKGdh -LM0 `@P, ,Kj@PU0@ , |,K^U0  , T,KS 0S SU000SPH UE o lU U U 0 7 0 0s03 U U U,pv 00$p v|!0 00.0ESPU U U 0K$ K7$0S0 90S U0U 0 @00SSS 0010,K0,0 dU 0 `0   000CS4"l"8#"8#8#8#" Khhh vhil& -@匐匠匀pLP`0S dR`P PP pP R000 $@$ TRK&&4iPiT0T0 R 0 R00S $ RsxK -pdA`W%Ld 0bPQ 0Y d 0S 0N R-L`p @_`5! p09P  Qd 00`p0 d (`5#p -LMpqi`@@@0 P`*tY -LMK p-@LP` ᓁ\0@0S L P000800SzTp4i0Sph&P -L qP@f T T Tt h -0LM0o$0 0@p@`%0K%PK  000e@PV-00e  $0 S  Ku`_ -LPMU@( p@tPp0)0K)`K 0M00 f{0@PW-00f  (0 S $Kuh_ -LPMU@( p@tPp0)0K)`K 000 fF0@PW-00f g (0 S $Kut_ p-H`HP0L@S 80 P9P0  PpP!Gl& 0-@ L0PS00C$@$0 R+0P00&P% -L@0@S -1LM0pP`9K$0 +%P0 p`$ pnR sR dR @@`PP  0&`P $0 S . Ku|_ 0-0L0PS@ t00S_ P0@0S @00S {$00S0 X0G%T&l& 0-L@Psw^D 0 0P& p-0L0 S P` 00S S0@@`p0P0S d00S ph2PG.H0 @@@io000T(0 phG&%L&P4&T&l& -D1LM00@` pK1 $1 0S! 0DS ..... 00CS ///(/$/ @T U}`PP0DS /////m 0@'l&'p p p @00C000C 000C?001$&P0@-<0Y@TU 0,K,0 edT,8 PTQ DT5 LT3 BTcWbT aT]mT- fT 055.:lTSpT+ nTM$sT? xTB G$0$S> 4$0S7Ww0$/$0S- !GP%4"pq QPH Q@P pqPP@T 0,K,0 dT,, PT DT6 LTY BTbT `#TTmTb iTB lTC fT;sT pTVtT xT2 QʝP2 R0@ B,00@@TSQʃPp2@ 0 B?@0pO0l00@@TdSbQ^P\0@W3B`pv@P w  U0T00>  0 @P4 p 0q-  + Q 0%P#R|p@q 0Q 0r S |000 P BP000 R Z0R:j%%Gp&|&`d&&$& f(0$0 0b0c0A^T&L&4&P -D0L<0 80b00` (0AI0 T&L&4&&'&0;P -XLP@LD < 80400,(0\`'``_P_PH`P000  $00S00S%PQ@-p`@QP0qr 0S 0Stu( U&T#00S! 0S00S00S  0S tu 0S0S:Q&GG&%Q -L`p@,Y r 000 R00ӑZ R00T0S@DX R P0PS  RT00&a 0T S@D00 vv p-LM@P 0`R  0S RU@V@P SL0 (0K;p3P (  0 0 0Kp%PQ-  0R 0RQ^  QP 0 0S  SR 0 0 0R 0R O00 -L(M`\SPD0  @ p D0RD0 h0O0@Kh 0O 0@0Sp0pS DK 0OP, Kw@p H@  @@Pp L pLHP QR0H0 `> QR P`@pHp 3 ,00S7 LP P0 `,0 , P `P,0 0S, 0S ,0Pp P `0W,0  pP`, ,0S0SpT0@0 (@0 S(KQ -<0L@@墒T 0 00@Q%% -L(MP`D @0 C0@ 00P00S0R0P0So H  4, 00@b  BR ]h00S44, 00@0S0@`H(K'&%&&& -L4MP3@3H D @ < IP Z 08 40 `8 4 8 4 V8K `2pq tu Q PP2YXtu $2 0@_` pH D *tu UT@P1 0@_ QP1 0 QP`p` p`VpH` Dp t u  80s04q 00 4 U80T8@K0t u U0T00 0K 0 Ph0qr ,0S00S0K@ < 0HK@K 0(K%%J -D0L0S40 00 (@PnG0 %&%QP -Lvw= 0 @0Ro800S&1p@Pq ZYp q Q0P00 `H2 00CXG &Gt&$& -0LM0@SPTpW*0000S㠠`pb@tPq Z 0 P " `00CV0pt&% &$& 0-LM K @K0tu 1 0vK0 -LM@Q 0S3 0'P| x3, 0<R dqTC0S 0S8#0S00 3 Is 0p0 Sp20S  lm PEP bPhFPRPޏeP2Wd2p D20S 02 <2B 0S 32 0Sk /P @P;tp@P6q4l1p X W@P%10`W@P  lq@P0`Vy@Pt u `VJn@Ptu t0@ ,P u($0K  0P l00S00Y0S  `00K  (0P (K vq%r&%&4rQP%%&&$&Dr -L 0 0S0 h&% -LP$hr 00s030hq% 000' 000' 000' -LM0 $ KK0 0 P$ K -@PL PH@ hSSS -41LXH @@ VR^_D0  @`Ppc0S0S 0 0?00`0  6X 0S L0DS$0   i'Sl&T&$&%pK&Xr -LMLp`KP 5p@P0[SPKT[' - L P00' -0L }gw<8us -LMP@P 0S 0S1 S K R3 P 0B?SP (KP (0Sp`$K $0(RpQ P` WQP00 -L 0KM#+ -L(M< @ 0<[ ,0 `pZP<@)@PP 00@P 44 04R0  00 4 8  00#0S83C尠o,0Z0 C@ 08 S00IP8S0 00CS00S 00+@P1!!!La000<#0S 0@Sv #0P\00%< MLx2 ` R p @  0SO ,K04 Δ@T# ,\24P"L"l2 0  H"<0P P R0ٰLQ0弰  001 `80S1 RE ᷰKTh4 ,0K4@h啰b0 , 4"4@ 000 00D(K @P 0 wt#g!:<2@PLP`DX }@2@ sTp| -@LMh p&>Goo`p20p0`W` K -LM @`, pI` poO&>@P2Ό P, 0U@(K -GMLM䐟0,0 oK 0P@t K@PLL 00npK`2@PΌ  0`0Vp, 0R(K囉uv -P&>L Y0\"]2@…D8< 叏00CL2 0`0CH20P2x0Tr( $@S 0X2 g0bTX2i7STU' D _R 0S2! 0 vT0S0?S4 0S 0S0?S0S -! LR% 0@PP@c@@cPE@@PcPPcP@ 0 0       -`!LQp 0 P 0CA2$,0 %@$U00e0PDWW00e0P00萗 -LHMpD  W@ !!8 2@  `0 @Pp1C4p 0V< 8 `*`p,0 ?040(@00}@P 0)@<P 0, D 800$DV(K QQ(KoQLT0 M-Lx0\@ P7P3!0SS`p  P4 00 ,?0"10  !00  0,?0"100P0f`]Y(Kx0 P0\0 0     !0   P_Q -L @ p ?  0 1<00 `! 0! 0 ?  0 1<0PP0 P` o -L M"Q`Hp  pU`W` 2QPY.EEwOE B1 @@P@xU^WP, p-`W` Kv$@ 0-LM P4P | p0R dK?p PR@P D0D 0HR* a8Ȟpt~ -LQ @ 'U QL p-0L00C S`Up@ PMP  žU p "100 lTp@T1"00 0@1!T$ TplPpXș -@L N &> YPU -Li -LM⬀0P$0 `OKpxT/0;p $ 0R  KO@(QUO@ 徆u$d~ 0-PL@(Tf08 -LMP0@ P@pmTKV"100!aRRl@0S`VXOLSTDPT@_ ?0DTDTp p-LM0@00C S1TKpP`|O Q2PP @@!00@1PD -L,M000C S$S KPPS@0 @P%U( 2pD`KA2@ @N P0DK000$S SHh -LMpG!P$ P` ˠ0`d@̠ 0``ZP? 0<`P@ K谛ț؛ -L M000C SPgS (KOPhN"@>8 <  `40 0 (C 0 !0@ 1 PRp!040        'SPqEA0T @@ll"0@~L/Np 80<  0a0`S ! 1RP1P!@1SS0!PZ0s1qN1s 0v@`!PE0l, P@!\`F0<`@\,!0 @!\0P@w!\0`@k\,!0@^00 S 0D@8Ȝ4L`x -L!M☠K`, e 00`HM@SR70M, 0R(Kru8l~\ - LP 0-MLM00 0 Pכp ANK@D@D+0 YP @P@@ 0 S <K0u0 -0LS@h}@ -0LSh% @ -0LS0Sh@ p-0L@T PPfQ0`00oP@}`p蠄x) p-@PL`l lf`\ 0f-0P0P@}PpTx)h -0L 屡f<8up -2LM00 S Q 10S 1 n1 0RA000Y 0 00S SI|10S? p10S;00^SY,  0  00S$S00,0 (p0S00p`P@ 00Q0P, Z00QP0  @j@a ` P@Pehp\P`@ 00 0 !0 0 000(K-/-/////$ 0[,c( 0-L@d@ ,PPd0hW -8L(M8 0H fSL  gS eS( (00080圈團 p`D0 @ < 8 4 G|(eU *HU BUAUi00E S0OEU CU*uFU GU%UU LU RU IU aU VUbU cUsU lU hU iU fUoU nUqU rUxU vU  H7uU U yU 'U 7UV00G S6 6 6R6 0 00C00 ,K, 0R& P00R0Sp AUp6PP&00L&3 ,K, 0R P00R0Sp55%00%00@05@x5 l5 {%000vx5 @p5Al00J@kXX 0<00a85 [05 X8 40R00 40 :80<@ 18 ID0|$00< 0>4 8$0 $0p4 @`4 |4 't4 $ h4!d00 X4 P$0@DP 0P0P  4 3@0p`S`@0 @HLD 3@5pP3H 0cl@80T I{2P)`hp@P 0 S 00KyP 0S0#3 &JPP  I{PU< @R@X00SX00SL0  %H10S$"0000S "0000S 10S($B$uRp 2p` !0QP 0B`1 /P !<t! Anp`d0W810S`KX 00S00S0  XDp30P @P P5PHx@u3c<///<lzT//- -D0///8u\///-//-//--px/sT Vxt-/0/-t 00 0x-|-0P$ 00C0 R0 x--|-Cz -LP -LP@P-  p-PL0` 00 0@ 0T0000D S0`8``0 0 0S0ڬphpx-|----0 CR 0R0 SS900 -h1L0`SPp@Da@<10S T (10S 9M@00S T 00S9M@T 00Sp`8Wc80 400S h  h8/t/xt/ -L{P  G -Ln{P  , -L$}P  L5 -L 30S: S0S6R) 20SQ b 0R20SR Hl2 2R P"7l2DR 0R08 KPK: @2b PKR8 K-z00C020S 0S0`KX Z\ 0S00R0S QPK000`` ``` `P 0S!0S @10S3\10S d10S\@5L T`2L`08q@S@`P0SU G$a`00S0P0S GT 00S0S0Sp0X00s03Q0S 00S  L\00S50`(K VT/T-/-H//0T----///-a//Ll/d 0-L <PP@ 3S S S @e 0DH@; PF0S $ 0tYD -L 0ƛ`8u -L 0KM#+% p-PPL `P @KPp.­P 00=P @T P 겭P H0 ,P @T $P.p0 p-`PL& 0S# nS$ 0 @@,ㆭP*y0PP@`00@,rPp4H0oS0 `  0Vj 0-t0L0PS Q @Q  㡏P,0 r300 R00V0 -LMp,K0 'FP1 -@,PW T^$ W@` MP00S | P, 0` <P00S | ?, 0(KqKn -LKMMMK@D@D0,0 `KKKP@AAPP]pP4: S  S 0]5L KPP L KP_ @LKbP, 0R(KLK `Pd 2 RrbuPq|LK 0p03Q0S 0W $0PL K$PPL KPPL KPP@4@HP  & ` $@0 0fPz IJq0 0f4a |:P   4$:0@ 0<FIuk 00iܱ<$|u -LM KD`P42C^Cp `V J 0d@Z ;P^E`VZ|}P Pp^E  -LP@/`!/p a0@SȻp$!/p1pg07 P00S20 R 0 R. V*1 RP @P PPR0 |0 Rt0d0` L0 P0' `shd, 5Hs0V 0lz0kj^ -LQ 0F^8u -LM0@00CS 80K 㰒P0 R lzT -L@P  00B S 00B SRh轋 l -L@P  00B S 00B SRh衋 뀢 -LM3QKI@I`P | , 0D $E E t#.pJ 90@?S?xXH0 @H"w.p+p30V1P@`P@   0] Z P@, ドP YP0P p@`KP FP AP "000s20K =/p `B0 0pcX2P R^ :Py 00@Td@Ta  5P  C1 岔Y!00070SQQQ4 F 0SC nS 1 4@K t!,hYDPPHP 01VD10AD0 @@ <0 8@ 0oS1 4@K 4 '0PoH0S @H`K0 0 (K PUO|L pH0 44VVsvd\hnƚ h -LM@08K0kVP@`AK:cVP0: S VPP SV H`@OVP$KP U @`0 R000]K@6VP l1: S 8B((]>BV  --LM0 0 /W8u -LM @Tp`P0S  0P P 000V -L,MD H &L0 0@  0 40 P @j@Pl HP W@ `0YX 4\{ V 4 R08  C@Vp<@ 0S00C S000C S BV0VPpU @ ۆP0S PUYP:0 0 %0 00 ğP0P00 @TT@TQ ኙP,@PX! 4  Y4 @0T l`VR hB @T PA@T 4`V$`>SVXg 0 0(K4 Ak 00 U  0L P0 I @8 <00  0@@30f0cß`D0S D0XX @T` LP@ 0 ,K pq Ÿ@TM@TJ 0P,@,4pp PB ^^I R0000 0W G 0020 0  0PP2  A R00C0VV X0Q1 `V` 0S 0SLP 0 Yt , 0`7A, ^^  0(4PMpmmm0\/ @T3 0Q  04 P 0'@TRf LEPa 0 ||+0 Fz0 04(4VjXl8uVФa@!8,L -OMLM00$0 P>hEOKpჼQnK`F 4@ dC pU@T:+SPPD@K9# $ᾐᲥuP8uȞ< P-L <@< 8媐 ,,妐U0 埐<8uh p-0LPP` @`P PA`Pp蠄 -LM0@0cSz bSz6 PK + 0`S R [ + 0 S PU 40!Vā,((0 "4^ L?D< [AP1 ,ԥ -LP@@I<1<oPpp`!"&p mP \ &p0 !0@S( W V<W# _T0 `P lkjP P 10 pRpp8$XT<LhslzT @-PR0 00@ R! 0b<,4$<, 4,$. !,00 0 0@SQ:00a0P<# P8#,8# P4("$$# 4S   8#8S ,8#  <4<("4  8,#44 7:-0^00 *0Q AS^*0rS 00n00 0S 0 \*00b\:\00\ q00l P: !00S78P8<444D444L44444444444444444444444T444\444d4444444l4444444t@<840,($ x$D, p-@L M0KP`  @ᑊ0S"V8#4,|4 <0 @!0 0 Kp@8<#4,4 < @0 7 ;:0 -L M A`+QOh0  Qp &0S 00000@0 KP  0SKt2XX0  QPp <04  Q  7:8h88D8p -L,M$K@0 ۉ$P儀U`pDK( K,0K@@ 4@ 0` , PD  0aP0,<S*0 CR )00 \ 0 CR 00 \0S l% \0 R \v%\%0R Pj%>hN%0R>h^%xt -pQL@ᬡ0S:`00CS`0YX0  X0xmp`9``!o0SD@`00CS`0FX0  X0 Q 0 CS  \  XQ $P`U 2 90S0C000@` VP  X U0 $X $X $xtttdPZ  p-LPL`@LD90  09$  phptXt -LM`@ h9Q |o/$Q P 0^, ` pP , Rp RP R0S0C000 \  R  R  R,  R P @U@00R p9T dB0P0 L9PW 0yZ  $9X  9Y @ v  8 @ 88!p &, R 8l4(800 L 488@T700 L T8P1 R) 0 480! C$1 R)`00CS`0'X0  X00Sd0S`F om# j#<o I}@`8@ 8H o#X o#:\8,Th|@Yt̫7PZxtt̪@ -L M0B0r0 S P Q (# 0RuK0ASO8L80 0CS0`1>8 98QN QO 28 o l,8 0 X%8PL!0S 8`V;0 40 L @L@(`@ 8{0@K8D!P 7:7 7xx s x7p7h j|``8`7u,Xxt@Y8DPYd -LM0@0 4 80 2xu/aT,  cT ,  gT0,0 ) ( (@şş0`4 ğ4P 48 4X0 P$`0 4 dX@ 4d0S0C0Y  @  \\@0S4$0 <400S0C0PP  0@Sß0 30S0C0PP  0@S0 30S0C0PP  0@SD#0 X30LS0C0PP  0@SŸ0  30S0C0PP  0@S}0  20S0C0PP  n0@SmT"0  t20hS0C0PP  Z0@S@g@02 R (K0@gS@ X1 RQ NPR,0SlA/JP 0SL 0R!0S|B  * ( T<A0Q$aq }y}u0S,  p 0d0,   00 R77l88@477XD;7:8T7:77|748 ;:P:x7 (4<D7Xt -7LM@ T0 P`0gS 7}w 2 !Rj ^1 180780 PU& |1 1 u|1 !R?1 mkT1 p1$db01 !R)T1 ZXvt o4U00V0S 0 R0%^4vdIqnkhe0a^[7:78:d8`8X77I,eHi|Xh8:XT7ЮP8حh$ -L@$M8PK pK8 L 04 ( 0@ ,@ $@ @@P PKc`P 0 @@P 0PV*@|0@U_ROLL5 p-!LM0@P` 8 @DT0-SA@Pxx@DT` HQpK >K0C0C@ @p> 1 R1 1R wH`9 8  0@pnK`F`F+Fp@}.0S px$ K@ @V Hd30(u:::7D;8pX[ -4L0M@PT`t4pPEU50-Se@P@0 @PU  ,K@?0~, RPEUp|3PLK 00K@L H@ 4 DP @P < 8P PPP0P P0SY Y *0 @P0 0S! @U ^(K2! 2 2 2 PU}  }P d0SP P20S 82  Q 0QX 0SW 0S0S 1 R00P001 001`PXP00P0 1 R0SF0 `> \u20S0C00j2,-a-0 Rt X2obP) 00KLK PPOP00P\ A]0Y-V d`2X+2P L7:D;7`8x :7 ,دhL5 -PLM`P/Ft3h#1p1 T0@"S"2 "p2嘢p-2A\P PP@g3 Pn T2 Ro<2p ,2 R!  1p1 1 1 1 11 0E2SNxxxxhxTxxxxxxxxxxxxxxxxxLxxxxxxxxxxxxxxxxxxxxx00[FsVF|0NFIFDPEF4@@f<0 0XS0[  s( <E+4Q<a>+0S;00`  B LR` BX0X00K @l @&+<1 R 4Q  +0S `00CS`0,X0  X04P yP `+0S 00 L9 5y0 R00p0R PT>X :g@ ]uX848ZHPxtd`dtl7 \t\88 -RL(M0@``PD0  0CDK(K, @ 40 0 <  08P @@P}(Pj VZpPz  0@@Pt(0`*&W*@0@V0SU0 0 R0@VpVUU@@BP 0@ 8 DP < 0@ 4@ @@qp2 (P- ZP? p 0 @@ap2 (0`%W*0PS@ 0PS r01@V0Vt%UU@@ $K@%0*S D<( 딶ȶ| r |0000 W0700c00B02p  4000 W0700c00B v -- LM 0P b KP 00 -0PLM 0ж -dL @nP H nP 4 nP  [PP舷 -pPLMRY`P 0@0P +R %R0s 0D 00s 0D jP P@ Rd v 0-@LtP 0000 h᧋P%T r 8000D p 0D00 v̷-0 CR 0R0 S00 -h?LM\ϟ\?, 0\1 0  P`1 u P" (s $ mP2@p  mP@p  mP"@p`r ,"/=P 0S U 3 T l 0  S2  0S` UT, PB B Uu0P/SXQ X X1S X10ST    0&P00S2 w t\ \1Sx\L mP\1p \0 xmP\1p , eP " " W 0S  XP02 2 0\/S/00LP 0S00@㶊@P2 0S/ PP:㬊P  0S T /R i*XP8  "*0p  @00\:≊*  0@Sp "" V ` `At (P02 ,`KSp0@s?KD,;@T X+d d1S X (B ;0S; f;d 0h1 l1 P h1Sh$l1S l |[0h1 @0X@ WP  4`l :R0@dap@X (lwP t1P0`t1 t!R 0S *0S |ʟ0S#`#0`0S0S*_*`:P t l90S/ 90S+9R&Q$90OTS 90S9#&9#d90Sd9 P9 @9 tAT D(a"90SAhtPK0[S ])P 0 :SSp`  :)@P00 eKⅻ7T01 01 7e_KUoK 0Zp\70X L@K H'P0; 0IP   TQ0SoK`1 B 00   0P,ϙǟ0St'  w` `1s# ` P!0S !`1@+!D0@`1  00L@K00@ 0PPUTi`1S k'0`̌|6 0Sd6 vFP`@#P@PU?VP\@PH"P00  0R;@PUPP\AT 50S5\!v"R ğğ$ 0gEğğ$ 0];xğt$ 0U:㋈P 'rPP@ %えP@$$0A$R#09X }P0#.ß3#'@40S,4  RP Էp@&P " ]/K!P L0Bt1 t!R  00 S S  0P PNK ŘK> qp1SPKPP 2P "0 S00`xp`Q"@0NK]/KP  x0Bt1 t!R  0 0 S S  vjP "0 @q2p1S V  `jPPt @ LP` [q@PL #㵇1PP0Sx1( uP ~`1s`X! %PGQSuܷPi (HlظXPZdtYtdp|\[Ĺ й$T@`x3H;ܺ<\tvttLdY_DHdxijxtpTihijdػuԶl0"0 " S X d d1S X%|00S0K8d 0h1 l1 P h1Sh l1S lP0h1 @0 a@ P sTP T0dt1 LpǏl B:"b0@Pt d 9p@XY%lPP `P`U0S 0S  "0S#9#P0pÏ0S0S*7t1Sl20S/ 20S+2R&Q$20OTS 20S2#3#(30S(3 <3 ~L3tQ p$.3qr t1S0S0S 30S 3{30Sh9P P  P"R  `1s `Q`)2 PO\OOO4, 0RV(K -ML MP70\ ,0 004 ` d$ 4@P (70S04 囸PL  0 S L$ 呸PH  0SH 6C.K0 BX4 B>K0C B0Ch$ l4 04`:ޅP 04`$xo0PT4 H D hhP T0 bhP  Ɵ0THd$0HpZWT Rh@PL$R Td$8pGT4/pᩅ:`᥅@@ᡅPT/ T-*P0#03V0S& L@ ᎅP@@ቅPTT*XW T$0S04`} pP  P$ 0[S]eP P0#03V0S @T 0:S(0p0@T! :L/PH0U0PU P:S V  R0305P1 :T:3Tt`PP PW 0S V @@V 0S /u%P@@@`@,30SD3 0UD4 @t <$  0S\C`S ~P0_/K|1 P+P$h3PU qG[\ \'Ē0S" Ÿ0S000 G[Z_K\ hKH[HK <@@GP  h0KPP 8000S S E!0 qx@p@,28  @P` p , 00l40d10@00   @P` p$(< ! DPp0s`00 P+VD000Sl  [?K3P`x@0V0  0 L ! V ,0 SJ(KouTpcZ[djd4nj<ddl_ܿ(tP\p8p|\pi` \XpVp(@ -LM|Ο0 ?`ppΟ00 ϟ>@P00LΟ@P 0 , 00 (8 X` Tp L oPD D0S = 0RS 0S  R00-S 8> ch0S> \h=0S D0S  `= 04 S< 0@ D00S0H0 0 PMX0SMPh00<0S<180S8,<=P`P0=`*"0<0  8 R|`oPQ 00|SM P>0S 0 S ( <8< /g@P000T  T T/00P;0S0 SP;0S 0 S \;0S  0S DQ,;0S  ;;0S h:P >P.D0S :0 PcPU   PP| \0 00S `V%(nPL:,0 :`) 00|S t@ , ,0S  ,*P0S00:P9 ^, ,0S9t 40 90S,0,*KKP0S;0 `i0 SPIBFP0P0( P0: S 0)0S00 9  X80S O0CSL8H0S 80S,0,>*\80Q (40 S8P x8P00pxP0JSP0S,0,*' Lp@0 S YPdU<W0/S' g0S 70S0S#&0XKPo@0X0 T@ 0XKS#0S*?0S000)f6 )`PYPPv000 o 60S3 60S 60S+6R&Q$50OTS 60S86#$6#}50S6 5 p5V ` V m%0@U{ Yrtu0E 0S , _PP@",p50S,00#30#,p3P 00 P@T@, _P0S @040PS4`P4` 40,X TL00L0 Q N0SG#}X0K 0OX0 T@ #0S #0S @#0S 0XKS#0S*0@0t P@H0S 0S,00#3 ,tPP)0S, , T t T 0S,,0@R刂尢`p0:p@`20S000@0;P ,20S,00@,.P H L0S BL Xel10S. 10S <10S&XK0S0S *h10S1#p1#P410SP1 <1 C,1¦00S000#3 0PP 0 S l 0@00S3,00#32jܷPiTixdjnpp^_`d@\iccZ( VtȞ|xt`R\RL5Hdtj4xi__Znhi,PP @Fl \nk40PSl0`Pt0`40,<8@0S@ 0y0RnD0Sk RQe10S` 4 (1R\ pP V Y0` P0`K\0 QpKt1PK@P6e7 0rd?@0 S1P 1P@ kh10S1<  #Q01@P@@40S ,0S40,00S07yH"0S0S<986(K -4LM0P,0 l4pP` _OKTP L@4|  U?Kx t pQ $p!LPKVkP QkP#LK 0GkP#LK P0(L0[S LK_/KU?KP p 4 ld3 T1P`Q,,84,#,3TQ(SK ET10S  <P,o0S2 c`P( P0S* 0S 0S  KPhdFy\A\Ay0LQS P8 00S 00 1cKPP xP x W?K\ ,[p0X0 I ,0 SE(Kuj8pZ `hptYnddRDdtjp[d|\o\ V4pȞpv  -,0ML  0b'<8u 0-L Pl10S 0P 00S%@w00@P000 t00S h0P \00S%D@w00$0 (0  w P0dipvxtZn -L +i -AMLMH64 @&@6@ <&<6, ',&P 0S606+ 66PP5uP5eP5P55P5PP@P 0S iPP iP iPP x}iPPPd`5`siP$5  H֦D%P 0S,50T0S 50@T@忦@P 0S OiP JiP Ei@p@3@40S&%4P<4  |40S|4h4%PB^KPEXDTDtPE`TdP3  e\c\C\ 6\, A\. 4\%P\k E\-V\ a\%n\B i\) g\w"k\& m\r3r\U o\5 p\jFt\_ v\e_  H3 _"00" ,3 2 2 2 1 PE]0$2R3>X2 4"007` R2`p / hp3|2PT"00#1 1 11 P]04"S  "0000C4 !5p^1P1 14 1e14 .P P`P BNK@D@D+Ã\1@L44S 1@P 4 P% ,0 SB(Ku nhd d`jjdcccd__dxidpD`h<ja8@HxttjtjlztvZ|iZL`d8udhcsjnpi_Z(@- @@00S0T0Sxxpl`P QR0ҷ0δ 0\0R0SQ  _dWn p-0LlM`K  0$SP$$S \S0 0\@Q K1PL!l00l00S T K1$HS 0S Q 0S0K!0l0#00[Q \Q $Q~0S0 0$SO @K10B00B SG0R 0 CQ 0Ll0ST H$ 00BQ >\R( $R"00A S0Q0  CQ 010AK!l0SH$  00BQ T   @R@,RR ]RR @\S0S0S ]S01g<0,S ]S& L 00B S0R0  CQ 010B@K!l0SH$ 00BQ QP< 0S`0S0S2KpjdSLej -L@Pt00}S h00S`0`fTP40 @0R80 P$0  ndj&j 0-@PL0S 0@0P-t 0  0dipvpZ -Lt0t0S 00CS0 O0  0 / 0宠0  屺xtj@d|v -AMLM! P, 84 0P0044 @0P04 1  \ Zp8 10S) 10 R`1BK0L`Lr 0 r 0 R0 @R 00S" /04 44R Q00s384t 0@Y \:T00S  ,0 S0@(Kunn vvLicxZj0 -AMLML1@ @1BK81@@ @@, 0$ 8 4$ P ]< B^KPEp`䐟䠟䀟PE0S0 0S P =^ 0CKS 0 0A 4D ,t0@ P@P<, 0, 0R0@8*@(Kuxv@d,|vZȞ,jj8- 0 @ 0^ 0ZȞ, 0-0P0@@ TLP Q0T 0S`0hTL 0S <b0^P 0@0P0cdZ0nT` Pp-LP$A ]Q!a] P0PeP@ ʼ0 ] dP @0S0 ] 0 p R 0S ph P <>0D 0@ 0pjhZtT^aZnxnT`cc 004[p -0LMK   0 0 ƿ K -LM5d0@0\S0 H Kmp 1[4 SP00 0P @Kxtjht@n -3LM 30 ,0 K?" `Q0=iBb@B mB\@PX 2g 0PŸ 0VcPtR@ P@ 0PZVW@" <"<2Q0P$$R@R@ ȷ 040!Kdp!0SK 1WXVV  0POژ1QK1 @PUETBP@Pᖷ 0 0 0֊2`^pKKP@o<`k<MPEd@d0 7!00S0P P@K P ,0 STu>(Kdux_.Ahi?$Pim@0ATiZxtj@ -$7LM0pD ,0  Gd&6&KZ60S 6`V66 < 8"  d <2d 8B 0!ర|&D D?~dSpdpRq@ ʿP W06$60S6PU ၥ P@ş` @Pşş!`@`0K%0 p 0K%0 50``VdජOKPYxşXşea0\%~ pL _K`%5;FEpP`V0U0WXOK1$0 \ Ba$@PV t4 b0h$^8B0=ɌBJB ͌BS0:(Ku|i!t!j  (4< jdit p-2L0PS 22 X2 p2 R22PR x2P 0S\P 420S 8pP(20S 12 W1@ @z1 @z1 @z1 @z1 |z10S1@1 T!0`03PV | i@Ph i@PP 0T.S@D0P008,!WTP$$ LP10S 1 1  V  d0 ~W R00 V   KP0^ 00`pdijPDdn_ dnj|dcd_`i f djntipnccctrprjn_x(4 0- LM0P@0P NiP KbS0 R r X0000 T 8@,l^ 0P8dpr vj -!LTM1Pp`PPW1A0 @0s 0 @0s 0` WKP P1P1^000 0000,K0K4K(0Kd@K$ K8K 傸, 80$ d0 40(`0 00v.B\0 ,0A BX0 0D0 T P (0V0p0S@0@@ p0x\ V V P@D] f@0tp0 Kdn vprj -00L((\ 0 0vV`|w<O 8u -4L@M$ , 0圔-S ``P@]Pp00`dp T$Yp d0@ S x`X#@p3 UPXZ #夦W p   pL p@H P9\/p sp @hpP UX@KT00 T0 "2a20S0jd0 `pl`K 0S `0#40Sj@\K \@ ӕP= 㳷W@ 㯷 p@ @ T ᤷ p0SH7{1p| `k@P9 Q 0" Od0S$  <iSa0S $ " ; XBr>;8f D.KK럒P@@\ AxܹDu<|wXb4s|Բ ;<Pbl\Q -L+ 098u -GML1M a |!@0P$4 X! p oP9 4!p 0bSQ`A~K pG0pG4 P3 $$004 4 =K 0C0C P"P -P P I\0$tA.Kh0 B B\T0$8 ,uspzTqk qqlzqg -LM@pP4 [PP 0S nS6 =f`P00QD @ Q? IP 0V0S D 0 YppV 0`pY" 0 0 p 0oSP500,K M,0@S00?p @ `60 p000"S 0('$P 0 04$hhhhh -LM`POP( @(K,pK 0 g(0@S /$KOn @-PQ @p`0N S3. P P 0 CS @ Tp@-PQ @` Q 0 CS @ Tp-A_\-S00 0S 0 -@<`Lpq/06p P60@S6耆 p-`$LP]/(P Y/ 00PS4S/ U@phM/@P p-1L(M0@0 hZPPE hp`D @@K$ ᗗ$ v ᇮp@0S 0P1P,   rp ,@QPE@TU0 uP|z,.b\0 uPHl 0 S4(5Kpui$(4|Xth p-LM`Pp P 2J壷pE 0@M  @K0  ` 1Kɺp0PS "P 1[ ~!Kp|X[ P-L@`Pp\i. r 0000SR 0 S ``P'R"R $R `R \R `F0 `F P@T:V00w vP0: -@̠Lp`.0'.TP! .U.S Ut! 000t0 00000s03-T0S _T _TX0h0`@T v p-LM@P`KP@ 00B.R SR @0 S EP Px -0MLAP040 0 p4E(U`R UO UU?U- ^U( UZBUUUU!U UO1UL -U,U%*U#D/UB=U7U=5U 3U9MU6 U4 BU*1@P A0 R) 0000@Px0 t;@P 0L140@t-0@0S$ \8\[ p-0L0Sx0@T``d0@pP LPp WTQ00ph[T[X[ -LM, 0 1`p PEPP0=S @0T -0AU2`l/PP 8A0-0(V0V1 V0f0 060 P,0f娚@0奚@ ᢚ@006 0S @ ] 0@$S `ST ኚ`T X:D0,0V倚@0}00@@ ,0 (K耆Lt -L MvE0p 00@00f(@ $p PP p  `KŲPP@@P H @ (K ( [K萆 | -LM(0@SPp$@ (@ ,@  $$ $P ( W , ( $0`0!=, 00 4 00 0 0000 P00 E00 @4K.$K ($ (K $(  ,K, 0 40  X`0 K茆 0-0L M 0 PῙ 00  K @ᵙK!  0wK0脆 -L MD0@0(0 $@ (`KtpP ]0 $0 (0 1(Q4K$0 S(G K % K茆 -zMLM\3 @, 8 s8 0BS7@PK<380@0 00 0T`K@T0S! D Q1S00H K0uOK]1S P 7( R 82$ Rk $,g"0 PB R< 18S(@:1 1@Q4!\1 Pϗ400 t0 Sl7h 4 Pẗ800!!粗 @1@PRP 4@PU uK'P  00JuK '`  V' p zKPJ0Jp`7 @K0d  T0, 0R@"1(KuT0@Pt p-PLM0d &@`6S,06S9 0FJ060Sx. 0t@&00 d `n0KX P1p0  <,b* $\x耆X|8KT? 0-@L0S UsF00 @)@T00Ph@Ah00S0@ @8Pc (00S00htxt -LMPQLB0S00ڶP,0$R0S U,0U2  _N 0@? UN( RPN$ R] JNY0 R p4 0APL 0p9N` Vp  0 A  v>  0   N  0   v>  0    Nz  0   v>  0   lMdIU(Ko菏Pp`(K|  8Lt M-LX-PPf.@` R 00 40pPPK X@`0$a01H S  10d0S A -P@$# @ d$ 0@0$@P$$N)$@1S 10l`00S ,P@(L ( 00 (K@X p-L^KMPEMPEda@0+0K|-8w41!0t6 l&  !0K@QF p6 h& =4 06 p@ 00$1S o0 5 5KSK?5 0800 0900 0:00; (0<0000D0H0L0P TTKp耆|| 0-LPMKM,B@0+@0K-810Kl6 ,0p6 \& <0@`6 0S1!d6 h& 0SS005 _ 0 00& 6 l1K0AA+ ˁ0SP00 Q K@@)p@ 000$1S 0 5 5KSK?5 0800 0900 0:00; (0<00000CSDD ˔< 0H 0L 0P (0T ⼔K0耆| -LPMKMa @@+@@K~-8y1U 0Kt6 1P  Ap (0K* # ڨpt lШpd `4pX  ᷪp@  p,  ,p l@͂ʪ0T0S P0 00p(K<lzhL[P[\[ s|(4,DT\tT[ld8u <X[<Ȟ`[(HT\h  -@3LM0,0 :~KpG pG+P p@P`0S P( K0U~8[S}8[ 0CS񟗠 P  2 05R P PXBu T0@0 P@<@ @@K0PwR00S 0Pf0` P@ 0PUPUDl1 05RK PEL10SA 0Y8A)<a P5R60A 0T 0CS00S* >T0T0S# 0 000S0 05R@1R 0@0KT@K@\ \0  ,0 SDk'(Ku`[|tx[tY -0LM0崠p(0 P<`K@KP $@P ,00 00@f ,P ;P <  (0 S ''$Ku(8 -LMP,K D P P pP00 ,`@09pP @ T  Tt~  @ X,Ls   ,P ;P (i Ph8 -LM@$PKp A?@0CS` A@AQ 0#$Vʴ :P` :Pd0P` $P R`8 H` -CML M4`CK0@X @,0 \4@P P0pP4DT,p1@KP p WEC.K B@@0KK B0LD `$ IP Jd4 L$AQ XQ IQ8 BQhLQF SQTlQA bQ^ fQjsQJ tQ`4+hV X #PDTᖍ@0 S  `4 b P$ y@KP @ d@ T `4Le ( h"@P \5D 0   $2@PD 0   !@PD 0   1@P Pژ!pP  \$ C ;TI DTpI8P \D8P  0 <;8P ,68P\4  H4K  T$ T$ T4Q>  T$0AS,P4 ;P~P4Q`"X$P@ CKAA X4p ,0 SXf%(Ku L`cẗlr 4 0-LMP@Kw  @@PR@PPPPPPPPPPPPPP 0pPPP,00,07KP 0P-00@YJP(  "P88(8$88 880c8@u K ;P l 8\|8 -LM@(PK {P U tD"pP .,0 0 ,  0s: [}S ] `10SMH10` @P00 00 P X0 0  @TZP  00 p%0`@T 0 S 0 ] P 00 0 0 000p$K|d 0-LMPKu  @@%P񟗪`th4L 4D28,Bp 0 1Byp{ 0 1Aopq 0 1Aepg 0 1(81v8t1@<:XA, 8,1 "1000 0080@x0888M8;8< EK ;P  <8萆|   0-LM@PK 0P 0HP {P ` 8b 0s4 8}S  8\|4 p-LMp@d8@P X`PKl 0s S ,F  SVxP[ V X -LMq1 < 0C  0 0K/0C ` 0` P0CP 0H!0C L0 ,00 00000 0<  0< P 0 ,00` 000 00 000 00;8@P PKp kU 0p3L[  V0 P00S \ ,0  $ 00Qᔆ p-0L$M0` 0 mpPp <@K 㜄 "c Dጛp@,@ 0 Sa"Kpui  p-0L,M0` 0 >pP D@K( m b \]pda,00 0 S+"Kpu6i( -,1LLM0` 0 pPS @@K 7 b 'PB 3[A0ASp0HQh@K(  b xP 0H0P0    0 S !Kui |6i( p-0L$M0P 0 岹p@ <`K  gb њpP "[A0AS 0 h2KĚpPʯƯ¯ 0 S!Kpui i  p-0P@L` 0SQ 0   @T @P Pt` R 0S @p0S@p Q@p @T00ꔆ 0-1LLM0:PK(K0 p@P@F@ G L00L0P H0S L0St]P 0P0 $00 PKH0K  PA 0 S!K0u| ,, -LMQa嘁q8K0S1 0T R X@aT`%@T@ H1 0R0000@0c!S0/0S (0s0 (0 80 00 2K3Kᘦ@=3t 0#S 0S 3[ R T0S (0sT2[ 0S 0SY |Tld `[ -LM K8P @p+0`V&PEP  0S 05 000` Ⲇ0D0S PP\  a0DP@T,0D0S  : 8|D -LMPap00000 o`PV p 0@>\I @P`0 @0Ol̆І|Ԇ1 P-L`h 1 @0Q0S 1 00&P>\DX` Q0DQD0 Q@L00 pP>00CS04@0T0, )0@0CSp0@0A0@p00 @PP [>\, 0O00踆Ԇ̆І|\\\]G-鄠儐Pp0 0S0 0 BS00R \P@`A܇-D0D@00  R P ܇ p-P@0|`00t0L@l0@d0@`0@ 0@0CS0 @@00 ph%p\܇] -1q00SL-P`0L00  P=000CS0#@00 0@0CS 0`@0w0(000   ܇\] -LMP@0 24PB ,K @@P vhhhrhb`"PYm 0 P40S0`00J%P, 000S SPp P4P aP 4PTAZ,KPPU 1 ,0Q.0 Q@L00e  P%=H00CS0<0A004 Z100CS@ 0@00H,  lu@p0P@ d P P \0P 00S Pp(K! t\\xt\] -LMP0@ T T3pP- 弐0帠S0@0+@P`P 0S  0  0庰p3PPP0T@,-0 CR 0R0 S00 -@0LP` r PeS`Z !`0Vh3`c0SUJ L0SF I0S\\r@U`T tl>P 0\!Sb/*0S@(0@0T0US8080E0US008`zU0PX*X00S\ l L " U 0@^S00\P0Sxt @$^t -LLrLLL`~@0S 00CS00PӤ0EA!APuG  Q/0 Q@L00  P;00CS0^A0w0V S0`0CS@ 0 L!0d800 S0!00 U`!00000 +0S0#3 LPP i;0S0`00M#` 0S0`00C#V @V00 00 0 <0 `xtt\$]8, -3LM, 0 0 S@`TA9P, `3@, P00T$P 9H;<0<80P ,)V0fȞTl] 8u - c L@p)"pW0 WP\00 PW 00CSP 0 "0a00 R0 Ch"000S 00CS00Ӥ0>>x0S0  'P 0S0@ 5P X R/ڈa刡0 RP\00 P@9d00CS0J@A0 0B u?0P0CS 0P00d X00p 00S0#3 PP 9yW d0 00l0 pD0 00@00S <00SWpGpxt\] -L M4 pTŸ`2 0BP00 p30!00P `X`1 P00CS0\A00T Q00CS0 P!0q0S p>0`>PrP0 nR pR lR 0P0P00PP 4=  Q =0S ==~PH==QP>P0 nR pR lR 0P0P00PP d<  Q <0Sw <<JP,0 0SS0 x<0S <0S( p<0S r ;000 8@P P0 nR pR lR 0P0P00PP 4;  Q Y;P( %P]PP0S!SH  A0S, 0S @P ; ::;0SZ rc T:000] P 0!S4  P0 nR pR lR 0P0P00P\ 9  Q 0S  A T9`V 9sP`GTPPgTPWVTP P0 nR pR lR 0P0P00P\ 8  Q  P(00090SP0 nR pR lR 0P0P00PP 8  Q ) 80SP0 nR pR lR 0P0P00PP t7  Q it'00cS0 `'0S TTG70S. P0 nR pR lR 0P0P00PP 6  Q 860S @7@c(7PP\0 nR pR lR 0P0P00PP 5  Q H60S 66P| $0h&@ 0R P0 nR pR lR 0P0P00PP 45  Q 5'@5ZPG 0 nR pR lR 0000P 4  Q $5 55/PT`pP40Se @Tk40SgV`pT P0 nR pR lR 0P0P00PP x3  Q j30S< h3P( 0 nR pR lR 0000P 2  Q >d3 \3H3P 0 nR pR lR 0000P 2  Q 2 220S:P0 nR pR lR 0P0P00PP x1  Q 10S |1 Rt1 d110S  0 nR pR lR00P 0  Q L10S d10SqT\ P5q 0000 10S1  1 g@P! P0 nR pR lR:0P0P020P v__\P^<8u$lz^8^\]L^H^D^ , v]8ȞMT ^   ],D6P 00  Q X00S* 0S0!S >0S0S @0P 00P 0 @$q,Q`0gS  S &:00C S#pS rS` 0`0`0`0 1@sTP000`00V FvV 00 S 20S@ p02  1 0 S 0 Sp pRV000|2@  @P00CS0LB0y0D ART P t 3 @ #00CS0,C0[0VPP=PT3h#0$S0000W0#00#0#00# 00 0nS pS lS0 00 00 0 0\ 3PP0 nR pR lR 0P0P00PP X4  Q N40S  444 |g4PD{P40S(0pW50SH'P0 nR pR lR 0P0P00PP |5  Q 50S #50S+P0 nR pR lR 0P0P00PP $6  Q PSQpqW QWPd6 Pt60 r 6000}`P7 60S6 R6 6  68P%0 nR pR lR 0P0P00PP \7  Q 0S0!S +=0S0S`{7WT7 70QP7(0P00 0S 80SqWP<80S0 nR pR lR00P 8  Q D B8 8 P010CS  H1@s rP00 0 nR pR lR 0000P x9  Q |9)00Q0 mP0 nR pR lR 0P0P00PQ $:  Q D:P 0S4:\:Mh:0St PCP0 nR pR lR 0P0P00PQ :  Q \;;d;0S( 0; 8; P P;  PPp P -LxM  ^5 bPڠ0000SrSd5deddddudU@sP xP pP00 @  0 57!$<p0 10 00b0 0S 000-S 0@S@ʠ000 00C0 ]|TP@KP0: S  0}000]Pt tttt@P : @7-#000S 000S 06P 0qPX30S 000!S 0 Lx;0S 8 000S  20SsRcT0S 䒟䢟"P 3ZPB-"0S& <"0S"p820S  p2Rlh2 0tLP20SH"0`008B"0@0<"000 S 10S!@0`00&@00@P @P  @Pt t t$ @!00,00S  1R 1 00 S dh00Sc 0R0 0Vh]]p8ulzs^ ]t]]L\P^<xtt0^S0]S[S 0.R =R:R  S0Q]S0]S S]S -1L`@[S \S`P t0 S\`0S S,140 pcQ0A0 QP\00Ph'00CS0-P010% 0P0CS0@00\@DP _ H0 0`S  0o x_\|_] p- L P p P 000 S S@0S pk`Pp0P 00Sb |0P@&pep\0P@P PۧP 8 80~Ppp_0^P^' -L Mğs@, 0 40 0&S903` 0hQ0 QP\00 P{ 00CP|S 0l#0wX0, $3 0P0@ 0Sv\SC00S@9S>400CS:0 2`2 0hQ0 QP\00 P5 0l0CPdS 0T"01@0,  2 0P0@ 0S0!`V&0 VP\00s P3&00CS080t0CPlS 0 \!0H0_01 00@ 0 0c SC R/`p0 RP\009 P%i00CS0@00 .0P0CS 0PP00(0 00@(K\] -LM  @$" (2 P  Ld0S  0@_K  0 B řP$" b  ," (2S  S ;#rPU0 U@L00 P; 0ß0CS@ 0 h0MT#00ß0S 0E ] K 0P 8"RpW$0 W@L00 PH%00CS0U0pŸ0CS@ 0 X0 D"0u Ÿ0S 0 ]K`0S 2S ,\    ?K(Pk  "向0pf 0 Q2 /hQ`0 Q@L001 P$<a00CS0AA009 &60@0CS 0@00W "1 $ 6p00S 0T@ $] H]Q"(K\]D! -L M0P䑟0C0 4 , 0Q000 400pP^A SPX|0`00pP\`P UDA  LPP!00CS0:A0,02 /V00CS0  00 P,00,0 p@0d 0b, RZPP  P(K\],t -L0  0%Su0 SqB 0Sr  Q.0 QP\00- P#]0@CT@xR00 "0<0CSP 0000  Q@ 0S.@D/\Q)0 S0 @!!0S 0S0`00  tQP d!000S SPFq@a$@00 S R0 a䀟0 RP\00pPx#00CS0#@0A0 0P0CSp0XP0.0$ H0@008]xtt\ -@p@@0LP` U0@ P0 R00R00 10BS  1@s @@ gR0000 -`吀L p Q0@P @T00Cs0,0 (0000 0__ __ -2LM0s22080  20s1xB0Sl2  /`"0X0 @0A0 S6(HH 000  0' 0 00 0 00L000 000 000 0000 0 00   00#0\L 1   @Bp4`K07# @D0 0C0n##0 C0?^NPnʬ00S>t0x@C d0 \0T800@ \P00 m(K_ _`_\_] -PpL0` Sd 0 A@P 0 P 0 5$q 0 5$k0 % 00!(Y@@___0# RR R 0 PP PRP -/L@KP  0 ST @T 0/S 0/S @T  -L|M $墲P  ) aPP3 30CS\x4xx4xx40SB 80Se 0$ p0/S0`c04@ 0T/S/000h0 S" $  -PPX0S (K@ 00   00TKp4 3ST D0 Sp * R2 0: S  R, T Rw  RV QP  0S. O@dp pP$  $ p3Sj D00* RX2 RL2 R` 0Sg uPS!L$ 0 pf0: SF1 Rc0S? D0݊: R5  R+  R1 R q3&P) 0S lDxD 0: S  00  1 R q3-P -@2 Zq3BPvN  ڬ00 0: S }00xT L p8 DNPTDҀ π __|tYD N܉D -LM@PԓN0 1 p0#gp5 H0@*S*0000000000000000000000000000t000000d0T"1p2`@fT"0Sa 0S !001pŃ2`Dμx2xBʼQ+2 P*YPDd 0 0!K'pPwԺ0SkVu8  *!00}1 yS1 1 q1 1j00g0p 1 b p ! ] p ! X0S 1SX0 0S0S 10 BKju1: S0S BK. 0 . B0 )kp 0S p~|h{| \ Ps|0: S܉s_(` 0-,@,PL( Y U?8u< -0 L8uP(0S ҿ_( p-0@L :#:0$ ?RP@3c0(  ,0c?B3c 0rP`[U  BPP0U* PP*0U0. L弻PP.p }PP0 ӹ0S }`0U<0ԈPP m뼹0U`0dLsPP 0-SL0S 8(V`p$P`ĉMb_@LX4 Q-L@ h̿PT ¿PD0P4(/h['_pd Q-L@ d妿PPiPD0P4( h6_|d -LMMpA^K PE0PE`@ 0 pp% 0K T04BvP0P 0RK`_P XL;HȾD,1u_dp -LMԄ0S  @T  rmpp 1DSGD0S>|4 R, pDpl$ h0SPD00CS00`0 Pp@@ $0S0 $0CS00 Pp0@@yVYV 2m`v\}u0S  t,m`v BK~PP1:( SPP@P0?4 8~/ p  0T00(@PU 2 2MP/0qp7 t  00 \H0?PX 4B0SD0  s 3Q R 0  !0SI }}P)(Kܽy}w}q00 t"LD!PJ (`Q lpp,庽嵽 P")P]}?}K ~P 0R0  !P dP函PD7"`T"`84}؉ԉ8u_xttL5 -0LM0PS :S\0@BVP0 HH  ,08 ,0   <8u M-LM00, 0S  (Ko00SP rg 07<@Pjg 0:, 0dlu d0 0 S0@ `p0  ,` p(Ko` 88u4Y@0 -82LM0, S@20S  Ŝ寷!,0S0I 0S 0 S0 00000   P` 0Pp4p 0 g h1;pb 0h:,4K0( ` 0@0@ 0@)0S&Q$SŘ?˨0000 P`pf d0;@P f 0':0 <妻(Kt8lY@|  -l`lLp'PP@ PE 0S@`VP -Lp`P@Pp  F.0e0@@Pr00a00  Pr0000D p-0@0LS0 sOP.  ` 00S 00CS00@Ӥ0  @d`dP0S 00CS00Ӥ0   PpyTpxtt8u p-LM`PP@L 410SH(10SD10S ݷ0@ շ5 000 8P 0S0;0PLQ ᱷPt 0$(0 Q(0$ , 0 Q(K lP(qKp84  - Lv$ -LMK P[ [4 0 S0S 0S -MLx%Mp%p K\, 4 Bo iPP,50S $P950S NP 40S )K0P4 40SzBNK`@D,dK@K@D4  K P$ H40S<z P840S ,4[S /P `++,3 3@T`K3`V n`KK(@D@DXPh#0 : SR SPFzP4 pi`V 20S9KK 0Pv  `P 20S~P [K(PEPEK9K)4@PP?U00S $20S 0S0 E m맴0SPPK K(A A0P U10SSPP0S |1 R1(K0S(0,  0$ 0U ^ v yP U200S.*U"10S (K0 KS(00+K( B B00S ;K(0C 0C 0UZ xP ,0 SHV(K4u(@p V,8tY -ML Md9`9 X9@ , 0HigS0@8 ^E0PEU\EPE@- 0S  00 0 0cRÌ`@0  0"0Q1 P0 0SccD -0L0Sc -`QLp@00SP(0^ ^0 01^ 4# # !^#$""1^"4##!^#$""1^"4##^#! ! !@D!$""1"#T T $0@T0 01 #c 0 "Q p-L`P@@Tp -pLAM0`, . 0J/K(1 |00R0@KJ_K   Pf@0    pd`0,1((K 0@-@P $^ 0 SΎ809P  L0  ( , 0 8 < lPP0P- $P Q < ^018 ,<8  Rp-PL@4 0@Q1S``.Pp(0 `S00`(0,0S0 ,00(PpUE20Pe$00E`S0,0$0p040$Pphp220%0  -@PL $Q ,0S 4Q00$,0$0P $P 00  00 0@-@P \00^ ^l\P:0 -LMpPL $`VI 0S<0S0S < 80 0(K08< 80080< #4 B80< <0 S0 h0 hh0  `h0S @ 0 0P 0@P0P $P 0 S<0s3 QP-Lp@T $PUQ (\N ,0SK 0,! `P 4P $ 0(P0, ILS.Q :%<,0Q P0b0bS.00 L P0l0S.0b0S>0Xl0 $0 #4I4$`0% -$@L40pS` $P0 (P47 (Q$ 02,(000( PcU4:b I (0,00 0e0`U`1`!  rIPU 4e kI(0,00P00( 0S00, (00PR:0,0 -pPL`P4 $@T1 0S 0 S+0 S  C @0P P 00( 4Ub'I(0,0e I,P0 0 -L0MPP  $PU 0S 0S0S0 S00D < , 0H0 8p<`@ 0S񟗓0,,,,,,,,P   !!0#%&'(($))p**,$< u<   ;< 0S  0 Z  0RJv`V0'GP0S'r0$ 0S8͟`F 30 `  0 0p8Z  0RJv`V'4<'<,4<0`80 00p 0S < H  D00<`8p p 080P\ 0S  07s`0Z  0RJv`V 0 S,!4!`!h! 0 0T0 0+X0 00LP 0|; 000!q`F<07s` Z y 0RJv`V0˟("('8,R_`0@ 0p@0Se DQ01 S@1 @!T\  HH@0D H0d d dD H @0Z I 0RJv` V"'5d  0 0Q\0`d 'w`FR0 0h Z ' 0RJv`Vɟ00 0'hq`Fh\0Q* h00h0S S.0L T0l T/p l0PVP< 00<0h0~T03L@ C01QZ  0RJv`P Z  0RJv`V:7q 0`ah TP  Z  0RJv`V:\`a7q, 5 00'q`F(P   Z  0RJv`V:71a q`AZ  0RJv`V:71a  s`AL  0S P7 000 h0 0h P*d `0h \L y:0S" S>/΅T 0 l@L0T l0p` 0P< Hl0X P00X0` 0  0pd P0< 0 `6 03T030CL01 P0 Z , 0QJv`S4  03 @C403<1 R0 Z  0RJv`7|`lS``@ 7p0  0@ D% 0H000HQ Z 0RJv`V:1H0C07q@ `a @ 00X030CP01 P0 Z 0QJv`8 03 @C803<1 R0 Z 0RJv`7|`l@``7p'0H00D 0HQ Z 0RJv`V: 1H0C07qD `a D @,0DD 00`R004 hD Rp @D0 bSH @c 0 bR a(00b@40bRD@0 Q !0a@0 aD H 0 R0@0HSH 0= DQC @0H AD 00H 10S4  Z 3 0RJv`V@0Dl00@0@0Q00 H0 a8'4<,'<4 <S D@  00D`@ p0 0< H00D(08pS<`0S 0@P @P0< 09,0@ pc`b0 00@ 0@0 0RV0 f z8 QS@00<`P  \ 00R40 <P<  < <(KxRG-|M⠀P00\ 0 S |@0 2R02BQ0`\ @00S@T@ \0@ @@@'@\ 00S@T 0 sJ QR0Q0P0S< # 000 Q | 0S4Q 0$A\0P P 3ß(0,  (,0 3ß(0,00S0!Tp!p1' PP#0 \00LS`$P08 8  8 800@0i^040@(,Ŏ0@`@0ià0%3l l 041 R @0@# R@0B00|0 02S0C8#(@  P P@@a800@|0T"C$ \ YPi0 \00cSPR :  0<Q00SA 0P0 0pa 0bC1 0wY $ 0S0`4 @8914 @00Q  0A0000S@010p|Ѝ8 v t 0`Fz -0L R0 R P0 |P0 |@||a0SHX@` @PQT0D0L Q0S 4JD<<|xlx@8u?(8h -L M0@SK@7P K0 R 0h 0-L M0@SPK09P K0 R U0g -L4MP@9'匧0儇oS000 `gR   0P` mS000 @fR  pT` H` 'ېp= H0@0S07x6x6x67x6x6x67x67x6x6x6x6x66x6x6x6x6x6x6x6x6x6x6x6x6x666|6x6x6x6x6x6x66x6x66666x666 H $&坐p 0P0 0S 10 -R# 0bST0SL  H0SMWppV00Lp L0 `QV< '  8 000CSE004K 8ӕ@=0S440 R, @ D 0@  T r`pop`lp`ipW0S `:S P p @ ` D < L`Pp יPP+ 30C S :8888(:988984949@ 寔p0S Z~ 0-^P 匪ᬙPPp֤0S ;j0SH 0!R0S0S Z@Xv sP P R 0S0SH0SZ D@ _PP PQ@9 apT RI 0S0S@000CSU4K` 9PPl0S40 R| @ XP D d8K0K, KB^Pl0@0 ,00D ,0 UD0 L00L0D, L00L0D L]PM tD@ hP ➕D0\c0P0S0L00@ D0 $cdP\ 1 0@0 D0 .` pP@  p D @  @ `"00yi|ft8 fd8 liX8 f Hf 8`i<@HD<stYDTe@- 1 ,0^:*\7 /+0;;0b p6!  p0p0t@\E\%0\Q) p0! @p0t@(%(5\%R 00OQ  44\%R 004OQ  D08 v+P` wFp6 Sp4^  & |6 00P @@b b3a R`QR|6VFU 4@^  850L 0 0 0@4;D$+4 0@0e1 0( R  0 OK,>Hß00 0PSc,>3 L00 R  > 0L0 R"0 0\2^ pF1 0p & l&R0 0@S1 pf> d!`2 R Tm0 0fK A ?p6 S1^t  & 6 00P @@b b3a R`QR6VFU1@^  850L 0 p1 0( 0Ox6 tF 0 h04h000O    p l& 1 0(p6! (0 h04Ch000OQ  p 1 0( p!1 0( ( |& pF1 0( 0O6 F gP*P z & u<0K@T,c    -LP`>0pS000000 `S8#80 @0c 0 K)0p0 = 0-P L@ 4P 0 00 0)0 00 -L@Ah30,qSP: !0S2 0 !: S0Q  @ f0S V&0S P*P 0 RG*PX0S 00f0hd0 PHh |4r @T[ XܘLc4 -LM\%EnK`F `F 0,            d$ `$ h P0: S4X@. 4ДP4 R 0$\Qp  00p 0S#Pm)P t0S!` 0pL4 P4T4 0$KHt 6 @D40 0S   ϟ, 0R(Ki0: SP+ )P 3 pP@{ 3 O@t M|#004KT$ Ht 5(A-(37&(0S  00̢~0S20S BKNN"1A\0A 2 0!00c000l\#0 0@Pb%HO4p!0S" 2 WPk 1 PN 1 R] 2Za`'0X0C0W )PI  h4s `!000'000,)hp qh'0000S {$BKNN+4K@T 00C0 , 0 S {uT[`@ܘT|c^!cX8l<\  N8 -MLMp0P@AnK 0 `F9`F T{ 0'U0 U| 0RK2@(P 0D: S40P ( uj<T[@  -X2LM (40p  h, ;;S  0SSYPPV 0SJ, Y, P` ,,0+@+PU`RP ` YV4 P,$/+0;;0b\c/00S@\,0 @ ( @,0 T0000 00S0SU$0S xu( @,0 TP0PPP4@ 0,0P<  ,0~@ -LM⸑40Qp,0 [0P (0 4P* /00S@0 @P, 0R(K0Q`0@0 P`0OO 4D;$+4 0-,P  Kp:?K0P  },0@ hK]:0 0 0< 0SP0SPu@L 0  ሚ p-d`L0S TPT 0@1@P0S000p褘 -@LP00T -LM@ 0@L y%00CSZpZ\ZXZXZ%,%00%00  -X0L@B8H0 P 0S P 0S $ -R00L(MQp h0b43X^u  0LQ OTUi H 8\J0@O /00@@D @ /T<9 H 0Po 0E0O<0 8@ H, 0H< 00 8<  5ɯ @0O 0 @T40 0@ 30 ,0O$!D@K0@P U`] S1 R(K  0@OP`0 @͠P SWSH@DPK`0PO` 0 @VU1 R 0 40姠<0O\%t1R H 0 RBNKL@D@D08!=410SP8   HH<0  r 3Li!P 0\Q H8! 0@H0 00H"h0 0S @0 @lHPH08(ALD uHW@ȉT0TdT -LM$0|S 0, $0000`6 \6\Q 00 @8F0P: S S\ S6^K 0(ŕ /R \5^E  0 RKAA` ,`U3($R>Kh d 0 T5 PE 0BO`E?DE Bh\ X T8 4 @E Kh d lBNK @D@D0$P_"2\%R 0 L5O0@嫕2 O @E(0/"08 t2( l2\Pk 0 TuP21COpW<2PoP `H% / D5 0  R+ 1PX0OD0 H 0h!H5DE0@H5 SDE t0w O\&.x1P`pWPX0 S R40S00X 0 BNK @D@D0 -k!P 0Wh0SN?hd%T P%  0\Q 00S@0@pl0 %0 L5O0 @W<00S@0 @u@T0Td\ 0- L8M00 < L0 H0 D0 @0 80 40 ,0 (0 $0 0 0 KP0 LK@4p0 l0\Q \,1ubH  0@K0 1X@T0$ -Lp@PST$ @0S 夔 0`@P``0 0\Q ,1%00i2rP 0p : S`0P T @ b10S 0@TT[($ -LLMDH RS, @ ȟ 0S 0Sp P ǟ'0S0@0 G0S ǟ0S7 R \(h0@S 0S 0S 0S YD 80 | | O   Q ?KP``F0`_K`P`P`B2 MP`K 0=2/R 0O? 0@l& @Ācp 0< 0A|B K2@1şU0S %0 0C@0S@Q 0Mx5 R E0,P/OQ o 5 pPş@@_@P004@. %8P|o% "2"_K`PU`P@`P`D0`ğ0S ٗx4@T җ@T p|T0S8 pǗ@T \@T o*#0S4u0Dp X00Dp X00, 0R(K " (?Kp x t aPS3P@@@@0S3 R2 (ß 0S. p, R*@0 O  & _? d0 0< l21 \>Q,ʠ0p, @RʬrD"0PBS400q0, R|b tb@ 10%Ÿ@ ,0SDR@@@0L 2 !0S pA0S 0Sd0S園Px K.XPf 0S7 K}X$C3|=t儒l偒7 0SbX{ 0S`Du]<rN @04@0 0S ԖP\!̖VS u dܘ@0<t 4\kdtP<,Lp xH\d p-L@M P`K@0S 0S  x -Lb@P|00"|p~ N0@+S+ꐈttttttttttptttttttt4t؇tttttttttttttttp1h!0001m 0>0!Sd 00!000|1 c 0|t1Pd<@1 T 0bqD1  80!000 1!0000z0p BP`g B0 RAV 1P@@ 0T0PЪlA\딚<lzlxc$|/,8s ؚ -L`( pIP(X-t"1> R.#P 0@ 0. 00X000 0@P`Z  P 00X000  0!0@0@Q 1 R= ڐ / P1 `XQ 00D1 R R 0S0S R0S 0S0 0S P PP8<| 0ip 0@0@QL] P[ꜚ`X -xLlM,0SPڼ0@Pt@ pP D 8OtP0, @tPK`P`RtP p` 8ڼ0p/t@ 00T 0 PoPpǏ`pT 0/ X|P`1> 0P@`UVW4HTLd@~+pǏpX30 -=@PmP -0000-m  ,0 `0 , K\0 X0 T0 L0 H0 D0 @0 <0 80 40 00 , Rg|@ xP |0 l 4-x|0 O*| Ql0`  0ǏOP`L 0<\%R  l0SN < RJ ,< R\00S 0C1 0R' sR"QX,|@0A@ @,@0\0  |P,0 @|PK`P`Q|P x` k00H(Kp P`0@0@0A@D`ePT@ [`|0V ` `Pa `  H;@ P0@` S0 @ `+ h d *Y [J`0\0ZE:Q :Q 000hK@ h d R0d@SlZ,j00 R:Y l@QA:$Z@c0T@? Q Q%TpP RL:)@00pd't)00PO/ 0\ux9@W 0T P9W 45S:  Zu I0S Z 9W 0 0BO?:Q6p3@P2 Z Z@ Z6 T1!(0p  P P0S  \X8W00S0S @8 R (80W 1100(p @8 R 7W 0  00UP@; Xg@ 0|'\Q ,J++ s(L7W_ 0S0s,7 R 7WV  峒(0 P"PN  hPV 0&\Q ,+U&P&O?@0\u`6@W807pd` ""PP "P0S 00 U0x R ! :S5WX !P0S 0005S: P UD5\uW (uU` 00%@0T00 0d + DPt@P)PPU^1!X0   0 S PUKX4W00S0S @4 R (4`W1100X < n*%O( i* F3W  (Ř Q \3W+  0 0 0@1>@ T DR @Ӝt0 BR @P  0@" 000S00S Z 00 *60"2@P00`KD ~H"0 404h20 \ő\h0O0/S 82$B\h 0 l , 0S X Q!0\Q00h0 00O0@Q pq'nPw1W}0 0@#1?@|W1> 0P@`UV& d 0`\%R\ 40O0@10X 9P0 cl%P 0\Q<  0 < 0SR +00 ]@ȉ0hdTܘU T(lLLT|\@$`XX<l  0 40O0 @\=P$ Mp hP 00 00T+h0SV g P  [ 㨥 U 㢥 -80LM, 0,   ZP@h -1L8M11!00, P ,0K` \ X T L H D @ < 8 4 0 , R"ڸ0 @Sp`T`@ PP D@ o0`KS . @0S,  R00(Kl@dp -80LM, 0,   P@p -LM(`X0,0 90䠟p,0  @,0P0T,0 0T @T 0S0S| 0T0`0T R 0R X 0@P`0,0 ,l@-0 0 0S@TTS -MLM0,0 00CSrȧ t|b xPqlP} 0:0090 006 $6FKL0%ş Z%@%0㴕X$ 44K%50h d i0`00 0S_ S;;SV~KpG,#L%0H%\Q@5(K05$( Kɠ0%\Q 0@X5 TE  R01 0#SP $0$\Q 0(0 0p0t@  R01 0# SP R P\\$0\Q0X000@\0FKL4  AH$ Z#0P0#3Z 0@00 R 0S 0R s S{ #PMPPZ<ß40@1`8#0T0 *PP 0S P0P0@V$Ÿ, 0R(K< 0PQŸ"0\Q6 0@0 @C 0@`5 \E [BNK @D@D0` \2 R@ LB 0̠DD1 0S@ 0?044 0 R P!0\Q 0@0@ !3dP {0P00u00C0  }ZXt HA 0̠T@ 0S <ƉZ(g $ P !P W PIM  e70P0CZ0:Pu2uptxxdب@T ܘ(X NLX<0t -LM$$ @0 @娢PtxP -LM44 0, @ᕢPh_'txl -LM0 pPR0,0 `'@TM,04 KK,.1K-Ky0-A[Sh00@PUnʅT6(K MK@&P 0 RH0S|, 0Ry(KQ0.S 0 0T&000QP8&94PU 0 0PT lP 0S ^00P0  0 R0,-1KP0KKl.1K4 -1[0 00R000 P8#8D c(K 00  0 30 0C0(K Z!(K@@@T0ZP00 0 Pv 00C0q00S0SX$ T4 RH4 R<$OPPv @0: S00S00000CS񟗄Įdd3(KPMK )%00@e 0 00C0  @P0 0 R%Q 0.S PPP! 00S00@0S "H0X0P00C000SP"3P0S 00Sڒ^K PEPE0RNK@D @D00!1 R ‡V bPdP 0 x0  P,@0S <,P!00o( t0(K MKl$XdP 8XP  00uP<Xh8 N|ܘ@Dp\4| -|!|01@phh1PL08X0S5 0pGS.000PP 0S0S `P @ 0 R@ P`P 0S P 0pGS00h 00000C00P0@00d| -LM$$ @0 @P| -LM(p`W0,0 C0,0  P0,0 "1> R*A R P) R 0S0S@00T pW 0@P`0:0 @   0@pW,Qꜚ -h2L8M```"P0 0, ,0K` \ X T L H D @ < 8 4 0 ,0S{ڸr a0S:ڐPTD@ 00CS5괵|h|е00噶`K  P0S@0\!\QA  000S. `K$d P0S,0S3ڸ `K NQ R Q0S R`Kx 5A`KP 00 0S 00(KX@dTT   -LM$$ @0 @ P蠚 -MLM pTO0 KPK(J8!J,0 HK 4Qk> R K0(K8!Lqt QF ;hK8aXQK0 ŢK8$UU`~UUL~K8Q$HK8AQ`PHK8A`0\3  BB00B"1hK18a0 000S]0S  xK8$PQP`ӼhK8a`0^3  BaK80@%0 B 0HK0B!8A!L0   XK0H͟ (K8! LqHK8A0XK  Ba 0p@WHKATd7  R\0?00 10  B\ hK a Vʜ (K8!$5S.p`l h0Vp0&P P U 8K81$%U  1P01p`0SVU HK8A$%U  101$0XKXQO0@0@0KOX0@0 @P`(K,!  /  0`O0@K8L#P QP8K01S XK8QHK4  De 0 0K8K,,KL0` P@`R`ZK8``L5HKsKD!8KP%81X?^ PTD, 0RM(KK$\^K8 K8!Pp(KP `p$41> 0R#4  R`0?00 1HK08Ap80P@`PW8 W#$0#0$0QK`08800cPKϊ/.Q00b\KK8T!0K880O8K 1 SHK$ATXKQ`XKa0XK008Q$%RK8l 0 0 08S8K>C`(K8!8KK 4L!P2 RQXK4Q 2Q\01\XK4QHK4A\0KH!dP KP8 P K41 XKR(K4!\0t1 daR\0H!H0 0hK4ax0 R0R0 tKP P 0 0hK@aVK4p 0Q\0?0`0RXK4QHK\04A0?00SF P!uH 4dT0ܘTU l@ PU 05 D0RK4K\040?0S5K8K0品!K4PU 8K@1pWHKC0, ,0 ,0 R R2"!5(K00@ S,", P 00C 4,  Q0 0C#4 4 404P8080 00,4 徐`Bⴐ00(0|, *8<0 0@@,@@8@଀@D ?4P%402,P$e<@ @ @ T 00S  0D0 00<40A40 0, 0I  Z 0,d 0S d V`0P3  B  B00B11@ 0008ST0  000( ,0 R et\d P-L@ 00 R$hn嫂 - 6LM , RvfFXS$3S Pu 0ȟʠ 0 Pş5 \5 SS SU us :0,\ڴP\%85R h0 S0 0B RR40NRR00^td0OS),`< ?&t$0ttS} \%h4R& 0O044D $0O84 R  0S> N彀0S \ϟP>.`@P00`` `` `` S/ O N0_Ss Pq nP(0..<0000P@n = R0  TIM0S T^m 84Q ,h\`žP &R^Pb F06 00`pW V p0OO  Q^Pa `0O?0@@ c@P[5P f0,R5P 0%?>T 0 5U  ;p5PXE 3T5P k|ş 5  05,5  z+h4 H]0y "~ , 0R(Kx0Sß@T" 0ßP@C0SI AVFD}+P, $}(`SH>L3-K B BGP [P S@Td 002P c\54 S0 `5S|@>xExb X}2>Lß<0},,o%P cS  0<0 iVfV$:RFTS8*06y1 Rb BR0 0 0ay1 R lp"0 0 0Ly1 R 8B ,<K0K40-Q5fy@ R*0 4D@ ` P0@_4 0K@P q- C<0K0@ h>y0@@ T (KosQ(K4<Kt <Koꘚ0"8"t(" -LM 0@S `V 0 V p̐ pp d T 0`V0p8d HDLTL? 0<` @\ l2>4Q,h\pC00p`V蘚l"#@ -LM,00K, K00 0S3\%RX` B2 R7Br噤 @T T `U@ | P剤ᇤU`Q\"\0Y00/H2 RB0 !A `gPP@0A#O 1"1?0P HA`p-8PP`# P P 0 r3p1>0 R! "A@e0 0@A0#O 1#"1?0P01 FA` -LP`  PT  P P@  P8  P( $ 0 X      @d$0  00 0( R\ 0  -@L娠P 墠P  圠h虠 0-L@J㌢0PP HP%P@@ၠP%P0\$ -\0LM@(0K( 0 @ K$ K0 P K$ K -0L@P  h --@0L M,K0,K  ? K`$ -`0LM00 0@0 K P @;o K|$ -t0LM $0K 0  $  K K0P $0@o K$ -0LM0S P oX@0 @00P n$$ -LM  K K0K  p@nc aK$ 0-LM 0PS    KK0 p @n?0 ;K0$ -L@40% 4% 0S00Hd -p-LM@0`P0 R{nP0200  0S CKp -0-L$@KM0 0 0P@$0 S000 @ ' 00 0SK0 --LM0 0 (! K p-PLP`  0]p3 rP@@p0S PP@PpUP@ 0@pp(tH%h%% - 0LP`p) 0S& 0S# ,㈢, @.0 0pll 0O]p\A3 PP@ V0(0(0$`@(@$`@T^vt -T1L 00 0(Q,p5@p 0`P0 (@T" 0 0R 0 0Hp 0 0S 00 0IP 6 00 0yo D+PP+@ 00 0fo (@T %H%\ 0-|0L@0S(@TH0@?PP 40PP@+P P*0h" \ --LM0 0 A$ K -LM@.<p`PK! E$P4 0p 0 s%%& -LM@㧶 0pP,Kpl P;p`dP U` (42,K ,P ,,2`T,(20[ 1S00 0KU% ,2 !J!pPl0S l0S l0S (A=(2* (:=(11#W0`SʌU#0S o#0 $K$0 0o0 ,N`KD&Xh&& p-`L0S* @P'   0P00 $0( S ( ( R$0$0phSp, ,0 pphp @d -LW0@ 00 0(@T p`P,np,l0S P# qp0Sl0 Sl0 S @ T |D$&h" 0 0-L P8 0@PU 0sl `0  0啵(@Tpp b@0S 0@d -L@ "I p$ r p(& -1LM@ 000 0m(@TV!=-p/ :p`+ P#,@K P (` $` ,P $ $D 0$!1(`p !0; Kgp 0 @p`P#40S 0:0[mp[k0S P" Gpp0SKk0 SGk0@ S TH<0$8K| ;Բ 'P$Dd&h" 0:0kDd0 fDd -L$M%:pP*0@K `P ,p (p 0P y$ u$210aS1 @0 8 <` 4p %@Km Yw PK l`T! oP!3 op@ XTj0S  0S( ylQ 0 0R0$0 $@K3\ |p b"4 H0xxx <pQ00 SKu< 3oP!nK00`Fp &op@ T(j0S (8[Sl0S 0@T(80 Sxt!p`0 \  $0 SH  KubԲ(mT(x(@d(h" ()(0@,0 09 I > 圓P = = = P y'K J= `|* P-] p J`Fp* lz -N0@&S;- - 1 1 1 - H. 1 1 1 1 1 1 1 1 1 1 1 1 1 X. . 1 . / `/ / / 1 1 1 0 1 `0 1 0 1 0 x1 < +0 `嗸9S<0|:  '| L7 p RQl<@0@0 X  L< 8 `i) <R 1 `Y);R  1 `G);R 8 `7)p;Rd 1 `')8;R, 1 `);R o1 `):R _c0 `):R O 0S hh*MF@\aPLL*000:8VP$:$ʟ1  h- 00) w p 9S9S T 0s 0 l*  0Sp$P 00l: p*Qp0SD9P (j 0e0bS |80S NK@D @D P9I9 I g! 4(1 R0h: -W epP& P! ^KPE[NKPE@D@Dh(0=\(\8Pp6`i4(88p-Wi +\70S' PP"MKe/<1 =C1 =1 7p(Kz xz J tZ 0C |K 0KK!G, ! !  1KRG6 Rx D'=K 0CPx f  K@ @ȩCfpP#f  I P哯PPfP aP) u9>9 l  yP ``rpWZ50S EP _P Y  0㤐* t: b  0P e\  CKA A +PeN  |540S \:: Sl + \:: SX fUhj@pPtz  P`P`0P00@ S Kt 00A Sa>@0 @@00@0h:  0 Shjtz # 0S (0@Sh*Xl:YiS xC  dp 00@@ 0 @@0@`0@@0` pR@P0S 20Stzh 0TP2`0O?   ß4;DQ#| `P`V u2 (2 R P 00C   R ʄ*(0 S;30 R 0S1  0#R ʌ101 S90!0Sh1010x10S ʀA0S l10s|T00 !0S00S00#1ѣ10NK@D @Dx: *d00S  ,P *x/000Sx ) )~u<k(e++,lze(,@,eX, ep,,e,e, e,-e8-Ld$e/eeP-- vks--xptp-tY-vvxwv- .8.\....80@S; ; ; ; ; ; ; ; 000 10B 0# 0 10S4/80@S< h< < P< < < < D< 000 10B 0# 0 10SL/ -L80LS$H= 0= p= = p= p= p= < 0S01S 00  00 #A10 #1 0S Sd/ -0LPA@`|  `   0BOpcP VB?㖃! p    萜 -LMp`Q pD4K iP00SDDT[0 PP 0$(蠜Ԝ|/ -LMp|`Q D@X4 iTP8D0 PP 0"(蠜М/ -LMte@D hUd # 0 H5Q@60S 0@p4 00 R@040 0@ 60PS`08 `?4K  P04K80Po4P 0` 0P0o ?S4 RhR 4 0 <4@44 `R`0_P 4K ß 0S0C0 ?0@3C  00C0 000 ?>0@3C 000p30SuH3 8cRT0@PTPd 4K ?H 00C02P2 R @4Kd  ?6 @ @4Kd u Xp?) pPUo50@0 p2P%R, 5d 4K` ? p0O<0 8@  00PO`&,ᕃ< K  < K ` F!P,` 0OP## ? @00C0laD@00QH 4D A!X18 8 04  ` P80 $0`ï @ 04 D0$ 80p00`$00 8040`!40 040 4KoQ`0ς`0O1>Q`0P0 20D080U00@ d 0 0H4K(K̜ȜU ///؜e - L0R  P#(0 -`2LM0, S,0l,@P(2(R@ d  0? 2Q)# 00C 0 БP\01 P\0?0 0! @ d y1 0; 0@4DX1 00C0p帀,0Z ! #,%#+ M0 OS d&0OP `+x9`0d 0@?@0 0P`x00S0 x0, 0 x 0,,$000 (00(Koe̜ȜU /؜H0 -LMK@,a0 K`_0@ P A P @ P L [ 0!C Dp  0 K4 0@ 0 @ ^K`pL =0@0O$+41 ! d ,04 0D KAde̜ -LM@`pGK,P1@ 0 A SA  )0K p P  0K >L  ,K01B00@S  0K4\P L=EK0@0O4;0 dD04 0GKDK蠜Ae̜tgde -:L4M` ?P L0 X @P T@ ɯ08D&`;:Q: `: Sr\ mQ (:  S4Z@ ,0ix J @P@PPjɟ 00T 0L59 0$: 049 0B90A  9`0UT X0PD RD:R08 R0Y00 8 04 000cH0 400cL0 H00O85|33 e3,TT4m Ĝht@E84ܜtt(eeT4d4؜̜u) ȐY QJ<00S<0|  00 00 ,00x0$@QPU``0^3  Ba0B 5 =0 B110L 000@x0`SF0 0OH4LD ,L=2 000 h1PH P=LV>00h0 h0 S:h0@2 0ȑ<0P2 0\ \2 0 0R0PT0XT0P0P0HU 00 00@50PP40@0, 0a84 0 =(0 H4LD0 ?>0 ?0 ;0 4 D0(40S0 8<4@P% {4 Id `p8<j 4 00@ Pf^@p4P `\ H5*P`8N, 0tJ^@  K K0K @@?PPK`VP ` Uap` p 5尐K蠐 圠  6, 张 8d 0A@@c00@ ZḐ 崠 0Y @K$'J F%*0)Z\PH70S㰋@P'B*0[\%7R7\5*0"ᜉG*0P7( 8Q0\570S(#Y 7PP P T8` Kp [PVP gPPd80X0 h R01:0P&{ H *ȴ`p㐐K9)`0S-90O ,00 /@_d 3)P0d PrcP@c@t 0 S f5  #] `pP0I,0V0S P5 :0S :Pr (:0S8P HD ?>0 ?0 ;0 4 D0P  J*0`PJTHLV0Od 00 f0 R 7000`P pV0 008P40 T] @@Q]A@; 0;0;, 0R ώ(K p-LM|`0@K0 Wl0P d0,` 0T P^q+ (WP 0RKpu̜Ĝܜt4) -0L 厬xq<8u4 p-LP`@T 㝾0@T *0P/S @0P/S00@T:/^P@0.S P@Tp0S .S0S`V (0  0S0F4 -1L MС`V( p1 R 0: S (P8( 0RX$K dd#\a\q0SB@F00CS0A0P0 Pp 0S0!0CS0 0 Pp0YUyUDbV0 S7K. [0 R@@Pn0d6 KHPګ@F!P>P(ٍu48uxtt44 -L@`P  V%pV 0  @'P 0PU`V U0 @ 'P 0 UU -LM0@QP(0  0: S ( 0Rk$K 0S FoK3Pp`W |[p1  ' p`B KGp> 2 S!3 ъP< 8 p|P (%P0 :8 jP %P0 (8 WP %PH܆p@  Wu54H5 -LpM`@T PKP 1 R U0S }[0 @TK0 Q p0S  Q 0 R[P 0S x0 RhmET0  qP 0 Qf"T5 -lbL0S\2 Rt p KPP LJ@P# #0B S5@w w w v w x w w w v W0 0Se P @  E1 (J@PSU0S^hF0SD P F0 00S= R R (1 R+m[P 0SZ0 @庱 02 0S P 0S U0S0 Rp>[P D Py #\YtYD -L@Pa0p0!?p- P0@"S"z y z y y y y y y y y y y y y y y y y y pz y Tz y y 8z y y y y y y y y z / ?p0 bQ!@+-0S 0W 0n0 0|0 t0h0 p0000yn(0 Rh5s -000 0LS    nXnjp58u5-0 CR 0R0 SD00 -@RLP 0S D#Y 4YTH UF 0@SB 10S<p `(<HD0C3@ R 0S, ,7D0S|.D@ l R @0 S0S400S(>h>hD11xtt 0-PL@0S(0hXBQP xXt d\00SP e <C 0X (0hXj555xtt56 - L Pm @6 mT -LM@/["P0002߯Pp2 lR dr`X;T2T"PPPfP tP  }>p2 10 bSP PP P 0@SX :vP10S Ya@a,@ pQl 4  ᲜPP `@a0<S 00K@P S0S 1 0S0X+0S% 3KP ,K 㰡 04 P,00S 040 8K[P @00S dL 0XG=lbjclz(6s,6Tji@6jjT6tYV -0L ֧l<8u6 -LtMp  Y6*V0/00B@$ 0P K S``j0&p3 p 0: S/00 V P P X 0: S }R0 0 (K !P  -Lp`@T[[t!=p mP2 pP D!s=p81 ApP@ @`z 0@S 0P/S @0P/S00 R:X  rPP)lPQ@P P  UP#!PHW` 0>P` 6slzT -`LVP@p\Vy Vp P0S [S \S Vi 0P [RW VY nR 00P \RW 0[V 00 ^S00]S00S5 ]S0 0[S \S \* ]\0]S$@P!n\ 000.\ =\:\ 0 0S  ]R  S @L4 000$) 00 " @77 -pRL`( P P9 ;P7 0@  ;P p0P P\ 0fWP @5  @ hP P@ @0@  p0P P00P@ vp7 P-L`* 0a0CS"ꌉ Ĉ 00  Ձ`Z`Z X RP P 20RP |0AT@T 0Sp ,P0W 0p 000`Z7,؟ p-L`@DP @P# 0S0pp0  R 6P L 0Pjp$ 3kğܟ7 0-LM0 9SP 0S:00 K@@8\S d@8$S0@0 /S @P 00877 -CMLM/0X T ,0 kP@0  r @0D r 00 0S#S ;S X$000 X   04>Pi 0P@0  r @0D r 00 00,S0l~`0I 0D0Sb 000Sf 0D S,^(S' P0S {0S!0 S񟗈ԍ Ȗ , h t p t 0T$0R0 T0T4 0D@T0D   r P00  r 00  0 @ 0;S@0D TRd0$@0D 0\SS  f` y@PC \pD oPP q X<  0s 0 0 @T#  )@&0D 0;\ \ 0$@0D 0\SS 0yP0 N 0@@0D 0PD4 SD4P4  0`+0<4 <`@4 H @$ <0aP <4 c 0`S@ 0:HH @H<$TL ' Lt\T  R; Z@T`F P \000@S0PD 0U}0UP@@@@TL@a$ $`P <$ <$ 0D@T0D   r 00  r 00  0 @ 0SI x 19 PU00]0)pV0DN! 09P@0 MT$R ,X4@P`@TMU @ 0PS0 ?U` Vh8 @AX8X  :',08(Q}(K0D0@T0D   r @0D r 00  0D0@T0D   r 4@0D r 00 B.K B B8 0S 0SvP P0"SP0&1p@T@T 0S0 ` DP @T0(0 000;S@0D ?0D0@T0D   r @0D r 00 0S 0V00;Sl@0D 0@T0D   r 000  r 00  0   0"0 000D0S*0D000ST0D0D@T0D   r \00  r 00  0 @ 0\S P 0D@T0D   r 00  r 00  0 @ 0SBK0JCK` JPpI44 M@P6  0fP  f 0`SP0:p0SB  0S \S @ R @ R@@ 0S0l^`004}00 04@T0D   r @0D r 00 T400DX 0S T ,D4S T^@|QS 0S0 `PHq`@T0D   r 00  r 00  0  f0P@0  r |@0D r 00 Lp`x  |\T&T~\00@zu  v8j,8t;;9($$97,;؟ܟПԟ09,VT9889D89:ȟH9:9@9l98 tY$; v:P::x89 :L;87 L$<4bH`Pd PD00D P 8D 008@P r 8 r 00  gR4 "9R.1R5*R\0 6 3p1 ,00 *r( 00 # @0D  pRa wR r8084 ;RT0@0TCKA [0@s@@8@P8   r 800  r 00  8  8\ \BNK@D@D  \  B8 \0T0 ? 3`V" 8~00HYT `0DB.K B B|  #p 6Kͧ 08L RkIp 000 S . ..arch  catdate chmodchgrp cp dd df edexpr hostname" ksh sh ln lsmkdir mteject mv pax tarcpio  rmsha256sleepstty |sync  ... ... . .. tmp db runEempty:Fhashv:էtzlist ... ... ...R 00 R{{U0T p t00 r 00  @0D P <F89BNK@D0@D,4Kr* ,8S  P{XT -LM(s0S0 g 0S00 (K,KՖ蒟@0SG 0#3P00,  "0000S+00CS0:0 0r%啴\"Hb0Pd 0S# 8B40PP@pJ 00S ɴ r ^=JP1!01 ִ aPxh<h0PP) 0S00CS00 0r+?0P 0S0 00 S 僴 ꡴ 00e0@J婦 0d0 U4^JP0PI0S 00TI,xt\ VtYt8 -@L00 @l 0-PL @0P@0 0 l -LM0`S($p00S )*P' 2 0SNG2PPw 0"000S㜢B,KPPr2 垳PS XB0S\R , QD R 0Qn00 R0$  ,00A,0 Q 0#S0nS1  SA0!!cP1@ Q0 000 \1  L 0, ;b, 00@)I 0|@,000 R ,0  R0#S0nSl0 00 000y, ,lX VTP̟0;tY p-LP@` "4pX E0@0S0\ ܩ ܩ ܩ ܩ ܩ ܩ ܩ ܩ ܩ ܩ ܩ ܩ ܩ ܩ ܩ ܩ ܩ ܩ ܩ ܩ ܩ ܩ ܩ ܩ ܩ ܩ ܩ L ܩ ܩ ܩ ,  ܩ ܩ ܩ ܩ ܩ ܩ ܩ  ܩ ܩ ܩ \ ܩ ܩ @e 81b,J$1 1`!000 0 0 0`P 7P @P0`zPlbQ P^H@ oT<;8ut̟lzȟğs`< --LM@p0l  u0DSP0P <0DL $ 8TK+b8ul<t< -L_{@P H室 蠄 -L|@P H圤 蠄 -P@Lp`x8 0P 0` Pp-LP`{S sS PV 0wSp  P00PVp p  P 0 0 @GJ 08b0@G? 0 W tY -P` PLpW000 $ 0 0 K ]@ -LM`, p PU &Up \U7 @0S<*PPU@0S :K@ 40@ P400p)  r+ P`0@0S-*0 ,0  00B S(&R\RpPK@ 0@ q  rs P`0@0S:K@ 0@ Sp ԟ -MLMxx0 S, /p``P1"0pS `"0 0R RxPPJK(@D@D 0*0RPְ0pS `ʰ0 R 6#3P , 0R0(KF0S @T Y,FPF$}렟uПt Vxtt`<7 -hLPM0H0@OP  00pW} .000S  R j P0PS.0N U 0 S RPET.0@`P `0. o0P0d0 0 0   r 3R\ 0=0C>SWꐶ ̵ < ( | ` H (  < ̹ t  ,0S 00ps0LS  R<pP #HI77@iZb4 eR/6%]V1d]?D &3P)˜qEIД&LewreiRIVtQL zϺ6w0 {lrD#1u| To?[n{/M 90 (|/;:;+ËzT, IŗRfmh~҆qKfRбFHU- *d X *?Q. C8\R> )hcp}'9@5N +hs| q0dqjCsk 3T?4Q)|:cnu%J)mS!eEز3ІksKN_[q]x.1ސ#)- 4%.l|98)\(BTA2/‡[kz~FFOitwV<0rWݰ̙vٍGL'!8jf)N chVRFƴT{]ȓDm$!0S0S\C3@ 01p@Wk `PVk 0S06K K0S2 LPr 0S0PP 1S0S@T 10T KtA ppl0_? P .U?0#K"0KR0(0v0@ ;0-Q6  h #K0@ RU t3JJ0+0#0K"K!pK  0垓 , 0<喓<}Jz၍(lJJKX|JJJ 0-PPL $0$@QjPP0X -LMPP 0-S- `pC#mlp lP sP ?P`Kㆅ`PhjJ`PCP#RlppV OA0' #0@| 2  0 \`Px @T3 奛P @, 0T00S&R+PppT] 01P` KoP@ pKAP=@T 0%SPP`wJ`T; 01P `K0S I@T' nPw !0LSLL 2Q0 dIXI`>o 8I``*`TI`O0 R @[$ R @ITI`@p@ cp`0QU Ap`0@ R V"T PApa@P `A\0p6U4ApYj@XDN^<HN -L0M8dP0D($cp LP PP ?P(KC#cp0S AAL H X PU 0S xpAl3p0S\gAa@P `T @gT 3p"P  "0 @T0 D P 2 ; 80 4 c80 0x@0 < 寅0pK@`K,K0 < ,0@P)00S "0 |hZP<h<@U AD0Sh !b5叒 @+t10S<<@0/S4ZBT0 iL P  3D0S> !D7 S번1P+ 0D0 P0 )PH壈0P DP P |@|i<@H Ć@x@Ci@P<@X@XDNlNNN^NNN0Zh(l`dNX<N0fP -hAPL`!ab`pp mP <1 8 g@0e@@`P- @p@@ `pp01@T `ꥂP0 [PP@T W)@Tp>PP p-LM 0S@P1  KcP/0S"  D 1`0P @b0P0fC10C0 0S0 ,0 R$0xxxXD> 0-hALM`!P_?PA 0AT00  KbP5 \51 R= 08S9 R 08S S\ 000 R\ 0 S Q0000 lp0%=0bP[XK0@c= (0=(lP1P 0-ALM P8_?P80AT K"bP%  0 0 rR P0S @WX_AP0@0d0 R R 00C8S@ 0  <(l|P -<LM4D0P$$,0 ^pp ?PA DSP#p^p0aV #0p6 00LS001 000C0 LR\30-W0  =W10h0 0 +W,UP (PU <, 0R(K3@3P pUv ֘P a0E`Sh x x x x x p x x x x x x x t x x x x x ` PUp 屘XIP `@PU ᥘP X0E S)x                                 @II @`@`*C`@` @`A`p 0S&<pGh2@2W" >KP`@0 0=00 0<00^L@D,00tP@T@B;FD;AuaPPPPP|=PPP<P p-AL!`]?P8 0Q@P vP# PvP@ uPp@B^ 0S ; \l;T @pT;pP@U 0-S0S>@p(lQQ -`L @]?P@ hpJ0T 10 00PS<0< V@w(lX| -0L8MT0 0\0 0CPX0 PEH%O]p2 rP ?P pP,K9PT ,N;(KsP uP@PT  , KK:PT , 6;D0$X0 ]p01 `Rd40&Tu:X$T-j?@RPP 00T:P s:X0S Tp 0 40 0 5400P<0 8 `0IVP0 8`u UD 0S C0 P0U u0  $0SsP 0;0 0S CthP0\0 hX0S L0 cRLKZpPp<0  cR<KZ`Z4 UJ uPu U0S8V  Vp 00S 0V0 R`FV000`D2 R98 㞀Pc0\0\U00Su U 0!0  80S 0SPr|1$ RPkTP IH1I PE][  0*IcP0B:AcX0S@x@3uX# T uP0  D0 @ ZD0p0H L0 p` 000HE2H@T9$Q0N8NXP 0-PLM @[?P0 01P@PK +@0PS80S08PK@P0(l p-,QLM$!@[?P5 0aV/ 1 0K#P+ 00 R 0 0  Q  0S  0UPx.4 X9xx>@xP4  9x(lXtYH p-0LM` P@c[?P 0AT K0T1\0\  00 0l x4V9xN9(l,QP R4 5:0QF -0L` Q\p 0PS @0S 0SᆊP00@SP>? - LR@:Q0AS Q 80bp3P000 ? -LM0P@ @ P&0 pP#0:0S0: pP]  `PG00< !@@p@3|0@ `P4!@ \P `P  P. @ 0@@ @ P @ 0@L @|4 @u @nHRQR0RR p-L@PY0PP` p P P` `V`p p-LP@0PP` p P P``V`p 0-L@0P 0 P 0u30 dR p-LpM`P@PT0 RKpK,EP@ : S I@@0 -LM`PP@p/ 0A#SG| l      ` 4       H  l    x ` ,  L        h (  K`P0#5 KKDPBKDP6p 0RKDPBKDP 1R 1R$K 0V/P000ɈP0  [p30  [ᰈOp3Ip3KP05 R  K,\P 0 00 KP\0S0 KP{3 RuKP04m k p3fKP`@IT[KPU0: SPKPJ0: SEKP?0: S:KP40: S/KP)0: S$K|P0: SKqP0: SKCp3K`p30!SPPU@_YP0 0 g1U b 0p03 0 0s30S!BKCPKCPp 0R ćPᾇp3(K 07.P 0ES񟗱     x $ (0Rӣ$ (0R$ (0R$ (0RÑ$ (0R$ (0R`0S0XR@@-0S0%@0#0%*0Q00 @5 @5tY -L M@2@"P40 0 020"P,0 ( @ @ @@1SGP1`6 T8` < >@T\J`@pK T; 4P` @TJ4PP*T 04PP<<00C<0 4P`<  @D1`P 5$K@pK 00 RP @ 0, p3p3@pK 0 0  ,@0 @ \ ( , HQRRXR 0-LM@P$K $Kp  ?<.5K0 Kpq 5R -@LM`ᒆP@Q $K 0 -P $P 0 05 K0C4pKl4@ 0P ,@ (P P)@T )历$44RRRR -LL0PS8H 0 S S0 0   0#  A0A0 S00`pB"Vp?@C "Pd& `% `% `% `% `% `% `% `% & `% `% `% `% `% `% `% `% `% `% & `% `% `% `% `% `% `% `% `% `% `% `% `% l& 0SV0SR 0RQQ  RP A!mVpp?@0!R t4``aThA\!UVp . ?0B"Sd& & & & & & & & & & & & & & & & & & & & & & & & & & & & & & & & & & & 4W |Q @x4QQ@T  8P$?S,S8S?0 0@-@^ 0#S^ 08 S00S0 0#S 00 R00^P P0 SPR R^ J0Q S0 B00Q B\0AZ# 00000 -L@`w{T- p@PP 0`pc@W P`ʏP ďP@W SdS -LM@R00?P`p@ 0pUWlŸ (0K P{ T0\\S@DLT\"0'P "P `P =P :P @DL^m0 g'Qe "Qc `Qa =Q_ :Q] PP^0 'Q "Q `Q =Q :Q \QP^TJ q7 1  01 0D@q* 0' \ZU-0/S '0/S PPpp0PdpU@{ Wl{y0Sp(  0 0 008PpP0  v6 S Q-L@' T# AT *0Q/S 0/S@T:0/S d 0R /S @T:0/S Qd+ p-`PLP@ VP 0R  0RQ^p^p -PPL`@p 8p@@P VThO 0-@ 0PL⫃P 0c0 -@QL.0  3Y00X p`@[T*T ?T $T P(U /TpU @\T0 SP` U~X 0* 0 <P WS -RLM0 a PR0 00#\R00S  0R0B`@0PP0PC P  `1`(K`14K!, 0 4 D4,0Q*0 0` 40 p@W1 1SP` V' @`0 @`DA A@,@ 0 4 P 0Sr`lT 0 `0K>PpWS  -LM0K` i iPp   UP P0xU*AVP hPp  (K @`DA jAP@P -L,MP L T @L 0 40 0 H 740T0<0 8 p P:2P8@w  YD  0< 0 bR<KP@Y R   P /00D00D0 H<0  cR<KP@PH @T 80 T0b CA#T00jC1T@0 $1`p@pW` 0,0 , KP LPQD p@8 5@`WT 1 00 R P80(K,0S 0 -RLM<0 / @KP`4`KcH#8#000 40 , ##0@T  L@T"0 !tx2P 0 0p400gCz @W `2  @WY8 @ ` P X`P @ 00NV 0P nP XP @  81J 80 1 RW 1 !0 04 4,0Q8*00040 ` 40 <  (K !RIZ0 P`` VP @#PA0<x 0X0@` DA A@,@ 0 4  40 8XT(l,49,3,(TT@A<X0T 0p-Lp0s TT 0RHHr P@4bU0c00D0c "S00!000 o!0PL 1pW)a0 S@10`PcU]0 0CSX@0 0CS@ TT 0R( 0R <qt Q!0@TtP0S:00 0R>*@DVt Q00 QPf:d\@P d0 R} X0 Z:wᗼ@$ 0,4@   -\0LT0L0L0@DP 0540 ,0 7h4 (,@ P P p-P0P`0 0LR@ 0 R R00CRphpq0DS J XK hK J hK hK J 00C00000,$ p-08`PLP @0U@Pp( -L - L 0    -LM`@ph0Pd K"d@P `00`H0H T w ,0 (0$ 0c0ALDH P-L@ p D 00 hK^IT?@hv v] -$0L N -Xp@LPP <`0T: 0S0UP(  0-LPP @@ T0 0-0 L\+ 0P @ @T!:\$Q \ q 0_Qq 0_Q $Q\@T*@00 v8 -LX0S <0 @! P PX 0-0L@Q 00P:|0@0h|lP P: 8 T00B0Rw T*0B0Rp T:4 -1!L@P\j q``VE:\ 0$R \ r 0_RLUD r 0 R0@!0 ӑ  T q 00 _Q $QUU q 00  Q 00ӑ\`V* `yq 00  Q` 00r 0 R0, 0  8 vsvCL}U{ -4LP $0 AL -0@LQ 0 Q 0 R 0`S Q0S0So0Sl0 SS CCQ0\0SY0S  C X -0L  -0L -H0H 0L S 40R 8 -H0H 0L Q 40R `i 8 0-0 L P- 0P  @^!: P$Q @ P@ Pq 0_QPq 0_Q $Q@ P@^*0+@  v8 -L -L0 g -LD0<0< 800 00@@. @  -L! -T LP00P0 0S P0l00C Q-L@!00@0@ QP:80 @00  0008< p-0L@`0 ^P :ϠQAQ 00S 0U^@*pp8  -LMpP` ȀȠ04 <0 8 0 00 , @@@@t4 0 b00zo<08 040 00 ,0 0D_Y Y (K I -|p|0LP R`*\@  `> :0 0 0 # -L@$P嬀`@P0 ㌠ 0 |pS030#00V 00@0Tt0S:00(@ $ 0-1L @To 1 R@0S S S "S 'S0S  R0S"S 'S 0S S S S S "S 'S0S R PU "U 'U PU U U00~P0᣺ D0T'* P P "P 'P 0CT: P P0c0 P P "P 'P 0CT:"P 'Pl<8 -l0l 0LS`\00000C0P 80 40 1$x L8T 0-PLM T@00Cs0 0K0KPK00Cs08&88 p-d0LX MT@T`0PP88 1?1c"10c Qp gfff -tpPlp@LX`d@D0 <0 40,0p p  @L -`PLP LPD < P0P0f 50%QA!V0Pfp p@z@Tp e` P㺴Pw0 0 B cRW@@T P U@@T00T0 0@Pto0S:\L$,0@ p-0L MP 0 K$KK a0a(@K @Y`P^Kp0 $0 `xV P0APVH PU$ P: 8Z ,l p-P`L@T @00TPc@PduH@pL - L00SS``pP0P x0@dT'0S00CP 0$p,0, $P LT -0 0Q tt0 `L X0R 0`@RJ@d< 8 -L -LK -H0H 0LQ 40Q8000 0Q 0 R D < -T0T 0L Q @@0R `k 8 -1L Mxx 0,K n0nP(K4@K0K @F`P3 U (4 u(M$K,00 (pcVW00S@ X (0  0R/S U0!U00SQ($(4 0,]0(0  ,l8Z -L -L -L -Lx -Lp -Lh -L` 0-0L^S@P DPe0@ bP0 -0L `R0 PhP0@k|0 p dِ@`0@噷TPT0T @@@ThP D@ -0QLp @aT`*@DT:PPX`0@_@0@^SDH(0P  @DP  -LBM␁IK pG0`P$ %1KV'D9P+X1 \0C )S* S. S<%0KS60V0 1@I`P0g%![^R@VV64 P$ 0R# K }`W *0C0eW  p`VV $ `gOuT dTX@ -T0L R D0404 00 0@<P8 - 0 0L8D -0 LAD8 -0L -0LP -@0 PL 0px@`00Cs0 V U PP PP] 8 -L@G R 0 0R ^R C>Q@D C?Q!   C R000 -LMpQ SP B P d00S S B_ @T Q 0h @Y"ThY P, p WzB0p;WP 0 S @ sP;WF !21C0 , > 0S A, 0 p1W ,00 0Sl0 00`  /.000b Q0000 A 0P  "`T@@ T 00SS WS@t T`VT! 8p, ` T@A<X\TpT -"LM2"2"p2p22"2@p2@ R "園,KpV0,0"0hPx0tt2P`@@ቲ0c00 E cP0각 | $ , @ |  Z   0S PD0Q D0 D >ZZP  _ Q    00 ZPY 0 0 "" "Z  R Y ZL Y 0 -0  00C0 40S  00 Z !  0删 0C0 p Z oꀌ t x @ (  Q D@ BP ~ R0P00S Qp,0  R `Q !0J]S~` Ԅ L ` 8  Ԅ ` ` L L $ R 0 B 0Z ZX PRJ  000 00 0 R 00   00 䬐 0 00  R0 S0    R0(  0  x0 t x00| 0 R  pq0P/S@j0P/S W :S 0 cR ڀK< @ 0S 0SS|p0S +S -S 2T @ U0P P`8U |tzU 0S0 80 cR8Ki<0S0000S0Tb X@ - <`` V> S`Q0@N {Z @I 00 Cp O)p |0〠 p B00 p 0 p 0 A   00#0CS$ 4 $ 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 H  /x@TR #T  Q00  0   00  000 RQ6@T*T000 #0CS #X50S'00 R 0@T@@@  0 @PD0   0@ ; 00s03S< 0-S=S ?S@ 0S 4P 0S0   Sm0S 0 400c0 P 0P0 0#0C S                         $   p *`p  $ P $00(   0S 0@80 cR 8K5;0Tp00S) 0  `p  0 $0( 0 0S @80 cR8K;0Tp00S)00 `p p Yp 004, `< `@enSP 0P0U*y  PZJ 1 ( 000 ``, 000  80 4  p Y[  1UzppezP "I0S p A v0S  Q   P0UK*` ZP(K400c0 ;0+D8l0XtYXXXWh(lNLN\J WWWW40St/`pP 0P0UE*p0 P SGPEP 0@` DA AP@P0 @`DA uAP@PC@x  0S>0 0R900 3` 0 P40@XA ᜭ   50` 40፭!0@P _a R0 00    00@"00@040apuP0%S #S `V0S   0S` p  } F>P7PEW0<0 ` j<#S(pp@`Ph3 `P( 0S K H`@|P  | 2V  D` 00   u` ` $4 0 | dPK@K0 uu a0S @80 cR8K*900 R `U` `PV& 0Sr[IuP 0@S*S0]S @V*Vpx5@ 0Q  0S00S T  8%00 = P  KZP?0 00 {0 :S 0  00S     0 [tP 0@S*S Q  =R  9]P`@ F 7R $0  P@U @` @0d'X`p0 R0@T  0S 00ST\ 00P%H`PG @ 7Q00S+P@ 0]S  #0BS  #<80S(8pZ\PP@ `0 T p@g DA A`p@`PUg0S(0@S@@&P j 000?0 0`A 0` (  `p0` 0`<PF`EWP|t*0  R Q+R  D \|_P\w_`;@P@' q 30S  \i_PᇟPP <0 00p`0S [Q_P g c>`p(Y[,< 0@S@P R  P@V :<AA  Ap`P Dp 0@@S000 t e0 ,W ] Z p-L Ml`0@PG 0$K 0 $0 $00`0S@@Kp(l p-L M`0@P$ 0$K 0 $0  x $00`C1@@ S @ Kp@(l -L M0@S`' p P$ ( *(0  (0 P (PK BP( 0Q*00$ 0` (0 @K  $ ( $ @`DA A@ @ $ (  p-LM0PS` `@`1T@S0 7Kp p-LM0@SP` P`P1V`S U T ?Ac Q0 0( $0K$@ ` 6Kpgfff -L@ 0 E蠄 0-LM@P0 DK0LX p-LpMPK@`R#P@@PU Kp : S  S @PV 0S I -SLM@0 < @ 00@/ rP[ i1P  000 , 00T080 4 1 `:qP4P7 X pf80@ cR8K5P@ /00P80  cR8K5P   4<@ P 0S4,(K` :qP4P4`, <@  cP  p-LM PK`|"M%M@P  V 0 /R 00M@PKp FL p-L@`P0=S\ *SZ +SZ@L M 0 ` p -0L@pT`T P MPL@0t03V0S  M 0 0  -L`L2p/@'qPP`F  U  Q22p 0@P 2U @ |9X  l2000Y @ @ ("00P00 ;Y\2P 0 P 1 P  0 @B&1 ; 0 8 TP5 0S0 h LP @ 0  P PU00SP LPP 0 |P 0 00 `0001   /PP 0@pX3\h0P@@  0a 8L0P0{X X$LT(l -LP`000K  @0`|;X P0 00P;000 OXKv30TX -x0tp00lL @`0PPB0D03 @<0000 0-@LPkK ,K@P 0h  tX0PR000AS (l 0-PLM0( 0 , i AF/$ 0 0 R<   0S41  V.@PA, R  (=- ApB K041,Qk"( 0 0$ P !0 00 =$0 P0R@@Dd0  0S A h0  -|`s$0@!d 00XX=XXX -0LM  00  P,0 0P, K  0 -? R:0 R< 00 0;0  0S N@P 0 @ %0 R\ 0 RW `(X p>$Q \KP004>X #,QT X 0HS񟗡   ȭ 0-S 08 KpP*0S WJ= P @0SP YQ  P1X W 0S 00CS4X  0 ` $ $ l l ܳ  h | H < R  ,һpWw 000 00 Sl<  0S0 00@,0,000S 0  P 0S!M; R0(K|p}; R 0@H  VYs @t+\0KfR ` bG\K007AWt +@oPj 0Sg :Rc0 ]0 R  0&0 R 0 RKP0: Sh`0S\z gL0 R8: @@(:  A4 0 $9# R& 40 R" VyY >40 R @440 0\9` 0x{>40 @R8 v:40 R 40o |0 S0 0 R  G0   (\0K Q@Hb 0X XH |(|8XX@@2b 0P0 0 0 0 0 p30 0<P0 000\0  7X 'P0 L 7'\KH0 D 0 0 0 0 0S00Q0#S0<\0 000 0 080K 0Sj 0 h64 00T6V@P 86  O0DSLT0 t00@ 0Si 0 Re0 4 40 R 40 yP  65Pi40040 4 0S0 0SD0 R@ 0 jP 0  a0 04 4@P 4  0DST0 0%0 0T00 0 @0 @0 R@@K <0@0  @.000 00 0S C0 0 0  @c00 0 4 00 0 @KX4 I/*04 .0Snh@4`pTWPP 0S0S8S 0 0P0 @ia0 8 K\2 U@P6"0S 0S>Rb0 @ 0 @@`K@PUPBP<0P0PS *8K ™1 00 0E 0 >m*4K\0K (!O 80!)X*V*0 00 I0 q0  @0  @@0 0< 0< 0 0 P0 0RPPM|POX |XWX 0l,lT^XYYX=Y dYԲpY,4X D`Yp(ltYDY0@ 0 R_ 4@80[ R`  `0`SQhtSV0SPPjSVD P]SV0S KVPP0DQU000 0@ 0 0 0  0 S00P0#Sp@8@K00S T0 0 40 R\ 0S40 40 T0 }0 40 RH8K 㰘(q)}` 8< -L$M< \@0 0,0 ` 0S<0 SH < <0@T8<0<) Q <0,) Q <0) Q- ?.PpP(00pP pU H  8 R=0H0 (01@PTs H0+`< <0SX 0S <0S <0  x}X<0S <0 R4 0D0 7 0R Ru Pp"0'0Q70 :00 R   0VD R I p Q0SO 0 47@# R WDVRU84 :@PTP  < <0S  `H 0PS @0 0H @0 0SE @\ <V S7 D 0@psV Q0SPU <0S < 00CSY l 8 <0  005 `0S 0SLe0 <0  8ş#000 < <0#20#0 ,4 <0<0 00ز@P 850$<<#04 <00< 0< S T'  @0,(K"6. XH WLD <0 `<0 R <0^ 08 ~0,0 < 0@<0 R <0 0 )PqD P 0< l< 0 0,0 <, < 00D0  `3 , 3 R /hP  (v 0,0 H< 02Ģ@W`D@ B\ @0vŸ<0  @  0`, sN ,p n04M  b l2 , d X> 0,0 ]&s'<0@}^0 , 0,0 K0`H0 <@ K<0 RS <0] 0 ~0,0 7<0  < 000<<0 G< 00<0@  8L1@ H@ 00 0P(@0 0S @1E .Ey <T<0 3RkQ   0,0 , d0 &X (P@0l,lT^X\XZdZ8ZXDY|DZYX|YY 0-L M$Q0 0 @R! ^0\ 0A|3SQ/ P 0R+K00*]p3P000QP ^ K K  L0S0K\ K00d7uHD -8@L ¿?0000  -LM0@00Q & `& &0BS x \    | 21Ch 0 X 0K 0 K 0K4"S0tYZZZ[0DZZ -0L(S 0S     "(0!B "0!B 0D -`L@t `2  @t 0T(0`0< (Ÿ00:0R _T{ 000#T0Sq 000#P0S _PqPA f 1@;0<000 @ RPP ⿾'0`0`@0 [T5 0S(Q ` 1@/O᣾&00`Pp+0 0pS T21C   IP0p`040)00`HLP`(   v0DR 0-L$M@8 0 0K, 4 $@ @ 5%1@P  R050$ T+40S)K00PK1(0(S }#(0(S8 0 R4 8FP$ [Q0C(0  %W  (l -0LS@P 00S p `QP @0u@050Q0 050p c -`Lp@T  00@@0A   P  QX @mPX @ - QL M`4 ,@!0DTPPTST] #Tq Tz&0DSpQZ(K4!T 0p0 0 "TP U 00c 0400C00 @pPDU%21C0 40RcT  , \ 0D,0 S, p RSTT T 0D0DTST U L p ` P @ 0 p `  p t L P @ 0  ,0 S(0    Pp@PDU$21C0 40RwT ,    0  ,0 ST  0S 00 00: P 00C 0 0Rö 0R 0R 0PSPUr  p0%SUv 00 0  00C 0 0S 00 00 0SH 00C 0{ 僙v 嘙q 0Rl 0Rf 0R` 0\ 0"X 0T 0RP 0L 0cH 0D 0S 0SI 0 0 OB 0S2 00 0  0p0C 0 0S# p<1p 0Zp- 00s03 0& u0p$S 0@p, 4   0D4[D[([ 0-L M,P0@4K4 0@ (00K00l-D0D 0lCQ  /10 00Pl - @L奶,00d -L ]Pl -LMP@, cP00PT"QaA0 10Q*(K婻0100CQ*00 0!  BR\ 0㰵P!` pP4 ) P 0@0PpP 0 R @40 c0 0C0. 0PP `E̠E-K0 ED,K+K-0K*@K)PK 0  0e$0LdPhx -RLM@PB `0S  U@PER L < ,  0U `0 d0 h0 lX0 p W:0FS 0bC1AVV0a1,0 PL @+,0  ``  PL -ML3M 3R, , 0R(Kl#00d#dHKNXP L+<P --@P sTh 0㼴܂P  0@P0`p` 0S0SZfJp J@ @0S00P :S P0*2PI P PEV.*0S PEV:U&  RU! BKAA! 0!35- P$ cP@f @d T/ ljP[@t000^@0 J0ִ 0*9-P 3IKAA P$AE00P82XutxP[pL dh\[F -<@L0S (0}/ }0 @ PL p-0L R PP #WP l`PdphpL0@D@@姹80( ,0 B @@tpdxhLP -`PLl0V ``p0`C!VQA8 ȹ0`0Qe @PL 0-L L0L@PMB P 0dCPB00P0P -LMQ@,0 ``p PhEQT00?