ELFa( 48K4 (   ""#CC((Kkk tۣe܎K܎k܎k$$ / /;0&00Qd;0 2 @00Q8$/ // @ P`D  B00 R "Р -L %k&rkmain() returnedr   ),@@(TQ 0/dvk0r - L 0 $ 0 $ -0L  T  T p-H$,$HP0`L@ 0p -0L(  -0L( _ "- L0 -4L\ ,00,0 200b104 0 ,00 200b10> p-0LSP P ,  4 ` ,  0P,00,0pp 0 $Pp@0D PT0T0S , , -0P@Lp8`  R   0@ 0 d -0P@Lp8`  R   0 @ 0 d -L_Œ @x`0 P  'H0!@ 0',0 0` 0 0' M-LM0'XX @X0 , %X 0  ( "('$' ,  pPP( 0"(X )%( 0 0 , 0'(h@(K 0-_02@P L0@ 0'0@-0@  0S  4000$ 4 @4@ -4L0S @440S - L0 -LM40S  3 lH0 ,P" K 0 Kh"P0@D0@ p-LM@`P3PUOx3e H0 P"00 h0 \8"3 @"89"3  : ""d0@0@D;A0@0@t0@ Q-L@"0 "0@0@ -PL4p`V$ 4! ,0 w0 """,0 000,  ,  0hPV@0D PT,0 0,0@NA0@0@0@1@1@ 0-0L P@ ,00,0 R 0$ 0 00  0 0B,00,0 R$ 0 0 00  0 @  00h޺긔o尻긔o -@L!0  0;0htsho -L` @Q;0 o -4LSPp `00  08#8<8#8000 08#8@08#803 08#8 08#80  0  :y4S0=0Sh=KMf4S 08#8 00L$H@0@@000 t31C0 1-L?rcWP`S V @ 0DPT0`T0d  D0PT0C4Q -LàL0L0Ϡ@blpP30 0S PVd~0P0,0 00P 03Q - @p`R0 0L PP 00 0 0008#808#80\4SX 03g4   -L@pX00S20W6 - 00` 00P00Zpd3 00X3  #0W  -0pS0L00@`% 000PU00S`U \[     8Q U J G DCr,1@D;AL1@X1@ -8@QL0z2>0 p-8P@L@`4 00 00S > S 0 p R  B  h  000 P Xp 0 00 d1@1@1@ 0-L@LP\ /0( '0( 0h' p-L@`B PUP00ShXP ?lp  000PS p 0U 0 0 0P 0UPp@p -0LSP 0S" 00 @ = p`Z8:Xo`Z6 @ 3S `V 0@ 0TTPPQ @Om@ {00000@TP303r8P060 0 308#83 R 00  b @00ShDC p-L@] 0P`dU  0#00PY YR`pp 0-LP@P 00dH@ @0cP' 0H@ 0V 0' -LM0` Pp @2 0S3  09P.0  0*0,0K0,0 Khn  KhS0S 08#808#80KhP  0P00 0S  0P3g4 Kh, -0`10#LP8p@P@ 00 0000  0 0, |0| 004 P`0  @a0@  00  x   1@ -L M0PSp 0S` K@K MPS 03K 3[8#808#83K0` P`h3[8#808#83K 3[8#8<8#83K0@0 4 @K?0K, LP000>x0   PXL0@ P0 0 0   ܲk,Ch= p-L@PI04`K0@p -2L M PRl2   ``0KST2`0 0 S<2004 plPRd0S| 3>1 :`@ 000S3033 T] >3dp0p|14 P=303@To3 `3`V㏏H0"S3R1  K0 ,pK ~K3 00,0K,0K3 f @4  0+@K*K( dK#t003 P3,00,0PVk,C L DCrX 㶶 0-L M|P@T  ߶ P00 K0H 0@`@O,J$0 ȶ00`C2@o o p-0QLM@`  `wxR P 0P ,Vx p-0QLM@`  `剁xR P P0\Vx p-0QLM@`  `VxR P P0XVx p-0QLM@`  ` xR P 0P (Vx0@- @@  P @   0 0< 4("4!̃,<,$,W0U VT0-  00  00 0 <4("4!  < $ W0U VT0@- @@P  N      0 00@ 0 0 0< 4("4!̃,<,$,W0U VT0A-P0p K Q,@ 0@0ll 0$ (, <4!4"<0cT$0 0!$` 0@0ll 0$ (<0cT$0 0 0 $@ 10ll 0$ (, <4!4"(00c0c$010ll $0 ( p- L0@P0  `;X8P5H2@/t3A2@2@2@@2@2@2@2@H2@P2@X2@`2@h2@p2@x2@|2@ -LM0@p  R 0 QP@ TG 0UD0$UP P 9 0S0U00T@,@ @ P"0!B203 0U>00!010!,0?@0p?<0,0 A00 P!0p20A 0?A0S 0' 0! <4("4! < $ +0) *(@! 0 T!0#40 TW(K0!0R0>0U;0U8! P 0 0S0S00@ P"0!B20T1 0U>0G0D!010?0p?<0!0 400000p00Ġ0U0V0, 0TW0020!0100?<0!0 000Sf0Ib0 ! (0 ! x= - L0p @05 $P i0$ , P0 * 0, 0 (0 $ @ 00 10P@ T`$00  0(0 00 $0` 00c0 " $;#;c 0 $ @ 02@ -LM`0 R @p  ti0 ! 0W0U V T0PS  R0 (0 0 0^W0UT0UQ< 0RP \ S 0S]0A@0!0?30P0200 >0!0?<0040!000P000L! 0 T!0#4 0T!0 T 0|P0S  P 0H0 (00h z3@2@=3@L3@3@ -P0 RLpẀ` @H 0S0800 0300#0! < $ +0) *(0! 0 T@00 @@ ""  0! <4("4! 0 000 # 0S/000 0300P 0! <4("4! < $ +0) *(0! 0 T0800 S0 0 00 0 s 0,0! 0W 0U V T0 000 # 0!000S0 x4@ 0-0@L $0P0 Td10 T0 p-L@P4"0B $C $`P Up0R $0N $ PR R @R pt0N TpD 00N Tp꠆4@4@|4@X4@4@ p-0L@ $00 TPx0U 0 $PpDe0@P T`$0 p5@ -LMp @0T 0T@ 0T 0T@ 0T 0T@9 0T@ 0T@A 0TN 0T@O 0TH 0TP0@00 T%020J T0 0!0; T0;V 0O $0PM T0 ;d@ 00O TM 0T@0O T0 3 DT0R $   0 S0C1 000R $  M T0  0P@" T`$ 00" 0  0@PG T`$0G 0  0T0 T0g -LM0p 0 ,0 G QE 0㊁8 0 0,0 : 0lppl 0P`$@(,(0 c 0..p .̠p, 0((< 4("4! l0.̠..l l j!loC芁 0p llp0@P0 ,< $4.4,$  0   :4PP  DK =PB?P0`  0 PP! `:PP 1, : !0` , x==5@T5@5@5@5@ -LM04 (@T ,0  c = -LM0) (@T :  -0L   1 <4("4! 10!, -0L @  <,$!$.!0\ 0- 80"(,#@L(P 80,#(0h -LMQ0p @Rb8` 0 0S[:01!$C0A0bA !!\Lt!`!!A' A10C0  101 - 0$N)` ,0  !< 4("4!,Q 0$\!! 1! c 100 Q0 0 m $0!00| = p-1@L`$  8Q 01ph -04p@0aA@L 00 P0U S` 480@P81080!081Q0C1 -LMP@ pP`' @0 0  B0 P` (0K0 0 *,P 1㳫`$K0 0 ( 04P 0 P 1 81 0 -LM1! 0SP@# *AT R0001 0  㢫pP 0  a .0 < 4("4!, ! 0A \!0  ! 1/< 4A!4",/0!1 0 101@! 0!080|00 1 !?\=LC -0Lp`Q@4P @T  4 8 1 40! T 1@01P R 0S 000Q0  PU@0i6@ -p4`0ALT㼠P 1@ R  P 0 < ުP s @@0<80P P8 Ta ㎪  0Q0 0ax6@(6@P6@ -LM0 @p`10! P0UQ@,PP G/c$ 0 6@ -L M` wP  qP NP0  PFP@ 0  00s0 00  0 P@ T0@ # , 0 , 0 0`  40 0P >  4,3Cp p0 0$ 0"0 0 0! U0V0WT0<80 (44 <0 (  4Z [XY00@! 0?<=0>00 <4("4!  (  4B C@A00! 0GDE0F00 <4("4!   ( 4HJ KI00 <4("4!  (  4R SPQ00! 0ge0f0d0000 < 4("4!̃, ,,4kj_ \ ] ^ i0h0, <4("4! , < $ a bc0`4 <4("4!@0.̠.$.T  0|$0 436("$ 4$#  4  (0 080 8 38("$$# ( 4 0 04 "4 4 "438("$$# ( 4 1!0< "8 < "838("$$#  4 ( ! 10# < 4("4 ! 10...̠ 0" ! 1.< 4!4" 10...̠ 0`" ! 1/< 4!4" 10...̠ 0"< 4("4! 10 ...̠0p! 0Q1R1SPJ ]p0d0 d 0, 0 , d1,0 S@Q2p\10\!\(Ko, <48 ("44 $" < s   @(Ko;(Ko   t PT@@GR J0!0 PU@@DZ( =CCCC7@6@(7@7@\7@ 0-PL@ $ d10d!@dA0h- 0-PL`AT R000d1 0  $ 0 -LM` TA(P0T1000 hQ,0 U  0 10! p0S PU,0SpQ0,0 0 $0S (00 1S X 1SX $0,S 'Z ʊ0(@'Z@P(Z X 00 0 00< 4("4!< 0Z\S0@ 1Y>0 1Y>0 ,$!$#< \10 I LS @ < 4("4!, !10\h @ 0Z? 02|R@ 1 Y>!0@\ T0  @Dh D2@|P".$2@|!.@2|0 S0Z/C1!PZ/B1! R0001 0 咥Pg?P1pPATP 80P80 XpP0) (\ 00: 1>, \ (  @0  !< 4("4!,10\ " @LXP @0  !< 4("4!,10\" @P=@C==P6@ -L M4 l 440%00KR,0 0 :4Q1 10pW# 0`00P0 @T ,00@,@ 0  0 `PR00SZ0S40% R4 hAT$00 0P0,  @,@ 0  @PU04 l10 0P,00@,@ 0֞ 40pAT$00 0P0,  @,@ 0hl @PU04 t10 0P,00@,@ 0嬞W 0@T, (0  0(0P( 0B0 嗞$ A $00CS00$0$00$( 5  R000,0  0@ bU(K004000!  Z40%eX8@l8@8@8@8@ 9@ p-@LT`0V <0P(00(0phQ,9@ -L(M0` $PD D0SM 0 ,X\ 0 ,Q::Q\:\ , 8 4 0 p @l3 Z0B (0P $<  Wm 4 (K0 T0S 0CTTZ >ΟW@ 0 @@@@sod.