@AP*Z:a@ CP X@0fPZ :,0S %P 0hCP -D0D 0 LS:PS0C  0Pd[ p-LMPK`@)P P11 0 b! PU3 S'x0P?S0 b@@0 @{0P 1xS*U xVSTxD 80 x xxP[d[x[ -$!$A0LS`: q Q0 R 0B0 吸00C0 V pP `P@ 00 R0 plP@p @0 ,TP 00DPx lL< -:LM$ `R pp p p p I)-&pV 00@CS l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l  l l l l l l l l PWUPHx(%p0XA P YW pW 0S㴀 Q Z0S0S  @TK X T Q7  000 , 004 080 pP ^00S  8  bRږ#P@  0 Pp$P `g 0 .8KQ}yu(K6 C2^ # Z 000   $6@  L* pTW  l0S0l Z o S[Qo @Y@X *P X  "X Z 0 r 3 Yy H%H5^ppQjZ00 ` & 0  fB!A/@/@ /_PP0 d /Q00`Z  X 3R+h|dp`d\^ 00S 0Y   ZJ =^P 3P'00c  Z  `0P3F/P`U RoZ00 @  $/0S00@Z  X 3R0pZ F HBWPlPP 02PP K }Pp0T20 (0,0 僶00@ `4 8  L0P08 @d\400c00b S8K5"8 @` RP _Y   aZ  @0S 0004`v"4`$@S 4v0ᕕ80`@ cR8K!P@ `4, `1>q@zS gb40&([@ X[`d \[[8b@x@\<^[ \<\\\h\\H\\0     4(0$0PQ004\ -0L`0V`Pp%@@⺵P,@ p0PP h0Ӑ P 0$0  00\ -@@L 00 00 D0 0 | P0-LtP lPP 0SP@0  0,@P00P004 -(@L0SS p004 -8@ LP0SS ]004 -0@L0SS L004 -@LBh? p-0`0C QL@ R pS0S T0P0Ppph,PP0&P00S 0P0&10P0` T 0 00P0P0T0P0 D]],]] -LpM|KǻPt0: S K --80LM R 0 0 #+ ) K| P-L( `@T PU pQPp0 -R  j-@T PU 0 S0HL]- 00$0$  -R  hN-d] --LM4@0 0 * *:)K --LM@HH)-0 40 *( g*!)TK p] --<0LM R$0 0 * K] --LM0 @0S(0 0 R   p0  KUP0 R 4@,0 0 f* *|X --LM\0\ @0S<()0 0 A* )| P-L@ Ҷ@P ̶0 S@ ] -LM@K3P0Pȹ0PK] 0-LP]@P0c0 S U] P0-LP@ T U  0h蘹0J(T0h萹0SS   0SPS00Q00Q R 0S 0S R ꄡ -LM@K 8;00 R000 1 0, 0-LMPKD "<00S@ @0@S 8, -L`\M0V,0  0d#@00X3 QP# Y+0x t0  0 S 0-0t0 0PUP  p R P 0"20lK@ k@VR 00Sm x +Vn VG ŸR2 T l K0+p PU  R0SVa V "Q 2 0 x+PUp0S o+, 0Rk(K0 0@9V0@50 SS@@l K.l0[S t!Tp1 0xl KM+0p0 V0@l0K 0S/lK@@ k@00S $ t05+V  /+lK@ jz 20lK@ js @Q 0@ x P@+lK@ ,@ R x+4hP  *T *u]](l ^<8^\^0l0^] ^^],lH^^ F-0SSS 0PSP^(0000S 0 R00  p 0Sd 00C0X0X L P000P00 $rꄡd^ -LM pK` ‡@T P 00CS0<0@T 0S 0@ d X}& 㣇PT 0@  ꄡ,X^ -Q@LP 0= S; 05 @`p40 0^@Q Q 0  P  0RQP tH0^0   ^  <00,h$1ꌡ^^^o -@P#0L0F%T0?S[\                                     \      \  $   p p p p p p p p p p       92P 40S 0Qk R0S Q PZT81`@T P0 ";PUSP@TU D1Pe9(1 P 0R@0R P0PU p0@T `P Wp@TPUW |0P P00Q 00Z 00Z 00 -LM,Kp`P\ TWpV@ 0K@P> U4T P@T ,40#00 W  @ 00CS0<0V 0P T 0@  T  (KU<0@  0$0!,^FtY 0-0LQ2 0 @P ^ T\ Q  P 0S R pp0R`  0  H0H0 P 0S 0脡XT^^^^ -LM`00̂000pSp Q  Q>2 R  U4P 0@`00@ 00 60@00 00/ 00 R 2 R 0S Q[ 1Q=PБc 0SY 1P 0S4 ! 0S0;004 S 0S- (h1, ` 0$ 0 P@ 0S 0S $!$ $ 0S 0S U 0S0  ,PP 20 5x0nP0h;00< 00P@gL 00Xm\L@_ -L M0K pxބ,KPP  RI Wx0@T `0S0C00$3`\# ~@Ty#V @GW. 0SB0SU0000 U00 0S W@ 2 R0x">0@  ㏄(K ㉄@Z@ 0S㬦PLW`A00 R ܑVQ>PY  cK 0@0 t- h#P0 -  E0@ hPPK0  @  2,0!@"k괐< ⩶0S0n  堶x 嚶0S T0P@rK 0L,(lL_T^0l_,_m_D_P_FtY\t_ -LM$`K@p( PTP  KP0 0S$ @ ̃T0d0K0P 0 P 0S 0S 㰃@ 㪃@ 㤃 R@ $0!n@,_FtY 0-LMPK ኃx0P h  }@8008, @ m8,__` p-0@LTP` `@T P #@P`Tp -LM$pK` PB K@P'  R 0S cP @ -KPJ \@UUF   0! @,tYF0000 R 40S0 ꜡ -LM@K 840 R 000 ۂ, -LM 4@, Kł%`V00 0 0000R D0S $p0``0$ 08논PP@v0#SpTn 4@ RisPP@@ v T$0S Q  :$4 R 4NY0$(33 ᑲT:V @,K f#pW00x 3P \1 0S, R 0' 0H3, ( $  ,00008 2"0`p` ,K &2A>0@!`Y2    | 8 0p00% u(" 0S DD $0@T $($@T  " @1 1lp!)@p 吻^ E ,KҁX!0S = @!0S 1d`1@!@ 1@ @@81 v$Ns 0S 0 0_@P  ᵱ㎣@` PD@D 0T,HkXmH8`D`L4`lb ``\`d`Xx<,F -RLQ5 0S^ܢ܂P0Br `D@D P0T0rS Bb0S Px P d2 00U P@ P8m2 0 "S Br `D0@D2 T 0S m7! 0Aq `D@D 0T 0Sd70Sh1 R80P0Hp00aP @20S#  /0R / P3H MP00l(H B00P`Hx 600x{HT ,P00KXm,FT$l\Xa```` -1L@TX pQpqpa@T 0Q 0S S0% P 0S @TPK 0R 0S㈢ 0SP 0S 0 R0Q`0  hT@QH0 ` P p `ꄡXT$lm -1QL@P` @0Ǡ) /Vpp 0S00 0%0 S0 R @` PD020@D .T0S80 R h6h{꘡,! X,F -LMt R `4 R 0S044 00(KtKb,K  tPPڼpKW`V 0@T@T 0U0,ß Q,=A A¼ ,(p0(c(Q=9 =t ,,00$b @(( Q$  =A A$ h0 cl Q=9b @ = $ $0H ᧇ,00, 0S|0C0 0SS0000x 00S  R R 0QS4 0S 00 S000000 00CSX@Q0S2 q 0Sf 0S& 0 S" 1 R  0S 0SA RpA #  0S 00SA> 0S; 1 V ) 0,0 000,`V6H $ p @0V 8 R 0R 00CS0rTG00Vꄡ?BX^@a4da -!MLM$̟, l( Pp8 d ; 0 ST  @T @0Pd( `( \8 , `\b TQ `X( \ \Pr !P- @\XX00SH p8S `x R p0 Bx p0`0, XQd( d( Pp8Sl\, 0dR(K0!S@ :LPK 0*0"ᧇX@ Xd@@hpQ`(\0" XQd( d( @ P P0d8  `X8  P T8S`,`X ` `X \PPU 9 RZ!0EVSV , * , * * * * * * * * * * * * @, @, @, @, @, @, @, @, * * * * * * * * - - * * , * * * , * * * * * * * * * * * + * 1 1 * * * x1 T1 01 * * * 1 * * 0 0 * * t0 * \0 * 0 * / * / * / h/ $/ / . . KJJ0 8(:p X@  Xd@6@hp\`\(0! X8Sdd @#@ \\d(`00`X d8 X @p'`X9 L'`(\0" 1!MK@D@D1KJJ0 &p6K J0J 0&p p00BS00ASwKJJ0 p&X6K J00J0a 0&p~KJJ /pv @h( }O{@T@P@Tp!]KPEPE+h_}OP@!MK@D@Dp1`KJJ0  2h}NpI!MK@D@D\1LKJJ0 ,%p8!MK@D@DK1;KJJ0 $ p'7y:@7u:(PCP  7k:CPKJ~0pJL4KKK t NP  NP KJJ+ <_ NP 0p0KJJ +,_p!MK@D@D0KJJ0 #pK3JJ +_pKJ 0J pd( L4KK$K`3K JR# $ 0pJL$KK4KKJ 0J pd( L4KK$K㎦Pu PKJJo + ^pKJJ0 KJJ . .0NPKJ0 pJL4KK$K}!MK@D@D0KJJ0 $"RplKJ0 pJL4KK$KcK0J\8 p0CJL4KZKJ\0 pJL4KK$KQKJ0pJ\8 L4KIh<69@\869CP+ KJJ{KJJ +t^p.KJpJ)KJJ +f^p 1K0J1J0  Mp6c9 0P0/SX5W9KJ0J0 \ 3puXaaWaNhI\Hk0a8F4Sa 0 0 0-0LMPP)@5"9F0 0 ŖP 0  K0p00`P0&40P(580aaa 0-00P @L 0@= 00 p-@L@`"0DSt0 P    $ < (`8 , 0 4 p<408`B400,p(l p- P0@S0C0 p0LPT`` 0P0@00p( @` 0<0괡(l --`LM 00CS< 00CS,@@0 0 (l -0@=C0 0 L u] -<L@Pk RV8 7 7 H8 H8 9 8 8 $9 d0P 0S R  p, ; bR,HP0W0PP} P0S0So D0PP0@0S <4  啜`0a0Q Y 3 R 0S  >Q $0 <P $0N <00$ $ $@} 00S44000 00  0R 2 ˣ<@@[2 RY0,00e z P `> 0R, SK 0 , b  nRڨ,PL 0 R KPq 2  0 <@@$00$0"<0Q0$ $ $Pa $00$0000<0@ 0  $0S `1 R, *,P`0S7 W@5 * RH  00S< 00S60 S6$00p p0S Y)0t |0,n<0 喛 ) @XT4l(l0l,l v p-1L R 0 0P0@0 p`0SP 0  0P0@0phyx@\T0 0R0 P 0 0R@0a P 00p踡 -1LM  0(,0 ( ,0耟0P40 0 p@`T`\TT 0 R00 @``40 cRP4KP[T@p ]TpGW00S T000( `΢w3$K -LM0/K,0  " ?@ 0@ 2 ! >K*.KH! 0  B 啢101 ? @  p@`00`" l `L/ P\P< 4ϟ0S006 P P #P= i> $0 0$0.0S  奟Kb  P\P Ο0S00 X V V0$.01 cRKp V8A A E E D D PF pE D TD C C C 0S0C0  P\P ͟0S00 )P \XR `X $X 00p0= R P-!X  $01 P\P ͟0S0@0 @ TT T !TL 00D-T Stt  h 00  " PK@K T T T @-0KU l  P\P T̟0S0@0 r@TPK PL+1PUF 0 !RB 0(r0˟00; 0 0< 7}Xm |X (Xl @X*X ?X+X !X 'X \X4 "Xm000 Y 0 p`0)X |Xh (X 0 0 0 Y p 00"X \XP* P\P ʟ0S00 $X> "X; X9  \00 p2\X 'X "X, 0 `0 p(X000 )X p}X1 IY 0`0p"X1 IY] `00 p'X00p1 IYQ 8 0`0 p B `X0k \X  P\P ȟ0S00$P "P3 P \00p|)X (X000 'XK0l0 0  Y D 0 p`0c0SF F F F tF 'Xs @T1 IY' `@ pL"Xm \X@00@0C0(X@@@ J"X 'X|  000@t' P\P \ǟ0S00(P 000 Y[ 0p`0&(P gt 00 [[X`  -P [00 p| P\P dƟ0S00P00pP00p0 Y 0 0 0C%00 pS  `0S CCR 0S BR 0S0C`0h% P\P Pş0S0P0 P(Uz {U ܄000@ X0 0 1@ cRK @P P\P ğ0S0P0 P00  0 X  p`<$ P\P $ğ0S0@0 f@$T "T 1 cRKj pT@ 0\  p@6 0@0p- 001 IY ` p#00 p1 cRK= p PC<XPP>X V`  Af V` 00 !`p0FbSRT@T0<"0P(RA  `ZyT0Su  r "@i  #@Pc 0` 0S  0TX   0TS < 0S (  @0 <0L1 ў] 00 p0W S WV(X ;X |X' 1 P\PI 0S00CX\ |X&PF 000 p`0w\TA `T'0@0pm, 0R(Ku vPXb DFaa0 Y 0@ 0  p`<00CS0ih0 P\P 0S00)P1 IYa `00 p P\P? 0S009(P:0 Y 0 1 0c0` p  1 cRK p X00p0P@0  $PS p(P ,0 Y 0@  ` p 0 0 0 Y  K0P0P`| @T\T 0S00 @VpQ |Q R @R Q #T`6 3 0`/`, `(V&004p P\P^ P0S00X:PY %P#Pk0 Yw 0`0g#0 1 cRK P@P0$0[TKP @0S @1 cRPK^ P00 R$S4 P\P 0S00 41:P@00 P\P 0S00p%P#P ]0 Y 0`0\P `Pr\XD `XB X@ )X@@D@ \X@00  %00C0@@00 X &Xg>000& P\P 0S00 P Pd00C00S0&0 0`00C06 P\P\ 0S00VX >P00S00 &P Z00 0|P0@00 000 0 堜7E` KPj 00p0S @1 cRKp00  0pS (wP0S pI]@00W  K]k  K  Kn$0 0 p)  K  K@  K;.p0S  6  0BD)000@9 < 1 ! T10 1  `0P pa P\P 0S0@0 @T W T p0T 1 cRK`@`P P\P0S TT @ UY 1 cRK@P@  P\P 0S0P0 P U 1` cRK@`PL; R, P\P< D0S006(P㐋 ` Q@ d+v00( 0C p( B`0    K  K K0PB  KcVT  KZ/CP00  KN]  KI;XȀ |Xㆀ <&XK  MPP< " =R }R3=/ (0(20@0 00 <   K  K0`!W0 00C02 S " :2 d O.">X00`0  Ka>X007 `00 P\P 0S00 -P0 00!!#U0000ԡ -LpM`P`U @TD P嫚$娚00 `P> K:BpP000T\S//z ,u%B@PPD0 R 㷚00@`P P0: Sl0 0 0 00W0P `?B@P 00$K輡LX 0-LpM|P@PpSP`OTZ 0T  KP 0 0K0|0: S\0 0L p-LpM$((!0S00cS1PU3 P Kk`P0: S 0 0PUKpP L0 `  `  0S h0R|-* @,0S\bPX(`  4r*P 0 PСԡ\(b< b 0-@PL 4P@T  0R @T0 -$0L@T @T p-l`LPU R @0@S @T⣙0 0PU 00p -(@L0 01h谙 -laLPp0S  0R/ R @@ T 0Q A@ T 0S 0S W 00hX d`V0 Re0 xP0@CTT WBHP@0 P42 d)X|T -P`LpGPP@pP P00 Q @ P-@L 0 RP0S 02n T000eᆊPP80 R (TP@OP@X8 0-LM( , (0$#$ R 0 0  ,0S2  $ 0S2  2I@P T$ 2  r2 R=(0< R? 0SJ(@P- 0S0SF (2 RB 00C0  R<( 001 R (0$   g10S 0S !0S001 R (0< R\1 R( ( $0$000$0$0 0S (0S Q0SwP (0  ,P/$0 0K004J 0S T |0 R (0 R0S( 00(0d ( la $ (0 0mX 0DSxI0,2 f 0 0D 炗$0( p`pP 0S 00TS@T  0l P X;00V00 0S3  |(K 0S v&)X0S  0)#>Pj0S)pPa '렟0P]@T0WW`-3P [uP0b@P :P3P"20Sӳn4"1S00} `1QS`Q0G 0@Ttd 0i.~<%])Pk("Rl g 0S/ ,O)oP P$P$  $ 0 00 KPBKP 1R 1Rp)0F  00P  ` 0dQ0D 2P6 x`9(0P @2 TR$mL=< (mX ;@lpbTy TLFTFN(l|bI0b)\bTjabbtFcabxbbhYbز|tYb -@LlP@k2 tY -LM0@0cSz bSz  PK I 0`S R  :  0S PU  40!Vā t,((0 "4P P@2 zԥ,tY- ` 0T00  R000 R8 # 000 R -L  4<0< R808R;\0;LD<4 ,@$hDddddddP 0-0@pL@P`p00fp@P*d 0 0     p-0`@R0 000 LP:0Pf 00 p Pp-L phPXPX@H`P ps  ph˓p - L@ P  P -LPp `PZ 0#S@Pʖ@ -@QL mP PP@1*@U0S pd m0P`d  @ nU n@j00 -LMxP8 < @0 @僓H14 8 =pP``H6pTXp V8ʕ `,pPVPW0 ,P V @PV@PX4 80<@ , 0|  V  Z YH4(Ko 40 00 V0``ppѿ,p3 0 0U`BuF 0-LM@P K0S  P00Q0Sp008 0-LP@P0P p-`PPLP n@ PGp 0-L,MxP0>Kp0 @Q X0 R%\<000 0RK0uFXF p-LMH@P4 `0T0 @ KpẌlr,e -aLMpP0Pp' PPR 0000p U0HS0 0Q$pP PSQ U00R0S00QR ,R @K$ ៈ㞺0 XT0 -LMT0Sp! j W4|1  DK.x t DK|!!p@ 40AT00#`9 oT" ?T WsT0x1  8$PP%U 0T0  s%U (K<@T  PS0S 1#0  VV<00t1 VGl\S@0HS LQ@%T80( FimB* PFam܂Jψ0S 00 Q0W002|1 t0-S /<P 0-SXRDŸ | b`8PpA `AT /m1(K! 0 DAHQp1`Pp P%Up!>KD40D !R 0-S-S+S 0SP h!0S#0D0 \ t1S Q D0! R  t1S 0S )0S  B9x\ D 1  Q 01 0Sl t1SD! D  ! tD1S1 0D S H<ءFpeXF4dXe0lTq4eA0ESD0P o 0Pc0ES$ ` ` ` ` ` ` ` ` ` ` ` ` ` ` 0 PP  d0EP P S񟗺ꀧ          H       H P0L0 `L ,pK4!000c00R0guU L R-00gg|+00ggw 00ggrgq`H V0<0 Hf< P <  = b S< @ P0P<0SV@0C00 @0T  0S@1T@  @ <0S@0 B @TP0  R@T@< @ r # 3,pK0  g \x0X0 G0GpB00g0B,pK0000g 0S000gg  V@H` ʼnک30#P0 `,pK0倐80K3P0#P0P 8pKq 30#P08PK8pKg P0pP0 1Wpg30#P0X -P+PI PG 0P 0Pa0SS 0C0 00 @`FVp@ 0xS0SB 0C0 00 @ p `F0P@ =@T 0 B P0T @ 0T  RqT @ 0T@0<<@ 0a@0 0S 0C0 00 @0p0`F0P@0 TQNuGpgdg --LM0 0 K 0-@LP! u  :? P  &P0 : @0 P@ 00 00 0S P0 X0PS 0@0 0p  g - L @ 0S# & -*  P 0S0 0S0:0xH  u$00p 0+ f0 00$ 0g - L@ R 0 B 0,p Rg -P L@3 T6 pD `Q!   j`P 00a0S@@ dpW   0Xd0P0 `\p Q V`T`g -P Lp! X `$R9p R V@@ Pd 0`d d0Vp0 V f0X ` 0 gg 0-0L@P 0P  0000   ,夅00 0- 0LS@P P  0P 0P 0 0- 0LS@PP ʋPP0  0,o0,j0 -L^\`pP@%T㼀& 0W, pE <  p0$ (P PPPB0BSU@P?ppEjk(0l^@h --L4MD@K0B 0 0 VK -p-PQ L4M`PP 0L@K0 0 0 P6Kp(h -pl`LP@)# T P (0V0W< `0``0$     dT P PPp P PPpPphhHh -l`LPp@% T9 V`+0 0,0$ (` p ` P  ⳇA 㪇PPP P PPH[┄P 0\⊄00@0h -@`L#0pt00 0,0< (0P y@P T00ӧ2 0 o3Q00 UhX@,@- 00D0  D -<0@L %  @      p-LP`@@P`p p-@L0`S 0 P p00P@0T * 00p00@>X0T0@` DA A000 0@@PLP(l -RL0pS@3Q0@A0T2 P- T<2P``V 0T0 XQ P@0T*00T+ T4 T- T: 0DSLQB`1 P1 R|1@` DA ⚃A000 0@@P41P``(P``Q 1 `p`3)P``0  0 `p`3TEP0  0BS Q` L Е`P H040R@0@ `wLPHHHHH -PPLML H00@!@1  Q@ - EQ5 Q 1P AQ 0 S P0AS0KK0K@K0  P 0  QP 0x  X\ 0KT  0p @ > @0@40 8 < @0l S` 䝟0P0=URMUq0KU t tt 0KlpP `p1@U@PBPU$=p⌀t Pt 0SS<@40T*``8 ` <@ ` t0X\*` g ⴀtt(KEUR 7|<U 0U6^0< KX0 T Lt  t 00K00Sb 7 7P_ {P0Cd0 N0 Sh \ i d0P 87@E`0pSr 7 (P0@@P0 '00P 6 |P  U:@f DA 1&A0P@0`P_|P T1@0@ f )]%0S d0S  O\Q\ hp p0\p S5 - (l5@f DA ~A`P  %h t0K 05t P<@40PT*$ 1 <@ <@40T*4lp  `<@ S P0  ylpP`t E@P 8$~  0 0 ,43  PwU*00P3@f DA p~AP`@h3  &0U0;0g0S7<80 0c0S7`3 R@C0S!,3 P<- `X :2@g DA =~A@p`@ 00Uap0PHPt, <80 0c0S2 R40\C*P00< IHd P;Pppf0S=TBp f }` .Q81@` DA }A @4@ @8 < (8@1@` DA }A @4@ @8 < 81 @` DA }A @4@ 8 < u}&0AA  }A`P)P806`t 0UgPs Pn |PBhLP   X  i  HX= 0@$i(iM$Mc -LP@Q 0  *=Q&0  "=Q QD1@P U0`0$ 岀00Pp  000I{ 0 @}0@ } P0P0 :00 0p0 p@| 0p PX"0@0Sb0"0 0S! 0!@ T! ! !0PU 000 !  0S @\)| t!}0S00T!uPU ! P 00 0  0!?00<0&1 b!@0<0AP`Gn,PQԤ$@ <1 0<0@!@`@0<00<0o0<0W0<0L0<00<0Hht 0<00<0b0<0x)tL@ꐳx|Xlh -`0` \0@L >T j h$0$  0 舳|lh -,@L0S /d0000\L -LAhȁ 0- P@Ld0hdL -L0L @R TT^#@@$h @X8m 0-@P LfB 0 00h p-X`@LdPd MB0 0 pL -LM@Pa0SW P 00|q$K(K0 @,K @3|`PJ (1 ($; $0V0 P,0AP2C {P#U0( bQ P0P00Ť0 00 @@ K lP P4Q (0Ph@@6Pmآ0 PDHT,l -L MK0 K @KK @{@P i|K -L$M@PPb0S S P 00唢U0 ,K0K4K8@K @{P U@ `EX80SF40qB`@0,0,  !6{P00SP 1T0 S/R  P4r|1!1|1|!@@R(K40X``p2|1 @ 40!A< {XpPPU U 40A{ P40< pꌐPz CP00dQp X0P@@^P[8 44|Pmܢ0 ,lPDHT -PQL@0 U b]`V TAtp@0 P0C 0 < D0 P\M$0PPL9@bl9l9X)l9V<94)`Y89@@ < 5P`FVT P9 0S0C0V) 6HXPn0 0 08! R;T8(@8L( 0S0 0008 IPIBV QB P8  q 0 QrQ8 \, 7'x7@@\ 0`l7@D7嬧4'@7 0S0DW0 <4  vCSfP?0 0f 03#3@@4# 00@3C0 wP 00xC00 ``@PVp 0 䒟PUF 3P 0S V2Ÿ2P2 P@2P0   Pc\! 0@P`@0`%S@D"k0S `V  q 0 Q Qp P1 P00P0S@]d!pJQ 1 @ q 0; Q9 \@Q0@ 0 0R00Q 1  `Q q 0 Q  PRPMVK80 I\HPmTLDXXm  svdmm\m,l\L vq 0 Q[Q/l `U00S* rP%` @0` 000&0 P0^V  P00 PP0E00 t=0 0c c, P,0p ^  `><00Q0 , 2<1]``g N= P, 0WSwS0  r 00 0 0R@s B 0d -L MTPD H P冡դ.Pՠ^0l0ŘnN cR0N 0NRlN dN`.0]H.z]  w7  s70  c > B >. =-@@PzQ4  P 00 S z@t) R ] 0S 0S 0S# RP U W 4W V |V U U U T W $V 0-0 0 @_00,QB T00^@  T  0 TPPU Q` Q < R B 0AL c0  F7H< 0S P&0S S S00l000S 00OPmZ P[ Z Z T00e ˟0  @0 000D SX X˟QT;P;  @;  @ T " +0000010DS 00D 0 1:ʟ @ T  *0 00D Sh 0!0000C00 T T`` 0 *TT 0T 0T :'Q{  9@ 9 R 0  R'd9@ M0 0 0C0 TT50  R> 9 ^0 0@0$0  00by@t x xyy R8 0 R0[ 8PȟȟH |P 0S cQsQ CQ \8P'P8 pq 8   0 B y T TPP& '10DSP00D P 0iǟ`@` P 0 S0@ @@|; l x }xyH0 SD Q 56D 0 0 (Kl&0SDƟ00*Ɵ0 ( 000x PwT@T[ H6 D 00`0 0Ɵ 00@m5@T5 R@0T 0T (0STS %PTd0^ P^ P^ P^ P^ ^ ^ P^ P^ @^ Z P^ P^ Z P^ P^ P^ P^ P^ P^ P^ P^ P^ P^ ^ P^ P^ ] d.P' %@K# 00C0D0 R84 0@ L4 P 3ß P @ğ@$a00@P P0 pg00x3! R|S0 0CR4#@0#Q@3 $ß0 @0S 0P0 0ž320P~ @ R B0 0P0 0 з0C 0 0QH2P0" !@0S 0 ` a41 0 f0b 00R0bP0`n"2`<0 @0K0` 0PFP @ `vPE`X@ ڰ 00 P  a4 1 0Pc 0/T PP  XPzbd.10cSsS8 CS6 2 xP cX )0  cU4 00 0;XLTPHDmK4 00 P Lb H Db H@ #1 1 1TX, 0R (KŗPT"<YT"0Y,T" Yum(B 0qDqXqqmtq -GMLMȑ0Pp,0 h 0S@`LS@( ,S0 0,SSBKHH j ] 0M9pP< IKAA]p: \41` V,0@SV1S   Q RQ\ ^00\0S lcY`, 0R(KDXY 8\\ $\KYXuqqqqqm p-L M`P 0(0P`0,P 4@0 0 0 2400 PPKpYmDqo - /[WxWp$[hW`[X[Z D[u|rmm&B(rrqm@rrXrrrrq -L`M0xpKP `(0 a :P @@.PP @|K< a|\ ( 0 R$K|K< L|\< A|wus n -LMPp`Ip@ $ K P Ep $0d0 K,0 0 (` rKvEp }ZK0 Z   09WZsB$B (sHs -LM@0EK ,0 $! t@P}K0r 1 $1A 1 1\1L1\.K1L?EP, 0Rk(K0H KH0 D@ @@ <@ 8@ 4@ 0@ *Ep] 40S`DP K(.0h K0 ` EpB Z xK7P,|0S)@B_K|0@S"p  .0 1 ` @ Dp K \1RDp`> Q NKZP!R (K06`Ksj@K 6K $宭(K0SL1S, $    dT0KK $嘭@1s s |4 R RKB/Kp8@C^ NKj@K6K B?K<K @娘<1S01 ^`rKp ,ß01 1 a 1 Cp 1S      |  M @1CSR NK0l3 Rz B/K,8X#(KT0( KH#(KFpK4#7h1[S] V@KZK 9 1[SO PKbK 1  B?KjKKpK2 RQ<1`S!t0 S! 5LŸ, 0R(Kx 1K d"@1CSNK0BK@<"<240,($ bFbDaBa@a>a C0@3S3 x  ؅ ̅ D 4 $@}p$0cP1 @0P`T ,0K 3Ptp0 < R#@0U U U U0 @ 0@0 0@0 S3 {#0 @P`0L D0 q3 mt1 0K@0 T3R_ 0@S0<0 X 3,#S #8 @P`H K2H0@P`C2 ?0@P`:2@ P00@ S`4 / 00K@ p00S8#840 @"0 @L P `D "0 @P`P ! 0 @P`0P 80  @ ! 0 @P P `8 11 @0 8 6(K}VGLD VBP8 V0=Ep* q@ fAp@0 0/SVP 0@0 P4H RtSlSdH cVX SPSvsmvlzmmvmsB(svv w w -LMd`0@V,0  pܠK?PK@ * *@060#0@@T z    C  ) @@D0\0#0@@T ^    ' T, 0R(KܠK I@@K   p`u0n -LhMD` VZ, P@ , 0Re(K0Cs P  -VW 00p0 0  @x t l@ | TpK@PK|l <0 ( p@ t |x0  0pRZ h@K  0@B0D0  00#0Q Q V@1@# {-`V |  | d" E)0T0 P0 L0 H0 D0 h0 d0 `0 \0 X0 @0 <0 80 40 00 zuP@G@DAꎎ< @ dS@0SO ᒣPG}00L QP4$, x1ϠA/ 0(@@lN#b 8K80 4 0@ , 5GP SP    S D剔P D @0-SL0S  1<@@  l0 R \ՓD,Гr <̓MbxxtxdxPx x -LnMxoKH0H`,0 pHP%L3Q PP03 R;$3 RAᅕP, 0R(Kߍ0S  ሓდ6: Sl KAAHP 6: S PPv6: Sm nOP, ("OP KAAP;KU2 [1 R |A@qS Px5S0: KP`렑0SQA00CS0P0P0 Pp 0S0P!0CS030 Pp0yUYUw {aNK@D@DនP! KrSPKP}c g^Y GP|^p|JL@PPux8u4xttxxHwx -GML Mp2 P@, X".xp fP. iP% ,"#xp 2 PbaU5&2IKpJQAA8P4: S X1 11 1tBKAA + P: DNdV+$ `0V/S /004`04 X p5 p@/:PP 0PST @T 0/S 0/S @TP(+0 S`K|pHX  &lPpzuXesx@-0@S00-\Q\ 0 00L S0 ^!00 000C\0LQ0c0 -LQNy -LM0@S K( {p 0 Q -LM0@SKP  00  -0LS@0s30 RP 0s3 -0LS@ hѼϼ -L@P 0GQ 0-LPx@P P 0003Q 0- L0@T) 0P0Q 0S =S 0S <Q >Q !Q0 0l0 \0 0XPP <0 e 0,0 00 0 0 0  y 0-\PL0S S0@ S 00@0)  -LNM`0\(0 0P S:NKXT1*D1S8 @1Ho@RPr0P Sv` -qP V?KOdP 4P=@hF@( 0R$KP.@JOK <H #M0uy -Lp` Q( T &@T TT$PP P T0 &LL0yHy -Lp` T0 0 00b00@T TPP P L0y -LM넃`p@T T T TT T$KPPc (KP^ 0D S괣 Ȣ Ȣ Ȣ Ȣ Ȣ Ȣ Ȣ Ȣ P  $ (0Rpprp{`$ (0Rppecn`$ (0RppXVa`$ (0pRpLJU`$ (0Rpp?=H`$ (0Rpp20;`0D S񟗯H  Ȣ Ȣ Ȣ Ȣ Ȣ Ȣ Ȣ Ȣ t @ QC `dDCPpp `V6CpPp`I)CPpp`;C`/Cppp3`" K p-L|`P0S @PP 0PS p p-LT`@0S PwP 0@S p 0-@PLTlPX0H0@ R0S(OFZ׉a ! -0L ]G<8u\y-0 CR 0R0 S}y00 -PTL8Mp`@MPP NP@":tpp3&@pK0K`< , K00 @` %@P,00,0 嚽PP K , ="0< ,0 0 @@%P \LNXK R&pL0T PR0T0 T0@`5K,0T@X >\P <\00S \ 0   \PPk;40[S  5[0Sl|xt ᜍ`@L0VU D00S8 W $x(Klzyyyyxtt -0L ア<8uy -0LAM @Pp  sp sPp  sp0` fRAT &APTNKAPP WɈ.yPPMMu$szz -LMp@# 04 4x8#Ȱ, ච P @0P#00 0P00S 0@PU*0 "4b*4# < 0  Bf 0nPP?P; @0,K,3K 0$4R SR8 @ 0MPP{Pw 4#0S@ *`4# Z&83 0` 0# 0# <0#0bSJT:YU @34S00 @#RFl1@  >P1KoKK˟K0p`P 8 1@ P,K@T00L S 0r03.\0SRU  HP,U0p `PJ\0 T 000  ,0  ,0 S(o(Kux~Lzz -|1LAMt.0pd( <>PpI@CBNK@D @D  -4[S2  -bS fS! 㱻PP Ƞ 0&P  @߷TNI@P`V 0S@BKJ H J` (0 S$Ku~\z,z -BML M2.0x, =Pp I@BNK@D @D  14[Sr mbS fS`ZZ  Z0 B1!QR&x P 0  !84^<!84V<@lt!84L <@DDH!84@PP& Ƞ 0PJ -@BT  00P00S  H@PpW H$0S@ B>K0CCK`I 0C I`FpH4  ,0 S,S(Ku~\z`zxzzzK0C P㈑ 0C B`<4 @$ Cl bS fS93@P4 Ƞ@ 0哼P@$ 0PP!   0 X 8$0  0 0 p0   *P`VU<$0S ,0 S4(Ku~x~z {({\zz -tL M.0p`8p`X X   #00ˁ`/00 2 .PኻPp@00D S/0PU0 E&0S.S'  Pt2 ` ՔlB,sPbX"X<,0 @P P0 ,K("2P{.U R0t 2000D :P 1 0:T,PU0R.S%  DlP0`0Q`A,0D1L!L`P@P P@u  0D:U .U 0@K  00[S `P0K$ bS fSε@P Ƞ 0CP  0{`T`PUV 0S(K~x~H\ v\zt 0-.L0@\8Pp0h,0  P0h0~G-M  T 0 (0@,@ P 0P`p4`08@T` $0<@P<0  0(,@4g0  .,@P(8P 0 0<fP \  .,0 "f.,@ 0 @P<4( 080@ `p(0, 48D`(P,`4Lp8pHPX`P@0 @! 0@!0Q1@`P@!@0`!!LP0hH. .pI$HPD0&E$ H`D0#j0 0 0#j 0P%@@X@ @^0LP@D PpX` DHL@PPTP00 `0 00D0 00H000 000@000 PL`000$P0 00Ѝ4{ -LM@ D1>?  08^P0Q8 n< ?^Q@ n< 0<P@ < 8 &<P8 < <0P0D0#<00 , D04 #880 @0D#\#.pT.l0[#4<8[0@0 @P劐pP0(Ko 0-PL@U  0#<00#800#400 R0 0h0 -RL`? D@A1>?0( @PcXPp: @0!0@@0D@e@0!0@@0D@~@00 @@0D@@H@?X X  P@0!0@@0D@ 0-PPL 80P ~@0@0D@04| P$S0SX} -L0MpQ`N 0S SI0SSSD CA$K0P $0S("(04"48#H~0"S* 0' R@ R@@HPK -4 K0p ,@X 0S S00@ Kll -0L@ `pWPP P   0 0 00000   -0L"@ eP  -L4Mp! 00`( <0 PP0C@P, 8 KIP 0R R@8 KP<   7@P <@PX0K0S<0@0 @<P +@ (0 S ^$KuT| -PL M.4 0450 ɲpP 1` _ p@ @>l1@`QP0000,0 8 p0 0 `P(00 ֹ`P0  ֮., 0P 0 04"48#80@T4ZYT0 Y  Y  00 ᫮`᧮ `(K~x~ p-ML M0@P0`. 4p0$ AK@T@  r PP 0@ K4P.SD@ 0pp @X PT0  AK@@J 0 S Kpu~x~Td| -LMZK0MH$ KP(@, @@ TZ Z ZuK p04"48S- K [K K(PEPE: `4e 0岾@PP ZZ:K Z [K(PEPEP 2KTTZKK K(L(NCKA 04'ăPN 4@@4 A$$0B40TKK i 0`PP ᴿP:K4P:KT@`PUp @ZKTUZ3V+K4ß 7`PK势P K KKDPUU@*K$0*K4:K  oKⰔ ~ZVV Q VOV VlK @P ZKŸ%4" 7V00W0S0V00W0S)V <K <0S80S40s :K4S ZK0ⰔKPV P@$*K w:K4PZKTZKK\ K0S K4K@Q *K$0*K4:K4PCu:KT T0#03\0SK^  KP K0  =K(0C*K0C$=K(0CZK0C$S=K(0C0C H0 <0K   ,0 S(Ku}}x~x| -!ML0Md KJKZK(@(@, @,1 K(K(N.(N0 (K0000 0000Pp[ T: 0S?0S<0S90S6075"0"S2 `V &@>0Sp(@\ 0S V Q R \S  R]K(PE(PE0s3SS S00S K(LL@^00K(pPK(LLKK](N(LJKN(LPMK(@DK$A K(LZKL`JK$ZK(PEPQ@LK$A LApPDLQ PQ @ EPP@(`F@ZKL P 0 PK R 0 R QK R 0 R Q0P@S K0S0 0SK 0S 0Y3*K$! IPz0S@:K(PP JK0  @Pg ZK( pPK$@q Tm jK(pPbpP^ 0 K$S@0JK(!  %PPZK(!0 pF XP0 0ipK(!0 pPK$P, -0S'0@S 0S 00SS  00S SPKP0 3*K40S (&PU "pW:K$1S JK$A0SZK$1KK K@T =K(0C0C0SYpl8(K0ppZK400Q\_K P 0V P RR:KJK01@   Q 0G Q \CPRK0 K0 0S K 0S 0.0x0*K(0PppZK8D KK 8 &$7(K0SK8  0P*K QbS fS?@ :K< ZK @=`PƟ0P0 5KPr*KpFQ00ZK0Q R* R. RK0`S 00 0:KL?1 0 @?Rp0@`P@Pl@  .@@P?0S@@:  eo -0L M0P@ 0 (`K  ! @Tx ~op` 0 P Qn/B(K 0 SKu@~4~8~ 0-PL@U !1 1 !320Q\ 0h 0 -@LP [00( -@LI'hF'$ -4@LP ͼP( VD~ 0-L@(*'P0P@ P#'0$< -LM8 Y< pP pp4 2n vP!P20S002 oPP 20S00#30#op3Pq o0k,`  P00CS00 Ӥ0R R r ,Kpt80SWS #P<,Kt0,Kt@P 0K @`00S p00RQW00S < P,0S  ω R ,0,SP SS SP00P,00,0 00qo04  0(K(xt p-LM@d`Pe&P@ 0  =,0@0S T&TKp$< rS-@L`P"@3::op 0P@/o@-op p-LM@d`P)&P@  0  ,0@0S &TKp$< rS-@L`P"@3:np 0P@n@np 0-@LP 00%,@r.0 % 0hs,$ 0-@LP 00%,@r.0 % 0h,$ p-LM 0`|%0tr.@l%PX%\00SiP  0`P@%Kp,$( 0-P,`LH(KLpW g ( $ G 8 0 Pl lPl (K0@|0@00i^K@PEPE FKDF Lv `V XF \F bKAe.K  Bm>K' 0C'cKKI7 A7嘗  B 0C⌗' '7 7I L@A BtW lG 北   ' D7 TG p䌟DGFoK46@%S@D  0PPD T `TOJl10lVJt`\&X6 R0X6 \& t |'P2jKt l' l' U]K0@ PE@7 DG p7 < -6K.6KDD @G 0IZS . hA hA . hA hA hA - hA hA . / hA / / hA 0 1 1 1 1 1 1 1 1 1 hA hA hA hA hA hA hA 3 hA hA X2 5 . 85 hA hA hA hA t1 hA hA ; hA hA hA hA hA 8= hA hA > hA hA hA hA hA hA hA hA 3 hA 2 d2 5 . 85 1 d2 1 hA 1 hA 09 ; X< 1 hA < 1 D= hA hA . hA 2 d Dg@TL -6[S -&Kp704 Tʔ1cR@`00C Q$SD6SL'0D D6`SAp@G @ Dg S @ @  p@'R[R} b@' p70p7 S+-KPD0*SD `@ D7@5Tfʔ1cRb@`00C Q$SD6SL'0D D6`S !pDg S!   p/<' Pȟ T;ʔ1iDR05S@0I QD7 $Y @Q@dB40K-0C+0S T30Ks>K0C` 00 0f P@s>K0C0 F2K F00LQ : dw4 KEWeW0020K000 <40K cY`' Pp0P7 ; PP 7<'QPPRp7 pp p' p7  D6S1 `> `:pp p  D6S!p@ D6S 18#X `P `p'D6  SQ`P`  S 1P` 0 P` D6S10P`P`l3L7 x0  .6KDP㊡H H   H3<\QH <' PH' `:pp p'  D6S!p7@ D6S 18#X `P `pD6  SQ`P`  S 1P` 0 P` VhL p p  D6S1 `> `:p'p7 p  D6S!p@ D6S 18#X `P `pD6  SQ`P`  S 1P` 0 P`pw 0  .K 0-6K<<Yp0̣p 0Q04 KH' I R 4K2H 5 :R3 7A0  `P`H p+ 0R000`H & 0"0 0dP`V U00 DH' 0D40KH7 Lw %2 H>&B lP`H H40KP`dU<P ھY 0 K☐K-6KP7 H' P-6[PwWpS.6[pSp7p0x7 1@ @gT㰘`*tH\&X6 R0X6 \& t |PjKt @DT 0t@\&X6 R0X6 \& t |Pj.Kt' -6[S b>Kt0C0C000\& X6R0X6 \& t |PjKt .6[S b>Kt0C0C0 /&K000\&X6 R0X6 \& t |~PjKt x'R1@7@gT``*tH\&X6 R0X6 \& t |aPljKt @DT 0t@\&X6 R0X6 \& t |IPTj.Kt' P7@eT(`*tH\&X6 R0X6 \& t |/P:jKt @DT 0t@\&X6 R0X6 \& t |P"j.Kt' p7 HtP\&X6 0RX6 \& -|P jKt dQ-<6Sit'\<000\& X6R0X6 t7\& 0t7 |PjKt <\p t00h' \& X6R0X6 \& t |Pj>Kt7 <6@cT0mP*t(\&X6 R0X6 \& t |PjKt @DT0t`@\&X6 R0X6 \& t |PjKt <'<6 <' o@6H\G0iT@Tt@\&X6 R0X6 \& t |tPjKt \?@cTnP+t'(\&X6 0RX6 t7\& 0t7 |XPcjKt @DT0t`@\&X6 R0X6 \& t |@PKjKt H'<\7Q H' p t00h\& X6R0X6 \& t | P+jKt @6H'K0C0CP H'00$ ,0 lS(Kmnu~ -DpL0`S@PP 0@SPxtQRP000S0 -LM0p (0 PPUoK0K/wKP@'L1[S  ݨ0P,KKL1 H1 D1 @1 <1 81 41 01 ,K0 dW /K/{wKP@ y$( 0R$K Fu@8 -aMLM䢟0(0 P|P: p@4 [nK=K`F0C0`F+ -K$0K B B0T5 u\e E 0p 4o/K*Ps1$2$ K0SPd20S#$cKAAwPb06: S"  S XH( 0R\$KWP[nK`F`Fl!l1|xI$0K@@uTaD[nK`F`F+u8$ K@@uTaD@P^0S &$ K0uC@PX .d>NX |7NX #X @d8冕0duwd edA\vP -L@P p 8'5'2'T#at -LMPp+^00!1 /8 Z@P +`Y10(KyP`" +XTp` 0,@ ,0 Z,0 04 K4@ 0@ ,0 4 0 5p@;#]0`0]0Sv]0S8 0pw P*xO` a8Td \0pw P*4=`]?00]?00 Vwd 4v( -LM@  K K0K  @@PK 0-LP@)P P 00.S0a C00C SRQ0 -MLM, P P@:e]?000!dr, 0Rf(KA弹`P0B~KpG@DpG (K0 dAT`PH dvP1 @4墹P $坹P 00+4Lι P*:(]?00 0'r-,P   P ]0S 0x rS]0S `H 0r 000 q$uLXd N|h< -LM8 < @ zpPP4K;  @P1 4 D0 S 0C0 lPP) 4 :40  @#P000S ,K( `P  >P@ 0 q Ψ@PU(K @P& 00S0 KdP 0 R ;;R d x@P 8P0< @00 gP@X VdvL[ -LM< ~ 4  0 `~ 0  -^00+^   Sc P`X-^00+^  P00N.^  .^ Sp4 8 4 R;040 P 00E.U  .U SR40EQ7 Q  A1!O  4  4 P P 0O(,  p^#< [00 (KR P`800S80 o A1!O p p1  0^0 QQ \["00`_p L1  0@!100 , 0 K @ QP` /  06V4A4 ,00 R2"40`S S  0P4Z`000,0 <0   U]["00zp4 Z vv -L M4 0 0?O4K#$XY8  0OO$ !5BE;t  +["0 0(Kr \B 1W2\ , ~  0   @P04K 4 0 0@aQP#o` P`0OO${p' YHZ0 Rr04K@4 0 , 4 00@G ,00|03P 1 0 Z@0\A04K@4 0 ,H!4004!8t V0 r/, 40 0 8kt t4cQ4K 0=4 0  8` _Y04K@ 4 0 40ds04K@ 4 0 꼀$ -LMȠ0`p  (0 PPqKu P ( 0R$KUOK -) SK)),KK%),KK/*KP cKRu<4 -LM@  K K0K  @@PKR-A ^ QQ 0SL\* -L@ßSM 08@ p040 < @ 0@ Z0,K00<PP3 ,QW 0U*@@0S 0S Pa ,@0SQ  E04 SA, QP 0 ST 8 `q`3R`V2 X 00Y00S! 80S  P 8@ R 8Y=   0R Y5   R0080 @\08(K00Ẍ@P@ 0 , 0,08@ 0 `8eQ\,  IP,,A, \ W04@ T@0 Y@0 W 40 S Y@Q  R88@ J p-LM`0`@K KKK`K UPP +0 000Kp -0L: ATP -$0LM KTP -ML M␢0匒`,0 ZPplpP 0/Sg TPk BNK@D@D+BNK@D@D+J^KPEPE D 0S :S S000S S:S  0SA0W0 0S /SIBK@@P 0T ^X@PV00SV00S040 t, 0R=(K0P j0+V:`P 0SPBNK@D@D+F?P 0S BNK@D@Dt+7UP೰BNK@DD@D04 r P: puXx`h(P P-L 3 c@pP 0S %S@ ß V *00SS@f| Tt0%0CMS(o k k k k k Lm k k Tm k k k n Xn k k k k k k k k k k o k k k n k n k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k m k k k k n k k k k n k k k n 0PUUwWx 2 Q_ PP U W1 S PP U V*PpgWP Pm Ux cUh Vz*p!?A1c000 Vr*P!?A1c!000c000 Vd*!?2c!  000Pb`*`(P;/".000bPE4p P10/A!b000c"P&0 U0@@P@ V0*%00" U,0 R@EXz8b\zgfffQ p-PL`( 00@ SP$.P1 *PP @PU 0B8 S8 7@PڈP@Tp1  0B00@ S!0.PP00@ S 00@ S00EP`zbz L"-L@Ÿ  RP`@ j QuN:R^0Cʠ &   B b< 0`C46H&0/p0/Ơ@ Q a@ p Ђ0T/`P@^0SR S PP n B2c `@0 T/ 0:56!ǠP `Uv00p   09 0P`10 Q 0 0P` -QąL@P$ML@ HP @PD SUp`=TKTA*T 006P%0\! 0aa9s& x'x )8HR@J*RJ@@bP 8#8R0PE*RPE 0U0D L H0 RLK p(KT`V:4V006$0\0@f(&x80 2 *j 0j7C93&x40 < < 4@($8HRR[R0:4R005%0\, 0l\9c%x'x )8HR@J*RJ@@b` 8#8R0`F*R`F 0SS:4\00< $ࠃࠓ0^,  VY0!#*0H D0 HK(KRPU:4U005|#0\@e(%x8 2 *Z 0j6C93%x40 < < (4!8HR<0@0C<0 :@b`o48#8R`F:@b< h8` mY )8HR@J*RJ@@bZ`F 8#8R0`F*R`F80 S00<!ࠃ ࠓ0^, q ,0,p# 0c5'6C93( 00 / @ x@ 'x0!8H,0RS@@A@ >:@b  `0p8#8R`F(:@ b.Ƞ%8 8"H 8R:,00T00S+ N0(U 006R 00R`FRA@@ R`F]R0C@<0 FwR0@-@P l^0,00 nSBS\N_0 0- L@0@PP $0q0l0A -@`p0 0V@TL  0x@P 0sP 0@0 <0@ `P @0`p?A -Q؅L@P,MT@ PP @PL S0 KUH `pJTzT:4T006X%0\, 0ll9s& < <X%X &)8HX@*X@@h *  8#88U0*U0H0eP < 31P T0 T0KL0PS0KUT P TK0 , L0S 0Kp0 , (KU:4U00<#ࠃࠓ0^ WY:Y pH R T Pp PT0KT`VW:4V006T#0\@f< (&x( <0 0&E@-/@d4xB 02d @-M)Ѝ@4=> 0  ̂ -L 0KM# -LMK  K;P K -LMK  K.P K -QL M@ K0 0#0  W0p03T0S00#0K -@@L0MP 0 0 D 03000 K( K7P(KN00dz88* -RL p@@@pT `v%  P DP 0AS2 0SQ0S 0S .P 0S0 .SQ00Q0S 2 0S .PQ00áP2@-@T   0000S  0P0S  0 RR00ӡ? 2 -LMp0 S( @0 ( 0R$KP !ᥠZP2`P8@KE X`PE u܂ -PRL@`pP@ 00PPPPPP p- @0PSL`R p0S 00   10 0pQ)03 0 00  Pꄖ Ė ̖ Ԗ ܖ xtplhd`\XTPLHD@< dd<lL0$W*\Q0@-P0@  % < ^9t | | | | | | Ě  4 < | | | | | | | | | | | | | | | | | | X ^@7!10# ^00S10# ^00S3 @\^` 000  RE C ;@\00M00q 2  0  ^0^0@0C@0@000*^?^: :!20# ^00S  0D ^Sp 1  0~ ?^*^ #^[^\00!0 !@00 00 0000@@000[^#^ s @1  0y0\  @  0\  @  }\00 L0 R,0C@000ĕ@p0\  @  i0\  @  b0\  @  [0\  @  T0\  @  M0\  @  F0-  @@ v p-0LQ`P @0 Qf`00p R-Lp`P@@D 0T0C 000jR -LM8  Bp`4 -PK 0e@YX: fp`WGQ< L VJ*\Q  Q *Q?Q< [Q#Q9 q! X1  0 *10# Q00S10# Q00S @\Q @Y7@*20# Q00S  0A QSq 0  0  @80S00Y*<Q @-PK0 B0eS`40c(K@ v * -@LP 00 p-LpMP@T ? KpdKc`P P L0  0: S RKO0 0 P L V -AMLM0唣,0  孕@P |ۙ`PW B^KPE PE` XsP 0#S 8 (  P @ @@P BnK`F`F0 P0DT P 0 Pڛ04SBNK@D@D +D @P xPO B^KPE PE  qP 0#S   P@ %P~  @1P Po BnK`F`F0 `力0DT`  PZ 0 P{04SQ%`P& `P `P `ަP `ئPX `ޔ@P00, 0R(KT` <|uTd4$ĄȄk\hnd 0-L@P0PP 堦P0 0-L@P0PP 勦P0 -80L R PP P@- ^ 0S^@0 S 0SS00@0DP0  -QLM@<0 zR| s~P8  h0 p 0Q `pY:%o$<0P  0Q0` pY*0@0 0Q"0h 4 ,0 @ 4 080 R@4 0 R0PI@Y :&D! 0 R0P@Y*U p P8 @<0P  0 R0U p 800 R4, Y4 8?z (KUI0 0@< PpPp< P@`//F *B *> *yy9 * --L]MpP@M?KC/KK `1 `4Q 0Q cl0 K A A @L0 Kl1 | LQ 8A P 0RK uħ ̄vv * 0J -0PLM 0 K0K0 P  K * p-L`HPPp@ @ IP T  0RpH0S p( t== *ii * P-L `hJH00:: * -0L MK , K0 0 0 P 0S$$$  K *SS~ * -LM KPwt@G-Q M 0@90P@Pe1A 00.b q($?P @RJ: 02!!b?P J$0  \0 @Z) 0 0 0 0 00 R0P P:02.2"!0Z  01%3 0 =00@T* 00 Ѝ =00ꫪԄ -LPp@Q qP <2  0=QK bP Tȭ l W6Q@T W@W @W@ X*0f1@0 Z0 fB10# @  Z0 fB2"0 Z0 f00Tꐭ  =QQ q 0  0s 0 0SW 0S Q q D0  0q 0 0PS vԄ 0-LM4P [[@[0[ P@`K07 * 0-@PL PU0. @ 0 @T *0P/S 0/S BT:R T*0RB/S T*0p/S0Pa U*T@ i000/U$0 @P F@?00 -L M0 0b. K @b2b 9n0n GϠ*""*jj*++* Y - LMK0 @ @ pK..* -p-LMP0U0  @ 0 I`0Q a0y`PU 0  Kp` 0Pd /` ,K K$0K@( $@ P, PPP 00<n77R*N* J*))F*B*>*:* -QL0 M4 0 0R000(K00* 4JPP- 0 P0S p`@tP `@ mP$ pW21C0 R4Q  000W |JPP(KY  0W0021C0 R 4 R 4 0W00l p- LPx@P` x`P T,03040S000 R   R0 \00pp** -LMpxa`P 0SLXQ0LL!PM_P00P00@$K(K 'P (0 RP@Pʐ T%5LP0SMR kR mR gRPAx5GR KR R P5L(P8PK,PF긇H܇ćm1*-*uu)*%%*% * -LM Q00    K  K  10BS)000C 00S 0 0S0 00Q:  -0L)S@P 010CSQ   1 0Q:`pV`` W0S P`P```00 p-0L)S@ p010CSQ   1 0Q:P`UV P pP 00p P  Q10C 0   Q-L@pRPPX`VP V V P `0 B  d00GPP00 Q-LPpR`@@, P 0S @V000 B  e00 0-PL @v0 0-PL @k0 -LR0L0@@PT@ lR0  0 R B0 0 " -LXpP`@@ R0DTST0S: 0 P` @UTW YPP Y I00 P0 0 0QQ00 A00  -PBRU`L@0R Vp Wp00jG d00`@`p P j0@0@@b00P0PjQ0PE0P -pBRWL@`0R XP UP00j d00`@000 R0pp00P   j0@@@b00uP0PjQ0PE0Pbb **** -L8M4\( p& < R R S @oWP  ᣺( 0R'$KR Z@K2 ᕺ|PU`@ PU PZ@K024 u\Z@K2 o\@yuntXh99* R  #R , R R R  R "R, \\R0 0 R00A0"S0 0D0  0 S S S0 0 0A -,@LP ]00  -4@LP ֎P  V - TL0S D 囌P  YP q 3  00 qQ#Q cs0 0n0@S0000 0PU L るP q 3  0 00 0y pP q 2  0 00 0g ^P q 2  0 00 0U LP q H2  0 00 0C< :P q 2  0 00 01 (P q 1  0 00 0 P q p1  0 0 0 0 p P =Q ᦨPP@Um0#S+ #U) @0PS0 㐨P  000 0 R r 00CS0ȫ Q#Q 0P  0 S S 0@S0+ @( ( vlr̈ ؆ 0-LP@P vP0 -LKM䡟0TK(0 p@8P4K@P/0j VXW"( 0RV$Kx Yl 0@PP 0l Kh0 0d `0 l` 0dK\ K @P X 0GR8"@7@P YP 0R 0GR  SKXPP L1R H1RB7>7:7,w\uv0$ 0-TLPA/H0P@ @A/kPP0o@@P0@-0PgS6 -S@ XS4 +S6 0oS6 uS= # @ @030 010 000 T 0301000gS80 400S 0 00 I@@-gQ@ oQ uQ =Q! /+Q -Q"\00  00  00 0 +T -T =T000`0R0- 0+\ 00XQ000000 -L$M@`T?0 0(K4@K00K 00 APA rP8 P00H S 8P p0P< 30D0 a0H@SX x x x x x p x x x x x x x \ x x x x x H Z@ =XR@0=X0 W@0 :<⌑ < r`P 0e0 F pP8 0D FpH R W:<00⃁<0 r`P 0e0 FpP8H0XD *pX ,X +X -X=X>@ =X @ D0H0 @D 0X0C S񟗦8 h h h h h h h h h h h h h h h h h h h h h h h \ h P I@D0S 0 Ď@D D R  @꒠@I@Z W:<  ₑ < %r`Po 0e0 F pP8 0D p=X @ " H+X00\0S W:<  ₑ < q`PI 0e0 F pP8D H0X pH W:<00⃑ <0 q`P. 0e0 F pP8D 0w@p_I @H [D '-D DD D0C>0D0 DΌD ` So  ,K.,0P R>0SK Bo\>"0 0`0+S -SXS S P0`+S0 -S0   +S0   XS00P^ -0 0 `Q +0 0 `\ X0 0 ` W@1 :`Pq@Ppn C808 =0 08n=0 01 xz!!* --LM0 0 -H0@L`P8 4T  < -W<8u\\*;;* -Hp`LP1@P 0S 0S0S hz -|pPL@P UP 0P `LP P@P0S hz -LMr0Sn (K 墉Pn ( 0 S RL0L(  S*A (0`` #R᠁P 0P`PP`ŅxP @`0 S S0 S S 8 P= 00Pv1U00 0@7 0S` 4ՋP 00@T 0S S SPP@ 0V*@PPąp庋P\00\\姉P;,0 000T` T0@ V -(@LP 00 0 hz 0-LP@LP 4 0000$$n 0000hz@ VE-,1M p 0R  ``XRxR `R,! B00BP@ S0A Vr 0D A0a00c BR,! 00BP@0jC R17 1RЍ.R0X r 0 v -PLM@` m<0 0$KP0K(K 00 , PPUp VT(0 (ppP  0 PP@p  "m;<@m7< @=* p-0LM@P0 ' 0S$ =S" 0 S =SSRPd`K P X0 ! 0S0 P x; 00xTy -LM0@ =SS=S$  0=SS=SP$Pd$`K {P! q$0 A$  oP $0 1 0S0 aP ;0 0p R`  0S0a`LnPP  0(pS PP@0 0 Ty -L M0`S=S00, p@P 0S=SPf, KPA ,0T00@K00 (K P 00 1 0S0 P,@PoP 1 ,0Q! =Q =S 0S0=000S0ꐀ R4   0S0aC140 P bn@P < 0S  0@ @4 ,  Ty -L@$ @P0 @n -pLP@Tx` 4P00 @ƥT R<",:J n 0-`L! 0TP:!@PP@T 0:P00* *- 0-Y+ ̌!00@  0 --LM0 0 -L@Pp:\0` TT嗏T  88 $0  冏pT<8u< -LM0 ! K ?0-Pp1@ LR` 0S VP P@ 0S@D0S00Z0 S ?0-Pp1@ LR` 0S wP P@ ۱0S@D0S00Z0 S   ]]*傟3*3IϠ$*0 ! -LMşR!  ,   e! e 0@A0!S1S UK  xş@K0 K0 X0 T0 P0 H0 D0 @0 <0 80 40 00 0 0 |0 t0 p0 l0 h0 d0 `0 \0 0 x L  K K,K  K K K K KQX0K1   @0PC⅀K  QPp0[ Q- Q+ T*00K[q 3  0  Q#00ӑK[ Q #00 ӑ K[  ~QPp 00-9L0l XKK, PHK K K K K |K xK tK pK lY=P@@!T 1S 9:T04@P!TU!X}w Q (Ÿ, 0 R(K  Kp80SX0S Ip !RK   B X K! N 9 ?0KK1 PXK L00L0 60[X KS060KI0@K0 1 K0 0  K K,K  K K K K Ke8~b80 A 0{]80  0u {ou vvs!P 0t p-L0M`0@0 P HK@00@0 H KQ Q Q )800 0R Kp0a$]Y7out,t,t,` p-LMP4K@1 K70! K,@ (8p`( P  K0 4K(TP$K@ < ` Kv$Kp K lTyԲ: Sb00 ^ Sl00  Ss00  Sv ?00 r0-000w0-000!=@Sx00 > SS00 ! SS r0-0t!00w0-0 00Rx00 # RS00 ,1R8 r0-0!00w0-0 00Rx00 - RT00 0R 0 0 R-00S-00 Sc00  Sd00  Sp00t00 00 s00s00R-00 00 -00ddA*KK=*9*oo4* /*zz+*R0S 0S0S0  R00ZZ*''* -QLMP* 1 R@J 0R% 10CR 0ZS Y0s30ZS U  P 0@S  P pZW @0`T00S,0 @0PT 0T 0R W`@|0PT,0VW:0S`#P @0 SP4 10P`P?!]:-n0P P000P R* -`LP p0W 1@PPP@FgUBg00Q R @1@S 4g R.g00 -LM`qpP r 0@r   t00 ( pDW PAbRP P g 0  R 0S 0f U@R f00P=  t!, CiPc 0Sa 0 0 0S0 g@00jPP  dPk0 0Q 0@0A   0, 0STU f0 0 ,iP% 0S4 U, 0p 0  R=*@0p@NjP  00p  001 0  g0S S1J0 R0(Z0 0Q0S S1J0 R0)Zz5 @mZf ir50 0d -ML M, p   `\2 /\ P0 C\/\@@  0 V*@pğ, 0R(KRm/\ pP0V:p//\ V:0BNK@D@D+PK 0@ ~KpGpG(PU> 0  0S00 0 0X/S 8: S S 000 (0@NK@D@D+hP( 0S B^KPEPE+\P@4P 0@X@4@0SNK@D@D`+㔬 0@{ $ Q 0@@  2( 8 P- 0  0 S00i* .RM XO*R  VI0S0ZC* P  J0  @P 0@3 +,k~KpGpGMPV+Pg 0@2 ,P^8: SZ0S /0 0R0.S@@*|+ :4@/PP34@0/00xLu 1| -LM M:K0P~UK4  >KK0C*K080K₎KU, @H ?U@4 [U& *U00 PU5P(K R*K, Q 0 @ (K*K 08 <R 0 X4R 40PP!U00S !U[ @DP 0`$< 0 P`];P 44!Up0:0C0Pp00-S@= ]SH P`[U8#80@0:S0@ :P 0]Sß0i@T Q:0 RR0SS @T 0 8#8000 @-S@]Q 3 00p]S@ 0"< 0 Pc*K, 0b2 *gKLK*KA KKA(@4 0 PT*K, QK 0x :KK0 4 0D"0a1 0 0P[Up`]0:Sz  0  nK`F*PK*KV8`@W*0ST /SR  *K/S 0 R@ 0S00 R 4P* dP*K0 PP" V!* R, 0*K S C  0R0S0 U p0 (KPPK0P ]U@AV< S  **?[n-]:h -LM0@{SD {P T႞KI p KI0pPC0 P\ @ `{Q` }Q Q [Q]QQ 0  0]SSS@Q  C0(KV `F0}S0SU0[\ 4,\ T:P[\0]SS   0]SSST0*0VU  S:0S0  uPp00{\ }\V`F` -ML M`,pKP`@00 <R 0` K Qr q 10bQ KK @ @   \S0A0SɃ BA.0K^*0S A00  <0 Q  R ꄋ\@p 00  vp 00  v P Pp 00   vp 00  vp 00  vp 00  vp 00  vp 00  vp 00  vp 00  vp 00 D vP @ 80 R00CS000ၛꡛxtRR#*R0S0  RR B0 0Q0 0Q*__**A*aa*P0Po -$0L! 0-$@LPaPa$aPa0ha p-LM$`0PK@.0 ֐P ѐP 8岕,00SKp,0긋 -L8M$@ 0PR 0`00\pK@` 0` 0DKڐ 5P 0 \0 5X00S$K,K,0D0 \` X0 k5P  -LMpPW $K$`3S Sh 3S\ S S WS= S S S00> QS0PW @ SO V&Sv S1X 0PS DS S>400 2Qa A0B !>3 S >3 !>3 SQ!1XX 0PX >320  0P0PS "S>0!># R0\PSu0S qXn 0P0A >Q>30Q,  0P,  0,0 ES @J`@` 0p3PT 0Q @0 \ (K>3!>3 S,  0`,  0,0 FS0H P0>3@ P 1>3 @!>#"R@D0  @V 0 @b|zQ& .Qu,  0@,  0,0 DSP`J  0`tP 0 `7Q 0>#" 0c OHQ QD 0>#" 0c O0 @9G-Q` $P @>3 S Sw 1S S S @XSO <S S S0>#00 00@0S0   @XS xS S 0>00l0 S00Sl@@ S G&Sr S1Z0   @\ p!>3 S >3 !>3 S 0@00Z >320  0   @!1ZZv0   @"Sl 0>00 1>3 S`  00@0Sv @USQ0 S @MZI0   @h80Z @=3S` Sf NS >3Sp SC S S =S S0^Q>3S V + >320 " `0^j&S@ S0S  R r 0 _R 0S* Vr 0_R `(KS S V `0Sg 0 S0 0^20Sj 0S0V S ` RZ Q0V Sa R* Vr 0_R V* r V 0R`!>3!>3 S0^yS SZ Sh @>32@d00 _ 0 0 ,P `0~x00^N0r `|0 00^<00 V0C 0 >3 a 0c  P A>30 @C  1>3 SA 1>3@!>#"R@D 0  @P `+> 28 0qH D i @ < H  R4 V 4 0lS:@   aP 80P 1 0P 4 10 ` @>32@d,0 _ @ P 0 wPJ0,`0  0cP6>3d 0dS0 000`0r` V` v -L,Mp P@6Q >3S` Sf NS >3Sp SC S S =S S0^Q>3S V + >320 " `0^j&S@ S0S  R r 0 _R 0S* Vr 0_R `(KS S V `0Sg 0 S0 0^20Sj 0S0V S ` RZ Q0V Sa R* Vr 0_R V* r V 0R`!>3!>3 S0^yS SZ Sh @>32@d00 _ 0 0 ,P `0~x00^N0r `|0 00^<00 V0C 0 >3 a 0c  P A>30 @C  1>3 SA 1>3@!>#"R@D 0  @P `+> 28 0qH D i @ < H  R4 V 4 0lS:@   ᫽P 80P 1 0P 4 10 ` @>32@d,0 _ @ P 0 wPJ0,`0  0cP6>3d 0dS0 000`0r` V` v -LM`< 004 (@40 0P8 Q p0 0 AϠ0 @0 S0 0,, ,0  XPy  X| , p R@ ,0 S T  0  Ppg@TP2W  X* x| p00 00_X00So 000_X0S 2WX ,0 S sS 0 , 00_R00SHA?G0CSE@ 00S 80 ļ< ZP]  40 8, 40 P0 S,0,, ,0  XP00, ,@ Rp0 0 0Wpp@vp 0  PpP,  R r h  0, 00_R0P Sp X x $v0O0(K v -LMp S, TQR Q0 Q Q Q Q  \>0A >Q>30Q,  0P,  0,0 ES @J`@` 0p3PT 0Q @0 \ (K>3!>3 S,  0`,  0,0 FS0H P0>3@ P 1>3 @!>#"R@D0  @zV 0 @b|zQ& .Qu,  0b@,  0Z,0 DSP`J  0`NP 0 `7Q 0>#" 0c OHQ QD 0>#" 0c O0 @9 -LM 40 \  ?R(00 Sh 0 000 $   0  X 00 00_W00S1 000_W0S 8U  Y y 0  00_Y00SA?E0CS <80^  R@ 0p`  ` p(K x0`  `p`d \ |   0'00_\0Sp Y y  0 l0l't7Wpp@0 ,@8w\0\0tH 0S x P H0S `KH0H0   0PP ^u X0S `0D R X" 0@0 @`0D PH0S\0  LPD0S H  0aH E U 0 \PP 0 R HJP P( TH0`0`O/\ `PX`^  D0"P0@0@0@X`VUDPU<U" uXD L0SPXU H  R @T 0`   Y y   0#00_Y0SP W w ` 0 00@#3UPP` 0 ,@lS~\0y` \0z` lSH  v ^H0S `KH0H0  0 PP Q X0S `0D R X" 0@0 @`0D PH0SV LPD0Sp H  0*H E U 0 dPP 0 [ HP R8 TH0`0`O/\ +`PXp^  D0"P0@0@0@ ` \0  H 0XXpW TDP+)H0STH0X``0`O/ H Q ` H0SaTH0Xp`0`O/  H 0HeE v`0DWP`X M<S WD L0SaP_XS@O`0DWPpX # XSDS<SXSDS@0`0 R T`0 CR` X0 X0(p0R RXxtttH`0 CR` X0 X0p0R RXtpX 000 P@ 00ӑP 00ӑ vvs0 S000 p-`L^P%*00@ S!@ T  00@ S00S !000V0@CT  \00S p@ p@-0p@T` P 0 0  00a^0200C S  00C 00S 1>3 01 -L@ X 1:%\" \0PS0]S0phPU ` kP0S PUW kfp 0-L @\*0S:00[S.QPQ*0R0.S :06 \:00]S 0-0LSP@0 TP@  0h p-0LS@`P\ 0  !p0 -L M@ 0S-: @0 0 T4 `4\ Q| ?>   cP"T001 X   R!*0^SE ]S6 -S000 -00-0 -  R%*0]S PU-S [SY B PR*0-S' @ 000 T   R: 0Sk 4 0u 40@^Zq9  0$@TfJP0` t4 ]040 4@Q @0Q0 @(KoR-S M P0:S% =S0S0* 0-S]S =  000  R*0S*0=S " 0S0*p0-S]S P r dǟ00   r 00  PPg7@T ` iP0S? @T  R*0S*0:S  L0]S -00-0 -  S0҅>]S00:<0 iP  iP  000(K0P  000   P`0S  @  e᥾0 `R ើP ?S@P@ PP @ w spZ nQ j 0-S]S* b& ^ R|*u V R,*%PPSP 0!0RP 0T ^001  ^0 f 040 >00  0 R (KoO & 000Y 4 Y& ^J 0@ @ 000`000^Z040 40 0 0  0 0C0 4 40^ @ 0@QT 4 0@2000  T, 0*0,S  T R# ^x p0`P  R00!S  00 R0#SP0^V 0 @R4   bB"(Kot 4 $00 ]00]0 ]   R !*0P0]S Q*-P0@0 @P#:T0]S/00 0]Sp-P 000   PD {040 6 vho p-LM0K KP` 0 ^00K K0C B@0K K"P`x -LM0` @8P pw 0  0  0S04  4pP 0KP00K@ 0]0pK0K K@P v -`RL@Pp  0!Ά000 p-L`\P p@  A$0S0$0L0U0L0 P  1 e! B⼷ 0Ap -LP`@p0 S#T TW0 W000STTTTTTTTTTdUUTTTTTT(VDVhp`  f00   fH  f" ? B a  h5@0 fy  f*  f" ! B a   FpG`@  f0T  fh3@DpG`u,@D`o -LMP\@, *0^S) `.U ^*U Q*0*S  ^\S $U`\?* RP%*P U5 \U $ 4U* 4Uy p>E0CS<0pC!`H0S   H   0H0^p0 0D4\U0 SP,0X [UG JU0D  D D` V1 0  p R *0Q0\S \) j V1 0H  Y@R*0^0\S0)Sn ^i3UbVa Q\RXVR FN 0 M  J:  0 hd  h   h0X  h @70{S1 `R*0,Sa P 0b@QO* ^C0\S@0}S:= H  (00(000000,0XAo0)SX[  (00(0,00,0P0}S ^  R*0R\S ^  @Q*000C S\VP ){} - LMP,  ` R*@|T T  $0D XSa(`,^,^,^h_,^P_P_,^,^x`,^,^,^,^,^,^,^,^,^,^,^,^,^,^,^,^P_,^,^,^,^,^,^,^,^,^,^,^,^,^,^,^,^,^,^,^,^,^,^,^,^,^,^,^d``,^_,^,^,^,^,^,^,^,^,^,^,^,^,^,^,^,^,^,^,^,^,^,^,^,^,^,^,^,^^x^ R*000C S  R*@*0D?TS{T `} R :` VT RY*0|SV0, 0R0  i00 aCD0" 00 Q (00(0 ,00,0  R*0D  D D@ T1 0  R*0)S ) T1 0H   R*0)S  (00(0 00000vq 0@ Nh R*00[^\g000C Sc^f+Ti 6*T  R`**0A?QS{QO0\L000C SH N ` 0  fv  f'   f0j  f?T= {T3 @Q*0,S p 0w Rd:   000C S|Tp  +T   f0*  f 0  f  f  f<"  B a3  k  H 0  j 00 ,0 0}S00J0}S  \  R:, R (K0  a  i (Kox -0LMS@ `  PPa :tNP  0    LP   J (KwP00   | @ 0KpK H 0S0\P@40  ( , 0 < @ D P `8H@ K$00C 0 0R*K  0R: K 8 0A $00S0 00 ) LPP QP: (@#L D0 03 0Q  Rʠ    0S 00B\p0S=0 0S5 Q^`L0>#Rc [R R @0^@@R@P(@a MP<@ @Q  >3S \00QP(@F40 00 4 Q 0眀MQ @00BaVP 0R 0R0\000XyR R RL>310>#R R "R (@@(@0>3S  S S 0>3S +R@(@7\ BK88K K K* 0R:K "PPSEe -t0 LR  @T P0R000PeIPbIP_I<P\IhYIeE{* -L$Mp0`QP 0 " @@Kᵘ0#" 00 P 0@0$0 @0 <0 80 40 00 ,0 (0 0RKALP `^Ou`8 -LMX0@K`P$0 p ᚘ$ 0R K?OuD -MLMK@ , p p`ŘPB@F XN 0QMOKHHV !+ 90pP#  ]V'0OPU`@ +@ ph, 0R%(K U 0pP@ W@UVKAAp X4U0eʶW$N uP 0-@MPL 00}K0 -pa`LP @b`P` 0`YP0imV1P Uj!0\1 X -LM ßß0 4 , =80 p~P `hy @TT PPBT  `PӵPV 0Q0V0SyOPBTy3 2@ ZR00S0BSmRJ 80S R 0 0(K1 R 40:S  04S11    0:S:? RUp1 R 4 0:S XL1 ? (1 R 4 0:S  i`0 R0 R 40:S 0S 00   040C0 :R:?Q R,0 1X 000 <0 , 0L0sss̔ slz -LMR4 , 0 80  F0S0000s %0S40 -R 0S+R 5 0R0%0C00%5  `uPu` P@t  00 e00b 0 000$0S0 R#, `4V ]0 4A@-QPpU4W}P @t x$0s`U h$-Up 80Sb L 01S[ -Q V :Qr 44}Pm 048 0pPF 3#0廯40P -Ru44 v+Rs44 o-U30S5P(KLsL3PHu0 , @00*#@d00d00P00"0P@0̂0s02`p@P:U@30S0002 R 40:S xUp2P?P0Sv,r,"P(2u a  000 d0b01 s-U0S4|P 8 0R0WU0S0 0;S7 :S 0S000|D00 R@!0:S 0, 0R01 !1Q  40:S 0P40 :R:P?PV0 100 0 0L0S0,0Q0 x0h  Q 4 0:S010048 0P sspzlzssslst s -LM@@\K -LM@@QK -LM 0F K*7*7tt**$$*6*6PP**33*- 0L0 0 0 0 0 0 0 0 0 0 0 0 0 0 0  0\0 |* P-Lp g/00@P0PR I00@ SFHc @<{f P!00@T8Q 00A SpWI:/QQ@} .Q(%00A S"P00A S  X R b@|\{f P!00@ T#Q] 00A SP@000XSxS r 00 D W` @(00Q P+ )q' 000D"  Qp!00ӑ`A{dPF0V02`0 pW:00` r!1CVpG/Q Q@ X t0j1 TLW00j!Q 0T0<0S SS0j1P@@0a, 00  0D vvPd0 -LM 0hl봕8u -LM0 h`8u -LMdOKPp` <, P @, 0R2(KY  P 0S S) 0KK ,P00?@T00V: KK ▰ %0 0 X=J 00SKKLP @ 00S Su -CMLM`P@, pP, 0R(KQ#T$  Q  2 P@T$ T0S 0RU@X4 & aKII (3$C.K B B 0P L pK eT  匰  0h<8u-d0 R 0 CR 0 0;0R RJxt 0-0L@P 0S 0 R r 1S0C10 CR 0 00̦P  000R  R0h p-H`L0PS@ 0PSpxt 0-0 LR@P r 1S0C10    R 0 bR !0P0C0P0S 0 U00S P 0qP  yP 00P0P -LM0`0  P@t 0-T\ +T0@,0 ,  v 3VV0TS R0*p00D S t, (!000& W070 cV \Q00R00S!! "00@0T   p `,0\00S00aS \0E(K@ , 0XSxS@P `r v 0-L@Pp Pbp T U 0=0X Lp@ T 0w<{{*MϠ4*QQ* R-$L  00 P-L @y?T p- LRP 80S@@T@f?80 S`?$0``PPV?T?R?vP APf@b@p -$0L@@LP`pB0P@  @ᘧ0(`004$0H000D0H ᱫ 0- L<R@ P?00+?0 00fAPPP P? P -LpM$0@0PKDP  Y&P0  P# P 0  P00KP 00p ; 0 p`P 0`pH00.S, 040I0S H040. S  80S  80S,0Q00P0 00 p-LpM$P@PR`"KPP T@ @Kp0 0R P00, 0RfP `PP -0LS@P`#V0 P 0U`   L0\01000(@pPpP/>pp -L0M`X P |P X R] $ 0S X\ < T 8 P 0lP@$D @ P$00 S/RL 0/  0 P 08yZH , a , phL H 4 #&PP2 $0 0.S  @P W8  00X$0D R <0S   P 00,0S00L,@ @HL@ H %PP m40S  R H0Q00c 00 R,  Q00c 000S0 80HS$0 0H RS000C00 000@P X H0SR H R 0H SR,(KP X4 00@R@P cT <  @ D 8 O 080 P 0PB TP303^ D $@ 6<0SI 8\ P PA$0H00c (< Re0@8PS B< ^pP R $0 0  4 4 08 ph 00X$05<,{ P0$0:, $0 ?00$0 0H00( 0S 040. S  @P P,S P #$0:, $0 PZ0( 0 0Hw0@0 <0 $D0 T0 P80S$$0<P8 P0$0:, $07,(Ko7 P 00QT0S0,0 ' P<P T0 P X RP0 0P, 0 P,  N Q Q-L@PP` 00p} P$0 S U U P T$0@:$080@S0 /R $0P P ӿpP$P 0-0LSP@ ѩ0T@1S00 -`LVp$0*-0Q4X Q#( R> 0`VR ;80Se 4S S 0$  0R/S@/00(  H╤`$0  `# 0B8S P$0 _P 303Q $@O 0 0RK 3P ,03P;80s 0$ `8QC$0 0`S003P$0@|P( H$  6/*P XW @+P '(P00 00 `\P  % :$0.P| `e34 $0 @PX  DP6 04N 0P O 3 03 P 0  Q nI0S  0vP} $0P:$0Pt $0 ើP 303$0`:$0: `` @ W @$0P:$0 0 #0 0 #0 N -0LM@p` 00 00(K(<PP0P  0P `00$@0 0$0 P aPW fPO 080@T . AT% P P5 P@PH 2 080 $  P03VY`, @, ,@ ATVX# *P  03$0 X a:z 00 Y:W:U: 0 *   P$00$0 -PL0@S0( 00Cp0.: ,:0S':h,~,`{0S wxt -LpMpKK`P 0: S " 0P0$KP@=P PʡL0@0=P  0 ( `(0@`( 0 `0`0@,``$`! p9P 0-LP!p" 00 R00S 0p  @P  0@ 000q@0 0-L;p@P  PP 00 -L,M0 P 0"pT0 4 rpP W ZH oP0@P0PC$@0P(P@Z%0`)T0PcT0P`@HQ000 00 00嗊(< , @D <D PTu*Y ,0j 0lS0P`S& HQc0X 0\0 0h@dgQ!Q H\a= 0Q0 W:WF*`d0` 0P  P0ZH0 0 ) R@100*0 Tg`g $ 00 `0 0R*@PT0PHP HQj 0P0 `0 0R:  0gY@(K0T0Pg`g " 00 g `0S @t:0T P0H\ HQI 0\0 HQO,0D< , 00 ,, DD CHP0 0Q0 .HP D0<D 0 0 @gHQ 0Q0 4 0P0 4 0Q0 U T003HQ,ł 0P0 P01 T  `00PL0 T P0i@0 T P T PL0i0c80 T PT PPT0PT PPT PP@4000 0P 0 ! 0^0 #000 0\ 0 T P`h4,0, 0Q 0 $P0 <0)) S@10*00Tg`g $ 00 `00Q*@PT PH\ HP 0P0 `00Q:  0gY@4 0P0 4 0P0 tT P\8T08PPST P(0T00`P`T P)@T0@@P@ 8T 8PP)@T @@P@ 0T 0`P`11F* p-LM`PQ @Q OP0fCKp000C S0 W -L(Mğ PK<KP0 L@ Pe/hM`< @ 0S0  @ 0|S :S 4 R@ :00$$<: <P#DKX00X0< ZpD0ß<(0 <QD0ß00 <JD0dß,0 <CD0Hß<l@ K40P@Tv3 D<1p3D00 ,0Ÿ  80<%2p8 40D0Ÿ<0 <pD0Ÿ:0 <pD0xŸ:+K0 U} .KQ} 1KM} 4KI}| 7KE} hb'aP`@HK<  6PK3PK0PK-PK*PKp00% D04K <0H0<1K 0p H@T<<7K p3 H0[S0F <7K@ K'P@F@0PqU``0D p 8|dQ0@ < *@K0pH @ 5T P(1<005(K00F<.K PpHpF @@ A@F`< ypD080#80;@ ꜖8OPT)0d sH4ĖȖ̖`sЖWEV 0 s@-@T' :T@0@S S S 0S@ S@^ :R ^0@S :R^:^-^  0R R0:S|S S |S 0R:SS  0-LP# P 0Q @ ..0 A0 SaA\A0AW AS7 AT0XQxQ@@0 -Lp= @P@d8P`d 0@:SS   P0Pfdr7P `d P@f e7P` D`V 4 -Lp= G@P@d8P`dP 0:SSo ^S \S0@ PUPfd67Pl `dP0S:SX 00@\:\O 0L0S 0/R@ 7R 0 B1/P07P0 @10@0B0L@2SD꼾ԾȾԾȾ00U@f 6P`VD`0T0 00} 00z 00w:00t00q 00n00kH4 -8@LP im000 0 0-@PLpPP'4d0@@0סLP00740P (0@ @塠00 -MLM@d  ^, ` h8 l p( @0S`WP loPm  7P 0pS LH T hL(Q\(  h QT80T8 X 傎KHH`YP 0 S 0Z@PY+h8P `0 SU0U@E\S 00 HX #RR l%Pp^ 0:SP P0:S0@0p_P@ P( = @Pr P0S :SP:0C0EK0@ @A\(h8@c`P vV v:0P E0E 4 0S :S00i c 00 4  S`D:R:0 00H0f c a0 X0;0g@5P H0g gg0 0H( `pPH @ e40(ݛ $3HDH ;Pgx5P: 0g@pPPX(Rh9lH8dg S0A0:P`@^@pß, 0R(K3 Rfh(02@X8S\T 0h8 0L0SL 2T(R@@W2X\K@ 00BNK@D@D" P)*2 R% h 0P l^K< nPE@8 PE @D 0 p& P$ D0Sh@8 0C<( 88 L TNPh TT X hkhr@hk@ 00TT a 560P  p000\H H8 X Ph H8X\!_2@Z\2@WWW2X(R2 R2l@ 00J4Pp@Wn D2kA2@D 0W;Pj 4P- 0jXp@ +0 Ph `h1 R' 0#3PU0j1 0P0P. 2M0PP@ p1( T 0T D\S@bPPP00 R#R |0h/0zM|0 j \\0WP00DL$ PAP$|7uxt Vܖ 0-L@P0h -LM 0  K K 0-PPL0@S02P0; 0R2P 60xt 0-PPL0@S0#3P0" 0R#3P 0xt *xz -LM K"8vtP4M<0 P81#818105:P02410!050%  8#" ЍOO** -aL0Sp7Q 42CSP@%:P000$"B Q40P  XPp OP 42CS8P8@*00 ;P 0-L|@ 0-LM@P 0S0$ (0  00K0@  0  , p0 R r 1S0C1L KȔ0@ST K0``xt!tt BBL*A``F* -`@L P2pP0S @TP 1i@ -L 0P|z 0-PLP i00@/@@/ @@0|z -LM0PS ,KK@P ,Q 0#S S 0 K@P $K0 S RA,  #P0d,0 , 2`P , :,0ppeMP @p0 S S0 S S xVM`P00(K \M(0S 00S0?p P8 Vp@ .@7MP( 00@T# 0S S S@ 0@!0S1P 000  b phhKP0s0 0>1PX@CT @tT V -LM0P|z 0-0LS@P K 00 00J 00 00 V|z##/*<<+*(%*!* 0HQ0  G$hh*$%% * p-LMa0PS-@T 0S00S @ R0S)xT! 00@0Sg`K pP 0S .xD.x(@00 xts p-LM, 0( rSwS@T 0@0Kp ?2 0S $KHP2 RRKpPB P#1@T 0@T 1 R , 0rSU $P[(0!үd1 R6, 0rS8 , rh@$0(a@ P0S00  0 R$ @$.}Py 000Q0 oli$9h@ o @$kT  d$_-ixtԲ ;Xs -0L =Ty -BML M#0PT ,0  0S 00, 0R(K/dPP0P4 L 04  pST L00C=SX(XXXXT4 R  T$1!S  b-1A L4010T$!X 尾BNK@D0@DP4  0 SP(1KH4 1D A  @t < 84 4 %h4pP 0S`Pq `BNK@D@DPQ ? 00OBNK@D@D X(0K@/0 4L X(K 04BJ&0S620P@@ᵚ00 c-!!R0$ 0  sB>K0C@@D0CPT L4 8(3 00uTy ;Բ(4L[m( -0-LMP0 S  @     0S0! b-1 00   0S0 0  Q 0RK02 00u --LM@0 S       0S0! b-1! 00   0S0   0S000 嵽 0RK2m 00u -0-LMP0 S  @     0S0! b-1! 00   0S0 0  QL0 m 0RK0K2% 00uTy @-@P  S 0 SS00N0 --LM0  0 j Kt 0-LM@PbPK0 qdP 7bP  2bP $@ 0@Pi -LRp` @PU  PP@ -L@`P bP pW0S ` ზWU W` @0@PW` P0Sl+00@T T`W /PP  㽓 0夏`H8u` `       --LM00  K p-L@P=X0` PPQOT  4埚4 0eV ph?O<8u<P 00s -(0LSP< 0S2ነ0 ! P` 00/`VpP <0O`Vp0S  R 00cO`p 0(p`p 0q 00`p0xt -Lϻ* ˻* -2MLM|$@0TP,0  <S   0/Sk @P B.K B B, 3+ iq X030#` V0#ScVH < VD / `P< PP#@aTQ~KpGpG (K0YC`d   ,@B0 /S ,3X5/00,8[S UP UPP0XP /,0VbPX A0/S/0C0@0@0S_`, 0 R{(K&?00,R,  *0<  +UrPKAA PPh<: S Qk®KJJ  hpP( K`\F,<[/SD XP /P0aY 00pu Nd 0-@PQPLTP p 0|@00 -P @PS)@ 0S Sl* --LM0 0  K -LMϟ0S, @P0 R r 1S0C18 p4 Q q@ Lo00 0+%Q, 0S 0S00C0pQ.0Sj (gbP r 00  00Cp0S`@zQxlX| 4( XbPN 8^8 @0S V`k@4 0SB  T%p@dtaPpq ;  0 00CS0p; JR@1@!t˯KJj< Z ˯KJ< +0B:SQ                                            T: JR@1@!tKLj<  N KN< +0AMSD$xxxxxxLxxxxxxLZ `'@`(K0 RQ 0Z0C000 0SaP V `T 008# p8# ,aPp(K0 RQ 0`0C V0 S(K0 RQV p Z @(`@q l7  00Z0C000 0S`P 0dp83083 00`Pq 6  00@0C T0{ SZ  ` d@Z0`P` Vy p9S :j0 0CS000*?K0Z  zePEPO  0Ly </083083 <0l p0 0CS00j0O`P   j  j  :j00CS0@?K0Z mZXPxP. ";<4#  @    00088 <0n p/4,4 j4# 00CS0ž_P 4#Ri043 j j  )?K? S i4# 4 ^ j43 t3 R4# jq H3  0 `@4#  043 0@S_P  0p0p@  0OlQ```l@@4 hQ``0KK^S  0 0 SPH@, @^-\ 0 ]\ \Nl@a "k@4# \` 0`@43 T@R!0000Ck<0S8 (, 08Rn(K@` k@4 2l@-`"k0 `@43 $BpN<4#z<00<80n p8 6 0NP 8p8 )Jxtu vxp `0j p0<0 0o R00]R0S0R@b0pV+< Q* `v\<#R:<3 S*ZR48 q -L`P , !0S*0 R r 1S0C1@pT0@ `0@V i000^Pp`d x 0S f ȏ P  0f ( 00S xt 0-L M0KK `0PS@ AK0"000@@@ 0$0%Ks -LM< t<0D @  Pu 0-U +U 0P8 80 D@ t 3TT0U RUD0 ?4 00 8 RX 4 K 4 K `V0D0@`c`f,` `p 0E Qࠑ uz \B000t W070cD^mR8Q4 YNK V0_ , ^00SD041 ,/@`p`Vp P0U8  @@RD@ 4 0 4 K ㈡4 K , 㷜 W# 8 V0& ,@^00S0040 ` `Pp X"00P`q V"00P`q W0 W0@Q RJ< <0@ 0(KP8 A0XSxSEP D 4 0 C v -L@'T`p@P  @00#:k0cS:UV@ 0gw`p -LxMXOP0 U80   0@D0 @@ 4 40 -SX888888Dp@`PM  | EPeP Y|0x@0`V ptp 4 @T400t`VDK(K@0D`t` 00Spxp { /Q9Qp@`9Qʇ!000T0pCچ!000T0`C@4 /QP R 0S H0SE0 RT4 | r 0@ Q  |040|0 R! |0S  P 0BSpچ0R`|PU 0 CR:ʇ!00 p0|0 04 0t0 4 0So 00Spxp 0XS xS 04 00S S`  x s4 @t@ |x 0 O 44 0+Q -Q,A    00@ S4 30P404 0P 10@S&40P@p p 4 /P 04 0@!00/PP9PpH*0aUS RaY T @l@ P O Z@PD@ @P @:H A u@P= 0tD @ YPP` 0j@T 9 DKuD @ 07 MSp`p dp \p Xp )0@ D0 `\ 8wdw\w`wXw"00 4 shP၏%P` y hPrt8M `8 0gP` d \ X  0X0 \0 `@wPd  ! *DK, K00KwP8 $yP\ P`, VPpPPg00ࠡ࠱Rb  B alR 6cT PbP @0"00C`T0 T @0` @T00 S 0S p pc@c`cU \.yP\ d 8sxPP` 82w8P T8'xP8 U XdyPd M VdxPd E W\xP\ = d8wPX 7 0 0\vPK X\g 1@P(iPKYe u` l h @5 Z 0Q0jZ0S lKx%x5 iP lK5P l h Y l0K`pk6pjDKt 0t 0DKSsD @ P@`\050Zp 8vdv\vXv 4tl h Ylph@@PQcP`p 4's`p@D0SH@ 46SE 3hPA44 ytl h l`A0`p | _I0@%Sh`(`(S@  2r` l h0 I0P|@  |@ 04 |00P0|0 10@S 4|0@ | y\2 l h0 BCbVD@K0@1 ` t@PVD@ @P @05&C@ ! DKsD @ @"1 R6CR0!0 5&0C@@ D0 @ @ @4@KeP 40 (R D @ 4@KLeP 40C44 eP40\!04 @ D0 Qt80K4K< Kc0S@t 4  S S 8 RL`K L`K|e8u0DK< bPP\ ~\cʄ0 DKsD @ N ?A|̙ęs|?5?55P9?hs5&HDK@PD`K@ ` p  0Ys 0DKqD @ @h0 0S56@0 0pW @0 0D0 lKll 0lKqY@PD0S46S !(1agPu8*ud(u\&u`$uX"u!h!h1OgP|!p15fP\l`hp0A;i@d 1 DKqD @ DB[ T3`j`T` DPK`2 @ rP`TDP @` \ @820#:kcQ Q4Q0 AD0 0"7&@ @ DK 0pIP'` d \ X 0@D0 @@ Ry|nY| @#46S TpW  Y DKD@K0 00qD @ 8tdt\t`tXtQ #0 0 K DKrD @ 3@ 0SYD0S@ 46S30kSX 0S0SXau0PX0 \tP@ ڌ`V L40kS7S8StdQt\Ot`MtXKtY0ц!0М `0| |0 D0l0 h@ D0@ 46SD0SPiP0Q< E DKrP e rD @ D0y jP0s%|DKL pD @ DKD@K0 0p @P0D@ @P HP2 XL K'ePH0$L0&@ D0 @DT (60jS#:k0c&B# P)X6Q `60&0@ D0 2|606C#**0@ D0 )D0 1D0 p 0-P0@LS pL(p000 0100"000 00 1 000 0  010000 00100C.0 6:0 0100 -RtL$M@K@P`p0D 0@ K,@K$0K4P @`YP$ 0 Kt T00 5CS0cC*R7S0BS c020 -LM< h ?4 00 4 K t, P` 00D S t= 0007 W070c Z1R V" U0& , \00S0040 Po P` @0T   04 0 U"00@P` V080R00S Pu`@Q RpG <2 R] 00SV0 R r 1S0C10B <000PD `0S@0PL pP- @  0 @p000CC000 R0@ <08 000B 0C B0S P, 0S0yi 0 0R0 R*0\SL P 00π0;0B #A03@ #0000Nt~xt-R 0R\0P0tS=t0=t -LM0  =tH  p-LM@K`P40 qxЙ --LM0 0 K||*0@-@$ 0@0 0 0 #EgvT2ܺ -L@M@ hKD ph( 0 @ 00# d ,0*0 0#`a0"00# \@dȟ0! 00#X@Dlŀ0 0 0#T@$(0, 00# P@ b* 0.0 0#L@0"00# H@ǟ`0! 00#D@̀0 0 0#@0n)+C0,0O B0#  <`G' 0.@0 0#@8@@dE0"00# 4 0$00#0`ǟ` 0! 00#, ǀ0 0 0#nd@& 0. 0 0#  -P@0" 00#<@|0!00# ` h@\Ɵ0 00#lƀT@<0,00#@@& 0. 0 0#  +,@0" 00#aX@0!00# `D@ş0 00#̀0,00#\@% 0. 0 0#  b)H`E0"@ 00#@@dF4@0$00# ` ş0! 00#ˁL0,00#n$ P.0 0#  T0b&P"H@`0"0# ğ<0 0 0#lȁ0! 0#d@d$0, 0#  HX0b. 0.0#L@, 0"0# ğ@0a 0 0#4@ā0! 0##h0n 0,0#\@  * 0.0#P0`0"0#D@ ß0 0#ll΁0! 0#P#,0 0,0#`@ 4 b( 0.0#h@000# L@Ÿa0 00#lˁ000#T@"0 0 0#  % 000#\@|` 000# @@\Ÿa0 00#d@<ȁ000#H@"0 0 0#  ,Ab- 0@00#@@PQdK0P00# PP4aX0`00#``Xe000#<|` 0 00#` \lˀ000#D@? A10N@b@P, P0@ R?W@pG 0 _?W@P0 W(K (Ko蝅@, 噅 I,0!pc?WP -L(M< 1>?0@0c@ S80 D ," 0S` 00P0SP@?0/0U40 4P T4@ 4K  KP" KP- 40S% T UP4@4P0P0 P,:P`00 ;0`0 40S0DT@40 PS4P @Ql0Q4 ? R0#S4K  0 4 P004L1XH1H1000 0 ^ 0 S J"10^=0P\ 0PE0S0 J@0S J"10^=0@0  S K0K 04 n0 PK XPl @0R @D R J@0040 ꫪ*lQ napt -LM@P`pJ0S 0@-H01=0\J 10S1 0p- -MLMPP8 <( 0S` `,0K,0 S (K `V 08 2Q22Y PBKAA 01 R0SJK=0 0( Q(@K1$0HR1(@KA 08008 04 PZ0HTڂK `LLD 4 480H0S48 48DH! !H( 0!L 0QHL8DH @( 1"10 p 縀^8<(,0K @@`v`3d `G,0 S@0 ` 0`v3 c` 0(Z0 0napt P0 0 P` P0 0 I` -0~03?LQ00Ӣ?Q 1!0 @0S d0 R0 R0 R, =0;p3 -LM|0@`l,0 /pP@ 0T00 +PP P:U /U .rFP JEP, , 0R(K:UP/U } P*/\K(PEPE+V+;+;.FFP@ @Pこp@ )FPGPUK\@ $(2Q P P\K\^2^*K\?SSTT1 !0C  K0\000, E0RK, H/\;:KPKHK`*KP/H0*KP?QKHQ0d?KH 7 KQd  XK dT7 QOK`0*KQH?Kd\ 1^KT00 S8 Kd*KT/H0Q*K KT?HKHf*KH/0S0/EPd PTh^KH*KH/ 0$& ^:KH0 S5ڶKL KH1KH,*KL/KH0*KK SLH Kd*Kd/R3^-  0 KH?K^d  :K\?S0 KH0S0^^-  KH:K\d T@ KH0S0 K`A 0Rb\0S KH 0gcPKH00QXPM0 SN  K` K`P=3@PK`@T 3  P P 00*K`/R JBT3K- KP@X XPE@DJ*KX UP 10P 00J4K` @0 S 0*K`?Kd0 S/\K(PE PE @P0S 02S@@0 0 \0 0 @0R P;0*K`?10 Rd ^[ 0 S1K-0 Kd @*K`/KR" K`0!S:K*Khd/`?*K0`?1 KhK`:KdK`:Kd?^ͅA2@@^M@ PKdKd2 ^^K(L P @*Kd/00 Kd/uHqx N+ -RLLM`@0<S p@ d0Sg(K@>0 >Sp@ d${(6p@ P1!@,  "pP00PUJ <Ua l@ d0S,Sl,0>C00 0q03W0Sh;Q,Qe QpWx5x%0  00@T H50D%  00Q ^ W ş^ @0^M^͆0@, 04 a$0` B0P0 P Z00 P 0 0 Sv p SZ o l Sg;S 0KP_DKPY 0,SVXKPQ Pt Mß^ @0^M^͆0@K=`0 |30 h0 h3, btp \#0l0 BP0Pt03 p`  0 ` dp \0 0h dh@X Kd00T\0` 0B0C@0B0hpp0h h0Ϡ"2l10!0h R0 3l20!h0Q008"1$#Bb20ad Q\0\KS`00`0 \ Sh0,0h0 d 0!0Ta !0!100QP0@D0M0 >Sl@ dn\0@`00A\ 00A[TQ  -L@ P  h4t -LpP`ޑ 0S@ tؑ@ 0V X0(0T=H00(0(0000 @P |ttt/  - @L - 3LMPU$ @ 0S" 0^( 0^N010 2 b B/#b0Ca"`0c(0 (0Sf%0S$\>^- 0 SP 0Q^M@  0$K @' 0 !0 1( K 10 ^( 0^!0n0C?t3c Ba`1"`( 0^\  0! 0^ QA!01"1,010 Q(K ^X $0R0@0@!. B2!Nc0@0@!. B2!NpQ"Y`|t -<1<`8!VL C 0S^͆®]P !0"100 !0S X @pP@P_0@0XZ]PpZ0^=0 @,xPpD5P00Z$000p|tt+t -tL0Sd@0 0R  Ph,0p> Pxp/ -@LVhS 0-8Ls@PA (Q0S5P2 wPP+P0S. \0   B,P0hE PxP 0:S  `P 0,0P0h, P\^xxpt/ 0-4PL@  @0a P0 0 p-8`LP@؏ *@яp -@LǏthď 0-LM KJ0PK@@%D0@`TK0@@@ 70@`T0C@@D@ *0@`T0 -LM K@0` -L,M@<KK -,L@, 0uP hh -,L@, 0dP h|l -LhT -L,M0PPp,0 `1  9@KR0! 蠟 R0!  0Āv 0P0 0    0@pV@@, 0R(K00 <OpW00 %umQ=Л4 -0L@H $0P H h Q *0S00S0 Q -LMTp,@KP` 0    0RKu -0LobfrgRBQ Alnn  `` @`Väp"d@`FT00æ?d@D`R ?V00S X W  40W  $@0iQ -LtM` \, Pp *: 0 p0 *: 0l  0 U 00\ %\z^DrtotototototototototototototototototototototototototototototototototototototototototoLrtototototototototototototototototototototoprrrrorrtttototo$utoototoDuPupu|uruuuvtotototototo4vXvtvvvtorXvtow$wDwwwtowtowx`xxxxxxxqD, 0R(K 0So$@ T  @d Ϡ0lP ,0PhKhK8@K0 !o P 0P #P i0 |0P h00  0C%P0B@0 S' V^ g^ | (0` Ba4P P 0S{ 0  00|  0S5u,c`d l̜Qn$Im*Ȝ؜!x|t -LMp@P `$KTH, 0V g $KZ  @4S -PLU@`rp@P P P@D -L>o 0 @@ -LHM쀟0P@$0 60p8`Kh r0d ` r0 \ X0 T P@ rUL H` DP  0| rD h0 hK@0 < ݊ H0p R$ 0R Kh$ u<@x]!0$ -P LQ @@0  BQ r 0000 @xtp -0L`Cp@1 00 a 0Qᅁ  00 @0N""(30b >P0 U  ^00U#3   0 P\ꀞ p-0L@,  0$R`P@ J2#($b!.1A QS 0N!A QR\p80\0 -L M 0`^J~^r@P p10鎠lp@PJ PL0 00lQ 1p\ ""(30b,>0A!0 S00QᦣP% 01C0 0 @0 0 2#8# cN(. 0B 0S   00C 0(K @ -LPMܤ0d(0  @0P (0 U  U UXh@K? AP$ K0DPCM0SJ @<0C>S񟗵(((((((ԃȃ((((T((Є((((Ą(L((((((((((((((T(|(pT((((H(<0 0t 0SPU 0S$3  mP, Pp 2P?kP@  q  qwm*@< 00 2P&kP00  0 S X, 0Z $%Z: U0 @ p( 0Ry$K000 0:$000(00(000(00 S(01,( 1 㙢0 000 @0$ (0  x00u00r00o0 0l0$0i00f00c00`0*0$ (0X00U00R0PPURPLk|00l0 R0S 00rp8v,u0 @<4{̞ܞxt0 -LM83`, 0&P, Q W>0 YRD0*VUoB0 S}*2 0(0#2\  L01@HpW L H0R3 U0 PXz H0 0e6Rp(Bk 0Sc ,0 e SD00eD0U0S 0S((K80\>0 Y p!0S* 0S0LHD0, 0eRD0#0S 0S kj  $1@P0ipp !000  o Nj  ș Dj  㾙  o l0 @P0ipH ,0p00D (0R$0@@ @ ->0>0L MSp00 4  (Koy"0(!Q, D0, 0cR,`Bc0 S*H2 00#2Y P1 P* L 0H0 R!D00b b0 D0L 00h0YPN ( P0@0a@H0S L0P H0x,X!(P H0S@  @P0 S @T(1( D0S(K 0PS,0S$4 10H ,LD00D0( T S(Ko|0(40嶠Ph 000a0@ ({04 n40 40@@ @ 8P -sLPi`P *"*R@ R@  B0B Tl0ST(3 RC0 S* 3  0 ""! HHXPUO :P 2@` 0 S 00Cx:#:30#" 01#^3! Q1(1"(0R!h 1S R000 !R0S Dn*0S00@@`$ 0b SP1:U xi<R>0N@ TK:X>0N@4 0$ 00b00!S 0S  i~ij h]i i$  bh R 0@@. @0N$@a mP 800@@@hȟ -L`Vp P0S0 @0T  @00S0 h0 0CR0mpm<0< @80T 0S$hmxt0@@ - PLMP5$0:CZ*p>0N&@ p`^ \0 RPP<6$Q,0PSa $ a R]*0S2:b0Y` 0S(K5, 0(RC S0JS1`0q0PU 0R xB1l%S@ `e0 S*P5 00#2 @T0N@$20!0R`p!@^@Z ` 0 #2 `0`080Q$0S Y` $0c gg86#Ƞ@^@D0000!1 B("(0,R1!P000#00c02!0QB !R `00Y00Sj Zh RgcMgX# .` 00Ta lPu03$ 0003l$  b.g? 4p, `7 PU P000 0            U a VI,!!a,00, ZlPv^  ,20 B0R\ ,"   0 ^ @P0P,00P0#, 0 X6 af$0 c:36 &8#8!1a1,a` 00,,*` 0@P0fp 0:0 0S00 8PP],*cP0PP0@@@$ @ -LP`Lq0S<<,@0. >.0 SD0 H z*Q`SD (0 S8 < 0 @00SY40W ^ 4 `T0bs5JP.U \UPn@kP 0D R0 0<? 4 X0S8 <0c\40@ QL L4=a4 #=0 p0S .S` < R(K0S 0D R0 q~<0S D00L@P*00L b@ R$ .0A Aa0ARS00A-Q S_Q\0 .Q .S \.\A Aa0ARS00A S0*S 0.S S R!0B]S,.R00S \\R R.R0S! C ]R00 <8 < 0 <0 Ƞ 40P 00v<(4"4 <SQ1 S -LM@0.s0pS80 S S  `P/P K . P Q |` X1  010S0 Pl1l1 0 0l!l10S S S S 0S SS P  P0:0  P0;0 | P0;0 \ P010 < P000~p v=h=xl -H/LOM@0P.0, s($/$0sU 0>NK A A<p/ U $!0S000 S000 =0005< 1l100  l1h< 3립PP    0 0 QP  3E.K B0 B4 % 5 \4KP `$ R*E~KpGpG Y`4(K 0@4DCx6 P@\4[S \ PV4[ S Sx 8 P7V4[ S S3Q S S0 S S SSPP h@,63 PT  P1Q$k$1RgH̟, 0R(KATIH PV4[ S Sh $ PV4[ S S\ S S0 S S SSPPw h@,2 N"PPh0L@SP  dR *R* S S0000 Q@0S0 00Nl1Q 0 2l1$h0Sd Qh0hSLPP@T T .SP0SX`V."VPEU00媼P0:0O 00kU1Sf1S b TP h@,2h0L@SP4  dQT %>* ST  Q7* S0 S S000 0 R 0@4 0S0 00ENK@D@DqP.!P ,hE2 >TP0 0 S S 0S S PR4[ S S%R S S P P0 S S SS Q `8  q 0Q@\@K0[S\pK  (50G.K B B@@@@@E>K@0C@ 0C | dD D C>PddddQ Vd a@|`Pl   0S @0 S S S 0R0Z0S@`  mP0P0  dP0P0 5 %0,S \Q 0 SS S S\ bRyR00 fR0! 1PT4[ S S \@ Q Q QQ ;Q PU`p |5`  ;U  u 0PU T Pp GKI0 I0 tPr D pA P PQ;Qp` p`4`  p q 0Q;Qp00 EP 5 4t1"10%0 #$p $ t!# \x@ PpU4[ S Slvh 10   r 0R00 S 0S S00 00   R5Ud4 R U%dd % I%5,Q0" 0000\pK 0Pu~~h|~vă V\zdģ̣ԣ vT!h=luĞ`  0-L@PPU@0 -LM@   K0K  @@TpKE-M00L SJ20\ p` P0 @ 00L @  S4$ 00L @ UQ | 0D A0a00cB.\! 0W @00L S0\p PX\x\PPT*0S R<8@%Ѝ\ Q| 0 0hC10SLT0SQ R<84@Z,<$!$$, T*0SL v -LMKnP@ -0LMp,`K,0K@PT Pe 0!00P XZ@`PTZ .T00X0S Z  ,K T -LMhŸ0P,0 PD P /004Ÿ, 0Rz(KD@ :T< 8 4 0 # p@ `PPKn@1AlA 8 4< <\ 0L ]cqNH^6 D  0!MPD@`P  0@,d0a0cK8< 00< @<AA 4 << 3cꎬ0!)VF``pY 0 S0GQ D<J07S^KPEpPE p q00@ ~^KPEpPE<< 8L eP 0&@P(07S v8Fuئ!< 0-LM@00 P>P8 -LMb K -L]M@NK`Pp KC/$@ d @8 4 2EVN_KPEFh0 @KX 0KO@eKQ Q C1 $0Q K uP0h p-LMP` P P |P0l r`0 0 Kp@44P0( @_@ {l -Lh8u -L  h<8u 0-LM0@ K Q0!0p@\ Pڔ!&|K0@\` 0S-xx0!pP,P0 pP0  p0 P0 R@` p01S ` pT0< pTltYm!ԧH -LrhV8u --LM0 0 IK K0QSA P Q 000qS 000 0 -LM$PK%%[à` @P","!P"!!!#!!!!!!!#? 10  @$K 10 x @0 #2>;?C0C0V`p Vpp@P 0C P00@PP00T0#S 00@ P00T0#""S T % * 00@ T4>2":c& :460V0) Vp0pS.Z0p0GT0  AT,K 0., ( 0 #2>;,p.p>.l.l>,@ P'X.X>- 0,@P& 0 "P,\ࠃ|  >  "P0L࠳|0 | 0jS SaB0Ct U U Et0 E\t t p   Q00 @  x Ps \00S ^ -01NB0H D    ̟ :,0`p@0 T P< HKP -H D  @H K ,X T |^ XK0< !P00Q00S ROXK; [-0X T 0L0 8 4 &X K L-; +40@S UA ;XK+ 0`p] P 1i!P ` \   pd \)/`0S d\\` /h/ 0S00 p` p0 0?\0Sn ^00ӡ!  ^ `: , 0@P ` \ p100 d Q @ B¤ Ť0@S((,,,l, x x 0Z J∠ ӄ 删  x 0S00 0 0 x x ,00 0C Q 0A63@ a 0aCAWJ Al  4 8 Ex\@` 0tS\t0tS0ct @cc Rx0S `p0P` \ h/PPX ht.hP 0P\ P pQxP R00Sp Vn46Sj70Sf t0@0t0 p\0\t00t 0 t @Tt0S|\6 R`U XY` ` U.@P `0  ! D!/P `` pd ` ` L <h-P. Q U00S 0S X^00S \W UbL 0`R h  /Ph d`\u d  /Pd `  /P` LL \hdh-`\~.@P 00`S -P Q  0 cc p N%0 _P00C0 x\ 4@5 (M* 0&*@ < XK~$@1% 0XK*0@ pP`@@K 0P< 0 * 0@KPv4Q j)@ K 4 P 0jW` @K 04l+ $4@ < e+`PB$@$ 0)0@@@ K `PP 08 -P0@ pP0 D+@P 0)$`$ 07+ 0)000 0@PP 3 P\P  0)@P  0KP  0P 8  w9R W8008  000800 h.Ph 40 820*  XK#`t$ 0XK]) 0@P~PP 400 p\00W 1*P@#`T$ 0=) 0P@^4P00 000 <1K>) 0P K ") 0P0w0S 8p u408`0 \0 @nT/X T   ,a 0cS0Ct @4S2+  +.P` T d X'ԪȪ?aCoc?`(?yPD??$@@@?h0  Q*Db 0@P0 pH0 p A*@P `X@ TP p@-Ph  \h0`h`h0  \0Sڈ T@d h-Ph \+P0w9S{ W p100  h\+Ph  -Ph UvN  \010+ 0`l^,0CN@6@c-P` t @t E0SS\ -P\ \h\x+Pʕ-P\ W\,P\ x{h,Ph ms`,P` rkh0S0SU%`rd p9V00l90000fz0w0S p^ X T p`  5-P` <hr,Ph V \ +P `:V `?9V X1``9`4 -L p3 -L p3 -L0MP T 0 R` BTL X 0X@P0T 00D0 L@PPH , 0 ITP*PAH0H 0,@p, pP0 `PU`,0D  PU `@R P 0*L@P 0 R000 CZ *0S 0SL0 B@^L :L P H(KH @ <  8 4 8 14pN$P @0`PU`@KPU`D @R @ < P*XP0 R0 0BP *0S 0SL00 A0CRL0 :LP@i 02@ * P-L@ @ 0S@*P@ 0-L@PP 0S0   0S0U 0! !A 0RR! B p-LM P#B|` 0 S 0K,0 ( $ 0 R r 1S0C1,K80@SKp|xt -@L  m R-L" 0S 0S \ @`R 0S  ^00NSa00A@0$0 -0LL0 -Q Q Q0  0  00  0-@L0PS P00SL0h>h -LDMP pP d`Pd p 0S, R00U@ @@0K=LP` 00 X T P \@ `K~P0S h0d0 *0  0@P04,"40dd@ P0P H0S00A0@1HP! d(K qP p_P00  0@7 00c00@ 00\00d@ 00U00p 000@07 00F0d 0GFv8u {ت -LTMp \ 0Qt x0 | 0d@ `0 0 @ L`Ro  l 0h0 $ L |00C,̠Č| 0("ČP@|H # P] P0\KPV p0  0PM xt PF l&PN l0SO `Pd RA 0A尡L0LPK0<0 8 XpKP P$P (KX0Y$7$P) h00Csh0 p  0 P$`0SdPl $0S0$0$0$00$0p0 0P0 $0(  H0S 0L0$ P$0S0$0{i -RLp`PU qp@`P`` 0$0(  -LMpRP(K !31C0Ϡ @l1@8K00 2Ku@K 0K9^`5 j4 <08R@0= Bc 0 B ABS=ɌBa!