`#43p YW  4 0 80 , , 08 10 0@ 0 $<0@ @ @A 6, , 1@c , L $W5 0) !0 "$#(, <4!4",  @Lg|d Ja CB0t033 W  0 $ 0\04 $<0@ R R , @10t03%5 W 0$040 ( 0  0!"4# 8<#L4TB@ 1p0, \, A , 8p 4p 0 W 4< 00 ,P@WF $0SS,:T 0CTj 0 T 0CT  }40S 40(0, , 1@c , d d0 0@P; T`$00;  I@_ W 0 <#0! " l$ 5,01hu 1p0, \ 0!"4# 8<@Y 04 T@ 1?, \e 1=>, \Wi! 0"4#8,@  ` P> T< Z =0@P, \`,0@, *7T( 0CT  0T>04 $P5 $06 p$10!Rh 10P AT 0G?, \RM H`0 ,@, , 1 c<0nW 0$04 ( jbgJl \4P V>@6T 0T05 $0<04 1p0, \5T |0T0, , !b&4Q0(0U~|d R\ 0B< 4("4!̃B,<,$,O0M NL 1=, \U05 $<@)0 $P` #P 4P +0h 00 .@,>@x9@9@9@9@0:@x:@>@T9@:@T:@9@9@9@:@X;@;@=@$=@9@ =@;@d<@:@H=@l=@$;@=@;@=@,<@<@=@<@<@<@:@800 04 R P\/hx?p#8 @0 (00@ 1?, \800 0  -LM0tp庐4 !0 0@,0 0` T$0!0(0 ,` 4, 40 <4("4!  < $ _0] ^\0  ,,B @P  0@PC(@T     $0  T0<00%  00t!@ t1ptqG0 PU <PU: 0 0 R U. (KoD0S00 0(0(Ko芘(Q 00`S  0S,0S0 0 0   00 , p  >@ p-LMP`P+gυ^O>.ZVd1t!l \|0`apahaXaa`0@`003Tad|@K3300  xa a CH7 -C=  L 40C 8$R2 d #8X$ -C=  L 40C 8$R4 h #8X$ -< <0L00\0  (@ $9;90@-9 0 0@0@0 0@0@ -L MA0P` ` ,0K "[P1RC R $K2[mCX#X4`+p@  1 R0C8 p (K"[p0 R2K"[0X00@ C=   00   &0Kp p0 00@0@,[D u=@  $0'$$$# 0-MLM@P90000& 1 R+ 1 t!0Sd1 KX!0KL1AKA AP(1K R000K003X000 K  0C,K 0AKA AP K00C S񟗼ꀌ p    `     P 000000000000'D -80)0L 0 '0 0   p-LMC= @+P-` x0 00> `P0 R0C  (P01Ł 0PP9 x+r 00a=C4`#hh 0`=xQ C= 4* `C-0`:0'8'>@ p-C= LP@p0`   000h凡2  4R` ^L00 S 07_PV@p $,$|r4$ -1@LP H0 `p 1 R 0 0< S\  SN  SL  SPS000H1  R  ` ` ` ` T 1 9 0 R 0 0 0| 0 R0 R S 0 p0 `0 P0 C=  0 0 00$' -41` BpL R ꐘ ܗ ܗ ܗ ܗ ܗ ܗ 0GS h  0 0BMP@ P l0l pᲀ\0 R     -L\M4@KP .03K/P3#K 8#c[Qr Qn 0S3Q  .2 3K2#K 2["[`0 2[d h0  .2 ㌂#K3K0[[3 1C 0"Pr0!2"[0<P"KKK 7 Py Ps r2 ">?DFcà.L !2c N"10,Ϡl`P!PdP0PhPc 0` P@(K T1   D1`  T!T1QQZ@K&..05K015K P-V0[@S*T0[.S'Q0[-S$N0[S!U0[S[#!BR[ O[3 A 1C "P[05A1!1 00 `p["[2[D1'X=$ $t3AhQD?@?@v'N$0R@2@ 0C 0h90CRI l2Ry 0R X2@@00CR0 0R( 0? R2 0h,0CR> 0R1@@00CR 0R1@@01@@0 1 01@@01@@0|1@@0X@0  -  -041@@0$1 0h1@@0 1 0 ?0h0@@0 0D ,0 0h 0 0R |00 0 ($ C$$ $,$?@ -MLMC= 0 p 000CSp(KBKII 0 D %0T `0S` @ T [pP@VP98! #  $1  pP pP04 9(K0P @ A(0K  0  pP pP9 (0K 0!(K  T0  pP  pP9 0  ' -LdM℀Kpd,2 S108K(K9<ô99<%P@`PK+  ,TP` V0 @ +TP`0008#88KT0  K40 d+100' -LIM\0R,0 @, 0RJ(KK G*8K C*0D"0C4K#KK t0 B("(S04"43K@BK0 5[90K, 5K'**K2 "*L (@ 0 B($[4[Q04KD 0 D B0000 < { L(@Q0 B'Dt 0 0 0C0D 0 ^5[ K R@0 80$Ba-#$@@'Cgfff 6S-LP` 8SB  op 00Q8  X@#8  00Q`8X@   #8`@@Dt `X0 R0C  (9Tp<@@$ -LMt!0 0 @P  @ 4QPEPuD q 0aR0 ` ( U3 0R" D ( R4 h 0X 60aP?`VP\\0 R0C6 l P0XU<'@@$ -0L R |P|`|@0 $<< p0T 0Ti$ 0-@LP@40 00 @0@0@@' p-0L M @RP+ 0`0 P PEuYKpUC-000X01KL01K01K0KC-00P$'@@ -LHMC=p$Kh`KD'0 ZK P' H(@"(D0#K0K"K0 0H00< 0 00P |' A@ -LTMx_l p@p hC=` P  { C0/0 C=P  &XE?*CmT  C>T N0CT Q>Tu >TB-p 0lX >Tb 0CT 0T  p0l0X 4X. X0S x 忒x\ 㹒C-0 :0m`(K=T =Tu =T4 =ThP 4XX l 6@ x xCd=T` '0CT 0ThƘP,= R   奒p X ,UP4X 0 S <R  R 0CR H= Xp0X,^V p }p0X \,UP l 6@= < R9 XCP hhxPpzX \hlP Qp X X+UPX0 \U;Q= ;Q 2 Q<  Q K0XPXPl 6 0#0p  + 0*0004K?4K P;$K NK:Q !0Q;Q |:Q :Q x:Q p:Q X:Q\ H:T @:TF 8:T,:T# $:T :ThPp{X 9T:p X 9T 0Tl 6D = S @S 9 l0&9 p9X 8 Rp 010   哑,X X0/ @9 XPX0 8R p 101{l 6 8 R@ 0mp8X 0X <08 XPoX 0 Sk !WX0 x cxp  ! &UxKh[Ps !@p0!  x TP xX 6 Q0T0 p X 0T 00bZp 0{SX |0 P\ d0 t UW t0 `8  |@h $ hA =t0 0$30 R0S   $05 %<0 S  S  7S  nS  0t B02 R B000 C B0 2 R0x0 h`$Px00x0p0\ | SPp0 T0 p0 X 0T 00b Sp 0d | Sd :|0B\0 peX hP p X X!9SPrX4 я$2X 0X0, 82 X@PX p0 㪀 X巏1X 0X0, 1 XPX0 p0!h㵕Pp 1S 喏?X 0p 1X 0X?P!l 61 1 p0?@ |r0A@ii i5i i i iiii 81-71$$%Ci8i|6i(iii8i i #A#C gfff8A@B#($$'pX 54p0 ! SX (U !0  g 0 Rh 0 4K04K0$K NK[| P1Rc 0RP 0CRk  PB XDI#hL1  : 0 R; h1 4K04K|AX0 u $5#2 0T X 0[1>,0X ꏭ@ x "xP X 00"0X 0S00) 0XD ##D2 RhBX0 u $0X 02X 0000 X 00200X0 T 4"X +002Q' D0CQz >0QDv3Q. 0Q=(3 RX D3  mC= u -C= p jC= @k bC= f ZX0 OC=  Y 3 R 3 X=1>,04 -LVKKEK5K!04X3K03K0 M !2K ! 6K3 R 9 45K05K3K C= Y3PpCP! 0,pK0  Pl, |3  d P]C= ,0C R<% `9 @0;9< RY&;! @0Ÿ00VK 5KKEK2! 0\05K20K5K 0t2t"5K K%K 00@2K05K?5K 00";71QK5K0DA5K 1!5K %KK01! #000 d1PL 0SI P D1D!5K 05K0%K 905K0K5K0)0 Q|0KK5K0'  ###: -$$dA@@A@ $,$2$0$$*$! -` L@LtPi@Dte q쁟0 ( TXA 8R  #8X PR 8  #8X PR8  #8X 8#8 XJz/ pP 0@R0 ` (  0R  ( R4 h 0X Z9 T4<9  00*<<$A@A@ -LMP,0 60  Pqa,0> R6 l @V R6 l 0X @R6 l 0X 60 i@P R6 l (T0P R6 l ((0P(K$4xV -L0M`P? QC D3P 83QX Fd0CQd  80-P/ @sR8 p 0X R8 p 0X\ RL8 p 0U2  0lP (K0SD2.`K0K2K02K(2Q: 0Q0SX2K?2K.`K02K00C SKt l d \ T L ( 0!02K0"K.`K2K 10S: x10S. S08#[.`KK}H!TK0@20pPK&W?D  K5K0 P@T0 R08#P 0H2K.`K0"K2KC      $$'!'#((($,$ p-LM`80@PPP<<0 R0C8 p 0Txx$ -3LM PR@v"0 0!P$ 80 P4 娂 0rR8 p (0`P 0R8 p (0S (K`0\ RL8 p 0}T0? SD 1 R 1R 1R 0R d0CR< 0RP P 0AS@ , $ L   D <       4 (1Q% 0Q0S? .PK2K"Kt0\ 0S40 00 000 .PK2K"KV<8# $'$ #'(( -LLME0 P5 0Rx5 RN x`P ; 1 #0 0@0@(KDp0p P <C42 D@F Q000P@ @|P  㣨T4 RH4Q Dl0KP6[p5[p0 `P ; @1 p0 00pC bp b3 R 6[* RV  RT  RR $[Qy0H# 00. Px$3 P  5[  2 R 2 RlK @P dS yT0 0S Sk S2< @>h<@0 fPb=  QA$[P& >K 8K  *K  0  0D P 0 0@0@3-갤[>0P 6[T! lKy0 <0< P 9 <00 0lK CM,@ 0[p GyP 9 00 @0@< G0 ~ K'' $($B@A@B@LB@B@C@ -C= L 9 s c @SR2 d 0X R4 h 2X訢b r0R2 d X 0R0 ` ( RP4 h @2Xsc 0R" D ( R4 h @0X1 Rh &4  1 R0C4 h :X``1 R0C2 d P1XU 2S?1 R0C4 h 0X0 R0C4 h 0X R4 h 0X R4 h 0X~0[x$p -L$M8888H}/` `P, 8 $K4K JKpP w, 0R(K  FK)V ܺdh 70P9$ ! 0|1( =! `  P ?DD7D'p0C 0'00(7 ' <07 pp0d '006 &6pp ?$K3K@K0P66#[   6Q Q) Q +>3K ,6$K P3[SC-000  ,u 4T 6:@K3K 03K5 P5  [^5ࠃv5  P BM@%5፿ 0k 0Ce0   0S 㴓 9 x.01h0<9 H ܲk#E@E@(E@F@P=F@ $4F@F@'hF@ -9(L`P"x vlL(@T0  ]     qhF@( -PL @`p94?!R 9 <#3 !1S =!R㮷듍0 YPP 1 9D  `1祻0 30P8PD " 2R:0O  1  0 0@0@@0!0 1Sq@p10q"9  "0% ɵ`QP 0xpP 1<1$20$28G@G@B'`G@ʚ; - LPDp`吁P pE 1‚32C0c0QA20`><@ ,=A?0C @300 0@0S 0 0=800- 0P0 00 4 f,0 p~H&$$ !' -SLM` 0 ʴ9b(K0L 0  0A 0  V@K0KPK P0SK 0KPP 0 WpPQ 3簺Q> Qb 9 \(PH2  MC  ? ; 0Y$ 2ᲂ $ ڨ K0 K& 4۴8c Դ 0Z2 R@ 9 N1  =!Q ʴ99B @pᖵWx1 R0S( S Y@PU 0  Q9 A 0R  R1Ḑ0 1 @PU @@P@D@T 9^  LPP@101A 0@0'(G@G@TH@&$H@G@H@ 0-9]L@0P {0 R 0t0t P00h0X0 qP  x +>8 , 0h! $&$$<!|H@ p-CPID@DL`0 #DB@@0 00 R 0\00 0   R 0 0 0 @P-00C0p&$ -LM9pş@`h5P, ph P5MQ0@| 0CQ 0CQ Epş, 0R(K4Q :4Qpp54 @T  0{S|㨐K 000@TI 0|SE:|pH|  Kep  KapL4K0 6K34K3U K#4V0Kf KK:00 e0Kf K:0 f [(0K0=0AfK:0 f [(K 0=0AfK:0 f [(0K0=0AfK | CpP 2긠K  BpP=  ʴ@T 0S`؀K@T 0`S:pF nK K3 0X P jj@k3S <0$ 03@T@l7S <0$ 07@Tp -LMħP b0Pe 0 0@0@0/"-0?0b b0#RO <0(C\E 0 00 <7(r\ 0 00 W2@7#<07(`V  $0  B< $s 03 0 0@0@0 0@0@7rW;';Q;0ħ;š 8<*4@0T 0-@L2PᇂP30L# 02T -LM6P+`A@: > 7p 0 1S" kP& 020#RG KhP= P?1S# kLpP  1S0  BPr0CW 087<*@04T06 00S: BQ  10R!!  10C1'7R 6;61S kj 00 @0@ 00S: BP  10R!!  10C1 0-@LCP2ׁ@*  L39@:ᒭ0hCL3 P30S <2)S@* PL 0-LM'P" 0  @@RC0<(\ ; B$0   7G7GG8 -LMPP ; @P7 0!0 0 y<凁0g 1 P : 7(K<(\' $0 <( \,  0 00 < (\ 0 00 Z 90,0 0G,0@,0, ?WA0 @<(\ 0 0 0 ,10<(\ 0 0 0 0/"-0?00b9\K@ -L@:?Sj7P -L M:PP0 Ssd3 0*R1z01*zpz0/"-0?0Qb[<I( b\pO 0 00 <(p\,p  0 00 X=1@w:<0C:(`V  $0  < $ d#$2 @R``  T 7S  0 0@P0@ M 0::pX,p p (K:S0D0 0 t!0Ca% BbQH1 L! 0 Q AC1 01*pz0 D:: 0 0@0@0  @: ,0  202, :S 9S202P   0E  2022:S 9S* 00C0 0 t  0-@PL ) YYZZZ0 0-L84@7 0TPPU 㘭8047 $U @:  84 0T0;K@ 0-8L#88P814` \@@lT 804` ,PT 0h\K@ -PL@p` d#0R  0i[VT)!X)!)!)!)!)!)!d 884#8XiD 0f h j {b tK@ Qp-L@ plR 884` \PPU 804` ,`PU  p804$pK@ -`LP@ឫd#@1pR  @H$TUU* f U XU  {تUӪU Ud 804(@Īj 804 $804h (@804b (@@tK@ -LlÐp0 6H804P@T`$00P dl804@PP T`$00P Z804@PP T`$0P dIȀ P 804@PP T`$0P  -LMp,  804@PP T`$00P d804P $ 08#804@PP T`$0P dXʠ,0尐 -LM8pK@4P0 P T`$<<0P dثZ*804@PP T`$00P  * K804@PP T`$0P 0"[0 X 804@PP T`$0P (K -L M80 "Kp@ `4,$, Rd# <R( <R 6CR R!@:Q @  Rh R }R  R@:8@ Rw {;R 5CR@: ~@ @ 0L: F0}0T:T:P*d3(+S!0Xp3 }0p3 X@:@ ^ @0PK80 4$@Td#:R :8 :<*O x:\ d#0S \Q "(8 6 $ < Q*~> 0~n@ 0 `@,0,PI  (KR  R R@ @  @ 0l3*K0C"[`96@KR0l30 0PK :00[S/0[S.0[S-0[S,0[S+0[SZ   +0[ 0+0Kw<7}'2 4P tK<0'0P8@ :<*`<= 0  0 P) *<0'"8804S $0!0@p3 SL !0p3@:0@:d#"l@<7'2 P@ ,<0@T 2<? 0 0 P@ @[@Q <0T<0$B0p3@: @ R R@:@ 5R! A:3R@:% ~@ R R@ S @ R R RuR R R@ @: @ z@  @ R Rr@ Q @ mR Ri@  @ R 05R_$5R &RYRR 5RSN<$ >?@D0 0@ ,,P Ns<>0* 04 4P h;<0 *0Z<8>  0 P $<0#8<)3 P@ <0@T7 1><0 0  0 P@ P@\@Q <0T<0$804 ,B 804,00g Pp@:" 2+12"12P1!0 @B yd#0R,1 R R0,1,1D"9,1! $ @:.  0[ 0V1!T312^@X#\3!1<8#8; 0` 0 `0 @:" 8 <(4"4!<4 \ 8 <(4"4!<4 \840D \Kp84 0 \8@4 0\ K`qP @@i P 00 @  01 0 0 T -LM囦 0@* )0i0 00888#8#84 X0K <84P 0T8@4 ,0\84 00\8@4P 0T>98p,P`04 \8),04 \'8,0@04$ \'8@,04 \8 047 T :St d#1RC 84@ 1\84 0T8@<4D \ :S1 84< 0XX:8@8#84> X8L 04\d#1R 84 1X :S J(K84@ 0\X*2Zy804@PR T`$ 0R 06 @0;6"@:9@:ѩ84@ 0\t? -L`P㫥pD00 @0@/3hM@ -PL@`p匥D1T% 0CT-  0Pa@4T դ0T 0T02.≩@4T6@ @ῤ6 @ Fᴤ@608#8@6 0 RPB@@ @@i 5i 6i( -;L@@`84< 0X804> (1PP P`PpXQ5 W <2S48d!04< X804> X(%7Pp` !00" 00p -  i`@:  kcp_`p``  804H \K`D H F -@QLPppU@^pW?`0OOP$ 2>AB?7aPP``0O?0@@ cAQaQ p- @L`0T 0TP$ U  $8P pp -0L040 T -,0L8l02 0$CX6k -,0L8l02 0 $CX6k0 8$C0 -1LMpQKP 0K 00`P 0@  T 0@`\ ڔ 0S 00 S R0Ġ T 0$ 04 000Ġ@Co4ukoakj!o -04Pp008@L `T0 T0  00G  0Tdڤ $)dѤ0 T0@@P*P 0T 0T 0T0 T $P 0T0 T -0L`4P 0T 0T 0T 0T 0T 0T0S0'0 Tp0 T}N@T P $  T 0pWd@}~@ $ pW 10@W}~ $0P0P@0T @O@ 0-@L Ϣ04 00P T0h -0㈠4p0  LT64 Qi  $  0PT  0T  0T  0Tdѣ@T T! 0  T0Sq S\S!Q!hS!R!S!(S!4S!tS!S!  $ P7 P%00<<0  T  $@P90  T  $P000  TP00@0S<< 0 T !0 T  $P  0T0  T  $P00  $0`  T  $Z0P  T  $0@  TZTU000c 0} 0 S0 00  0T  $q0@  T@0  T0@ 42P ("(Ÿ0 S[00 SY QT <  Plf 1 R0  01vQ000pzdQ s000Dm<j4g0@000~m  $0 r0$ 0440 0S0 }0 @0 0 00\oO@4ukakj!P@`!G! \!P@P@,P@HP@dP@O@O@P@P@$r@Co'P@ -PL `p@ 0TW@DD0 @T0 T 0T 0T 0T0 T $i0 -LMP@pP 0`P  0<<0< 80@` ,0 $ $0poHC$ro@CDCo<C 0-LMhPd0d@ @0P @0S000,0 0K0hono@Coo <CQ@ -8pLW`4@P t0  0@#00C S|Y!|Y!`Y!W!W!W!W!W!W!W!W!W!W!0@2Ÿ 0i9 @0TP 00 T0 TH40 T0 T0) 0KSpږ SpGpӌ0SY p0 TdW $ 0TdJ $0S2 0 T0 T 0T 0T 0T 0T 0T 0T0 T $<<0 pT<Co -LM@`p᪟}^PU  $  0 T00 0 }^PU ʠ $  iٞ0 oo -LP `op $  $@ $ᵞ 0 oo -@LKt0  0t0 -PPLL 0RH 8p6@堀`T Q):W0  t0 o{0 0040 TkT*tt ` x p0 0Rp0x <T l0  2@ 0XX6k> -L M80`S4@删  $8 , 8  $PP 0  0, Py0  , 0  , t0 0t0| R,0H╕, ,l08"20  $R  $p lP 000 -0S^ 00@ 1 R4  $p*  $0U :x t0 0Rt0x T<x0pP0UP, 0 0 00 TPu#(K0, l0 20,Pw 0 00  Tl000 00妝l0 20,^X6k4k -L M@0pPtpx0p0t0g<<0W ``U 0p`Kn@t3A$Q@ -LM⬑P1p ,  A4`pt0 0-7, 0R/(K|0Sʤ0 0 H0S t00t002 000 H0S H@TP0 00 T HR #K.PP @ D 0@ TTKG00 Tܲk$C> -LM#p0`0Q(@0P4,0 $0S T @(K0, R@pp  Rp  R*    p0p pYp# 0S $0R 0Y0! t@H"2d |@|@|0@P0C|0 8WApp0,00 T, 0T0 0Si $0KS00, T0000N 0N 00$0(  0 9S0&6R l0d!20P  0 00, T@n,0 T0  ,TI4,0 T,0 T0,00 T 00, T,0 T$0KS0!0, T0, T$CPQ@X6k -LMŸa48@, l ሠpPP(K0 P`2Wh T2W4 @0CW6 42W I1CWd ;1CWlP 00#3000000*000 , , T0 00 0 0 0H1WG 0W0 @00, , T1W 0W000 000 000000|0  @@0@@@,  @ LD ,0@$P@@a0 0$CX6k]t@yt ktzt lt - LA8P4pt0`  0  l0 20 㳛t0  t0 0t0 N000 T<㨟$CX6k - (LM(" P4 80 0qW ~8P@U Ӛtp5p% 0 px   8kPIg , R; t0  ,幚@(K$ $ 0  0 0 0T 00 T $0  0tt4  0S ,z@\$4 ťt@P t  t0S  ,Wt@́tp3 0 0@>K`가 p-0 00 LR`#ڔ0SP00S PU@ 0@9 088P;<:T8lpP4ukakj! 0-LM0@SP ! 