@B ͌B31C0/A#b1@TV0p$0V v  Sp@ P06 p$0( 2[   000S 0p($0 00 0$0( pMb -40LQ < 0( n p-LM@PU% <\ Kp00`K0 @ 0 0(,0<,00S @yP Pn{0v0S \\ 4xKlKK`KTKHKS 00  0S S S00   \00 \ 000 S00 0000  00000 0 00 00 000000 0-0 0 0LS@P 0P P P  P 0h 0-LP@P 0SP0S0h0h 0-LMP@P8P 0S 08Dv  0-LP@P0 >0h 0-LP@P0 {P 0S S 00P 0h-  @ \vv@-0S@ 0C0@ <(4"4!<0  -0S0C0 <(4"4!<0  0 c0 Q0a0  R %3 a 0 0% %  0-0LS@P*00b0 < 00 00 0-0@SLP*00b0 < 00 00 -LM0@S0C0K< 4("4 <0!  < 00 0 0-LM0@SP0C0  Kt< <(4"4!<0  8 -LPQFM0`,0 @] TC TR0 41 8! 0)p@S810(KOK 0< U@P! M?KV@P8!ᴠ@἞TK?KS N/KdP8!埠@, 0R(K081 4A 0p 0UPꎞ@.00<K_K<N/K81 cp 8!+A[7u -L,Mo,0nD 0Kp0 ``0 庒KP`P 0@p 00< 8 4 * K0 @ P @0K P2[Sl0  00pcD0 [(K,000lS { 0-L@PP0P P  0h-0 S 0Q S0 Q(,0^ 0a(00 0Q<@\ 0-L 0Q0l0CP< (4"4!<0 @@b T 0 0 0@-Q @0S 00@  0S* n B!< 4!4"<0 0 0  0- @P  0SL 0  <4("4!<000 0P 0 0 0-@0LS@ 0, $ 0 P bp 0,0(P0 p-PQL@U  0(0PbU (,0`SPppcP0à - @LDP`Up$P  bLP"W000H$P1 H04 X0T  cP@ X0T PX> 00࠱PP L0 R0L00P ࠑ0H<,$!$ H \ QT0PR<0TPU$1P $(0lH0 (0, P$8`,P, 6<P$P$, 0 @0 X 0,`H 00`(40L P,0 D P @ T ``0 (Ko0 @080o7 000o-v8u 0- @LP 0ZTp 0S S 0 00b0q( ,00bc0 p-L@` Pp 0fS  0 `P0P3 5: pS0( P,0 `R$0R0` #00%( %* -LIM0 P$0  0SQKO_K`NK@D @{9 gl0! Q$ 0R  KD! i9,0 MoKK_KQK@ <1 8! u!8 -L@TP`pJ 0 /T #R70! zW8?XQd@@0 1T  R#*0B0L!000c00R0nT-0 0@ L 1Z AW@ <"@@ 0-LMP40@ L0 @K0踵H -LM`p@BP0PP@0  pt@2TPPKv\ p-L@ P  j  0 0 p-Lpd ` <4("4!<SVJ@L@TP0? " !BP <4("4!<0cS ,  < @4( "4 ,\,.<4("4A$<U@%LPU!0? " !Bp <4("4!< 0cS<,$ PPe ,00i \0 , 0h5Y9 Q> Qj LQ; R00@$  ,p, W``T0U0S&a Y00 ;0S8 w 3JX00S\00Sl @(K0S @T,0S%@ QB4 @8  T 000lnPP 0@0  0` P00 R \`0p@APPE 0@10 @dP0 ` W0p 0 `0 000 k "00 0`210 2!@m210@ B  0T0W0P`0 p p 3q 0@0uPP0`` 0@0j -LMNPpU 0  0@P0 L@  D 4 @p @0 -SN`````````````````````````````````````܀ @ 0S@0D@ 40 @p @T@00\40<40 ^  q D4(K 00S    /Q 9Q@`9Qʈ!000T0Cچ!000T0`C@@ /QP  EPeP9 Y0@0\uI0@%Sq갔4444444444444444444444444444444444@ >00 q 0 @ @p@ 0+Q> -Q  9 00@ S@p 0P@0@ 0P 10@S@0P@ 0@ /P 0@ 0@!00/PP9Pڌ*0aUS RaD040 @p 1 @ l 0\ P0`40  P  p3 Y ppT @@ A W@PP@ LP 9H A @PA 02P L 5RYO\0Sk \\JP 09R QH } HK5@`\D9 PK@P L 5T@@4K 0PK@@@P 40S D0XS xS 0@ 00S S  @ @KD0K@P4 x PD @p \ 0g@T ,8 PK9P L 0 PK< K80KPD T 80<@cT< <8 <  0 @n0TiT @  (7  0<P| ( | P ! |0  ! .D0P  D  ! .8P<@Px  \i\\ pnp  0@Pc@0 d0^0j00n`PU00S0ScPc`c\ xPx  @P @ iQڄP  WڀP  VڀP  XxPx  4 Pt  0St0@ p @x+`\`P`V 0 03 0 4  W !0@ 40 X T 倔 <\` 8+  , K00KpP{ ,QJpPt D`R, 010DPD d 0@S20@DT@ T D)PD Q <0C< %A D/PD < 0 0CSu R 80@0T80 Q6` <08 @ STQu "2  @P2XKf 1`p P 0 P[ 0@S 0XK PO40040 Q80 @cT DPD < d< 0x|t@<0 R 00SM SG S D00 @021T0D 40 * 00Q   0 b320PW vtxrtpnP tx 1@PPW 0` 0 ` p 0^0Z0S.   R 0S nNt?V瞯!0L0P40, Sa ,  4 0Y000 0Cp,0 p,0 @000 @e P D21 0 " \  Pppp ,  , 8 0, R2 =@"00 0,0 4 R 8  0S S2 R/ P000.@r`(⼾PPPG ( P?W 00S `P T@ 0VP @F R 000@0b@8 0< 0"00:1 0J 0eP #8 0,  R, @"0S@ 0bVUE P0S 8 00CS"@21 0 02@"@8  0S: S4 Sh 8 0`BPP0 0@0Pr TP0 0Q0 0U f R!10 8 @0< 00S{J R20S. nЄ0\  0@RZR R 000A10  R*0\0Q00Q- 2R  101.Q  10 P *0 BSP*02SP: -LM@(KPp`,K0( c,0 c R:pI 0m $K -L` B/ bR@pP00RP 0 WP0 0@ P VU  0 BSPP P 0 BJ0PP0 U @980"p@-R`1Q0@  0 ^2$ Pd050 ^2$R  0fC1S00p^0^0 0fC1S00p -LM0 10R@# *P0@ @0S Q @K0 @0S" 0      $ ( ) * + , !-" . # /D0S 80 00 00 vnvvvR0Sa@ R 0S0a@000-@P 00W b@-A d0.3Ġ Q -LM4 4@00S 0"! 000 004 APP@Q Q00S p ,  QP- 2`VM Qn,X W0#03R0ST WՕ@ `' , P@ Q0Q0XSxS0 S@QPX\ W0#03R0SgZ1* 0Y0*00Y*0S  Z QZO 0AS (K R WՕ@00' 020@ 8 _800S 0 `0320)QX00S400Q" 0R )RP  R0'O0 XSxSa0 S҅@\00 &Z*4 00Є0S  0 S  -4@L,    hЄD -L` -LI`Q Q0!0a0PR- \1,0l00 ?\0 00R- 0bR R ?R0̑03012<000QS@-@  \0l 1<0̠ \ L ?\0 0@@\ P T  0 0-R ,0l0>-S0c012 0 00 S 200 0 3# R02 P0 0 bQ B2c0 @- @0cR#3n\0CQ0C2 d  l0p@-H h$H! Q. &.ȌV2UXP`pP1#3P1 <2PQP3100QP3100Q#2QPP ;; ;Sq0 P0-9XpTP@ U` V( 0@0000# p-L`P@@@`@p -LPP@`p P B`B0Q40A"A`R0E0U0@ EPU0r @0P 00`04S0`P0  0  \"vv -X1L0ps3X@@`S P S `8?SPQ QU 000@U000#? 0S`Z?45VCq00ࡣ0aS S4#0C@@PUQ @T@Pvv p-`LP@@!aph -L@P0, 7 `p P  0G`pe -L@pPe P eL -;PpLg45^@càU WN^a lAi^<.0n0ðVU, UPp V* f(\\0"?DE iW U0naS S6#0c``< 0S00O@`V`vA-;P`f45^@s àU VNŒ^ 2 0N0AA A^<.0n0ðWU U ?1"C 0\ A<V U0nrS S 7#0spp\?DE pWp/R 5/R 1 -p!   PLP` &:::S@ W 0@ 460@ P S460 PXP -p!   PLP` &:::S@ ?P @ P0@ 000#460@ 460 W V  RXU -p!   PLP` &:::S@ ?S@ S 0@ 460@ 460 W V0 PXU0 ;p-@TTLUo Z~T 000p54 "d a3000V `pT00U0SpP |Vpv;0 S-L@ ;0S P 0045S P [45S PP;0 S- L ;0S P P0045S -45S %R 0#03P;0 S- L ;0S P P 0045S 45S R 0#03PPPO? ` H !:0-LʠʠAL@N$^?&P@)0\^.0n04.U`U00P00S R 00000\ U0 0H0\6n "30  0000v -;L0M^P( $ 堏' ^ (P=O*1@@^ `0OO0   K\0O/ $K( K,$N$ \0O/@0 P0@00 ,@ $p4 < 8p PK4B0 ^0 ?^1@^ @T@0X0@@` Ѝ& Z Z& ` 0 `0O PO ` P`` ЍG"04C0X0 Y ZnfQ&030#Q0516!P&030#0O/@0  Q ?Q 063UP030#&@Q `V`UP&0 A030#& -顏OLMX`p P  -顏OLMX`p P -LXMt p p`| x0 x&Jᄪ.J`p E媪ZoO`&l` t@|`8@ 4 , @` < 0 P d^  ^P 0 0p(K |@K0 K<0K,Z48l p0O჏8K, K40K,8@4@<0*6々/00 E cXh 8@ 4 Šh0O⨀8@ 4 h  @ < P< Ƞ,Ƞ"h @0#H!\0 8ᑃ.\ d  D X S.D@ᑜ$&.(40D V 20gUXP,8C T0C28T0CR0CVbP0C X`SfH ZH\X 03#Z # 30d  B\H0 d X H ;#;S` N<0P0 @@.#P` $8 " q(Ƞ,ȠT@ a$8P^%L0 !$(H Q 2LV 0ch`(8C U0C2U0CZ0C2Q bP0CWxp`Sa `ZP0T 3# 3 # `0`0CV`0 `@0 0@`@ d``:ʠ5lh%p ` ^ l 0O/@0pl p 0O჏00 T030"S* ! Fpl /O p -LlM  ` 0 &J,JJJ@ 倠D `^oOP`&@px` P`8@ 4 , @P < 0`  @cT ^ x 0O8K, K40KY0^ <@ xP0O@K0 K<0KF0`` @<0 *6D0 D4086!#((*Ƞd |0 `  (|`"( XDpu'l0 `0*h.6#h@ F$H X0 t HP@ d@,p X\@ P@ ȠH ទ)L@ A$pH 垥*'Q2dT l P XR,8| ^,dx&"L`p 0T02T0P`h@*T蠃ࠓ`@\2XP\`T0蠃ࠓ VT%(  Y 2Y 8 S 030#p,0 Q@@0\C)*DPt`|x 0003<0S00S0 0-@PL  QXP0SL 10A00h4](10 AR 0hSxtov -pL0PS U AT01 0S0 005 U e10፭P@ @T&0eD!<0 0c1S10@0`xtovv8o -LM@Pp`P# 46 Z(0 6(0 T$@ (K(0 0 @UC>E0C05 `0  C>@0C!0 B@`@ K$KP(0$  `!30$0 0(0 (0S@@0@ -LP`pP@ 0`PhP5 p0!1 0 P`0@ Q Q @P` XP` P *0 @0S@P`YP`00S 0pGS B p -P0 0p -0 0BPU`Lpڂ UP" T  0R0100@10 d 040 \2.R P0E00\00\0 -LMD PpU0D0 D 0Pp0 RD0< P@ O < 100Q80 * 0080S10000 !PD0  4 "*, 0S D ,pP`5 J$40  Sp 0 R,00,0 < R 8 0S 0 BS<00S<0 <0@ 0@(K -@Lq P00@ -LM0 0pǏ,0 ɯ0@*"P,` QPp 0, 0R ,0 10p00  0(K=PP0P  00  ! 00P 0-L@ODa TAPU/ ` @T P /@P/ `p0S V}@T 0S O}PP@ 00p0S |<}PU 0S \5}LgPP 00, 10 eP8xxtvq  -@L ,0( P00 -P(0`6s!LW(`0 W#A嗩P. 1!0 (1! 0P10D! D , V00  ,0oaꂁA3P  ( dkء P-L@ 0At tv00 -LM41S(K4 0   @0 @ @ HA X <   pP`D! 0 L1 @0PA  0 1P0  @0 @, @' Y$0 S ಐR 0 P |}0Px  p! uPg  1S0C1, 0R00001p0q =W0 pU 80x03 f PJXG<4 001A  0 <30 BQ 1 11  00q ͆0! q0pq5 !D00^ 0 Y P QKR B 0\R! BQ  0R     ( 0 \0 0" 00" 00" 00" 00" 00"0Q200" 00" P  00P  -LM PK 00%0 @% 0STkl  klM@0S0S Q 00Ѕv100,*2 -LM@p`@!  0, S,0K80 4 ( 0 0 R r 1S0C18K0PS U 0`@$K[U[xt -LM0 0pSV  0S 0 0P60,0 K U& , R  Z `1`!@P00V0S V ,@PZ 0 00dS0 PdUP0,0 PU  U 1+#,PP`0 00`S0 (KPU B<B S@ <  ) U@1  `!`1!10 0f @`0 0 00jS0 PdUPPx i 0 00PUb UR:,PG @ `@U0@`` 0@T:P3  00b0 @@0 60 @0f Z0 c6P, ]  P0h0,0 8 000PF 0 @00j  0 0e `@0  0 00P `t p-LP `V 0@f00T`0T  ,P`@`ʼ0@00pp p-<`L0PS0@SaZp[Zxt p-@PL ``0S0 P0SIZp/iP 00>Zphxt' -PLp`PS J0SX@`PUZXu 0-1L @R 0P  Q-   0 0c0 00000  0P @0P Ù0P $000  8#8 0B< S /0t~ p-LpM@PP`0+0 KpK.P0@: S  Q;  0  SL ( 0R  0 p-LM0@C 00   KpK K`&PP h 0 SPP P 0000C0  0PP, -L MpP`0S=@T@0S P" 0S$K$Km 0@P0 p x0 F@l0!0 0@S000 p 0S xtЅw -LMp`18 R P!0L!0v00TY Y Y K P!Xe00@(K P e0S l-Lp@e0S `e0S@@@e@00  -L @P  - L@p -lLMd 0R,0 Tq Lq0   R8,B0 0 㬀K%@ 0K K @@i0P0C `?<   c00P 0@ T0 LD@ 0 0 T0`<, 0R( (0 (K[DxuHxjPy@ -0@L0S0Shxt -LGe<0 R00 R$ hy 0PPyDxLy -L0pSP(U `@P0 000  000  eU 00CS0F0SixtPyHx -8qL0SH(!00C0p @ 00 P@0  0 0 ` @P 0  0P `0 P@0 0  Wp@@? 9xtPyHx P0-LP P@``B@P:<00 - LM0, S*0 R$ p00C00 0 %P, `@0@00  Z 0`,0 ,0RoxtDxHx@-M Ѝ@-MЍ! !P: ZŒŒ#! !P: `B!,aB 0>ZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0  -L@3che -L@\Pp`P h\bQC0S! R0 0% 0S! 00CS1AAAAB BAAAAAAAAAAAAAR<0 0 0;S < 3 0 01 00 0b0 0p0 0d0 00 0; 0 0 00 0b0 0(, @-Q:@- R (2 R R -PPPP RrPP B PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R@- RP1P P1P RrP1P  B P1P B@  R010 1  B R0q0`0q0`0q0`\0q0`0q0`0q0` R 0\6 R B0@-81, Ġ%̌T$\D#L0P  R0@ Ġ01#̌  R R B0@-81, Ƞ%ȌX$XH#H0P  R0@ Ƞ01#Ȍ  R R B0@-81, ̠%Č\$TL#D0P  R0@ ̠01#Č  R P0Sb22c#*_#*JJ[#*2W#*2NϠ8L#* -L` ؕpP @H1B@A01 v P dp 020 0 0 崜8q -LBMcP< , @$ D4 y8 *bPx BNK@D@D0"z Pa*BnK`FBK `FA0A 04 Cp  g # yj  ,2R Pe 0CZBNK@D@D<p`004 0 ^ 0D\1 @<@PY@$00@_S c4R SQQC 0<8$P'p. 8\ `O00`?00, 0R9(KWP@4<`%0BTD h@ F@d : :<BK0NN@``0( K` 0T 0@C@ruXL -LMp`xQ@ 00 0 0C0``(KSL R ..., where is one of: instbin%s: %s not compiled in mount_cd9660dfmountmount_ext2fsarchsyncnewfs_msdossttylndisklabelpaxtarcpiofsck_ext2fscatifconfigsysctlrtsolping6datelessmoremount_nfsfdiskgrepfgrepegrepumountmount_msdosfscksha256mknodreboothaltmount_ffsdhclientcpgzipgunzipgzcatchmodchgrpchownfsck_ffsnewfsrmmtejectmkdirksh-shbioctlsleepmvexprdmesghostname4@eDe4`6`Le@@@Te Xe\e،`e$ l@@deHconv option disabledunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs cannot be zerocbs meaningless if not doing record operationsbuffer sizes cannot be zerobuffer sizes cannot be greater than %zdseek offsets cannot be larger than %qd%s: illegal numeric valuecbsconvfilesibsifobsofskip%s: end of device%s: short write on character device%s: short write on tape devicefiles is not supported for non-tape devicesstdoutinput bufferoutput buffercase conv and -DNO_CONV%zu+%zu records in %zu+%zu records out blockblocks%zu odd length swab %s %zu truncated %s %qd bytes transferred in %ld.%03ld secs (%0.0f bytes/sec) skip reached end of inputmainDhPhd\h`hhhth>|hhhhusage: mount_cd9660 [-egjR] [-o options] [-s offset] special node session number is %s: %segjo:Rs:realpath %scd9660%s: Filesystem not supported by kernel%s on %suserquotagroupquotarwautoaccesstimeatimeexecsuidrdonlyupdateneedsdoes not need-o %s: option %s a value-o %s: option not supported%s: illegal value '%s'usage: %s [-hiklnP] [-t type] [[file | file_system] ...] df: %qd: %s 1024-blocks 512-blocks%-*.*s %s Used Available Capacity Mounted on Filesystem%-*.*s %*lld %10lld %11lld %5.0f%% %s %7s%-*.*s %*llu %9llu %9lld %5.0f%% %7llu %7llu %5.0f%% %s %-*.*s %s Used Avail Capacity Size1K-blocks%-*.*s %s Used Avail Capacity iused ifree %%iused Mounted onempty type listonly one -t option may be specified.hiklnPt:-h and -i are incompatible with -Pretrieving information on mounted file systems%s is not a local file system%s mounted as a %s file systemffsext2fsprmountmountfsmainnfs:@ufs%s: fstab uses outdated type 'ufs' -- fix pleasemfs%s: fstab type %s != disklabel type %susage: mount [-Aadfruvw] [-t type] mount [-dfrsuvw] special | node mount [-dfruvw] [-o options] [-t type] special node -o%s,%s%s on %s type %.*s (%sunknown flag%s %#x, ctime=%sv3v2udptcpsofthardintrnoconnrdirplus%s%s=%dwsizersizerdirsizetimeoretransmaxgrouplistreadaheadacregmin, %s=%dacregmaxacdirminacdirmax%s%s=%lu %smsdos%s%s=%u, %s=%uuidgid%s%s=0%onowin95direxecnorripgensextattprocfsversion %dlinuxstatfs %s%s on %s type %.*s: %s already mountedexec: mount_%sfork%s/mount_%sexec %s for %sno mount helper program found for %sforceAadfo:rswt:uvrqnoautogetmntinfounknown special file or file system %s.root_devicecan't find fstab entry for %s.%s has unknown file system type./var/run/mountd.pidsignal mountdasynchronousasyncexported to the worldkerberos uid mappingNFS exportedanon uid mappingexported read-onlynoatimenoaccesstimenodevnoexecnosuidwith quotasread-onlyroot file systemsynchronoussoftdep/usr/sbinmainDhPhd\h`hhhth>|hhhhusage: mount_ext2fs [-o options] special node o:specified device does not match mounted devicefilesystem not supported by kernelmount table full%s on %s: %susage: machine [-a] usage: arch [-ks] machinearmisharmOpenBSDmain{@@{@h {p{p {p {` {@ { $%s: no default %s%s: illegal %s%s: bad %susage: %s [-N] [-a FAT-size] [-B boot] [-b block-size] [-c cluster-size] [-e dirents] [-F FAT-type] [-f format] [-h heads] [-I volid] [-i info] [-k backup] [-L label] [-m media] [-n FATs] [-O OEM] [-o hidden] [-r reserved] [-S sector-size] [-s total] [-u track-size] special [disktype] %s: bad FAT typevolume ID"*+,./:;<=>?[\]|%s: bad volume label%s: bad OEM stringbytes/sectorsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsfile system sizesectors/track/dev/%s is mounted on %s%s: block devicewarning: %s is not a character device%s: unknown standard format%s: can't figure out partition infoioctl (GDINFO)%s: can't read disk label; disk type must be specified%s: unknown disk type%s: partition is unavailablebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %u-%c is not a legal FAT%s optionblock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectorstoo many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs=%#x bkbs=%s: can't read sector %uNO NAMEFAT%uBSD 4.4%s: can't write sector %u160180320360720120014402880 ( 0U4 md<DH PX `h p |x: $,4<DL T \#d3l#t3|233#@@4@@Ć̆؆ (08 @ H@P@X`hpxcȇЇ؇  Ĉ(08@HPX`lx@@@@̈ Ԉ    (@0@8@H P lC$XC`C$hCp|ȉЉ؉  @@ (08@Hprintmainoption requires an argument -- %sundefmaximum option value is %d -- %soption requires a numeric argument -- %sdiscarddsuspeofeol2lnextminquitreprintstartstatusstopsuspflushrprntillegal gfmt1 option -- %sillegal gfmt1 option%lxcflagiflagispeedlflagoflagospeedgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d TIOCSTOPTIOCSTARTTIOCSETD%d %d rows %scols %sillegal option -- -%scbreakcolscolumnscookeddecekeverythingextproclcasenewoldostartostoprawrowssanespeedttycs5cs6cs7cs8cstopb-cstopbcread-creadparenb-parenbparodd-paroddparity-parityevenp-evenpoddp-oddppass8-pass8hupcl-hupcl-hupclocal-clocalcrtscts-crtsctsmdmbuf-mdmbufignbrk-ignbrkbrkint-brkintignpar-ignparparmrk-parmrkinpck-inpckistrip-istripinlcr-inlcrigncr-igncricrnl-icrnliuclc-iuclcixon-ixon-flowixoff-ixofftandem-tandemixany-ixanydecctlq-decctlqimaxbel-imaxbel-echoechoe-echoecrterase-crterasecrtbs-crtbsechok-echokechoke-echokecrtkill-crtkillaltwerase-altweraseiexten-iextenechonl-echonlechoctl-echoctlctlecho-ctlechoechoprt-echoprtprterase-prteraseisig-isigicanon-icanonnoflsh-noflshtostop-tostopflusho-flushopendin-pendin-crtnewcrt-newcrtnokerninfo-nokerninfokerninfo-kerninfoxcase-xcaseopost-opostlitout-litoutocrnl-ocrnlolcuc-olcuconlcr-onlcronlret-onlretonocr-onocrtabs-tabsoxtabs-oxtabsonoeot-onoeot tablet disc; slip disc; ppp disc; strip disc; nmea disc; #%d disc; ispeed %d baud; ospeed %d baud;speed %d baud; %d rows; %d columns;lflags-extprociflagsoflagscflagscchars%s = %s;%-8susage: %s [-a | -e | -g] [-f file] [operands] -aefgaef:gnot a terminalTIOCGETDTIOCGWINSZgfmt1illegal option -- %stcsetattrTIOCSWINSZlinkitusage: %s [-fhns] source [target] %s [-fs] source ... [directory] %s/%s%s: disappeared%s and %s are identical (nothing done).Ffhnscmplabelduid_parsegetasciilabeledit ;Xmpsavehas_overlapgetuinteditor_allocspaceedit_parmsedit_parmseditor_resizeeditor   @ @@ $ @0(@< %-H@  `N@H_@d `йع t(0@'8@DkȹLTkmPhTk\dttxȹhlp|gt|ttz?/ y?FIĿ/uTL薿Dx5E E)}5Ѷ7 ԇ9gnmf,J< 4vP"Z$ $S~>{ԩfQID+F"z;<! ӹqAv燢cB,'o}G ΢3@ GJ]SSgyVD\Ǎi\qVZ4wjzU.lfؤⲈ뭴n5> ̍7,j֪plj!=>TZW׻ u4K@ꌠj`J .6:_Ju^V]*26a0/ fh/i޼Lirc qY=@ MٔUmHEl*5Ͻi|**ތqSIg: GTJ]Vd X0Dq `K7Y[ H`W2x v<չ]3bEbJS[]0o <{vzf6h6oDRM j/ۭR<:<(ܚo 6"P[?DL#Rx*I0c,|rE Zv JkE,8.g[ /f;oWpz Qg(n $>jJfd 푩+ؗL5RaU(.RH*UHbʋ 3aZ(氩C-&TR%I V3CWڌ\j^v;*[jG7C8T~[e#TCIUgpn }r*fnvX54UDz8lM7+:dXd` kb-yEPߡZX!hU83Uϛ,aQD`qd Ӭ&mgYy%< !!dgE2f1g^o,henU &q dr!>iS@@2e("Ollu^ nWY+›2_MYCh)ortU/_JTۥP軮cjm,JM0~aEUgLAkхS(^Ԋ?6)TB$ q`M D$_x YJ4`2q+ ᱦbDo5u'%dSɾ/3ݛ硙/KNH߀v3o[KkӐNB$xDvX,F'pV $rtga9㘝n|]iRЫ =65:;"NNbLXr`lEp4+8祍^Fl)qFv5|*-e0J|y,)$G'i'r}}aJG I1H@ F U5.ʡzf/T#W]B:JcZզRa%;𳾥O^Ʊ {`=h-RMҪ0Ɏ9xײ`kS7X9 R~aryy_9@j'l< !v 8sA(\թ5EJϓūٝzk91P31@Moe-Iϣ@f\؋Uy[Y!`r5X&GdncbX3 z;~N]&N幼ڰ`/=F]QeG-{+GTeA,PeqPmCf0|fgG1 ,3G7u+EkztQroْl.3;S0q_+M s 4e)u fT [mhV EYRNcwICӽt?z:+ԃRcVܖ7~^+} ,jYS>6^Ҥo)ѯB.[sZB9 ~LR6H TsڭUQ~@v˅JFO S!L\q:yuA}D rZ0oC. B=PGm]y#|쩓t@L |4\z R^eˡAP|;1)nfCY݈[ U`y,ԦS +BMЌk :Qf A .׳h|eE R\O'xiϼT5iiz`@?}Eer Mm9I'GM4N0?A,3lKLh[Lm"ڞ` mAD~f9bNYy!Klx<[%D (Ö[?%JYkk"=]t煀aljԓܸ4ooo?F_懜#F>C߫lU1l܌ M~tH yNY*EJ-X8%иWݏyj0* DI M"Z)hh\j y Fz 8E:;Y\d1?ٽr*h}Jj2h2͂]5UAr!v78 iyM0w@(UoGche ŒF~Aes7}Bks鬟XA>h$Hږ1]#؞ͧ~ hđ֩ [(M ֶ* Xg"^Q&ԶW6 w \[Lj*QIrAӃUöpq?vAi,NF&%i ˄َ vɭ)WQL¥rY6ϕITV݂n*x:GgeSsMos }SAUllO*6܋9,Azh>QcQ@Hy u8ʦ="N0c$'[1P4"Ymh)Qn53빤;PNY2m!fĴfA"4ص* z>e9'Kmг} tƐ)ێ07V  @&dzܨM?)|H=Oj҄g6B?Y"6ր%-ے'm)m-3g0ww&zAƕ%y@b&Nd{]~|>8o׃˵Fu?}zǨbw+QTU1a5E^vn$7AqS_"h TZf$)w̢&5a^-zdÀWӠm%L )/Sef-;..da)ܞ7 F'bV٩]b3gXYɩ\ф^)9k; %+vɌDu @b(/{QJ-F2+ Kٺ GhN` ogѳu/%]<ӿPXŞa|A?3)Ӷv:܃r|BP } t?6>$2+&Ҙ^9b #x|kOO /N9>8?Tp 9~=V9]ʧߣ'#V j?_=𺟯N?W!W ~O%~8y`Wڎ#Z6ώx{h3z ֚ߡ1jOh{E9sz9*^s=W a?z 5~9 \ uOx(}{)x D?E}W3PG~A}m37xH:=Bcwt2Hmϟ=/`ɽ3Wh޼6x,Q=W}L__6~ MbF *mq ^\';o8c=&Uϟ=Mh| "Y}={m+|79=ܢʃ]gX8wdW П;m?д라+xG-`_#?HSa7!& MiL_I|]ޙuы)H飣0.O.a=U]usage: disklabel [-c | -d | -t] [-Av] [-h | -p unit] disk (read) disklabel -w [-c | -d] [-Anv] disk disktype [packid] (write) disklabel -e [-c | -d] [-Anv] disk (edit) disklabel -E [-c | -d] [-Anv] [-F|-f file] disk (simple editor) disklabel -R [-nv] disk protofile (restore) %sdisklabel -%sw [-nv]%s disk disktype [packid] (write) %sdisklabel -%sR [-nv]%s disk protofile [disktype] (restore) `disk' may be of the form: sd0 or /dev/rsd0%c. `disktype' is an entry from %s, see disktab(5) for more info. /etc/disktab`packid' is an identification string for the device. `protofile' is the output from the read cmd form; -R is powerful. For procedures specific to this architecture see: %s fdisk(8)sector size %dsectors/track %dtracks/cylinder %dcylinders/unit %dboot block size %dwarning, boot block size %% sector-size != 0super block size %dwarning, super block size %% sector-size != 0warning, number of partitions (%d) > MAXPARTITIONS (%d)warning, partition %c: size 0, but offset %lldpartition %c: offset past end of unitpartition %c: partition extends past end of unitwarning, unused partition %c: size %lld offset %lld # line %d: syntax errorunknownIDEESDIline %d: warning, unknown disk type: %sbadsectvendorline %d: bad flag: %sdrivedataline %d: bad drivedata %s%d partitionsline %d: bad # of partitionsduidline %d: bad %s: %ssectors/cylindertracks/cylindercylinderstotal sectorsrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekboundstartboundendline %d: bad partition name: %sline %d: too few fieldsline %d: bad partition size: %sline %d: bad partition offset: %sline %d: warning, unknown filesystem type: %sline %d: unknown field: %sVISUALEDITOR/usr/bin/vi/bin/sh%s: No disk label on disk%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of disk%.*s|Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:nc#%u:sc#%u:su#%llu:d%d#%u\ :p%c#%llu:o%c#%llu:t%c=%s:t%c=unknown%d:b%c#%u:f%c#%u:Bootstrap doesn't leave room for disk labelioctl DIOCRLDINFOioctl DIOCGPDINFOioctl DIOCGDINFO/dev/%s%c%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx.aioctl DIOCWDINFOunknown disk type: %s %c: %16llu %16llu %c: %15.*f%c %16llu %7.7s%7d %5u %5u %4hu %19.19s# %s# %s: type: %s type: %d disk: %.*s label: %.*s duid: %02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx flags: badsect vendorbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %llu # total bytes: %.*f%cboundstart: %llu boundend: %llu drivedata: %d %hu partitions: # %16.16s %16.16s fstype [fsize bsize cpg] offset # Notes: # Up to 16 partitions are valid, named from 'a' to 'p'. Partition 'a' is # your root filesystem, 'b' is your swap, and 'c' should cover your whole # disk. Any other partition is free for any use. 'size' and 'offset' are # in 512-byte blocks. fstype should be '4.2BSD', 'swap', or 'none' or some # other values. fsize/bsize/cpg should typically be '2048 16384 16' for a # 4.2BSD filesystem (or '512 4096 16' except on alpha, sun4, ...) No changes.re-edit the label? [y]: bckmgtBCKMGTValid units are bckmgt ABEf:F:hRb:cdenp:s:tvwSMDMSCPold DECSCSIST506HP-IBHP-FLtype 9floppyccdvndATAPIRAIDunusedVersion6Version7SystemV4.1BSDEighth-Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSHFSADFSNTFSUDF-cTreating sectors %llu-%llu as the OpenBSD portion of the disk. You can use the 'b' command to change this. %lluOpenBSD area: ; size: ; free: # %16.16s %16.16s fstype [fsize bsize cpg] Can't stat deviceAvailable commands: ? | h - show help n [part] - set mount point A - auto partition all space p [unit] - print partitions a [part] - add partition q - quit & save changes b - set OpenBSD boundaries R [part] - resize auto allocated partition c [part] - change partition size r - display free space D - reset label to default s [path] - save label to file d [part] - delete partition U - undo all changes e - edit drive parameters u - undo last change g [d|u] - [d]isk or [u]ser geometry w - write label to disk i - modify disklabel UID X - toggle expert mode l [unit] - print disk label header x - exit & lose changes M - disklabel(8) man page z - delete all partitions m [part] - modify partition Suffixes can be used to indicate units other than sectors: 'b' (bytes), 'k' (kilobytes), 'm' (megabytes), 'g' (gigabytes) 't' (terabytes) 'c' (cylinders), '%' (% of total disk), '&' (% of free space). Values in non-sector units are truncated to the nearest cylinder boundary.%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx.%c%s%c none swap sw %s%c %s %s rw 1 %d failed to sort partition table%s: [%s] [d]isk or [u]ser geometryEnter 'd' to use the geometry based on what the disk itself thinks it is, or 'u' to use the geometry that was found in the label.Command aborted BIOS geometry not defined. Note: user geometry is the same as disk geometry. You must enter either 'd' or 'u'. noneWhere to mount this filesystem (ie: / /var /usr)'%c' already being mounted at '%s' Mount points must start with '/' The disklabel UID is currently: %02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx The disklabel UID, given as a 16 character hexadecimal string.Invalid UID entered. partition to deleteThe letter of the partition to delete, a - p, or '*'.Partition must be between 'a' and '%c' (excluding 'c'). Partition '%c' is not in use. partition to nameThe letter of the partition to name, a - p.You cannot name a filesystem of type %s. can't get mem sizePossible values are:"IDE", "%s"Disk typeWhat kind of disk is this? Usually SCSI, IDE, ESDI, CCD, ST506, or floppy."%s" is not a valid disk type. Valid types are: Error, partitions %c and %c overlap: Disable which one? (^D to abort) [%c %c] %s: [%llu] %lldRounding to cylinder: %llu FS typeFilesystem type (usually 4.2BSD or swap)FS type (decimal)Filesystem type as a decimal number; usually 7 (4.2BSD) or 1 (swap).Invalid entry Unrecognized filesystem type '%s', treating as 'unknown' Size of filesystem blocks. Usually 16384 or 4096.Error: block size must be at least as big as page size (%d). Error: block size must be a multiple of the fragment size. Error: block size must be at least as big as fragment size. fragment sizeSize of fs block fragments. Usually 2048 or 512.Zero fragment size implies zero block sizeSize of the partition. You may also say +/- amount for a relative change.The size must be > 0 The size can't be more than %llu sectors, or the partition would extend beyond the last sector (%llu) of the OpenBSD portion of the disk. The 'b' command can change this limit. Sorry, there are only %llu sectors left partition to change sizeThe letter of the partition to change size, a - p.Partition %c is currently %llu sectors in size, and can have a maximum size of %llu sectors. Starting sector for this partition.The offset must be >= %llu and < %llu, the limits of the OpenBSD portion of the disk. The 'b' command can change these limits. The offset must be in a free area. partition to modifyThe letter of the partition to modify, a - p.No space left, you need to shrink a partition The letter of the new partition, a - p.Partition '%c' exists. Delete it first. Starting sectorThe start of the OpenBSD portion of the disk.Size ('*' for entire disk)The size of the OpenBSD portion of the disk ('*' for the entire disk).Changing device parameters for %s: What kind of disk is this? Usually SCSI, ESDI, ST506, or floppy (use ESDI for IDE).label name15 char string that describes this label, usually the disk name.The Number of sectors per track.The number of tracks per cylinder.The number of sectors per cylinder (Usually sectors/track * tracks/cylinder).number of cylindersThe total number of cylinders on the disk.The total number of sectors on the disk.You may want to increase the size of the 'c' partition.Not enough free space to shrink by %llu sectors (only %llu sectors left) partition to resizeNo such partition Cannot resize spoofed partition [+|-]new size (with unit)new size or amount to grow (+) or shrink (-) partition including unitAmount too big Partition %c shrunk to make room No room left for all partitions You need to specify a type for this disk.can't run when there is partition overlap.No 'c' partition found, adding one that spans the disk.Label editor (enter '?' for help at any prompt) unable to get default partition tableThis option is not valid when run without the -f flag. PAGER/usr/bin/lessgunzip -qc|%sunable to execute %sIn no change mode, not writing label.No label changes.Write new label?Write the modified label to disk?unable to write labelResize only implemented for auto allocated labels Free sectors: %16llu - %16llu (%16llu) Total free sectors: %llu. FilenameName of the file to save label into.cannot open %sOriginal label and mount points restored.Last change undone.EnteringExiting%s expert mode Unknown option: %c ('?' for help) /tmp/var/usr/usr/X11R6/usr/local/usr/src/usr/obj/homelfsadosntfsudfsdrzwdFLOPPYxdhdCCDVNDsvndar_revar_drainar_nextlistextractcopyarchiveappendbcpio_wrvcpio_wrcpio_wrcpio_endwrset_crcnode_creatls_ttyls_listabcdfiklnoprstuvwxBDEGHLPTUXYZ0rep_namemod_namerep_addsig_cleanupadd_dirchk_ftimeustar_wrtar_wrCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specForward positioning operation on archive failedCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Reverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %d pad blocksUnable to backspace tape %d blocks.Failed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDUnable to truncate archive filecould not pipecould not fork-dccould not exec %sFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed chdir to %sFailed stat on %sCannot write an archive on top of a directory %s%s: Waiting for tape drive close to complete...done. %s: unknown format, %qu bytes skipped. %qu blocks %s: %s vol %d, %lu files, %qu bytes read, %qu bytes written. Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Ready for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again Cannot identify format. Searching...Sorry, unable to determine archive format.Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot chdir to %sCan't fchdir to starting directorydirectory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sUnable to open %s to readCannot mix current archive format %s with %s%s: Reading archive to position at the end...User specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUnable to append when there are archive read errors.Archive read error limit (%d) reachedCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Write block size %d too large, maximium is: %dWrite block size %d is not a %d byte multipleWrite block size of %d too large, maximium is: %dWrite block size of %d is not a %d byte multipleWrite block size of %d larger than POSIX max %d, archive may not be portableUnable to allocate memory for group name cache tableUnable to allocate memory for user name cache tableUnable to allocate memory for group id cache tableUnable to allocate memory for user id cache tableFile is too large for bcpio format %sCould not write bcpio header for %sCould not write bcpio link name for %sBcpio header field is too small for file %sCpio link name length is invalid: %quCpio link name read errorCpio link name is corruptCpio file name length %d is out of rangeCpio file name in header is corruptedFile is too large for sv4cpio format %sCould not write sv4cpio header for %sCould not write sv4cpio link name for %sSv4cpio header field is too small for file %sFile is too large for cpio format %sUnable to write cpio header for %sUnable to write cpio link name for %sCpio header field is too small to store file %s070702070701070707TRAILER!!!File changed size %sFile %s was modified during readFile rewind failed on: %sFailed seek on file %sFailed write to file %sFile seek on %sWARNING! Major Internal Error! GNU hack Failing!Out of memoryCould not set permissions on %sUnable to set file uid/gid of %sUnable to obtain file stats %sAccess/modification time set failed on: %sUnable to close file descriptor on %sUnable to copy %s, file would overwrite itselfUnable to remove directory %sCould not unlink %scannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCould not create: %sCould not access %s (stat)Unable to link file %s to itselfUnable to remove %sCould not link to %s from %sUnable to link to %s from %sA hard link to the directory %s is not allowedUnable to create %sIgnoring unterminated pathname at EOFIgnoring too-long pathname: %sCan't chdir to %snext_fileFile system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %sWARNING! These file names were not selected:Invalid file name argumentUnable to allocate memory for filenameUnable to allocate memory for file name buffer%b %e %Y%b %e %H:%M%s%s %s %s%2u %-*.*s %-*.*s %4lu,%4lu %9qu == -> %s: unknown option %c %s: %c argument missing Invalid option nameUnable to allocate space for option listInvalid options formatusage: cpio -o [-AaBcjLvZz] [-C bytes] [-F archive] [-H format] [-O archive] < name-list [> archive] cpio -i [-6BbcdfjmrSstuvZz] [-C bytes] [-E file] [-F archive] [-H format] [-I archive] [pattern ...] [< archive] cpio -p [-adLlmuv] destination-directory < name-list usage: tar {crtux}[014578befHhjLmNOoPpqsvwXZz] [blocking-factor | archive | replstr] [-C directory] [-I file] [file ...] tar {-crtux} [-014578eHhjLmNOoPpqvwXZz] [-b blocking-factor] [-C directory] [-f archive] [-I file] [-s replstr] [file ...] usage: pax [-0cdjnOvz] [-E limit] [-f archive] [-G group] [-s replstr] [-T range] [-U user] [pattern ...] pax -r [-0cDdijknOuvYZz] [-E limit] [-f archive] [-G group] [-o options] [-p string] [-s replstr] [-T range] [-U user] [pattern ...] pax -w [-0adHijLOPtuvXz] [-B bytes] [-b blocksize] [-f archive] [-G group] [-o options] [-s replstr] [-T range] [-U user] [-x format] [file ...] pax -rw [-0DdHikLlnOPtuvXYZ] [-G group] [-p string] [-s replstr] [-T range] [-U user] [file ...] directory These format options are not supported %s = %s Invalid block size %sbzip2compress/dev/rst0/dev/rst1/dev/rst4/dev/rst5/dev/rst7/dev/rst8b:cef:hjmopqruts:vwxzBC:HI:LNOPXZ014578-IUnable to open file '%s' for readProblem with file '%s'-Cwrite_opt=nodirTAPEUnknown -H format: %scpio: Known -H formats are:abcdfijklmoprstuvzABC:E:F:H:I:LO:SZ6Destination directory was not suppliedProblem while reading stdinInvalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multipleError count value must be positiveab:cdf:ijklno:p:rs:tuvwx:zB:DE:G:HLOPT:U:XYZ0%s: Invalid combination of options: -%cbcpiosv4cpiosv4crcustarFile name %s/%s, too longWARNING! These patterns were not matched:Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Removing leading / from absolute path names in the archive ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Pattern select out of memoryPattern list inconsistentEmpty pattern stringUnable to allocate memory for pattern stringEmpty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sCpu time limit reached, cleaning up.Signal caught, cleaning up.Can't open current working directory.TMPDIR/tmp/Cannot allocate memory for temp file name.LC_TIMEUnable to set up signal handlercan not gzip while appendingEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [[[[[cc]yy]mm]dd]HH]MM[.SS][/[c][m]]Unable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryCannot canonicalize %sUnable to store mode and times for created directory: %sUnable to allocate memory for directory timesCannot allocate space for directory access time tableCannot allocate memory for device mapping tableCannot allocate memory for interactive rename tableCannot allocate memory for hard link tableDirectory access time reset table ran out of memoryDevice map table out of memoryUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedNo interactive rename table, links may failCannot update rename tableInteractive rename table out of memoryHard link table out of memoryFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sUstar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sFile is too long for ustar %snobodyUstar header field is too small for uid %lu, using nobodyUstar header field is too small for gid %lu, using nobodyUstar header field is too small for %sTar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %swrite_optnodirUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.%s: /dev/ttyFatal error, cannot open %spingersummarymainusage: ping [-DdEefLnqRrv] [-c count] [-I ifaddr] [-i wait] [-l preload] [-p pattern] [-s packetsize] [-T tos] [-t ttl] [-V rtable] [-w maxwait] host patterns must be specified as hex digits%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0x%02xping: sendtoping: wrote %s %d chars, ret=%d Vr HL TOS Len ID Flg off TTL Pro cks Src Dst Data %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %s TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Echo ReplyDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set (MTU %d) frag needed and DF setSource Route FailedNetwork UnknownHost UnknownSource IsolatedDest. Net Administratively ProhibitedDest. Host Administratively ProhibitedDestination Net Unreachable for TOSDestination Host Unreachable for TOSRoute administratively prohibitedHost Precedence ViolationPrecedence CutoffDest Unreachable, Unknown Code: %d Source QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect, Unknown Code: %d(New addr: %s) Echo RequestRouter Discovery Advertisement(%d entries, lifetime %d seconds) Router Discovery SolicitationTime to live exceededFrag reassembly time exceededTime exceeded, Unknown Code: %d Parameter problem, required option absent: pointer = 0x%02x Parameter problem: pointer = 0x%02x TimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask Reply (Mask 0x%08x) Unknown ICMP type: %d --- %s ping statistics --- %ld packets transmitted, %ld packets received, %ld duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/std-dev = %d.%03d/%d.%03d/%d.%03d/%d.%03d ms packet too short (%d bytes) from %s%d bytes from %s: icmp_seq=%u ttl=%d time=%d.%03d ms (DUP!) (TRUNC!) wrong data byte #%d should be 0x%x but was 0x%x%x %d bytes from %s: LSRR: 0.0.0.0 %s (truncated route) (same route) RR: NOP unknown option %xsetresuidnumber of packets to transmit is %s: %sbad interface address: %sbad timing interval: %s%s: only root may use interval < 1spreload value is %s: %spacket size is %s: %stos value is %s: %sttl value is %s: %srtable value is %s: %ssetsockopt SO_RTABLEmaxwait value is %s: %sDEI:LRS:c:defi:jl:np:qrs:T:t:V:vw:unknown host: %s-f and -i options are incompatibleNo audible output for flood pingsbind-R option and -D or -T, or -t to unicast destinations are incompatiblerecord route not valid to multicast destinationsping: record routesetsockopt IP_MULTICAST_LOOPsetsockopt IP_MULTICAST_TTLsetsockopt IP_MULTICAST_IFgetsockoptsetsockoptCannot set the receive buffer sizeCould only allocate a receive buffer of %i bytes (default %i)PING %s (%s): %d data bytes PING %s: %d data bytes ping: recvfrommakeentrylinkupfileerroriblockckinodemainpass2pass2checkpass5setupйع t(0@'8@DkȹLTcatchquitNO SPACE LEFT IN %s (EXPANDED)EXPANDUNREFDIRLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTUNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORYlost+found IS NOT A DIRECTORYREALLOCATESORRY. CANNOT CREATE lost+found DIRECTORY SORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%u CONNECTED. PARENT WAS I=%u NAME=%s %s=%s DIRECTORY CORRUPTEDwrong type to dirscan %d lost+found%d %s I=%uBAD STATE %d TO BLKERR cannot find inode %d bad inode number %d to nextinode Cannot allocate space for inode buffer bad inode number %d to ginode blk %d < cgdmin %d; blk + cnt %d > cgsbase %d blk %d >= cgdmin %d; blk + cnt %d > cgdmax %d LARGE FILES UNSUPPORTED ON REVISION 0 FILESYSTEMSSETTING LARGE FILE INDICATOR SET LARGE FILE INDICATORTRYING TO SET FILESIZE TO %llu ON MODE %x FILE I=%u OWNER=%u MODE=%o SIZE=%llu MTIME=%12.12s %4.4s cannot increase directory list PARTIALLY TRUNCATED INODE I=%uDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDSCLEAR (CLEARED)-%c flag requires a %s usage: %s [-dfnpy] [-b block#] [-m mode] filesystem ... Alternate super block location: %d bad mode to -m: %o ** lost+found creation mode %o b:dfm:npystarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system** Phase 1 - Check Blocks and SizesINTERNAL ERROR: dups with -p** Phase 1b - Rescan For More DUPS** Phase 2 - Check Pathnames** Phase 3 - Check Connectivity** Phase 4 - Check Reference Counts** Phase 5 - Check Cyl groups%d files, %d used, %d free %d files missing %d blocks missing The following duplicate blocks remain: %d,The following zero link count inodes remain: %u, ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW *****EXCESSIVE BAD BLKS I=%u (SKIPPING)CONTINUEEXCESSIVE DUP BLKS I=%uDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%uINODE I=%u HAS DTIME=%12.12s %4.4s (CORRECTED)bad size %llu:HOLD BAD BLOCKbad size %llu ndb %d:bad direct addr: %d bad indirect addr: %d LINK COUNT TABLE OVERFLOWINCORRECT BLOCK COUNT I=%u (%d should be %d)UNKNOWN FILE TYPE I=%uROOT INODE UNALLOCATEDALLOCATECANNOT ALLOCATE ROOT INODE DUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYFIXBAD STATE %d FOR ROOT INODE DIRECTORY TOO SHORTDIRECTORY %s: LENGTH %lu NOT MULTIPLE OF %dMISSING '..'BAD INODE NUMBER FOR '..'BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' BAD TYPE VALUE FOR '..'CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '..' EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEUNALLOCATEDDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORY (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%d ZERO LENGTHBAD/DUP%u: %2x BAD STATE %d FOR INODE I=%ld summary info for cg %d is %d, %d, %d,should be %d, %d, %d SUMMARY INFORMATIONS WRONG FOR CG #%dblk_bitmap:bbmap:BLK(S) MISSING IN BIT MAPS #%dino_bitmap:ibmap:INODE(S) MISSING IN BIT MAPS #%dsummary info bad in superblock: %d, %d should be %d, %d SUPERBLK SUMMARY INFORMATION BADstrdup failedrealloc failedmalloc failed/r%s (%s): UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat rootCan't stat %s %s is not a character device ioctl (GCINFO): %s %s: can't read disk label %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A EXT2 FILE SYSTEM (%s) BAD SUPER BLOCK: %s MAGIC NUMBER WRONGBAD LOG_BSIZEcompat 0x%08x, incompat 0x%08x, compat_ro 0x%08x INCOMPATIBLE FEATURE BITS IN SUPER BLOCKsuperblock mismatchesoffset %ld, original %ld, alternate %ld VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATECan't stat %s: %s %s is not a character deviceCan't open %s: %s ** %sNO WRITE ACCESS (NO WRITE)cannot allocate space for superblock LOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO FSCK_FFS TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ext2fs(8).USING ALTERNATE SUPERBLOCK AT %d state = %d ** F%sile system is clean; not checking ** File system is already clean IMPOSSIBLE RESERVED BLOCK COUNT=%d IN SUPERBLOCKSET TO DEFAULTWRONG FPG=%d (BPG=%d) IN SUPERBLOCKBAD SUMMARY INFORMATIONcannot alloc %u bytes for blockmap cannot alloc %u bytes for statemap cannot alloc %u bytes for typemap cannot alloc %u bytes for lncntp cannot alloc %u bytes for inphead returning to single-user after filesystem check bad file type 0%o cannot allocate buffer pool INTERNAL ERROR: GOT TO reply()%s? no %s? yes %s? [Fyn?] (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %d CANNOT %s: BLK %dProgram terminated SEEKWRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN: %ld,PARTIALLY WRITING %sZERO'ED BLOCK %d TO DISK UPDATE STANDARD SUPERBLOCKSPanic: lost %d buffers MARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEANcache missed %ld of %ld (%d%%) READTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %ld (%ld),deadlocked buffer pool %6d usage: %s [-benstuv] [file ...] benstuvsetifxflagssetifchansetifnwidsetifbssidin6_getaddrvlan_statusieee80211_listchansin_getaddrunsetvlandevsetvlantagsetifwpasetifflagssetvlandevinit_current_mediaieee80211_listnodessetifwpagroupciphersetifwpacipherssetifwpaakmssetifwpaprotosieee80211_statusstatussetifnwkeysetifwpakeyin6_aliasin_status68========x==H>H >(>(>8$>8,>L0>L8>@>ĪL>@\>hh>4p>4x>4>42d>d2>2>>t>H>>>>\4T4>>P>P?؁?؁$?؁0?؁H؁8?؁D?؁L?؁T?؁\?؁d?؁p?؁x?؁|?؁`=??? ??@??4?P?ܩlxL???t?ė<i i@4h=8i ixT ? @` @@ @$@,@`h8@x#@@#H@#P@#T@$\@$d@$l@$p@%x@%@%@%@&@&@'@'@(@(@)@)@*@*@+@+A, A,A,A-$A-0A-4A.randommalformed link-level addressSIOCSIFLLADDRSIOCGIFXFLAGSSIOCSIFXFLAGS[#%d]usage: ifconfig [-AaC] [interface] [address_family] [address [dest_address]] [parameters] invalid channel %s: %sSIOCS80211CHANNELmtu %s: %sSIOCSIFMTUprefix %s: %sbad hexadecimal digitshexadecimal digits too longstrings too longSIOCS80211NWIDmalformed BSSID: %sSIOCS80211BSSID%s: bad value%s=%o%s=%xmedia mode %smediaopt instance %d"%.*s"0x vlan: %d priority: %d parent interface: %s SIOCG80211ALLCHANS %4s %-8s %s chanfreqproperties %4d %4d MHz passive scan%i%i: bad prefixlenSIOCGETVLANSIOCSETVLANvlan tag %s: %sSIOCG80211WPAPARMSSIOCS80211WPAPARMSSIOCGIFFLAGSSIOCSIFFLAGSSIOCIFDESTROYinvalid vlan tag and device specificationSIOCGIFMEDIA%s: no link type?only one `instance' command may be issuedmust specify `media' before `instance'media instance %s: %sinvalid %s %s: %s%s not allowed for the AFvltimepltimenwid chan %u bssid %s lladdr %s %u%% %udB powersave %uMESSIBSSCF_POLLABLECF_POLLREQPRIVACYSHORT_PREAMBLEPBCCCHNL_AGILITY SPECTRUM_MGMT QOS SHORT_SLOTTIME APSDDSSSOFDMDELAYED_B_ACKIMMEDIATE_B_ACKCACHEBSSAUTHASSOCCOLLECT no permission to scanSIOCG80211ALLNODES none restoreunknown %s media mode: %sonly one `mode' command may be issuedinvalid media mode: %sunknown %s media subtype: %sonly one `media' command may be issuedmay not issue `media' after `mode' commandsmay not issue `media' after `mediaopt' commandswpagroupcipher: unknown cipher: %sstrdupunknown %s media option: %sonly one `-mediaopt' command may be issuedmay not issue both `media' and `-mediaopt'only one `mediaopt' command may be issuedmay not issue `mediaopt' after `instance'wpaciphers: unknown cipher: %s802.1xwpaakms: unknown akm: %swpa1wpa2wpaprotos: unknown protocol: %s ieee80211: nwid chan %u bssid %s %u%% %udB nwkey persist%d: wpakey wpaprotos %swpa2 wpaakms %s802.1x wpaciphers wpagroupcipher powersave on (%dms sleep) (auto) %ddBm%sHIDENWIDNOBRIDGEUPBROADCASTDEBUGLOOPBACKPOINTOPOINTNOTRAILERSRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTTXREADYNOINET6INET6_PRIVACYMPLSWOL rdomain %i metric %lu mtu %lu lladdr %s status: %s %s: no media types? media: supported media: physical address inet%s %s --> %spersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEYSIOCG80211NWIDwpakey: invalid pre-shared keywpakey: passphrase must be between 8 and 63 characterswpakey: nwid not setwpakey: passphrase hashing failedSIOCS80211WPAPSKinterface index is already filledgetifaddrscould not determine link local address inet6 %sSIOCGIFDSTADDR_IN6 -> %sSIOCGIFNETMASK_IN6 prefixlen %dSIOCGIFAFLAG_IN6 anycast tentative duplicated detached deprecated autoconf autoconfprivacy scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime inet %sSIOCGIFNETMASKSIOCGIFDSTADDR --> %s netmask 0x%xSIOCGIFBRDADDR broadcast %sSIOCIFCREATE%s: no such interface interface name '%s' too longcreatedestroyinet6'%s' requires argument'%s' requires 2 argumentsSIOCDIFADDRSIOCAIFADDRarp-arpdebug-debugalias-aliasdeletenetmaskmtunwid-nwidbssid-bssidnwkey-nwkeywpa-wpawpaakmswpacipherswpagroupcipherwpaprotoswpakey-wpakeywpapsk-wpapsk-chanbroadcastvlanvlandev-vlandevanycast-anycasttentative-tentativeeui64autoconfprivacy-autoconfprivacygrouppowersavepriorityrtlabelvlanpriotxpowernwflagrdomain-inet6descriptiondescrwol-wollink0-link0link1-link1link2-link2mediamediaopt-mediaoptinstanceinstlladdrinetEthernetetherFDDIIEEE802.11TDMCARPautoselectmanual10baseT10baseT/UTP10UTP10base210base2/BNC10BNC10base510base5/AUI10AUI100baseTX100TX100baseFX100FX100baseT4100T4100baseVG100VG100baseT2100T21000baseSX1000SX10baseSTPSTP10STP10baseFLFL10FL1000baseLX1000LX1000baseCX1000CX1000baseT1000T1000baseTX1000TXHomePNA1HPNA110GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10GbaseCX410GCX410GBASE-CX42500baseSX2500SX10GbaseT10GT10GBASE-T10GSFP+Cu10GCuSingle-modeSMFMulti-modeMMFCDDIFH1FH2DS2DS5DS11DS1DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72t1t1-amie1e1-g.704e1-amie1-ami-g.704t3t3-m13e3e3-g.751e3-g.832e1-g.704-crc411a11b11gfhmasterfull-duplexfdxhalf-duplexhdxflag0flag1flag2loopbackhw-loopbacklooprxpausetxpausedual-attachdasadhochostapibssibss-mastermonitorturbohdlc-crc16pppframerelay-ansiframerelay-ciscoframerelay-ituno carrierno networkbackupactivekeepalive downusegroupwep40tkipccmpwep104displayprintlong %s: %s: %s: directory causes a cyclefts_readCOLUMNS1ACFHLRSTacdfghiklmnopqrstux%*u %*qd total %lu %s %*u %-*s %-*s %3d, %3d %*s%*qd %*s ls: %s: %s usage: %s [-1AaCcdFfgHhikLlmnopqRrSsTtux] [file ...] usage: sysctl [-n] name %s=kern.osreleasehw.machinehw.modelhw.producthw.disknameshw.ncpufoundwarnmsgrtsol_timer_updateifconfigmake_packetmainrtsol_check_timerrtsol_inputsendpacketrtsol_inputsendpacketsockopeninterface_statusinterface_uplladdropt_fillinterface_statusinterface_upget_llflagdefrouter_probedefrouter_probesendprobeprobe_initmultiple interfaces foundreallocprobing %s<%s> %sillegal interface state(%d) on %sstop timer for %sset timer for %s to %d:%dfailed to get link layer information for %sinterface %s was already configuredmemory allocation failedlink-layer address option has null length on %s. Treat as not included.memory allocation failed for %susage: rtsol [-DdF] [-O script-name] interface ... rtsol [-DdF] -a usage: rtsold [-1DdFfm] [-O script-name] interface ... rtsold [-1DdFfm] -a adDFO:adDfFm1O:kernel is configured not to accept RAskernel is configured not to accept redirectskernel is configured as a router, not a hostfailed to open a socketfailed to initialize interfacesfailed to initialize %sfailed to setup for probing routerstimer expiration on %s, state = %d%s status is changed from %d to %dNo answer after sending %d RSsthere is no timerNew timer is %ld:%08ldselect: %srecvmsg: %sfailed to get receiving interfacefailed to get receiving hop limitpacket size(%zd) is too shortinvalid icmp type(%d) from %s on %sinvalid icmp code(%d) from %s on %sinvalid RA with hop limit(%d) from %s on %sinvalid RA with non link-local source from %s on %sreceived RA from %s on an unexpected IF(%s)received RA from %s on %s, state is %dsend RS on %s, whose state is %dsendmsg on %s: %smalloc for receive msghdr failedmalloc for send msghdr failedff02::2inet_pton failed for %ssocket: %sIPV6_RECVPKTINFO: %sIPV6_RECVHOPLIMIT: %ssetsockopt(ICMP6_FILTER): %sunsupported link type(%d)ioctl(SIOCGIFFLAGS) on %s: %sioctl(SIOCGIFMEDIA) on %s: %sioctl(SIOCGIFFLAGS): %sioctl(SIOCSIFFLAGS): %schecking if %s is ready...socket(SOCK_DGRAM): %sgetifaddrs: %sioctl(SIOCGIFAFLAG_IN6): %sget_llflag() failed, anyway I'll try%s is ready%s is tentative%s is duplicatedlo0ioctl(SIOCGDRLST_IN6): %sdefault router list contains a non-link-local address(%s)probe a router %s on %sshutdown: %snigrouppr_iphdnsdecodesummarypr_rthdrpr_icmphpr_nodeaddrpr_packmain](V]]]usage: ping6 [-dEefHmNnqtvWw] [-a addrtype] [-b bufsiz] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [hops ...] host ff02::2:0000:0000-%uVr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->\%03o --- %s ping6 statistics --- +%ld duplicates, %.1lf%% packet lossround-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms path MTU for %s is notified. (ignored) NodeInfo Supported Qtypes, compressed bitmap, raw bitmap???nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu HbH Options: Dst Options: Routing: sendmsgping6: wrote %s %d chars, ret=%d IP6HBH DSTOPT FRAG RTHDR AH ICMP6: type = %d, code = %d ESPUnknown Header(%d) No Route to DestinationDestination Administratively UnreachableDestination Unreachable Beyond ScopeDestination Unreachable, Bad Code: %d Packet too big mtu = %d Time exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option Bad code(%d) pointer = 0x%02x Listener QueryListener ReportListener DoneRouter SolicitationRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sNode Information QueryNOOPSupported qtypesDNS namenodeaddrIPv4 nodeaddrunknown qtype, subject=%s(%s), oldfqdn, no subject, subject=%sDNS label(invalid), invalidNode Information Reply, %sBad ICMP type: %drefused truncated no address %s(TTL=infty)(TTL=%u)invalid peernamefailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%g ms(DUP!)extra (%d bytes %s)refused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luinvalid socket buffer sizeMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %stoo small interval, raised to 0.01Must be superuser to preloadillegal preload value -- %s-R is not supported in this configurationinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %da:b:c:dEefHg:h:I:i:l:mnNp:qRS:s:tvwWtoo many intermediate hopsgetaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface namecan't initialize rthdrbad addr family of an intermediate addrcan't add an intermediate nodeUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP setsockopt(IPV6_RTHDR)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> pollrecvmsgnew path MTU (%d) is notified IPv6 addressIPv4 addressSuccessRefusedmainusage: %s [-aju] [-d dst] [-r seconds] [-t minutes_west] [-z output_zone] %-*s[+format] [[[[[[cc]yy]mm]dd]HH]MM[.SS]] illegal time formatUTCcannot unsetenv TZad:jr:ut:z:settimeofday%a %b %e %H:%M:%S %Z %Yspecified date is outside allowed rangeCould not get local time of dayadjtimedate set by %stoo many argumentsltget_envget_termraw_modeeditcharbin_fileplinenumopt_xinttoalinenumtoapostoaless_printfap_linenumap_intap_pos?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for data?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?m(%T %i of %m) .?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%tCannot allocate memoryLESSSECURE-E-G-L-mMORELESS--WARNING: terminal is not fully functionalLESS_TERMCAP_krklkukdkPkNkh@7kDLINESlicoTERMhcxndadbsgpcticdcmsomdmbvbbc|^srNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketseek error to 0ch_ungetchar overrunseek errorread errorESC^%c*s<%X>ungetcc overflowless %s(P)+Non-match First-file EOF-ignore Keep-pos Regex-off Pattern not found [Press space to continue, 'q' to quit.] helpCommand not available(N-th) No %snext fileNo %sprevious fileNo such filemark: goto mark: Brackets: [Press 'h' for instructions.]Warning: some edit commands disabledWarning: some commands disabled"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETAESCAPE\LESSMETACHARS; *? '"()<>|&^`#\%c%s%c%s %s %sLESSCLOSELESSOPEN...skipping... Cannot find help fileCannot seek to that file positionCannot seek to end of fileDetermining length of fileDon't know length of fileCannot seek to beginning of fileCannot seek to line number %n~ LESSANSIENDCHARSCalculating line numbersInvalid mark letterMark not set-" must be followed by 1 or 2 charsquotes %sUse "h" for helpTab stops and then every %d spacesless Copyright (C) 2002 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less Line number is required after -lValue is required after %sNumber is required after %s-%sThere is no %s option ("less --help" for help)There is no %s optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionBe less helpful in promptsBe helpful in promptsSearch includes displayed screenSearch skips displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by clearing each lineRepaint by painting from top of screenAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesAllow help commandDon't allow help commandCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: Position target at screen line %dDon't display a status columnDisplay a status columnDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numbersprompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linesDisplay underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: Horizontal shift %d positionsUse keypad modeDon't use keypad modefakeNo previous regular expressionPlease re-enter search patternInvalid patternNothing to searchLine numbers turned offmainDhPhd\h`hhhth>|hhhnhpapvtv|vmv m@vvllv v@vtmmmmusage: %s [-23bcdilsTU] [-a maxreadahead] [-g maxgroups] [-I readdirsize] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-w writesize] [-x retrans] rhost:path node hostname too longno : or @ speccan't resolve address for host %sNFS PortmapCannot MNT PRCbad MNT RPCcan't access %s: %s-2 and -3 are mutually exclusiveillegal -a value %s: %sillegal -g value %s: %sillegal -I value %s: %sconflicting version optionsillegal -R value %s: %sillegal -r value %s: %sillegal -t value %s: %sillegal -w value %s: %sillegal -x value %s: %s23a:bcdD:g:I:iL:lo:PR:r:sTt:w:x:Ubgconndumbtimernfsv3mntudpresvportnfsv2acmainUSER_print_diskUSER_modifygetuintask_numask_cmdMBR_pcopyunused DOS FAT-12 XENIX / XENIX /usr DOS FAT-16 Extended DOSDOS > 32MB NTFS AIX fs AIX/Coherent OS/2 Bootmgr Win95 FAT-32 Win95 FAT32LDOS FAT-16 Extended LBAOPUS OS/2 hidden Compaq Diag.OS/2 hidden OS/2 hidden OS/2 hidden AST swap Willowtech ThinkPad Rec Willowsoft $NEC DOS 'Win Recovery8Theos 9Plan 9 @VENIX 286 ALin/Minux DRBLinuxSwap DRCLinux DR MQNX 4.2 Pri NQNX 4.2 Sec OQNX 4.2 Ter PDM QDM RCP/M or SysVSDM TOntrack UEZ-Drive VGolden Bow \Priam aSpeedStor cISC, HURD, *dNetWare 2.xxeNetWare 3.xxfNetWare 386 gNovell hNovell iNovell pDiskSecure uPCIX Minix (old) Minix (new) Linux swap Linux files*OS/2 hidden Linux ext. NT FAT VS NTFS VS Linux LVM Amoeba FS Amoeba BBT Mylex BSDI NotebookSaveFreeBSD OpenBSD NEXTSTEP MacOS X NetBSD MacOS X bootMacOS X HFS+BSDI filesy*BSDI swap Solaris CTOS DRDOSs FAT12DRDOSs < 32MDRDOSs >=32MHPFS DisbledCPM/C.DOS/C*Dell Maint SpeedStor SpeedStor SpeedStor BeOS/i386 EFI GPT EFI Sys SpeedStor DOS 3.3+ SecSpeedStor Xenix BBT XwriteXreinit[[S~UWf)_pvHv9!LRFݞV7[KRlLjc鋴7)ou89Z'/z%ߩD-tv`Pqkky/_w+b0A]Βs|et2K2]&U,\yiӕWi&2K%giYRe #`A Mr0L4]^y <&Nsӵ%Z< b5r腔MQfRqna=jr1 uE`Cn @JEgu—7w2NUhW 2ҫ4:Zu"uJ̆^DIENTzJ3Q)̶viİxz2O3/y:8h =0 TͶ`/^ UrDXp\ fB݊38 :OEfK6  zbbrJ"d4/bb\lluN >ԏnڛC"IzNx%Fyq5{0S㙧̅S:Hzg-U,![[hMmv i`mb窈.,4⠈Kuch/Nެ Jr ƪ!g`%͹h_rnT*Ѻx₝#T8ҦC` T+OpipL6l7gmQY+u|cNV] y$fKâ 7Wg`kw`T\MT˩x?