0 10 0 R<0(\  $0  B 0(0$0 08 -2LMP0V/,1 1b !, ^'`    """Ƞ  (@T x!x #"BPT1 !/b32Cc,0 S9 $$1 (`#rBV 00@  0 h00 0 R00Q  , $ $!,""̠" $0D ` 0\(K* -LMpA  $(,    $(,"(*"* R   $(,, """Ƞ !(@T G/ #"B 00/-000b 0 0P( 0C3`j\,  00 @ t , 1JP 0L$Q00 808 ( 0\(K0@ 00CSw!x! x!x!w!,x!x!$x! P P@7P,@nPX@l`0 $H0AhSw z!$z!$z!$z!$z!$z!$z! z!z!$z!$z!$z!$z!$z!z!$z!$z!$z! z!$z!y!$z!$z!$z!$z!$z!$z!$z!$z!$z!$z!$z!y!$z!$z!$z!$z!$z!$z!$z!$z!$z!$z!$z!y!$z!$z!$z!$z!$z!$z!$z!$z!$z!$z!$z!$z!$z!$z!$z!$z!$z!$z!$z!$z!$z!$z!$z!y!$z!$z!$z!$z!$z!$z!$z!$z!$z!$z!$z!$z!$z!$z!$z!$z!$z!$z!$z!$z!$z!$z!$z!y!$z!$z!$z!$z!$z!$z!$z!$z!$z!$z!$z!y!0 0 R Q Q0-L@P  R  0@QT  08#0`08#0@jPj|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!      -Lp0(S0:  "4""\,H,l,00|@0 P` @ T0Z Z 0 04( 8"(<;!#!? ##Ƞ 0rJ QZ Ƞ ,4Z0 8 00 0L0Ba21C0aW  Q  R ,{0 0 颋. -`Lp@8 0\(P320 \4 0\PP QH00.\8SM0 08 \ -pL`P0O/\8-0\@Q/0\R/t0\-X0\@Q/@0\R/(0\p8 8  -LM(p0(Ⳡ`R(00@  ,0 Z, [,P<0, \ 0H \, P0L \8S 000 p-LM8@SS0 `0 0P 00 R x8t t0g/B(\ 21C $0  B x0 00 R8 -\0L R L0L 0 \$0$ 0 \ -,0L8$8  \F -0 d@8`Tp4 P0L< \ 04 \ -0 d@8`Tp4 P0L< \ 04 \ -hph`0@PL ,  4 ( 00 , 40 p-P`LLP@ ,9 0 \pPꄅ!!!!!!|!|!|!|!|!|!|!|!|!|!!840,($ `Q@hQ@pQ@xQ@Q@Q@Q@XQ@ -LP@@ dT |`|p0 ,PdT  4%#61 \1 0mQ@ -@0L @R < )0 @ h -L@PPĕdU( pĀ0 ,idU  49 \PꪕdU \0\  ,0 P$QLQ@ -L@PPdU ```p0 , dU 9 4 \m!Q@ p-LP@@[dT P dT8 p,`@0 @@TpQ@> 0-@LPiT T$ 00C0S 0h -@LpPT` T``t0tP A QR` L@0W/,080W/\ -LSLHCpT 0`\T 0\ݔT 0\ԔT 0\˔T 0\”T 0\㹔T 0\㰔T 0\㧔T 0\㞔T 0\㕔0T , PPZEa夁@AT 0\}0T \tPUZT 0\iPa0T \\0T ,, Ŋ@ ȠT 0,PE\GuT 0\<T 0\3T 0\*T 0\!  -Lp  à  AU0 Ƞ!H,Ƞ.P$H P= @l 0 @`@@ 4#T0`G]4P@ 4*T0P( -L@0~#`P00V0ST3PF#0Pp1p#S,꼐!!P!#@ 9!41!/#)D )VP! -#\!X1!#@  ,1! #)D 1V  ~  0!#)D  f -8 <0!  -S>$>>>D>|>>\> -LGME=|2pt2`l 2P AC81 , XŸ4!  00 PP`~(2Y P0 P \0CJ͇0@40C -1LM` 0CS 0-0p 60LSP0CS006 0h0宽00 @0@0@@90 -PL@`p嗎1T* 1T2 1T  4P@2 ލX10SL1T; 0⪍@4T͍@606 0S. 6@ @@ Gẍ@ P4P@8S 6A0AS@@  ᛍ0⸍@006A0AS4@Di i i ϖ1i 9@0 -LM0p,0 L! 00@D  ᳳ D&P 0` L!\Q 4! 4 8S 0<1 V7 PʨX 4Q Q8S, S 6,x0CPƟ 2`\1 AC0 0 PP00`U@@TST6PU @P0@418&006 0J͇0640C @<7P"<`0T1 2@Ÿ@X P T! 0 H P1PPT@8  h廻  44@Du @@H$D8a  @0_0@0 01@! 0PPS@!ʔ㇌L000݋L! 0P T  X`8,PH,,Z(\ P!T1` $0` (@T 0#"B` 00`|0x Q 0 0 p-LM6`=@SP2 x8S1SU kP 2 .R1ST k@LP  v K@P P  v Pi1  06 00 BQ@r 00 BQ 1 R`ʃ.0@ BT10S*0 0  P  u 'P x 1ASq Bx 00S:A BT  10R!!  10C1 10R''  88 0C8800  P6x;6   xxQ00 0@0@x6 ;6   x< -00L M`00 N TW0<4 8< "0""(0 ,0(@qJTP 1!E=C#0"B,0  (\ ,0 $0  B 1 @$@0\@ 0X0/".000bA 0$!10p3Pj 1(0\,0 @ 0  00  04 8  0S #00S0 R40 `0 R`0C  R P 0009;90(Ko(K\R@D<4 -0 LM`, WP P8@080   048< ""0"(ဂ0 (@T `2`"0#0"B,0 (\  $0  B 2 @$@,Q@1!/!b32Cc@1!p`0(3@j\<P 0C  00   048,+ )' 1JpP}(8 0(80 0@0@}0 0@0@q(8 08(l0Q40 R`0CP 0009;9,(Ko.Q(K*R@ -LIM4 , 0( ,4 4b $`00V< D1   tPP ; 1 Td(\  $0  B 0$0p 0p;P@! P,  -00.  /00D@1 048<#8@!:#:0 0t3 R: Pcds0D ,0@@ ,PP0I͈   3# 0 "0 n0 0CI=$1 @1 ,1 00 @0@30 0 0p;P,00-  .00/  0 0@0@{H@囸ܲk<PQ,T >R@ -q0PL ,p` P 0\@0 \9@   @  \0\~ym -@B #LU[@Q \00HS X00 0R B0HSQ -`PBM(@LCx尋 ᮋX'ꐹ!p!\!\!!8p}8HS c'8SS1 v(R6 R 8s6 T 08pS8pNߋW0 8 0\ IP  Ps( }㺋庶7R@B #-Ǭ 0-@L㮇8PS 0, C }0h蘋H! 0-PL㕇8@S 0h06 -L@R4P 6A0AS 4@ Q -LM0S HA(\  $0  B 0$#"B 80 0@T0 0S) p@P0S  0(`V $0` 0$ pQ 00 0 S@oDQ -0L(M<  $0 0(0pD< `#@`P@  0 P ~ (K ",0K0 0P *,P ٵ 0(,  04P  0P P <念0廵@ <0B,  QPt < R4 0 3RRP ;X w;!W  0@ 08 1@PL8@@@0 40<S00, 000  -00.  /00 104 M?C@P0 04 P 0 8  @P  Wb|0(\`  $0  B XlE P\@ KL;F<6 AR@S@TS@4S@S@S@S@T@xS@ -LM0S PA(\  $0  B 0$#"B 80 0PP1 0S+ pP@0S  0(`V $0d 0$<0Q0 00 0 p SoO -0LM@ 0(0$000,0 "0 0#`a0p@  0 PP 壴x(Kx!,0Kt!0 0 *,PP @労(1 0,  04PP 0 PP ok0 0B,  OP X`ʹV `0 00 0 PP` 0C(? PR@S@TS@4S@S@xS@ 0-@B L(⻈0PC ⸈ᅩ>C(EFF80 434#-`LC  ႇB ( }2" ,R Mc2pCM0 (@޳0 P xճ E]P P Ddz  P 巳F  P 娳 }F8 0PT818 㴈师?x ?P@㏤\1P/UN>0@<1+>!!!D!ܷ!`!X!! \,T@ -LM0@S  # 0 30 S80(\  $0  B 0 0$0 -(LR000X0 000CS!!! !!$!!! P P@7P,@nPX@l`0 $H0AhSw!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!0 0 R Q Q0-L@P  =  0@x=T  08#0`08#0@jPj!x!!x!x!x!x!x!x!!!x!x!x!x!x!!x!x!x!!x!!x!x!x!x!x!x!x!x!x!x!x!!x!x!x!x!x!x!x!x!x!x!x!!x!x!x!x!x!x!x!x!x!x!x!x!x!x!x!x!x!x!x!x!x!x!x!!x!x!x!x!x!x!x!x!x!x!x!x!x!x!x!x!x!x!x!x!x!x!x!!x!x!x!x!x!x!x!x!x!x!x!!      -L@8Ơ#Ȍ0 Ƞ,<.L p(8H#8""l$H"X,Ƞ.0@P`p@ M0Y Y 06 04Ƞ8,Ƞ< * 0"*#"#? ## 0Q @1 0 0 @ ("<8 #8"(T-0, I u<Y Ƞ ,4Y 0 8000P0Ba21C0aX  Q  R ,{0 0 颋.@Ph!`!X!P! `Q@U@0U@U@U@-0 02 \0^  ^J@^Z@40^  ^V@^d@@@ -L M0pS0 1, ,  , P @0S 00(`V $00 0$00 0    ,  Q8H00(\  $0  B 0$0 0,0(0(K -@LQ B r[@Q \00HS X00 0R B0HSQ(RB ^ 0-PLE8@S 0h虀0 0-PL@4 PR08 R  040 0   0   B |0hIKd` -`eVLpP X0QP 0@S 0SPT[P\ p-PL<0`Q 0@S Tph?\ p-P@L0`cS$ 4KPP π\\ 00 0 `0  0Pp0cSPd` 0-LP ( K@P 00 p-PL㛀00`Q @WTph\ -LM0S @A(\  $0  B 0$ #80 0@T/ 0S(@Q`0S  0(pW $0\ 0$Q 00 0 S@o^J -0$ML0<  $0 0 S0p`  0 @P 0@ 0(K ",0K0 0 *,@P | 0 ,  04@P  0 P0  ۮ0@֮0<,   2JPk < R0040 /JnP ;P ;!O  l  4 83@P 4 D8 @@@ 40< S,00-  .00/   14灁 0 P@P 0 8  @P  zix0(\h  $0  B `hi @WXd @RD_N<[ @IR@S@TS@4S@,(S@S@S@T@xS@ -LM0S PA(\  $0  B 0$#!B 80 0PP1 0S+ pP@0S  0(`V $0d 0$a0Q0 00 0 p SoI -LM@0 p! 0,0(0$0#aB0  0 PP ̭|(K|1!,0K0 0 *,PP D峭,!0 ,  04PP0 0  PP 嘭唭0, @  HP W`ʹV d00 0  0 PP` 0k(g PR@S@TS@4S@S@xS@ 0-PB L(0@C ᭢d{@AC4@TG$0PeH0 -2"LQ`B 2QB 0@ 2 "9!2"10@!0` h89szT1!19!1)3!1#3!堟K  X0qd1  D0C!@<0D BD0\ACC-(, P 80h詬  8p@$P㤝1P DU=0@@ P㖝0P U=0@@㉝0@ T=0plDU@8U@+>+>!"" "XX!&(&( -LXM0h _Pd G7(Kh dp0 `K  @e   : @@ ,a,qP 0 ;C*@,0 T0Zd Z p@P0* `, + 0pT Wd[p0 R8hP :0h-[0S0#0Q00K-0U@,?, -LKM00 H! ,0 /0 0@0@ 048<0#, ##$0(@T ll4 00 #<0@4  ! ?  a 4 `( 0CPC0\p 0C  @0  0 48< @<L1 "0PD1 ;L!GD1 a(\<   $0 L! 0$D1  L1000 ;P@ <D! , Ÿ -00.  /00H10 048<#8:#:0 0 RH XbXr0*,4",0@*,",PP@AK͈0  @!  1!1 .0*0CtK͈@1$ K(1 1L R@ p-L`AQ0*, ,@0 W00P 00 00000 0@0@S  \T0 0@0@P 0 00 p0R@ -8LS` @P0*, 0\@P0*,| ,(3T@2 8Q0xw8P0*,0 \h0d0 -`Lp8@* ,0P ,0P*,P0 \$08S 000 - LM0000!0峠Z P`8tpK=*@, 0T@K= 0 00 -p`0@L*,-,9V 0*V,0-\ -騠@ 堀0 pHLDP`@* L, 0T \ 0@*H D, 0 \0 0 -騠@ 堀0 pHLDP`@* L, 0T \ 0@*H D, 0 \00 p-0L0`S! S @P0*, 0\p|@|P0*,X >\p<@ -0QHX`,P8P (Pp`pL @ _ 1 R[ 0 @P1  `h Q \1 RM K V X  #Q a b@0*,-,@0P0xx*,0-\0 l0   Q T0 R 0 @P  0 R  -L@M`P0*,-,0p*,8-\ K MG0*,0-\ -L`0pə82P  \^22PPP \ 0P0\0!àA0 S p c _ PA Y0 %Sw M I   C0 %=w 7 3  .0 %(cp 0SS Z  ^0 mwH>P>L -pBM(@LCmXyyZ *L","""d"8pE8HS (X'(RRA RC R 1  ^0}z  08p8pyU@P0*,t ,0`*,4< \{(^(d0 -LM Ip, Q0P@L `1 PQ U PȞPB 0\E Q8 8 8SP 0\D1 T\8` V0X@1 p0  @ -2LJM8! 8 2pp, 0C`  B >C ADP0 pŸ  04 P`H2P <"z?C0!,2̇ 0 "0240C$  p-LM6`=@SP3 x8S1SV kP T2 R1SU k@LP  \ Kk@P P  \ 0Pe1  06 00 BQ@r 00 BQ 1 RJʃ.0@ BT10S*0 0  P  X\ P x 1ASq Bx 00S:A BT  10R!!  10C1 10R''  88 0C8800  P6;6xxQ00 0@0@x -LM(@p08 =`  ,(P4U@ (#!B10 (PU ,40$0`1 $8F(@ @ 0T(@0C@ 0(@3(aCZ 80, P     A 4 ""80"(0 l0Q0C R40CL0 R @)0+000)8(KoQ(K -dRdB0pL*,0 \0*,0!,\0*,0!\0*,0 \0*, 0\\1\!Z 4Q4a0* @,)0T X@P0*,0 \0*, 0\``*r}V `@`P0*, ,d }V$͟!U@ -"pp6L=R6 v0lB0*,8@"\0*,-,0`*,8-\0*,0!\0*,0t!\0*,0D!\0*,0 \0*,0 \0*, 0\AC4prWG$lZ T0 R H@00 00040l4h4 -LM8 l7 H0C0S P 8(K '000G8'0P 8000FVp6*`,0&\p6*`,0 +\pT6*`,0,&\p 6*`,0%\p5*`,0%\p5*`,0%\0*,l5d%\0*,@58%\0*,5 %\0*,0$\0*,0$\0*,$0\td萆t0 *0, 0` \ V8  M(0 c*0 *,0 #\0 *, #0\@@5pT Sc0*,P#, T0ٝ8P 8 8(Bp000*,-,8 Sh 8 S6gf fAQ0*,0-\M4pKQa0*, ,1 @-BT0*,0!\0*,0p!\0*,L1D!\0*,0 \0*, 0\8 06;@06(R  9 3R@U@44d4 44$P4 4 4@T4,444X44>000A0h4l4 0-0p 60LSP0CS006 0h4000 @0@0@@ -L@ᮑ4P 6A0AS 4@90 -PL@`pm1T* 1T2 1T  ᰳ4P@2 mX10SL1T; 0l@4Tl@606 0S. 6@ @@ l@ ဳ4P@8S 6A0ASk@@ al0l@0`6A0ASv4@Di i i ϖ1i -9L@@ 0 000 -tpt`0@L*,T0 ,*,P 0\! p-`P0@L*,8 \0*,0 \0*,0X \0*, 0\1 phi,04 -RB0`L*,",0p*, ,w  p0000*,0 "\0*,0 \0*,0!\0*,0 \9@ /RKD=61, ' "AQ0*,0 \0*, 0\G$O vF>E9$4C4/Eh4l4 -DUDE0`L* ,0 %\Hm0*,0$\9m0*,0$\*m0*,0X$\m0*, 0$\ m0*,0#\l0*, 0#\l0*,0h#\l0*,0,#\l0*,0"\l0*,", PPZEr唂0*,@A0d"\l0*,0("\lPUZ0*,!0\~lQq0*,0!\kl0*,`!,0#28@8*#,!0\HJlx0*,0 \9l0*,0 \*l0*,0X \l0*, 0\ l p4 p-L` 4A3@ 4C3B 4E3D    E1 Ƞ@!!,Ƞ @j?.0 s 2 8HQHA #800Md0S!<C<0N[0S <C<00S /0#@0C00I]S  P00C0C 48#(R0  0S05@ 46T0PIM2@P(0@8sP 40ĕĕ#U@p<2 - L0C` 0LC  lB ( lM=!0p0pUkW AQ0*,*,@P W1 gh`\1p 0D@AC4 P(@TG]$P P ͘@DAC4x@TZ@ P 0@T  p官d媘Z0LH SN!!`\V@@L@,V@lV@LoHV@T@0kP! p-LM`0@S P(\ 0 $0  B  0$0+8<  0h0Q T0 H00S ,0  00S0x'' 0-LM@P 0498#,("(#8 \ 000(\  $0   P8 -LM00(@0!0+00C -H`\A0TpK@LP ,P %8 \ -H``A0XpK@LP ,P %( 0 \ 0-LP0  , 4 " 1!0@ \00S 80 d0  S 00 0 0@0 00  0(( -DpD`P@L0 00\ !<\\` p-P`LLP@< ,80 \p -0L0S S t0t l0/\L0L >C/\$0$ 0/\_ -`P0L@p ,0 \W 0p ,8#8:H \00 ,0 \,( -0 d@8`Tp4 P0L<4 \ 04 \ -0 hp@8LX`4 P0<8 \0 84 \  -XP@LPp`D ,x80 00 \ p-0P@ 0PL`` 0 -\x8 Ph Ph$0, 0/\p -NpLP@l0T TH6T8 404 \1`V@?/4 6.02/\? /4 6.02/\? /4 6.02/\` < 08".\80. 08/\ -0L`p @P*,0 1# 0*\H@`@P0AK ,0 \@ P >"(>"0>"8>"@>"H>"P>"X>"`>">"h>">"p>"XTPLHD@<840,`Q@V@V@V@V@V@V@V@V@V@V@V@ -9I9)QL 5xI   4A3@  4C3B  4DE3 M4@xP8 P 4U0D@8(QH  48#(P8R 0  l8 X8  D8$8 ,8P 8 ( 0G  48S7'000S 7' 0 B07 m`pO@@) W 0@ 4@0  4X706p 0 S00ƅ60S060ƅR`m-`pO@@<xV S@ 4@0  4(X706p000S00ƅ6000S060ƅ(Q`5 0S  p 48# R m `oU  @ Ȅ 00x -LM0@Sp Q(\  $0  B 0$ +80  0Q 0 `0倀S`  (PU $00 $_ @Q 0 V -LM0@S Q(\  $0  B 0$ +80  0Q 0 p`@pT`  (PU $0 0 $  00@@Vp -LMp`@T㈠  (PU $0 0 $ 8  00@ @X`01 11 p-@L0` P 0 =0` fa @ p0B0= 0@PT0  fba @ pP0000 ԗ ԇ bbfa @ pQ(R(S(T( -(LMp"h@@mcdTw 1!!,dTj AWQ( (40! \`0 0;  0H!\W@1!!,0 S  Z@d'cTP` 0\@ 0\<T x`xp0| ,@\ 0\P08 \14C@Tppp 0Ƞ P ,(("(0f( -LM6P@_!@@6|q=6F 0\a0/\I0,!,P 0 !\ 0\P0 0; 0 \0@3C@T^Z \0 R P@0000''9@0 -LMEUh&h 0,` \`p ;p Ib 0\` ;p 8b 0\` ;p 'b 0\` ;p b 0\` ;p b 0\` ;p a 0\` ;p a 0\` ;p a 0\` ;p a 0\` ;p a0 ,0``,0ԢSF r@A0 \ P ; a 0 \ @ ; ~a`VZ  0\ @ ; kaIpQa 0\@;  Ua0 ,<ʠlj@ Ƞ 0,\ ; pG8aw 0\@ ; %a 0\@ ; a 0\@ ; a 0\@ ; ` (K -ALP8`-#, 08 10-\@@`}T! Pp0-,0}T ?0?S Y.b0 ("(, 888## ? -LMlalQp+8\L!L@0  *t+0\@0 0; +0\@ 0\ 0\@0 0; @@Z`T H0H +, T(<(ppU@ -LM0Q,Ap !0\`0 0; PP"`U `̀0/,@ Uʍ<2 `%0/\Q0 \ QX00 '5'W( Q-L !0S0Q@@ ˃=0 `p@             0 0S  S 00SP  S@ 0  x@?   ?  i >|C'''U( -LP@@H^dT l`lp0d ,PdT  4&#51 \m Q@ Q-`Lq 1p0S01 1R0S S0 +=Q0  >''' -LMP@@]dT8 aq0 ,dT+  4 8 \@0 0;  0{]@x]dT \0\ P ,0@((p,W@ -1LP8p @1<1#,@@0P3):ࠃ3A1 | 1!`\p0 0'`(p0 -qL0`!S*@P0 \0!S) 0S0,0 \M]@P@T 0A0S @aT g3y , 0\'4W(8 -L Pc? p 4Y , @@dT> [7;`P dT1  @@ d00T [7!0`0S  T0D@@   < -L`,, @[ 3#.B,3 R 0C !R 4CS#\0t#, 0X#\L3L#QDS@ 0 @&T @ r0S) "@=0@ 9  N nx"/=0 A 6<2 !R\BR0E/,0E/\1 Rj e0SS 1 R 01 R  Y 1 ,Q %JL1 !R0 R 81P00 4 - 4? P@0 @>TS00S`0 S@0`00S SjW('r5h >5U(V(''''](* > -pM@ L7 b` >P 7 b ? @7 b V V3 RoR xKP t\3\#/, 838#Q R `3 Rs KF X2"/, 20"/\2"2"P\N VA2@ |2R @\y X2\y @2@"0/\$24"Q@ V(2Q$" "0Շ0՗00.0  BhZRb KF 1Q? =0! 20 1@ t1R@\RDPKP R }1!/,1 0 V :0 0/\0=0! "0 RD H0H 0/\ | VY('r5Z('5'p0Q(VUUU 0-LP0%{ @P00T0Sh0h QGT@TT0h_Y0'p0 -LM }2 8p Pp  0 `Pb !M,0K<@0 0 *,`P Q 矝,  ;4`PI  @;`PC (\ 0 0; 0,p 0 p 0Z 00p  BAD0o 0 0 0 ~  nM8@`P L L商(K0卆$剆S@S@W@W@ -LM` `p 00 @p  0 PP fq$K (0K 0 0p  ,PP M (  ;4PP  ;PP (\ 0 0? 