גoz*^5[EAuoUӳYw)(aDq '}(ⴏ?,ڂ"725$!5; ;uq䑊! FdR[1KA5|H,aZE+FiBa_v׸SH֒Kc7 {'yG/K$ <> .< ī=% "h1k$ :ɣ̺n~ :g-%[/ sGBmE^CV*Q n]ϣ D֡W*^J{NfhXF `K+ HsLby֪H=e Yq-ya@- DoCeŸB#D ƺ\)[Xun>0.8BRŴ&yM;PrZxiD@o%d?Yņ2H3gUX9Ykw5E!fltqf=k ˗ eH`j)8XG)-0K/6MS6m? OT{c8I) dzjI WPxeֱ>5톟j/D J}/[VWx7Y ~'m4Ģ&$v,zv%ʟjvwO5;dBqF48xlhفeos!=;o6xNtG>P˷//~OB®s%;y,ݍ-?- 7Y郢J|AI 9Ga_~GHx|2wQ׷ []Z?|9vYXr8:9&9O'Cq]k*?_՛@t_&{;noillZi\(9Bgl&Khz-efeԝ%2:F0="_&GtQkfU`S zv_ŐlkW:]]?@: ̶0:DFRJ#]㱊\M᳉v=M^T}e/nLs mǤX +oʰL)uUB~GaF=}.eQҬ+D #Hfҗ)FY a>,J#Ӿ&Qٖ#L \*~Dxl/,wwDZp?3Oqp`[L8~xrs%&3훗΁i;Gv3—@sH,=W4@L-[naϨ[v)a9$2K*9G[-"Ò+GkvUߘϣ7jFYLQ,3E9]̋$^6qWot)3=u$=Pː >%_ȻNñjXk^߯7迺;9E"FMFz> Ǔd>tynzV/hcS^ˏd7`;@Tj|ts/jQ#HTpѰ^OW˱ZRolkB(e/[>Wvrn~Kgj~?? GD/4Q|29eJ0ӳdh8r#FITZ@if1249LItl8uf0>;φ%p|r20:I NN߃͢-Qh4:@.fyцRIat6[&h@L\)ݡ.'NM>/͵f2NAwK0<$iz0g rԱ<YTT޸hr' l9e pN#o;qZ蟕؝›*ٓ[m&^S~od({jMRƷᾙZ~d\ sS& vTW*w_|R=kh{+15uN2usage: %s [-eiuy] [-c cylinders -h heads -s sectors] [-f mbrfile] disk -i: initialize disk with virgin MBR -u: update MBR code, preserve partition table -e: edit MBRs on disk interactively -f: specify non-standard MBR template -chs: specify disk geometry -y: do not ask questions `disk' may be of the forms: sd0 or /dev/rsd0c. Cylinder argument %s [1..262144].Head argument %s [1..256].Sector argument %s [1..63].ieuf:c:h:s:yPlease specify a full geometry with [-chs].Can't get disk geometry, please use [-chs] to specify.using builtin MBRUnable to read MBRerror initializing MBROffset: %lld Enter 'help' for informationfdisk:%c%d> Invalid command '%s'. Try 'help'. Aborting changes to current MBR.Do you wish to write new MBR?Do you wish to write new MBR and partition table?Command help listShow entire OpenBSD man page for fdiskreinitRe-initialize loaded MBR (to defaults)setpidSet the identifier of a given table entryEdit current drive statseditEdit given table entryflagFlag given table entry as bootableUpdate machine code in loaded MBRSelect extended partition table entry MBRSwap two partition entriesPrint loaded MBR partition tablewriteWrite loaded MBR to diskexitExit edit of current MBR, without saving changesQuit edit of current MBR, saving current changesabortAbort program without saving current changes%s: [%u] Rounding to nearest cylinder: %u %s [n] %s [%X - %X]: [%X] %s [%d - %d]: [%d] (? for help) '%s' is not a valid number. '%d' is out of range. BytesSectorsKilobytesMegabytesGigabytesDisk: %s geometry: %d/%d/%d [%.0f %d-byte %s] geometry: %s is not a character device or a regular fileDIOCGPDINFOSignature: 0x%X Start of partition #%d after end! Starting Ending LBA Info: #: id C H S - C H S [ start: size ]-------------------------------------------------------------------------------%c%1d: %.2X %6u %3u %3u - %6u %3u %3u [%12u:%12.0f%s] %s Warning CHS values out of bounds only saving LBA valuesChoose from the following Partition id values:%02X %s %02X %s %02X %s %02X %s %s %s Invalid argument: %s [value] Invalid partition number.Partition %d marked active. Partition %d flag value set to 0x%x. Machine code updated.Writing MBR at offset %d. error writing MBROffset: %d Invalid argument: %s Partition %d is not an extended partition. Loop to offset 0! Not selected.Selected extended partition %d New MBR at offset %d. Partition id ('0' to disable) Invalid argument: %s Invalid partition number %d. Swap with what partition?%d same partition as %d, doing nothing. Change disk geometry?BIOS CylindersBIOS HeadsBIOS SectorsPartition %d is disabled. Do you wish to edit in CHS mode?BIOS Starting cylinderBIOS Starting headBIOS Starting sectorBIOS Ending cylinderBIOS Ending headBIOS Ending sectorInvalid offset.Size of the partition.Invalid size.In memory copy is initialized to:Use 'write' to update disk.bin_fileinvalid file type(standard input)(fd %d)usage: %s [-abcEFGHhIiLlnoqRsUVvwx] [-A num] [-B num] [-C[num]] [-e pattern] [-f file] [--binary-files=value] [--context[=num]] [--line-buffered] [pattern] [file ...] ^\((%s[[:<:]]%s%.*s%s[[:>:]]%scontext out of rangegrep version %u.%u binarywithout-matchtextUnknown binary-files optionCan't use small fgrep with -wbinary-filesmmapline-bufferedafter-contextbefore-contextextended-regexpfixed-stringsbasic-regexpwith-filenamebyte-offsetregexpno-filenameignore-casefiles-without-matchfiles-with-matchesline-numberquietsilentrecursiveno-messagesrevert-matchword-regexpline-regexpunix-byte-offsets0123456789A:B:CEFGHILRUVabce:f:hilnoqrsuvwxyLine is too big to processBinary file %s matches umountfsusage: %s %s umount [-fv] special | nodeumount -a [-fv] [-h host] [-t type]%s: not currently mounted%s: not a directory or special device%s: unmount from %s Bad MNT RPCafh:t:vmainDhPhd\h`hhhth>|hhhho@usage: mount_msdos [-9lsx] [-g gid] [-m mask] [-o options] [-u uid] special node invalid file mode: %sunknown user id: %sunknown group id: %ssl9xu:g:m:o:stat %snot an MSDOS filesystemcheckfsfsck_%snostart %s %swait %s%s/fsck_%sexec %sCan't get resource limit to max data sizeCan't get resource limit for data size-b %sInvalid option stringusage: %s [-dfnpvy] [-b block#] [-l maxparallel] [-T fstype:fsoptions] [-t fstype] [special | node ...] dvpfnyb:l:T:t:%s: unknown special file or file system.Can't open checklist file: %s/etc/fstabpass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s: Unknown pid %lddone %s: %s (%s) = %x %s: %s (%s): EXITED WITH SIGNAL %d THE FOLLOWING FILE SYSTEM%s HAD AN %s UNEXPECTED INCONSISTENCY:%s: %s (%s)%smainusage: sha256 outfile usage: %s [-m mode] fifo_name ... usage: %s [-m mode] name b|c major minor %s [-m mode] name p node must be type 'b' or 'c'.non-numeric major number.non-numeric minor number.major or minor number too largemkfifoinvalid file mode.m:sodumpinet6_makenetandmaskprint_rtmsgmonitorPDG\DPDhDXCXCXCpDpDpDtH8xDnetname6routenamep_flagsp_rtentry0123456789abcdefUGHRBD M@dmCXLS1@2 3cJPTdefaultconnectedstaticospfis-isbgpbad label: %s is %sking bula sez: set_metric with invalid keyset_metric: %s is %sinvalid table id: %srouting table %ilabel too longprefixlen is not supported with af %dprefixlen %s is %s%s: link %s; %s: inet %s; %s: inet6 %s; 128internal error%s: resolved to multiple valuesmpls labels require -in or -out switch%s: not a network%s: bad address%d: bad address familybotched keyword: %susage: %s [-dnqtv] [-T tableid] command [[modifiers] args] commands: add, change, delete, exec, flush, get, monitor, show setrtable sockaddrs: locks: inits: route to: %s routing message version %d not understoodmessage length mismatch, in packet %d, returned %dRTM_GET: %s (errno %d)destination: %s mask: %s gateway: %s interface: %.*s if address: %s mpls label: %s %s priority: %u (%s) flags: label: %s use mtu expire%8llu %8u%c %8d%c sockaddrs: [rtm_type %d out of range]: len %d, if# %d, name: %s, link: %s, flags:, metric %d, flags:, if# %d, name %s, what: arrivaldeparture, priority %d, table %u, pid: %ld, seq %d, errno %d flags: use: %8llu mtu: %8u%c expire: %8d%cso_dstso_gateso_maskso_genmaskso_ifpso_ifaso_labelso_srcwriting to routing socketread from routing socketmust be root to alter routing table-mplslabel requires -inet or -inet6-in requires -mpls-out requires -mpls-out requires -push, -pop, -swap-pop requires -mpls-push requires -mpls-swap requires -mplspriority is %s: %snetmask missingnet: gateway %s (%s)entry in userouting table overflownot in tableroute-sysctl-estimateactual retrieval of interface tablesetsockopt(ROUTE_MSGFILTER)setsockopt(ROUTE_TABLEFILTER)got message of size %d on %sno such interface %sactual retrieval of routing tableExamining routing table from sysctl(address family %s) write to routing socketgot only %d for rlen %-20.20s donednqtT:v/dev/nulladdblackholechangecloningdstencapexpiregatewaygenmaskgethopcountifaifpjumbolinkllinfolocklockrestmpathmplslabelnojumbonostaticpopproto1proto2pushrecvpiperejectrttrttvarsasendpipeshowssthreshxresolveRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics or flagsRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_RESOLVE: Route created by cloningRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_IFINFO: iface status changeRTM_IFANNOUNCE: iface arrival/departureRTM_DESYNC: route socket overflowPUSHLOCALPOPSWAPlink#%dillegal prefixlen%s/%d%u/%d%u.%u/%d%u.%u.%u/%d%u.%u.%u.%u/%daf %d: %s(%d) %s%-6s %-*.*s %-6u/esp/ah/ipcomp/ipip//use/require/acquire/deny/bypass/dontacq//in/out%-*s %-5u %-*.*s %-5u InternetInternet6Encap Protocol Family %d: MPLS%-18s %-5s %-18s %-5s %-5s %-22s SourcePortProtoSA(Address/Proto/Type/Direction)%-9s %-9s %-6s %-18s %-6.6s %5.5s %8.8s %5.5s %4.4s %s In labelOut labelOpGatewayFlagsRefsUseMtuPrioInterface%-*.*s %-*.*s %-6.6s %5.5s %8.8s %5.5s %4.4s %sIfaceLabel%-6.6s %5u %8llu %5u %5s %2d %-5.16ssysctl of routing tableRouting tablesspd-sysctl-estimatesysctl of spd Encap:url_getauto_fetchļdataconngetreplyabort_remoteinitconnhookupmaingetitmgetptransferprogressmeterfileindirremglob2ftp_login KMGTPftp://http://file::/Can't allocate memory for URL decoding <>"#{}|\^~[]`receivedCan't allocate memory to parse URLurl_get: Invalid URL '%s'No `/' after host (use -o): %sNo filename after host (use -o): %sNo filename after directory (use -o): %sCan't allocate memory for proxy URL.Malformed proxy URL: %serror in base64 encodingCan't open file %sCan't open %sCan't allocate memory for transfer bufferWriting %sReading from file(unknown)Trying %s... r+Requesting %sCan't allocate memory for URL encoding%%%02x (via %s) GET %s HTTP/1.0 Proxy-Authorization: Basic %s%s %s User-Agent: OpenBSD ftpGET %s HTTP/1.0 %s%s GET /%s %s Host: HTTP/1.0Can't allocate memory.[%s]:%s %s%s Writing HTTP requestReceiving HTTP replyError retrieving file: %sToo many redirections requestedContent-Length: Location: Relative redirect not supportedCannot allocate memory for URLRedirected to %s Reading from socketRead short file. Auto-login using ftp URLs isn't supported when using $ftp_proxyImproper response from %sftp_proxyhttp_proxyCan't allocate memory for auto-fetch.Invalid URL: %sCan't connect or login to host `%s'*?[]{}NLSTRetrieving %s/%s mget file fetch aborted. http fetch aborted. Extra `@' characters in usernames and passwords should be encoded as %%40Forced abort. The connection will be closed. local: %srunique: can't find unique file name. receive aborted waiting for remote to finish abort. acceptsetsockopt TOS (ignored)%c%c%c421 Service not available, remote server has closed connection. Lost control connection for abort.%cABOR No control connection for command.QUITRETRSTOUSTORPASVproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s use of scoped address can be troublesomeEPSVwrong server: return code must be 229 LPSVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u%c%c%c%d%cparse error! setsockopt (reuse address)setsockopt IP_PORTRANGE (ignored)setsockopt IPV6_PORTRANGE (ignored)listenEPRT |%d|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dlocal: %s remote: %s REST %lldnetin: %slocal: %s: %s%s: short writeWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sftpgatehttp%s: bad port number `%s'connect to address %sfdopen failed.Connected to %s. usage: %s [-o output] ftp://[user:password@]host[:port]/file[/] ... %s [-o output] http://host[:port]/file ... %s [-o output] file:file ... %s [-o output] host:/file[/] ... FTPSERVERPORTFTPMODEpassivegateunknown FTPMODE: %s. Using defaultsgate-ftpFTPSERVERNeither $FTPSERVER nor $GATE_SERVER is defined; disabling gate-ftpdumbemacssukeep alive amount is %s: %sretry amount is %s: %s46AaCc:dEegik:mno:pP:r:tvVnmap: unbalanced brackets. CWD %sCWD command not recognized, trying XCWD. XCWD %scan't get cwdSkipping non-relative filename `%s' a+winternal error: unknown type %d.TYPE %s %sTYPE %susage: %s [ | Using %s mode to transfer files. %s: unknown mode. asciiimageebcdictenex%lld byte%s %s in %.2f seconds (%.2f %sB/s) ETA: %02d:%02d:%02d %-*.*s%s %3d%% %3d%% |%.*s%*s|************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************* %5lld %c%c %2d:%02d:%02d --:-- ETA - stalled -%02d:%02d ETAUnable to determine real path of `%s'%s: not foundunable to create temporary file: %sftpXXXXXXXXXXLISTcan't find list of remote files, oops. can't find list of remote files, oops.anonymous%s@Name (%s:%s): Name (%s): USER %sPassword:PASS %sAccount:ACCT %sLogin %s failed.Already connected to %s, use close first. gateserver not defined (shouldn't happen)PASSERVE %sConnected via pass-through server %s non-printstreamSYSTRemote system type is %s. 215 UNIX Type: L8215 TOPS20Remember to set tenex mode when transferring binary files from this machine. SIZE %sMDTM %s191Y2K warning! Fixed incorrect time-val received from server. %*s %04d%02d%02d%02d%02d%02dCan't convert %s to a time. mainusage: %s [-dn%sq] dlnpqhalted (with powerdown) by %shalted by %srebooted by %s~SIGTSTP init/etc/rc/dev/consolerevokesetsidopenSIGTERM processesWARNING: some process(es) wouldn't die(can't restart init): mainDhPhd\h`hhhth>|hhho@pah`nlpusage: mount_ffs [-o options] special node filesystem must be mounted read-only; you may need to run fsckreloadget_ifnamepriv_script_write_paramssend_requestroutehandlerparse_reject_statementparse_option_declget_rdomaininterface_link_statusinterface_statusinterface_link_forceupgot_onesend_packetif_register_bpf5pretty_print_option="t%T 8K &?he# Pb $(08@HX ` l!x subnet_numberbroadcast_addr<@ĹL dlJX\XlXXXXXXXcac cĹ$c0c@ăPăl|aaăĹă,ă<ăPĹl||ăăăc XX$@@XXXlcXXĹĹ <@cPah|c@@@cXc cX4X@XLXXXdXtXXXc@@@@@@@X(@8@D@P@\@h@t@@@@@@@@@@@@@@@(@4@@@L@X@d@p@|@@@@@@@@@@@@ @@$@0@<@H@T@`@l@x@@@@@@@@@@@@@@ @,@8@D@P@\@h@t@@@@@@@@@@@@@@@(@4@@@L@X@d@p@|@@@@@@@@@@@@ @@$@0@<@H@T@`@l@x@@@@@@@@@@@@@@ @,@8@D@P@\@h@t@@@@@@@@@@@@@@@(@4@@@L@X@d@p@|@@@@@@@@@@@@ @<;Zx0Ndispatch_imsgegresssocket errorno interface in group egress foundioctl SIOCGIFGMEMB: %mget_ifnametoo many interfaces in group egressInterface name too long: %mInterface name too longcannot forkchdir("/")%s [priv]poll erroroption_as_string: bad code %ddhcp option too largewarning: hostname %s contains an underscore which violates RFC 952Invalid IP address in option %s: %swarning: Only 1 IP address allowed in %s option; length %d, must be 4Bogus Host Name option %d: %s (%s)unknown dhcp option value 0x%xdaemonscript_set_env: no memory for variablescript_set_env: no memory for variable assignmentillegal character (%c) in value '%s'%s%s=%sfork: %mwait: %mexecve (%s, ...): %munexpected msg type %ureceived corrupted messageip_addressnetwork_numberbroadcast_addressserver_nameno space to %s %sprepend optionappend optionexpiryscript_init: no memory for environmentPATH=/usr/bin:/usr/sbin:/bin:/sbin-T %dreasonlease file not openlease { bootp; interface "%s"; fixed-address %s; filename "%s"; server-name "%s"; option %s %s; renew %d %d/%d/%d %02d:%02d:%02d; rebind %d %d/%d/%d %02d:%02d:%02d; expire %d %d/%d/%d %02d:%02d:%02d; } dhcpoffer: no memory to record lease.Invalid lease option - ignoring offerdhcpoffer: no memory for server name.Bogus server name %sdhcpoffer: no memory for filename.options do not fit in DHCPDECLINE packet.options do not fit in DHCPREQUEST packet.options do not fit in DHCPDISCOVER packet.DHCPDECLINE on %s to %s port %dNo DHCPOFFERS received.Trying recorded lease %sTIMEOUTnew_bound: renewal in %d seconds.bound: immediate renewal.No working leases in persistent database - sleeping.FAILDHCPDISCOVER on %s to %s port %d interval %dEXPIREold_DHCPREQUEST on %s to %s port %dDHCPNAK with no active lease.BOUNDRENEWREBOOTREBINDbound to %s -- renewal in %d seconds.DHCPOFFERBOOTREPLY%s isn't satisfactory.packet_to_lease failed.usage: %s [-dqu] [-c file] [-l file] interface c:dl:quifi callocclient callocconfig calloc%s.%s/var/db/dhclient.leasesasprintf%s: no link ... sleeping got link cannot open %s: %m_dhcpno such user: _dhcpcan't open and lock %s: %mcan't open %s: %msocket(PF_ROUTE, SOCK_RAW): %msetsockopt(ROUTE_MSGFILTER): %m/var/empty/chrootsetresgidsetgroupssa == NULLinterface address deletedinterface downinterface departureroutehandler: %snew address not one we set/etc/dhclient.confexpecting IP address.no memory for reject list!expecting semicolon.expected option name.%s: unexpected option name.%s: too many options.expecting hexadecimal constant.hexadecimal constant too long.string constant too long.expecting string or hexadecimal dataexpecting identifier after option keyword.no option named %sexpecting string.option data buffer %soption data buffer overflowexpecting number.expecting identifier.truefalseexpecting boolean.Bad format %c in parse_option_param.semicolon expected.out of memory allocating option data.expecting interface name (in quotes).wrong interface name. Expecting '%s'.expecting lease declaration.expecting left brace.no memory for lease.unterminated lease declaration.expecting a statement.unterminated interface declaration.Corrupt lease file - possible data loss!/sbin/dhclient-scriptget_rdomain socket: %mCan't create socketioctl(SIOCGIFFLAGS) on %s: %mCan't allocate timeout structure!receive_packet failed on %s: %sInterface %s no longer appears valid.No interfaces availableInterface %s: rdomain changed out from under usNo live interface to poll onpoll: %mgetifaddrs failedno space to remember ifpsend_packet: %msocket(SOCK_RAW): %msetsockopt(IP_HDRINCL): %m/dev/bpf%dCan't find free bpf: %mCan't attach interface %s to bpf device %s: %mCan't get BPF version: %mKernel BPF version out of range - recompile dhcpd!Can't set immediate mode on bpf device: %mCan't set filter-drop mode on bpf device: %mCan't get bpf buffer length: %mCan't allocate %lu bytes for bpf input buffer.Can't install packet filter program: %mCan't install write filter program: %mCannot lock bpfcScoption %s (%d) larger than buffer.rejecting bogus offer.Can't allocate storage for option %s.Can't expand storage for option %s.Discarding packet with invalid hlen.DHCPNACK%s from %s (%s)%s from %s%s from %s rejected.DHCPACKpretty_print_option: bad code %d%s: Excess information in format string: %s%s: no size indicator before A in format string: %s%s: garbage in format string: %s%s: expecting at least %d bytes; got %d%s: %d extra bytes%s: %d extra bytes at end of arrayUnexpected format code %ceof in string constantnumeric token larger than internal bufferstring constant larger than internal bufferappendbackoff-cutoffbootpdenyethernetfddifixed-addresshardwareinitial-intervalleaselink-timeoutmediumprependrebindrenewrequireretryscriptselect-timeoutsendserver-namesupersedetimeouttoken-ring%s line %d: %s%*c^ %d bad IP checksums seen in %d packets%d udp packets in %d too long - dropped%d bad udp checksums in %d packetspadsubnet-masktime-offsetIAtime-serversien116-name-serversdomain-name-serverslog-serverscookie-serverslpr-serversimpress-serversresource-location-servershost-nameboot-sizemerit-dumpdomain-nameswap-serverroot-pathextensions-pathip-forwardingnon-local-source-routingpolicy-filterIIAmax-dgram-reassemblydefault-ip-ttlpath-mtu-aging-timeoutpath-mtu-plateau-tableSAinterface-mtuall-subnets-localbroadcast-addressperform-mask-discoverymask-supplierrouter-discoveryrouter-solicitation-addressstatic-routestrailer-encapsulationarp-cache-timeoutieee802-3-encapsulationdefault-tcp-ttltcp-keepalive-intervaltcp-keepalive-garbagenis-domainnis-serversntp-serversvendor-encapsulated-optionsnetbios-name-serversnetbios-dd-servernetbios-node-typenetbios-scopefont-serversx-display-managerdhcp-requested-addressdhcp-lease-timedhcp-option-overloaddhcp-message-typedhcp-server-identifierdhcp-parameter-request-listBAdhcp-messagedhcp-max-message-sizedhcp-renewal-timedhcp-rebinding-timedhcp-class-identifierdhcp-client-identifieroption-62option-63nisplus-domainnisplus-serverstftp-server-namebootfile-namemobile-ip-home-agentsmtp-serverpop-servernntp-serverwww-serverfinger-serverirc-serverstreettalk-serverstreettalk-directory-assistance-serveruser-classoption-78option-79option-80option-81option-82option-83option-84nds-serversnds-tree-namends-contextoption-88option-89option-90option-91option-92option-93option-94option-95option-96option-97option-98option-99option-100option-101option-102option-103option-104option-105option-106option-107option-108option-109option-110option-111option-112option-113option-114option-115option-116option-117option-118option-119option-120option-121option-122option-123option-124option-125option-126option-127option-128option-129option-130option-131option-132option-133option-134option-135option-136option-137option-138option-139option-140option-141option-142option-143option-144option-145option-146option-147option-148option-149option-150option-151option-152option-153option-154option-155option-156option-157option-158option-159option-160option-161option-162option-163option-164option-165option-166option-167option-168option-169option-170option-171option-172option-173option-174option-175option-176option-177option-178option-179option-180option-181option-182option-183option-184option-185option-186option-187option-188option-189option-190option-191option-192option-193option-194option-195option-196option-197option-198option-199option-200option-201option-202option-203option-204option-205option-206option-207option-208option-209option-210option-211option-212option-213option-214option-215option-216option-217option-218option-219option-220option-221option-222option-223option-224option-225option-226option-227option-228option-229option-230option-231option-232option-233option-234option-235option-236option-237option-238option-239option-240option-241option-242option-243option-244option-245option-246option-247option-248option-249option-250option-251option-252option-253option-254option-endBogus number: %s.Bogus number: %s: digit %d not in base %dvalue %s%o exceeds max (%d) for precision.value %s%x exceeds max (%d) for precision.value %s%u exceeds max (%d) for precision.Unexpected integer size: %dno space for numeric aggregatenumeric aggregate too short.numeric day of week expected.numeric year expected.expected slash separating year from month.numeric month expected.expected slash separating month from day.numeric day of month expected.numeric hour expected.expected colon separating hour from minute.numeric minute expected.expected colon separating minute from second.numeric second expected.expecting a network hardware typeExpecting numeric lease timefilename must be a stringno memory for string %s.buf_read (short read): %mbuf_read: %mbuf_close (connection closed)buf_close (short write): %mbuf_close: %mbuf_add: %mbuf_open: %mcorrupted message receivedreceived unknown message, code %dhandle_hupcannot close temp fileinvalid address/tmp/ed.XXXXXXXXXXw+cannot open temp fileline too longcannot seek temp filecannot write temp filecannot read temp fileunexpected end-of-file& no previous commandinvalid pattern delimiter\  \abfnrtv\cannot read stdincannot write filecannot open output filecannot close output filecannot read input filenewline inserted newline appended cannot open input filecannot close input fileshell access restrictedinvalid mark charactered.hup/ed.hupno current filenameinvalid filenamefilename too longno matchnumber out of rangeinvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioncrypt unavailableHOMEcrypt unavailable ? p:sx ? interrupt? warning: file modifiedscript, line %d: %s usage: %s [-] [-sx] [-p string] [file] unbalanced brackets ([])trailing backslash (\)no previous patterninfinite substitution loopnothing to undocopy_link%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).HLPRfiprthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too longusage: %s [-fip] [-R [-H | -L | -P]] source target %s [-fip] [-R [-H | -L | -P]] source ... directory lchown: %sutimes: %schown: %schmod: %schflags: %sunlink: %smknod: %smkfifo: %sreadlink: %ssymlink: %soverwrite %s? dodecompressmain (,  0 048<\lgz_open      A@!  @a`10  @`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O @@ !1Aa  0@` #+3;CScs|@ . .. pppAfirmware Ggroup!H protocols!d1KpasswdtmpIspwd.dbL services!asswd.origJpwd.dbM fstabN resolv.confO( hostsA .@..B . ..C binDmdecv:sbinv:share:C .B .. ftpgrep fgrepegrepgzip gunzipgzcatless more \sedD .B..E ...F . ..P bsdQ base50.tgzR comp50.tgzS etc50.tgz(T man50.tgz(U game50.tgzip 0 IP icmp 1 ICMP tcp 6 TCP udp 17 UDP usage: %s [-123456789cdfghLlNnOqrtVv] [-b bits] [-o filename] [-S suffix] %*s [file ...] usage: %s [-cfhlNnqrtVv] [-o filename] [file ...] usage: %s [-fghqr] [file ...] OK %4.1f%% -- replaced with %s %lld bytes in, %lld bytes out method crc date time compressed uncompressed ratio uncompressed_name%-7.7s %08x %s %10lld %10lld %4.1f%% %s %10lld %10lld %4.1f%% (totals) .-_tgztazfchown: %sfchmod: %sfchflags: %sfutimes: %scompression not supported%s: won't read compressed data from terminal%s: unrecognized file formatcrc errorzcatzipunknown program nameGZIPoption -a is ignored on this systemillegal bit count -- %s-o argument is too long-o option may only be used with a single input filemay not mix -o, -c, or -t options%s is a directory: ignored: unchanged%s not a regular file%s%s already has %s suffix -- unchanged%s: unknown suffix: ignored%s%s: name too long%s: input: %sdeflate.gzZgzz123456789ab:cdfghLlNnOo:qrS:tVvcfhlNno:qrtVvfghqr1.2.3need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionusage: %s [-R [-H | -L | -P]] %s file ... owner[:group]usage: %s [-h] [-R [-H | -L | -P]] %s file ... %s [-h] [-R [-H | -L | -P]] :group file ... group is %s: %suser is %s: %sHLPRXfghorstuwxthe -R and -h options may not be specified together.invalid flags: %sinvalid flag: %smakeentrylinkupfileerrordirscaniblockckinodecheckfilesyspass2pass2checkpass5setupйع t(0@'8@DkȹLT @ catchinfocatchquit?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@%lld %s I=%ubad size: blk %lld, offset %lld, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock.fs_fpg %d cannot allocate memory for inode cache cannot increase directory listbad inode number %d to nextinode %d cannot alloc %lu bytes to extend inoinfo CG %d: BAD MAGIC NUMBER %lld files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %lld files missing %lld blocks missing %lld,conversion levelcannot do level %d conversion usage: %s [-fnpy] [-b block#] [-c level] [-m mode] filesystem ... dfpnNyYb:c:m:cannot alloc %u bytes for inoinfobad direct addr: %ld bad indirect addr: %ld INCORRECT BLOCK COUNT I=%u (%ld should be %d)too many inodes %llu cannot realloc %zu bytes to %zu for inoinfo phase 1, inode %d/%dphase 1b, inode %d/%d%s %s: LENGTH %ld NOT MULTIPLE of %d%s %s: LENGTH %ld NOT MULTIPLE OF %dphase 2, directory %d/%dphase 2, parent directory %d/%d (REMOVED)phase 3, directory %d/%ldphase 4, inode %d/%dDELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS UNKNOWN ROTATIONAL TABLE FORMAT %d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %ld MARKED FREE ALLOCATED FRAG %ld MARKED FREE BLK(S) MISSING IN BIT MAPSphase 5, cg %d/%d%s: NOT LABELED AS A BSD FILE SYSTEM (%s) NCG OUT OF RANGECPG OUT OF RANGENCYL LESS THAN NCG*CPGSBSIZE PREPOSTEROUSLY LARGEILLEGAL BLOCK SIZE IN SUPERBLOCKILLEGAL FRAGMENT SIZE IN SUPERBLOCKoffset %d, original %ld, alternate %ld VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN LAST ALTERNATEINFORMATION; SEE fsck_ffs(8).clean = %d UNDEFINED OPTIMIZATION IN SUPERBLOCKIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE NPSECT=%d IN SUPERBLOCK (FIXED)INCORRECT BMASK=%x IN SUPERBLOCKINCORRECT FMASK=%x IN SUPERBLOCKINCORRECT BSHIFT=%d IN SUPERBLOCKINCORRECT FSHIFT=%d IN SUPERBLOCKFormat of filesystem is too old. Must update to modern format using a version of fsck from before release 5.0 with the command ``fsck -c 2'' INCORRECT MAXFILESIZE=%llu IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%lx IN SUPERBLOCKINCORRECT QFMASK=%lx IN SUPERBLOCKINCONSISTENT CGSIZE=%d INCONSISTENT INOPB=%d INCONSISTENT NINDIR=%d cannot alloc %u bytes for cylinder group summary area cannot alloc %u bytes for inostathead cannot alloc %zu bytes for inpsort cannot alloc %zu bytes for inphead inoinfo: inumber %d out of rangeCANNOT %s: BLK %lldWRITING %sZERO'ED BLOCK %lld TO DISK UPDATE STANDARD SUPERBLOCK %lld (%lld),single_user  delete %d: %sinsert %d: %ssession database close: %ssession database open: %scannot get kernel security level: %scannot change kernel security level from %d to %d: %sfatal signal: %scan't parse getty for port %scan't allocate windowcan't parse window for port %sport %s changed utmp index from %d to %dcan't fork for window system on port %s: %msetsid failed (window) %mcan't exec window system '%s' for port %s: %mcan't fork for getty on port %s: %mgetty repeating too quickly on port %s, sleepingcan't exec getty '%s' for port %s: %msome processes would not die; ps axl advisedcan't get %s for controlling terminal: %mcan't exec %s for %s %s: %mautobootcan't exec %s for %s: %mcan't fork for %s on %s: %mwait for %s on %s failed: %m; going to single user modeinit: %s on %s stopped, restarting %s on %s terminated abnormally, going to single user mode/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bincan't exec %s for single user: %mcan't fork single-user shell, trying againwait for single-user shell failed: %m; restartinginit: shell stopped, restarting single user shell terminated.single user shell terminated, restartinginit: %s init: already running initial setsid() failed: %mrootsetlogin() failed: %munrecognized flag '-%c'sfignoring excess argumentsmainmkfssiginfousage: %s [-b block-size] [-c fragments-per-cylinder-group] [-e maxbpg] [-f frag-size] [-i bytes] [-m free-space] [-o options] [-P file] [-s size] special node usage: %s [-Nq] [-b block-size] [-c fragments-per-cylinder-group] [-e maxbpg] [-f frag-size] [-g avgfilesize] [-h avgfpdir] [-i bytes] [-m free-space] [-O filesystem-format] [-o optimization] [-S sector-size] [-s size] [-T disktype] [-t fstype] special ioctl (WDINFO)%s: can't rewrite disk labelinsane maxpartitions value %dP:T:b:c:e:f:i:m:o:s:NO:S:T:b:c:e:f:g:h:i:m:o:qs:t:%s: invalid ffs versionsector size invalid: %sblock size is %s: %sfragments per cylinder group is %s: %sblocks per file in a cylinder group is %s: %sfragment size is %s: %saverage file size is %s: %saverage files per dir is %s: %sbytes per inode is %s: %sfree space %% is %s: %s%s: unknown optimization preference: use `space' or `time'.file system size invalid: %snewfs_%s%s/newfs_%s%s not found%s: getmntinfo: %s%s: not a character-special device%s: can't figure out file system partition%s: `%c' partition is unavailable%s: `%c' partition overlaps boot program%s: no default sector size%s: maximum file system size on the `%c' partition is %lld sectorswarning: changing optimization to space because minfree is less than %d%% setblock bad fs_frag %dclrblock bad fs_frag %disblock bad fs_frag %dwtfs: write error on block %lldrdfs: read error on block %lldcg 0: bad magic numberfirst cylinder group ran out of spaceinte 08` LN<   LNdC`[~ [~ LN`@@<@TU h LNdbh LNdd?A LNU  LNH LNH ѷ A LNBh LNBh LNBh  %A LN LN-q LNk}  A LN LN7- LN7- +A LN LN LN A LN< LN< LN< Qgi A LN<_ LN?f_ LN?f &! LNJ\- LN. LN.  ) LN?8 LN?8 LN?8 '@ LNᓼ2 LN_4 LN!58 ( 0    @ PRs5A LN*U3 LN!5 LN!5 x H P X ` h p Pt_ LN*U3 LN!5 LN!5 q LN"O9 LN9 LN9 uX3Y LN,W: LN,W: LN,W:/tmp/fstab.shadowP÷ LN LN LN/tmp/resolv.conf.shadow  LNH LNH LNH/tmp/hostsqEA+ LNy$- LND - LND \I|A- LNSv C LN. C LN.  AC LNS !Z LNc8Z LNc8 e)AZ LN}9[ LND{Q [ LND{Q k"SA[ LN)o _ LNv_ LNv iA_ LN?f` LN-? ` LN-? OK/N{W@G%kj݇γ7IZ1- )jh+b!"03eʘ=3Œ -12 Q#~1KѦ |]\͂"U%`cbtͼu߾S!\5-OkF:q5 5zU/O…Q eO+}\$Sq4[0l-{ tv\NT f>b인+rZ!sK^iv/~ :LD5|m=ipVH{> 'yƕ$tc;U1$;,̳xyJ I9flJ` X-<V :vC0~9r:=THe;5e =%'G{(/GMoT 0 $A+V'`5_LYr#`KqB%`iYXZ6,jzCå\2=AB ʹ]rnal error: can't find block in cyl 0ilog2: %d is not a power of 2 fsinit: inode value %d out of rangeinode table does not fit in cylinder grouppanic: cylinder group too big: %d > %dpreposterous size %lld, max is %dpreposterous size %lld, max is %lldblock size must be a power of 2, not %dfragment size must be a power of 2, not %dfragment size %d is too small, minimum is %lldblock size %d is too small, minimum is %dblock size %d is too large, maximum is %dblock size (%d) cannot be smaller than fragment size (%d)fragment size %d is too small, minimum with block size %d is %ddensity reduced from %d to %d bytes per inodecan't honour -c: minimum is %dfile system size %jd < minimum size of %d sectorsreduced number of fragments per cylinder group from %d to %d to enlarge last cylinder groupcalloc failed%s: %.1fMB in %jd sectors of %lld bytes %d cylinder groups of %.2fMB, %d blocks, %d inodes each can't get physmemwarning: fsck_ffs will need %lluMB; min(MAXDSIZ,physmem) is %lluMBsuper-block backups (for fsck -b #) at:cannot allocate I/O bufferfsinit1 failedfsinit2 failed%s: initializing cg %ld/%d checkrm_overwriteusage: %s [-dfiPRr] file ... "." and ".." may not be removedremove %s? override %s%s%s/%s for %s? %s (inode %u): not overwritten due to multiple links%s: malloc%s: is a directorydfiPRrusage: %s [-t] device usage: %s [-f device] command [count] %d: unknown tape drive type %s tape drive, residual=%d erblocksize: %d (%d) density: %d (%d) ioctl MTIOCGETf:no remote support%s: unknown command%s: illegal countbsfbsrdensityeomfsffsrofflinerewindrewofflretensionweofWriteProtectMounted76543210usage: %s [-p] [-m mode] directory ... m:pcompileflush_appends\ can not be used as a string delimiternewline can not be used as a string delimiterwhitespace after %sundefined label '%s'RE error: %sunterminated regular expressionexpected context addressunexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandfilename expectedw commandread commandbranchempty labelduplicate label '%s'substitute pattern can not be delimited by newline or backslashunterminated substitute pattern123456789\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expressionmore than one number or 'g' in substitute flagsnumber in substitute flags out of rangeno wfile specifiedbad flag in substitute command: '%c'transform pattern can not be delimited by newline or backslashunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthextra text at the end of a transform commandunused label '%s' ..."usage: sed [-aEnru] command [file ...] sed [-aEnru] [-e command] [-f command_file] [file ...] Eae:f:nrustdout: %ssed: %lu: %s: first RE may not be empty\ %03o\%d not defined in the RE\abfrtvO0 O O Ĉ O $O( (O0 4O -eq-ne-gt-ge-lt -le!-ef"-nt#-ot$lR$0[@StTSfdScxSdSsSlSmSnpx_modex_search_histhb fd'(! ! %"#)< >g  0y7#-1 1= ?2*?* /&.&_606162636465666768695U5u4L4l3C3c[O%A"BCDB ܕl T|g Tf T>= &= ^= |= <<>><=>=<>&& || */%+-&^|? , ~!():hist_initj_print(lpa|aadoppromptyylexIFS= ${PS2=> } ${PS3=#? } ${PS4=+ }c|ZmchYgmatchgetoptionseaeece@eeeeeeiekeleXCmfC$pnfff f^b(fu0f!let||&&()str_valE SlmlP[ l   bm mm m(m0m(l@(#)PD KSH v5.2.14 99/07/13.2 AAA  Q AA A QBafree: %p not present in area %punable to allocate memorylmmissing options argumentmissing name argument%s: is not an identifierc_getopts: no argvarguments changed since last callOPTARGbad signal `%s'ls:usage: kill [-s signame | -signum | -signame] { job | pid | pgrp } ... kill -l [exit_status ...] %s: arguments must be jobs or process IDs%*d %*s %s%*d %*d %sjob control not enabled%%lpnzno argumentsadtdprtUxalias: -r flag can only be used with -t and without arguments alias %s alias not found L#R#UZ#fi#lprtuxonly -t, -u and -x options may be used with -ffunction %s %T %s() %T %s: not identifiertypeset -i -x -r -t -L%d -R%d -Z -l -u -U exportreadonly%s[%d]pvpvV is a reserved wordexported is an %salias for alias %s= is an exported traced undefined (autoload from %s) function special is a%s shell builtin is a tracked %salias for not found%s is *GOK*Rnprsu,-n-p: %s-u: %s: %sLPcan't get current directory - %srestricted shell - can't cdPWDOLDPWDno home directory (HOME not set)no OLDPWDdon't know current directoryCDPATH%s: bad directory+alias+cd+command*=export+fc+getopts+jobs+killletpwd*=readonly=typeset+unaliaswhence+bg+fgunalias-tainvalid file modeusage: mknod [-m mode] name b|c major minorusage: mknod [-m mode] name ptime: -%s unknown optiontime: -%s requires an argument:p%s%*ld.%02ld%s%s%*ldm%ld.%02lds%sreal real user sys user system fv%s is read only%s: cannot %s%s: can only %s %d level(s)%s: bad numberugorwx%#3.3o augo=+-rwxugoXsbad masktrap -- bad signal %sprsu,nothing to shift*=.*=:[*=break=builtin*=continue*=eval*=exec*=exit+false*=return*=set*=shift=times*=trap+=wait+readtest+trueulimit+umask*=unsetmissing closing parenmissing argumentexpression expectedmissing second argumentmissing expression operatorunexpected operator/operandinternal error: unknown opmissing ]-t-aunlimited unlimitedinvalid limit: %sexceeds allowable limitbad limit: %susage: ulimit [-acdfHlmnpSst] [value]ulimit: %c%-20s time(cpu-seconds)file(blocks)coredump(blocks)data(kbytes)stack(kbytes)lockedmem(kbytes)memory(kbytes)nofiles(descriptors)IFS"#$&'()*;<=>?[\]`{|};|&()`+@!fileglob: substitute errorFPATHPOSIX%s = '%s' nothing to yank yank something first I-search: cannot bind, not a tty%s: no such functionbeginning-of-historycomplete-commandcomplete-filecompletedelete-char-backwarddelete-word-backwarddelete-char-forwarddelete-word-forwardkill-lineredrawend-of-historyeot-or-deletegoto-historymacro-stringauto-insertkill-to-eolkill-regionlist-commandlist-filequoteprefix-1prefix-2yank-popbackward-charbeginning-of-linebackward-wordend-of-lineforward-charforward-wordnewlinedown-historynewline-and-nextno-opup-historyprev-hist-wordsearch-character-forwardsearch-character-backwardsearch-historyset-mark-commandstuffstuff-resettranspose-charsexchange-point-and-markcomplete-listexpand-filecapitalize-worddowncase-wordupcase-wordset-argcomment*+?@! substituteexpand(NULL)%Rfunny $() command: %s%s: cannot open $() input%s: parameter not set%S%s: bad substitutionparameter null or not set%*d) %sdbteste_error: %s (offset %d)shcomexec: %shere document missingcan't %s temporary file %s: %sherein: yylexerror writing %s: %sPS4%s%s %s: restricteddupcannot %s %s: %scould not finish (dup) redirection %s: %scoprocess already existsPS3EXECSHELL%s: %s: %sbuiltin: %s: not a builtincommand -p: restricted%s: can't find function definition file - %s%s: can't find function definition file%s: can't open function definition file %s - %s%s: function not defined by %sCFUNC %d%s: cannot execute - %s-rend of expression%s: unexpected `%s'%s: bad number `%s'%s: expression recurses on parameter `%s'%s: %s requires lvalue%s: %s applied to read only variablemissing )zero divisormissing :HISTFILE%s.%dno history (yet)%s: not in history%s: invalid rangehistory functions not available-%c%se:glnrs0,1,2,3,4,5,6,7,8,9,can't use -e, -l, -n, -r with -s (-e -)substitution failedcan't use -l, -n with -e-16%.*s cannot create temp file %s - %serror writing temporary file - %s${FCEDIT:-/bin/ed} $_cannot open temp file %serror reading temp file %s - %sno coprocess%s/shXXXXXXXXbad file descriptorfd not open for readingfd not open for writingillegal file descriptor name%s[%d]: internal error: shl_stdout not validtoo many files open in shellcan't create pipe - try again RunningDoneDone (%d)[%d] %c %5d (core dumped)%s%s %-20s %s%s%s%s%5d %-20s %s%s %s%sremove_job: job not found (%s)notifyj_async: job not startedj_async: bad nzombie (%d)zombiejobsstopped and runningYou have %s%s%s jobs j_waitj: tcsetpgrp(%d, %d) failed: %sjob not job-controlled[%d] | 1st tcsetpgrp(%d, %d) failed: %sfg: 2nd tcsetpgrp(%d, %d) failed: %scannot continue job %s: %sjw:resumejw:waitforwaitlast: no last jobwaitlast: not startedjw:waitlastexchild: XPIPEI and no last_job - pid %dfork failedcannot fork - try againchildexchild: execute() returned[%d]jw:last procj_init: getpgrp() failed: %sj_init: tcgetpgrp() failed: %sj_init: setpgid() failed: %sj_init: tcsetpgrp() failed: %swarning: won't have full job controlcheck_job: job started (flags 0x%x)checkjobno such jobambiguousargument must be %job or process id\%c%a %b %d%l:%M:%S%r~/%sPS1\$PS2missing ] no closing quote here document `%s' unclosed MAILyou have mail in $_shell: %dUse `exit' to leave ksh include: %dSH_VERSIONPPIDUSER$ -c requires an argumentCannot determine current working directory/etc/profile$HOME/.profile/etc/suid_profileENVtypesetKSH_VERSION-xOPTIND=1evaltypeset -i RANDOM MAILCHECK="${MAILCHECK-600}" SECONDS="${SECONDS-0}" TMOUT="${TMOUT-0}"hash=alias -ttype=whence -vstop=kill -STOPsuspend=kill -STOP $$autoload=typeset -fufunctions=typeset -fhistory=fc -linteger=typeset -inohup=nohup local=typesetr=fc -e -login=exec login-tUccmailmakeprviwho |&;<>()*@#!$-? =-+?#% "#$&'()*;<>?[\`|0123456789ABCDEF%-*s%*s'\'%s%s-%c: unknown option%s%s-`%c' requires argument%-*s %sA:o;sCurrent option settings -o %s%s: bad optionparse_args: `%c'allexportbraceexpandbgnicecsh-historyemacs-usemetaerrexitgmacsignoreeofinteractivekeywordloginmarkdirsnoclobbernoglobnohupnolognounsetphysicalposixprivilegedtrackallverbosevirawvi-show8vi-tabcompletevi-esccompletextracealnumalphablankcntrldigitgraphlowerpunctupperxdigitshf_flush: no fdshf_emptybuf: no fdshf_write: flags %xshf_write: nbytes %dshf_putchar: flags %xshf_putchar: no fd0123456789abcdef(null %s)shf_ungetc: flags %xshf_fillbuf: no fdshf_getchar: flags %xshf_getse: flags %xshf_read: flags %xshf_read: bsize %dshf_sopen: flags 0x%xshf_snprintf: buf %lx, bsize %dshf_reopen: missing read/writeshf_reopen: bad shf/buf/bsizeshf_fdopen: missing read/writeunmatchedsyntax error: unexpected EOF ?%dsyntax error: `%s' %s unexpectedtoo many <<'s too many redirections for%s: bad identifier %s: invalid function name thenelseelifficaseesacwhileuntildo{}[[&&||;;((|&setexecsig: unset signal %d(%s)ERRError handlerEXITtimed out waiting for inputSIGwdscan: unknown char 0x%x (carrying on)%S #no-vars# #no-args# ( %T) %T| %T%;%T%s %T %S ]] select %s for %s in %;do%N%T%;done case %S in%N(%S%c%;%T%N;;%Nesac if %Tthen%N%Telif %Telse%;%T%;fi %s %T%;do{%;%T%;} %T|& %T& function %s %T%s() %Ttime %T< <<- << >> >| <> <&>&No controlling tty (open /dev/tty: %s)Can't find tty file descriptorj_ttyinit: dup of tty fd failed: %sj_ttyinit: can't set close-on-exec flag: %s%0*s%.*s%*s%.*s%s: subscript %ld out of range%s: is read onlysetstr: %s=%s: assigning to self0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789abcdefghijklmnopqrstuvwxyzOPTINDPOSIXLY_CORRECTHISTSIZEMAILCHECKMAILPATHRANDOMSECONDSTMOUTLINENOM-grabhist: bad history arrayy$%s %dfc -e ${VISUAL:-${EDITOR:-vi}} --derive_key_pkcsbio_getvolbynamebio_diskinqbio_deleteraidbio_createflagsbio_changepassbio_parse_devlistbio_createraidstr2locatorbio_setblinkbio_inqhmac_sha1pkcs5_pbkdf2Invalid keyInvalid saltToo few rounds: %dcan't specify passphrase file during initial creation of crypto volumeinvalid passphrase filecan't stat passphrase filepassphrase file must be owned by rootpassphrase file has the wrong permissionscan't read passphrase fileinvalid passphrase lengthunable to read passphraseRe-type passphrase: Passphrases did not matchpbkdf2 failedinvalid KDF infoinvalid KDF hintKDF hint has invalid sizeunknown KDF type %dnumber of KDF rounds too low: %dBIOCINQBIOCVOLinvalid alarm function: %sBIOCALARMalarm is currently %s DIOCINQ%s: <%s, %s, %s>, serial %s delete volume %s failedinvalid flags listinvalid flag %s%s: failed to get KDF hintOld passphrase: New passphrase: %s: incorrect passphrase%s: failed to change passphraseinvalid device listcould not open %scould not stat %stoo many devices on device listduplicate device in listinvalid AOE dev list: use nic,dsteaddr,shelf,slotno devices specifiednot enough memory for dev_t listunsupported raid levelnot enough disksnot exactly one partitionioctlPassphrase: Incorrect passphraseBIOCCREATERAIDtarget not specified/dev/bioCan't locate %s device via %sBIOCBLINKTarget %s: %sBIOCDISKDisk %s is not in an enclosureDisk %s does not existinvalid device %sBIOCSETSTATE%-11s %-10s %14s %-8s VolumeStatusSizeDevice %d%% done %u secondsScrubbingInvalidOnlineOfflineDegradedBuildingRebuild%s %u%14llu%11s %-10s %14s %-7s CRYPTO%s%s %11s %-10s %14s %-7s RAID%u%s%s FailedHot spareUnused %3u%14skey disk%u:%u.%unoenclunknown serial%11s %-10s %14s %-7s %-6s <%s> %7s %-10s %14s %-7s %-6s '%s' usage: %s [-hiqv] [-a alarm-function] [-b channel:target[.lun]] [-H channel:target[.lun]] [-R device | channel:target[.lun]] [-u channel:target[.lun]] device %s [-dhiPqsv] [-C flag[,flag,...]] [-c raidlevel] [-k keydisk] [-l special[,special,...]] [-p passfile] [-R device | channel:target[.lun]] [-r rounds] device Invalid RAID levelNumber of rounds is %s: %sa:b:C:c:dH:hik:l:Pp:qr:R:svu:need deviceneed -c parameterneed -l parametermust use bio deviceusage: %s seconds do_movemainusage: %s [-fi] source target %s [-fi] source ... directory /bin/cp-PRp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status/bin/rm-rf%s: remove%s: set owner/group; not setting setuid/setgid%s: set owner/group%s: set mode%s: set flags%s: set timesrename %s to %scannot resolve %scannot rename a mount pointcan't remove %s%s: destination pathname too longeval5syntax error|&=<>+-*/%:()non-numeric argumentdivision by zerousage: %s [-M core] [-N system] M:N:sysctl: KERN_MSGBUFSIZEcouldn't allocate space for buffer datasysctl: KERN_MSGBUFmainusage: %s [-s] [name-of-host] sethostnamegethostnamegetnetanswergetnetbynamegetnetbyaddrIN-ADDR.ARPAbf0.0.0.%u.in-addr.arpa0.0.%u.%u.in-addr.arpa0.%u.%u.%u.in-addr.arpa%u.%u.%u.%u.in-addr.arpagetanswergethostbyaddrgethostby*.getanswer: asked for "%s", got "%s"-_//etc/hosts%x.%x.ip6.arpa/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxqg jgrn<:ORQhك[explore_numericres_querydomainNgetanswergetaddrinfollllll}~~~gethostby*.getanswer: asked for "%s", got "%s"# SHA1TransformSHA1Pad/etc/groupgetpwnam_r/etc/spwd.db/etc/pwd.dbether_hosttonether_ntohost/etc/ethers%02x:%02x:%02x:%02x:%02x:%02x__find_arguments__vfprintf0123456789ABCDEF0123456789abcdefnanNANinfINF(null)bug in vfprintf: bad baselogout/var/run/utmpreadlabelfskmPhTk\d/dev/diskmap%sr%s%s: not a device node%s: couldn't read disklabel%s: bad filesystem type in label%s%s%s%c%s%s%slogin_protect%s: %s: %m/etc/fbtab/*%s: chmod(%s): %m%s: chown(%s): %m%s: opendir(%s): %m%o%s: bad entry: %s@BKMGTPE0B%lld%c%lld.%1lld%clogwtmp/var/log/wtmp\\#tgetentTERMCAP/usr/share/misc/termcapTERMPATH.termcap /usr/share/misc/termcapOOPS5MS7) longjmp botch. inet6_rth_reverseargument buffer overflowunknown/invalid errorno errorinvalid value for ai_flagsname or service is not knowntemporary failure in name resolutionnon-recoverable failure in name resolutionno address associated with nameai_family not supportedai_socktype not supportedservice not supported for ai_socktypeaddress family for name not supportedmemory allocation failureinvalid value for hintsresolved protocol is unknownfstabscanxxswsscanfABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/%u.%u.%u.%upȅЅԅ؅a@ $,08@HPдX`hSignal 0HUPINTILLTRAPABRTEMTFPEKILLBUSSEGVSYSPIPEALRMURGTSTPCONTCHLDTTINTTOUIOXCPUXFSZVTALRMPROFWINCHUSR1USR2THR$08DLXht ,nosappndnosappendnoarchnoarchivednoschgnoschangenosimmutablenouappndnouappendnouchgnouchangenouimmutablenodumpnoopaqueBLOCKSIZE%s: unknown blocksizemaximum blocksize is %dG%s: minimum blocksize is 512%ld%s-blocksregerrorREG_0x%xREG_NOMATCHregexec() failed to matchREG_BADPATinvalid regular expressionREG_ECOLLATEinvalid collating elementREG_ECTYPEinvalid character classREG_EESCAPEREG_ESUBREGinvalid backreference numberREG_EBRACKbrackets ([ ]) not balancedREG_EPARENparentheses not balancedREG_EBRACEbraces not balancedREG_BADBRinvalid repetition count(s)REG_ERANGEinvalid character rangeREG_ESPACEREG_BADRPTrepetition-operator operand invalidREG_EMPTYempty (sub)expressionREG_ASSERT"can't happen" -- you found a bugREG_INVARGinvalid argument to regex routine*** unknown regexp error code ***/etc/ttyssecurertsctssoftcarwindowttyname_r/var/run/dev.db/etc/networksreadpassphrasetcsetattr ;Xglob2authunix_createauthunix_create_defaultauth_none.c - Fatal marshalling problemauthunix_create: out of memory [:<:]][:>:]]ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ !"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789ABCDEFabcdefNULSOHSTXETXEOTENQBELalertBSbackspaceHTtabLFVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBIS4IS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoponetwothreefourfivesixseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDEL(0DT`l̒ؒ(8Ldtԓ,(0DT`l̒ؒ(8Ldtԓ,HangupInterruptQuitIllegal instructionTrace/BPT trapAbort trapEMT trapFloating point exceptionKilledBus errorSegmentation faultBad system callBroken pipeAlarm clockTerminatedUrgent I/O conditionSuspended (signal)SuspendedContinuedChild exitedStopped (tty input)Stopped (tty output)I/O possibleCputime limit exceededFilesize limit exceededVirtual timer expiredProfiling timer expiredWindow size changesInformation requestUser defined signal 1User defined signal 2Thread ASTSHA256EndSHA256DataSHA256FileChunk0123456789abcdefunknown option -- %coption requires an argument -- %cambiguous option -- %.*soption doesn't take an argument -- %.*soption requires an argument -- %sunknown option -- %sinet_net_pton_ipv401234567890123456789abcdef/usr/src/lib/libc/net/inet_net_pton.cn >= 0 && n <= 15n >= 0 && n <= 9assertion "%s" failed: file "%s", line %d, function "%s" assertion "%s" failed: file "%s", line %d ip6_parsenumericgetnameinfoinet_ntop4inet_ntop%u.%u.%u.%uasprintfb0b1ncdtscsbpxbxfxoxtxdxgetentcgetnext%s.dbtc|:/etc/protocolsexecvpexeclpexecleexeclexecvp: : path too long xdr_array: out of memory   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~realpathvfscanf  ؗҜ<3#I9=D2[%Cod(hinityan%h %e %T MD5Pad0123456789abcdefsnprintftzloadmnGMT/etc/localtime/usr/share/zoneinfoposixrules,M4.1.0,M10.5.0abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789 :+-._Local time zone must be set--see zic manual pageasctime3JanFebMarAprMayJunJulAugSepOctNovDecSunMonTueWedThuFriSat??? ??? ?? ??:??:?? ???? %.3s %.3s%3d %2.2d:%2.2d:%2.2d %-4s %.3s %.3s%3d %2.2d:%2.2d:%2.2d %s _conv_fmt $(,048<@DLX`$hpxĝȝН؝  |^-0%m/%d/%y%2d%Y-%m-%d%03d%H:%M%I:%M:%S %p%H:%M:%S%e-%b-%Y%04dJanFebMarAprMayJunJulAugSepOctNovDecJanuaryFebruaryMarchAprilJuneJulyAugustSeptemberOctoberNovemberDecemberSunMonTueWedThuFriSatSundayMondayTuesdayWednesdayThursdayFridaySaturday%a %b %e %T %YAMPMwrterrormalloc_initmalloc() warning: unknown char in MALLOC_OPTIONS recursive callregions_total not 2^xinternal struct corruptmunmap/etc/malloc.confMALLOC_OPTIONSmalloc init mmap failedmap roundmalloc cachemunmap roundmalloc cache underflowmalloc free slot lostmalloc cache overflowbogus pointer (double free?)bogus pointerguard sizemprotectchunk info corruptedmodified chunk-pointerchunk is already free in free():free() called before allocationpp & bits in calloc(): in realloc(): in malloc():__stack_smash_handlerstack overflow in function %sclntudp_callclntudp_create: out of memory __hostaliasres_queryres_querydomainHOSTALIASES%.*s.%.