0,  $&"S@S@W@W@ -LMß6PA0, ASu 0BSx4}"~"~"~"~"~"~"~"~"~"~"~"~"~"~"080 0022< k< iR} H3H# 0 00t00S* 0SS   S .4 <30K2 K4K.x. x ,4,`1K0pK/K.K-0K2"<0!0*040Kt0p( TBTR0*,0 1#8 3*\, 0Rw(K080 8 8 < QA0aK ,8000 \PqP0 00t8S2 @P 0Pt P0tl0P00 S̀ ,#,430K2K1 K0K4K-K.K/Kw.4 <_  3 K40K2K^@P 0Pt P0t9[^ܲk@ > -LMp: 0C0S P t `\*000T: RrHZHj08*\0/,@>/\+9\@0 0; +<\``P9( M0  hIh 0 s@ 88 \49T@@VdT h0/,0 dT⋄ <`傄 |8|(/,tp~>/\@/@8\+8\@P ;P +<\@'0\'0\@ ;P  0t'\lG4W4g @\T<7<'Q00 , @@TVdT 弦0 ,,PdTpp&000/,@0}0/\u-B;\ D&0\@ 0&0\ r0VU`PF\ 0P+@; )00 0P*@\E 0P+ 0P+@0 *00Cm`^ЄФ $1\@ @0\ P 0\)U@0 \ /0\@ /0\ P$P4\@@UdT Sc0/,0 dT >/\@0!.\]M3@P0A0S |@T3 A  QR(`3R 0L3S 083C 0TR0S0#001 0S2 0S  S ;2\ L2"Q` *(2("Q(8p0A 0r밁0","0 4!\(10P `P',0\@/1\0  l1 0\6;@06( 8S   \00 \00 @21C! c.  @FTR@X((V@U@W@?, >'p0 X@(pp'(((''5D'90# -PL@`p0S1T* x1T4 p1T  4P@4 wR<10S01T4 0CR@4TfR@606 0S' 6@ @@@ T 4P@8S 6A0ASB@0XR@06A0AS4@Di i i ϖ1i 0-0| LQP@AT@06 0hr<嬁 00 @0@0'@@ -LM` p` 00 P`  0 @Pe ",0K 0 0`  ,@P sT p`,  ;4@PO  P;@PI0, ` !-P;B  L @  2@P/ Z, ` -00.  /00@* Ԑ!  00 0  @P; (Kl`X 7@ (\ 0 0; S@S@W@W@,X@ -LMH p0,0 H1@9L! 0D1 ׇ@ 0SZ P 000S< 0 8 00U0S 898 R``0D9Z 0U0L08P0H(08#,(^"(#80 0@ 0 Vw 00 $ ("<''''P >J@===P= -LM6P=@S`0p1 8S"- 0@ BTX0S*1Sc kM@Pw LP  V9 K.@P P  J9 8P*|1  06l1 RR > RN.@0T B0S:@ BT  1R0' '  88880C0C88880 0 ᎟00 @0@ 1R0L( P(  880C0C88 00S:A BT  10R!!  10C16;6' -LMP0 200"00180 00/3<0 ,8<0,  01!00,0 Q4 F p01ᄑ0 @Tt ) (`V $0 0 $4!00@ 0@010 0  00/"-0?00b , AR 08< 00t 01\ 0?Q0 02D0   94;9(Ko'' p-8LS@0` hP8 0# 80p@0S8 0C000C00 R{d` -LJM6 , 0P/,6 @ @ *00T@! D1 9 0|6 R D3@D N?K0 4 mDo 0498#,("( #8 &0(@T 5 00# 0%@00@Q@ 50H1 (\` 5  0  03 0 48< { ;oP %(\A 5A  $0   Ԥ0@ $4 4 0p;P< $ p,0H!0-  .00/  @D10 048#8:#:0 0<8  @@  81081  0 4 H3QR 0RࠓࠃQD00 X3 ࠁR?  00x#0l3 0 L3 0C 048#9l  S| 3@D0CͅD0> |00 @0@w0S """"T1   D!0000S~ꠧ"""p"`"P"@"0"0  0  0  0l  f0`  b0H  ^00  Z0$  V|0  Rl0  N\0  JTTLB|ܲk<'<<< =<<\ >R@ -L MR0 P |1@TL@2B  :q0 [0(S5#,q, , P\0 2S P UZ$0X0#- 0@ \@DJ0NS` 2"0 P`0, [0 S, (K20  @<0H00!0+0!0tdl > -HLT`p` X "H"("("x"TAQ0!,8`!\ @1u8pb8S  ";'(RR' R) R }U8p  I8p68p1T ;(((2! - B  ep -0LM PR `p0 ,8S  0h詚 x 0\@0 0; dL0 0\h"8S S0ⳟ -pqpa0PL,,p@ P,0\   @" %(+ . /      @       m 0-LP@mn4P 0p 0 |" G30 2S Q <0 6A0AS 0d0l >  0-0@LPn{G@3C@gT^0P|0 BB--8L`< P|2 2RR8 QA-jA@PO-U  k f@Pjh1P/UN>0@H1 @!@1)18!810@1!0` hGFcn1!1)3 0#83 0<#3 0 #(3 0,#3 k  X0y0 0 D0C @<0D BD0 0hxLX@'q+> >+>+>D"" "T""4"4"`5"T:"|;"|"="ĩ"" \,=.=XX@ -2L M P `0@@JdT T2T" B,0@s dTwx  G[x11 0 Ix@3CpP7@T^m`pP ,0x@D3C4@TZ 000 pP0 Q  0 0S 0  R B xtw0X X-|V@'`(Y@L@'''X@T@'LoHV@X@"0k -1Lp <,$!$(p : 6M `<`< * &꘺Tv+>>`>>> <<nO),'>>>5 l>5$TTPPI*>aq -@L    ("( ("(,h, p-LPL@ 8`("(  phsQ 0 S0#8R#( Q 0  m> 0$("(("( -L@h Q0-LP n? 0m/00m?@C X0d 6"\0R 0S 0m0hR`n?p "("(R;P 8#8 0   -`L@0000 ("08#  x> P-L -LM0,  㰐Რ\Ppp` `0eS0cS@`VP0V ( 8B(C62 ~0P, P0-:@C,S 0C8:0?S?0?0 Q p-LP!h@n("(f("((B(R ("((0B(R (B(@G@Tp 0-<1"LRP 00 ! ,0S:0C *0b10 0?A2c>S@>@OH$D@ H$( ,0S t ~h z\ vL r@ n4 j,0heP gfff  8( c31 0P @PP p-0L` 0   XU@0@8#Xt t0UPPhJ* (P"(ph'(@[%X XX%X  0- 0LSP X@ @00\T@ @ 0tT0 -Lp\@0P`  0S 84#(#  #("(X 0S3 X " 0S& ("(, ("(0Sw |, ("(\0SH XP T  L$H=08#8T Q" =08#8" Eb/=08#8b/9 0S@ AQ4,\0SC/4\封0DS;#HMt- ("(R8X#P`0@ %[  ;a 60 P@^ X`(08#8^ $9*("( K~a'+ (-L`"X@p I,R00C4 0@(T"X 0 S R10lAC 0CS? 0 Cm@S@P @ -(0L("(0*(A- BRq0 /h 0bS1b1P# &L#$#&Ġ& 0`@ -pLtP@`T@ @P P,@ UU 0-H0L0P@0 ,$0 0 $#20 00!  r 3R0000088##0   -rL@v@0@P00000 Q0C @R000kN -Lp`!HPU04 4 0P(U"H -H0L0@pPK/\`,0K/ -L0L0P`@K/\p,@0K/ -pL P`@!1 $O\H@0 \0@1 0C\ -L M$  0@  K -RL P <,@p8 R#h <@WpT p-`LP@;,$("(1* *("('*("(Q<-0Pp -L$MΩP@LK @T-@DL6.0D@T,)"))("( ("(%  ("(%x t ("(\T@%D 0 ("($  ("( ("(w0 ("(|nt0  ("(XdZ-`YH$\ XX p*("( Og ("(F^# >V` @ ("(4,0S R C# ("(C p R0SDD# +,?  ("(+ +"?,+("(+,("(" 2   0Szz Wp`,8#H` CPX`VX0 ("(@FTp pT0G8#xP@ @0 @Tm?@D01.0D @vTD[ ("( : $[$[$[~10C1C 0C /?(KVpڨ mSC EpCP~+("(4],u)("(Tk>>)  -LM "Q2p@@,  WXhRhb0.,D"0X@-0X,0 "X@!0X!0X@!0X0!X@!1X,0X@l!00X"T1R? Y@!: T 1!!(@ @0  ( @ : T@0 i.( @  9 T"x0R ,0S Q7 ov,0S Q o>>h  Lj&P  -0l!Sh1L`ppP@U00 08#88 #(!@T@DU8 #(!@TU@Y 0q' !8'#("H8#XJ_)@  ("(J0@``1@T  `P@ ,d KQ0@11Sʸ dJ01,R00C41"?=R 40`1l@ ʓ` RLd`80R4 `!0 ⷓ`CY@`Y@>Y@8> -2p"LQ? Rb0"X0/(HL"0X0<"(@8.#8ʠ",ʠ"$N 0R10% R. R c!1P\E c0@T@ T0@@Rxh10d1P \1PE Pc81P* 4c00 110!S1 !1 1 !111!11010,@0T@000 10!10 S000! 10t0110p 1T0!1| 01!CpZ@` Y@P S Y@@Z@p+##""{#h#n#"""""Xs#" c@>Z@ 0-1@L!P>.(,R00#$R *\F Pc0R 8b0\( 0 S 0 S9 0 S8  b0\ b010 ^0$ 0 *>R00#600|0 $0t0 1G.0!2X0 $0r01s01t0 2Z@[@X>Z@Z@#r" p-X1LP`@% P 414!Q pQà 0e010   0S  R }bp wbprbpR 0e01P0   X0@` 00 0 RP 000p8 000p$Cx>l[@L[@8[@  -LMp`P  4b,K ) K2[ S 2"B 0S 0S>*P b`BR0 ,t2)[h"0`2[ B0 8 #X,2[(" SZ 2U  0 S R a`!1 B PU 0X 1   @t0C!! PX0/0"0)[0P!P1 @@T `P ) K!0[ 1 !PP 1P) [a)0[S4 #0  a`Q aL|0 za`C `<[@p>[@ C>[@ [@\@DY@0\@ -`@p0PL.,1 010U],00 X U= R h3a,8\0,,0000P\@ -@P0Lp.,`43.\.,0S@@93dT @ 2P dT`<p\@ -p@圀0P`L.\,0. 0J/\0.,J/, o -@pLP>.(0`@.\P,7.0S8Sw1 011 01 -LfP p0@P.\`,0.0., @2`0@T H0H J/, $0TL`< '\@ -0LS8S!tpt0P@.\`,7.0., f21 01 -LM8K`P@m  pʏ#[3[,K0K@P ,@ 0P C[" 1R 8#H2[3K3[CK3K U:(K,P0QTQ,0S0 A0C A@,0 0 ,0 0 @ c8#HT,0 0@,0 0 00  , 1 B !H, 0 P  -LM1p@ Nx1t!QI )PKX PP 0SA p P;)0[( ['[&[ 0  ?0? ??)0K( K'K&KPh"[2[[00[00S 0C1UA% KP[! a00B1Zc?0 b c!B0 E$KZ P`0@0 0H p-PLJ08`S ph/8,S @~00C F4 -@0L <4,4!Z BpPaRg` 048#8#$0$("!888 S L23,:X^^1!04!48#8PNX0Z`E1 U70 $("(04"48#!888 S-*Q ^PN304 8<̠Č@ Č#<\0Z`EU  t^d^ 0H^8^(^ ]@\@\@]@\@ p-L!@`VPP Q !NPPpw^p r^pD]@X]@ -X"p1L0C #a.4A\VP"<4!4 <Y/\P 0V@Qa@L.1,С\Y/9\@.d1\X @P8!<4!4 <Y/\P X0X@P`J/0\@.0\@@A0T `吀0J/,PU Th]<0J/,  !JP(]p]@]@ p-LMRP`@"iT 0 $(, <4!4"<NS  ]x0S  `@]x H0]x0S @ @]xx]@8^@]@x^@ -LM1!pQL (!q1!@P!X`(10! 0S6 1@1 0S< mO(K 0PK  03K02K 02K@101)U1cP`P*Tv' v  K0  (K0Sڸ"p0Rv ("(v< ]1@01{zP ^@ -L P`mA 0p bP \@ 0 QP \蠀0 @0.,1 S 0`` \0J/,P 0,$ \UU^@UU^@_@>$_@ -L;A S P##0##0##0##H##0##0##0##0##0##0##0##0##0##0##0##0##0##@##0##0##0##0##0##0##0##0##0##0##0##0##0##8## e]L_@B,BBH_@ -鴁Q0pL!,@ J`h!8\@.TB <10&088#8#8ESF0C8#Ƞ  0b8#Ƞ\ 08 #(^"(0S)48U#( U Zp9S:0C8#Ƞ -S.0C0C88#Ƞ #Ƞ U 0U08#pp08#p0   P98#48U#( U`008#p U 80U=08#p(p=08#p_@ - 0LSP 0@R`p R0Sp0"R 0@`p iC0S 0`00@ p@0@`pEZP _@ p-`0L`'QL[|@|P0S 40 $堇00 @Tp$U -L!Ȱ`o,Y* =R?006$ᘠp 99 B1 0t 0Ph0h@ `$k Q 0z Q(09;9_@DHDLDU -LP`p0.,@P]/ 0, 008#80$!00 @0@9 0 -0LMp0(`\P $ $0  B 4@T , 20 !i0/"-0?0@bV4`@U -x0x` tP00pL ,J$JA1 \9 0@U -L`0p@Q၂0e0 1 , &00R0S R @* T xHX T \!TT0e0 0\@$$0e0 1 ,  @l* T !X T a*0e0 0 0\ 3 $0 01U=0@P0PS `0 $[000S y00U@|T`@4`@ -QL`0p%3$001U= 0@P0PS 0 $*QTy0 @U XYx0x  QL[t@tP0S @0 $ 0 @TtT -LMp, , ,3$00PPU0 "10 0؁U=00@`0`@  0 P , 0fWU U=0@h1 `V@, k (K,  R, ;t00@ 0 P @ 9W,@@T a 0fQ<|00 P0P 0 P p WT L 0fP 0P U0,  X`@`@`@|QtT -0L M`,将0(\ $ $0  B 0(@40P0Pp@ p @U@P0(\  $0    00P K@U -$300 1L@ 0M  0 d0(\ 0 $0  B p0ppp@Ph` 1 1\$OH 0\DHTTT|T -p@L-00S* S0  ,P` 80UaP@10\0\  , a00PPP `@` X>U 0- L M0@'PK0 KPP Kl0l  ,41C  c<00K(0 bP -!L M0p0K KKP1!Q |1  0 R'c0CX!@P \`,8#87   %00S/ S0 ( 0\(K6$000" c`P@#9 \$l 20a #9 \40, ( ?\!C?BC -0@00L p/|,H0 88 0  @R00<<O81|1 -L0M0`@eVD@T@D79,D@TS((3K))("()A ("( 8  ("(d\.T&L 0Szp ("(zz ("(zD'P; zz  ("(% d ("(LD ("(,0 ("(0 ("(Z-Y.X 0S *("(  ("(ld`$T ` @ ("(zy ("(z2@KV903K0K2KCc  ("(C@& p  {30SPP@0VC @J T @D0 ß,C @DtU ("(4L)("(+0SU@ᤢPBKp 0 @TPڶ%[%[8 (%[(K0"b @BK @TP@DBK @T. /   ,("(xp@ ("(X`@ ("(`,("(qP {%_  HPW$HPEpUW  BpP {s%E p HpW$HPpUW  (>&>)>"x -8L#8MP@0  *K< '080 40 00 0"p0"烀<9@`J4 R Z  !*K XaX080 X0080 C)(@2R  %b2@8@008#(z10  !*K 0`pW4000S40 0 8(K)h @P *K  C41Z 080 @BR 7% @ C)(0R  %% @0 @80 *K㎂Z)(C l08 0088@#()H *K z C08` 8 >>P> -2@0L`CqTP pE("<8#8"(0p 21C0`0gSp 0-P@LD0 p-@LP`P P  ph phOS`@ -LM< <  @ D P, <0p81  }0! 041 Y qI x4 "  G300<X6 H4H$`V 4$@P0@p0U̅p 60 40C |a@ -0LSPp`0@PgC  H 7 (0"(0`SP $QJC  Ha@ p-LM `K@P剀02K01K01K01K0t v _P 0S00 g 0bKp -LB 0-PL!8@S 0h 0@v -L@RMP1`P70,0 D TE ;S;X 00 L0t03  P, 6TqB9 !0g0 `   A,0g`@ 0(\ 0 $0  B   0 0C ,(K ; ~TqB qB 0 g  $tTtQ|QxQdU -3LKMP P!0Z,0 00pL1 H  H 0 0@0@0/"-0?0bP1 S # 2 1C( 3\ 0 $0  B   OP  0 48#80$S("HPP  T pO00 @0@ ~K w0D 0L!0 |0Y 0@ 1`V0  0U48!#80@P10@1ȗ 0p1 p.0,0CDU̇0^0$ KKK 1L1L , (1  {@Lu0P41  O?KČ Ƞ ,Ƞ` L8 `Lp PU0@!H  O0@ h0PX (\ h0 $0  B $, 0HR(K,u(xTܲktQa@UUUU4U> -h0hL`p P ,J$JA ` 1\$U p- 0LM@P P@U  a`P  hNx\0(\ L0 $0   000 0PxxTa@4U$U8U p-0L`PV l@ 0$ 00$$  0php@U -KLP@`0pS 0$A0 0`V@`0 R L@0C $0U( 0 hC4 00 @ Lp LkLgLcLc@:#LUX3#Y#/#$"d"X#"9#\UL"2#"l""h"""\"""d""c@(c@lc@c@ -L  -@C 8#LB[@Q \00HS X00 0R B0HSQC 8#-B -8LS@ 0$ lC }h[!Lc# -pQLP2 9@ 1 !.B(L5@` Q Q  T0W0  Q* *  4`V@0 0.BX   X0pQ W W Q Q  0 R   0-@B L0P C  U0P0 0-6 @LP& ` 0S 0CS006 0h=0(K00 @0@DUM@ -L M6P=@S`0 (KX3 0 p140 4  08#00S~ 00 BQa@r8Ss1Sg kOᤅPk 1S 㜅@ 0 S~@P) irP, LP  , Kpz@P P  0@JXS ,0P ,Q l0 0@0@  0  S p`a 10 40 .0@ BTA0S* 0, 0 1ASq B00S1p 1   &e,  A =E@P\ X ,l0,0  00Sy:A BT  10R!!  10C1i 10R''  880C88 0, 0sMy6 ;6pP)LL)DU -lplP0h`@L (L0 q0 X 0 hh0 -PL0@p` ( K0` X0 0 0 ?/à€,, 0 0m40 -0QL0@ 0 0@0  `R0 0R^ ^ ^X 10 h4FK,0$0oU>c@ p-1LM @R ` 0S\ adl<S  B$fK!Ka<S  B$̄K!K6 PK R00L 0\00L00L  \ 0A0QS 0\Q00L00L Q00L 0S P  s  Kphl0<4000 \ L 00?00 10C 0`>>i#"U -0LQp1 "0R ,0S Q00  0@PX`:>@8#8?.\0 0P@X`:>@8#8?. iIP c@> -L,Mp "JKT >0>x -L$Mp@4I.D@T@D>K`@TCS0#(H 0#(/(D 0Szz LS0 *>??0" -L>>) VUUU " ??" 0R00 /xB ` -1LQ@p- 8#8 TI``! 0 PX`@W3>@8#8?.Z 0aP@/X`(00/} y0 R! @0P` 0 P@/X`(;8#8/ =l@0P`  -<L -`PC} pL@tU! 8p5P!8S U%  1U0 U C  0X5 A輘'<l0  (R R 8s}40B 0 (kHUc@U -@L)x3+t0   m he -L(Mp0"JKP0 q0EdEdU0\%(98#88%X0/(U*KQ5KM`KICK#zKRK0K 0 CC0/X. (x 3[$ 52[$z +#*#09@ #[n0@ L$H, ("(| ("(\@H$(89@m.#0c /#Rb 0/X$[*$[5#[`#[C"[p"[zlB[R@BK008#8 R2K] 0"X0 #[r#[n#[j#[f#[b#[^P (K! ("(Q/!L|1^#[ ("(D?3[T! 09pzX ("(z, 0BSSR @FP  ("(|P ,0S| Zp [{ \ ]?  ("(],0S] |3|#|3l#XA.. b(3 kt2"/ 0Xa*"*az ("(zQ ("(Q|,("(d\*("(D[ \ Q BR@ S T Z ~[k z \v1 RN] n^ js f} b| ^~ ZQ7 URp QS MT IZ E[ A] =^ 9 }5@< /~N] ^ z?> !??`aˆh@+ -0LS`p 4$Q 0$Q DP PLU@5',,("(5TD2S 00S?ڸ2S $4$$0$X ,("(*("(# ,("(5 d ("(5] ("(]0S &3+0 3# 33-BX0Sh  "0SW  PB32S u my iP eP# a2Sd [{ Z \Vzo ("(zM  h2 d*!`2S8 1!P@/X`(?008#8/X1X!/:X L!7&,2!,!." !*#!&$!"l] P Zp 8  zP ("(zz ("(zQ ("(Q !P +j"?0>c7~g p-0LS@`  R R` T  R@ B RRwPPPPPp R0Rx ,0S 0S0,0S'3#Q "3R,0S Rn?  ("(R\0S83 N .$#t0SN/ #m00Sm"`2 B 00S:s{ ,0S< 2 2(R@ p00S``";TT"7U HM ,("((+ y."%0S/!0j F;,0S! 1 1(R! XP((ph6 0*&("(6gE+  a ("( ("(> "("(R3~P uxC02)> 0-|0@Lp .,  0S 000PU  -2pL"`23-BX "a& ]0 Y>,UXBP PNLDU@DR/:X0S A2S u y P P# 2S;  2 2SK 5h!&3+ 2SB </X*!2S e0  ik* P Zp [{ \ z 8` 2 &,"?0=<P ˆw -LMH 00 `P@C ,K hj, <(4"4!<S  X R,0 3 PpL@,0S  X RH@& HFjH Ej jPPp@@< (4"40 !<0D <(4"4 !