*s __res_nameinquery__res_queriesmatch__res_send  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~_res_init/&ndots:insecure1insecure2edns0/etc/resolv.confLOCALDOMAIN;#inet4lookupsearchnameserversortlistRES_OPTIONSenvinet_pton01234567890123456789ABCDEF0123456789abcdef  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~/etc/services,/Hp""too small ((((( AAAAAABBBBBB connectlog_r__vsyslog_r/dev/log_rsyslog%s: unknown facility/priority: %x<%d>[%ld]Error %dvsnprintf(D`tܨ4Xt (D\xRPC: (unknown error code)%s: %s - %s %s: %s ; errno = %s; low version = %u, high version = %u; why = (unknown authentication error - %d); s1 = %u, s2 = %uRPC: SuccessRPC: Can't encode argumentsRPC: Can't decode resultRPC: Unable to sendRPC: Unable to receiveRPC: Timed outRPC: Incompatible versions of RPCRPC: Authentication errorRPC: Program unavailableRPC: Program/version mismatchRPC: Procedure unavailableRPC: Server can't decode argumentsRPC: Remote system errorRPC: Unknown hostRPC: Port mapper failureRPC: Program not registeredRPC: Failed (unspecified error)RPC: Unknown protocolAuthentication OKInvalid client credentialServer rejected credentialInvalid client verifierServer rejected verifierClient credential too weakInvalid server verifierFailed (unspecified error)InfinityNaNclnttcp_create: out of memory bindresvport_sa<xdrrec_create: out of memory perrorlibcUnknown signal: Unknown error: _catopenNLSPATH/usr/share/nls/%L/%N.cat:/usr/share/nls/%N/%LLANG(<TpĭܭDa4HTlx̮ܮ$DTd|د,Llذ $DtԱ8Tpв0@Th|ܳ0L`|̴$8dxUndefined error: 0Operation not permittedNo such file or directoryNo such processInterrupted system callInput/output errorDevice not configuredArgument list too longExec format errorBad file descriptorNo child processesResource deadlock avoidedPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkOperation not supported by deviceNot a directoryIs a directoryInvalid argumentToo many open files in systemToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksNumerical argument out of domainResult too largeResource temporarily unavailableOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not availableProtocol not supportedSocket type not supportedOperation not supportedProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceOperation timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downNo route to hostDirectory not emptyToo many processesToo many usersDisk quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticatorIPsec processing failureAttribute not foundIllegal byte sequenceNo medium foundWrong medium typeValue too large to be stored in data typeOperation canceledIdentifier removedNo message of desired typeNot supported(0DT`l̒ؒ(8Ldtԓ,xdr_string: out of memory xdr_bytes: out of memory  !#&(*-/14ABCDEF7yACnF?O8M20HwZ> P30123456789=:f/?/*?*n+n,N-N.m'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !+ Hh VqQ:q:QZZ    l h b  w  i x X      0  $  k  j  is not a regular file (use -f to see it) is a directoryJJaP&hiibP@&iiBP&ijcP&@jljjdPA&jjeP&jkkfP&8kPkFP&lkkgP&kklhP&Uu|agPtPS[X!Using drive X, partition YMBR on floppy or old BIOS Read error No O/S No active partition OxUf8@Ċē`$dPltԋh0@dܔ@ $HLPltHܕ8Ėm̖ؖH@̞fܞAB<CeDE$F4GDHpU8,VaTb`6c`e ffhhtiLlnqqğrПsܟvwxuxptpHLX`=hl|ht x |   I,j?h=8K,VİCаHذ =!"=#$%&'2($?)*+ ,- .(/,04182D3L456X7dxб(Ppز4T| priorityrttvarrttssthreshsendpiperecvpipeexpirehopcountmtuUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CLONING XRESOLVE LLINFO STATIC BLACKHOLEPROTO3PROTO2PROTO1CLONEDSOURCEMPATHJUMBOMPLSUPBROADCASTDEBUGLOOPBACKPTPNOTRAILERSRUNNINGNOARP PPROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD SRC SRCMASK LABEL<NOOP pĹĹ9nu( 0(EHC P E(  0(EHDHC H_ ... ...xh" DhPhd\h`hhhth>|hhho@hn@@@%s: can't read disk label; disk type must be specified......Їh6l6p60x6   |66666`6666{}abcdDgGhHilnNpPqrs tw xy !:#=X\ Pc|Zcc(chYmhc4d|bc4d,c8c@c=ccccccd$d8dHdXddd=xda|dbxba@ bddbdb] ;ddbfff$f8f`fff/(fPfx _ xx:xx:xx:xx:xx:xx0000000000000000 Ј ,8Xd  ȉԉ   ,P\tԊfff$f8f`fff/(fPfx   ffPfTffDff (f/ffЍ   $ `V ( , < @ L P `dhlptx|b$/ !Ď"Ԏ#$%&'(()<*H+T,\-d-t.|.8/H/Ty0123456789ȏ:ď;Џ<=>?@ [4\@\P]h^t^__`{{А|}}~?ttxȹйع t(0@'8@DkȹLTbkh455tt t000h08{t000h0L| 8u000h0`}utu\PXp,\zC???d@? >operator*System &/operator/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Boperator*System &/operator/sbin/nologin3operator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/ksh1rootQLbin*Binaries Commands and Source//sbin/nologin2bin*Binaries Commands and Source//sbin/nologin3uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucpTFTuucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2_dhcp*MMDHCP programs/var/empty/sbin/nologin1_dhcpn`n_dhcp*MMDHCP programs/var/empty/sbin/nologin2_dhcp*MMDHCP programs/var/empty/sbin/nologin3MPBPnobody*Unprivileged user for NFS/nonexistent/sbin/nologin2nobody*Unprivileged user for NFS/nonexistent/sbin/nologin3a  n}bin*Binaries Commands and Source//sbin/nologin1binrrootdaemonCharlie &/root/bin/kshn2rootdaemonCharlie &/root/bin/kshn3]Xdaemon*The devil himself/root/sbin/nologin2daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user for NFS/nonexistent/sbin/nologin1nobody ul+&~==operator*System &/operator/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Boperator*System &/operator/sbin/nologin3operator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/ksh1rootQLbin*Binaries Commands and Source//sbin/nologin2bin*Binaries Commands and Source//sbin/nologin3uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucpTFTuucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2_dhcp*MMDHCP programs/var/empty/sbin/nologin1_dhcpn`n_dhcp*MMDHCP programs/var/empty/sbin/nologin2_dhcp*MMDHCP programs/var/empty/sbin/nologin3MPBPnobody*Unprivileged user for NFS/nonexistent/sbin/nologin2nobody*Unprivileged user for NFS/nonexistent/sbin/nologin3a  n}a67b251b857e20a8ce72976b3c62be146fb24fd4ed796bbb468c4cc90cbe2d74 35e49f137fdd9ec9caf9456cc4ff351533c147d182fa035e194c1adfea8f7906 T right/MST right/MST7MDT right/Mexico/ right/Mexico/BajaNorte right/Mexico/BajaSur right/Mexico/General right/Mideast/ right/Mideast/Riyadh87 right/Mideast/Riyadh88 right/Mideast/Riyadh89 right/NZ right/NZ-CHAT right/Navajo right/PRC right/PST8PDT right/Pacific/ right/Pacific/Apia right/Pacific/Auckland right/Pacific/Chatham right/Pacific/Chuuk right/Pacific/Easter right/Pacific/Efate right/Pacific/Enderbury right/Pacific/Fakaofo right/Pacific/Fiji right/Pacific/Funafuti right/Pacific/Galapagos right/Pacific/Gambier right/Pacific/Guadalcanal right/Pacific/Guam right/Pacific/Honolulu right/Pacific/Johnston right/Pacific/Kiritimati right/Pacific/Kosrae right/Pacific/Kwajalein right/Pacific/Majuro right/Pacific/Marquesas right/Pacific/Midway right/Pacific/Nauru right/Pacific/Niue right/Pacific/Norfolk right/Pacific/Noumea right/Pacific/Pago_Pago right/Pacific/Palau right/Pacific/Pitcairn right/Pacific/Pohnpei right/Pacific/Ponape right/Pacific/Port_Moresby right/Pacific/Rarotonga right/Pacific/Saipan right/Pacific/Samoa right/Pacific/Tahiti right/Pacific/Tarawa right/Pacific/Tongatapu right/Pacific/Truk right/Pacific/Wake right/Pacific/Wallis right/Pacific/Yap right/Poland right/Portugal right/ROC right/ROK right/Singapore right/Turkey right/UCT right/US/ right/US/Alaska right/US/Aleutian right/US/Arizona right/US/Central right/US/East-Indiana right/US/Eastern right/US/Hawaii right/US/Indiana-Starke right/US/Michigan right/US/Mountain right/US/Pacific right/US/Pacific-New right/US/Samoa right/UTC right/Universal right/W-SU right/WET right/Zulu Africa/ Africa/Abidjan Africa/Accra Africa/Addis_Ababa Africa/Algiers Africa/Asmara Africa/Asmera Africa/Bamako Africa/Bangui Africa/Banjul Africa/Bissau Africa/Blantyre Africa/Brazzaville Africa/Bujumbura Africa/Cairo Africa/Casablanca Africa/Ceuta Africa/Conakry Africa/Dakar Africa/Dar_es_Salaam Africa/Djibouti Africa/Douala Africa/El_Aaiun Africa/Freetown Africa/Gaborone Africa/Harare Africa/Johannesburg Africa/Kampala Africa/Khartoum Africa/Kigali Africa/Kinshasa Africa/Lagos Africa/Libreville Africa/Lome Africa/Luanda Africa/Lubumbashi Africa/Lusaka Africa/Malabo Africa/Maputo Africa/Maseru Africa/Mbabane Africa/Mogadishu Africa/Monrovia Africa/Nairobi Africa/Ndjamena Africa/Niamey Africa/Nouakchott Africa/Ouagadougou Africa/Porto-Novo Africa/Sao_Tome Africa/Timbuktu Africa/Tripoli Africa/Tunis Africa/Windhoek America/ America/Adak America/Anchorage America/Anguilla America/Antigua America/Araguaina America/Argentina/ America/Argentina/Buenos_Aires America/Argentina/Catamarca America/Argentina/ComodRivadavia America/Argentina/Cordoba America/Argentina/Jujuy America/Argentina/La_Rioja America/Argentina/Mendoza America/Argentina/Rio_Gallegos America/Argentina/Salta America/Argentina/San_Juan America/Argentina/San_Luis America/Argentina/Tucuman America/Argentina/Ushuaia America/Aruba America/Asuncion America/Atikokan America/Atka America/Bahia America/Bahia_Banderas America/Barbados America/Belem America/Belize America/Blanc-Sablon America/Boa_Vista America/Bogota America/Boise America/Buenos_Aires America/Cambridge_Bay America/Campo_Grande America/Cancun America/Caracas America/Catamarca America/Cayenne America/Cayman America/Chicago America/Chihuahua America/Coral_Harbour America/Cordoba America/Costa_Rica America/Cuiaba America/Curacao America/Danmarkshavn America/Dawson America/Dawson_Creek America/Denver America/Detroit America/Dominica America/Edmonton America/Eirunepe America/El_Salvador America/Ensenada America/Fort_Wayne America/Fortaleza America/Glace_Bay America/Godthab America/Goose_Bay America/Grand_Turk America/Grenada America/Guadeloupe America/Guatemala America/Guayaquil America/Guyana America/Halifax America/Havana America/Hermosillo America/Indiana/ America/Indiana/Indianapolis America/Indiana/Knox America/Indiana/Marengo America/Indiana/Petersburg America/Indiana/Tell_City America/Indiana/Vevay America/Indiana/Vincennes America/Indiana/Winamac America/Indianapolis America/Inuvik America/Iqaluit America/Jamaica America/Jujuy America/Juneau America/Kentucky/ America/Kentucky/Louisville America/Kentucky/Monticello America/Knox_IN America/Kralendijk America/La_Paz America/Lima America/Los_Angeles America/Louisville America/Lower_Princes America/Maceio America/Managua America/Manaus America/Marigot America/Martinique America/Matamoros America/Mazatlan America/Mendoza America/Menominee America/Merida America/Metlakatla America/Mexico_City America/Miquelon America/Moncton America/Monterrey America/Montevideo America/Montreal America/Montserrat America/Nassau America/New_York America/Nipigon America/Nome America/Noronha America/North_Dakota/ America/North_Dakota/Beulah America/North_Dakota/Center America/North_Dakota/New_Salem America/Ojinaga America/Panama America/Pangnirtung America/Paramaribo America/Phoenix America/Port-au-Prince America/Port_of_Spain America/Porto_Acre America/Porto_Velho America/Puerto_Rico America/Rainy_River America/Rankin_Inlet America/Recife America/Regina America/Resolute America/Rio_Branco America/Rosario America/Santa_Isabel America/Santarem America/Santiago America/Santo_Domingo America/Sao_Paulo America/Scoresbysund America/Shiprock America/Sitka America/St_Barthelemy America/St_Johns America/St_Kitts America/St_Lucia America/St_Thomas America/St_Vincent America/Swift_Current America/Tegucigalpa America/Thule America/Thunder_Bay America/Tijuana America/Toronto America/Tortola America/Vancouver America/Virgin America/Whitehorse America/Winnipeg America/Yakutat America/Yellowknife Antarctica/ Antarctica/Casey Antarctica/Davis Antarctica/DumontDUrville Antarctica/Macquarie Antarctica/Mawson Antarctica/McMurdo Antarctica/Palmer Antarctica/Rothera Antarctica/South_Pole Antarctica/Syowa Antarctica/Vostok Arctic/ Arctic/Longyearbyen Asia/ Asia/Aden Asia/Almaty Asia/Amman Asia/Anadyr Asia/Aqtau Asia/Aqtobe Asia/Ashgabat Asia/Ashkhabad Asia/Baghdad Asia/Bahrain Asia/Baku Asia/Bangkok Asia/Beirut Asia/Bishkek Asia/Brunei Asia/Calcutta Asia/Choibalsan Asia/Chongqing Asia/Chungking Asia/Colombo Asia/Dacca Asia/Damascus Asia/Dhaka Asia/Dili Asia/Dubai Asia/Dushanbe Asia/Gaza Asia/Harbin Asia/Ho_Chi_Minh Asia/Hong_Kong Asia/Hovd Asia/Irkutsk Asia/Istanbul Asia/Jakarta Asia/Jayapura Asia/Jerusalem Asia/Kabul Asia/Kamchatka Asia/Karachi Asia/Kashgar Asia/Kathmandu Asia/Katmandu Asia/Kolkata Asia/Krasnoyarsk Asia/Kuala_Lumpur Asia/Kuching Asia/Kuwait Asia/Macao Asia/Macau Asia/Magadan Asia/Makassar Asia/Manila Asia/Muscat Asia/Nicosia Asia/Novokuznetsk Asia/Novosibirsk Asia/Omsk Asia/Oral Asia/Phnom_Penh Asia/Pontianak Asia/Pyongyang Asia/Qatar Asia/Qyzylorda Asia/Rangoon Asia/Riyadh Asia/Riyadh87 Asia/Riyadh88 Asia/Riyadh89 Asia/Saigon Asia/Sakhalin Asia/Samarkand Asia/Seoul Asia/Shanghai Asia/Singapore Asia/Taipei Asia/Tashkent Asia/Tbilisi Asia/Tehran Asia/Tel_Aviv Asia/Thimbu Asia/Thimphu Asia/Tokyo Asia/Ujung_Pandang Asia/Ulaanbaatar Asia/Ulan_Bator Asia/Urumqi Asia/Vientiane Asia/Vladivostok Asia/Yakutsk Asia/Yekaterinburg Asia/Yerevan Atlantic/ Atlantic/Azores Atlantic/Bermuda Atlantic/Canary Atlantic/Cape_Verde Atlantic/Faeroe Atlantic/Faroe Atlantic/Jan_Mayen Atlantic/Madeira Atlantic/Reykjavik Atlantic/South_Georgia Atlantic/St_Helena Atlantic/Stanley Australia/ Australia/ACT Australia/Adelaide Australia/Brisbane Australia/Broken_Hill Australia/Canberra Australia/Currie Australia/Darwin Australia/Eucla Australia/Hobart Australia/LHI Australia/Lindeman Australia/Lord_Howe Australia/Melbourne Australia/NSW Australia/North Australia/Perth Australia/Queensland Australia/South Australia/Sydney Australia/Tasmania Australia/Victoria Australia/West Australia/Yancowinna Brazil/ Brazil/Acre Brazil/DeNoronha Brazil/East Brazil/West CET CST6CDT Canada/ Canada/Atlantic Canada/Central Canada/East-Saskatchewan Canada/Eastern Canada/Mountain Canada/Newfoundland Canada/Pacific Canada/Saskatchewan Canada/Yukon Chile/ Chile/Continental Chile/EasterIsland Cuba EET EST EST5EDT Egypt Eire Etc/ Etc/GMT Etc/GMT+0 Etc/GMT+1 Etc/GMT+10 Etc/GMT+11 Etc/GMT+12 Etc/GMT+2 Etc/GMT+3 Etc/GMT+4 Etc/GMT+5 Etc/GMT+6 Etc/GMT+7 Etc/GMT+8 Etc/GMT+9 Etc/GMT-0 Etc/GMT-1 Etc/GMT-10 Etc/GMT-11 Etc/GMT-12 Etc/GMT-13 Etc/GMT-14 Etc/GMT-2 Etc/GMT-3 Etc/GMT-4 Etc/GMT-5 Etc/GMT-6 Etc/GMT-7 Etc/GMT-8 Etc/GMT-9 Etc/GMT0 Etc/Greenwich Etc/UCT Etc/UTC Etc/Universal Etc/Zulu Europe/ Europe/Amsterdam Europe/Andorra Europe/Athens Europe/Belfast Europe/Belgrade Europe/Berlin Europe/Bratislava Europe/Brussels Europe/Bucharest Europe/Budapest Europe/Chisinau Europe/Copenhagen Europe/Dublin Europe/Gibraltar Europe/Guernsey Europe/Helsinki Europe/Isle_of_Man Europe/Istanbul Europe/Jersey Europe/Kaliningrad Europe/Kiev Europe/Lisbon Europe/Ljubljana Europe/London Europe/Luxembourg Europe/Madrid Europe/Malta Europe/Mariehamn Europe/Minsk Europe/Monaco Europe/Moscow Europe/Nicosia Europe/Oslo Europe/Paris Europe/Podgorica Europe/Prague Europe/Riga Europe/Rome Europe/Samara Europe/San_Marino Europe/Sarajevo Europe/Simferopol Europe/Skopje Europe/Sofia Europe/Stockholm Europe/Tallinn Europe/Tirane Europe/Tiraspol Europe/Uzhgorod Europe/Vaduz Europe/Vatican Europe/Vienna Europe/Vilnius Europe/Volgograd Europe/Warsaw Europe/Zagreb Europe/Zaporozhye Europe/Zurich Factory GB GB-Eire GMT GMT+0 GMT-0 GMT0 Greenwich HST Hongkong Iceland Indian/ Indian/Antananarivo Indian/Chagos Indian/Christmas Indian/Cocos Indian/Comoro Indian/Kerguelen Indian/Mahe Indian/Maldives Indian/Mauritius Indian/Mayotte Indian/Reunion Iran Israel Jamaica Japan Kwajalein Libya MET MST MST7MDT Mexico/ Mexico/BajaNorte Mexico/BajaSur Mexico/General Mideast/ Mideast/Riyadh87 Mideast/Riyadh88 Mideast/Riyadh89 NZ NZ-CHAT Navajo PRC PST8PDT Pacific/ Pacific/Apia Pacific/Auckland Pacific/Chatham Pacific/Chuuk Pacific/Easter Pacific/Efate Pacific/Enderbury Pacific/Fakaofo Pacific/Fiji Pacific/Funafuti Pacific/Galapagos Pacific/Gambier Pacific/Guadalcanal Pacific/Guam Pacific/Honolulu Pacific/Johnston Pacific/Kiritimati Pacific/Kosrae Pacific/Kwajalein Pacific/Majuro Pacific/Marquesas Pacific/Midway Pacific/Nauru Pacific/Niue Pacific/Norfolk Pacific/Noumea Pacific/Pago_Pago Pacific/Palau Pacific/Pitcairn Pacific/Pohnpei Pacific/Ponape Pacific/Port_Moresby Pacific/Rarotonga Pacific/Saipan Pacific/Samoa Pacific/Tahiti Pacific/Tarawa Pacific/Tongatapu Pacific/Truk Pacific/Wake Pacific/Wallis Pacific/Yap Poland Portugal ROC ROK Singapore Turkey UCT US/ US/Alaska US/Aleutian US/Arizona US/Central US/East-Indiana US/Eastern US/Hawaii US/Indiana-Starke US/Michigan US/Mountain US/Pacific US/Pacific-New US/Samoa UTC Universal W-SU WET Zulu posix/ posix/Africa/ posix/Africa/Abidjan posix/Africa/Accra posix/Africa/Addis_Ababa posix/Africa/Algiers posix/Africa/Asmara posix/Africa/Asmera posix/Africa/Bamako posix/Africa/Bangui posix/Africa/Banjul posix/Africa/Bissau posix/Africa/Blantyre posix/Africa/Brazzaville posix/Africa/Bujumbura posix/Africa/Cairo posix/Africa/Casablanca posix/Africa/Ceuta posix/Africa/Conakry posix/Africa/Dakar posix/Africa/Dar_es_Salaam posix/Africa/Djibouti posix/Africa/Douala posix/Africa/El_Aaiun posix/Africa/Freetown posix/Africa/Gaborone posix/Africa/Harare posix/Africa/Johannesburg posix/Africa/Kampala posix/Africa/Khartoum posix/Africa/Kigali posix/Africa/Kinshasa posix/Africa/Lagos posix/Africa/Libreville posix/Africa/Lome posix/Africa/Luanda posix/Africa/Lubumbashi posix/Africa/Lusaka posix/Africa/Malabo posix/Africa/Maputo posix/Africa/Maseru posix/Africa/Mbabane posix/Africa/Mogadishu posix/Africa/Monrovia posix/Africa/Nairobi posix/Africa/Ndjamena posix/Africa/Niamey posix/Africa/Nouakchott posix/Africa/Ouagadougou posix/Africa/Porto-Novo posix/Africa/Sao_Tome posix/Africa/Timbuktu posix/Africa/Tripoli posix/Africa/Tunis posix/Africa/Windhoek posix/America/ posix/America/Adak posix/America/Anchorage posix/America/Anguilla posix/America/Antigua posix/America/Araguaina posix/America/Argentina/ posix/America/Argentina/Buenos_Aires posix/America/Argentina/Catamarca posix/America/Argentina/ComodRivadavia posix/America/Argentina/Cordoba posix/America/Argentina/Jujuy posix/America/Argentina/La_Rioja posix/America/Argentina/Mendoza posix/America/Argentina/Rio_Gallegos posix/America/Argentina/Salta posix/America/Argentina/San_Juan posix/America/Argentina/San_Luis posix/America/Argentina/Tucuman posix/America/Argentina/Ushuaia posix/America/Aruba posix/America/Asuncion posix/America/Atikokan posix/America/Atka posix/America/Bahia posix/America/Bahia_Banderas posix/America/Barbados posix/America/Belem posix/America/Belize posix/America/Blanc-Sablon posix/America/Boa_Vista posix/America/Bogota posix/America/Boise posix/America/Buenos_Aires posix/America/Cambridge_Bay posix/America/Campo_Grande posix/America/Cancun posix/America/Caracas posix/America/Catamarca posix/America/Cayenne posix/America/Cayman posix/America/Chicago posix/America/Chihuahua posix/America/Coral_Harbour posix/America/Cordoba posix/America/Costa_Rica posix/America/Cuiaba posix/America/Curacao posix/America/Danmarkshavn posix/America/Dawson posix/America/Dawson_Creek posix/America/Denver posix/America/Detroit posix/America/Dominica posix/America/Edmonton posix/America/Eirunepe posix/America/El_Salvador posix/America/Ensenada posix/America/Fort_Wayne posix/America/Fortaleza posix/America/Glace_Bay posix/America/Godthab posix/America/Goose_Bay posix/America/Grand_Turk posix/America/Grenada posix/America/Guadeloupe posix/America/Guatemala posix/America/Guayaquil posix/America/Guyana posix/America/Halifax posix/America/Havana posix/America/Hermosillo posix/America/Indiana/ posix/America/Indiana/Indianapolis posix/America/Indiana/Knox posix/America/Indiana/Marengo posix/America/Indiana/Petersburg posix/America/Indiana/Tell_City posix/America/Indiana/Vevay posix/America/Indiana/Vincennes posix/America/Indiana/Winamac posix/America/Indianapolis posix/America/Inuvik posix/America/Iqaluit posix/America/Jamaica posix/America/Jujuy posix/America/Juneau posix/America/Kentucky/ posix/America/Kentucky/Louisville posix/America/Kentucky/Monticello posix/America/Knox_IN posix/America/Kralendijk posix/America/La_Paz posix/America/Lima posix/America/Los_Angeles posix/America/Louisville posix/America/Lower_Princes posix/America/Maceio posix/America/Managua posix/America/Manaus posix/America/Marigot posix/America/Martinique posix/America/Matamoros posix/America/Mazatlan posix/America/Mendoza posix/America/Menominee posix/America/Merida posix/America/Metlakatla posix/America/Mexico_City posix/America/Miquelon posix/America/Moncton posix/America/Monterrey posix/America/Montevideo posix/America/Montreal posix/America/Montserrat posix/America/Nassau posix/America/New_York posix/America/Nipigon posix/America/Nome posix/America/Noronha posix/America/North_Dakota/ posix/America/North_Dakota/Beulah posix/America/North_Dakota/Center posix/America/North_Dakota/New_Salem posix/America/Ojinaga posix/America/Panama posix/America/Pangnirtung posix/America/Paramaribo posix/America/Phoenix posix/America/Port-au-Prince posix/America/Port_of_Spain posix/America/Porto_Acre posix/America/Porto_Velho posix/America/Puerto_Rico posix/America/Rainy_River posix/America/Rankin_Inlet posix/America/Recife posix/America/Regina posix/America/Resolute posix/America/Rio_Branco posix/America/Rosario posix/America/Santa_Isabel posix/America/Santarem posix/America/Santiago posix/America/Santo_Domingo posix/America/Sao_Paulo posix/America/Scoresbysund posix/America/Shiprock posix/America/Sitka posix/America/St_Barthelemy posix/America/St_Johns posix/America/St_Kitts posix/America/St_Lucia posix/America/St_Thomas posix/America/St_Vincent posix/America/Swift_Current posix/America/Tegucigalpa posix/America/Thule posix/America/Thunder_Bay posix/America/Tijuana posix/America/Toronto posix/America/Tortola posix/America/Vancouver posix/America/Virgin posix/America/Whitehorse posix/America/Winnipeg posix/America/Yakutat posix/America/Yellowknife posix/Antarctica/ posix/Antarctica/Casey posix/Antarctica/Davis posix/Antarctica/DumontDUrville posix/Antarctica/Macquarie posix/Antarctica/Mawson posix/Antarctica/McMurdo posix/Antarctica/Palmer posix/Antarctica/Rothera posix/Antarctica/South_Pole posix/Antarctica/Syowa posix/Antarctica/Vostok posix/Arctic/ posix/Arctic/Longyearbyen posix/Asia/ posix/Asia/Aden posix/Asia/Almaty posix/Asia/Amman posix/Asia/Anadyr posix/Asia/Aqtau posix/Asia/Aqtobe posix/Asia/Ashgabat posix/Asia/Ashkhabad posix/Asia/Baghdad posix/Asia/Bahrain posix/Asia/Baku posix/Asia/Bangkok posix/Asia/Beirut posix/Asia/Bishkek posix/Asia/Brunei posix/Asia/Calcutta posix/Asia/Choibalsan posix/Asia/Chongqing posix/Asia/Chungking posix/Asia/Colombo posix/Asia/Dacca posix/Asia/Damascus posix/Asia/Dhaka posix/Asia/Dili posix/Asia/Dubai posix/Asia/Dushanbe posix/Asia/Gaza posix/Asia/Harbin posix/Asia/Ho_Chi_Minh posix/Asia/Hong_Kong posix/Asia/Hovd posix/Asia/Irkutsk posix/Asia/Istanbul posix/Asia/Jakarta posix/Asia/Jayapura posix/Asia/Jerusalem posix/Asia/Kabul posix/Asia/Kamchatka posix/Asia/Karachi posix/Asia/Kashgar posix/Asia/Kathmandu posix/Asia/Katmandu posix/Asia/Kolkata posix/Asia/Krasnoyarsk posix/Asia/Kuala_Lumpur posix/Asia/Kuching posix/Asia/Kuwait posix/Asia/Macao posix/Asia/Macau posix/Asia/Magadan posix/Asia/Makassar posix/Asia/Manila posix/Asia/Muscat posix/Asia/Nicosia posix/Asia/Novokuznetsk posix/Asia/Novosibirsk posix/Asia/Omsk posix/Asia/Oral posix/Asia/Phnom_Penh posix/Asia/Pontianak posix/Asia/Pyongyang posix/Asia/Qatar posix/Asia/Qyzylorda posix/Asia/Rangoon posix/Asia/Riyadh posix/Asia/Riyadh87 posix/Asia/Riyadh88 posix/Asia/Riyadh89 posix/Asia/Saigon posix/Asia/Sakhalin posix/Asia/Samarkand posix/Asia/Seoul posix/Asia/Shanghai posix/Asia/Singapore posix/Asia/Taipei posix/Asia/Tashkent posix/Asia/Tbilisi posix/Asia/Tehran posix/Asia/Tel_Aviv posix/Asia/Thimbu posix/Asia/Thimphu posix/Asia/Tokyo posix/Asia/Ujung_Pandang posix/Asia/Ulaanbaatar posix/Asia/Ulan_Bator posix/Asia/Urumqi posix/Asia/Vientiane posix/Asia/Vladivostok posix/Asia/Yakutsk posix/Asia/Yekaterinburg posix/Asia/Yerevan posix/Atlantic/ posix/Atlantic/Azores posix/Atlantic/Bermuda posix/Atlantic/Canary posix/Atlantic/Cape_Verde posix/Atlantic/Faeroe posix/Atlantic/Faroe posix/Atlantic/Jan_Mayen posix/Atlantic/Madeira posix/Atlantic/Reykjavik posix/Atlantic/South_Georgia posix/Atlantic/St_Helena posix/Atlantic/Stanley posix/Australia/ posix/Australia/ACT posix/Australia/Adelaide posix/Australia/Brisbane posix/Australia/Broken_Hill posix/Australia/Canberra posix/Australia/Currie posix/Australia/Darwin posix/Australia/Eucla posix/Australia/Hobart posix/Australia/LHI posix/Australia/Lindeman posix/Australia/Lord_Howe posix/Australia/Melbourne posix/Australia/NSW posix/Australia/North posix/Australia/Perth posix/Australia/Queensland posix/Australia/South posix/Australia/Sydney posix/Australia/Tasmania posix/Australia/Victoria posix/Australia/West posix/Australia/Yancowinna posix/Brazil/ posix/Brazil/Acre posix/Brazil/DeNoronha posix/Brazil/East posix/Brazil/West posix/CET posix/CST6CDT posix/Canada/ posix/Canada/Atlantic posix/Canada/Central posix/Canada/East-Saskatchewan posix/Canada/Eastern posix/Canada/Mountain posix/Canada/Newfoundland posix/Canada/Pacific posix/Canada/Saskatchewan posix/Canada/Yukon posix/Chile/ posix/Chile/Continental posix/Chile/EasterIsland posix/Cuba posix/EET posix/EST posix/EST5EDT posix/Egypt posix/Eire posix/Etc/ posix/Etc/GMT posix/Etc/GMT+0 posix/Etc/GMT+1 posix/Etc/GMT+10 posix/Etc/GMT+11 posix/Etc/GMT+12 posix/Etc/GMT+2 posix/Etc/GMT+3 posix/Etc/GMT+4 posix/Etc/GMT+5 posix/Etc/GMT+6 posix/Etc/GMT+7 posix/Etc/GMT+8 posix/Etc/GMT+9 posix/Etc/GMT-0 posix/Etc/GMT-1 posix/Etc/GMT-10 posix/Etc/GMT-11 posix/Etc/GMT-12 posix/Etc/GMT-13 posix/Etc/GMT-14 posix/Etc/GMT-2 posix/Etc/GMT-3 posix/Etc/GMT-4 posix/Etc/GMT-5 posix/Etc/GMT-6 posix/Etc/GMT-7 posix/Etc/GMT-8 posix/Etc/GMT-9 posix/Etc/GMT0 posix/Etc/Greenwich posix/Etc/UCT posix/Etc/UTC posix/Etc/Universal posix/Etc/Zulu posix/Europe/ posix/Europe/Amsterdam posix/Europe/Andorra posix/Europe/Athens posix/Europe/Belfast posix/Europe/Belgrade posix/Europe/Berlin posix/Europe/Bratislava posix/Europe/Brussels posix/Europe/Bucharest posix/Europe/Budapest posix/Europe/Chisinau posix/Europe/Copenhagen posix/Europe/Dublin posix/Europe/Gibraltar posix/Europe/Guernsey posix/Europe/Helsinki posix/Europe/Isle_of_Man posix/Europe/Istanbul posix/Europe/Jersey posix/Europe/Kaliningrad posix/Europe/Kiev posix/Europe/Lisbon posix/Europe/Ljubljana posix/Europe/London posix/Europe/Luxembourg posix/Europe/Madrid posix/Europe/Malta posix/Europe/Mariehamn posix/Europe/Minsk posix/Europe/Monaco posix/Europe/Moscow posix/Europe/Nicosia posix/Europe/Oslo posix/Europe/Paris posix/Europe/Podgorica posix/Europe/Prague posix/Europe/Riga posix/Europe/Rome posix/Europe/Samara posix/Europe/San_Marino posix/Europe/Sarajevo posix/Europe/Simferopol posix/Europe/Skopje posix/Europe/Sofia posix/Europe/Stockholm posix/Europe/Tallinn posix/Europe/Tirane posix/Europe/Tiraspol posix/Europe/Uzhgorod posix/Europe/Vaduz posix/Europe/Vatican posix/Europe/Vienna posix/Europe/Vilnius posix/Europe/Volgograd posix/Europe/Warsaw posix/Europe/Zagreb posix/Europe/Zaporozhye posix/Europe/Zurich posix/Factory posix/GB posix/GB-Eire posix/GMT posix/GMT+0 posix/GMT-0 posix/GMT0 posix/Greenwich posix/HST posix/Hongkong posix/Iceland posix/Indian/ posix/Indian/Antananarivo posix/Indian/Chagos posix/Indian/Christmas posix/Indian/Cocos posix/Indian/Comoro posix/Indian/Kerguelen posix/Indian/Mahe posix/Indian/Maldives posix/Indian/Mauritius posix/Indian/Mayotte posix/Indian/Reunion posix/Iran posix/Israel posix/Jamaica posix/Japan posix/Kwajalein posix/Libya posix/MET posix/MST posix/MST7MDT posix/Mexico/ posix/Mexico/BajaNorte posix/Mexico/BajaSur posix/Mexico/General posix/Mideast/ posix/Mideast/Riyadh87 posix/Mideast/Riyadh88 posix/Mideast/Riyadh89 posix/NZ posix/NZ-CHAT posix/Navajo posix/PRC posix/PST8PDT posix/Pacific/ posix/Pacific/Apia posix/Pacific/Auckland posix/Pacific/Chatham posix/Pacific/Chuuk posix/Pacific/Easter posix/Pacific/Efate posix/Pacific/Enderbury posix/Pacific/Fakaofo posix/Pacific/Fiji posix/Pacific/Funafuti posix/Pacific/Galapagos posix/Pacific/Gambier posix/Pacific/Guadalcanal posix/Pacific/Guam posix/Pacific/Honolulu posix/Pacific/Johnston posix/Pacific/Kiritimati posix/Pacific/Kosrae posix/Pacific/Kwajalein posix/Pacific/Majuro posix/Pacific/Marquesas posix/Pacific/Midway posix/Pacific/Nauru posix/Pacific/Niue posix/Pacific/Norfolk posix/Pacific/Noumea posix/Pacific/Pago_Pago posix/Pacific/Palau posix/Pacific/Pitcairn posix/Pacific/Pohnpei posix/Pacific/Ponape posix/Pacific/Port_Moresby posix/Pacific/Rarotonga posix/Pacific/Saipan posix/Pacific/Samoa posix/Pacific/Tahiti posix/Pacific/Tarawa posix/Pacific/Tongatapu posix/Pacific/Truk posix/Pacific/Wake posix/Pacific/Wallis posix/Pacific/Yap posix/Poland posix/Portugal posix/ROC posix/ROK posix/Singapore posix/Turkey posix/UCT posix/US/ posix/US/Alaska posix/US/Aleutian posix/US/Arizona posix/US/Central posix/US/East-Indiana posix/US/Eastern posix/US/Hawaii posix/US/Indiana-Starke posix/US/Michigan posix/US/Mountain posix/US/Pacific posix/US/Pacific-New posix/US/Samoa posix/UTC posix/Universal posix/W-SU posix/WET posix/Zulu posixrules right/ right/Africa/ right/Africa/Abidjan right/Africa/Accra right/Africa/Addis_Ababa right/Africa/Algiers right/Africa/Asmara right/Africa/Asmera right/Africa/Bamako right/Africa/Bangui right/Africa/Banjul right/Africa/Bissau right/Africa/Blantyre right/Africa/Brazzaville right/Africa/Bujumbura right/Africa/Cairo right/Africa/Casablanca right/Africa/Ceuta right/Africa/Conakry right/Africa/Dakar right/Africa/Dar_es_Salaam right/Africa/Djibouti right/Africa/Douala right/Africa/El_Aaiun right/Africa/Freetown right/Africa/Gaborone right/Africa/Harare right/Africa/Johannesburg right/Africa/Kampala right/Africa/Khartoum right/Africa/Kigali right/Africa/Kinshasa right/Africa/Lagos right/Africa/Libreville right/Africa/Lome right/Africa/Luanda right/Africa/Lubumbashi right/Africa/Lusaka right/Africa/Malabo right/Africa/Maputo right/Africa/Maseru right/Africa/Mbabane right/Africa/Mogadishu right/Africa/Monrovia right/Africa/Nairobi right/Africa/Ndjamena right/Africa/Niamey right/Africa/Nouakchott right/Africa/Ouagadougou right/Africa/Porto-Novo right/Africa/Sao_Tome right/Africa/Timbuktu right/Africa/Tripoli right/Africa/Tunis right/Africa/Windhoek right/America/ right/America/Adak right/America/Anchorage right/America/Anguilla right/America/Antigua right/America/Araguaina right/America/Argentina/ right/America/Argentina/Buenos_Aires right/America/Argentina/Catamarca right/America/Argentina/ComodRivadavia right/America/Argentina/Cordoba right/America/Argentina/Jujuy right/America/Argentina/La_Rioja right/America/Argentina/Mendoza right/America/Argentina/Rio_Gallegos right/America/Argentina/Salta right/America/Argentina/San_Juan right/America/Argentina/San_Luis right/America/Argentina/Tucuman right/America/Argentina/Ushuaia right/America/Aruba right/America/Asuncion right/America/Atikokan right/America/Atka right/America/Bahia right/America/Bahia_Banderas right/America/Barbados right/America/Belem right/America/Belize right/America/Blanc-Sablon right/America/Boa_Vista right/America/Bogota right/America/Boise right/America/Buenos_Aires right/America/Cambridge_Bay right/America/Campo_Grande right/America/Cancun right/America/Caracas right/America/Catamarca right/America/Cayenne right/America/Cayman right/America/Chicago right/America/Chihuahua right/America/Coral_Harbour right/America/Cordoba right/America/Costa_Rica right/America/Cuiaba right/America/Curacao right/America/Danmarkshavn right/America/Dawson right/America/Dawson_Creek right/America/Denver right/America/Detroit right/America/Dominica right/America/Edmonton right/America/Eirunepe right/America/El_Salvador right/America/Ensenada right/America/Fort_Wayne right/America/Fortaleza right/America/Glace_Bay right/America/Godthab right/America/Goose_Bay right/America/Grand_Turk right/America/Grenada right/America/Guadeloupe right/America/Guatemala right/America/Guayaquil right/America/Guyana right/America/Halifax right/America/Havana right/America/Hermosillo right/America/Indiana/ right/America/Indiana/Indianapolis right/America/Indiana/Knox right/America/Indiana/Marengo right/America/Indiana/Petersburg right/America/Indiana/Tell_City right/America/Indiana/Vevay right/America/Indiana/Vincennes right/America/Indiana/Winamac right/America/Indianapolis right/America/Inuvik right/America/Iqaluit right/America/Jamaica right/America/Jujuy right/America/Juneau right/America/Kentucky/ right/America/Kentucky/Louisville right/America/Kentucky/Monticello right/America/Knox_IN right/America/Kralendijk right/America/La_Paz right/America/Lima right/America/Los_Angeles right/America/Louisville right/America/Lower_Princes right/America/Maceio right/America/Managua right/America/Manaus right/America/Marigot right/America/Martinique right/America/Matamoros right/America/Mazatlan right/America/Mendoza right/America/Menominee right/America/Merida right/America/Metlakatla right/America/Mexico_City right/America/Miquelon right/America/Moncton right/America/Monterrey right/America/Montevideo right/America/Montreal right/America/Montserrat right/America/Nassau right/America/New_York right/America/Nipigon right/America/Nome right/America/Noronha right/America/North_Dakota/ right/America/North_Dakota/Beulah right/America/North_Dakota/Center right/America/North_Dakota/New_Salem right/America/Ojinaga right/America/Panama right/America/Pangnirtung right/America/Paramaribo right/America/Phoenix right/America/Port-au-Prince right/America/Port_of_Spain right/America/Porto_Acre right/America/Porto_Velho right/America/Puerto_Rico right/America/Rainy_River right/America/Rankin_Inlet right/America/Recife right/America/Regina right/America/Resolute right/America/Rio_Branco right/America/Rosario right/America/Santa_Isabel right/America/Santarem right/America/Santiago right/America/Santo_Domingo right/America/Sao_Paulo right/America/Scoresbysund right/America/Shiprock right/America/Sitka right/America/St_Barthelemy right/America/St_Johns right/America/St_Kitts right/America/St_Lucia right/America/St_Thomas right/America/St_Vincent right/America/Swift_Current right/America/Tegucigalpa right/America/Thule right/America/Thunder_Bay right/America/Tijuana right/America/Toronto right/America/Tortola right/America/Vancouver right/America/Virgin right/America/Whitehorse right/America/Winnipeg right/America/Yakutat right/America/Yellowknife right/Antarctica/ right/Antarctica/Casey right/Antarctica/Davis right/Antarctica/DumontDUrville right/Antarctica/Macquarie right/Antarctica/Mawson right/Antarctica/McMurdo right/Antarctica/Palmer right/Antarctica/Rothera right/Antarctica/South_Pole right/Antarctica/Syowa right/Antarctica/Vostok right/Arctic/ right/Arctic/Longyearbyen right/Asia/ right/Asia/Aden right/Asia/Almaty right/Asia/Amman right/Asia/Anadyr right/Asia/Aqtau right/Asia/Aqtobe right/Asia/Ashgabat right/Asia/Ashkhabad right/Asia/Baghdad right/Asia/Bahrain right/Asia/Baku right/Asia/Bangkok right/Asia/Beirut right/Asia/Bishkek right/Asia/Brunei right/Asia/Calcutta right/Asia/Choibalsan right/Asia/Chongqing right/Asia/Chungking right/Asia/Colombo right/Asia/Dacca right/Asia/Damascus right/Asia/Dhaka right/Asia/Dili right/Asia/Dubai right/Asia/Dushanbe right/Asia/Gaza right/Asia/Harbin right/Asia/Ho_Chi_Minh right/Asia/Hong_Kong right/Asia/Hovd right/Asia/Irkutsk right/Asia/Istanbul right/Asia/Jakarta right/Asia/Jayapura right/Asia/Jerusalem right/Asia/Kabul right/Asia/Kamchatka right/Asia/Karachi right/Asia/Kashgar right/Asia/Kathmandu right/Asia/Katmandu right/Asia/Kolkata right/Asia/Krasnoyarsk right/Asia/Kuala_Lumpur right/Asia/Kuching right/Asia/Kuwait right/Asia/Macao right/Asia/Macau right/Asia/Magadan right/Asia/Makassar right/Asia/Manila right/Asia/Muscat right/Asia/Nicosia right/Asia/Novokuznetsk right/Asia/Novosibirsk right/Asia/Omsk right/Asia/Oral right/Asia/Phnom_Penh right/Asia/Pontianak right/Asia/Pyongyang right/Asia/Qatar right/Asia/Qyzylorda right/Asia/Rangoon right/Asia/Riyadh right/Asia/Riyadh87 right/Asia/Riyadh88 right/Asia/Riyadh89 right/Asia/Saigon right/Asia/Sakhalin right/Asia/Samarkand right/Asia/Seoul right/Asia/Shanghai right/Asia/Singapore right/Asia/Taipei right/Asia/Tashkent right/Asia/Tbilisi right/Asia/Tehran right/Asia/Tel_Aviv right/Asia/Thimbu right/Asia/Thimphu right/Asia/Tokyo right/Asia/Ujung_Pandang right/Asia/Ulaanbaatar right/Asia/Ulan_Bator right/Asia/Urumqi right/Asia/Vientiane right/Asia/Vladivostok right/Asia/Yakutsk right/Asia/Yekaterinburg right/Asia/Yerevan right/Atlantic/ right/Atlantic/Azores right/Atlantic/Bermuda right/Atlantic/Canary right/Atlantic/Cape_Verde right/Atlantic/Faeroe right/Atlantic/Faroe right/Atlantic/Jan_Mayen right/Atlantic/Madeira right/Atlantic/Reykjavik right/Atlantic/South_Georgia right/Atlantic/St_Helena right/Atlantic/Stanley right/Australia/ right/Australia/ACT right/Australia/Adelaide right/Australia/Brisbane right/Australia/Broken_Hill right/Australia/Canberra right/Australia/Currie right/Australia/Darwin right/Australia/Eucla right/Australia/Hobart right/Australia/LHI right/Australia/Lindeman right/Australia/Lord_Howe right/Australia/Melbourne right/Australia/NSW right/Australia/North right/Australia/Perth right/Australia/Queensland right/Australia/South right/Australia/Sydney right/Australia/Tasmania right/Australia/Victoria right/Australia/West right/Australia/Yancowinna right/Brazil/ right/Brazil/Acre right/Brazil/DeNoronha right/Brazil/East right/Brazil/West right/CET right/CST6CDT right/Canada/ right/Canada/Atlantic right/Canada/Central right/Canada/East-Saskatchewan right/Canada/Eastern right/Canada/Mountain right/Canada/Newfoundland right/Canada/Pacific right/Canada/Saskatchewan right/Canada/Yukon right/Chile/ right/Chile/Continental right/Chile/EasterIsland right/Cuba right/EET right/EST right/EST5EDT right/Egypt right/Eire right/Etc/ right/Etc/GMT right/Etc/GMT+0 right/Etc/GMT+1 right/Etc/GMT+10 right/Etc/GMT+11 right/Etc/GMT+12 right/Etc/GMT+2 right/Etc/GMT+3 right/Etc/GMT+4 right/Etc/GMT+5 right/Etc/GMT+6 right/Etc/GMT+7 right/Etc/GMT+8 right/Etc/GMT+9 right/Etc/GMT-0 right/Etc/GMT-1 right/Etc/GMT-10 right/Etc/GMT-11 right/Etc/GMT-12 right/Etc/GMT-13 right/Etc/GMT-14 right/Etc/GMT-2 right/Etc/GMT-3 right/Etc/GMT-4 right/Etc/GMT-5 right/Etc/GMT-6 right/Etc/GMT-7 right/Etc/GMT-8 right/Etc/GMT-9 right/Etc/GMT0 right/Etc/Greenwich right/Etc/UCT right/Etc/UTC right/Etc/Universal right/Etc/Zulu right/Europe/ right/Europe/Amsterdam right/Europe/Andorra right/Europe/Athens right/Europe/Belfast right/Europe/Belgrade right/Europe/Berlin right/Europe/Bratislava right/Europe/Brussels right/Europe/Bucharest right/Europe/Budapest right/Europe/Chisinau right/Europe/Copenhagen right/Europe/Dublin right/Europe/Gibraltar right/Europe/Guernsey right/Europe/Helsinki right/Europe/Isle_of_Man right/Europe/Istanbul right/Europe/Jersey right/Europe/Kaliningrad right/Europe/Kiev right/Europe/Lisbon right/Europe/Ljubljana right/Europe/London right/Europe/Luxembourg right/Europe/Madrid right/Europe/Malta right/Europe/Mariehamn right/Europe/Minsk right/Europe/Monaco right/Europe/Moscow right/Europe/Nicosia right/Europe/Oslo right/Europe/Paris right/Europe/Podgorica right/Europe/Prague right/Europe/Riga right/Europe/Rome right/Europe/Samara right/Europe/San_Marino right/Europe/Sarajevo right/Europe/Simferopol right/Europe/Skopje right/Europe/Sofia right/Europe/Stockholm right/Europe/Tallinn right/Europe/Tirane right/Europe/Tiraspol right/Europe/Uzhgorod right/Europe/Vaduz right/Europe/Vatican right/Europe/Vienna right/Europe/Vilnius right/Europe/Volgograd right/Europe/Warsaw right/Europe/Zagreb right/Europe/Zaporozhye right/Europe/Zurich right/Factory right/GB right/GB-Eire right/GMT right/GMT+0 right/GMT-0 right/GMT0 right/Greenwich right/HST right/Hongkong right/Iceland right/Indian/ right/Indian/Antananarivo right/Indian/Chagos right/Indian/Christmas right/Indian/Cocos right/Indian/Comoro right/Indian/Kerguelen right/Indian/Mahe right/Indian/Maldives right/Indian/Mauritius right/Indian/Mayotte right/Indian/Reunion right/Iran right/Israel right/Jamaica right/Japan right/Kwajalein right/Libya right/ME . ..MAKEDEVconsole tty memkmem>null>zero>stdin>stdoutstderrksyms>klog>bpf0>wd0a>rwd0a>wd0b>rwd0b>wd0c>rwd0c>wd0d>rwd0d>wd0e>rwd0e>wd0f>rwd0f>wd0g>rwd0g>wd0h>rwd0h>wd0i>rwd0i> ... . ..chowndhclient" disklabel"dmesgfdiskfsck  fsck_ext2fsfsck_ffs"ifconfig"init mknodmount mount_cd9660" mount_ext2fs" mount_ffs" mount_msdos mount_nfs"newfs newfs_msdosping ping6reboothalt routertsolumountsysctl .B.. .B ..miscv:keymaps . ..itermcap . ..chowndhclient" disklabel"dmesgfdiskfsck  fsck_ext2fsfsck_ffs"ifconfig"init mknodmount mount_cd9660" mount_ext2fs" mount_ffs" mount_msdos mount_nfs"newfs newfs_msdosping ping6reboothalt routertsolumountsysctlbioctljdhclient-script#!/bin/sh - PATH=/sbin:/usr/sbin:/bin:/usr/bin T=$0 [ "$eo" ] || eo= hex() { case $1 in [0-9]) echo -n $1;; 10) echo -n a;; 11) echo -n b;; 12) echo -n c;; 13) echo -n d;; 14) echo -n e;; 15) echo -n f;; esac } alph2d() { local t="$1" local p="0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ" local sub=${p%${t}*} echo ${#sub} } h2d() { local s="$1" local f=${s%*[0-9a-f]} n=${s#[0-9a-f]*} echo $(($(_h2d $f)*16+ $(_h2d $n) )) } _h2d() { case $1 in [0-9]) echo -n $1;; a) echo -n 10;; b) echo -n 11;; c) echo -n 12;; d) echo -n 13;; e) echo -n 14;; f) echo -n 15;; esac } unt() { arg="$1" tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" while [ "$tmp" != "$arg" ] do arg=$tmp tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" done echo $arg } dodisk() { [ "$DEBUG" ] && set -x n=$(($((${5}*${7:-16}))+${6})) count=0 [ 0$7 -ne 8 ] && l="i j k l m n o p" for d in a b c d e f g h $l do M $1$2$d b $3 $(($n+$count)) 640 operator M r$1$2$d c $4 $(($n+$count)) 640 operator let count=count+1 done } dodisk2() { n=$(($(($5*${7:-16}))+$6)) M $1$2a b $3 $n 640 operator M r$1$2a c $4 $n 640 operator n=$(($n+2)) M $1$2c b $3 $n 640 operator M r$1$2c c $4 $n 640 operator } RMlist[0]="rm -f" mkl() { mklist[${#mklist[*]}]=";mknod -m $1 $2 $3 $4 $5" } M() { RMlist[${#RMlist[*]}]=$1 mkl ${5-666} $1 $2 $3 $4 G=${6:-wheel} [ "$7" ] && { MKlist[${#MKlist[*]}]=";chown $7:$G $1" } || { case $G in wheel) [ ${#whlist[*]} = 0 ] && whlist[0]=";chgrp wheel" whlist[${#whlist[*]}]="$1" ;; operator) [ ${#oplist[*]} = 0 ] && oplist[0]=";chgrp operator" oplist[${#oplist[*]}]="$1" ;; *) MKlist[${#MKlist[*]}]=";chgrp $G $1"; esac } return 0 } R() { [ "$DEBUG" ] && set -x for i in "$@" do U=`unt $i` [ "$U" ] || U=0 case $i in ramdisk) R std bpf0 wd0 wd1 sd0 tty00 rd0 wsmouse R st0 ttyC0 wskbd0 apm bio diskmap ;; std) M console c 0 0 600 M tty c 1 0 M mem c 2 0 640 kmem M kmem c 2 1 640 kmem M null c 2 2 M zero c 2 12 M stdin c 7 0 M stdout c 7 1 M stderr c 7 2 M ksyms c 8 0 640 kmem M klog c 6 0 600 ;; vscsi*) M vscsi$U c 100 $U 600 ;; video*) M video$U c 38 $U MKlist[${#MKlist[*]}]=";[ -e video ] || ln -s video$U video" ;; tuner*) M tuner$U c 75 $(($(($U*2))+16)) 644 ;; systrace) M systrace c 50 0 644 ;; uk*) M uk$U c 28 $U 640 operator ;; tun*) M tun$U c 33 $U 600 ;; rmidi*) M rmidi$U c 57 $U 666 ;; *random) n=0 for pre in " " s u a do M ${pre}random c 40 $n 644 n=$(($n+1)) done ;; radio*) M radio$U c 97 $U MKlist[${#MKlist[*]}]=";[ -e radio ] || ln -s radio$U radio" ;; pppx*) M pppx$U c 103 $U 600 ;; pf*) M pf c 46 0 600 ;; pci*) M pci$U c 88 $U 600 MKlist[${#MKlist[*]}]=";[ -h pci ] || ln -sf pci0 pci" ;; nnpfs*) M nnpfs$U c 51 $U 600 ;; music*) M music$U c 58 $U M sequencer$U c 58 $(($U+128)) MKlist[${#MKlist[*]}]=";[ -e music ] || ln -s music$U music" MKlist[${#MKlist[*]}]=";[ -e sequencer ] || ln -s sequencer$U sequencer" ;; lkm) M lkm c 35 0 640 _lkm ;; iop*) M iop$U c 73 $U 660 ;; hotplug) M hotplug c 37 $U 400 ;; fd) RMlist[${#RMlist[*]}]=";mkdir -p fd;rm -f" n=0 while [ $n -lt 64 ];do M fd/$n c 7 $n;n=$(($n+1));done MKlist[${#MKlist[*]}]=";chmod 555 fd" ;; diskmap) M diskmap c 102 0 640 operator ;; crypto) M crypto c 47 0 ;; bthub*) M bthub$U c 101 $U ;; bpf*) M bpf$U c 22 $U 600 ;; bktr*) M bktr$U c 75 $U 644 ;; bio) M bio c 52 0 600 ;; audio*) M sound$U c 36 $U M mixer$U c 36 $(($U+16)) M audio$U c 36 $(($U+128)) M audioctl$U c 36 $(($U+192)) MKlist[${#MKlist[*]}]=";[ -e audio ] || ln -s audio$U audio" MKlist[${#MKlist[*]}]=";[ -e mixer ] || ln -s mixer$U mixer" MKlist[${#MKlist[*]}]=";[ -e sound ] || ln -s sound$U sound" MKlist[${#MKlist[*]}]=";[ -e audioctl ] || ln -s audioctl$U audioctl" ;; apm*) M apm c 34 0 644 M apmctl c 34 8 644 ;; uscanner*) M uscanner$U c 69 $U 660 ;; usb*) [ "$i" = "usb" ] && u= || u=$U M usb$u c 64 $U 660 ;; urio*) M urio$U c 67 $U 660 ;; ulpt*) M ulpt$U c 66 $U 660 ;; uhid*) M uhid$U c 65 $U 660 ;; ugen*) n=$(($U*16)) for j in 0{0,1,2,3,4,5,6,7,8,9} 1{0,1,2,3,4,5} do M ugen$U.$j c 70 $(($n+10#$j)) 660 done ;; uall) R ttyU0 ttyU1 ttyU2 ttyU3 ugen0 ugen1 ulpt0 ulpt1 uhid0 uhid1 R uhid2 uhid3 uscanner0 urio0 usb0 usb1 usb2 usb3 usb4 usb5 R usb6 usb7 ;; ttyU[0-9a-zA-Z]) U=${i#ttyU*} o=$(alph2d $U) M ttyU$U c 68 $o 660 dialer uucp M cuaU$U c 68 $(($o+128)) 660 dialer uucp ;; wsmux|wsmouse|wskbd) M wsmouse c 63 0 600 M wskbd c 63 1 600 ;; wsmouse[0-9]*) M wsmouse$U c 62 $U 600 ;; wskbd[0-9]*) M wskbd$U c 61 $U 600 ;; wscons) R wsmouse0 wsmouse1 wsmouse2 wsmouse3 wskbd0 wskbd1 wskbd2 R wskbd3 wsmux ttyCcfg ttyC0 ttyC1 ttyC2 ttyC3 ttyC4 ttyC5 R ttyC6 ttyC7 ttyC8 ttyC9 ttyCa ttyCb ;; tty[C-J]*) U=${i##tty[C-J]} case $i in ttyC*) n=C m=0;; ttyD*) n=D m=256;; ttyE*) n=E m=512;; ttyF*) n=F m=768;; ttyG*) n=G m=1024;; ttyH*) n=H m=1280;; ttyI*) n=I m=1536;; ttyJ*) n=J m=1792;; esac case $U in [0-9a-f]) M tty$n$U c 60 $((16#$U+$m)) 600;; cfg) M tty${n}cfg c 60 $((255+$m)) 600;; *) echo bad unit $U for $i; exit 1;; esac ;; pty*) if [ $U -gt 15 ]; then echo bad unit for pty in: $i continue fi set -A letters p q r s t u v w x y z P Q R S T set -A suffixes 0 1 2 3 4 5 6 7 8 9 a b c d e f g h i j k l m n o p q \ r s t u v w x y z A B C D E F G H I J K L M N O P Q R S T U V W X \ Y Z name=${letters[$U]} n=0 while [ $n -lt 62 ] do nam=$name${suffixes[$n]} off=$(($U*62)) M tty$nam c 4 $(($off+$n)) M pty$nam c 5 $(($off+$n)) n=$(($n+1)) done ;; ptm) M ptm c 98 0 666 ;; tty[0-7][0-9a-f]) U=${i#tty*} o=$(h2d $U) M tty$U c 12 $o 660 dialer uucp M cua$U c 12 $(($o+128)) 660 dialer uucp ;; st*) n=$(($U*16)) for pre in " " n e en do M ${pre}st$U b 25 $n 660 operator M ${pre}rst$U c 25 $n 660 operator n=$(($n+1)) done ;; vnd*) dodisk vnd $U 19 19 $U 0 ;; rd*) dodisk2 rd $U 18 18 $U 0 ;; ch*) M ch$U c 27 $U 660 operator ;; cd*) dodisk2 cd $U 26 26 $U 0 ;; local) test -s $T.local && sh $T.local ;; all) R bthub0 bthub1 bthub2 ccd0 ccd1 ccd2 ccd3 vnd0 vnd1 vnd2 R vnd3 sd0 sd1 sd2 sd3 sd4 sd5 sd6 sd7 sd8 sd9 cd0 cd1 rd0 R tun0 tun1 tun2 tun3 bio bpf0 bpf1 bpf2 bpf3 bpf4 bpf5 bpf6 R bpf7 bpf8 bpf9 pty0 diskmap vscsi0 nnpfs0 ch0 hotplug ptm R local wscons pci0 pci1 pci2 pci3 iop0 iop1 uall rmidi0 R rmidi1 rmidi2 rmidi3 rmidi4 rmidi5 rmidi6 rmidi7 tuner0 R radio0 music0 video0 video1 audio0 audio1 audio2 uk0 random R lkm tty00 tty01 tty02 tty03 apm crypto pf systrace wd0 wd1 R wd2 wd3 raid0 raid1 raid2 raid3 std st0 st1 fd ;; wd*|sd*|raid*|ccd*) case $i in wd*) dodisk wd $U 16 16 $U 0;; sd*) dodisk sd $U 24 24 $U 0;; raid*) dodisk raid $U 71 71 $U 0;; ccd*) dodisk ccd $U 21 21 $U 0;; esac ;; *) echo $i: unknown device ;; esac done } R "$@" { echo -n ${RMlist[*]} echo -n ${mklist[*]} echo -n ${MKlist[*]} echo -n ${whlist[*]} echo ${oplist[*]} } | if [ "$eo" = "echo" ]; then cat else sh fi {user} > /mnt/root/.forward mkdir -p /mnt/home/$user (cd /mnt/etc/skel; cp -pR . /mnt/home/$user) (umask 077 && sed "s,^To: root\$,To: ${username} <${user}>," \ /mnt/var/mail/root > /mnt/var/mail/$user ) chown -R 1000:1000 /mnt/home/$user /mnt/var/mail/$user echo "1,s@wheel:.:0:root\$@wheel:\*:0:root,${user}@ w q" | /mnt/bin/ed /mnt/etc/group 2>/dev/null fi if [[ -n "$_rootpass" ]]; then _encr=`/mnt/usr/bin/encrypt -b 8 -- "$_rootpass"` echo "1,s@^root::@root:${_encr}:@ w q" | /mnt/bin/ed /mnt/etc/master.passwd 2>/dev/null fi /mnt/usr/sbin/pwd_mkdb -p -d /mnt/etc /etc/master.passwd if grep -qs '^rtsol' /mnt/etc/hostname.*; then sed -e "/^#\(net\.inet6\.ip6\.accept_rtadv\)/s//\1/" \ /mnt/etc/sysctl.conf >/tmp/sysctl.conf sed -e "/^#\(net\.inet6\.icmp6\.rediraccept\)/s//\1/" \ /mnt/etc/sysctl.conf >/tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf fi finish_up 08` LN<   LNdC`[~ [~ LN`@@<@TU + LN`b+ LNA  LNy~N! LN~ LN~ LN3#v! LN~ LN~ LN~! LN~ LN~ LN~a LN~ LN~ LN{'_*+! LN~ LN~ LN{'_*Q a LN~ LN~ LN{'_*fZ! LN~ LN~ LN{'_*z`a LN@r LN@r LN{'_* ! LN@r LN@r LN{'_*)ha LN@r LN@r LN{'_*#! LN@r LN@r LN{'_* 4a LN@r LN@r LN{'_*v3! LN@r LN@r LN{'_*M_3a LN@r LN@r LN{'_*p! LN@r LN@r LN{'_*Ca LN  LN  LN{'_*gQR! LN  LN  LN{'_*b<| a LN  LN  LN{'_* V! LN  LN  LN{'_*Da LN  LN  LN{'_*{-Y! LN  LN  LN{'_*ηa LN  LN  LN{'_* ڨ ! LN  LN  LN{'_* ya LN  LN  LN{'_* =`! LNB LNB LN{'_* 6`~a LNB LNB LN{'_* gXt! LNB LNB LN{'_* 6a LNB LNB LN{'_* &1! LNB LNB LN{'_* \a LNB LNB LN{'_* .! LNB LNB LN{'_* Vqa LNB LNB LN{'_*z1! LNB LNB LN{'_*0[a LN R= LN R= LN{'_* иA! LN R= LN R= LN{'_*d9a LN R= LN R= LN{'_*AM! LN R= LN R= LN{'_*굓a LN R= LN R= LN{'_*XQ+! LN R= LN R= LN{'_*ka LN R= LN R= LN{'_*6|m! LN R= LN R= LN{'_*87Da LNX LNX LN{'_*15! LNX LNX LN{'_*ؓa LNX LNX LN{'_*! LNX LNX LN{'_*a LNX LNX LN{'_*=! LNX LNX LN{'_*Sa LNX LNX LN{'_*^! LNX LNX LN{'_* a LN'_o LN'_o LN{'_*T4! LN'_o LN'_o LN{'_*;a LN'_o LN'_o LN{'_*Jg#! LN'_o LN'_o LN{'_*Нba LN'_o LN'_o LN{'_*! LN'_o LN'_o LN{'_*lza LN'_o LN'_o LN{'_*Kl! LN'_o LN'_o LN{'_*Ua LN'_o LN'_o LN{'_*mLE! LN'_o LN'_o LN{'_*6Fa LN3 LN3 LN{'_*1! LN3 LN3 LN{'_*Wa LN3 LN3 LN{'_*P! LN3 LN3 LN{'_*jka LN3 LN3 LN{'_*&P! LN3 LN3 LN{'_*}Qa LN3 LN3 LN{'_*4 >! LN3 LN3 LN{'_*Y>a LN3 LN3 LN{'_*2-! LN3 LN3 LN{'_*ي1Ma LN3 LN3 LN{'_*x! LN3 LN3 LN{'_*|a LN3 LN3 LN{'_*ҙ! LN3 LN3 LN{'_*|$Da LN;! LN;! LN{'_*L! LN;! LN;! LN{'_*zYa LN;! LN;! LN{'_*1! LN;! LN;! LN{'_*raa LN;! LN;! LN{'_*g! LN;! LN;! LN* ja LN;! LN;! LN*p! LN;! LN;! LN*Ni(a LN;! LN;! LN*N@! LN;! LN;! LN*|G&a LN;! LN;! LN*ۣs'! LN;! LN;! LN*&۵a LN;! LN;! LN* H! LN: LN: LN* $0a LN: LN: LN* Mң! LN: LN: LN* ˶a LN: LN: LN* @rC! LN: LN: LN* a LN: LN: LN* n! LN: LN: LN* a LN: LN: LN* *;! LN: LN: LN* +]a LN: LN: LN*iNf! LN: LN: LN*MEQa LN: LN: LN*\k! LN: LN: LN*4! LN: LN: LN:|% U?Bu! LN% LN% LNq0& R YBua LN% LN% LN*Ձ! LN% LN% LN*YGxa LN% LN% LN*&! LN% LN% LN*:! LN% LN% LN%?JR! LN% LN% LN%?O{Sa LN% LN% LN*]X*! LN% LN% LN*a LN% LN% LN*G{! LN% LN% LN*Ya LN% LN% LN*A! LN% LN% LN*a LNl LNl LN*C! LNl LNl LN*9! LNl LNl LNl<! LNl LNl LNl=J! LNl LNl LNl"0! LNl LNl LNl"Qb! LNl LNl LNl4C+`! LNl LNl LN*f@ LNHP+ LN + LN h,$x+ LN/ + LN + LNhZp4˸I{?'=!v>ÄnV:Œ (6N^Zn*lPBN$]!QH=69ZXKi . ..MAKEDEVconsole tty memkmem>null>zero>stdin>stdoutstderrksyms>klog>bpf0>wd0a>rwd0a>wd0b>rwd0b>wd0c>rwd0c>wd0d>rwd0d>wd0e>rwd0e>wd0f>rwd0f>wd0g>rwd0g>wd0h>rwd0h>wd0i>rwd0i>wd0j>rwd0j>wd0k>rwd0k> wd0l> rwd0l> wd0m> rwd0m> wd0n>rwd0n>wd0o>rwd0o>wd0p>rwd0p>wd1a>rwd1a>wd1b>rwd1b>wd1c>rwd1c>wd1d>rwd1d>wd1e>rwd1e>wd1f>rwd1f>wd1g> rwd1g>!wd1h>"rwd1h>#wd1i>$rwd1i>%wd1j>&rwd1j>'wd1k>(rwd1k>)wd1l>*rwd1l>+wd1m>,rwd1m>-wd1n>.rwd1n>/wd1o>0rwd1o>1wd1p>2rwd1p>3sd0a>4rsd0a>5sd0b>6rsd0b>7sd0c>8rsd0c>9sd0d>:rsd0d>;sd0e><rsd0e>=sd0f>>rsd0f>?sd0g>@rsd0g>Asd0h>Brsd0h>Csd0i>Drsd0i>Esd0j>Frsd0j>Gsd0k>Hrsd0k>Isd0l>Jrsd0l>Ksd0m>Lrsd0m>Msd0n>Nrsd0n>Osd0o>Prsd0o>Qsd0p>Rrsd0p>Stty00>Tcua00>Urd0a>Vrrd0a>Wrd0c>Xrrd0c>YwsmouseZwskbd>[ st0\rst0>]nst0>^nrst0>_est0>`erst0>aenst0>benrst0cttyC0>dwskbd0e apmfapmctlg biohdiskmapLUMNS=80 : ${EDITOR:=ed} [[ -x /usr/bin/vi ]] && EDITOR=vi export EDITOR COLUMNS cd / umount -af 1>/dev/null 2>&1 for _ifs in $(get_ifdevs dhcp); do set -- $(v4_info $_ifs) [[ $1 == UP && -n $2 ]] && continue ifconfig $_ifs delete down -group dhcp 2>&- done cat <<__EOT At any prompt except password prompts you can escape to a shell by typing '!'. Default answers are shown in []'s and are selected by pressing RETURN. You can exit this program at any time by pressing Control-C, but this can leave your system in an inconsistent state. __EOT set_term if [[ $MODE == install ]]; then ask_until "System hostname? (short form, e.g. 'foo')" "$(hostname -s)" [[ ${resp%%.*} != $(hostname -s) ]] && hostname $resp THESETS="$THESETS site$VERSION-$(hostname -s).tgz" echo donetconfig (( nifs != 0 )) && startftplist echo while :; do askpassword root _rootpass="$_password" [[ -n "$_password" ]] && break echo "The root password must be set." done questions user_setup set_timezone /var/tzlist echo fi while :; do ask_which "disk" "is the root disk" '$(get_dkdevs | sed s,^$,none, )' [[ $resp == done ]] && exit [[ $resp != none ]] && break done makedev $resp || exit ROOTDISK=$resp ROOTDEV=${ROOTDISK}a SWAPDEV=${ROOTDISK}b dumb|80-column dumb tty:\ :am:\ :co#80:\ :bl=^G:cr=^M:do=^J:sf=^J: vt100|vt100-am|dec vt100 (w/advanced video):\ :5i:am:bs:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :@8=\EOM:DO=\E[%dB:K1=\EOq:K2=\EOr:K3=\EOs:K4=\EOp:K5=\EOn:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:as=^N:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:do=^J:\ :eA=\E(B\E)0:ho=\E[H:k0=\EOy:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\EOt:k6=\EOu:k7=\EOv:k8=\EOl:k9=\EOw:k;=\EOx:\ :kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:l1=pf1:l2=pf2:l3=pf3:l4=pf4:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[0m:mr=\E[7m:nd=\E[C:pf=\E[4i:po=\E[5i:\ :ps=\E[0i:rc=\E8:rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :..sa=\E[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t\016%e\017%;$<2>:\ :sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: vt220|vt200|dec vt220:\ :5i:am:bs:mi:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :%0=\E[29~:%1=\E[28~:*6=\E[4~:@0=\E[1~:AL=\E[%dL:\ :DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:F1=\E[23~:F2=\E[24~:\ :F3=\E[25~:F4=\E[26~:F7=\E[31~:F8=\E[32~:F9=\E[33~:\ :FA=\E[34~:IC=\E[%d@:LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:\ :SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:eA=\E)0:ec=\E[%dX:ei=\E[4l:\ :ho=\E[H:if=/usr/share/tabset/vt100:im=\E[4h:\ :is=\E[?7h\E[>\E[?1h\E F\E[?4l:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k6=\E[17~:k7=\E[18~:k8=\E[19~:k9=\E[20~:\ :k;=\E[21~:kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=^H:kd=\E[B:\ :kl=\E[D:kr=\E[C:ku=\E[A:l1=pf1:l2=pf2:l3=pf3:l4=pf4:le=^H:\ :mb=\E[5m:md=\E[1m:me=\E[0m:mr=\E[7m:nd=\E[C:nw=\EE:\ :pf=\E[4i:po=\E[5i:ps=\E[i:r1=\E[?3l:rc=\E8:sc=\E7:\ :se=\E[27m:sf=\ED:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[24m:\ :up=\E[A:us=\E[4m:vb=\E[?5h\E[?5l: #!/bin/sh delete_old_address() { if [ -n "$old_ip_address" ]; then ifconfig $interface inet $old_ip_address delete route -q $rdomain delete "$old_ip_address" 127.0.0.1 fi } ip6_delete_old_address() { if [ -n "$old_ip6_address" ]; then ifconfig $interface inet6 $old_ip6_address delete fi } add_new_address() { ifconfig $interface \ inet $new_ip_address \ netmask $new_subnet_mask \ broadcast $new_broadcast_address route -q $rdomain add $new_ip_address 127.0.0.1 } ip6_add_new_address() { ifconfig $interface \ inet6 $new_ip6_address \ prefixlen $new_ip6_prefixlen } delete_old_routes() { route -q $rdomain -n flush -inet -iface $interface arp -dan } add_new_routes() { route -q $rdomain -n flush -inet -iface $interface for router in $new_routers; do if [ "$new_ip_address" = "$router" ]; then route -q $rdomain add default -iface $router else route -q $rdomain add default $router fi break done } add_new_resolv_conf() { rm -f /etc/resolv.conf.std if [ -n "$new_domain_name" ]; then echo "search $new_domain_name" >>/etc/resolv.conf.std fi if [ -n "$new_domain_name_servers" ]; then for nameserver in $new_domain_name_servers; do echo "nameserver $nameserver" >>/etc/resolv.conf.std done fi if [ -f /etc/resolv.conf.std ]; then if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >>/etc/resolv.conf.std fi if [ -f /etc/resolv.conf ]; then cat /etc/resolv.conf > /etc/resolv.conf.save fi cat /etc/resolv.conf.std > /etc/resolv.conf rm -f /etc/resolv.conf.std chown -RL root:wheel /etc/resolv.conf chmod -RL 644 /etc/resolv.conf return 0 fi return 1 } ip6_add_new_resolv_conf() { rm -f /etc/resolv.conf.std6 if [ -n "$new_dhcp6_domain_search" ]; then echo "search $new_dhcp6_domain_search" >>/etc/resolv.conf.std6 fi if [ -n "$new_dhcp6_name_servers" ]; then for nameserver in $new_dhcp6_name_servers; do echo "nameserver $nameserver" >>/etc/resolv.conf.std6 done fi if [ -f /etc/resolv.conf.std6 ]; then if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >>/etc/resolv.conf.std6 fi if [ -f /etc/resolv.conf ]; then cat /etc/resolv.conf > /etc/resolv.conf.save fi cat /etc/resolv.conf.std6 > /etc/resolv.conf rm -f /etc/resolv.conf.std6 chown -RL root:wheel /etc/resolv.conf chmod -RL 644 /etc/resolv.conf return 0 fi return 1 } case $reason in MEDIUM) ;; PREINIT) ;; PREINIT6) ;; ARPSEND) exit 1 ;; ARPCHECK) ;; BOUND|RENEW|REBIND|REBOOT) if [ -n "$old_ip_address" ]; then if [ "$old_ip_address" != "$new_ip_address" ]; then delete_old_address delete_old_routes fi fi if [ "$reason" = BOUND ] || [ "$reason" = REBOOT ] || [ -z "$old_ip_address" ] || [ "$old_ip_address" != "$new_ip_address" ]; then add_new_address add_new_routes fi add_new_resolv_conf ;; BOUND6|RENEW6|REBIND6) if [ -n "$old_ip6_address" ]; then if [ "$old_ip6_address" != "$new_ip6_address" ]; then ip6_delete_old_address fi fi if [ "$reason" = BOUND6 ] || [ -z "$old_ip6_address" ] || [ "$old_ip6_address" != "$new_ip6_address" ]; then ip6_add_new_address fi ip6_add_new_resolv_conf ;; EXPIRE|FAIL) if [ -n "$old_ip_address" ]; then delete_old_address delete_old_routes fi if [ -f /etc/resolv.conf.save ]; then cat /etc/resolv.conf.save > /etc/resolv.conf fi ;; EXPIRE6|RELEASE6|STOP6) if [ -n "$old_ip6_address" ]; then ip6_delete_old_address fi ;; TIMEOUT) add_new_address sleep 1 if [ -n "$new_routers" ]; then set "$new_routers" if ping -q -c 1 -w 1 "$1"; then add_new_routes if add_new_resolv_conf; then exit 0 fi fi fi ifconfig $interface inet $new_ip_address delete delete_old_routes exit 1 ;; esac exit 0 #!/bin/ksh MODE=install . install.sub DISK= DISKS_DONE= _DKDEVS=$(get_dkdevs) rm -f /tmp/fstab.shadow /tmp/fstab /tmp/fstab.* ask_yn "Use DUIDs rather than device names in fstab?" yes [[ $resp == y ]] && FSTABFLAG=-F while :; do DISKS_DONE=$(addel "$DISK" $DISKS_DONE) _DKDEVS=$(rmel "$DISK" $_DKDEVS) if isin $ROOTDISK $_DKDEVS; then resp=$ROOTDISK rm -f /tmp/fstab else ask_which "disk" "do you wish to initialize" \ '$(l=$(get_dkdevs); for a in $DISKS_DONE; do l=$(rmel $a $l); done; bsort $l)' \ done [[ $resp == done ]] && break fi DISK=$resp makedev $DISK || continue rm -f /tmp/*.$DISK AUTOROOT=n md_prep_disklabel $DISK || { DISK= ; continue ; } grep -qs " / ffs " /tmp/fstab.$ROOTDISK || \ { DISK= ; echo "'/' must be configured!" ; continue ; } if [[ -f /tmp/fstab.$DISK ]]; then while read _pp _mp _rest; do if [[ $_mp == "none" ]]; then echo "$_pp $_mp $_rest" >>/tmp/fstab continue fi [[ /tmp/fstab.$DISK == $(grep -l " $_mp " /tmp/fstab.*) ]] || \ { _rest=$DISK ; DISK= ; break ; } done /etc/fstab rm /tmp/fstab.$_rest set -- $(grep -h " $_mp " /tmp/fstab.*[0-9]) echo "$_pp and $1 can't both be mounted at $_mp." continue fi _i=${#_fsent[*]} while read _pp _mp _fstype _rest; do [[ $_fstype == ffs ]] || continue _OPT= [[ $_mp == / ]] && _OPT=$MDROOTFSOPT newfs -q $_OPT ${_pp##/dev/} _fsent[$_i]="$_mp!$_pp" : $(( _i += 1 )) done >/tmp/fstab munge_fstab mount_fs "-o async" install_sets if [[ -z $TZ ]]; then (cd /mnt/usr/share/zoneinfo ls -1dF `tar cvf /dev/null [A-Za-y]*` >/mnt/tmp/tzlist ) echo set_timezone /mnt/tmp/tzlist rm -f /mnt/tmp/tzlist fi if _time=$(ftp_time) && _now=$(date +%s) && \ (( _now - _time > 120 || _time - _now > 120 )); then _tz=/mnt/usr/share/zoneinfo/$TZ ask_yn "Time appears wrong. Set to '$(TZ=$_tz date -r "$(ftp_time)")'?" yes if [[ $resp == y ]]; then date $(date -r "$(ftp_time)" "+%Y%m%d%H%M.%S") >&- fi fi if [[ -s $SERVERLISTALL ]]; then _i= [[ -n $installedfrom ]] && _i="install=$installedfrom" [[ -n $TZ ]] && _i="$_i&TZ=$TZ" [[ -n $method ]] && _i="$_i&method=$method" [[ -n $_i ]] && ftp $FTPOPTS -a -o - \ "http://129.128.5.191/cgi-bin/ftpinstall.cgi?$_i" >/dev/null 2>&1 & fi sed -e "/^console.*on.*secure.*$/s/std\.[0-9]*/std.$(stty speed)/" \ /mnt/etc/ttys >/tmp/ttys mv /tmp/ttys /mnt/etc/ttys echo -n "Saving configuration files..." (cd /var/db; [ -f dhclient.leases ] && mv dhclient.leases /mnt/var/db/. ) hostname >/tmp/myname if [[ -f /tmp/hosts ]]; then _dn=$(get_fqdn) while read _addr _hn _aliases; do if [[ -n $_aliases || $_hn != ${_hn%%.*} || -z $_dn ]]; then echo "$_addr\t$_hn $_aliases" else echo "$_addr\t$_hn.$_dn $_hn" fi done >/mnt/etc/hosts rm /tmp/hosts fi _f=dhclient.conf [[ -f /tmp/$_f ]] && { cat /tmp/$_f >>/mnt/etc/$_f ; rm /tmp/$_f ; } (cd /tmp; for _f in fstab hostname* kbdtype my* ttys *.conf *.tail; do [[ -f $_f && -s $_f ]] && mv $_f /mnt/etc/. done) (dmesg; cat $SERVERLISTALL; sysctl; route -n show; df; ifconfig -A; hostname) >/mnt/dev/arandom 2>&1 echo -n "done.\nGenerating initial host.random file..." /mnt/bin/dd if=/mnt/dev/arandom of=/mnt/var/db/host.random \ bs=65536 count=1 >/dev/null 2>&1 chmod 600 /mnt/var/db/host.random >/dev/null 2>&1 echo "done." apply if [[ -n $user ]]; then _encr="*" [[ -n "$userpass" ]] && _encr=`/mnt/usr/bin/encrypt -b 8 -- "$userpass"` uline="${user}:${_encr}:1000:1000:staff:0:0:${username}:/home/${user}:/bin/ksh" echo "$uline" >> /mnt/etc/master.passwd echo "${user}:*:1000:" >> /mnt/etc/group echo $ . install.md set_term() { local _layouts export TERM=${TERM:-${MDTERM:-vt220}} if [[ -n $CONSOLE ]]; then ask "Terminal type?" $TERM export TERM=$resp else [[ -x /sbin/kbd ]] || return _layouts=$(bsort $(kbd -l | egrep -v "^(user|tables|encoding)")) while :; do ask "Choose your keyboard layout ('?' or 'L' for list)" "default" case $resp in "?"|L|l) echo "Available layouts: $_layouts" ;; default) return ;; *) kbd $resp && { echo $resp >/tmp/kbdtype ; return ; } ;; esac done fi } stripcom () { local _l [[ -f $1 ]] || return while read _l; do [[ -n ${_l%%#*} ]] && echo $_l done <$1 } quote() ( for a; do alias Q=$a; a=$(alias Q); print -rn -- " ${a#Q=}" done | sed '1s/ //' echo ) scan_dmesg() { bsort $(sed -ne "$1" /var/run/dmesg.boot) } scan_disknames() { local _n _oifs=$IFS IFS="," bsort $(for _n in $(sysctl -n hw.disknames); do echo "${_n%%:*} "; done | sed -ne "$1") IFS=$_oifs } get_dkdevs () { echo $(scan_disknames "${MDDKDEVS:-/^[sw]d[0-9][0-9]* /s/ .*//p}") } get_cddevs () { echo $(scan_disknames "${MDCDDEVS:-/^cd[0-9][0-9]* /s/ .*//p}") } get_ifdevs() { ifconfig "$@" 2>&- \ | egrep -v '^[[:space:]]|(bridge|enc|gif|gre|lo|pflog|pfsync|ppp|sl|tun)[[:digit:]]+:' \ | sed -ne 's/^\(.*\):.*/\1/p' } get_drive() { ask_which "$1" "contains the $MODE media" "$2" "$3" [[ $resp == done ]] && return 1 makedev $resp || return 1 return 0 } mount_mnt2() { local _dev=$1 _opts _file=/tmp/parts.$1 _parts disklabel $_dev 2>/dev/null | grep '^ [a-p]: ' \ | egrep -v "swap|unused" >$_file _parts=$(sed -e 's/^ \(.\): .*/\1/' $_file) set -- $_parts [[ $# == 0 ]] && { echo "No filesystems found on $_dev." ; return 1 ; } if isin "c" $_parts; then resp=c elif [[ $# == 1 ]]; then resp=$1 else cat /tmp/parts.$_dev ask_which "$_dev partition" "has the $MODE sets" \ '$(disklabel '$_dev' 2>/dev/null | grep "^ [a-p]: " | egrep -v "swap|unused" | sed '\''s/^ \(.\): .*/\1/'\'')' [[ $resp == done ]] && return 1 fi grep -q "^ $resp: .*MSDOS" $_file && _opts="-s" mount -o ro,$_opts /dev/$_dev$resp /mnt2 } askpass() { set -o noglob stty -echo read -r resp?"$1 " stty echo set +o noglob echo } rm -df /tmp/lock lock() { while ! mkdir /tmp/lock 2>&- && sleep .1; do done } unlock() { rm -d /tmp/lock 2>&- } retrap() { trap '>&- && kill -KILL $cppid 2>&-; echo; stty echo; exit 0' \ INT EXIT TERM } rm -f /tmp/update ( while :; do lock if test -e /tmp/update && [[ "`dmesg`" != "`cat /tmp/update`" ]]; then dmesg >/tmp/update kill -TERM 2>&- $$ || exit 1 fi unlock sleep .5 done ) |& cppid=$! retrap _ask() { local _int _redo=0 _pid trap "_int=1" INT trap "_redo=1" TERM lock; dmesg >/tmp/update; unlock read resp lock; rm /tmp/update; unlock if (( _redo )); then stty raw stty -raw else case $resp in !) echo "Type 'exit' to return to install." sh _redo=1 ;; !*) eval "${resp#?}" _redo=1 ;; esac fi retrap (( _int )) && kill -INT $$ return $_redo } ask() { local _question=$1 _default=$2 while :; do echo -n "$_question " [[ -z $_default ]] || echo -n "[$_default] " _ask && : ${resp:=$_default} && break done } askpassword() { local _oifs=$IFS IFS= while :; do askpass "Password for $1 account? (will not echo)" _password=$resp askpass "Password for $1 account? (again)" [[ "$resp" == "$_password" ]] && break echo "Passwords do not match, try again." done IFS=$_oifs } user_setup() { local _q="Setup a user? (enter a lower-case loginname, or 'no')" while :; do ask "$_q" no case $resp in n|no) return ;; y|yes) _q="No really, what is the lower-case loginname, or 'no'?" continue ;; root|daemon|operator|bin|smmsp|popa3d) ;; sshd|uucp|www|named|proxy|nobody|ftp) ;; [a-z]*([a-z0-9_])) (( ${#resp} <= 31 )) && break ;; esac echo "$resp is not a useable loginname." done user=$resp while :; do ask "Full user name for $user?" $user case $resp in *[:\&,]*) echo "':', '&' or ',' are not allowed." ;; *) (( ${#resp} <= 100 )) && break echo "Too long." ;; esac done username=$resp askpassword $user userpass=$_password if [[ $sshd == y ]]; then ask_yn "Since you set up a user, disable sshd(8) logins to root?" yes sshd_disableroot=$resp fi } ask_until() { resp= while [[ -z $resp ]] ; do ask "$1" "$2" done } ask_yn() { local _q=$1 _a=${2:-no} _resp typeset -l _resp while :; do ask "$_q" "$_a" _resp=$resp case $_resp in y|yes) resp=y ; return ;; n|no) resp=n ; return ;; esac done } ask_which() { local _name=$1 _query=$2 _list=$3 _def=$4 _dynlist _dyndef while :; do eval "_dynlist=\"$_list\"" eval "_dyndef=\"$_def\"" set -o noglob set -- $_dyndef; _dyndef="$1" set -- $_dynlist; _dynlist="$*" set +o noglob (( $# < 1 )) && resp=done && return : ${_dyndef:=$1} echo "Available ${_name}s are: $_dynlist." echo -n "Which one $_query? (or 'done') " [[ -n $_dyndef ]] && echo -n "[$_dyndef] " _ask || continue [[ -z $resp ]] && resp="$_dyndef" isin "$resp" $_dynlist done && break echo "'$resp' is not a valid choice." done } isin() { local _a=$1 _b shift for _b; do [[ $_a == $_b ]] && return 0 done return 1 } addel() { local _a=$1 shift echo -n "$*" isin "$_a" $* || echo -n " $_a" } rmel() { local _a=$1 _b shift for _b; do [[ $_a != $_b ]] && echo -n "$_b " done } bsort() { local _l _a=$1 _b [[ $# -gt 0 ]] || return shift for _b; do if [[ $_a != $_b ]] ; then if [[ $_a > $_b ]] ; then _l="$_a $_l"; _a=$_b else _l="$_b $_l" fi fi done echo -n "$_a " bsort $_l } showcols() { local _l _cdir=/tmp/cdir set -A _clist mkdir -p $_cdir rm -rf -- $_cdir/* while read _l; do [ "$_l" ] || continue mkdir -p /tmp/cdir/"$_l" _clist[${#_clist[*]}]="$_l" done (cd $_cdir; ls -Cdf "${_clist[@]}") rm -rf -- $_cdir } manual_net_cfg() { ask_yn "Do you want to do any manual network configuration?" [[ $resp == y ]] && { echo "Type 'exit' to return to $MODE." ; sh ; } } makedev() { local _dev=$1 if [[ ! -r /dev/MAKEDEV ]] ; then echo "MAKEDEV not found. Can't create device nodes." return 1 fi (cd /dev && sh MAKEDEV "$_dev") >/dev/null 2>&1 } addhostent() { local _addr=$1 _name=$2 _delim="." [[ -z $_addr || -z $_name ]] && return [[ $_addr == *:* ]] && _delim=":" sed "/^[0-9a-fA-F]*[$_delim].*[ ]$_name\$/d" /tmp/hosts \ >/tmp/hosts.new 2>/dev/null mv /tmp/hosts.new /tmp/hosts echo "$_addr $_name" >>/tmp/hosts } select_sets() { local _avail=$1 _selected=$2 _f _action _col=$COLUMNS let COLUMNS=_col-8 cat <<__EOT Select sets by entering a set name, a file name pattern or 'all'. De-select sets by prepending a '-' to the set name, file name pattern or 'all'. Selected sets are labelled '[X]'. __EOT while :; do for _f in $_avail; do isin $_f $_selected && echo "[X] $_f" || echo "[ ] $_f" done | showcols | sed 's/^/ /' ask "Set name(s)? (or 'abort' or 'done')" done set -o noglob for resp in $resp; do case $resp in abort) _selected=; break 2 ;; done) break 2 ;; -*) _action=rmel ;; *) _action=addel ;; esac resp=${resp#[+-]} [[ $resp = all ]] && resp=* for _f in $_avail; do [[ $_f = $resp ]] && _selected=$($_action $_f $_selected) done done done set +o noglob COLUMNS=$_col resp=$_selected } configure_ifs() { local _first _ifdevs _ifs _name _hn _vl=0 _vd _vi _p _tags while :; do _vd=$(ifconfig vlan$_vl 2>&1) [[ $_vd == @(*no such interface*) ]] && break [[ $_vd == @(vlan$_vl: flags=0<>*) ]] && break : $(( _vl++ )) done _vd= while :; do ifconfig vlan$_vl create >/dev/null 2>&1 ask_which "network interface" "do you wish to configure" \ '$(get_ifdevs)' \ ${_p:-'$( (ifconfig netboot 2>/dev/null | sed -n '\''1s/:.*//p'\''; get_ifdevs) | sed q )'} [[ $resp == done ]] && break _ifs=$resp _hn=/tmp/hostname.$_ifs rm -f $_hn if [[ $_ifs == vlan[0-9]* ]]; then _vi=$(ifconfig $_ifs 2>/dev/null | \ sed -n 's/vlan: \([0-9]*\).*/\1/p') _tags=$(ifconfig vlan 2>/dev/null | \ sed -n 's/vlan: \([0-9]*\).*/\1/p') [[ -n $_tags ]] && _tags=$(rmel "$_vi" $_tags) if [[ -z $_vi ]]; then _vi=0 while (( (_vi += 1) < 4096 )); do ! isin "$_vi" $_tags && break done fi _ifdevs=$(get_ifdevs) set -- $_ifdevs while [[ $1 == vlan[0-9]* ]]; do shift done ask "Which interface:tag should $_ifs be on?" "${_vd:=$1}:$_vi" _vd=${resp%%:*} _vi=${resp##*:} if ! (isin "$_vd" $_ifdevs && [[ $_vd != vlan[0-9]* ]]); then echo "Invalid interface choice '$_vd'" _vd= continue fi if (( _vi < 1 || _vi > 4095 )) || isin "$_vi" $_tags; then echo "Invalid or in-use vlan tag '$_vi'" continue fi grep -qs "^up" /tmp/hostname.$_vd || \ echo "up" >>/tmp/hostname.$_vd ifconfig $_vd up ifconfig $_ifs destroy >/dev/null 2>&1 ifconfig $_ifs vlan $_vi vlandev $_vd echo "vlan $_vi vlandev $_vd" >>$_hn [[ ${_ifs##vlan} == $_vl ]] && (( _vl += 1 )) fi ifconfig $_ifs 2>&- | grep -q "^[[:space:]]*ieee80211:" && ieee80211_config $_ifs $_hn resp=$(hostname -s) [[ -n $_first && $_first != $_ifs ]] && \ ask "Symbolic (host) name for $_ifs?" $resp _name=$resp v4_config $_ifs $_name $_hn v6_config $_ifs $_name $_hn if [[ -f $_hn ]]; then chmod 640 $_hn (( nifs += 1 )) : ${_first:=$_ifs} _p=done fi done } v4_info() { ifconfig $1 inet | sed -n ' 1s/.*/etc/resolv.conf.tail if [[ -n $_hn ]]; then _hn="send host-name \"$_hn\";" echo "Issuing hostname-associated DHCP request for $_ifs." else echo "Issuing free-roaming DHCP request for $_ifs." fi cat >/etc/dhclient.conf <<__EOT initial-interval 1; $_hn request subnet-mask, broadcast-address, routers, domain-name, domain-name-servers, host-name; __EOT ifconfig $_ifs group dhcp >/dev/null 2>&1 dhclient $_ifs set -- $(v4_info $_ifs) if [[ $1 == UP && -n $2 ]]; then mv /etc/dhclient.conf /tmp/dhclient.conf mv /etc/resolv.conf.tail /tmp/resolv.conf.tail return 0 fi ifconfig $_ifs delete down -group dhcp 2>&- rm /etc/dhclient.conf /etc/resolv.conf.tail return 1 } hextodec() { local _d _b for _b in $(echo ${1#0x} | sed 's/\(..\)/\1 /g'); do _d=$_d.$((0x$_b)) done echo ${_d#.} } ieee80211_scan() { [[ -f $WLANLIST ]] || ifconfig $1 scan | sed -n 's/^ nwid \([^"]\)/\1/p' > $WLANLIST cat $WLANLIST } ieee80211_config() { local _ifs=$1 _hn=$2 _prompt _nwid _haswpa=0 _err ifconfig $_ifs -nwid -nwkey ifconfig $_ifs -wpa 2>&- && _haswpa=1 rm -f $WLANLIST while [[ -z $_nwid ]]; do ask_until "Access point? (ESSID, 'any', list# or '?')" "any" case "$resp" in +([0-9])) _nwid=$(ieee80211_scan $_ifs | sed -n "${resp}s/ .*//p") [[ -z $_nwid ]] && echo "There is no line $resp." ;; \?) ieee80211_scan $_ifs | sed -n 's/^\([^ ]*\) chan .* bssid \([^ ]*\) .*$/ \1 (\2)/p' | less -XEN ;; *) _nwid=$resp ;; esac done if [[ $_nwid != any ]]; then ifconfig $_ifs nwid "$_nwid" quote nwid "$_nwid" >>$_hn _prompt="Security protocol? (O)pen, (W)EP" [[ $_haswpa == 1 ]] && _prompt="$_prompt, WPA-(P)SK" while :; do ask_until "$_prompt" "O" case "$_haswpa-$resp" in ?-[Oo]) break ;; ?-[Ww]) ask_until "WEP key? (will echo)" if _err=$(ifconfig $_ifs nwkey "$resp" 2>&1) && [[ -z $_err ]]; then quote nwkey "$resp" >>$_hn break fi echo "$_err" ;; 1-[Pp]) ask_until "WPA passphrase? (will echo)" if ifconfig $_ifs wpakey "$resp"; then quote wpakey "$resp" >>$_hn break fi ;; *) echo "'$resp' is not a valid choice." ;; esac done fi } v4_config() { local _ifs=$1 _name=$2 _hn=$3 _prompt _addr _mask if ifconfig $_ifs | grep 'groups:.* dhcp' >/dev/null 2>&1; then _addr=dhcp else set -- $(v4_info $_ifs) if [[ -n $2 ]]; then _addr=$2; _mask=$(hextodec $3) ifconfig $_ifs inet $_addr delete fi fi if [[ -x /sbin/dhclient ]]; then _prompt="or 'dhcp' " ifconfig dhcp >/dev/null 2>&1 || _addr=dhcp fi _prompt="IPv4 address for $_ifs? (${_prompt}or 'none')" ask_until "$_prompt" "$_addr" case $resp in none) ;; dhcp) if [[ ! -x /sbin/dhclient ]]; then echo "DHCP not possible - no /sbin/dhclient." elif dhcp_request $_ifs "$_name" || dhcp_request $_ifs ; then set -- $(v4_info $_ifs) addhostent "$2" "$_name" echo "dhcp" >>$_hn makedev bpf$(ls /dev | grep -c "^bpf[0-9]") fi ;; *) _addr=$resp ask_until "Netmask?" "${_mask:=255.255.255.0}" ifconfig $_ifs -group dhcp >/dev/null 2>&1 if ifconfig $_ifs inet $_addr netmask $resp up ; then addhostent "$_addr" "$_name" echo "inet $_addr $resp" >>$_hn fi ;; esac } v6_config() { local _ifs=$1 _name=$2 _hn=$3 _addr _prefixlen _prompt ifconfig lo0 inet6 >/dev/null 2>&1 || return set -- $(v6_info $_ifs) [[ -n $2 ]] && { _addr=$2; _prefixlen=$3; } [[ -x /sbin/rtsol ]] && _prompt="or 'rtsol' " _prompt="IPv6 address for $_ifs? (${_prompt}or 'none')" ask_until "$_prompt" "${_addr:-none}" case $resp in none) return ;; rtsol) [[ ! -x /sbin/rtsol ]] && { echo "No /sbin/rtsol." ; return ; } ifconfig $_ifs up if rtsol -F $_ifs; then set -- $(v6_info $_ifs) addhostent "$2" "$_name" echo "up\nrtsol" >>$_hn fi return ;; esac _addr=$resp ask_until "IPv6 prefix length for $_ifs?" "${_prefixlen:=64}" ifconfig $_ifs inet6 $_addr prefixlen $resp up || return echo "inet6 $_addr $resp" >>$_hn addhostent "$_addr" "$_name" v6_defroute $_ifs [[ $resp == none ]] && return route -n add -inet6 -host default "$resp" || return echo "$resp" >>/tmp/mygate } v4_defroute() { local _dr _prompt=" or 'none'" [[ -n $(ifconfig | sed -ne '/[ ]inet .* broadcast /p') ]] || return [[ -f /tmp/dhclient.conf && $nifs == 1 ]] && return [[ -x /sbin/dhclient ]] && _prompt=", 'dhcp'$_prompt" _prompt="Default IPv4 route? (IPv4 address$_prompt)" _dr=$(route -n show -inet | sed -ne '/^default */{s///; s/ .*//; p;}') [[ -f /tmp/dhclient.conf ]] && _dr=dhcp while :; do ask_until "$_prompt" "$_dr" [[ $resp == @(none|dhcp) ]] && break route delete -inet default >/dev/null 2>&1 route -n add -inet -host default "$resp" && { echo "$resp" >/tmp/mygate ; break ; } route -n add -inet -host default $_dr >/dev/null 2>&1 done } v6_defroute() { local _if=$1 _routers _oifs if [[ -z $(route -n show -inet6 | sed -ne '/^default */{s///; s/ .*//; p;}') ]]; then resp=none return fi if [[ -x /sbin/ping6 ]]; then _routers=$(ping6 -n -c 2 ff02::2%$_if 2>&1 | sed -n \ -e '/bytes from/{s/^.*from //;s/,.*$//;p;}') fi _oifs=$IFS IFS= PS3="IPv6 default router? (list #, IPv6 address or 'none'): " select i in $_routers; do case $i in "") resp=$REPLY [[ -n $resp ]] && break ;; *) resp=$i break ;; esac done IFS=$_oifs } enable_network() { local _f _gw for _f in dhclient.conf resolv.conf resolv.conf.tail; do if [ -f /mnt/etc/$_f ]; then cp /mnt/etc/$_f /etc/$_f fi done ifconfig lo0 inet 127.0.0.1/8 for hn in /mnt/etc/hostname.*; do (( nifs += 1 )) if=${hn#/mnt/etc/hostname.} (ifconfig $if||ifconfig $if create)> /dev/null 2>&1 || continue while :; do if [ "$cmd2" ]; then set -- $cmd2 af=$1 name=$2 mask=$3 bcaddr=$4 ext1=$5 cmd2= i=1; while [ i -lt 6 -a -n "$1" ]; do shift; let i=i+1; done ext2="$@" else read af name mask bcaddr ext1 ext2 || break fi case $af in "#"*|"!"*|"bridge"|"") continue ;; "dhcp") [ "$name" = "NONE" ] && name= [ "$mask" = "NONE" ] && mask= [ "$bcaddr" = "NONE" ] && bcaddr= dhcpif="$dhcpif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 down" cmd="$cmd; dhclient $if" makedev bpf$(ls /dev | grep -c "^bpf[0-9]") ;; "rtsol") rtsolif="$rtsolif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" ;; "up") cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" ;; *) read dt dtaddr if [ "$name" = "alias" ]; then alias=$name name=$mask mask=$bcaddr bcaddr=$ext1 ext1=$ext2 ext2= else alias= fi cmd="ifconfig $if $af $alias $name " case $dt in dest) cmd="$cmd $dtaddr" ;; [a-z!]*) cmd2="$dt $dtaddr" ;; esac if [ -z "$name" ]; then echo "/mnt/etc/hostname.$if: invalid network configuration file" return fi case $af in inet) [ "$mask" ] && cmd="$cmd netmask $mask" if [ "$bcaddr" -a "$bcaddr" != "NONE" ]; then cmd="$cmd broadcast $bcaddr" fi [ "$alias" ] && rtcmd="; route -qn add -host $name 127.0.0.1" ;; inet6) [ "$mask" ] && cmd="$cmd prefixlen $mask" cmd="$cmd $bcaddr" ;; *) cmd="$cmd $mask $bcaddr" ;; esac cmd="$cmd $ext1 $ext2$rtcmd" rtcmd= ;; esac eval "$cmd" done /dev/null 2>&1 route -qn add -host default $_gw && break done [[ -z $rtsolif ]] && stripcom /mnt/etc/mygate | while read _gw; do [[ $_gw == !(*:*) ]] && continue route -qn delete -inet6 default >/dev/null 2>&1 route -qn add -host -inet6 default $_gw && break done route -qn add -net 127 127.0.0.1 -reject >/dev/null } install_files() { local _src=$1 _files=$2 _f _sets _get_sets _n _col=$COLUMNS for _f in $THESETS; do isin $_f $_files || continue; _sets=$(addel $_f $_sets) if [[ -z $DISPLAY && ! -d /mnt/etc/X11 ]]; then isin ${_f%${VERSION}.tgz} xbase xetc xshare xfont xserv && continue fi isin $_f $DEFAULTSETS "site$VERSION-$(hostname -s).tgz" && \ _get_sets=$(addel $_f $_get_sets) done if [[ -z $_sets ]]; then echo -n "Looked at " echo $_src | sed -e 's/\(^ftp:\/\/[^/]*\)\(:[^/]*\)\(@.*\)/\1\3/' echo "and found no $OBSD sets. The set names looked for were:" let COLUMNS=_col-8 for _n in $THESETS; do echo $_n; done | showcols | sed 's/^/ /' COLUMNS=$_col echo return fi resp=y isin INSTALL.$ARCH $_files || ask_yn "INSTALL.$ARCH not found. Use sets found here anyway?" [[ $resp = n ]] && return select_sets "$_sets" "$_get_sets" [[ -n $resp ]] || return _get_sets=$resp [[ $resp = n ]] && return shacmd="cat" [[ -x /bin/sha256 ]] && shacmd="sha256 /tmp/h" for _f in $THESETS ; do isin $_f $_get_sets || continue echo -n "Getting $_f ..." rm -f /tmp/h case $_f in *.tgz) ftp $FTPOPTS -o - -m "$_src/$_f" | \ $shacmd | tar zxphf - -C /mnt ;; *) ftp $FTPOPTS -o - -m "$_src/$_f" | \ $shacmd > "/mnt/$_f" ;; esac if [ $? -ne 0 ]; then echo "'$_f' did not install correctly." elif [ -f /tmp/h -a -f "/var/hash/$_f" ]; then if [ "$(/dev/null 2>&1 && \ SM_ARGS="-s /tmp/etc$VERSION.tgz" [[ $_f == xbase$VERSION.tgz ]] && \ ftp $FTPOPTS -o /mnt/tmp/xetc$VERSION.tgz \ -m "$_src/xetc$VERSION.tgz" >/dev/null 2>&1 && \ SM_ARGSX="-x /tmp/xetc$VERSION.tgz" done } encode_for_url() { echo "$1" | sed -e " s/%/%25/g s/ /%20/g s/!/%21/g s/\"/%22/g s/#/%23/g s/\\\$/%24/g s/&/%26/g s/'/%27/g s/(/%28/g s/)/%29/g s/\*/%2a/g s/+/%2b/g s/,/%2c/g s/-/%2d/g s/\./%2e/g s/\//%2f/g s/:/%3a/g s/;/%3b/g s//%3e/g s/?/%3f/g s/@/%40/g s/\[/%5b/g s/\\\\/%5c/g s/]/%5d/g s/\^/%5e/g s/_/%5f/g s/\`/%60/g s/{/%7b/g s/|/%7c/g s/}/%7d/g s/~/%7e/g " } ftp_error() { if [[ -n $(echo "$2" | grep "$1") ]]; then echo $1 return 0 fi return 1 } startftplist() { (( nifs < 1 )) && return set -m ( ftp $FTPOPTS -a -o - "http://129.128.5.191/cgi-bin/ftplist.cgi?path=$FTPSETDIR" \ 2>/tmp/ftplisterr > $SERVERLISTALL echo -n $SECONDS >$SERVERLISTSEC ) & ftppid=$! set +m (sleep 12; kill -INT -$ftppid >/dev/null 2>&1) & } waitftplist() { local _dot # XXX [[ -z $ftppid ]] && return while [[ -n $(jobs $ftppid 2>/dev/null) ]]; do echo -n . # XXX _dot=. # XXX sleep 0.2 # XXX done [[ -n $_dot ]] && echo # XXX } ftp_time() { local _ftplist_sec=$(cat $SERVERLISTSEC 2>&-) local _time=$(sed '/^TIME=\([0-9]*\)$/!d;s//\1/;q' $SERVERLISTALL 2>&-) [[ -n $_ftplist_sec && -n $_time ]] && echo $((_time + SECONDS - _ftplist_sec)) } install_url() { local _url_type=$1 _file_list _url_base _oifs _prompt _passwd _mirror eval local _server_ip=\$_${_url_type}_server_ip \ _server_dir=\$_${_url_type}_server_dir waitftplist ask "HTTP/FTP proxy URL? (e.g. 'http://proxy:8080', or 'none')" \ "${ftp_proxy:-none}" unset ftp_proxy http_proxy [[ $resp == none ]] || export ftp_proxy=$resp http_proxy=$resp if [[ -s $SERVERLISTALL ]]; then _prompt="Server? (hostname, list#, 'done' or '?')" sed -n "s,^${_url_type}://"'\([[A-Za-z0-9\:_][]A-Za-z0-9:._-]*\),\1,p' \ $SERVERLISTALL > $SERVERLIST set -- $(sed q $SERVERLIST) _server_ip=${1%%/*} else echo "(Was not able to get ftplist from ftp.openbsd.org, but that is OK)" _prompt="Server? (hostname or 'done')" fi while :; do ask_until "$_prompt" "$_server_ip" case $resp in done) return ;; "?") [[ -s $SERVERLIST ]] || continue less -XEN < $SERVERLIST ;; +([0-9])) [[ -s $SERVERLIST ]] || continue set -- $(sed -n "${resp}p" $SERVERLIST) [[ $# -lt 1 ]] && { echo "There is no line $resp." ; continue ; } _server_ip=${1%%/*} ;; +([A-Za-z0-9\:.\[\]_-])) _server_ip=$resp break ;; *) echo "'$resp' is not a valid hostname." ;; esac done eval _${_url_type}_server_ip=$_server_ip set -- $(sed "/^$_server_ip/x;\$!d;x" $SERVERLIST 2>&-) resp=${1#*/} [[ $resp == "$1" ]] && resp= if (( $# > 1 )); then resp=$resp/$FTPSETDIR _mirror=yes fi ask_until "Server directory?" "${resp:-pub/OpenBSD/$FTPSETDIR}" _server_dir=$resp eval _${_url_type}_server_dir=$_server_dir if [[ $_url_type == ftp ]]; then _oifs=$IFS IFS= ask_until "Login?" "${_ftp_server_login:=anonymous}" _ftp_server_login=$resp if [[ $_ftp_server_login == @(anonymous|ftp) ]]; then _passwd=root@`hostname` else resp= while [[ -z $resp ]] ; do askpass "Password? (will not echo)" done _passwd=$resp fi IFS=$_oifs fi _url_base=$_url_type:// if [[ $_url_type == ftp && $_ftp_server_login != anonymous ]]; then _url_base=$_url_base$(encode_for_url "$_ftp_server_login"):$(encode_for_url "$_passwd")@ fi _url_base=$_url_base$_server_ip/$_server_dir ifconfig lo0 127.0.0.1 if [[ $_url_type == ftp && -z $ftp_proxy ]] ; then _file_list=$(ftp $FTPOPTS "$_url_base/") ftp_error "Login failed." "$_file_list" && return ftp_error "No such file or directory." "$_file_list" && return else _file_list=$(ftp $FTPOPTS -o - "$_url_base/index.txt" | \ sed -e 's/^.* //' | sed -e 's/ //') fi install_files "$_url_base" "$_file_list" installedfrom=$_url_type://$_server_ip/$_server_dir if [[ -n $_mirror ]]; then package_path=$(print -r -- "$installedfrom" | sed -E "/\/(snapshots|[0-9]\.[0-9])\/($ARCH)\/*$/!d s!!/\1/packages/$(arch -s)/!;q") else package_path= fi } install_mounted_fs() { local _dir while :; do ask_until "Pathname to the sets? (or 'done')" "$SETDIR" [[ $resp == done ]] && return [[ -d /mnt2/$resp ]] && { _dir=/mnt2/$resp ; break ; } [[ -d /mnt/$resp ]] && { _dir=/mnt/$resp ; break ; } [[ -d /$resp ]] && { _dir=/$resp ; break ; } echo "The directory '$resp' does not exist." done install_files "file://$_dir" "$(ls $_dir/)" } install_cdrom() { get_drive "CD-ROM" '$(get_cddevs)' || return mount_mnt2 $resp || return install_mounted_fs } install_disk() { ask_yn "Is the disk partition already mounted?" if [[ $resp == n ]]; then get_drive "disk" '$(bsort $(get_dkdevs))' \ '$(bsort $(rmel $ROOTDISK $(get_dkdevs)))' || return mount_mnt2 $resp || return fi install_mounted_fs } install_nfs() { local _tcp ask_until "Server IP address or hostname?" "$NFS_ADDR" NFS_ADDR=$resp ask_until "Filesystem on server to mount?" "$NFS_PATH" NFS_PATH=$resp ask_yn "Use TCP transport? (requires TCP-capable NFS server)" [[ $resp == y ]] && _tcp=-T mount_nfs $_tcp -o ro -R 5 $NFS_ADDR:$NFS_PATH /mnt2 || return install_mounted_fs } install_tape() { local _z _bs get_drive "tape drive" '$MTDEVS' || return export TAPE=/dev/nr$resp if [[ ! -c $TAPE ]]; then echo "$TAPE is not a character special file." return fi echo -n "Rewinding $TAPE (mt rewind)..." mt rewind || return echo "done." while :; do ask_until "Skip how many files? (or 'done')" 0 [[ $resp == done ]] && return [[ $resp == +([0-9]) ]] || continue (($resp < 0)) && continue if (($resp > 0)); then echo -n "Skipping $resp file(s)..." mt fsf $resp || return echo "done." elif [[ -n $_bs ]]; then mt bsf ; mt fsf fi unset _z ask_yn "Is the file gzipped?" yes [[ $resp == y ]] && _z=z [[ $_z == z ]] || _bs=10240 ask_until "Blocksize for this file?" "${_bs:-8k}" [[ $resp == done ]] && return _bs=$resp dd if=$TAPE bs=$_bs | tar ${_z}xvphf - -C /mnt || return done } set_timezone() { local _zonefile=$1 _zonepath _zsed _tz _zoneroot=/usr/share/zoneinfo [[ ! -f $_zonefile ]] && return [[ -n $TZ ]] && return if [[ -h /mnt/etc/localtime ]]; then TZ=$(ls -l /mnt/etc/localtime 2>/dev/null) TZ=${TZ#*${_zoneroot#/mnt}/} fi waitftplist if [[ -s $SERVERLISTALL ]]; then _tz=$(sed -ne '/^TZ=/s/TZ=//p' <$SERVERLISTALL) [[ -n $_tz ]] && isin "$_tz" `cat $_zonefile` && TZ=$_tz fi [[ $_zonefile = /var/tzlist && -z $TZ ]] && return while :; do ask "What timezone are you in? ('?' for list)" "$TZ" _zonepath=${resp%%*(/)} case $_zonepath in "") continue ;; "?") grep -v /. $_zonefile | showcols continue ;; esac while isin "$_zonepath/" $(cat $_zonefile); do ask "What sub-timezone of '$_zonepath' are you in? ('?' for list)" _zsed=$(echo $_zonepath/ | sed 's,/,\\/,g') resp=${resp%%*(/)} case $resp in "") ;; "?") sed -n "/^$_zsed/{s/$_zsed//;/\/./!p;}" $_zonefile | showcols ;; *) _zonepath=$_zonepath/$resp ;; esac done if isin "$_zonepath" $(cat $_zonefile); then TZ=${_zonepath#$_zoneroot} return fi echo -n "'${_zonepath}'" echo " is not a valid timezone on this system." done } sane_install() { local _q=$1 _s _m for _s in $SANESETS; do isin $_s $DEFAULTSETS || continue resp=n [[ -z $_q ]] && ask_yn "Are you *SURE* your $MODE is complete without '$_s'?" [[ $resp == n ]] && _m="$_m $_s" done [[ -n $_m ]] && return 1 return 0 } install_sets() { local _d _locs="disk ftp http" echo [[ -s $SERVERLISTALL ]] && \ _d=$(sed -ne '/^method=/s/method=//p' $SERVERLISTALL) ifconfig netboot >/dev/null 2>&1 && : ${_d:=http} [[ -n $(get_cddevs) ]] && { _locs="cd $_locs" ; : ${_d:=cd} ; } [[ -x /sbin/mount_nfs ]] && _locs="$_locs nfs" [[ -n $MTDEVS && -x /bin/mt ]] && _locs="$_locs tape" : ${_d:=http} if ! isin "$_d" $_locs; then for a in http ftp cd nfs tape disk; do isin $a $_locs && _d=$a && break done fi echo "Let's $MODE the sets!" while :; do umount -f /mnt2 >/dev/null 2>&1 [[ -n $method ]] && _d=$method sane_install quiet && _d=done ask "Location of sets? ($_locs or 'done')" "$_d" case $resp in done) sane_install && return ;; c*|C*) isin cd $_locs && install_cdrom && method=cd ;; d*|D*) install_disk && method=disk ;; f*|F*) isin ftp $_locs && install_url ftp && method=ftp ;; h*|H*) isin http $_locs && install_url http && method=http ;; n*|N*) isin nfs $_locs && install_nfs && method=nfs ;; t*|T*) isin tape $_locs && install_tape && method=tape ;; esac done } run_sysmerge() { echo "Please run sysmerge(8) after rebooting to repair your /etc configuration." #if [[ -n "$SM_ARGS" || -n "$SM_ARGSX" ]]; then #fi } update_firmware() { local _get=Install [[ $MODE == upgrade ]] && _get=Update ask_yn "$_get non-free firmware files on first boot?" no [[ $resp == y ]] && \ echo "/usr/sbin/fw_update -v" >> /mnt/etc/rc.firsttime } munge_fstab() { local _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do [[ $_dev == @(/dev/vnd*|\#*) || \ $_fstype == nfs || \ ! -f /sbin/mount_$_fstype || \ $_opt == *noauto* || \ $_opt == *xx* ]] && continue _opt=$(echo $_opt | sed -e 's/softdep//') [[ $_fstype == ffs ]] && _opt=$(echo $_opt | sed -e 's/ro/rw/') [[ $_fstype == ffs ]] || _opt=$(echo $_opt | sed -e 's/rw/ro/') echo $_dev /mnt${_mp%/} $_fstype $_opt $_rest done /etc/fstab if [ ! -s /etc/fstab ]; then echo "Unable to create valid /etc/fstab." exit fi } mount_fs() { local _async=$1 _dev _mp _fstype _opt _rest _msg _fail while read _dev _mp _fstype _opt _rest; do [ "$_mp" = "/mnt" ] || mkdir -p $_mp _msg=$(mount -v -t $_fstype $_async -o $_opt $_dev $_mp) || _fail="$_fail\n$_mp ($_dev)" echo $_msg | sed -e 's/, ctime=[^,)]*//' done 0 ]] || continue echo -n "fsck -${_f}p $_dev..." if ! fsck -${_f}p $_dev >/dev/null 2>&1; then echo "FAILED. You must fsck $_dev manually." _fail=y else echo "OK." fi done /tmp/resolv.conf for _ns in $resp; do echo "nameserver $_ns" >>/tmp/resolv.conf done cp /tmp/resolv.conf /tmp/resolv.conf.shadow fi manual_net_cfg } populateusrlocal() { if [ -f /mnt/etc/mtree/BSD.local.dist ]; then /mnt/usr/sbin/chroot /mnt /usr/sbin/mtree -Uedqn -p /usr/local -f /etc/mtree/BSD.local.dist >/dev/null fi } apply() { if [[ $sshd == n ]]; then echo "sshd_flags=NO # disabled during install" \ >>/mnt/etc/rc.conf.local fi if [[ $sshd_disableroot == y ]]; then sed -e "/^#\(PermitRootLogin\) yes/s//\1 no/" \ < /mnt/etc/ssh/sshd_config > /tmp/sshd_config cp /tmp/sshd_config /mnt/etc/ssh/sshd_config fi if [[ $ntpd == y ]]; then echo "ntpd_flags= # enabled during install" \ >>/mnt/etc/rc.conf.local if [[ $ntpd_server != default ]]; then set -- $ntpd_server sed -e "s/^servers /#&/;/#server /a\\ servers $1 " /mnt/etc/ntpd.conf >/tmp/ntpd.conf cp /tmp/ntpd.conf /mnt/etc/ntpd.conf fi fi if [[ $x11 == y ]]; then sed -e "/^#\(machdep\.allowaperture=${MDXAPERTURE}\)/s//\1 /" \ /mnt/etc/sysctl.conf >/tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf fi if [[ $xdm == y && -x /mnt/usr/X11R6/bin/xdm ]]; then echo "xdm_flags= # enabled during install" \ >>/mnt/etc/rc.conf.local fi if [[ $defcons == y ]]; then cp /mnt/etc/ttys /tmp/ttys sed -e "/^$CTTY/s/std.9600/std.${CSPEED}/" \ -e "/^$CTTY/s/unknown/vt220 /" \ -e "/$CTTY/s/off.*/on secure/" /tmp/ttys >/mnt/etc/ttys [[ -n $CPROM ]] && \ echo "stty $CPROM $CSPEED\nset tty $CPROM" >>/mnt/etc/boot.conf fi ln -sf /usr/share/zoneinfo/$TZ /mnt/etc/localtime } questions() { local _d _xdmask=y _def ask_yn "Start sshd(8) by default?" yes sshd=$resp ask_yn "Start ntpd(8) by default?" ntpd=$resp if [[ $resp == y ]]; then ask "NTP server? (hostname or 'default')" default ntpd_server=$resp fi def=no [[ -n $DISPLAY ]] && def=yes if [[ -n $MDXAPERTURE ]]; then ask_yn "Do you expect to run the X Window System?" $def x11=$resp _xdmask=$resp # if aperture was n, do not ask for xdm fi if [[ -n $MDXDM && $_xdmask == y ]]; then ask_yn "Do you want the X Window System to be started by xdm(1)?" xdm=$resp fi if [[ -n $CDEV ]]; then _d=${CPROM:-$CDEV} ask_yn "Change the default console to $_d?" defcons=$resp if [[ $resp == y ]]; then ask_which "speed" "should $_d use" \ "9600 19200 38400 57600 115200" $CSPEED case $resp in done) defcons=n ;; *) CSPEED=$resp ;; esac fi fi } finish_up() { local _dev _mp _fstype _rest if [[ -x /mnt/sbin/swapctl ]]; then /mnt/sbin/swapctl -a /dev/$SWAPDEV >/dev/null 2>&1 while read _dev _mp _fstype _rest; do [[ $_fstype == swap ]] && \ /mnt/sbin/swapctl -a $_dev >/dev/null 2>&1 done /var/run/dmesg.boot FTPSETDIR=$SETDIR set -- $(scan_dmesg "/^OpenBSD $VNAME\([^ ]*\).*$/s//\1/p") [[ $1 == -!(stable) ]] && FTPSETDIR=snapshots/$ARCH MTDEVS=$(scan_dmesg "${MDMTDEVS:-/^[cms]t[0-9][0-9]* /s/ .*//p}") nifs=0 DISPLAY=$(scan_dmesg '/^wsdisplay[0-9]* /s/ .*//p') CONSOLE=$(scan_dmesg '/^\([^ ]*\).*: console$/s//\1/p') CONSOLE=${CONSOLE% } [[ -n $CONSOLE ]] && CSPEED=$(stty speed) md_consoleinfo THESETS="bsd bsd.rd bsd.mp $MDSETS" : ${DEFAULTSETS:="bsd bsd.rd"} for _set in base etc comp man game xbase xetc xshare xfont xserv site ; do [[ $MODE == upgrade && ( $_set == etc || $_set == xetc ) ]] && continue THESETS="$THESETS ${_set}${VERSION}.tgz" isin $_set site && continue DEFAULTSETS="$DEFAULTSETS ${_set}${VERSION}.tgz" done SANESETS="${SANESETS:-bsd} base${VERSION}.tgz etc${VERSION}.tgz" COLUMNS=$(stty -a | sed -n '/columns/{s/^.* \([0-9]*\) columns.*$/\1/;p;}') [ COLUMNS -eq 0 ] && CO\%4b%b%oA g%f%dOnp]?t&x]?Л']?(]?Hu%]?u%]?t%]?8j]?4t%]?dn%`@,u%]?|t%]?u%?u%*+'+'+'u'P&{'w'& '8p*' pI*K*J*<=*K)K)X*p6*'*%*4*:* * *<*0G*3*D* 9* $8*0*P/*l&t&|&&H&Ќ&d&|&&&܈&& &@&&$&@0j@0j@0j00jt1jP0j 0j@ 0 0'l''1j1j1jdp?p?1j1j2j~'@B4q?1jD2j2j2j2j43jp3j3j3j$4j2j Tr? @u?0u?$B4j(h(4jd(( %  ?u@}?TA?4A?l??8?$?;Av?@,?@^?@?4?t@c? @3=33Qj..t3.L.QjlT.\j..ȋ..QjȔ44444Ą4Qj:`34444̔3le3dL3Qj<8:3Qj+3Qj,?3Qj).444.Qj.444QjȔ44444?OjQjD+@22@ X XdpRjtRj>?? ' ` ~ ^ "' ,AAA AA'CEEEEIIIINOOOOOUUUUYaaaa aa'ceeeeiiiinooooouuuuyy"A"E"I"O"U"a"e"i"o"u"yA^A`A*A~ACE^E`EI^I`I~NO^O`O~OU^U`UYa^a`a*a~ace^e`ei^i`i~no^o`o~ou^u`uy@lk7w7Dv7tk74m7Lm7n7x7x7}7(z7,?,@0@4@8@<@@D|77d707@@7|77774&@  % 3u Du u <u 8u 2u 0&'u 1&u 0&u     )%uu 0 1 8%u   3 D D%uu < 8 2u 0&'u 1&u 0&u  P@*8)8*84&>@H@l@*xi8di8j8m8@@@# # T@@@@{{؝@`@D;9x=9H>9d;9D@9?9П@XF9J9G9dK9L9lL9@P9U9V9:L>:X::ܮ@@:D@:X:: @B:0B:X::(@PE:|E:X::D@hH:H:X::@K:K:X::̯@`L:tM:X::L@N:W:X::d@x\:\:X::l@|u:u:X::0@{: |:X::,@~:(:X::@L:\:X::$@::X::,@|::X::@p(:ȯ::ı:w@:\::`:8 ' $' H& & l::8 ' $' H& & p::$:' $' H& & ::;;::;;ОANeN3NQ"NQ!NQNQ&3NQ&!NQ&1NQ1NM1NI1Nm1NE1NE^ & b .,f,b,b܂bܚbܑb܎b܍bmb܁SB1 B 1 11111 e T C B ꂀ"T"B"TB BBBB0A@؞APA ܞA0A00A3A5A@@EAFAH@PD@QARAUAX AaA0@3A5A@@AAAE AF$AH(AP@Q@R4@U@`,Ab 0Ac 4Ad 8Ae -AX ;;|;;<8;;;,;@ 8LI -R`+`=lW*Dw7,J< P3pd'`jx><p̺pjxjf8(<,C:P9 ,|K::WDDjeP5rx"$ԇ9r&\|7P"x!`0+<2|/HY/@ &LDj+H;g)@Dn#76`Po \) 8G"($ o5 =j; t'\A BL (DT Hx7` `^ L> k Nj$y 4j t!0 tp 8f. < LA> p G-X 7T =: " LE;h: /LJ . U oc T7p |)z (4 Pp  n, H(l 0: p9 34 n |'L "hXj lE9($ o@8'C#X%@h9vO2<n.Bk2<|&PDv7xt6j?>?4H +| ! d4l%d(0$@ATc%J\C8 X0*Da8u o|2X&l0܈&Hl5x 7T61j`'d1@<>p9Il Z(>dB`mp|'Hl%h\48X8(.'p,F:06X8L-L'Pj:8#(4jIp-S 8`*$o67tt%">'d%h5 &P@:Ĩ54$)Aj45%<M88X43d[*Dn(H~`Lo'@6x6(H(8k$092!*' <6-(0j8<DI0Q7Xf`;T x*+D&<-H ,lu% f8`9)R>X5,2P&, 0%;P+2T<DoL<9|bH}2 yt1@7$h* ;jlC-"*L*t&d%$<XG- &<. 8$JoDЊjNp$e ,sP2ē7@!E(tG$,>N% pBn4$D= Gj dp+U)8|/<I(<QM7(`,4gx6O9e0Djw`Dj0"6<X{5(f2Pnl,0b98 U"5j`"<79dj"HAjt"<|"%x"|J8$"p"~'"&"E8"lV7@"x1"tn"X9#8#\/T&#x<@5#L9C#J5,T#,$q#$,#l8#$#%<#4B#|9#j#D 7T#86$(y'$hj#$ȼ&T/$ &$:$p&C$%DO$}$_$Bx$Ծ!$7$'$&$<'$z'$d'L$%#T$@Tj$-$'*8%hH:, %<%`)p/%n7%؀&@%Ⱦ1lQ%\c-0_%X&s%5<%_$d%n(% $%W8%%<%#%:,&|!,&:h4&+G&t9U&8`&!u&7&кp&8&(&#D&$q)&(}.D&#&t/' &6&D%'t7t"'<4'pB',<U'<p]'pk9m'DXj|'dOn` '6p'p'M3'Tc7' |.'Б;@'8'*$'<(Q>)(;5X9(}20D(.8U( &(e( j`l(l,X('(5(`<(T.(*"(0p(p9(6)@< )x:)Cj.)7A)7PU)'i)q%z)|:)H-\ )")4")+)0j)'H)T8t)+(\)2)l<@*0m2l#*!+L+*"(T4* ) =*P)M*Z'[*nf*#w*X#|*@80*t>'x*t2*0o*$*8$*p/*1j*H%*@l"L +B+H<*+0 3+D7LF+5`W+p*h+5t~+/+d,+<7P+"X+)l+1(q+XL1T98b16q1t*1tn1|51Rj141x&T1=01-L1e91|51p28+l#2:h>2pe9dI2z*LS26f2$5x2Gj2 +X2%2|$h2N$21x2l782Tp 28c/2I<38:38Oj&3>+X<3h3 I3hU2,W300jd3<t31&X3 34/ 3 >)d>9(>Xm%t>u3>:$0>9|>4Oj>D1>B?8?P8?0Mj.?0H:?(G?",T?%%g?p00q?j*?Q><?7h?9 ? =?T)l?-?I#0?5@ (8@l+)@]*T2@T! ;@pH@-U@_*t]@$:\u@8@p'@"@44@4v98@6@,>@T%/P@LO8h@=)@$A`pA4Po$A72A(Jo=A "$lGAB(QAB[A9/4cAl&oAs5XA A7Al+ A &,A4jA8"A02dAi) B42$B@1p&B$#4B<%@B,nUB!)< _Bp+ hB%(qBB{Bx:60B|H-$BP8DB-B#$B@/(B87PB4 C@4h C! !C\xj,C'34>C(FCb7(VCP,,qCؐ+P{Cq*dC\+`C|&<C%$C8<C|7C(DjCnC'Cp6*8C`A%0D"Dh E #E<+E"?E~5PEă2pdE/ nEToyE&xE8K,,E\#"E$V9E<8lEF7lE<$,DEd"dF32(F2d-Fb-\=FDW!xMFP6^F(jhFL<{FDoF$n(FX!TF!\Fl:F9FY*<F'`F"F|*/G(GlDj-G{)5GW#HG:P[GP>TnGxjG0G(q!G7jGp(2G%G H1H/pI"(I9I@S"`.ID6j5IG7DI\3 VI<-nI=jI'I_"lIhRjIE-XIx1(I`s-Iht(I8p*I(j J0jJj#JOj.J59JD!JJpK> VJ jpJ.J&pJ<.XJ7 J$#J9J8J14J:KK7D Kp/KQ!$KGj3K%$AK~!RK7dK64kK*wK8K&PKD,K("hKT9pK7K,n.KCjK#DK=xLd%4L#6#L*H3LGj;L'ILh8TL=j`L;qLh7@LhjHL0*|LD&LjL`9(L0j L@l%Lj LD(|L$E!HL@XjL"> M(p`M<5H0M409MZ!LAM8DnRM6*8]M('<nM:{M2MpL(M"M!M-'M$9lM#M4m7MX6M)NX#0!Nt7<)NA1:N7<EN:`[Nj jN+h}N "=N;4N49N<ND'N (N2N ,N8N\a4NЀjOLj!O\9`+Oغ8 6O0&xFO< PODp_O;zO9HO8OL9OP`4`O3O^&O|-|OX(PЎ'P-,PX)L(P"9P8`MPt8TUP/fP,dP'Ph%HPLK<P4I"P*HP #P,P)$ Q|nQj Qw-&Q,?Q("dOQ|F> [QjhQ4mQx320zQ(lQ]'Q`}(QK&Q8dQ`!hQXN;Q,LQ$R,=R7p)Rp(p2Rxn9RD#tMRN:hZR"8fR(nR,%0{RT6jRd#R\5Rp%R:DR$XR'RhnRHj$R O+\S>j S(+S(0SD=-HS" WSF%|eS?+|SXnS9xSDp S$4S|N< S7SȔ5S nSl)Tb)x TP*Ti%'T9$;TT-'\DTLV$RT+aT(`hTHG5vTd7T!HT-,,T(J%lT8t0`Tx7T6ThCj4Tl$T@<U $U&X Up8 -U"6p=U("HMUl8XU'@gUH *rUEj{U.U#PU*4U( UL:pU{jUpDjUd0jVp-Vg&4V$+V38;V`pFV7PVL6XVt>n`V3ppV&XvVh8V8V#;|Vp3V+1V#0V)"xVO Vh(-HWP."W \%)WD;08WnDWț0 OW:^W8jWH0dsWKjWH9W,3$W(W*`W(tW<&WD"W 8W0}%W' lXp.XH( 7X}6KX$,@YX<iXl5@X`74DX\$HX9X0HX@-%$Xx% Xp$X\8Xdp YL)YL'2Y`nn?Y$4QY_9[Y6jYM>lYd 1LYr;YPE)HYh:Yz9YTnY~!HY3pY@0jZJ%Z)Zh*l(Z?'$9ZBFZ/4SZ5jaZ5LkZk4zZl4XZN6lZtMoZ5 ZH)DZY: Zк' Zd)<Zp8Z83|[ P[>[8&[!P6[POjH[T0xU[2-\h[ܾ;`[J8D[pxj[L* [j[$$[؄![0l8[l2[ 3l \t2\8"=\y'\3\H'dB\&Q\:hb\o$y\@/\,)X\<,'\xQ5\:j\\5\+\%`\7 ]p]8:/L"](r&d.]h'p=]H&E])0P] b]X#6hq]l}.]9d]7l]M9H]j]+]LTj],%|],^XF($^В8l^p8!^Tp0,^`Z%0D^pM^4%<T^txjZ^**g^<p^~:~^p^Ԥ'^<^8^ #^!^G<^,l^`'_L6\#_ o*_h# 6_tCnD_8P_T-)Y_&te_0a6t_in_|F(P_<$_H08p_82_l0X_d,4_h4_&_4"_(!4 `L$`*+`p2&?`t%,P`lL9T\`p+Dj`)<`#0`p`%t`#`U9(`, )`$`$+al<aܿ8$a|B&9a;$Qah6([a,-oa(a&Taxnna%aL:aL,:aL'a}(`atN0ta<"aW!<a9bX8T#bP04b-?b$_1dMb9#0bb!ub4b0jb4blk7b#bP(@b1db($lb4b|=(bnb$&cؤ/x!c.82cK:,=cEjKcx+Vc8pdcT+sc@/c4 `cpc"@c4 c$(xc *cx;czjc4d.ldC*pd>H1dHId8g*Qd`$xjd,#ud\+xdX&d$dh8hd(/d }1dP<d`&dTj1d$Jj(el;#e-1e!De&`ReL$ee# ze<eԥ9e<et9!eEj eЌ&He<8e|%8e#De6:xe)D fd%tf='f*2fhnx@f0_5lHfDV)Tf(^fL/mfb*vf$f@: f58$fZ*@f<> f- f|jf,*fkLD(tHk)"PZkM-dk@1Hukf&k*kj k2kD5k$k+lkh6,l;l7t2l12,Al )Ll@M(D^ljglLX(ul&(l %\lHjlh-plh"lolp l, lpPm8lmHpm4,mI6\>mN;hPm)HXm (phm;HmT;m>/mnm~=mP;8\m$(hmh +mY3m1n|t%n43D#nG(t+n%P@n 'RnL3[n1Dln@Vjwn6n-&n!8nHN0 n& nf&n"$n&nl+nz8o7oC7D$o.4t5o=j?o(DonQopn)]oV2lot6HoQ+to8nop<oW98oC6To<o8o|3o)p%p7Ppp&p`+H0pܠ*:pHjHpDV+Pp(UpW*Dap(Bxp,/-|pd+#pS <p !hp7PpL,dp9dp'&dqt!qXn!qdDn(qj1qȈj:q<(XDq\"LXq9kq,q,q5qEjqOjq42tqk-q/qnqo$rIj(rn.rD0(8r1Dr\%]rl6frN(vr(%xr"rq-prx'ryjr<:Lr4Gjrf:rF)d sKj(s6/$/s'@s( Ps/]spgsozsps,js:s7\s+tsP1@s<%8sD6Ds--sUjs % t$%t2(t(1thn=t9$DKt60Ut+>^tnjt *tt)tt'`tnt0z8'8z\B7z1 Ez,xYz\8|dzs;uza: zd6z`"6zO*z$ zi94zy9,z xjzhVjzj{hb9`{82d${),+{X?<C{.)hJ{Q#P[{"\j{8E4Px{ R#h{ ):{'`{()#{Pj9|{x%x{P%{n x{82:,{,5 |+\|,",|<58>|le3M|2d|tH1r|6{|h[+|4p$d|#l|p | o|L+ |Ln|hj|8I2|f% }$"$}Pn }p*}\=1X7}5D}7/Z},#j}H>8`v},j }T:,}<}n5}%D}dg%X}p4} 5}-~e:l~,|8d*~x<+4~Y,L~1j[~tM: g~$|{~K6~%d~_5~7~(.t~|1~p#`~9~z7~P 2D~TB6 4T:/.n9nBpG- R'ta0;@v:lhH> <96T08pTLp@Hj$Y&pu$`X'd0*ؓ*03r&P=x!xM)tJ9 Y+lcBoIj(&| jVj,)(ԝ: 88Ȉ*0ӈ04)T<(XnE5D Ġ"0@.P.\9Tg&G!pW0(*8a7jj44yh02XU0H<"(8xn3ʼnnp͉5,׉xn:@p88"H0Rj+|/8̨nH 8WH6li8>2{1t%4.p8-<8jȊ9`ފ,53   $/8%d!4$E$C0+K&W܉64cvjj40{@oDo`<9p0#ċ!Ջ 7T<5H/ #J-,1Oj<#S d^(jfxn7,s&p7.=@dHn Y#8ʌj܌(:,2)xH&4. '4? Ll+8Zpg|4sP0j9T&2n!<8#$ȍn Ѝ .܍/ 8No4* \n@~04(8%(t4L#K\/X\:f,t~L$4$896Pn:̎d(X܎B - 4 )D(d& !6,t<;,<Aj8R<g 2t0~r4<X&(s2<8jp8$L͏\R>Hߏ`86X2p+Ljt5 <2@d/H'H7:jD,0Xjb4ol7z1ر$x(Hph}2Xؐ=(+7) w1) ! pX07@ Fp|j^=p.-H`f14]*@H).‘L74Α(n֑8\%\!D t%4 P&@&-\*X24b%<8=FX7 O@,ed:{o7*0Y&@^;@ا*Ē 4lΒ hjŘ2)ҘX1tޘd%x@;*<7PnP$%'T248l=C,5jSpax51,c"L:\p/8LB&0+%3 ,:,>1LlBTi6[`.it80y7wj20|j1t(&80#@М8<`?8*0p/ <$|;>#p,+DB a7O\-DZL<nR8d~̉j.T<#4p# x'`ĝ4"ҝ\ '%+ dK9,R+&P'1,E}+@RjY[<\n5D:9L0Pa% t\4lt*$*+|98:5LI 4DYl[&fq:uD;D0 0[4@o`ã%dѣn٣`B74 &p"($,^(90(GP[4Qo$4c8<rhB 5L0|,<`<<7ڤԒ93'@P;W(xA#@dDjӥ$ߥ<U0<@*d 0H8k/-԰"@l'(lNnW\<a4kpp{x%H^'$=, '8v%L!8Φ2xئ(dHj$>)D& %4n!+2447A$+6R0_|8* k$=$r2D(7+4tH> D7ŧxpէL40ݧ*h(D:4tu4 l121%D +P2`&48 c1G`/UH%<_%hjD Brm7@~t(\T:6$Q O(&4A8PĨ498ͨ%*Dڨ+L`4j Pu+8,h8j%,pH*LQ0<5)@D+PGxp P|)X(a@:0v_7 5Dq/`(DG0D!˩0 שx!*`W:,j K88 X4Ȣ/ )m%;l)\F:SXL6f4*DqЁ+}`3 ho(h(pBB0ŪX*Ϊ%ުj9L#8,H>)$#j353@d*Qn]@;it`8vp/98<4+P*T{#,ƫ"߫% \G: M(L3*866-2<Lp1 c@]1r+H;)o82X8F<p̬p"7Ӭ)<|:43&D6@9$<98*R 7pX<`nh0jI;*,%(}!ԭ,\$jV$$ );0.l6<65E7``4 k<5$Cj9+`1̮P7Pٮ.;XĄ4PD1Pp:j##*-\99f(\K\%X[;h7xt!81`H+D8<:g1˯t(`ׯK/L U. !:(r5 l6M7p%13y.Bu88P87aHj0r~)z*`[*@x'pl%P$ʰtM+ְċj߰x, )8,((*& 4t(?H>9L<[;e0<ut (%nt8|2lα7 ܱ ,\%005j%#((2'4@P>W>b+m()HtO$~!,,k6D50,Fj\$\-² Z&@ϲEj߲d&_%X) zjT< 30(j/U+P5t*&\Jl;\=>dȡ'DuT$+"h1XX(:(9³P7<̳x :d׳@5PL_*@8X&P+(l T&7'\*5:0Ix9dS!_ OjmhG*4v8% %  p68Qj4Ǵ|9ܴ4t5q+d H&!@$125"\FH[7X4n:+#Q;=j5n?}1H+ X(Ldlq*\rl.},%9D2pȶ,ڶ$,,;%+$ j)) 0T~$p< <PX<h0jpC7|HRj)" x9:j$j˷L5Lշ+7H/ $, .Ej$(#.nn<,#:X%90g8> 6I21[Xk+0d@9jtĕn0}"y6Lk7tBtB$dоn׾<P<_!> LL9 8`%&#0=D8$HO,+X<k`7p0/0\/(n(|'ÿ<ɿ)ҿ >ڿDE> "(<  oP DE(xn\B0(9:jC(10U98d8mH=2384l0<@x7 xRj4<=j70#PT'%B /X,D<[@:,f<y2+,@1"e9 Tj3pD8t-PN#0e8G;{-<<*80;$=|)!XTQ597\*< S$ '8%01",>;S$$*`^ĵ#hif9;_)Xp`o J20G,x,"<ة < \62EjGD[,aT,8z>84/J+$'/*!6 #x@ 4K XN7 lQ>l60jF#0\:h-ru;[*L̐)0,"@!\7;36ķ4\f/a* h#x9,09Л'`I!_jf(ppzL3|$@:xRj̫# D/%X% XT#Llj't @-pԪ,3#(E 8Rpb ,<wpR2 ( 8f.tr+\M&4/&w'$`#|m7`%@ *,lS+>@BF6(T4%hhL8d|03\3\6<dKj(*,ܤnp.<6d/p% po8lc64!@Mj2L6j8,'TFD(lU d7oX1pM>x 0L<x8@<XntE> D>  7<":,.8DjB8:DPn\RjhN8m)ԕ7T(+(,?%*<d22#x;hp 2|2#Tf%81 4|=Xu1H BYz(e.q<a*@&<,h l@I(Xa97$H9/pm*x-hb5h:(D4*8N,lW,#4#@B,h0& *9 |(5lMXjT.ad*oK> {l/<"($m98% 1%2"X><<$S0dL.0G*8%(/<BX= K@7X/9o<5jm%7n"X0"0j"> 7,; 9d`p `0j-u'= nF"Z6Hl(t v7$L1TEj B,H;AW+|40X# ":H:" p6KjDT,W<'Tf86${wj̎(X4 %pk8n\U980{8<.$L(!@k%9D#p<9$9j@7 U,]60eD4Tz$p3@%|'@@4p,-<~&pr<in%D>|"70)>83*4KH"pXx!m0Dy5P8<,< 5%$@d<H4 Hyj66@)(x+D0 _*@='<MBPl7<Y<lEjz(&tX<08\|p`1lm.tC+#HJ!X:H)R62D!D4:R3 Zxi8Xic64pW& $$!\0z!|s*$,\$HlF80j0}7 tZ)hCj&T9j6 &AJ9KD8X53fjl )}$27H(( P`?:^,uu!9+H!|Z3Hi&,uN) %xj,97X4doH2@$p08.,X*D54 1'@,xj8/E|;*TO7_pm A&@~+t)TDn,1j#X9$;j 1<D50Hf*d:H*^8p6XDjA)@R7<pH 4Wjd8d5n(8d 7"<5$ )( & 4<!x/. m/A%TH(Sh<Z*`q49z`6h,6'81',T!x& pԣ(l9 J8pe3"h,0<<O:`[`8Xh5p2<Xn_8Ԩnhf5B+ E$ B<9P *h1j̫08]&)*4?%88)A:Ti7hw*4u@:,7t6 P2d|*-HKjpG+-_<2TnP9,{Pv1ps0j7P7H3+8DWjxU+,5$h,"8,@<J7^D,tt+|؁2dԬ'2$:p#l[:  '`#0jM7D't*%%"8l!\?8#JtS;[:q0<w \ )p5@ؽ+T^"pNo f:L0/<P#6&42(5.x@p B@I5R2j,EjTxp'd |!pt(l"@9I# n46`2'ij'P Xa5d-|.p6P^3K`)8g&Hp܎8D}, 7\sX(p|;9(ot1jp&4,%$0Tj 6]7(""`;#<6j*%94DjKu'W8|5g3@t(B#(<`\7\2LNj*@D8L7 #  $+*{'7)`?J;RN>f=jq ,"ld $* ,p\j.X'p%$7T̂60(d4|'\t109 TC7M\e-pXnbGjn|)xz8:P4j A9Ejdo:O,xD)$|)h!&/$47J 9jZ\$k4dstq/8z o,C564X*8x F7)`y8p[05\@%0$')L!j1n>Ԩ7`Tpb\+lr1j~o ,Pd<><ܨnP7l2$.@(*"'p$*\*2%B </$Lj T5(]h2kpu#:p18(&l:4H5j: " ):Dt'T$+-';|$M#]X8n"T!L(Z:DD'HY'7P`7(6I)\j(Oj#L$87\6D^*@Ce8pTX'au(ninz66Jj(K L<)hO) "!!`9|`%8tpinxd$h/B6 4j :P2#0x*n #<45(+Af88NpZ&i\(xq(Dzp9$P" 9@d)L 60 ,/+T)lQ9$1*Hn78B>h/MD-X)e(,-d|n&,Bp :`,( +ЩnX:pn/hn\"(0<&H9`A9hMj^`$L rTI(xl<<:,:,8,*u(O>`&+6,@N0&4$5l)4BB,Y bl-*\m~'$+1 <&ll%$#748o &j`j x.0p)$n?lL> K7hV)<ld+DxAjB4*;y7d4D!4(jB:3*l_*`< 11n'6:4pM<:h^9i|e/y)'l3*xP8n-'8<4 pQ8D#P|8>6 81 6Cv.P<*l]t%q@,g"6H|%0&$` dg!A;7TLJj(x,</H;=8<C6pN o7l[x4je`"9sp8~70q5X4&d3d*.B*p-1+\@j$W!   / F$+X/H6H<FX{3P8,Z0t4Dk03Lzj494TW2|7T8J05dK/@Xpe(ox,>v̫4%\|j;:4tF9Xj$w/L;9' p#TopX*D&8#80B8/Ot2xf<op8'x@&d7847lM&TH Lj47`7\0!@\W),#d3%5 .0@HX&R:$`)4nj}p78d;29$.P$(7/3d :Lx88yj 0 %"'t1B6:XH7jXyjf0%\nL6x{5,&P$h\08@#'d.X tjFjd1$|L'l$7H9?%pA.SD5jc&0q4"dpJ3H +4yjO3x,'  :4d0b9(T:,.H,@h+O`(Z4(<ep/r-$D)D)\464`4 2CjP/'%H!p$0$H9j,ܼ'8< E=QB%`8ptEj{n`0<`87$|97j%in#t,x+ 7D4d+@%88 JL8` 3'hl 48xC04j!{7X|*lu*@jKj$@j<>i9t( 8-!<  / 2|* L]!2 <B; u'PC 4)@T 7`\ $6h 0%4t  G>  ,|9P 86$ / (' l$ - ('X P7<0{:,/p!|8p34u*>x08G &pU!k<1@to"(PR0Գ),P=%:46$q5̨1 8\ ,d (l+`"Xn)L";7Dd,X +|h`B5rD@9~̔3L #^5<(t(K p@8Dؑ-H ( :h)#+4PzjI<P@p\lndU9hqpC2,<p7t2!D4  p3pNoP#BXj`-#\% *.>@P"Txt9 ]3i0+uHj9oj"p>,8(< /Y*<G> 2 / \7|'C)6'0ExjK,"^|U;kDN0(]$Hw7t><l{9H<\/$(lt0 t,>-p3&:#C.34Ru%,e9nX*7w%L: \72e/`@- !2h$)6$']92&@8P&HE8UF> e7m\#q+L7HB:,l'@"< %<!tK X1xil5wPB;6`d-H(%j<09l2(]/0j"$)W&$0E;|GLt9S/[,v% g+tt$6/>s!+!l:||9dh(84f% p:\H58-':nD8)lXx!h4#rhG#Lq1\&Xpܿ1(p#li#`0#*8nH+,d)86p:t)I~$\\"g)\s\= z%,8`5/,P  w0$<3 -4d(5@,/H.29 7 L6<7|8()p(l7nL=T8G 0 R+>YH4pg"{ 94$hp7H+(8L}#1?:X0H*.458=86S (Y|"#l6tq"ж< +DI:0)=4V 9di8 (2  Ej 8@/ D%\K h&pX h9f @/Tr 8e)Ty x'D 4Rj q/T &(  '  < ;3 /  h)x 2X!7x*!(!x#N&0I#7U#la,dn#w+}#'#!#.6#Ej#!#0/"t#6t#@2|$ 9$5d&$ܴ"L6$<<H$9S$8\$ji$h8{$-$h%=4$(u8`$ܤ($!$<$:$03%D%<%(i9#%*>*%p<%pnL%50a%+Do%@37d%43(%%%hp%28%-%T'h%`%t%X +%& <2&,);& 't,0D'&l (,\#(:*D.(`j6(9C(<S(T3 e( q(@9(0(W&,(`:(B(p(|:j(L"T(H*"|(:l)0 90 )D8T)`1X&)04)l==)7S)pa)ܧ/p)b9|)09)7,)\2)T0)o)0'<)!)j)P6D*Z*D *$@*",*Q07*AjI* oV*,7hd*t1lt*4w**&*;*0R)x*%8* l$l*:*'L*tn*(*;+d7+H'\'+j.+( 3+(g >+:Q+.=h+)ps+6+@<'P+D<+j+n7|+Xj+б'+6l+<@#,t%"h,:,?)/,`=8T=, !O,L hb,>y,j,\N0,(K5,,8-,)0,4j,7,, %,7 -lyj-@Dj(-\%8/-D$8I-,hc-ܢ7w-(M3-d.x-j-"-t:j-b7h-0 -6-3.H7.t($. &0.#t9.PV!I.2tW.Ы)`d.]%l.#lx.:...q%. ". 12. '.l69.<.g8|/.!/66/,J/tS#L]/~9 m/88x/Xj/:X/>@/8$/4'/a2/\j/L7t/J(/*x07X0Mj*0h%-C0u%V0tf!_0 zjp0d2:}0 '0 1+\1H01h71TK5x1722#2$8p12Xh%h>2M5P2'\2؋jc2܇%Tr2D> ~2(j9(2Lk3 2 'x21L2'28x2@7$2p2+263PG7 3X:t"3#.03o73n%\L3(,S3L-$`30,<s3)3TC"3)30B3I#3:3P503<043t/3(::4,4@p,4<@4̬4 D4Ь$4Y4,#p4x3Py4X'x4o4:4=8`4=(4l p4$4/"4646/\508X5@'d/5Fj:5v(C51T50pe57Tu50,5(T5Ԯ;t5+@5Lo5Do58<5)l5#860B 60l6'x#6*,.66=68 5E6o%S6R+`6h9q62P|6206+d6j6<6z6646)*,6zj60 366<6:T6̔67Vj 7 3X-7pL67u(?7x+lT76`e76v7I!L7<7_*D7D7T7b27H(\7P B7dP>$7(z97|07 X82849+<*8%!;88%$I8 8 S8P>Z80:g881|u8P+~8&d8"> 8Fj8 Fj8*9X8dj8w288N048,898.\!9" X+9:j:97TK942pX92d9T98r9B9`v!$9H6(9@'@9V79Ĩ6,939, j9Xn9N-:lv9`:|7%:I-`4:Љ)4>:dm!I:8.,`:8i:x<{:9h:* :d0:P:': :x:$:",:8(7(:." ;F(<;6,;<4;y%I;Dj;V;|.<a;l4m;`-x;Լ%\;D!;|);\'0;$;j;<;7T<T(|<11<h1d?<4jU<<d<5p<=l=4I=`&W=`!c=lpxr=,=t>3@=\2=dp=`Xj=d*=d&=@#>,>8d">PX&8>4F>66 Q> !0l>>-p>J6>,4>lF!>9d>Lc%>̳">$: >2> =d?<50 ?1p?T<%-?l6>?6tK?}2Lf?h+Hq?6(?5,?9?\<?n?U$H?ȯ:?xAj?p7d?6H @Ƚ-@8t&$@!6@I*PHIXnSI8F+8fI(HxI)Ido5Im1I^$0I#HIx%I <I |:I!,J$m&J4J(&0J@n6J FJ:ZJD*hJb%0rJ((~Ji%JX1J_&Jd*$J #pJh 4`J3JdM98J-9,J7( K"lK,o$K$' pBK52 UKt:cK0nK<}K. KD"<K!$Kh:K,$K.K,u(K+K;Lc%TL5L 1*Lm4:L 00EL;hULЂ'(fLt''oLhnxLx&L<L^*LLH%<L8L,M7,L?3h L#LHpMLB5M89j%M,04M\,@HMc.8SMl(@\Mt1jML4p|M|3pMl:PM5M :M:MH<M2hM^*<M$h&NN>0NRjT%N";Nh6(HNe6PNA%ZN̺)(qN[(N,j N)N4r-$N7N8OoN(#0N\#TNDQ2QD*# Q0m-<Q(@+Q# Rh,%R5P2R6|CRxXjRR=jeRB-R:R)RP}8DRPjRd7R$)/R.\R '0Rn5Rt2l Sh'lS 6\,SK7 @SP5DGS0/VSh$0pS BwS:XSx:S>8LSlA+S+S(8tSh6<SoS,SDnTX Td38T ))Tx'=TjGT9TVT05%pT<T@jTl<0T`*Th/4T`a-0T0jT8+DT37lU>j|$U 5j+U"l=U(|FU">NU)8\UPMjmUh",U1@U\(`UnUȲ#0U:U' U8Ux&U VD6<V$V(<1V3XBV%D[VlG> gV98}V ,,V7xV,V8XV4oVh54VT:V+ W<Wĩ=!WL)*W8!;Wu9XW<%WinWEjX|Dj X4 Xd:)X27XH=BXoIXnPX(YX9mX 7<~XS2@Xd+X$XEjXW+X*1(Xxj8X>%@X(& YZ4YxDj&YX(1Y,EY>MYlm-<YYX,0nY5pY,Yl+LY2Y`#Y'=Y%Y,1LY!HZ+>Z:j&Z0j/ZXM&<]+]@T"]8h]У/4]E)d^l5  ^j%^ B -^:?^P6P^X5`^S2xp^5\~^ ,(^j/l^$"^.^T(^q%^2 ^L46^p^<_\.-*_d:9_lp9dF_XDnO_ g/a_0<v_W&_Ij$_p.)_$P_E6_8j50_|v'_$^)_D)X`<4@`F> `hn`,L+`XX&0<`,$0T`TSja`3 n`<`t5`[)D`\%p`(:d`zj`7`N*|`2`n`paEjaz%/a p@aH(8KaH&; cal&oa,a &Ta(5ja;al8axu2a0ja ;|b >:, b6,b0$x0bB8b pCb@-(VbL7eb ub9b14b,%$b/pbk+Pbd(bdn%bh 8b(2b5@bBcj c 9\cIj(4cpQ,|Jc">Scp;dc<tc)8|c8>*c(c#Dc cD9#cxjc=+|c@jc%dt?#(dt , Ad'xId LRdxjXdpp%td.=d*d,;8d|6\dx>$Ld05`d0jd\%HdP<88d0'$e%:e8)ep9)`3e1j=eJ8He8TetX/del.T newj{e0njnjn Do %oa'=8o$0(tAoJ8tKopTot&_o%Pwo.Xo'o9oHu%To8o#ot(doܛno/o7H pop(0p4$X+p 9d6pȯ=Bp'TSp2_p|6hhp8oop<p3p -p4j p5p3,p$'dpH"\p2p,}7p8 + ps)q # qEj2q|*4=ql?%KqpXqDjdqxpqq`Rj~q?q/:Tq&:Pq+Pq:q<q7hqXI6lqtS5 r0<rnr1 .r@e5()8Rrt]$0lr6l|rDjrvjr{jrh8 r7'(r8trd*rorh)r&Tr8-"rjs<sp&sL57sDOj Csd@2 Qs#fsXpns$$sl9$s |s;sT/s\H> s`a5stPOoJtd>+LZt\s9gt-8vtD-t3%8tx# t1ttoth4t`F-t%(u s!u:@3u,7DHu2)Ou&d[up|2lvu+~u,Pu.2lu }$hu@L;ul+,u7lu) u49u`,v pvj9v.Evм%Vv(!jv:v7v+6@vt*vd5Lv#v0jv$8*,v9\w(Pw+#w?`7wD1xGw_(Zw& ew;XuwT;@wt&w&dw"w!<w6$wL4w."w *Pw`'xĊ'4x"!xP!1x(<Bx,%LMx4#dxjrx5(xEjx ox|/xhD!DxF2XxC$x0x$/P xW&yLjx y2,y(x=yx-Ly&Sy"<`y-vyL'y&$yjy&`y(Dyt#,y\+ yh1*yTjy̠70y,4z4. z80)zx7t z70zPpAzX5' HzX9LZzw8dzl0pzP/Xz@Ajz|G(z'pzTpz$Mjz\/z&$z|F;(z=z 7{\p8d{)-){)1{t/>{p/L{8W{\8d{*o{@!}{l {Nj {/j{j{ {,N6{/{x'x{8{,.@{|/ |(|:!|:2|;,Q|c:D`|7k|DTjy|$|$Q:|d6|54|\Tj|<|XRj| 1P|1>|Kj }hn%,'}k$0?} nL}>x`} <k}`x4}}S"}+9<} 5x}.}B}8Vj}u,}m/}<}ht9}H6d~\*<~$F6.~%E~d3S~$)_~"o~jw~, |~/~<~.p~pn~P5H~,$9~m8x~ !~`(~5jS(T$`#T0l/h-494% K};\Xpe42tnlr/xp)d0,0XB@< ,E; T+B(t+( 4_:-L(j8$%JQ54XD+`jS#wg9$&L'h,Dj` Pɀ+|ހh)#d+:  t\65j!&/$?*::%J*U7r36`oX&ܽ1,+1|ŁTY4H݁Hw4&*Ȳ9 1g,)=$59>>M|jZld(`n$)~ ,![#3(0=;pMLj^|(hs_ \ PhC8$2 =#Dȋ7$ԋe*d݋$'|L9t8.82#(Mj2$7Bd7 Rv0\dK,4rz){)l@4,Rj$&$p0*|%|H#̌ ތ"l/4D1|ov$"+0X5(?CjPR(`|9Dm 5{<h%0<>X:089H9`ٍ V7`5Lj\j\>9*\Dj=%H=c jl|)t<yr9p =85jn+Ŏ|:,ЎLXjQ+B<\*XnD41Y48?_1LL:j$Wl%eH)xlnvx6`7t8f2xn<Џ$-/PAj58%\8$<80(AH"MG> Y7i0 ym#L ė#`(@0G> t94<Ґ4y5(4("pHD5<0't/B7'4FS,a8n(}Hp7)7<np l=jƑp4j֑(ߑ@!9ȥ7Tp'\-5n?#hLT,^5t<1L'& .- ɒ6ޒ<7*,;=4'88<,H> ?\v*4KE)Z|&c7p\p( i6l 1,x+& 06`˓t0ԓ̔#)&\)x4U+l#/?"C7@O0pX4 b# l0v<* /0`  ?(Ŕ7LӔ5*8ܔ!-d@- f%D6j@*,,9*$8dL3E(pL'|\l <u,j7(p& %@ 9$\͕,19p&o"<,X,xJ(05L+Ixk%DVD4hhh2{24,\nnX!Ė̋ і Bږ`j02X32 2,dKn/(P" |57$r0EjKV9X1mXz'z9$Po*Pj'd@;Ǘ:Hٗ8)(#"X+`K+4'q*l5y#0AxjHP<2W"iT7Tq8K8D| &1(XM7\x8`%$0C$CNj$N2U1XnH<. h4\<:ś%2ӛT<-ho`$H#`.\(h-3\*$<BI<,e+}@&dBX1>Hj$ #ɜQ"`ܜ07<:$(1X 8~:,*|p4% CP<Rh4t]d4vI7l@,K(I&:-<ҝl+ޝt]*@5h9$@1@.,j>,T$2xb=jx[%1$@H#(1jĞunٞ\:L-;:0,l-CLY*@LX*TV"h\ppxjx&j8H& l3ğ1џTXjٟXA#< P`W*D" v18-x),2;X9DH"[8&fpuHDjm)T1e.Ě'48dLI"Ԡ6H̝+6G-|z%P:,&pJ5`1<8d> 2*K$O6]p f@'3,*;\8Z;Hʡ< D'9(( ,k P=9'$Fj52??9K$8d[`poEjB `:p:$\44=h|&؎$<(689:pB[*TNpnV /h_&kr'|xw6@ 5<' %ɣ@!ۣpW,p<o7&3h&,>pRj\<<oj~t1P`#8zjRjŤ7%@`e8<68$Dj/&xn/jP:7(I $WT*H f4r*t1jP4'\o<o:4¥EjҥX,*pܥ% 145j j%x#B 4`j C0tUй%fj~|6to7DRj$;8˦A)֦%6D5!4%/xt( ,n5'A.4[#tt$%7`x{7@d1s*|L7}68ͧp/ާo@68:T 6LPK2d&ē+X27T@2$N|)a$1p,p+\un :1-˨4+ب*;jK,(?% ;h'Z,= 'tL!]n.fJolo{jFj^2K))$`BD4ɩ&٩-(:j$!|!R-3!:$09h0D8.3tSo+$a(7\[h*5e.r`8t(4L>$-)`íj0Э T6:TFj[3H(9j&(Q454@'Ko$b Z0dkB(y 2`Dnp%!h$00$\Ǯ9$Ѯx#('(466pn\Dn3"p &+X4<4 B`&L() Y8 f!t9 PW6|&H@oLn(įL9կ(/ <)@>$04T::4*%@;@"LO$5_l<p|8}`+*Xl%DTRj)ǰ6\ְ$*dpT,<,30*Hc&9#lP!:,[9e<&&(,:9*|ı*ϱu:Tݱt7zj`)7`P1 ȝ(&`2D/X-Epn N|<\8p6,DD: p/"˲P9ڲ`-=hn# y980'`&<'!6`,$J'$RhN7hb4<xQ0Hr,40j:˳/׳,j޳' # " %TF)($k%d:0DFh= RB<4n68{T75̶!64d$|XjԴjߴh($>'` # 2hK&d*@$=A>Eh> Z/y@RjLv$G9X( '̵=*4ֵ#81J&ȳ#28&" 60@? WB)c~-Pt&tz)(D1:Lx7H&7Ķ6ԶT*߶< DB7/0X2dP(X+p$7A#E>60R)lmB0j& X9`pG9p=8ɷ86ӷF)ݷdC50~!x 8428)<>(J{jV8d624rp<~ (/vjh<3 k5pŸh2ո܂jܸk"|? \ o% \),:=`:Njswap_onwi_set_nwkeyucom_unlockpfslowtimonanouptimebuf_rb_bufs_RB_REMOVErandomreadehci_device_ctrl_closeem_set_mac_typeaxe_tickre_disable_hw_imlongjmpwi_usb_rx_list_initsr_crypto_discipline_initkdb_trapvfs_allocate_syncvnodetc_setclockuhci_pci_attacharpresolvechrtoblktblsw_reg_strategysys_minheritieee80211_tree_RB_NFINDputcharural_update_promiscuvmfault_unlockmapschild_returnrtlabel_unrefHMAC_SHA1_Updateuvm_map_inituvscom_attachipsec_soft_first_usenkmempagesuhci_device_isoc_donecopyinstraue_miibus_readregieee80211_send_group_msg1sys_getgidieee80211_tkip_micdofilewritevwi_inquire_usbuftdi_matchdumpmagieee80211_derive_ptkttyflushsys_setsockoptcomdefaultrateclock_gettimeieee80211_watchdogwihap_sta_disassocdefrouter_lookupinetswbwi_rate2modtypewi_get_fid_usbwdog_periodcdce_rxeofip_reassrt_maskedcopyin6addr_anyVOP_ACCESSusbd_get_quirksem_k1_gig_workaround_hvip6_get_prevhdrscheduler_startdb_logpciide_triones_productspmap_alias_bitsuvm_maxkaddrehci_pci_cansphy_cdumass_io_putral_pci_detachicsphy_resetieee80211_getmgmtrlphyattachipmforwardingmainbusprintohci_waitintrumsm_attachsys_closeusbd_do_request_flagsbwi_mac_attachrt2560_set_rxantennartflushclone1in6_purgemkludgeffs_inode_allocdes_encrypt2sys_setsidbwi_rf_calc_nrssi_slope_11gieee80211_encapusbd_intr_transfer__ashldi3artisea_chip_mapvn_statunp_detachsiop_scriptnd6_nud_hintether_ip6multicast_minumodem_breakusbd_submatchtcp_secretrti_find__mainbwi_rf_lo_writeaue_stopufs_quota_deletehardclocksd_vpd_thinenc_xform_aes_ctrieee80211_eapol_timeoutsr_rebuild_threadrt2560_wakeup_expirewi_read_data_iomyip_ifpwdc_reset_channelrt2661_get_rssiumodem_set_comm_featurein6_domifdetachieee80211_get_authvtagssiop_pci_attachmtx_enter_trywskbd_cndetachdb_get_variablecd9660_vgethotplug_get_eventpcaled_caieee80211_inputcrypto_dispatchsr_discipline_shutdowngeneric_armv4_bs_wm_2if_group_routechangesys_fstatatfiq_claimohci_device_intr_closebrgphy_disable_early_dacurl_csr_read_2dest6_inputgsignalacphy_cart2560_suspendehci_pci_matchipport_firstautoehci_strbwi_mac_set_tpctl_11bgmii_mediachgwi_txeofaue_devsipsendredirectsbpf_setifem_encapunp_internalizetk_rawcc__wdstartscsi_xs_sync_donefc_lfcemptyvfs_export_lookuprt2860_set_ledsif_cloners_countifnetyieldohci_endpdm_freemwsmuxattachuhid_seltrue_filtopsfilt_seltruesc_print_addrlogcomspeeduvm_rb_subtree_spacevn_writechkin_ifscrubral_pci_caarmv4_tlb_flushIuvm_pmr_freepageqpdevnames_sizemichael_updateumsm_umass_changemodescsi_mode_select_bigmainbus_bs_wm_2route_dstinit_execuvm_pmr_size_RB_NEXTieee80211_send_4way_msg4wskbd_cdnamecache_rb_cache_RB_FINDsys_getdirentriesbcmpgeneric_bs_r_1ieee80211_node_detachdb_set_breakpointsnd6_dad_startexec_maxhdrszuhci_device_ctrl_doneblf_zerokeydb_force_whitespaceSHA512Initieee80211_ifattachmmmmapieee80211_clean_nodesuvm_map_spacefitsbwi_memobj_write_2setjmpsd_read_cap_16prefetch_abort_handler_addresswdc_disable_intraes_ctr_reinitricohrtc_clock_readrt2560_get_rfpdc203xx_dma_finishpci_subclass_communicationsurlphy_funcsuvm_deviceopslogread_filtopsre_ifmedia_stsvndxfer_pooltcp6_mtudisc_callbackcopyoutstratu_capte_l2_s_prot_uieee80211_countrycode2regdomainusb_transfer_completelxtphy_servicepciide_unmapregs_compatswcr_newsessiontcp_attachla_hold_totalwskbd_cngetcbuf_dirtysoo_writesystempageieee80211_align_mbufm_zeropdc20262_dma_startural_alloc_tx_listnd6_llinfo_timerunp_gcingreaddoslabelbwi_rf_init_hw_nrssi_tablebdevswumodem_matchbaddynamicportsworkq_initohci_root_ctrl_closeX_db_line_at_pcural_ack_rateuvm_mk_pclusterbswap16domainnameehci_endpduvm_pmr_addr_RB_REMOVElockinitwsmouse_detachttywrite_filtopswi_usb_devsnd6_ns_outputbpfkqfilterre_ifmedia_updinflateCopyttyunblocksr_meta_opt_loadbioclosehidms_disableremovedeudav_miibus_statchgigmp_timers_are_runninguvm_deallocatefilt_procattachufs_quota_free_inode2filt_procdetach__divdi3pciaddr_resource_reserve_disabledi80321_io_bs_allocallowpowerdownsys_clock_settimesiop_led_offural_txeofwdc_floating_busuvisor_calocnameshidkbd_bell_fndisk_busydb_breakpoint_allochidkbd_belltcp_pulloutofbandevcount_sysctlsqphy_statussddetacharprequestsiginituipaq_cdpci_mapreg_mapuhci_device_isoc_abortpool_set_constraintsusb_task_thread_procip_sysctluhidev_closemsdosfs_vptofhscsi_mode_sense_bigusbd_clear_endpoint_stalldb_vnode_print_cmdums_casetdisklabelbio_registerdeflateknote_removesii3112_drv_probepmap_bootstrap_pv_page_allocsr_hotspare_rebuildroutedomainsr_crypto_meta_opt_loadhid_locateicmp6_errorVOP_MKDIRpool_large_freeip_protoxsys_settimeofdayi80321_sdram_boundssdstrategyaddlogehci_sync_hcuvm_page_physgetrt2560_bbp_readmsdosfs_synccheckdisklabelscsi_mode_senseip_savecontrolstackgap_randomfiq_setregsffs_clrblockusbd_set_hub_featurepdc202xx_chip_mapbpf_filterchgproccntip_drainieee80211_tree_RB_PREVdb_map_print_cmdumass_init_shuttlesoqremquepci_class__adddi3uvm_map_inheritsys_getthridcd9660_syncem_enable_hw_vlansin6_ifawithscopebuf_page_offsetumodem_set_line_stateuvm_pmemrange_addr_cmpkm_freeusbd_is_dyingsync_printvnopsieee80211_rssadapt_inputsys_lchownmsdosfs_removecd9660_readdb_read_tokenem_attach_miibusieee80211_regdomain_compare_rnfilt_timerdetachwi_get_idzeroin_addrbmtphy_cdehci_device_bulk_closewdc_set_driveuvm_map_protectusbd_get_xfer_statusre_encapprintfehci_alloc_sqtd_chaincdce_devsrandomwriteuhci_device_intr_methodsprelist_updatehmac_ipad_buffercrypto_drivers_numip6_protoxsys_recvfromswcr_freesessionttrstrtwskbd_mux_openrandombwi_txeof_statussysctl_doprockcopysiop_modechangeext2fs_initrtfreere_pci_detachcuio_getptrcd9660_linkhostnamelenupl_cdusb_needs_reattachdeflateTunesched_cost_runnableem_flowstatusxscale_cache_purgeID_rngttyopenuplcom_rtsraw_ctlinputwi_usb_ctl_unlockbwi_rxeof32nd6_ioctlsched_chooseprocphyslockspec_setattraxe_miibus_statchgpte_l1_s_protousbd_get_stringfill_prlistipsec_exp_allocationsHMAC_SHA256_Finalbpfcloseusbd_probe_and_attachsys_writevsys_setpriorityumodem_set_line_codingm_tag_prependE_abs_script_sched_slot0_Usedaxe_cmdfrag6_insqueurl_unlock_miiumass_detachusbd_free_iface_dataip_defttlwi_usb_attachurl_rx_list_initusb_schedsoftintrarpintrkqueue_registerpciaddr_resource_managecred0in_delmultibuf_nkvmsleeprt3090_rf_setuppmap_procwruvm_forkdisk_lookupuhci_device_intr_abortuid_findumass_activatend6_rtrequestuplcom_cduvm_km_suballocusb_delay_msucomparamif_getgroupattribsbpfdetachsys_closefromumodem_closeehci_devdttydefcharssigexitscsi_link_openhidirtypagesrt2560_reset_tx_ringin6mask128rt3090_rf_wakeupbus_space_read_raw_multi_4uvm_amap_poolin_pcballocVOP_LOOKUPsr_meta_readbrgphy_loopdb_shift_exprphysical_startbs_notimpl_bs_c_8ifa_delpcred_poolenqueue_randomnessexphyattachusbd_set_idleserverworks_pci_intrieee80211_find_node_for_beaconemul_nativeaxe_txeofwskbd_inputdes3_zerokeyre_miibus_statchgobio_matchacphy_cdcrypto_getfeatsched_cost_loadbwi_memobj_write_4bwi_phy_config_agcwsmux_attach_scusbd_pipe2device_handlecpu_do_powersavemainbus_bs_freebwi_free_rx_ring32aue_rx_list_initi80321_bs_vaddruvm_km_pagesufs_quota_alloc_inode2ieee80211_name2countrycodemicrouptimesr_validate_ioaes_xts_decryptsocket_poolpgrphashsys_setpgidpciide_jmb_caprofhzAES_GMAC_Updatentp_update_secondcache_enterdb_watch_tablei80321intc_attachedsysctl_file2exec_elf32_makecmdsusb_rem_wait_taskext2fs_bufatoffsys_setlogininitarmmainbus_bs_r_1amap_listdb_trapip6_maxifprefixesthecustcp_do_rfc3390ieee80211_req2nodesys_setresuidsvwsata_dmactl_readcrypto_kinvokern_deletesd_get_parmsiskmemdevstat_rush_requestsrt3090_filter_calibwi_watchdogatu_start_scanipsec_def_compfc_lmdistancench_poolphtree_RB_REMOVEsomaxconnural_readscsi_xs_get_doneatu_external_firmwareipsec_exp_timeoutip_directedbcastbwi_free_rx_ring64i80321_pci_decompose_tag_bus_dmamap_loaduvm_pmr_pg_to_memtypeuihashtblieee80211_node_getrssiumct_activateticks_per_secondsd_buf_doneieee80211_get_rtsamap_initffs_flushfilesubsa_baudrateiq80321_pci_intr_establishicmp_sysctlsys_lseekmainbus_bs_subregionnprocsdes3_decryptllinfo_arpmsdosfs_pollpci_lookup_quirkdatamsdosfs_accessaddupc_intrdvd_read_bcasys_thrsigdivertamphy_servicewsevent_finiip6stathotplugread_filtopsuplcom_set_line_statehidms_enableuvm_pageboot_allocconfig_pendingmii_phy_updatei80321_i2c_matchbwi_mac_dummy_xmitether_crc32_lepiix3_4_setup_channeluvscom_set_crtsctsaue_csr_write_1rn_searchugenread_isoc_filtopsipipstatsecureleveluftdi_cadb_consoleurl_matcharpt_keepsavectxdb_printsymums_disablepte_l2_l_cache_mode_ptbinuptimesys_seteuidhidms_attachwskbdpolluvm_map_checkprotmax_protohdratu_tx_list_initcdce_activatedes_is_weak_keyohci_pci_matchural_rf_writedb_access_irq_spieee80211_add_qos_capabilityieee80211_cipher_keylenumass_scsi_attachsr_raid1_discipline_initrandomkqfilterbufpagesuipaq_attachusbrev_strpciaddr_resource_allocateiic_execsleep_setup_signalrlphy_cdprocess_newsys_keventcopyargsarc4_reinitsr_chunk_in_useuhci_device_bulk_methodsrt2560_attachwd_standbymi_switchcd9660_statfssysctl_sensorstsleepkern_sysctlbwi_dma_mbuf_creatend6_delayin_pcbinitsys_fchmodatsqphymatchbs_notimpl_bs_rm_4nmbclust_updatehw_prodfdremoveuvm_tree_RB_NEXTigmp_fasttimobufq_disksort_queueatomic_setbits_intehci_device_ctrl_startuserconf_cmdbufwi_get_pmumass_bbb_statedb_print_loc_and_instohci_device_ctrl_abortsvwsata_dmacmd_readrt2560_updateslotpiix_setup_idetim_timingsrt_mpath_matchgateubsa_stopbitscdce_startrt2661_reset_rx_ringusbd_port_disown_to_1_1uvm_map_entry_poolcrgetuhci_activateunp_bindtcp_delackuhci_device_isoc_closecsignalreaddisklabeldb_print_cmdusbd_clear_endpoint_stall_asyncehci_pci_shutdownvirtual_availbs_notimpl_bs_rr_2tcpstatuvscom_readstatdma_constraintdb_break_tableuvm_anon_pooli80321_softcicmp6_mtudisc_timeoutfillmapentrytcp_timer_persistsata_chip_mapudav_newbufsys_umaskuhci_pci_attach_deferredpci_subclass_i2o_tr_flush_blockpow2dividesyn_cache_reaperfilt_fileattachsysentieee80211_find_rxnodecpuset_addpmap_alloc_specialsbs_notimpl_bs_r_8tcp_setpersistrt2860_drain_stats_fifoufs_ihashlookupubsa_intrscsi_inquire_vpdmemmovesii3114_mapchanicmp_rediracceptugen_set_interfaceusbd_get_hub_statusworkq_create_threaddb_boot_halt_cmdural_attachip_outputbwi_init_rx_ring64bwi_bbp_attachbpf_mtapnkmempages_maxfindblknamekue_rx_list_initpool_inituvn_referencebwi_pci_detachuvm_pmr_addr_RB_PREVbpfreadpool_putm_copym2buf_alloc_pagessysctl_structbufqs_stopohci_hash_rem_tduhci_poll_hubaxe_ifmedia_stssysctl_rdstringuvn_attachlasttimesr_wu_putehci_freexcryptoclosesysctl_disklockcnkqfilterrt2860_alloc_tx_pooldesiredvnodesbs_notimpl_bs_r_2ufs_pollusbd_remove_devicepmap_map_sectionmsdosfs_readlinkpmap_devmap_bootstrapdes1_encryptieee80211_decryptusbd_get_device_statusbwi_rf_init_sw_nrssi_tablenchinitexec_mapdb_qualifysnprintfcomcngetciicbus_printext2fs_readlinkether_ioctlumass_bbb_transfertqphy_servicebwi_free_txstats32ip6_forwardingsr_shutdownural_cdkue_resetarp_allocated_bus_dmamap_load_mbufbwi_plcp_headerwdc_print_capswi_watchdog_usbifindex2ifnetcd9660_ioctlem_initrt_mpath_conflictusbd_get_config_desc_fullin6_savemkludgein_pcbnotifyalluvm_pglistallocsyn_cache_addpool_large_free_niohci_device_ctrl_transferbuf_kva_endsr_raid1_intrincoreurlphy_cdhzdcphy_mii_phy_autodefrouter_resetcd9660_ihashinsbwi_dma_allocrt2860_newassocrt2560_bbp_initsiop_script_writesched_exitcheckaliascue_activatettyretypestartuphook_listrt2860_detachre_tx_list_initpte_l1_s_cache_modeuvm_pmr_remove_addrkue_detachrt_timer_queue_changelf_initwi_ioctl_usbcpu_attachrn_mpath_countbwi_set_addr_filterwdc_preata_drivemii_phy_matchrt2560_eeprom_readural_amrr_timeoutzlibVersionsr_raidp_assemblesdclosevop_generic_kqfilterpffasttimoinitsiginfosys_getuiddb_set_cmdcomconsunitcpuidsexec_setup_stackobio_bs_vaddruao_createdb_free_watchpointssensor_detachbwi_led_blink_endifaddr_items_RB_INSERT_COLORbuf_mapbrgphy_adc_bugaue_lock_miiidentify_arm_cpuffs_realloccguplcom_set_crtsctsrt2860_initwskbd_load_keymapxscale_cache_cleanD_rngm_clpoolcd9660_bufatoffugenintrgroupmemberuvmspace_initrt2661_ioctlscsi_plug_detachether_sprintfatu_calculate_paddingfintek_refreshmsdosfs_unlockselwaitpmap_init_l1icmp6_mtudisc_callbacksnd6_slowtimosys_forkbufq_implsip_setmoptionsuvscom_reset__qdivrempmap_deadproc_cache_stateifaddr_items_RB_PREVpiix_setup_sidetim_timingsumct_matchspec_openi80321_io_bs_vaddrpmap_vac_me_kpmapswcr_sessionsfilt_bpfreaddb_watchpoint_freesr_disk_attachehci_alloc_sqhuvm_fault_wireusbd_abort_pipekernelstackcrypto_initem_k1_workaround_lvpci_resumevm_nphyssegifaddr_items_RB_NFINDip6_randomiduvm_pseg_initproc_filtopsfiq_nullhandlerelf32_os_pt_notewdc_print_current_modesSHA512Transformfiledescopensys_vforkehci_freempmap_vac_me_usercomcnspeeduvm_pager_initcpufuncswinChkNamebwi_regwin_is_enableddvd_read_copyrightieee80211_recv_4way_msg1bio_delegate_ioctlrt3090_set_rx_antennauvm_pmr_addr_RB_MINMAXdb_history_prevem_read_pcie_cap_regbwi_rf_clear_stateem_setup_receive_structuresmyip_initializedsys_mkdiruao_reference_lockedcom_resumepmap_devmap_tableufs_fhtovpcrypto_donewskbd_translatedumppcbbwi_rf_set_nrssi_ofs_11grttrashohci_root_ctrl_abortmblowatgetnewvnodeufs_inactivepciide_natsemi_productskue_load_fwnd6_mmaxtriessiop_intrsys_socketuhci_detachuhci_abort_xferbwi_mac_fw_loadugenopenohci_shutdowni80321intc_imaskffs_cgreadwi_init_usbugenioctlspec_close_clonevop_generic_bwritenanotimere_cdufsspec_writelxtphy_casd_read_cap_10iso_disklabelspooffdfreeuvn_detachieee80211_ccmp_set_keyfintek_capci_set_powerstateuvm_km_valloc_trytty_counthidkbd_detachwd_hibernate_iobwi_phy_init_11gdeflate_globaluftdi_detachraw_disconnectipsec_ipcomp_default_levelsensor_task_registersis_south_matchusb_end_tasksip6_neighborgcthreshbufkvmKERNEL_BASE_virtremove_coproc_handleratomic_clearbits_intumass_polled_transferucom_to_tiocmdeflateSetHeaderuvm_pmr_extract_rangebrelvpsensor_attachre_intrmsdosfs_mountfsvfs_relookupem_oem_bits_config_pchlanpcibr_flagsem_82547_update_fifo_headncpusfoundehci_root_intr_startwi_stopip6_sprintfsync_fsyncumsm_activatesetstatclockratecd9660_strategyohci_allocmem_iffuserconf_parseural_tx_bcntiocm_to_ucomip6_keepfaithext2fs_allocpmap_cachevivtusercryptowskbd_deliver_eventdb_eregscom_fifo_probeieee80211_delba_requestsr_raid0_set_vol_statebread_cluster_callbackfdcopy_bwi_txeofatu_send_mibemul_findAES_GMAC_Finalb_to_quvm_pmr_size_RB_INSERTin_len2maskbus_space_read_raw_multi_2uhci_pci_matchcmd0643_9_chip_mapobio_bs_allocusb_blk_freelistudp_sendspaceuvm_objtree_RB_PREVifg_headvfs_rootmountallocSHA1Updateehci_device_isoc_transfercue_tx_list_initbs_notimpl_bs_sr_2netintrcd9660_openrw_initi80321_bs_mmapAES_GMAC_Reinitixp_setup_channelohci_root_ctrl_startbuf_rb_bufs_RB_FINDcmaskbrgphy_cd_bss_end__ext2fs_blkprefdb_pool_print_cmdbwi_encapwi_alloc_nicmem_ioicsphyattachdb_delete_linescsi_activateuhidkqfilterVOP_ISLOCKEDsys_kqueueAES_GMAC_Initieee80211_tree_RB_REMOVE_COLORuao_referenceusbd_kill_pipeuhci_freemin6_addrscopebuf_getdb_searchieee80211_ifdetachuvisor_attachbs_notimpl_bs_wm_4vfs_getcwd_scandirmaxlockdepthwi_usb_tx_unlockieee80211_free_nodeieee80211_node_leave_11graw_usrreqnblkdevuhci_find_prev_qhpciide_detachinitidbs_notimpl_bs_wm_2uhidev_detachsr_crypto_hotplugttyinputscanc__stack_smash_handlerbwi_pci_conf_writeumsm_matchukbd_consopsbiodoneural_activatedb_set_breakpointicmp6_rip6_inputehci_free_sqtdwi_usb_txfrmmaxslpext2fs_makeinodeehci_device_intr_methodscue_startaue_csr_read_2ufsread_filtopsufs_symlinkm_dup_pkthdrbwi_bitswap4sr_crypto_assembleufs_mkdirvfs_getcwd_getcachepci_subclass_satcomusbd_get_no_altsural_newassoc_length_codenamecache_rb_cache_RB_PREVin_iawithaddrbwi_mac_fw_free__anddi3phtree_RB_REMOVE_COLORrt_missmsgVOP_BMAPre_txeofignore_addrsip_dooptionsvn_locksvwsata_lba48_write_regcue_tick_tasktimeout_add_tsbwi_phy_attachrip6_ctlinputubsa_activatescsi_link_shutdowncdce_caSHA384Initumass_cbi_adscsbdropsr_meta_native_attachmsgbufphystcp_debugusbd_transferinpcb_poolohci_pollohci_hubdnextralocblf_keysys_setegidbus_space_write_raw_multi_4wdc_wait_for_statusucom_status_changern_matchcd9660_symlinkautoconf_verbosebwi_memobj_read_4in6_setpeeraddrunp_externalizesys_munlockalluvm_faultuhci_waitintrrandomioctlsoftraid_disk_attachsoreceivesiop_iwrpool_getuextralocscsibus_printlinkdb_show_radix_nodeudav_csr_read1ieee80211_eapol_key_inputohci_root_intr_startffs_dirprefucom_shutdownrip6_outputinflatert2661_setup_tx_descscsibus_cdin6_get_rand_ifidndflushcompose_tab_cmpieee80211_parse_wmm_paramsrn_insertspec_pollbpf_wakeupfilt_kqdetachdb_flush_lineaue_unlock_miiwsmux_getmuxipsec_exp_bytesbufqueuesconfig_defersys_faccessatgf_mulbwi_mac_setup_tpctlem_check_for_link_bus_dmamem_allocm_tag_initbsearchif_attachsr_crypto_free_resourcespciaddr_ioaddrsys_setrtablem_reclaimsr_raid_read_capnameibwi_disable_intrsem_read_pci_cfgbs_notimpl_bs_sr_4ext2fs_readdirip6_ctloutputdead_polltqphy_funcswihap_initversionbwi_mac_opmode_init_bus_dmamap_syncuvm_pmr_remove_sizelzs_dummybuf_needvakqueue_initieee80211_wep_delete_keyrt2661_read_eepromuplcom_set_line_codingaxe_rx_list_initata_dmaerrieee80211_bip_set_keybwi_mac_set_retry_limuvm_pagezeroin6_setsockaddrigmp_leavegroupcom_common_getciic_probe_sensorre_pci_cabs_notimpl_bs_rr_8mountlistuserconf_histbufcomsoftwihap_mgmt_inputpdc203xx_read_regudav_initVOP_REVOKEconfig_deactivatebwi_txeof_status64SHA256Finalclallocipsec_esp_trans_default_levelbiowaitbwi_led_blink_nextpdc268_config_readpci_subclass_inputprobe_addrs_sensorfilt_ufsreadrt2560_rx_intrunixswuvm_objtree_RB_INSERT_COLORdb_stop_at_pcsccstqphy_caehci_check_intrral_pci_activateccpupmap_updateehci_device_setintrobio_cduvm_map_replacegeneric_bs_sr_1em_setup_linkpci_vpd_readre_pci_activateacard_chip_maphidkbd_inputsr_raidp_recreate_wunexttickeventfdinitboothowtoarc4randomnsphy_funcsuvm_map_entry_unwiretcp_delack_ticksbwi_get_rf_loupl_stoprt2860_intr_coherentttopenata_get_paramsip6_randomid_initieee80211_tx_ba_timeoutether_ipmulticast_minconfig_rootsearchrt2860_bbp_initrip6_sendspaceieee80211_countrycode2nameuao_dropswapin_addprefixenxiosys___getcwdcd9660_specvopsusb_cdrnd_event_headin6_maxmtupmap_enterrt2560_iter_funcamphy_funcsundefined_handler_addressRMD160Transformsys_setreuidSHA1Initusbd_ratecheckbwi_phy_init_11b_rev6wi_usb_open_pipesudav_tick_taskuvm_map_findspacepdc203xx_pci_intrwsevent_initcryptoopencomcnattachuserasymcryptodb_var_rw_intrt2560_set_bssidusbd_devinfo_freesdsizesys_pwritevudav_lock_miikqueue_scanieee80211_pmksa_findbwi_rf_off_11g_rev5uplcom_breakusbd_iface_claimedtcp_closeicmpsrcohci_free_stdsd_patternsX_db_search_symbolscsi_initmsdosfs_advlockswcr_idwdog_registerkue_attachif_indexlimpdcsata_chip_mapusbd_free_xferdb_varssys_utimensatfalloclxtphy_cdatu_joindeadproc_mutexdb_breakpoint_freeumsm_methodspfctlinputcomcnprobephys_mapumass_bbb_methodssoft_intrqdeflateSetDictionaryufs_lockcomintrboot_eaddr_validsys_accessem_read_mac_addrnsphy_statusuvm_swap_iouserconf_initbwi_phy_init_11art2560_ioctlkillpg1url_tx_list_inituhci_strwsmouse_mux_openi80321intc_attachvputonfreelistuhci_device_ctrl_transferwdioctlext2fs_mountrootobio_printpciide_mapregs_compatumodem_methodsieee80211_findrateregyearem_update_stats_countersurl_ioctlpage0setrunnablepool_do_putuvm_pmr_getpageswi_set_ssidcue_ioctlnd6_prefix_onlinkugen_seltrue_filtopsffs_specvopsumct_intrcue_attachelf32_read_fromosversionticks_per_intrem_free_receive_structuresatu_get_mibhid_is_collectionwi_usb_tx_list_initfind_pfxlist_reachable_routerip6_pcboptstvtohzieee80211_get_eapol_keyphtree_RB_NFINDratecheckin_rtchangevfs_syncwaitrt2860_tbtt_intrudav_ifmedia_statusaue_crcffs1_reallocblksieee80211_node_lateattachcansignalhotplugpollem_link_stall_workaround_hvrt2860_suspendmsdosfs_check_exportbwi_fwimage_is_validieee80211_up_to_aclf_setlocknbigpipecue_devsin_controlieee80211_get_addba_respbwi_regwin_inforlphy_funcswsmux_srcopslmaxuvm_pagecopyphtree_RB_NEXTsysctl_quadsys_readexec_process_vmcmdskue_tx_list_initrt2560_update_promisccmd_chip_mapieee80211_tree_RB_FINDohci_freemi80321_bs_tag_templateucomioctlm_cldropmbstatuhci_remove_ls_ctrldcphy_statusuhidev_intrttyinfodb_flush_lexttyinohci_root_ctrl_donegetnulldevdb_dmesg_cmdpciide_dma_initsr_meta_save_callbackextent_destroydb_lpenc_xform_rijndael128if_group_egress_buildloop_clonerttsetwatergetcieee80211_addba_requestrt2860_gp_intrsr_raid6_intrifaddr_items_RB_INSERTdb_last_addrural_update_slotuvm_pseg_lcksr_ioctl_volem_clear_hw_cntrscom_obio_matchpmap_enter_pvmsgbufenabledunp_disconnectsys_listensys_mounthotplug_put_eventehci_root_ctrl_donepgsignalehci_waitintrbpf_mtap_etherfirstcdb_read_bytesuhub_detachrt2560_media_changeieee80211_ccmp_delete_keysr_failioffs_fsyncwsmux_mux_openfintek_attachinetdomainehci_abort_xfermemcpywdc_enable_intrkthread_exitaxe_activatescsi_req_detachbwi_nrssi_writecue_newbufdisk_constructvfs_unbusyip_nhopsrip_usrrequhci_setup_isocspec_writesiop_wdtr_msgpciide_unmapregs_nativecom_obio_cdipsec_esp_network_default_levelkq_timeoutmaxin_broadcastfd_getfilesr_sensors_deletehidkbd_set_ledsmsgbufaddrucomclosesdioctlutsnameip6_setmoptionsexit2aue_resetkue_open_pipesacer_setup_channelip6_mloopbackext2fs_cgupdateuhci_add_hs_ctrlrt2860_ampdu_rx_startsiop_scsifreeieee80211_send_4way_msg2tcp_update_rcvspacerddumpem_enable_intrcpu_setperfufs_lookupsiop_pci_resetugen_attachufs_bmapdoasyncfreeudav_miibus_readregip6_randomflowlabelttpolldegetlogpollkthread_createbwi_mac_set_promiscugen_set_configdb_elf_sym_initwdc_default_read_raw_multi_2current_ipl_levellogclosesd_vpd_block_limitsieee80211_kdfgeneric_bs_wr_4install_coproc_handlernd6_dad_findohci_rhscudav_detachufs_strategysr_crypto_create_key_disksr_put_blockohci_device_requestkue_watchdogphysical_freeendcopy_statfs_infobounds_check_with_labelarc4_timeoutsr_raid1_assembleumct_opensd_ioctl_cachepci_subclass_networkext2fs_checkpathns_scx200_chip_mapsocantrcvmorepci_vpd_writeuipaq_rtsprocess_poolrt2560_update_ledip6_setpktoptfile_filtopssr_raid6_rwbuf_unmapmsdosfs_renamesysctl_proc_argssiop_adapterdes1_zerokeypipe_wfiltops__lshldi3purge_detachedpfxrtr_addcd_load_unloadipq_poolpmap_activatebuf_dealloc_membmtphy_resetconfig_make_softcunp_discardcue_csr_write_1ip6_outputwi_read_record_iouhid_caudav_rxeofrt2661_bbp_readswap_syscall_lockufs_kqfilterieee80211_newstateem_is_valid_ether_addrums_enablescsi_autoconfcheckdirsexecswsr_raid0_creatert2560_set_txantennaumass_atapi_attachin6_are_prefix_equalin6_controluvm_pmr_rootupdateleapyearsleep_finish_timeoutsys_sigsuspendcd9660_unmountpciide_dma_startehci_device_bulk_abortswcr_authcomputenamecache_rb_cache_RB_NFINDtrapsignalmainbus_bs_allocrushjobpmap_devmap_registerrn_inithead0db_single_step_cmdwd_flushcachend_defrouterblf_decfdcloseexecevcount_attachlimcopybio_doreadwi_do_hostencryptscsi_req_probetcp_timer_rexmturl_ifmedia_changei80321_gpio_pin_writeuftdi_attachsiop_pci_cart_timer_initnd6_useloopbacksr_crypto_rwieee80211_next_modeputsaxe_tx_list_initrip6statip6_id_ctxsr_raid6_free_resourcestcp_debxcnpollcd_casys_truncateesigcodeacphy_servicescsi_xfer_poolsysctl_wdogarmv4_tlb_flushIDudav_csr_readohci_add_donert2661_ack_rateem_read_phy_regieee80211_tree_RB_NEXTsched_choosecpu_forki80321_pci_initsrv_ipohci_add_edwdc_xfer_poolcdce_newbufsoacceptkqueue_pollcdgetdisklabeldb_call_depthdb_printfehci_device_isoc_doneuhidreadin6_ifaddloopufs_creatend6_freend6_optionscd9660_seekbwi_free_tx_ring64nd6_llinfo_settimersr_roam_chunksmsdosfs_unmountelf32_load_psectiondb_show_all_bufsuftdi_writern_mpath_nextnamecache_rb_cache_RB_MINMAXuhci_device_bulk_transferarm_pcache_unifieddb_add_symbol_tableuhci_remove_intruplcom_setm_tag_nextohci_intr1msdosfs_writebs_notimpl_bs_w_1cue_resetexec_script_makecmdsehci_rem_free_itd_chainiic_matchieee80211_reset_erpfilt_pipedetachcd9660_rootentropy_add_ptrdb_unaryrgephy_statusiophyattachdisk_attach_callbackselrecordffs_validatert2860_intrcomstopatu_wait_completionaxe_ax88772_initffs1_compat_readrip_outputext2fs_accessbwi_ofdm_plcp_headerrt2560_read_eeprommld6_fasttimeokthread_qimaxwsmouse_matchohci_free_seduserconf_pdevuvm_object_printitsr_detachinflate_fastiq80321_devmapmbpoolclock_secs_to_ymdhmsaes_xts_setkeytcp_canceltimerstqphymatchrip_recvspaceroute_initswap_prioritylink_rtrequestffs2_reallocblkswdc_get_xferuvm_vmspace_poolbwi_setup_rx_desc32stackgap_initpipe_createsysctl_vnodepdc202xx_setup_channeliodatand6_sysctlsyn_cache_putdoopenatpciide_amd_productspci_subclass_multimediavn_opensr_raid0_alloc_resourcesuhci_freexif_clone_createbufq_fifo_requeuesr_boot_assemblycdce_tx_list_initSHA384Finaluao_detachcpufunc_controlmallocamap_pp_adjrefauth_hash_hmac_sha2_384_192apollo_chip_mapin_pcbrtentryrt2560_get_macaddrknote_dequeuesr_discipline_inituhci_root_ctrl_startuhci_pci_activatewi_cmd_usb__udivsi3re_ifftcp_outflagskqueue_statcdce_ioctlcd9660_rrip_analyzeohci_hash_find_tdexphymatchbuf_fix_mappingbio_unregisterip6_v6onlysys_preadvdb_tok_stringuserretsys_recvmsgpipe_statHMAC_MD5_Finalvn_writesr_hotplug_unregistermtdphy_servicehidkbd_hookup_bellVOP_LINKubsa_devsicmp_inputumass_cdvcountvm_page_zero_enableieee80211_get_sa_queryuvm_vsunlock_devicerd_root_sizein6_delmultistathzenc_xform_cast5route_ctloutputwdog_ctl_cbbwi_nrssi_readsched_idleuftdi_get_statuswskbd_cnattachwdc_ata_bio_intrvirtual_enduhidev_get_reportsys_getloginifaddr_items_RB_NEXTbuckstring_inituhci_free_std_chainiq80321_pci_init2icmp6_rediracceptbwi_set_gainsdetruncdb_elf_symbol_valuescopyoutpfindbufq_peekcomconsaddrip_ctloutputuhidev_set_report_asyncwsevent_readenc_xform_arc4bwi_stopbrgphy_5704_a0_bugarp_ifinitdb_write_variableufs_dirbadcd9660_readdirvfs_unmountallsr_ioctlrgephy_loopsys_renameatohci_allocxcopyrightsdattachxscale_optionssched_peg_curprocwdc_default_lba48_write_regtcp_timer_keepusbd_devinfo_vptcp_mss_updateiopiic_cdphison_setup_channelpciide_lookup_productfree_pagesehci_root_ctrl_startdb_proc_print_cmdrt2560_initrw_enter_readdb_show_all_procsvunmapbufehci_device_ctrl_transferroute_outputrti_deletesys_geteuiddb_output_positionicmpmaskreplin6_pcblookup_listenmsdosfs_mknodip6_defmcasthlimsys_munmapsii3114_dmactl_writekp_nonefilt_solistenvsnprintfrt2860_node_leavearplookupuvm_map_pageableproftimer_trampolinechainallocuplcom_methodssw_reg_startpmap_copy_page_xscalesr_ioctl_deleteraidifmedia_baudratei80321_calibrate_delayem_82547_tx_fifo_resetusbd_setup_default_xferuvm_pagelookupsoshutdownuserconf_hist_cmduftdi_cduserconf_listproc_cansugidcd9660_rrip_getsymnamedb_command_tableip_mloopbackbwi_rf_get_tp_ctrl2bpf_iflistwdc_downgrade_modeieee80211_node_leaveip6intrqaxe_newbuftodr_handlend6_rs_inputscsi_activate_buspciide_mapreg_dmasoabortm_free_unlockedem_82547_move_tail_lockedem_get_bufcast_encryptunp_inobwi_default_led_acthidkbd_attach_wskbdlogkqfilterbpf_mtap_pflogni6_dnsmatchuvm_tree_RB_INSERTdb_extent_print_cmdip6_init2uprintfdb_clear_single_stepsensordev_installrandomiduvm_page_printitmainbus_cai80321_local_dma_initcoredump_elf32rt2560_intrsoftdep_flushworklistsys_issetugidinitclocksbwi_rf_attachcd9660_mmapif_detachaue_watchdogwsmuxopenwdc_ata_bio_startnd6_cache_lladdrifqmaxlencatqsession_poolunp_connectuvm_pagermapiniic_smbus_read_byteif_detached_startpool_serialxscale_cache_flushD_SEuplcom_activatescsi_probe_lunirq_entryaue_ioctlni6_inputvfs_mountedondb_expressionboard_powerdowncputypert_lookupfc_lookup__bss_start__if_downndqbVOP_GETATTRuhci_root_ctrl_methodsieee80211_fix_ratebwi_get_pwron_delaysiop_add_reselswwihap_deauth_requsbd_fill_di_taskieee80211_node2reqwi_usb_matchelf32_check_headerrt2661_bbp_initdb_historygf_logeephy_cdinphy_cdttytstamprt2860_mcu_bbp_readural_set_txantennaieee80211_node_allocieee80211_crypto_detachpmap_unwireipaddrip6_auto_linklocaluvm_pageunwirerti_fillHMAC_SHA256_Inithw_serialehci_device_intr_abortauth_hash_hmac_md5_96autoconf_attdetufs_chmoduvm_unmap_psr_raidp_discipline_initcdattachuserconf_devicesr_raidp_alloc_resourcesbwi_rf_off_11ain_localaddrsys_sigaltstacki80321_i2c_casii3114_dmatbl_writeDES_versionbrgphy_resetsoisdisconnectingauth_hash_key_sha1Blowfish_initstatesched_steal_procwi_media_changenull_decryptsyn_hash2rttimer_queue_headarm_pdcache_sizeexphy_capcidetachucom_dtrrtredirectuvm_map_printitdb_read_variablesoftintr_initieee80211_setkeysdonedb_regsdb_stack_dumpsr_raidp_rwuvm_pmr_pnaddrttymodemdb_lbuf_endehci_free_itdmtx_enteraxe_devskqueue_poolvntblinitbuf_rb_bufs_RB_INSERTcpuset_intersectionallcftablesem_lookup_gcubwi_rf_tssi2dbmuhub_activateAES_GMAC_Setkeysleep_queue_initpmap_preferin6_ifattach_linklocalVOP_REALLOCBLKSuhci_globalresetE_abs_tag0_Usedtcr1_get_timecountugenwritesys_setresgidsr_crypto_encryptuvm_pmr_freepagesieee80211_input_bamsdosfs_sync_vnodesplassert_failarm_picache_waystty_initaxe_ioctluvm_km_freesys_killrn_mpath_repriouserconf_numberperflevelcomconsiohpmap_set_pcb_pagedirinsw16em_watchdoguvm_pmr_addr_RB_NFINDrt_setmetricssys_getegiddb_set_single_stepuvm_objtree_RB_FINDsw_reg_iodone_internalhidms_detachem_check_mng_modeserverworks_setup_channelumass_init_insystemfrag6_deletefraghdrem_validate_eeprom_checksumdirchkifaddr_items_RB_FINDexphy_resetipip_outputpipecloseVOP_REMOVEpci_mapreg_typewi_usb_activateconsinituvm_pmr_isfreeurlphy_statusext2fs_dirremoveuvm_vnp_uncachesysctl__stringffs_clusteracctconfig_detachmtdphyattachifaof_ifpforaddrcryptop_poolsensordev_listsr_checksum_printhidms_ioctlsc_pld_shminidatacleanrt_timer_queue_destroysr_meta_probewi_cdsd_cduvm_pseg_geticmp_mtudiscipport_hifirstautoieee80211_tkip_delete_keysys_fstatem_read_eepromenc_xform_3desrgephyattachuserconf_enableext2fs_vinitdb_endlpuplcom_intrumass_bbb_resetffs_alloccgbuf_object_storecryptodevallowsoftobio_foundgeneric_bs_w_1sa6_anysys_getpriorityatu_radfirmpci_subclass_cryptosysctl_diskinitE_ldsa_abs_reselect_Useduvm_km_vallocieee80211_send_mgmtcue_getmacnatsemi_chip_mapbrgphy_bcm5421_dspcodescsi_xsh_delscsi_plug_probesys_unmountsr_meta_native_probeuvscom_dtruipaq_detachbootdvmainbus_bs_tagelf32_probesumct_detachin6ifa_ifpwithaddrvgonelpciide_jmicron_productssofreebwi_amrr_timeoutbwi_rf_lo_findnd6_dad_timerbwi_led_newstateinphyattachcpuset_unionbwi_init_tx_ring32uvscom_shutdowndb_del_symbol_tabledb_add_exprsiop_timeouteephy_matchpmap_removebpf_mtap_afrt2860_set_basicrateshidkbd_parse_descicmp6_fasttimouvm_pmr_addr_RB_INSERText2fs_removemtx_initif_clone_destroyehci_close_pipebwi_regwin_enablewdccommandmyipbpf_setfuserconf_historypciide_pci_cauvm_page_unbusyfilt_hotplugreadbwi_rf_lo_isusedtk_noutusbpalockext2fs_mountpmap_collectBlowfish_expand0stateuhci_check_intrukbd_enabledb_symformat_elfpciide_compat_intrgeneric_bs_rr_4cpu_sysctlcd9660_deftstamphotplugkqfilteri80321intc_smaskzlibCompileFlagsip_randomidbrgphy_eth_wirespeedaue_tx_list_initnettxintrieee80211_recv_disassocnosuidcoredumpukphyattachsr_startwu_callbackcddumpdb_search_cmdastusbd_claim_ifacetcp_disconnectuvmspace_execuhci_timeoutwi_usb_detachwsmux_createsys_mmapehci_bus_methodsbootnd6_is_addr_neighborblf_ecb_encryptunp_rightshostnamedb_print_llinfodisk_closepartcmd680_setup_channelpci_enumerate_busbrgphy_fiber_funcsem_disable_pciex_masterupl_outputi80321_intrext2fs_bmapuvmexpnextstateventenc_xform_blfbufq_doneehci_detachsensordev_getufs_diremptyreinsertfinishduprt2661_newassocsleep_setup_timeoutbrgphy_crc_bugukphy_serviceqsphy_resetdeflate_decompresspool_destroylogwakeupshutdownhook_listhidkbd_attachip_dosourcerouteieee80211_node_join_rsnsoread_filtopsgcu_miibus_readregieee80211_media2ratedmapoolsbdevsw_lookupdisk_changebwi_mac_resetuplcom_matchamap_lookupsdoreallocblkscache_revlookupamd756_setup_channelbpfread_filtopssoinitem_get_speed_and_duplexVOP_MKNODuvmnd6_ifdetachin6_ifaddrroute_protofilt_ugenread_isocsync_vopshw_uuidext2fs_truncatere_newbufcd_play_tracksscsi_do_mode_senseuvm_pmr_allocpmrvirttimer_trampolineip6_maxfragpacketsdb_errorehci_confdprefetch_abort_handleruvm_km_threadsr_checksumem_rxeofuhci_root_intr_methodsscsi_probe_buslminm_leadingspacesys_fpathconfwsmuxpollarpt_pruneohci_device_bulk_methodsem_copper_link_postconfigkp_zerosoconnect2knote_poolcnopensiop_scsiprobenatsemi_setup_channelscsi_test_unit_readyural_set_bssidricohrtc_reg_writenmbclustural_get_rfsominconndma_freert2661_mcu_wakeupuhci_device_clear_togglesoftraid_cduvm_vnp_syncpool_allocator_large_niieee80211_get_disassociopxs_cduvm_map_hint1wihap_assoc_reqarpt_downrdgetdisklabelarm_pdcache_line_sizebpf_tapdb_lookupuvm_pmr_addr_RB_NEXTrt2860_tx_intrnumnegpciactivatemii_phy_autouvm_pmr_addr_RB_FINDmax_datalenmsdosfs_initohci_device_ctrl_startwi_write_record_ioext2fs_writelf_clearlockbwi_rf_set_ant_modegeneric_armv4_bs_wr_2uvmpd_scan_inactivedb_lastsymsiop_resetbusurl_memip_srcrouteuhidioctlip6_accept_rtadvieee80211_recv_4way_msg4sr_raid6_alloc_resourcespte_l1_s_cache_masksys_setregidusbd_device2interface_handleurl_csr_read_1cpuset_infosusbd_dopollvinvalbufsys_ftruncateuhci_device_isoc_startbwi_rf_map_txpowerubsa_dtraes_ctr_cryptm_splituhci_remove_hs_ctrlsoftintr_disestablishentropylockumodem_ioctlurl_stoptcp_timer_initdb_tab_stop_widthdb_putncharssii3114_dmactl_readmainbus_bs_unmapscsi_sem_enternd6_maxnudhinttcp6_inputsosetoptkp_dirtyehci_set_qh_qtdtcp_mssifa_addcache_purgeudav_stop_taskbpf_mcopycomconsrateauth_hash_hmac_sha1_96fork1curpcbdb_activevfs_hang_addrlistpci_primary_vgacue_tickdead_writeufs_dirrewriteinsmntquettreadtk_canccdb_write_bytesrt2860_media_changeext2fs_blkfreeudp_outputfind_last_setrt2661_set_chansys_chmoducomreadprelist_removeuvm_objtree_RB_NFINDffs_vgetrt2661_tx_intraxe_encapinitprocip6_getpmtubcstats__umoddi3brgphy_fiber_statusarm_dcache_alignugenclosert2661_media_changeip6_log_intervalnull_encryptsched_idle_cpuswihap_auth_reqscsi_activate_lunuvm_page_physdumpuvm_atopgX_db_sym_initsyn_cache_timerieee80211_auth_opensolisten_filtopsatu_internal_firmwareprocess_kernel_argsin6_update_ifa__wdcerrorSHA384Updatecdce_detachrt2560_tx_intrehci_alloc_itdrt_msg2suser_ucredsd_shutdownmem_noext2fs_buf_allochicleanpagesbufbackpagesral_pci_matchatu_xfer_list_freeuhci_free_stdwihap_sta_deletepciaddr_resource_reservemainbus_bs_rm_2pmap_free_l2_bucketRMD160Update_intrevarprequestkernel_mapuhci_device_isoc_enterwi_init_iodumpdevwsmouseioctlcd9660_lockusbd_ref_incrieee80211_mgt_subtype_namegf_powbwi_led_eventugen_do_readdb_not_taken_bkptm_printpciide_unmapreg_dmauvm_pmr_splitvfs_mount_foreach_vnodekqueue_kqfiltertimeout_add_usecwi_mgmt_xmituhid_do_ioctlzeroin6_addrstrncasecmptimer_filtopsatu_tx_startuvm_objwirert2560_encryption_introhci_device_bulk_start__guardtcp_mss_advSHA512Update_intin_ifaddrnd6_optionwin2unixfnmax_hdrffs_readm_freephtree_RB_FINDbwi_mac_hostflags_initaes_key_wrapurlphy_attachieee80211_get_assoc_reqsr_meta_attachsr_meta_native_bootprobescsi_inqmatchfdesc_poolcmd_pci_intrpool_page_allocsr_switchin_pcblookupm_tag_delete_chainfilt_pipewritecd9660_polliicprobencbadaddr_read_4bzeroumass_scsi_probearmv4_drain_writebufswapdrum_addufs_closedefrouter_delreqfixjobcuvm_pmr_size_RB_REMOVEdb_show_all_cmdsehci_shutdownpci_subclass_daspscsi_devidin6_addmultirn_newpairbios__udivdi3sys_obreakblf_setkeyusbd_set_config_norgephy_cdieee80211_pmksa_addpciide_cdlastddateucom_do_ioctluvmfault_unlockallsr_meta_getdevnamem_inithdrpmap_curmaxkvaddruvm_pmemrange_addr_RB_NFINDin6mask0bpf_validateusbd_get_string_descvaccessuao_set_swslotmbinittcp_secret_ctxusbd_get_reportabortwskbd_default_bell_datascsi_readsafe_cmdieee80211_set_link_stateamap_allocVOP_LOCKbuf_rb_bufs_RB_INSERT_COLORMD5Finalwskbd_matchcp_timeaxe_rxeofcd9660_vget_internalrt2560_decryption_intrdb_page_print_cmdwi_intrrw_casvgetrd_attachkd_nowaitugenpollieee80211_create_ibssbrgphy_jumbo_settingswsmouseopenwinChksumbufq_requeueserverworks_chip_mapfreeclusterchainmld6_initswapmapscsi_get_linkmainbus_bs_w_4disk_initSHA256Updateohci_bus_methodsohci_hash_rem_itdatu_cdrip6_ctloutputdisk_readlabelpciide_pci_writeaue_sendusbd_getnewaddrnd6_na_outputext2fs_fhtovpsr_validate_stripsizeumass_cbi_transferext2fs_createieee80211_gtk_rekey_timeoutem_local_timerusbd_bulk_transfer_cbexec_aout_prep_oldomagicwi_sync_mediapipe_pollpool_reclaim_allnsphy_cabmtphyattachucomopensysctl_dopooluhub_matchpmtu_expiretcp_respondsys_readvcrypto_getreqamap_cow_nowroundrobinbadaddr_readuvm_map_createissignalwdprintsr_attachfilt_uhidrdetachin6_selectrouteieee80211_recv_rsn_group_msg1cdevvprt2560_bbp_writeuhci_intrbwi_mac_balance_atten_setsoftintrigmp_joingroupuiomoveohci_device_isoc_doneoutsw16wi_usb_wridrespmsdosfs_startlf_alloccpu_idle_leavedb_loop_countwi_intr_ackpciide_dma_table_setupfiq_releasebpf_reset_dem_hv_phy_workarounds_ich8lannd6_dad_stopuvm_tree_RB_PREVdiskmapioctlhid_start_parseuseloopbackinflateSyncPointuvm_waitnexecsbwi_init_rxdesc_ring32mclpoolsi80321_mem_bs_mapieee80211_regdomain2namepmap_referencesys_bindrt2661_watchdogloioctlrw_exit_writebs_notimpl_bs_wr_8ieee80211_eapol_key_micrt2560_free_tx_ringumct_initusb_abort_taskspmap_bootstrapbs_notimpl_bs_wr_2blf_cbc_encryptipsec_auth_default_levelsys_mqueryarm_picache_line_sizekmeminit_nkmempagesbwi_rxeofusbd_new_deviceuvm_pmr_size_RB_REMOVE_COLORmcllivelocksscsi_io_putscsi_iopool_inituvm_pmemrange_findfillinusemaprecvitbmtphy_funcsums_cdfilt_sowriteuvm_kernacccnpollcsys_linkucomsubmatchlog_opensr_rebuild_initfilt_randomdetachuvm_pmr_size_cmpfragtbl124userconf_totdevi80321_bs_tagrt2661_tx_cmdxscale_cache_flushIDrt_tablesrt_ifmsgrandomread_filtopsieee80211_plcp2rateumsm_setobio_bs_maprealitexpireipstatunix2dostimesr_raid6_recreate_wurt2860_delete_keydounlinkatscsibus_caubsa_attachiic_probe_eepromuvscom_openurl_newbufusbd_delay_msffs_dinode2_poolcrfreecnputcuhid_do_writepte_l2_s_prot_wip6_lasthdrohci_device_isoc_abortuhub_uhub_capci_count_vgaugen_matchtcp_reaperlastnowpool_sethiwatrt2661_tx_datasvwsata_mapreg_dmawi_read_record_usbuftdi_methodswdgetdefaultlabelmicrotimeuvm_pmr_addr_cmprt2560_tx_datapipeunlockuvm_pmemrange_addr_RB_MINMAXuvm_swap_getpciide_serverworks_productsext2fs_reloadrt3090_rf_initurlphy_matchcsefindelf32_copyargsisochariophymatchuvm_km_alloc1siop_cdcdopentcp_usrclosedaue_ifmedia_stsboard_resetphysmemuvn_flushurl_cduvmfault_relockinferiorbwi_rf_calc_rssi_bcm2050xscale_cache_purgeD_Eukbd_attachclusteralloccryptof_readsr_raid_syncuplcom_capci_dopmrt_if_remove_rtdeletewskbd_attachin_pcbbindxscale_cache_flushIumass_cbi_statemtdphy_caudp_notifyuhci_timeout_taskuhci_root_ctrl_closeendtsleeprt2661_resumewihap_check_txsigactssharedb_set_watchpointbpfattachuftdi_openif_detach_queuesitimerdecrieee80211_get_delbaether_outputpci_cdem_phy_setup_autonegpmap_bootstrap_pv_page_freeauth_hash_md5crypto_kdoneinflateGetHeaderbpfilter_lookupm_copym0bwi_led_onoffaxe_miibus_readregvm_physmemiso_shipdirrdwritebwi_txeof_status32ieee80211_node_join_htrnd_timeoutieee80211_parse_edca_paramspipe_ioctlfilt_timerexpireural_set_chanwskbd_enablepmap_devmap_find_vacd9660_mountrootbpf_allocbufsbwi_init_txstats32set_stackptrrt_gettablemsgbufmappedohci_device_setintrrt3090_set_chancomprobe1cdsizedb_symbol_valuesuhci_device_ctrl_startumass_lookupdb_evarsupl_activateiic_smbus_write_bytebwi_rf_get_latest_tssiwsmouse_mux_closewakeupgetnanotimeatu_devspciide_matchrt2860_rf_writei80321_mem_bs_mmaptcprexmtthreshkprintf_mutexrt_getifadb_malloc_print_cmdwi_get_fid_ioenosyslockmgrbwi_bus_attachrtlabel_name2idbwi_node_allochidkbd_is_consoleuvm_vnodeopsdb_bcstats_print_cmdvfsconfrt2860_free_tx_ringVOP_OPENcompwroffbuckstringuhci_device_bulk_startrt2860_enable_tsf_syncsiop_scsicmd_endusbd_fill_deviceinfoscsi_interpret_sensesqphy_cdugen_do_ioctlext2fs_flushfilesdes_ecb3_encryptieee80211_send_eapol_keycomconsattachedbrgphy_probelxtphyattachwi_usb_txeof_frmufs_readlinkrdopenin6_ifadddoscheckpathpcbmapatu_newstate_tr_stored_blocknd6_option_initbufq_quiescebrgphy_servicepiix_setup_channelext2fs_setsizeffs2_ballocin6_init_prefix_ltimesnchstatscd9660_fhtovpmsgbufpE_ldsa_abs_selected_Usediq80321_pci_intr_stringsys_setgidrt2860_set_keyuserconf_common_attrfilt_ufswritert6_flushehci_timeout_taskgeneric_bs_r_4E_ldsa_abs_slot_Usedmmrwffs_bufatoffieee80211_add_ds_paramsem_init_hwiq80321_pci_intr_disestablishwi_usb_rridrespdohooksgf_invem_pci_set_mwiieee80211_rssadapt_chooseehci_free_sqtd_chainem_disable_intrukbd_activatesiop_sdpaue_setmultiif_detached_ioctllocnamppsegswi_usb_casch_chip_mapuserconf_showbwi_next_scanip_mtudisc_timeout_qsr_scsi_cmdaddress_exception_entryffs_fhtovpgetvnodefilt_ufsvnodecrypto_get_driveridbwi_mac_updateslotpool_setlowatkmembaseswi_entryrip6_inituvm_aiobuf_poolisofncmpsysctl_emulseltrue_filtopssys_sigprocmaskdb_commandrt2661_select_bandin6_if_upfilt_pipereadenc_xform_aes_gmacsoreservepidtakendb_formatrt2560_reset_rx_ringuvm_mmapusb_activatescsi_report_lunsufs_quotactldosymlinkataroundin6_pcbnotifyifaddr_items_RB_REMOVEbrgphy_5708s_funcsusbd_clear_endpoint_toggleexplore_pendingstrrchrgetdevvpm_clgetpci_mem_finddefrouter_selectamap_unrefext2fs_statfsbpf_mtap_hdrcrdupamap_wiperangecuio_copybackisodirinodb_strlcpycfrootswsmousepollchrtoblkscsiprintsiop_get_lunswuserconf_pdevnamminphysukbd_matchurl_ticksys_fchownatrtalloc_noclonetimeout_mutexether_addmultiieee80211_recv_actioncdce_cdip6qffs_vptofhvfs_isbusyifunitirqstackbawritetputcharsvwsata_dmatbl_writewskbd_detachpmap_postinitcsedeletepool_print_pagelistffs_fragacctrt2661_rx_tuneffs1_ballocsys_fchowndcphy_attachuvisor_methodsums_activateinflateInit_SHA384Update_intdb_breakpoint_cmdvwaitforiomii_phy_tickcd_read_subchannelextendfilelortrequesticmp6_inputbuf_valistuserconf_addohci_device_intr_methodswi_func_iocreatedefilt_randomreaduvscom_closebwi_regwin_nameieee80211_michael_mic_failuresbreleasedb_history_sizein6_selectifmsdosfs_islockedmax_linkhdrem_dma_freeumass_attachcryptof_statudav_resetget_stackptrsysctl_rtablemsdosfs_reclaimbwi_set_chanbwi_rf_calc_rssi_bcm2060wdc_free_queuesqphy_serviceuserconf_hist_eocsys_readlinkati80321_intr_disestablishuvm_objtree_RB_REMOVEuvm_map_reference_amapext2fs_getattrrtlabel_id2namesbdroprecorduvisor_activateuvm_coredumpem_write_phy_regi80321_handlerwdsizenamecache_rb_cache_RB_REMOVEacphy_statusip6_sysctlsuserdiskconfural_tx_dataatu_get_card_configvn_syncer_add_to_worklistusbd_get_interface_descriptorgeneric_bs_rm_1tk_ninsysfilt_opspciide_mapchanclusterfreefilt_randomwritert2560_beacon_expireieee80211_alloc_node_helperrootdevehci_device_isoc_startm_tag_firstem_82547_move_tailcdmatchpmap_map_entryusbd_get_config_descriptorpfxrtr_delpciide_machdep_compat_intr_establishdumpsysicmptstampreplif_detached_watchdogsys_nnpfspioctlusbd_ar_pipecy693_setup_channelrip6_sysctlext2fs_fsyncdoforceuhci_root_intr_startsys_fsyncwi_usb_stopuserconf_add_readsr_crypto_writere_pci_probeusbd_reset_portrt2661_set_macaddruvm_mapent_copyifconfsiop_led_onpciide_pci_intramap_wipeoutuser_configcast_setkeytcp_outputnsphyattach_bus_dmamem_mmapi80321_attachupdate_ledsext2fs_updatetcp_timer_2mslaue_openpipesi80321_gpio_initffs_reload_vnodebuf_putmsdosfs_setattrVOP_RMDIRwdog_tickledb_delete_breakpointsr_ioctl_installbootif_addgroupciphy_cdieee80211_setmodeuhid_matchieee80211_add_ibss_paramspool_allocator_freefilt_proceopnotsuppumodem_parambwi_pci_resumeem_rxfillffs_reallocblksphtree_RB_INSERT_COLORrandomcloserootvpaxe_miibus_writereguvm_pmemrange_addr_RB_NEXTugen_do_writeieee80211_eapol_key_decryptsr_raid1_free_resourcesuserconf_maxlocnamespool_reclaiminitdisklabelpci_subclass_serialbususb_quirksbpf_sysctlvflushehci_openieee80211_bip_encapcddetachpmap_clear_modifytcpctl_varsarptimerbufq_dequeuetcp_reass_limitruaddrdstrategym_copymsystemsbcopy_pageip6_freepcboptsdb_free_breakpointsif_upcoredump_notes_elf32piixsata_chip_mapumsm_catimeout_add_nsecehci_intr1rt2860_enable_mrruvmfault_lookupm_extfreergephy_resetupl_intrucomprintural_matchdeflateBoundVOP_BWRITEbufq_fifo_peekrt_timer_queue_createm_cluncountwddonemsdosfs_ioctlpciide_dmatbl_writeupl_matchrt2560_stopno_constraintsys_opensr_crypto_change_maskkeywdc_alloc_queuergephy_funcsscsi_sem_leaveinet6domainural_enable_tsf_sync_bus_dmamem_alloc_rangeether_crc32_be_updatepgdeletert2560_next_scanuvm_pageidlezerobwi_enable_intrswskbd_do_ioctl_scdead_vopsdb_symtabsi80321_irq_handlerieee80211_media_changeucom_detachraw_attachural_set_rxantennahidkbd_cngetcscsi_ioc_cmddb_boot_sync_cmdastpendingifnewlladdruhci_noopphison_chip_mapether_ip6multicast_maxpipe_pooluao_initifa_ifwithroutem_clinitifpspec_kqfiltertcp_notifyieee80211_match_bsscd9660_tstamp_conv7ural_free_tx_listffs_dinode1_poolieee80211_set_keyieee80211_bip_delete_keyem_smartspeeddb_print_positionrtflushclonedb_radixgetblksr_raid_turem_tbi_adjust_statsxscale_cache_flushD_rngmaxsmapwdc_ata_bioip6_mcast_pmtusoconnectrt2860_txural_initvtypesdata_abort_handler_address__lshrdi3rtrequest1usbd_errstrSHA256Update_intsr_scsi_ioctltcp_identtcp_rst_ppslimuhci_openbwi_pci_activateem_realignifinitsd_cmd_rw10cd_load_tocunpst_recvspaceget_ifidscsi_io_getkue_initxscale_cache_purgeIDraw_inputcd9660_reclaimrt2860_stopkue_ioctlfilt_logrdetachtimeout_add_btnd6_ifattachunpdg_recvspaceoutswm8dofaccessatpipe_closeeephy_activatecd9660_inactivesoftdep_mountmsdosfs_rmdirdb_is_activemsdosfs_fsyncre_setup_sim_imcfdatadeflateInit_ffswi_usb_tx_lockusbd_do_request_async_cbufs_checkpathem_init_eeprom_paramspmap_pte_init_xscalepfxlist_onlink_checkdiskmapreaddb_elf_lookupm_tag_findinittodradler32blf_encvputpte_l1_s_cache_mode_ptvector_page_setprottcbhashsizeworkq_syswqcd9660_setattrfilt_hotplugrdetachbwi_rf_set_nrssi_thr_11busbd_get_configieee80211_node_leave_rsnufs_quota_initkqread_filtopscoredump_writebrgphy_bcm54k2_dspcodeusbd_setup_pipexscale_setttbxscale_cache_cleanIDem_read_part_numaue_csr_read_1buf_acquireieee80211_beacon_allocatu_attachubsa_get_statusdolinkatbioopscpu_classesieee80211_add_htopbpf_setdlttcp_flush_queuepool_setiplmsdosfs_statfslboltpipe_inituvm_wait_plarn_mpath_priousbd_open_pipe_intraes_gcm_reinitsyncerprocrt2560_set_macaddrifa_print_rbufs_ihashinszcfreein_setpeeraddrinphymatchatu_taskwindow_inflatedb_readlinert2661_enable_tsf_syncether_ifdetachsr_meta_native_readieee80211_recv_probe_requhidev_get_report_descuserconf_histcurrndstatscy82c693_writemsdosfs_inactivepciaddr_do_resource_reserve_disabledcurrent_intr_depthpanicstrbwi_set_clock_delaypdc20265_pci_intrupl_newbufumass_scsi_cbscsi_delayext2fs_sync_vnodeif_startunpdg_sendspacesession0bwi_power_offviscpywsmouse_do_ioctlE_abs_lunsw_return_Usedehci_abort_isoc_xferhw_ver__umodsi3copyincomparamsiop_common_resetural_stopudav_sendcd9660_defattrohci_device_bulk_closeehci_reverse_bitsrtalloc1bs_notimpl_bs_sm_8uao_swhash_elt_poolufs_ihashgetswcr_combineddes_set_odd_paritysigacts0findblkmajorntohlsorflushugen_caiophy_funcsbwi_phy_config_11gttioctlarpintrqvprintfslpqueohci_root_ctrl_methodsttycharssyncdelayuvm_vslock_devicewi_usb_infofrmugenreaduvm_pagealloc_multihidkbd_enableffs_mountral_pci_resumewsmux_mux_closeicmp6errppslimbadaddr_read_2msdosfs_vopsusb_desc_iter_inituhci_add_intrconfig_process_deferred_childrenohci_ifcdieee80211_add_htcapsxscale_cache_purgeID_Eluphymatchbs_notimpl_bs_sm_2in6_setmaxmtuem_camsdosfs_roottqphyattachusbd_finishbpf_getdltlistrt2860_startm_tag_getsb_lockem_enable_tx_pkt_filteringohci_root_intr_abortuhci_pollrt_labelscrypto_unregisterHMAC_SHA1_Finalupl_watchdogsuid_clearttwritedma_alloc_initatu_initem_activatebuf_rb_bufs_RB_NFINDbuflowpagesehci_activatert2661_set_basicratesswapdev_vpre_miibus_writereguipaq_methodsaes_xts_cryptieee80211_deliver_datadead_readufs_pathconffile_pooldb_boot_reboot_cmdohci_timeoutbwi_setup_tx_desc32unputcbwi_rf_lo_measure_11gendluphyattachVOP_CREATEcpuset_firstSHA512Updatecdce_stopifai_cmpuvm_map_referencebwi_rf_set_nrssi_thr_11guvscom_get_statusnd6_recalc_reachtm_intervalpagetables_startin_ifinitohci_device_ctrl_closepciide_mapregs_nativein_pcbhashlookupsys_mknodatem_setup_transmit_structureskp_dmare_eeprom_putbytemainbus_bs_mmapural_writeucom_cleanupVOP_ABORTOPehci_pcdcoredump_tradsr_raidp_free_resourcesbwi_power_onem_identify_hardwaredofchownatuhci_idoneuvscom_set_line_codingdefault_chip_mapsys_acceptuvm_map_entry_kmem_poolbackoffpagesuvm_pagerealloc_multiieee80211_wep_decryptbwi_rf_calibvalwi_inquireehci_pci_takecontrolleradm1032cloneprobetcp_rst_ppslim_countieee80211_recv_assoc_respieee80211_parse_rsn_bodyukbd_detachaes_key_wrap_set_keyif_clone_listtc_windupsys_futimesrt2661_update_promiscsdgetdisklabelbwi_intrwi_do_hostdecryptsiop_table_syncinternal_commandpci_subclass_wirelessmalloc_errintvlbwi_phy_init_11b_rev5ciphyattachin_losingsis_chip_mapVOP_SYMLINKgeteblkrt2661_suspendrt2661_detachusbd_set_interfaceem_force_mac_fcscsibusmatchinflateBackInit_crypto_kregistervn_ioctluhci_remove_bulkwi_usb_ctl_lockufsspec_readdb_show_calloutrt2661_set_txpreambleaxe_cdpipespacefiqvectorget_last_resort_ifidohci_alloc_stdcmd646_9_irqackip6_sendredirectsbwi_initcast_decryptddb_sysctlsr_get_blockbwi_startukphy_caitimerfixip_stripoptionsieee80211_node_join_11gbwi_init_statechgaxe_setmultisyn_cache_countieee80211_add_xratesnd6_timer_chuvm_pseg_releasecpu_resetudav_ticktcp_ctlinputether_multiaddrstart_cleanerffs_blkfreeexit1sys_thrwakeupohci_detachbwi_mac_adjust_tpctlwsmouse_add_muxbdevvpifa_ifwithdstaddrehci_cdi80321_bs_mapdb_watchpoint_allocudav_ifmedia_changeselectroutein6_nigroupscsi_mode_sense_big_pageauth_hash_sha1sys_mkfifoatuihashrijndaelEncryptscsi_ioh_deltcp_keepintvlsr_raidp_createuvisor_detachcdwriteufswrite_filtopsttybgconfig_searchphtree_RB_PREVwihap_sta_findusbd_printuvm_km_valloc_prefer_waitsyn_cache_poolpci_subclass_mass_storageffs_allocwrite_multi_1aue_tick_taskcpufunc_faultaddressdb_preveephy_funcsinphy_funcsucom_hwiflowbswap32rgephymatchipsec_exp_first_userlphy_serviceplimit_poolip6_defhlimumass_setup_ctrl_transferunp_connect2usbd_set_pollingrn_walktreepool_prime_pagepciide_ite_productssys_chownuvm_pagewirebwi_calibrateem_stoppci_vga_pciin6_joingroupsys_munlockhotplugattachinflateBackuvm_anfreeuhci_bus_methodsdofilereadvipip_sysctlbs_notimpl_bs_sr_1vn_statfilerw_exit_readieee80211_iterate_nodeswi_intr_enabletablefullumct_set_line_stateuhub_exploresr_meta_chunks_createupl_txeoftcp_maxidlevfs_getcwd_commonset_cpufuncscttyioctlsys_lstatieee80211_recv_wpa_group_msg1ieee80211_recv_addba_respohci_timeout_taskohci_hash_add_tdieee80211_tkip_set_keyiso_uiodirurl_activatecttyopenpmap_link_l2ptinet6ctlerrmapbwi_bbp_power_onicmp6_redirect_diagdisknamessched_queued_cpusumass_quirksdumploRMD160Updatemsdosfs_mountacphy_funcsffs_clusterallocbwi_calc_rssiuvscom_activatenullcnpollcuvm_km_inituvm_objinitbwi_hostflags_readpciide_acard_productsbzero_pageffs_sbupdateudp_sysctlsys_openatm_clcountbs_notimpl_bs_wm_1vmmapbsyusb_add_taskurl_int_miibus_readreguserconf_histlendb_list_breakpointsusbd_set_protocolrt2860_alloc_tx_ringrt2860_updateedcankmempages_minukbd_accessopsusbclosesis96x_setup_channeludav_matchvector_pagekq_ntimeoutssys_sched_yieldvmspace0bwi_phy_clear_statescsi_decode_sensettywaitwsmousedevprintuvm_map_setuptcp_syn_cache_sizewdc_default_vtblieee80211_add_tieem_defer_attachetextifa_ifwithnetmemchrohci_device_ctrl_doneqsphy_statussqphyattachpte_l2_s_cache_maskcomp_algo_lzsieee80211_recv_barsysctl_cptime2scsi_mode_sense_pageboot_argspipelocksr_raidp_addioumass_scsi_setupproc_pooluplcom_dtraue_intrmainbus_bs_wm_1udp6_inputsys_writert2661_next_scandb_get_valueural_set_txpreamblegeneric_armv4_bs_rr_2sb_maxusbd_fill_iface_datacd_set_pa_immedemul_flags_translatesr_uuid_print__bss_end__ip6_insertfraghdrcnstopextent_print_allihashtblieee80211_set_shortslottimesys_dup2em_phy_resetdb_inst_countdb_read_linesiop_productswd_get_paramsbread_clustersys_readlinkbwi_rf_writert2560_setup_tx_descext2fs_size__ashrdi3cpufunc_faultstatusbs_notimpl_bs_mmapzErrorohci_intrxscale_cache_flushI_SEcrc32ip6_auto_flowlabelsvwsata_mapchanuipaq_cafintek_worklistdevid_copylf_splitifafreeVOP_STRATEGYtimeout_add_sectzucom_rtsxscale_cache_syncIrip_sendspacecoredump_writenote_elf32xscale_cache_cleanID_rnguhidev_writeusb_generic_tasksamap_addtcp_freeqif_setgroupattribsuhci_device_requestcom_attach_subrsii3114_dmacmd_readdvd_authrt2560_node_allocexphy_servicesiop_maumass_scsi_cmdcdreadbufq_disksort_requeuesr_check_io_collisionrt2661_get_rfrt2560_enable_tsf_syncspec_inactiveehci_device_intr_starthidms_setupwi_func_usbwsmux_do_ioctlsys_sendtoicmperrppslimgeneric_filtopsknote_dropuftdi_setcue_watchdogin6_selectsrcrd_casoftclock_siem_82547_fifo_workaroundwi_usb_threadsr_ccb_putin6_pcbsetportalldevsbwi_vendor_led_actrt2661_iter_funcwddumpicmp_do_errorvmcmd_map_readvnrandom_startcomconsfrequsbd_get_interface_altindexamap_extendsigpropvmapbufumass_scsi_switchi80321intc_intr_initdehashtblsocketopssiop_pci_matchscsibus_bioctlbuf_acquire_unmappedX_db_sym_numargsnd6_maxndoptuvm_map_clip_startffs_fragextendtcp_always_keepaliverawcbtablespec_readfiq_nullhandler_endumodem_cdunp_markacphyattachdes_key_schedicmp_mtudisc_timeoutnwsmuxpmap_zero_page_xscalettyread_filtopsiic_printusbd_bulk_transfergetinoquotabrgphy_5708s_statusscsi_do_ioctlrtable_existsdisk_lock_nointrehci_free_sqhcd_resetX_db_foralluhci_pci_cascsi_ioh_addbwi_mac_reset_hwkeysscsi_detach_busudpstatroute_inputsetrootcd_read_tocural_amrr_updatecdioctlieee80211_defrag_timeoutbufq_switchcue_stopuvscom_detachifmedia_addatu_usb_requestlxtphy_funcssr_matchusbd_set_config_indexlogopenluphy_serviceieee80211_add_rsn_bodyrt2560_txtimert2661_rxratecd_buf_donebreadntcp_hdrszscsi_devid_pg83tcbtableieee80211_recv_4way_msg2i80321_mem_bs_init__xordi3frag6_drainuvm_objtree_RB_REMOVE_COLORdosdiremptyigmp_slowtimoifpromiscre_disable_sim_imip6_setpktoptsfork_returnsys_getsocknamecd9660_lookupricohrtc_cawi_usb_intrusbd_alloc_bufferinflatePrimemask_rnheadsw_reg_iodonepte_l2_s_protoufs_roottcp_sysctlVOP_SETATTRpmap_kremovesigactsinitohci_pci_caffs2_blkprefdomknodatusbd_set_reportcpu_kcore_hdrexec_elf32_fixuprt_newaddrmsgvop_generic_lockcomconsiotuvmfault_anongetconsttybwi_detachural_bbp_readsr_ioctl_diskusermountext2fs_dirrewrite__ucmpdi2vn_closefilepci_findvendorumass_discoip_mtudiscvfs_free_netcredem_power_up_serdes_link_82575mld6_start_listeningcpu_mainbus_cakue_matchpmap_kenter_papidhashtblaue_matchusbd_get_protocol_nrssi_thresholdpmap_l2dtable_ctorm_pullupenterpgrpxscale_tlb_flushID_SEnull_zerokeycrypto_freesessioncnbellm_copydatainswm8getdirentries_internalatu_stopcd_setchanieee80211_get_probe_reqmtx_leavefilt_signalsigactsfreert2560_free_rx_ringwdc_default_write_raw_multi_4ttymallocupl_attachums_intricmp6_notify_errorieee80211_recv_probe_respbs_notimpl_bs_sm_4pcisubmatchkue_setmultimmioctluvm_coredump_walkmapdb_nextumass_matchsched_choosesendsigohci_device_ctrl_methodsbpf_ifnameehci_allocmohci_cdural_ioctlvfs_busytimecounterfilt_ufsdetachbufq_initlf_getlocksr_raid6_xorpsolistenpdc205xx_drv_probewskbd_compose_valuespec_getattrpciide_dmactl_readobio_bs_unmapiic_scanip_ecn_ingressmsdosfs_bmaprip_ctloutputffs_vtblif_getgroupieee80211_parse_rsnpool_debuguserconf_morekqueue_ioctlmax_processesem_free_pci_resourcessys_wait4rip6_recvspaceamap_share_protectieee80211_bar_tidfs_sysctlukbd_cnattachieee80211_ibss_mergeboot_filefilt_sordetachpsignalieee80211_regdomain_compare_cnconfig_pending_incrusb_task_threadfrag6_deqbwi_mac_unlockamap_pp_establishauth_hash_gmac_aes_192ieee80211_setkeysuvm_pmr_nextszatu_activateuvm_anon_initffs_reclaimbmtphy_causb_free_deviceusb_exploreifaddr_items_RB_REMOVE_COLORxscale_cpufuncsif_link_state_changepmap_virtual_spaceieee80211_add_wpaieee80211_eapol_key_check_micpage0_endusb_disconnect_portieee80211_add_capinfobpfpolluvm_pmr_nfindszupdatepriohci_activateciphy_fixupbwi_mac_lockbmtphy_servicesched_kthreads_createuhci_device_bulk_closeuhid_cdwskbd_cnbellbintimesr_crypto_intrbwi_set_clock_modere_woluhci_intr1jmicron_chip_mappciide_print_channelsoutswwi_seekfilt_soreadpmap_remove_allrtable_addrt2860_mcu_bbp_writezeropageipsec_def_encbrgphy_bcm5401_dspcodeffs_nodealloccgbwi_mac_calibrate_txpowersoftintr_establishuvm_pmr_removeip4_input6pdevinit__iordi3uvm_pmr_findnextsegmentinetctlerrmapresetpriorityrt2560_set_slottimeenoioctlrt2860_watchdogwi_usb_start_threadbwi_dma_txstats_allocsigacts_poolpcaled_matchexecsigsconfig_initcpufunc_null_fixupip_weadvertiseskip_fcicmp6_redirect_inputbuf_rb_bufs_RB_REMOVE_COLORrw_enteraue_read_macpciaddr_print_deviduvm_pmr_size_RB_MINMAXdb_access_abt_spnd6_ra_inputffs1_blkprefin6addr_loopbackuvm_objtree_RB_MINMAXttypenduvm_swap_freepagesqsphymatchnd6_dad_starttimerin_revarpinputstrlcpyX_db_symbol_valuesiopiic_attachehci_device_isoc_methodsumodem_setusbd_reload_device_descext2fs_advlockknote_fdcloseusbd_get_devcntehci_device_intr_doneem_get_pcs_speed_and_duplex_82575if_clone_detachpipe_rfiltopssiop_dmamem_allocubsa_openin6_cksumcomcninitpciide_print_modesstrncmpcsrc_ptedes1_decryptvfs_shutdowngetsockieee80211_get_deauthbwi_newassocbs_notimpl_bs_c_4upl_startsyn_cache_respondif_creategroupllinfo_nd6sbcheckreservepreemptuvm_iobioattachieee80211_begin_scanunixdomaindb_next_free_breakpointbwi_led_attachbwi_tbl_write_2uvm_tree_RB_REMOVEsmdscsibusattachumct_rtssyn_hash1ulminwihap_data_inputi80321intc_do_pendingdb_last_symtabproc0paddrrn_addmaskifaddr_itemspciaddr_do_resource_reserveusb_attachbpf_bufsizeselscanpciide_promise_productssoo_pollumodem_activatertafidx_maxsig_filtopsknote_processexitohci_device_bulk_transferukbd_cdricohrtc_getcalwskbdopenrt2860_reset_rx_ringrt2661_eeprom_readem_startttclosurl_rxeofipsec_soft_allocationssleep_setup_bus_dmamem_mapip6_fragmentnet_sysctlcom_cdbwi_mac_init_tpctl_11bgxscale_cache_cleanD_Ewskbd_do_ioctluvm_pmr_size_RB_FINDudv_listdead_ioctlaue_initusb_matchbwi_txeof__wdccommand_startsysctl_iflistsys_thrsleepvwakeupcmd680_channel_mappci_subclass_bridgeif_clonersrt2860_set_txpreamblewdcbit_bucketvgonewdc_probe_capspmap_initializedtcp6_ctlinputsched_init_runqueuesdb_stack_trace_cmdusb_allocmemsd_sizeufsspec_closend6_prefix_offlinkuvm_anon_dropswapwi_detachucom_lockigmp_inputkmemusageswcr_sesnumlf_getblockpciide_irqackautoconf_attdet_mtxumodem_attachtcp_rttdfltcleanerprocpdc202xx_pci_intrieee80211_parse_edca_params_bodysbappendstreamm_tag_copy_chainrt2661_bbp_writeohci_handoverusbd_intr_transfer_cbsowrite_filtopssr_chunks_unwindstrncpycseaddrevarp_in_progressdb_disasmsdreadupdatefatscue_memata_perrorvfs_getvfsaue_txeofffs_sync_vnodedeflateInit2_sr_raid6_discipline_initproc_stopvfs_vnode_printdb_history_lastrrticks_initusbd_set_port_featureusb_run_tasksbpfilter_createsysctl_locklockfpoolwihap_disassoc_reqieee80211_find_nodecpu_switchtoucom_cahtonlsched_all_cpususb_find_descin6_mask2lentcp_dooptionsdos2unixtimesys_sigactionsr_scsi_donedeupdatehci_ifcdSHA256Transformrndlock__negdi2in6_purgeaddrcpu_modeluhci_softintrsii3114_read_regarm_dcache_align_maskuvm_tree_RB_FINDcttyreadcd9660_unlockpciide_dmactl_writeuserconf_cmdsural_taskbwi_set_bssidiophy_statusschedclockbpfioctlconfig_attachsr_sensors_createohci_alloc_sitdcue_rx_list_initbwi_hostflags_writert2661_attachhookbmtphy_statusdisk_unbusysysctl_fileusb_syncmemugen_detachi80321_io_bs_freesoisconnectedurlphydebugamap_clean_worksuhci_alloc_std_chainusb_block_freememVOP_PATHCONFumass_fixup_sonydk_mountrootassertwaitokdb_run_modescsi_minphysauth_hash_key_md5siop_script_syncxscale_cpwaitvattr_nullsys_getsockoptrt2661_tx_mgtre_rxeofumct_paramuhidev_attachfrag6_nfragpacketsdb_linesr_raid0_assemblebwi_cdpool_allocator_largein6_restoremkludgeuvm_anon_lockloanpgvfs_sysctlcpu_get_controlite_chip_mapVOP_READLINKbuf_mem_initumass_cbi_methodsdb_ed_stylemii_submatchuvmexp_printohci_root_intr_transfermsdosfs_pathconftimeout_wheelbwi_pci_conf_readbpf_m_xhalfumass_io_getaverunnablecd9660_getattrttyfreettysleepehci_root_intr_donert2860_rx_intratu_get_opmodeunp_disposescsi_inquireufs_getattrBlowfish_encipherieee80211_mhz2ieeevfs_exportuplcom_closesr_hotspareuvm_km_pgremoveex_region_plfscaleffs_alloccgblkip_optcopyvfs_registerieee80211_proto_attachm_livelocksys_dupmcllowatmii_printieee80211_setup_ratesbpfilterattachproc_stop_topci_find_devicetimeout_todoswcr_initdb_lcbwi_updateslotcpu_read_cache_configumsm_truinstall_changemodeumsm_detachwdc_sii3114_vtblsr_ioctl_createraidpanicget_pc_str_offsetL_cksumdataciphy_resetural_rxeofcue_rxeofmsdosfs_lockseltruepci_subclass_systembpf_m_xwordscsi_xs_syncieee80211_recv_group_msg2softdep_initializestackgap_allocunp_shutdownieee80211_tkip_encryptwi_resetdovutimensdummy_get_timecountext2fs_sysctlgeneric_bs_wm_4kthread_run_deferred_queuearc4_initsr_raid1_recreate_wuwdreadlastdaycheck_execdb_max_linewi_usb_cdtcp_initpte_l2_s_cache_mode_ptdeferred_config_queueciphy_funcsucomreadcbbuf_rb_bufs_RB_MINMAXnetisr_initipport_lastautouhci_endpdsis_setup_channelwsmux_detach_sccom_raisedtrdb_last_commandicsphy_statusip6_pcboptwinSlotCntvn_kqfilterfiq_getregsext2fs_syncsched_stoleni80321_io_bs_unmappte_l2_s_prot_maskpciide_intr_flagudav_ioctlcrypto_registercache_purgevfspostsigsys_pathconfcue_open_pipesin_addmultigetmicrotimebs_notimpl_bs_rm_8maxumass_clear_endpoint_stallohci_setup_isocaue_newbufscsi_probedevaxe_ax88178_initi80321_i2c_attachtcp_templatemsdosfs_readdb_object_print_cmdieee80211_notify_dtimrt2860_select_chan_groupfintek_write_regsr_crypto_finish_ioohci_initcomopensata_setup_channelusbd_setup_xferauth_hash_hmac_sha2_512_256ieee80211_tree_RB_MINMAXpiix_chip_mapbcopyiic_attachwsmouseclosewdog_autourl_tick_taskcue_detachusbioctl_bus_dma_inrangekqueue_wakeupip6_unknown_opttcp_reasssys_getfhext2fs_vgetrt_timer_timerrtbl_id_maxcomcnputcKERNEL_BASE_physSHA1Update_intehci_alloc_sqtdcuio_applygeneric_bs_rr_1ni6_addrsaxe_resetdefrouter_addreqin6_clearscopebwi_pci_cand6_dad_ns_inputuvmpd_tuneusbd_set_addressudav_openpipesffs_setblockipsec_expire_acquirepci_suspendkue_stopicmp6_mtudisc_cloneatu_send_commandinflateResetmemcmpwskbd_init_keymapobio_bs_subregionnamecache_rb_cache_RB_REMOVE_COLORumct_dtrip6_dad_pendingieee80211_rate2plcpmsdosfs_createcd9660_startdb_output_linebwi_get_card_flagsbwi_rf_get_gainscomstartaes_xts_reinitdb_examinecfroots_sizedb_end_linebwi_mac_gpio_finitickadjpool_alloc_item_headeriq80321_irq_mapip6_splithdrsiop_clearfifotcp_secret_initieee80211_recv_sa_query_reqsbreserveundefined_initvrecycleem_phy_hw_resetubsa_matchextent_printieee80211_alloc_nodeblf_ecb_decryptcrcopydb_symformatural_newstatewdcloseundefined_handlerssys_revokeural_free_rx_listsysctl_stringsys_rebootext2fs_specvopsbufpoolproc_finish_waitwdccommandext_dist_code_bus_dmamap_load_buffercpu_forkwi_write_data_iodb_print_ifattylistwdopenuvm_vslockre_initdeflateResetcast5_setkeypci_ndomainsttyoutputkue_caexplicit_bzerocd9660_tstamp_conv17wskbd_calxtphy_statusuftdi_8u232am_getratetqphy_cdcryptodev_cbumodem_detachcpuset_add_alluhci_root_intr_abortrn_mkfreelistVOP_READbwi_phy_calibrateufs_ioctlffs_freefilein6ifa_ifpforlinklocallastdtimegetdisksys_setuidiq80321_pci_init_wdc_ata_bio_startstart_updatesiop_common_attachudav_cdusbd_clear_port_featureusb_abort_task_threadufs_quota_free_blocks2re_stopsenditsr_crypto_decryptudp_detachbufq_fifo_destroyacer_dma_initcluster_writernd_event_tailhidkbd_decodeuvm_setpagesizeehci_root_intr_closetcp_xmit_timersr_raid1_rwucomwritein6_recoverscopensphy_serviceaue_ticki80321intc_cdsr_raidp_set_vol_statetimeout_add_tvticksvwsata_write_regmclpool_warnmsgi80321intc_cadb_termscsi_preventmmcloseieee80211_get_assoc_respcd9660_accesssr_wu_getffs_statfsuhci_shutdowncpuset_complementrijndael_set_keywdcprobeiophy_cdudp_recvspacekm_allocfill_file2i80321_mainbus_matchgf_initsyn_cache_unreachuserconf_histszsys_getrlimitrt2860_attachhooki80321_mainbus_foundicmp6_errcountbpf_attachdfintek_cdicmp6_ctloutputieee80211_ba_move_windowcpuset_issetsvwsata_dmactl_writeufs_dirremoveumct_setrgephy_serviceieee80211_add_timif_attachsetuppipe_writem_clsetwmscryptof_pollin_pcblookup_listensbappendm_copybackscsi_remove_linknd6_rtmsguvm_swap_puticmpbmcastechoHMAC_SHA1_Initextent_print1db_continue_cmdrt2661_mcu_beacon_expireehci_timeoutbufheadconfig_scanwi_get_nwkeykp_pageablesr_raid6_addiopmap_copy_page_funcripsrciso_nchstatsem_update_eeprom_checksumkue_txeofugenkqfilterural_amrr_startnlineswdb_restart_at_pcdb_sstep_printohci_rem_edether_ifattachusbd_devinfo_allocinflateSyncsr_raidp_xor__wdccommand_doneumass_adjust_transfersignal_initfill_drlistffs_updatedb_print_formatrt2560_tx_bcnwsmuxcloseunix2dosfnspec_advlockmtdphy_cdfragtblraw_sendspaceubsa_cauvscom_breaknullopre_attachAES_CMAC_SetKeyip6_ecn_ingresscomdiagextralocunsleepvop_generic_bmapwdprobescsi_xs_getX_db_lookupmtdphy_funcsuipaq_seti80321intc_matchblf_encryptsched_proc_to_cpu_costohci_alloc_std_chainipintrgetnanouptimeohci_pci_detachuhci_pci_detachudav_activatei80321_pci_attach_hookdes3_encryptmaxdmaprt2661_tx_dma_intrural_alloc_rx_listusb_block_allocmemmainbus_bs_w_1ext2fs_symlinkdb_skip_to_eolip6_savecontroldevice_registerpciide_chan_candisablesr_raid6_set_chunk_statend6_dad_stoptimerq_to_bmountrootsyn_cache_resetdb_inputcharuhci_device_intr_doneuhidev_opendb_boot_cmdsundefined_entryip_initreaddeprocess_read_fpregsohci_freexural_txtimecd9660_rrip_getnameufs_check_exportdes_encryptsysctl_rdintpdc20268_setup_channelcd_interpret_sensein_mask2lenbwi_ack_rateural_eeprom_readscsi_iopool_destroylodirtypagessr_ioctl_disciplineem_probeumct_get_statusfindwin95VOP_WRITEsys_nanosleepre_rx_list_initstart_init_execifa_update_broadaddratu_detachnd6_addr_addifa_ifwithaddrsr_dumpclock_ymdhms_to_secssiop_add_devuhci_root_intr_transferbwi_dma_freebwi_phy_init_11b_rev2rootduiddb_write_cmdif_clone_attachuplcom_get_statussys_getfsstatohci_abort_xferbpfopencdstrategynetisr_intrem_config_collision_distnatsemi_irqackdeflatePrimerandomwrite_filtopsnd6_slowtimo_chuvm_km_valloc_alignenc_xform_nulldb_max_widthip6_pullexthdrmalloc_printitcpu_idle_enterbwi_regwin_disable_bitscomwriteuvscom_intrbuf_kva_startVOP_RENAMEauth_hash_gmac_aes_128cdclosecast5_zerokeysys_fchdirsr_crypto_readsysctl_ifqprocess0ieee80211_send_eapol_key_reqm_cltick_tmorandompidwd_cdurl_initfilt_ttyrdetachrt2560_update_plcparp_inuseuhidwrite_bus_dmamap_destroyvn_polluhci_device_isoc_methodsinet6swrouteswdosdirtemplatemainbus_cddb_uvmexp_print_cmdre_ioctlsys_mincorepdc203xx_setup_channelieee80211_tree_RB_REMOVElastsecondswdog_timeoutpci_probe_devicewsmousedoopenwi_get_txpowerural_plcp_signaludav_stopusbd_error_strsusbd_sync_transferlun_switchamphymatchtcp_maxpersistidleudav_tx_list_initspec_ioctlufs_initproc_reparentrt2661_select_antennauvm_exitfc_bmapcallspr_rmpageffs_initcluster_wbuildsr_crypto_createsvwsata_dmacmd_writescsi_ioh_setbootsyncuvm_initaue_attachieee80211_crypto_attachsys_ioctlif_free_sadldb_dotbwi_mac_gpio_initucomstopieee80211_node_joinfilt_bpfrdetachcompress2umodem_openicmp6_initbwi_mac_shutdowndisassemblebs_notimpl_bs_rm_1filt_ttywritepool_update_curpagesiop_script_readhid_end_parsein_setsockaddrpool_set_ctordtorcy82c693_readbpf_moveiniq80321_hdlg_irq_mapostypevndbuf_poollastpiduplcom_resetuvm_page_physloadreset_entryucomstartuvm_pmr_remove_1strangere_setup_hw_imwdcresetwdc_exec_xferip6_insert_jumbooptipintrqohci_noopmaxprocusb_frag_freelistip_slowtimordsizerijndaelKeySetupEncrt2860_load_microcodeubsa_rtsip6_nexthdrrtdeletemsg__bss_startumsm_openrt_tab2domdcphy_cdbwi_rf_readpciide_via_productskue_rxeofsiop_attachrijndael128_encryptVOP_KQFILTERukphy_funcssys_msyncdeflate_compresswskbdreadsbappendrecordevcount_detachsd_cabwi_free_txstats64ixp_chip_mapsoftdep_fsync_mountdevinitmsgbufehci_device_bulk_startwsmouse_attachpciide_intel_productsuipaq_dtrmemsetcuio_copydatapipe_free_kmemufs_getlbnsieee80211_get_actionieee80211_sa_query_requestphysioohci_strin6_selecthlimdb_show_all_vnodesupl_sendwdattachdb_symbol_is_ambiguousmii_phy_delete_mediausbd_set_report_asyncin6_unlink_ifacrypto_kdispatchicmp_mtudisc_clonert2661_rf_writeuvm_pmr_insert_sizesodisconnect_spllowerumct_closesys_setgroupsmainaue_csr_write_2lxtphy971_funcsucomttyohci_device_bulk_doneether_crc32_le_updateusbd_initmtdphymatchtimespecfixbwi_read_spromsr_raid1_set_chunk_stateuplcom_opensiop_lookup_productural_set_basicratesip_flushieee80211_delete_keykue_startre_watchdogsiop_scsicmduvm_unmap_removepmap_alloc_l1svwsata_chip_mapi80321_mem_bs_unmapicmp_errordb_hangmanwsmuxdevsbs_notimpl_bs_sm_1upl_rx_list_inituvm_swap_markbaddes_set_keykqueueopsrt2860_iter_funcvholdbufq_fifo_dequeuepciide_map_compat_intrubsa_parityidgen32db_help_cmdrt_if_removesr_minphysscsi_default_getghash_gfmulusbd_no_quirkrt2560_ack_ratere_read_eepromsis_hostbr_matchuipaq_matchm_adjmld6_stop_listeninghotplugioctlsvwsata_read_regpmap_map_chunkppsratecheckkmemlimitbuf_rb_bufs_RB_PREVrt2560_rf_writebwi_ioctlbwi_init_rx_ring32amap_copybufq_drainphysical_enduvm_rb_spacebwi_phy812_valuebwi_rf_calc_nrssi_slope_11buhci_allocmuhidpollsched_wasidleieee80211_ieee2mhzieee80211_dup_bssi80321_io_bs_maplf_findoverlapsr_raid_start_stopbwi_txtimelf_wakelockkv_anydb_sym_numargskue_attachhookdumpconfAES_CMAC_Initwi_rxeofehci_pci_detachbrgphy_cahpt_pci_intrdead_badopbwi_dma_mbuf_destroypciide_dma_finishpool_large_alloc_niblf_cbc_decryptcalcrusys_unlinkdb_cmd_listmainbusmatchrt_setgatetcp_ack_on_pushpmap_growkernelext2fs_rmdirufs_chowndofchmodatsysctl_intupl_tx_list_inituvm_shutdownkqueue_closepte_l2_s_cache_modeuvn_initstrlcatifnet_addrssysctl_int_arrbs_notimpl_bs_wm_8cdce_matchsoftintr_dispatchdisk_unlockpciide_cypress_productsufs_ihashremfrag6_enqieee80211_recv_4way_msg2or4cttywrite_bus_dmamap_createSHA256Inittcp_update_sndspaceurl_stop_taskpciaddr_device_is_agpsdmatchusb_freememudav_txeofpool_chk_pageproc0cdce_initufs_renameaxe_caext2gennumberbwi_rf_calc_txpowerudav_attachsr_already_assembledusbd_get_hid_descriptorrt_ifannouncemsgsoo_readbwi_rf_lo_update_11guvm_km_doputpagepciide_vendorspci_get_powerstateufs_opencopyout_statfspmap_modify_pvi80321_intr_establishm_catbwi_free_tx_ring32splxbwi_regwin_switchohci_pci_attachrtinittqphy_statuscluster_collectbufskp_dma_contigsiop_handle_qtag_rejectwi_write_data_usbumass_scsi_minphysuvm_swap_inittcp_nowaue_miibus_statchgdb_trace_until_matching_cmdproc_printitural_bbp_initdes1_setkeyunp_gcsys_clock_gettimeip6_hdrnestlimitcsefreepool_catchupcpuset_clearxscale_cache_syncI_rngfrag6_initsiop_sdtr_negbuf_replacevnodeuvm_pmr_size_RB_NFINDiq80321_pci_intr_mapre_miibus_readregtimeout_setrdread__subdi3ntohsmsgbuf_putcharbwi_media_change_bus_dmamem_freeinet_ntoadb_boot_poweroff_cmdsd_flushcd_setvolext2fs_mkdirohci_openext2fs_direntersys_symlinkatmii_pollstatrlphy_cawdgetdisklabelrw_exitpciide_machdep_compat_intr_disestablishkv_pagedupfdopeni80321intc_calc_maskidgen32_initbwi_dma_ring_allocifmedia_list_addpidhashrt2661_updatestatsrtprefxscale_context_switchuvm_totalencdebugicmp6_ratelimitdb_unread_charsr_raid1_createsys_mkdiratiic_searchdofstatatstart_inituhub_attachieee80211_recv_assoc_reqether_fakeaddrsysctl_tc_hardwarert2661_prepare_beaconscsi_ioc_ata_cmdtcp_mssdfltrt2661_alloc_rx_ringrt2860_updatesloti80321_bs_unmapuvm_swap_freeatu_newbufdata_abort_handlerbwi_tbl_write_4bs_notimpl_bs_r_1umsm_closeaxe_initdb_look_charuhidev_set_reportin_pcbdetachmsdosfs_vfsopsaue_ifmedia_updttycheckoutqrt2560_watchdogread_multi_1piix_timing_debugicmp6_mtudisc_callback_registerdb_set_variableuvscom_set_lineaue_causb_explore_tasksrnd_event_spacepmap_clear_referencert_getmetricswdc_ata_bio_kill_xferin6_ifdetachdb_search_symbolcn_tabswaplist_insertip_forwardextent_createrdclosebpf_freeddisklistin6_lifaddr_ioctlsys_fstatfsurl_txeofkue_devsbs_notimpl_bs_sr_8m_injectem_mta_setudav_setmultiip6_mforwardingnd6_setdefaultifaceffs_isfreeblocki80321_mem_bs_freeseltrue_kqfilteruvm_map_lookup_entryhztoicsphymatchBlowfish_expandstatebs_notimpl_bs_w_4ieee80211_get_probe_respdead_strategypciide_dmacmd_readswi_handlergcu_miibus_writeregni6_store_addrsspec_fsync__wdcwait_resetuvm_map_deallocateicmp_reflectieee80211_parse_wpamii_phy_activatescsi_xsh_iohext2fs_reclaimpciide_acer_productsffs_ballocsys_getgroupsieee80211_node_attachsys_linkatuhub_cdwi_start_usbgeneric_bs_wm_1ip6_raw_ctloutputkernel_textumodem_get_capsufs_startbufq_disksort_dequeuebrgphy_mii_phy_autoohci_devd__end__kinfo_vdebugbwi_start_tx32rt2860_ampdu_rx_stopnsphy_reseturl_sendcdce_encapuvm_rb_insertufs_bmaparrayfragtbl8i80321_mainbus_attachuvn_sync_lockaes_ctr_setkeyumct_attachurl_resetusb_needs_exploreswaplist_findufs_quota_alloc_blocks2fc_fileextendsfilt_sigattachre_startwsmouse_cdricohrtc_settimeVOP_FSYNCsr_uuid_getbwi_mac_get_propertyffs_sysctlipport_hilastautoarpinit_doneusb_wait_taskuvm_anon_pageinspec_closecd9660_closeem_initialize_receive_unitsys_shutdowncngetcehci_rem_qhsii_fixup_cachelinetc_adjfreqrnd_statesm_gethdrem_dma_mallocugen_activateconfig_rootfoundcue_cdputcsiop_resetsii3114_mapreg_dmaieee80211_phymode_namebufbackoffricohrtc_attachsysctl_rdstruct__divsi3uhidev_cdwsmousereadxscale_minidata_clean_sizeschedcpui80321_gpio_pin_readbwi_mac_bss_param_initrt2661_attachurlphy_servicesbappendcontrolukbd_set_ledswihap_sta_timeoutsiop_update_scntl3pciide_nvidia_productsugenread_intr_filtopssoftdep_flushfilesdb_access_und_spipv4_inputm_getclrpool_headwsmuxioctlsr_crypto_read_key_diskusbd_interface2device_handlepcaled_cdipforwardingdb_lexohci_device_isoc_transferieee80211_get_cts_to_selfusbd_open_pipe_ivalicmp6_redirect_timeoutsyn_cache_lookuparc4random_statebwi_setup_tx_desc64prtactiveksym_upcaseufs_makeinodescsi_xs_ioip6_process_hopoptsusbd_find_edescfilt_ttyreadsys_getpgiduhci_runcom_common_putcswaplist_trimcache_lookuprdioctluhci_allocxobsd_pci_mem_findrijndaelKeySetupDecdb_boot_crash_cmdbwi_rf_on_11auvm_objtree_RB_INSERTsysctl_tcurl_detachbs_notimpl_bs_rr_1umass_scsi_sense_cbrijndael_encryptricohrtc_clock_writeieee80211_recv_mgmtbwi_newstate_beginumsm_get_statusaxe_detachdumpsizepci_matchbyidukbd_keydesctabsr_raid_inquiryextent_freeuvm_aiodone_daemonusb_cookie_noi80321_gpio_pin_ctladdupc_tasksched_syncusbd_clear_hub_featureext2fs_vopsieee80211_send_4way_msg3db_mount_print_cmdcomcloseiopxs_mainbus_caeephy_attachsetsigvecsiop_dmamem_freesys_sendmsgi80321_bs_barrieruhidopenvn_marktextiic_cdbrgphy_bcm5411_dspcodefrag6_remquestrcmpsys_quotactluhidev_matchsr_raid_startwuieee80211_get_hdrlentcp_mtudisc_increaseulmaxatu_txeofin6_pcbconnectdehashluphy_cakue_cduvm_pmemrange_addr_RB_INSERThook_disestablishexphy_funcsbpf_catchpacketffs_isblockucomwritecbdb_stack_trace_printusbd_find_quirkuvm_swap_allocpagesuvm_aobj_poolhotplugclosedb_show_frame_cmdsys_adjfreqpci_cadb_examine_cmdqsphy_funcsuvscom_seticmp6_reflectsetrunqueueudv_attachsettimecdce_rx_list_inituhub_intrarm_pcache_typertable_initscsi_ioh_runqueueata_set_modemii_phy_auto_timeoutsyn_cache_getnetisrdb_clear_breakpointsttyrubrevarpwhoamiieee80211_get_ratevop_generic_islockedrt2860_reset_tx_ringm_pulldownbufcachepercentbwi_mac_detachacer_pci_intrpmap_initufs_rmdircryptodevkey_cbrlphymatchieee80211_next_scanpmap_zero_page_funcarmv4_tlb_flushD_SEminsr_meta_native_writeuhci_device_ctrl_abortip6_initconfig_detach_childrenrawcbpdc203xx_write_regukbd_cngetcz_errmsgtcpcb_poolsr_shutdownhookrt2860_updateproti80321_pci_make_tagBlowfish_stream2worduhidclosetimeout_add_msecipip_allowsys_polluvm_map_clip_endufs_makedirentryusbd_set_configieee80211_recv_addba_reqm_defragem_write_pci_cfgrtable_l2setvnode_hold_listlastdosdateudav_unlock_miibuf_rb_bufs_RB_NEXTuhci_add_bulkral_cdufs_linksched_choosecpusys_mkfiforicohrtc_matchzcallocdb_cmd_searchifa_ifwithafural_read_eepromin6_ifinitin6_leavegrouprtlabel_id2sasqphy_caem_reset_hwsddumpiminsys_chflagsobio_bs_tagget_hw_ifiddelaypci_reserve_resourcessdstartdb_machine_command_tableip6_hopopts_inputddb_regsselfalseieee80211_media_initricohrtc_gettimescsi_default_putcom_enable_debugportpage0_datavn_isunderusbd_get_port_statusuvm_pageoutpffindtypepdevnamespci_subclass_dockuipaq_breakqsyncwi_setmultiuvn_clusterifaddr_items_RB_MINMAXre_gmii_writeregcd9660_vptofhwi_attachusb_camii_phy_downuvmspace_forkraw_initknote_enqueueums_accessopsudpcksumtcp_sendspaceurl_csr_write_4db_maxoffuvm_pmemrange_addr_RB_REMOVE_COLORffs_oldfscompatieee80211_add_rsnrijndael_decryptwdcdetachmaxlocksperuidfilt_ugenrdetachin6_matchlensys_madviseupl_openpipesehci_device_ctrl_methodsrt2560_plcp_signalscsibusdetachdisk_attachwskbd_displayioctllm75probeip6_clearpktoptsncpusdb_cmd_loop_donearptfreeubsa_detachfilt_ugenread_intrdb_show_arptabbufadjustcom_detachieee80211_ccmp_encryptaxe_stopbs_notimpl_bs_w_2ural_set_macaddrdead_printeephy_serviceinphy_servicemii_media_tablesr_discipline_freebwi_rf_lo_devi_measurewdstrategyrt2860_set_macaddrttyprintfi80321_pci_bus_maxdevssigcodedb_elf_search_symbolhpt_chip_mapipip_inputdeflateCopyieee80211_send_group_msg2db_delete_watchpointcomttybuf_undirtysysctl_tstringsr_meta_cleardb_watchpoints_insertedxscale_cache_cleanDusbd_start_nextfilt_ttywdetachuvm_tree_RB_INSERT_COLORamap_swap_offpool_allocator_nointrbwi_pci_attachsys_sysarchrt2560_disable_rf_tuneBlowfish_decipherbio_validateigmp_initmii_phy_add_mediacpu_reset_needs_v4_MMU_disablecache_zapMD5Initem_txeofpcaled_gpio_pin_writecryptodesc_poolbus_space_write_raw_multi_2ffs_vfsopssysctl_mallocwihap_ioctlcpu_info_storeieee80211_outputfrag6_slowtimouvm_pmr_insert_addrwant_reschedpmap_bootstrap_pv_allocatormsdosfs_mkdirkthread_create_deferreduhci_free_sqhieee80211_ioctluhidevsubmatchbufq_disksort_destroycrc32_combinedevid_freeboot_eaddrre_rx_list_fillieee80211_sa_query_timeoutscsibusactivatend6_timercomcnpollcatu_matchbioopenbwi_phy_set_bbp_attenqsphy_servicein6_ifloop_requestcd_patterns__cmpdi2crypto_workqsr_crypto_create_keyssd_ioctl_inquiryscsi_xsh_adduvm_pmemrange_addr_RB_FINDraw_detachscsi_xsh_runqueuepmap_get_pdeural_read_multibs_notimpl_bs_wr_1domainnamelenehci_pollpciattachigmpctl_varsusbd_get_report_descriptorsd_thin_paramsip_rtaddrfiledesc_initrt2661_enable_mrrload_dsatag_switchurl_ifmedia_statuspciide_pci_readatu_get_cmd_statuscue_csr_read_1vrelewi_set_pmwsmux_do_displayioctlohci_alloc_sedem_set_media_typeem_update_link_statusscsi_xs_errorprtrealloccheck_consoleamap_freeem_detachin6_domifattachugen_get_alt_indexusb_blk_nfreend6_prefix_lookuptc_getfrequencyrt2661_mcu_cmd_intruhci_device_ctrl_methodsbwi_rf_lo_adjustsync_inactivespec_printlocleanpagesext2fs_lookupmsdosfs_openehci_hubdext2fs_linkvop_generic_revokeohci_hash_add_itdusbd_get_bufferieee80211_add_erpieee80211_decapfilt_sigdetachfilt_seltruedetachext2fs_renameipsec_def_authuhci_add_loopusbd_setup_isoc_xferttywflushcd9660_rrip_offseturl_startwskbd_default_keyrepeat_datacomcnmodeclosefcomioctlumass_cbi_resetscsi_ioh_deqsoftdep_sync_metadataif_clone_lookupgetmicrouptimerandom_initdisk_openpartmii_tickip6_dad_countem_pci_clear_mwiatu_complete_attachumct_breakuvm_pager_dropclusterfilt_generic_detachuvscom_rtsip6_getmoptionssensor_task_unregisterehci_intrlist_timeoutbwi_rf_calc_rssi_bcm2053pool_print1wdc_ioc_ata_cmddb_breakpoint_listcd_get_parmspmap_extractrt2860_set_channd6_ifptomacwsmousedoioctlamap_unaddural_watchdoguvm_pmr_insertcd9660_printsr_meta_saveohci_rhsc_enableif_congestionnfilescd9660_islockedin6if_do_daduhci_root_ctrl_transferrt2560_amrr_timeoutrevarpwhoarewecue_txeofatu_rxeofaue_detachcryptodev_keyieee80211_iserp_stapipe_kqfilterem_configure_k1_ich8lannforce_pci_intrext2fs_openpmap_devmap_find_papmap_kenter_cacheusb_insert_transferaxe_matchukbd_keymapdatasr_meta_validatestopprofclockdb_hangbwi_rf_on_11bgnullioctlcertance_irq_mapcryptof_closepte_l2_l_cache_modeisohashrt2860_rssi2dbmmclsizesparsediskre_eeprom_getwordrt2860_calibwi_set_debugbcstats_printbwi_regwin_selectbreadem_intrieee80211_node_copyamap_lookupipctl_varsbwi_init_tx_ring64apollo_setup_channelpmap_page_removert_timer_remove_allwskbddevprintuhid_intrpcaled_gpio_pin_readrt2860_free_tx_poolwdc_output_bytesatu_ioctlieee80211_classifyproc_stop_sweepieee80211_media_statusiophy_capmap_set_pt_cache_modescsi_xs_exectcp_usrreqmichael_keydb_playsieee80211_setbasicratessd_interpret_senseudp_usrreqifmedia_initrtable_l2ext2fs_vfsopsuvm_mapent_freeext2fs_inactivedead_bmapdb_guessesif_getgroupmembersdb_show_all_poolssoo_kqfiltercpu_startupamap_refehci_device_bulk_transferuhci_device_isoc_transferdb_command_loopwdc_ioctlamphyattachrt2661_updateslotfdexpandsrandomcoredump_countsegs_elf32tickswdc_ata_presentpdc20262_dma_finishmsdosfs_closerd_detachpool_do_gethotplugreadext2fs_setattrsysctl_clockratevn_rdwrohci_close_pipend6_need_cacheip6intruftdi_activateurl_setmultiusbd_get_device_descbwi_phy_writesyncer_maskwdc_default_write_raw_multi_2uvm_pagedeactivatecy82c693_initufs_unlockmainbus_bs_r_2tcp_ctloutputrt2860_mcu_cmdrt2661_plcp_signalukphy_statusieee80211_derive_pmkidMD5Updateblktochrifmedia_setem_setup_interfacebio_lookuppmap_createuvm_map_extractnd6_prelist_addufs_removepciide_activatesysctl_tc_choiceptsignalboottimecd9660_readlinkxscale_cpu_sleepVOP_ADVLOCKdb_watchpoint_cmdaxe_watchdogwskbd_mux_closefrag6_inputuhci_device_intr_closepmap_alias_distcompressBoundunpst_sendspaceffs_indirtruncieee80211_add_ratestcp_rscalettwakeupuvmspace_freeext2fs_inode_poolffs_ino_poolpci_detach_devicespmap_pageidlezeromii_phy_statusmsgpdc203xx_irqackcpufunc_domainsswapdrum_getsdpVOP_PRINTfdsharepci_subclass_memoryicmpv6ctl_varsbwi_rf_lo_measure_11bfintek_matchcdstartgf_premulfilt_generic_readwriteuserconf_disableumct_methodsvrefin_scrubprefixusb_detachipforward_rtuhci_device_intr_startbwi_rf_lo_update_11bem_access_phy_reg_hvdb_elf_forallohci_device_isoc_closeuplcom_attachurl_int_miibus_writereguhidev_activateAES_CMAC_Finalnd6_dad_na_inputuvisor_cdsd_cmd_rw16ghash_updatedb_set_temp_breakpointsiop_cmd_putdb_buf_print_cmdbwi_rf_set_chaninpcb_pool_initializedsys_nosysbwi_regwin_disableat_pollallproccdevswsr_rebuildxscale_cache_flushDumodem_get_statussys_mlockallwskbdcloseuvm_sysctlmalloc_lasterrgetsndiskmapopen_bus_dmamem_unmaprthreads_enableddisksortsys_fchflagsnamei_poolrt_timer_countvfs_buf_printuhci_device_intr_transfercryptodev_opworkq_destroyukphymatchuvm_pager_putuvm_tree_RB_NFINDdiskmapcloseohci_device_bulk_abortbwi_newstateem_access_phy_debug_regs_hvudav_caip6_ecn_egressbwi_get_clock_freqin_canforwardifa_item_removeohci_device_intr_abortieee80211_tree_RB_INSERTpmap_destroyscsi_mode_selectkernel_pt_listetherbroadcastaddrieee80211_rssadapt_updatestatssii3114_chip_mapvfs_getnewfsidaue_rxeofem_cducom_attachSHA512Finaludp6_ctlinputitimerroundarm32_vector_inituvm_pmr_size_RB_PREVwdog_shutdownscsi_print_sensewskbd_update_layoutmmopenffs_inode_freeohci_device_intr_transferwdc_cdpci_findproductamphy_statusukbd_intrifa_item_insertrtioctlkue_ctlscsi_xs_putifaddr_item_plieee80211_tree_RB_INSERT_COLORprofprocswdc_free_xferip6_inputbuf_free_pagessleep_finish_signalicsphy_cdwi_usb_cmdrespsr_crypto_alloc_resourcesgeneric_armv4_bs_rm_2route_srcehci_pci_activatespeedup_synceraes_xts_zerokeyigmp_sendpktsched_cost_residentloop_clone_destroywdc_ata_bio_doneifmedia_baudrate_descriptionsv_putcbwi_rf_clear_tssim_getptrukbd_cauhid_activateufsvnode_filtops_bwi_adjust_devideuvm_fault_unwireuserconf_common_attr_valsched_noidleuhci_add_ls_ctrlobsd_pci_io_findsys_getitimerhid_get_datadonicewdcstartcpu_configuresr_rwohci_pci_attach_deferredip6_freemoptionssr_raid1_alloc_resourcessqphy_funcshidkbd_delayed_decodeieee80211_amrr_chooseusb_create_task_threadsieee80211_end_scancdce_txeofbufhighpagespmap_fault_fixupdcphy_servicern_refinesgeneric_bs_rm_4hmac_opad_buffersockargshpt_setup_channelhidkbd_ioctlvop_generic_abortopsr_raid6_set_vol_statesetregsupl_rxeofni6_nametodnssobindvmcmd_map_zerodb_read_charvfsinituvisor_closeupl_caubsa_paramcnclosedb_tok_numbertcp_do_rfc1323ip_fragswdc_dmawaitmii_phy_setmediain6_ifpprefixkd_trylocklo0ifphostidpool_chkwi_alloc_nicmem_usbusbd_free_bufferuvm_pagermapoutrt_if_linkstate_changesr_raid0_rwipqmaxlenif_downallext2fs_vptofhnam2blksr_raid6_assemblecoredump_writeseghdrs_elf32rt6_deleterouteip_maxqueuesysctl_ttyieee80211_chan2ieeeuhub_cain_socktrimieee80211_recv_delbaext2fs_dinode_poolieee80211_node_cmprtallocsys_mprotectuhci_alloc_sqhieee80211_std_rateset_11gdequeue_randomnessuvm_km_kmemalloc_plart2560_alloc_tx_ringcue_casyncer_maxdelaydeadprocstart_reaperehci_root_ctrl_methodssys_fcntlnforce_setup_channelvfs_free_addrlistsys_setrlimitsys_sigpendingbwi_led_blink_startrt3090_efuse_read_2loop_clone_creatediskmapwriteem_hash_mc_addri80321_timer_initeduvm_map_cleanuvm_pmr_get1pageicmp_redirtimeoutworkq_add_taskttyclosewdrestartugen_isoc_rintricmp6_nodeinfocomp_algo_deflatemaxvfsconftimeout_addcpu_cdip6_forwarddb_fncallnumcacheobio_bs_freecmd0643_9_setup_channelural_write_multiuvm_pagecountcpu_initclocksbwi_mac_fw_alloccue_sendwskbdioctlmii_downrn_mpath_hashbrelseext2fs_unmountpsratiosdminphysohci_device_isoc_methodswi_usb_tx_lock_tryaxe_unlock_miicpuset_delttyoutdevice_lookupuvm_map_pehci_device_requestDebuggerwi_usb_txeofcdminphysschedhzurlphy_caem_allocate_pci_resourcesi80321intc_write_steerrip6_inputuvm_tree_RB_MINMAXtcp_totbackoffvdropuserconf_basepci_subclass_displaylooutputrt3090_rf_readcue_setmultirijndael128_zerokeysoisdisconnectedcpu_coredumpxscale_cache_clean_addrrevbitssvwsata_drv_probedvd_read_disckeypmap_clean_pageuvm_aio_aiodonepmap_clearbitieee80211_mgmt_outputcrypto_freereqbwi_rxeof64syn_cache_rmclrbitsdb_boot_dump_cmduvn_putscsi_add_linkpci_vga_tagxscale_cache_clean_minidataieee80211_proto_detachmii_phy_statusuvscom_matchcommajorcrypto_newsessiongeneric_armv4_bs_r_2bufq_disksort_peekenc_xform_aes_xtssoclosesr_ccb_freescsi_detach_targetinstall_coproc_handler_staticwakeup_nsys_connectbuf_daemonskpcluphy_funcsdb_leieee80211_bip_decapbufq_fifo_createohci_root_ctrl_transferipv6ctl_varsroute6_inputbs_notimpl_bs_w_8board_startupsys_socketpaircnreadpcimatchcertancepci_addr_fixupdounmountuvm_swap_allockthread_create_nowhidkbd_bell_fn_argtcp_ackdrop_ppslim_countdb_elf_line_at_pcarm_picache_sizettspeedtabns_scx200_setup_channelkqueue_readieee80211_add_edca_paramscd9660_mountuserconf_maxdevre_pci_attachcue_inituvm_pmemrange_addr_RB_INSERT_COLORfork_tfmrateacard_setup_channellxtphymatchi80321_bs_initsr_hotplug_registerpv_sizeuvn_sync_qin_proto_cksum_outwskbd_activatewi_media_statusurl_miibus_statchgnd6_purgedb_mult_exprtcp_keepidleif_attachheadnextcdb_listbreak_cmdwi_scan_timeoutuvm_wakeup_plaiszerodevuhci_devdciphy_caupl_inputauth_hash_hmac_ripemd_160_96ieee80211_recv_pspollumass_caem_hardware_initgeneric_bs_sr_4lf_freesys_fhstatnullmodemohci_hash_find_itdwihap_sta_deauthbwi_ds_plcp_headerprobe_addrs_eepromif_attachdomain1raw_recvspacesr_raidp_set_chunk_statebwi_mac_set_ackratesieee80211_amrr_node_initdiskerrwi_startcd_cddb_machine_commands_installieee80211_state_namesys_preadem_media_statusscsi_moveehci_root_intr_abortkernel_pt_lookupkmem_mapcd9660_check_exportukbd_translateconfig_pending_decrqsphyattachaxe_startsoqinsquediskstatsums_detachcdce_attachdes_ecb_encryptudp_inputnchrtoblktblehci_sb700_matchihashrn_search_mresettodrusbd_ref_decrpcaled_attachufs_readdirsys_flockiq80321_startpvwi_usb_do_transmit_syncspec_badopbwi_memobj_read_2msdosfs_linkpciide_unmap_chanbs_notimpl_bs_c_1ohci_root_intr_methodsicmpctl_varsigmpstatmichael_finalvn_initialize_syncerdpipeselwakeuprt2860_get_rfxscale_controlcd9660_quotactlicmp_sendadjtimedeltauhci_root_ctrl_donesiop_morecbdcy693_chip_mapcdce_watchdogdb_mbuf_print_cmdsiop_ppr_negwdc_ata_errieee80211_choose_rsnparamstime_uptimeuvm_pagealloc_pgcdce_intrfilt_uhidreaduvn_wlistuvm_pmemrange_addr_RB_REMOVEsowakeupinsidetcp_autorcvbuf_incbufq_queuesr_raid0_free_resourcesbs_notimpl_bs_r_4db_putstringprefetch_abort_entrysigactsunsharetimeout_hardclock_updaterdattach_edatagcu_miibus_statchgupl_detachrijndael128_decryptbwi_setup_rx_desc64ttkqfilteri80321_pci_conf_writem_tag_deletecd9660_ihashrembwi_phy_readsensor_findip_fragmentfilt_timerusbd_endpoint_countsys_statfsSHA1Finalsched_nomigrationsinittimecountersensordev_deinstallrawin6pcbtablepmap_protectkprintfdevice_unrefrc4_keysetupdcphy_matchscsi_startuvm_pmr_addr_RB_REMOVE_COLORin_cksumvnode_poolrt2661_rx_intrvnode_free_listtcp_savetiuvm_pagereallocbwi_setup_desc32iicprobeinitsensordev_countrt2661_stopiic_ignore_addruvm_fault_unwire_lockedklist_invalidateuvm_km_createthreadpool_printitubsa_flow_endpciide_attachdes_check_keyrt_senddesyncsogetopthid_report_sizerd_matchricohrtc_cddb_deletewatch_cmdusbd_ref_waitsr_crypto_calculate_check_hmac_sha1sr_raid0_set_chunk_statepollscandomaininitsii3112_setup_channelvflushbuftime_secondbwi_pci_matchacer_chip_mapip6_forward_rtusbd_get_interfacewskbd_get_mapentryuvm_pmr_initsr_hotspare_rebuild_callbackusbd_read_report_descsbcreatecontrolsys_mlockhotplug_device_detachrt2560_resumeieee80211_setup_nodebioioctldvd_read_structvdevgonehtonsumsm_intrehci_pci_attachubsa_setdb_show_callout_bucketbucketkqueue_writesys_syncieee80211_reset_scancominitrt2560_newassocieee80211_add_pmkid_kdeenodevobio_bs_barriersr_raid0_discipline_initffs_mountfsin_delayed_cksumm_clticksfintek_fullspeedi80321_mem_bs_allocicmperrppslim_lastrtstatttvtimeoutatu_startkd_waitokabtstacktimingsafe_bcmpspeclisthbdwritecpu_idle_cycleversion_to_spcVOP_INACTIVEwsmux_do_closepte_l1_c_prototcp_syn_cachehaltpciide_sis_productseephy_cainphy_cawihap_sta_is_assocsr_raidp_intrieee80211_std_rateset_11akputcharums_ioctlbootargssys_getsiddb_trace_until_call_cmdRMD160Initdisk_gonewi_write_record_usbdb_show_all_mountscue_csr_read_2uhci_device_setintrm_trailingspacefileheadrc4_cryptusbd_alloc_xfernextvnodeidcttypollsr_meta_initural_startkp_dma_zerosensor_task_ticksys_swapctliic_dumpbd_reqbs_notimpl_bs_rm_2copypktoptsin_selectsrcmsgscpu_exitip6_initpktoptsworkq_threadbwi_get_eaddruvn_getwsmux_add_muxbpfilter_destroyunp_attachohci_device_isoc_starttcp_syn_bucket_limitsys_renamesr_raid6_xorqpci_vga_procusbd_nbusesfrag6_nfragsip6_log_timeem_deviceseephy_statusinphy_statusrtalloc_mpathsii3114_chansetupxscale_cache_purgeDusb_begin_tasksscsi_activate_targetdisasmufs_ihashinitunp_deferuvm_km_valloc_waitsys_sigreturnbwi_iter_funcsbflushehci_device_intr_transferscsi_link_closeipsec_require_pfsswapdevwd_cakue_sendsysctl_intrcntaxe_tick_taskvn_readnclrunegheadbwriteleavepgrprt2860_set_gp_timerqsphy_cdarmv4_tlb_flushDkernel_pt_tablepmap_get_pde_pteuvmpageropsuvm_page_initohci_root_intr_closestatminsr_copy_internal_dataehci_root_ctrl_closewihap_sta_allocem_fill_descriptorscast5_decryptbrgphy_copper_funcsxscale_setuprt2661_set_bssidnamecache_rb_cache_RB_INSERTpcaled_gpio_pin_ctltcp_timer_funcsipqent_poolif_attachdomainubsa_requesticmp_ratelimitieee80211_rssadapt_raise_ratesr_crypto_decrypt_keyuhci_rem_loopuvm_km_page_initrttimer_pooladler32_combineieee80211_regdomain2flagadd_entropy_wordsrt2560_rxratergephy_load_dspcodeusbd_get_config_descsosenddosetrlimituvm_pmemrange_addr_RB_PREVrn_initieee80211_set_timuvm_objtree_RB_NEXTsr_scsi_probecmd_channel_maploopattachusb_match_devicesiop_update_residural_rxrateieee80211_save_iewdc_input_bytesusb_abort_task_thread_procRMD160Finaldb_listwatch_cmdrt2661_set_slottimepci_get_ht_capabilityusbd_do_request_flags_pipescsi_cmd_rw_decodechainlengthprocess_read_regsbwi_mac_startwdc_pdc203xx_vtblsys_unlinkatural_disable_rf_tunettwakeupwrrn_lookuppciide_ati_productsuvm_map_reserveuserconf_show_attrsys_execveamd756_chip_mapite_setup_channelfdallocprfindrt2860_updatestatsrt2661_alloc_tx_ringscsi_doneexec_aout_prep_oldzmagicrt2860_set_bssidchkvnlockhw_sysctltc_ticktockbwi_start_tx64rt2560_newstatephtree_RB_MINMAXdb_siftinguhci_device_bulk_abortdb_look_tokenpmap_alloc_l2_buckettcp_syn_cache_limitnumvnodescryptof_ioctlcomreaduvm_pagefreeehci_device_isoc_abortext2fs_inode_allocswcr_encdecbufq_fifo_queuedb_examine_formatin6_pcbbindpool_large_allocicmp_do_exthdrreaperbwi_bus_initieee80211_add_gtk_kdecoredumpfilt_kqueueugen_cdmalloc_rounduppipe_readuhci_root_intr_closeifioctlsys_utimesdb_symformatsusbd_do_requestnd6_storelladdrrip_initsocreateobio_searchusbd_find_idescpmap_cache_stateureadcatu_get_dfu_stateaue_startufs_setattrrijndael128_setkeyieee80211com_headlogpriworkq_queue_taskmemhookdoclusterreadcast5_encryptsys_exitpciide_chanfreesbtryusb_desc_iter_nextuvisor_matchieee80211_send_4way_msg1m_applyswcr_processcryptof_writeudav_startaxe_lock_miidomkfifoatrt2560_detachwdc_exec_commandudv_lockbufqsdb_watchpoint_listwdcintrcd_playHMAC_MD5_Updatesys_clock_getresaxe_attachsyn_cache_insertrc4_getbytesttystats_initpciprintpci_mapreg_probeem_allocate_receive_structuresbrgphy_ber_bugucom_matchnd6_umaxtriesohci_device_intr_donedcphy_reseti80321intc_read_intsrcnd6_setmtu0nd6_debugmainbus_bs_r_4ip6_maxdynroutesuvm_map_pieumodem_cawindow_deflatedb_delete_temp_breakpointehci_root_ctrl_transfercpu_cpuspeedpciide_cmd_productscpufunc_iddefrtrlist_updatert3090_rf_writeurl_csr_write_1_tr_initSHA1Transformesymfiqhandler_stackieee80211_defragcrypto_invokeosreleaseubsa_breaki80321_io_bs_initVOP_RECLAIMscsi_probe_targetsr_raid1_set_vol_stateip6_getpcboptbuf_releasert2860_newstateucom_cdsiop_update_xfer_modeHMAC_MD5_Init__modsi3tcpqe_poolpgrp0mainbussearchurl_watchdoguvisor_initwihap_timeoutuserconf_changedb_panicuserconf_helpsr_ioctl_setstateufs_advlockicmp_initsr_raidp_openingssii3112_chip_mapcdst_pteuvm_growcsecreatevfinddevieee80211_node_cleanupE_ldsa_abs_reselected_Usedral_pci_attachpciide_unmap_compat_intrrt_msg1ehci_device_bulk_methodsether_delmultibrgphy_5709s_statussave_rtedb_history_currsr_crypto_get_kdfmainbusattachrn_mpath_initheadbwi_watchdoguvscom_paramexec_sigcode_mapsys_gettimeofdayipsec_soft_timeoutwdccommandshortieee80211_rate2mediavcleanuhci_device_bulk_doneiophy_servicecd_getvolsplassert_ctlsys_getresuidsys_fhopensr_crypto_ioctldos2unixfnpciaddr_do_resource_allocatescsibussubmatchrtentry_poolbufq_restartuvm_km_pgremove_intrsafeext2fs_sbupdatein6_init_address_ltimesdefrtrlist_delsys_fchmodatu_watchdoguvm_unmap_detachieee80211_recv_authehci_add_qhupl_initusb_dev_quirkswskbd_srcopsuserconf_common_devvfs_mount_printstartieee80211_needs_authwdog_cookieusbd_devinfosiop_wdtr_negvn_isdisksys_selectbwi_attachdeflateParamsbwi_mac_initbadaddr_read_1vop_generic_lookupcryptoattachzombprocdb_branch_takenin6addr_intfacelocal_allnodeslogreadumsm_cdrn_mpath_capabledead_lockworkq_next_taskieee80211_name2regdomainbwi_nrssi_11gtcp_issphysical_freestartfc_largedistancesys_setitimerisofntransurl_attachnd_prefixvfs_unregistermii_phy_flowstatusdisk_mapselwakeupumct_set_baudrateffs_reloaddefault_chip_unmapdb_set_watchpointsem_initialize_transmit_unitfill_kproccnwritert2661_reset_tx_ringumass_bbb_get_max_lunin_ouraddrpolloutdb_show_panic_cmdehci_device_bulk_doneuipc_usrreqnd6_na_inputdb_next_free_watchpointvflush_vnodewsmouse_activate_bwi_rf_lo_update_11gaes_key_unwrapem_media_changerip6_usrreqin6mask96colddb_clear_watchpointsunp_scansbappendaddrbufqs_mtxbpf_maxbufsizeextract_entropyufs_islockedusb_detach_wakeupffs_unmountffs_vopsdofutimenssys_pwriteisohashtblwihap_shutdownuvmspace_allocrevarpinputcd_pausecompresshashinitttstartumass_setup_transferciphy_statuswdwriteipsec_keep_invalidpciide_channel_dma_setupuao_detach_lockedpci_devinfoumct_set_lcrieee80211_parse_rsn_akmrt2661_newstatesdopentcp_tracemii_phy_resetip_getmoptionsuhci_hubd_piixin6mask32__moddi3disk_countohci_confdpmap_page_protectdead_openscsi_detach_lunsr_ioctl_inqkue_setwordpci_vga_countdb_list_watchpointsuserconf_attrwdc_kill_pendingbmtphymatchicmp6_redirect_outputroute_cbsys_futimensexphy_cdreadepcpuset_init_cpuscsi_init_inquirylxtphy_resettcp_slowtimoieee80211_std_rateset_11bre_setup_intramphy_cdcd_play_msfpmap_remove_pvtcp_newtcpcbsbchecklowmemswapmountffs_mapsearchsys_fhstatfself32_load_filesys_getpeernamert2860_alloc_rx_ringrt2560_prio_intri80321_bs_subregionehci_device_intr_closeehci_intrieee80211_get_txkeydb_taken_bkptdb_eqnamescsi_strvistcp_set_iss_tsmbpfwritedoingcachesys_getrusagepdc205xx_do_resetmainbus_bs_mapauth_hash_hmac_sha2_256_128aue_reset_pegasus_IIcryptoioctlbufq_destroynd6_prunert2560_set_chancomconscflagm_getbwi_bbp_power_offffs_truncateuhidevprintmii_attachuvscom_cabwi_rf_workaroundttylclosecmd680_chip_mapwdc_svwsata_vtblpool_allocator_allocsiop_cmd_getwdc_default_read_reghidms_inputin6_ifremloopchar_typeohci_free_sitdusbctlprintvn_closeworkq_createuftdi_readudav_csr_writeuhid_do_readin6_createmkludgedoclusterwriteusbd_close_pipeusbd_deactivateffs_writeieee80211_wep_set_keybremfreefilt_sowdetachnd6_initip6_maxfragslimfreedoutimensatdb_show_regsuhci_reset__wdccommand_intrrt2661_startaes_ctr_zerokeyuvm_km_free_wakeuprootvnodeehci_initifmedia_ioctlpmap_pmap_ctoricmperrpps_countuserconf_modifywi_usb_rxeof__one_cmpldi2cpufunc_nullopcd9660_ihashgetumct_camii_phy_detachatu_media_changeumsm_huawei_changemodewskbd_add_mux__muldi3umct_cddb_qualify_ambiguous_namesuhidev_caurl_lock_miiip_mtudisc_timeoutrandomopenin6addr_linklocal_allnodesamphy_cabufinitinswubsa_closebootconfigscsi_quirk_patternsuserconf_lineslimit0rt_if_trackciphymatchuvm_md_constraintsif_attach_commonE_abs_targ0_Useduniqdosnamedb_recoverinflateSetDictionarypfxrtr_lookupext2fs_mknodvttoif_tabdb_delete_cmdbgetvppgrp_poolsd_cmd_rw12ucomstartreaduvm_pmr_addr_RB_INSERT_COLORucred_poolxscale_cache_purgeD_rngip_insertoptionsdes3_setkeyarp_maxtriespmap_uareacd9660_bmapaue_eeprom_getwordukbd_cnbellphtree_RB_INSERTrt2661_initdcphy_funcscom_obio_attachufs_dirbadentrybwi_rf_init_bcm2050bwi_get_firmwarelogioctlicsphy_funcsubsa_databitsgeneric_bs_wr_1_bus_dmamap_load_uiostrlenrt2661_intrusb_run_abort_tasksdb_machine_initsensor_task_workuhci_cdconfig_suspendieee80211_parse_rsn_cipherkue_activatepool_page_freewsmouse_inputwdactivatecopystrsched_nmigrationswdc_do_resetiftxlistwdog_ctl_cb_argsys_pipert2661_free_tx_ringural_setup_tx_descusb_detach_waitarm_pdcache_waysarp_rtrequesthw_vendorbwi_mac_testieee80211_encryptxscale_setup_minidataext2fs_reload_vnodeelf32_check_brandwi_cor_resetudp_initieee80211_recv_4way_msg3i80321_pci_conf_sizeproc_trampolinesys_rmdirem_attachcd9660_vfsopscpuset_copyem_get_bus_infobrgphy_5709s_funcsspec_accesssocantsendmoreproc_zapusb_rem_taskpte_l2_l_cache_masksiop_sdtr_msgcdactivateuvm_vsunlockether_inputlockstatus_splraisequotaoffbwi_phy_init_11b_rev4coredump_note_elf32fs_posix_sysctlif_slowtimouhci_root_ctrl_abortrt2860_setup_beaconwd_shutdownudbtablewi_setdefwdcattachufs_printem_rar_setfatentrywi_update_statsAES_CMAC_Updatesiop_startbwi_pci_devicesusbd_printBCDsys_statrt2661_txtimein_baddynamicieee80211_keyrunhotplugopenlineswmsdosfs_symlinksys_symlinkicmp6_sysctlclfreeconfig_found_smem_check_phy_reset_blockuhidread_filtopsusbd_interface2endpoint_descriptorfdreleasedb_line_at_pcehci_disownuvm_swapout_threadsural_bbp_writeknote_attachmax_keylenrt2860_ioctlieee80211_tkip_decrypt__assertif_congestion_cleardb_put_valuend6_dad_ns_outputin6_prefixlen2maskuvm_pmemrange_use_insertudp6_outputieee80211_prfcn_devvpcom_activatewi_get_debugmaxfilesupl_devsuvm_pagecmpuvm_pageactivatein6_addr2scopeidgf_mapdma_alloc_bus_dmamap_load_rawffs_mountrootrd_cduplcom_paramuvm_map_pageable_allsleep_finishehci_device_isoc_closeipqmsdosfs_strategycd9660_vopstimeout_delem_ioctlural_media_changem_cltickuhci_alloc_stdrt2661_load_microcodeieee80211_chan2modeif_delgroupspec_strategybwi_rf_initiic_cauvm_pglistfreebwi_tmplt_write_4usbopenums_attachext2fs_readsoo_statwskbd_cnpollckue_newbufrusage_pooldisk_detachstrchrubsa_methodshid_clear_localbufq_disksort_createehci_check_itd_intrscsi_sizescsi_plug_poolrgephy_capci_mapreg_infomainbus_bs_barrieruvm_pmemrange_use_cmpaes_xts_encryptrt2661_free_rx_ringuvscom_cduvm_pmr_size_RB_INSERT_COLORdb_deleteget_bootconf_optionauth_hash_gmac_aes_256crypto_driversiftovt_tabsysctl_int_lowertcp_backoffworkq_task_poolmainbus_bs_w_2sys_chrootehci_odevdubsa_cdieee80211_rssadapt_lower_rateumodem_dtrsr_crypto_wu_getehci_device_clear_toggleuhci_portresetrt2860_attachicmp6_redirtimeoutenc_xform_dessoisconnectingarc4random_bufpci_subclass_processorsr_wu_freeehci_check_qh_intraobj_pageruvn_iouvm_tree_RB_REMOVE_COLORgeneric_armv4_bs_w_2MD5Transformmld6_inputgeneric_armv4_bs_sr_2rgephy_mii_phy_autouvm_objunwireieee80211_rx_ba_timeoutbpf_d_listsr_wu_allocuhci_root_intr_donesyn_cache_cleanupip_pcboptsfc_purge__data_startieee80211_eapol_key_encryptifmedia_delete_instancefilt_timerattachE_ldsa_abs_data_Usedurl_caenc_xform_aes_gcmbwi_mac_stoprt2860_txrx_enableucom_breakpdc205xx_pci_intruvm_mapent_allocudav_miibus_writeregacphymatchicmp6statdb_single_stepgeneric_bs_w_4inflateEndexec_aout_prep_oldnmagicwsevent_pollieee80211_pwrsavesys_profilvmcmd_map_pagedvnciphy_servicein6_pcbhashlookupbpf_detachdVOP_UNLOCKpmap_uncache_pageehci_root_ctrl_abortuvm_rb_fixupsyn_cache_initcd9660_wchar2charieee80211_find_txnodeip_ecn_egressether_ipmulticast_maxsr_raid6_createohci_checkrevbwi_dma_txstats_freeuvm_init_limitsukphy_cdentropy_input_rotatesii3114_dmacmd_writein_pcbconnectem_free_transmit_structurespciide_dmacmd_writeieee80211_add_igtk_kdeVOP_POLLVOP_IOCTLrt2860_node_allocstatvarsafeprisys_rforkluphy_cduhidev_ioctlwdc_default_read_raw_multi_4ip6_copyexthdruao_swap_offmachinebwi_newbufwi_cmd_ioVOP_CLOSEbwi_reset_rx_ring32uvm_anallocin_pcbdisconnectuvm_vnp_terminatewi_usb_rxfrmbwi_init_txstats64sys_getpidnd6_defifindexipmultipathunp_dropuvm_map_advicetcp_mtudisctimeout_startupcue_matchrt2860_eeprom_read_2fintek_read_regrn_addroutesdactivatedb_print_sadb_elf_sym_numargsural_detachdb_trapperukbd_cnpollcdoreadlinkatdvd_read_manufactundstackconfig_activate_childrenip6_check_rh0hdrdomkdiratem_allocate_transmit_structuresnforce_chip_mapem_mc_addr_list_updateremrunqueueatu_initial_configsoo_closesiop_handle_resetumodem_rtstcp_recvspaceuvm_meterumodem_intruhidev_maxrepidpmap_needs_pte_synctcp_ackdrop_ppslimuhci_ifcdsii3114_write_regehci_device_ctrl_donend6_lookupieee80211_cache_sizeurl_openpipesukbd_countrylayoutbwi_led_durationsys_getppidsr_raid_request_sensescsi_ioh_pendingmii_anarVOP_READDIRdomainsrc4_skipsys_threxitsys___sysctlsd_cmd_rw6arm32_dma_range_intersectin4_cksumextent_alloc_subregiondb_putcharrt2661_node_allocieee80211_recv_sa_query_respneedbufferusbd_do_request_asyncin6_ifattachieee80211_get_addba_reqtcp_rst_ppslim_lasticsphy_cabs_notimpl_bs_rr_4wsmouse_srcopsuvm_rb_removeohci_root_intr_doneiq80321_thecus_irq_mapip6_multipathusbd_get_device_descriptorcd9660_initumass_fixup_yedataiicprobeipsec_soft_bytesmichael_initnselcollemul_elf32usbd_open_pipeohci_softintrmsdosfs_lookupspec_pathconfmountroothook_listhook_establishem_copper_link_autonegbrgphy_copper_statustcptv_keep_initsys_chdirdb_unread_tokenext2fs_diremptyuserconf_cntdcphy_casr_crypto_wu_putE_abs_msgin_Useduvscom_methodsext2fs_inode_freedb_find_variablexscale_cache_clean_sizescsi_io_get_donebuf_objectucom_activateip6_rr_prunejmicron_setup_channelsbcompresssr_crypto_rw2iic_smbus_receive_bytepmap_free_l1nd6_outputSHA512Lastcdevsw_lookuplogsoftcsys_adjtimerijndael_set_key_enc_onlyohci_device_clear_togglesr_ccb_allocwdstartwsmuxreadamap_splitrefspec_open_clonewskbd_do_opensd_thin_pagescryptof_kqfilternclruheadscsi_move_doneural_next_scani80321intc_inituvm_aio_biodonern_initheadusbd_get_descuvm_pmr_printvop_generic_unlockuvmspace_shareieee80211_node_leave_htrt_timer_addentropy_poolpci_get_capabilityieee80211_print_essidroute_usrreqdeextendspec_vopsieee80211_wep_encryptsr_raid6_openingsem_receive_checksumieee80211_recv_deauthsched_init_cpure_config_imtypetcp_dropicmpstatcom_irq_overrideudpctl_varsuvmpd_scansys_getrtablem_prependsoftraid_cainflateInit2_cd9660_pathconfin_pcbrehashpool_walksyncer_delaynore_resetre_tickin_arpinputpmodehci_root_intr_transferufs_accessin6_embedscopeif_alloc_sadlphpoolunix2winfnmsleeppiix_setup_idetim_drvsreassignbufuhci_confdsiop_minphysip_freemoptionssr_meta_rwums_matchsohasoutofbandddb_initieee80211_release_nodesch_setup_channelbs_notimpl_bs_c_2nd6_dad_duplicated_bus_dmamap_unloadieee80211_free_allnodesmsdosfs_fhtovpbs_notimpl_bs_wr_4maxvnodesether_crc32_besiop_setuptablesinflateBackEndieee80211_add_ssidcpu_reset_addresspgfindatu_rx_list_initobio_attachsoftint_pendingtcp_ackdrop_ppslim_lastloadfirmwareswcr_compdecbwi_mac_lateattachral_pci_devicesip4_inputtcp_inputsysctl_dumpentrydkcksumnd6_gctimerieee80211_ccmp_decrypturl_csr_write_2iptimerip_inputwi_set_txpowernd6_setmtuaxe_ifmedia_updwdc_ata_ctrl_intrdb_last_non_spacemii_detachusbd_get_endpoint_descriptor_tr_tallyudp_ctlinputudav_rx_list_initpool_sethardlimitpci_subclass_prehistoricip_freefvfs_lookupdb_show_cmdswdc_default_write_regrlphy_statusudbhashsizeicmp6_mtudisc_updatesun_nonamekmeminitnd6_ns_inputdeflateEnddevice_refehci_device_ctrl_abortffs_syncrd_root_imageuvm_map_submapsr_hotplug_callbackscnioctlrt2560_startufs_vinitsr_ccb_getehci_noopbwi_mac_fw_load_ivpool_primedevid_allocpgrphashtblcomconsinitrt2860_read_eepromifmedia_matchget_crc_tablestatclocksiop_ppr_msgaue_activatert2560_tx_mgtwi_read_data_usbdvd_read_physicalrw_enter_writemaxcleanpagesuserconf_argbufatu_media_statusMD5Update_intm_tag_copyehci_idoneinflate_tablesiop_pci_attach_commonpci_io_finddb_value_of_namert2860_free_rx_ringpmap_l2ptp_ctordata_abort_entryhid_get_itemrt_xaddrsmsdosfs_getattrdb_find_breakpointip6_maxifdefroutersm_devgetwritedisklabelsr_raid0_intrmsdosfs_printkernel_pmap_storeem_write_eepromin6_ifattach_loopbackstartprofclockohci_device_isoc_enternsphymatchupl_ioctlundefinedinstruction_bouncesys_getresgidprociniteephy_initatu_switch_radiomsdosfs_readdirdead_ebadfbrgphy_attachusbd_interface_countobio_cawddetachuvm_map_unreference_amapsoo_ioctlswap_officmp_redirect_timeoutforkstatwi_card_identaue_miibus_writeregi80321_pci_conf_readieee80211_recv_eapol_key_reqicsphy_servicenull_setkeyrt2860_resumewi_send_packetigmp_sysctlin6mask64db_lbuf_startohci_rhsc_ableuipaq_activatesoftclockre_gmii_readregieee80211_node_freetc_initupdate_modifierreaddir_with_callbackffs1_compat_writeieee80211_amsdu_decapdb_breakpoints_insertedpdc203xx_dma_startblf_decryptswdevtdisk_lockuhci_initbwi_rf_gain_max_reachedarc4random_uniformsbwaithotplug_device_attachufs_reclaimkv_intrsafeem_access_phy_wakeup_reg_bmscsi_xsh_set_tr_alignrt2560_alloc_rx_ringsdwriteohci_device_intr_startxscale_minidata_clean_addrwsmouse_cafilt_logreadsysctl_rdquadbwi_mac_fw_inituvm_vnp_setsizevmcmdset_extendsr_sensors_refreshural_cadefault_product_descaes_key_wrap_set_key_wrap_onlyip6_use_deprecatedehci_softintruftdi_paramuserconf_hist_intextent_alloc_regionsys_mknodbwi_mac_config_psext2fs_mountfskill_vmcmdsuhci_device_ctrl_closeuhid_attachbwi_rf_off_11bgufs_mknodpciide_phison_productssbinsertoobin_lifaddr_ioctlknotelf_advlockpffinddomaineephy_resetwsmux_do_openfreepci_device_foreachricohrtc_setcaldorenameatwi_ioctlrt3090_freqsugen_get_cdescffs_hashallocswstrategyuserconf_pnumehci_allocxbwi_plcp2ratescsibusprintnamecache_rb_cache_RB_NEXTehci_root_intr_methodssched_cost_prioritysys_getpgrpuplcom_detachuftdi_breakukbd_ioctliicprobewsonewconndb_fetch_regufs_direnterrt2560_set_basicratesudav_csr_write1uhid_detachgeneric_armv4_bs_c_2pffindprotocom_obio_caudav_watchdoguvm_pagealloctcp_saveti6wdctimeoutHMAC_SHA256_Updatenchrdevfrag6_freefundefinedinstructionuvm_pmr_use_incaue_cdrt2860_switch_chanre_pci_devicesaf2rtafidxnamecache_rb_cache_RB_INSERT_COLORnatsemi_pci_intrpciide_chansetupqsphy_ca