<0(K@ -LLMc0@ 0 q/P塎P 2Q: 0RK1S 1S> 1S[ 1S  RR R0B0SwT/:Ho0`pKS0#@0"9!dKs?^P d0!u0BP  0: 0`pKS00@!9!dKu?7Pd0!p0P  RR 0B0S090`pK@ 9!dKw? Pd0!i0Pz i`pK@ 0u9!dKy?Pd0!i0P` Lܲkd@\U@d@>d@d@Hd@Td@xd@d@ -Lp( /P }PP4 R0C R h0C#P@A/B\`,20#PP ^9c吣 .3\PPPP;PPPP00 0,# X$10S 0"X@ a.9X0 "X@ "<Xx2h"J/9\@1$PwD4 0 \8"@T?C P7 T{g 0 @P!\`,6! !0 !X 0A@x1PP>@TX1PP:1 81@P50 !P0X!P0[}? V101; b/1\@ c/4\x 00000C x8 l|8`x8Pd@VUUULUTU\Ud@e@(e@ 0-0LS@35PP 0]PP 0S- EPPPPPP000l 00d0\ 0X ,0, .B, -(4LMP$100!0$0#?A3c03@ 0CC @@  q B 0 l C  g [`P `Ph3  `PS`P`P,`P|w3 Rp(K31C01<0@ `PL`P (`P2p R`Pl2l"1!d2d"1)  0Phg< 2\0B P A00R"C40Q` b8 0S㠀h 08 N@pd(p1/Wᰀ@ MH &@3:\I7X1  0D!08<10@(N-B(3,1!# 1 !3)!)U  X00  oD0C @<0D BD01T @3   7CMbU\c#R###e#Xe#$le@+>+>@L@U"HUP#b#b#`# \,UULe@ p-1L`P+0@@0T0000000` 000T0L 0X I101p0XUPU`U -QLMPC 0 9@?D1 R(KM@ ` 1` R0zO 31C01<0p( KP (0` RZ" 9@=8 BQ@9IV9@ <@U808 >-B,-|U -LP@P10Sl` P m|pP X M0 eLA ut0!00 $1 R3 P9Z@0;90@) 8S,  m@0@,T p吀0.,]/T`58  xUk$g0e@ -Lo -L@y*4P 6A0AS 4@ -PL@`p1T* 1T4 1T  L4P@4 L10S@1T1 0@4T@606 0S$ 6@ @@@  NL4P@8S 6A0AS@0@0:6A0AS80p0(4@Dp)/i i i ϖ1i -LM9`@(KSs0J/,p@ 0K/, <0P@KD0 PU 2唂%A@r@!U 7KwK,07 1  LP4UJ/ 0\@2 0 0@\T @V P@(c@0PY408@OI1 R9 t1 R5 0T0U  ' L1L!0QE|AQ0-,-0XD 1 4>_SRU Vq4DUw@h0@T0P@Z4VUUUe@g0Ue@e@tUhUe@ 0-L0@P)UP0 R @@ 0@ R00S0S<SH0H0<<0S<<   <0CS,<00-,000-,000@-,00@0@<0000 -0@@L0 0 0S 040 R000 - 2! 00202 -0L@3 (0< p-L0`P="R p03M @0< ylp$# -L@A/P 0h 0-0P L@3   0S0 00hn/@-4@PTp @`  !00\;0 #;^0 H00dH00 0@I/\# 5 )\  0;-R#;  '\v Q  Q0 00000v 09000 0-PL@<0L0hQ Qp-L`P @Vp p-LMlR@`pt2 ` l” 0pXd@7lRpt2 ` l” p0Xx -0LP@ ra00B@0U0 0 0"2R0CB200 -0PL@`0pSS  4@0T0 1* **P\^.h p-PL`T0 L@0U0 0 <SLp00 p- 0RLP` 0@S  0@@ ph=p p-0LP` L@0U0 0 `<SLp00X p-0LP` L@0U0 0 C<SLp00; p-P 0RL@` 0S  000 0S @T0Sp0 ph@ p-PQL`@p1bU 000ESQ 000 0ASQ0pp 0-LMLPT 0< aK0 0K3P  ,0 0  ,  ^ @< p-LML`T x\@0< ^aKp 0KV3PPPb@   ,0 0  ,  ^ < -L$MP@D H L0 4 @ h0@ 21(KH  @mH0@S08#h@ P0pp'0'00 l1l!Q 8 D"8 YE  j0 `P, <0 L0S44 404i0 079 @ 0`V , 00 0,"Jp'PDj@P! <P008 0 V <0 H P@Q  @H P@ D e@ -LMPp@`0V@ H0 0P0  0$Q  R 0S  0KD0 < K$@K @<$ V040 $0 0 H0 0P  00 -L0MP,+0  Q`%8 <  D 4 H P@Lp@@  000<,K < 400@K @PY00,@ 00 < D0T  H% H0D 68Ǡ-0 0b @D0H 40S,08 001100 f  0 0 吀p@  p00 0PS @ <S0,00l03-S  <2S 00C(K@ l@g ,U00.il# -LLT H0S<> 0< _e @P -RLMp, /R@@gP P= T`: U  0"100"P V `^U#`00 `V# P  V1@`F4V g,0H@PU`, H@PK @`, H0@Tf@ -0@Lg ` P p11$$00WW@@4(@0@T PPT1Q@CRJ@0 PU@DZ@g3@P@ 0  ^ 0@K 0D0H i 0-PL40@00 <R P P 0X1,00P1,0000S#p#L#(#0( 1r,0 0h0,0P@00,00hm0,0P@ PL@0PP@L0 D0v0P @L|Py0XCpCCCCC -0Lp@@0 0 Q502`P`•@0\ PP 0S0 0 `D VP@gij8.i @f@ -0@PLp`-U@H0@cT{2@H0@4Tn2Hgi8 -0LSS@ P 0 P0! 0:0::Q:\   ll0P$h -@L0P`p="R:80 XQ30h!R/ plJ0Pq$ R 050 R 020@<#h 0 l@)i4~.p@l0P?$|rf@hf@ 0S0 0 0-L@vP0h-0 =\  0 `\0d hP$8# 0-=2LSPX20QX2 @<T<SX20CX200< 0-@ LPP g PP<S 3 0<H0eS<> 0<H<S0 -QLM` Q l–Ppt2 P l2p (l–@pt2 P \2l–0<8#8 pXdT1l–pt2 P l2p (l–@pt2 P !l– (1"(0p Xdl–pt2 P l2p (l–pt2@ P 41l–008#8p X 2 1l–ppt2 p l2 p(P (  lBpt2p l–00p XX l–pt2p I=l–08#8p X0@ 03 < LLD0lR`X 004 lppt2 p l˜ 0p XlRpt2 p l˜p 0XmmpDC p-LMlP pt2  B l2p (?0@# s# <S y'x``` `l' `f'  =2S! 0=2Vx0=2xlB pt2  B l•8#8p X\20\2ex<'g@Hg@`g@g@ -LMl@ pt2  B l2p (?h -LM`0Vp0P`VJ+=2 SlBpt2 l2p (? ^0S 00h# p-L0P`="R04  R@0 BA@@<S0,003=\0.<2Spp p 0-LP"P@0(T0 -LMP`0p="R @ K0< $@K0?D0  K @F@P$ 040 $  @0S<@S0,003=l0@<2S O H0 0  @0S -L@("P 0h 0-0L P@=2S 0P<2S00 -L@"P 0h -LM@P0`="R  K0 @p0D ?H0<$K(@K @P( 040$(00 $0   <S0,00\03-S  <2S @@F<2S l@h Vl# -L@!P 0h=2S<2S $ -LM0` P=rW 3M @: $(<0@ plBt2p  l•p (0 0S 00 0lBt2p l•p (x00S 0 00 0S 0 0 t8 @X20X2~!8 X20CX2o$# -LM0A`S$#$ $##pp<2l0<2弬Ppt2 P l2p (pl–pt2 P |2l– ,00 p\lBpt2 P l–T#0p XlBpt2 P l–p <TlBpt2 P l–08#8 pXZ)lBpt2 P l–20p XlBpt2 P l–p 0XlBpt2 P l– 0pX2&)<2,0CR<2 3M @5,#m.,<pS 3 !<20<2_l–Ppt2 P l2p (1lBpt2 P l–p 0XlBpt2 P l2p (l–pt2@ P @l–H$8p X2(<20C\<2 Pp0=2 $#80$8SH0H0(8$ 0-LMQP 4lB@04 pt2  B l•p @0\84lB@04 pt2  l•p @0\80 0 0-#204S0$0 0A>0 0!2010P0S0SP(0-#206S,0&,000a>000, R000000 !2010P(0S(0S,P0 =2S, 0 ,(0 000 - 0p`L80@S@ p>"X00090_,oH@l0PPo|rXh@0h@ 0S0 0 0-L@'P|0h{ p-LM H`T  X@ 0 8P040 06aKp 0K"PPP@   ,0 0 ( (@ ^ 8B -LM008 0<0 =P}80s<0"0080<04 @0 ,04@\^j4 PL@&j, ;, p0 0, 4R0><ʅ0 S00,0 ,4 0PLCJ 3( 25 < ( 480, ^0, P80@ B00p*0 W!`<apP- ,#(0L",A P p4,80< 00 80< `d(08 04p090(Ko(K<0$(KoN <  (KoH `h@ p-LMH`T AX@0 8'P0$00>Kp 0K"PPP%@   ,0 0  (0 ^ 8m -`P$0 SL0p4@P 00$1l00< @0, 00 00C 00$P202L@0040004 -LMS<0 <0GF, 0@,08 `,00 Ǡ0F0R4 p8 @84j:#:zc>0PP*3 S R 00 Ӫ ```0F  0P"0X$0= @00C 00 市`P2p$<\ (K, 810\0S 00  0ᘪ@P4P  0 0B$@Bp -L MP`%< 0+p,4@0P 0 r ,0 P000 | $$@ < R4 00,80  40,K@H,0P0  , a044080< % bp108< 0, 0 0 帢$`庢40!,P(10L@0,0,0, ,0 , 02,0帢, $`08 04lBpt2  l—0p \0S <2S ( 0 0(Kl@N< < N,K(0x$ 0-LMHPT 08 N00K0 0K P  ,0 0  (  ^ @8 -LMP0@= `Z0 p ;80 S9 P2 pW0[ P, Q 4 0 40Q # 800 0S00 00W#$H$p$ $B@ A(KP 1,0 P1 ,00,0* @ ) 80,  PP , R  P 4 (" , ( D0r,0 (Ko$0,0(KoaCCCCCC-0 =\ : 0 `\0d hPt$ -LM=BT (KX20X2084X4H40 0HU)Z P& $`V 0SS l:0Pa0S 0C0b20000#>80 s2+Z P40S`  4P$0U00 W 0SSQ 3N 4 <00b<0 L, 0 倐3. 0 p#> 00Y R00`V,0@ 1@*C6"*0S8# 00V,00,0 3 Y@ 0L08@G0 R8S?X20CX2Z$pW@$0S 0 00lB pt2  B l˜p 0\80S 0 000@W<0S800@IR08 -$HLT H0S$8>0(8 Le 2@P 0-@LPP PPIK-!0 -L4M⨚ , 0p="R =,+ )0*T d<0@ %0& P('$Ry .0:R <R R R 0lB pt2  B l—p <\00t@, 0R$(K Rk  R z`9R 0RU80R _(9R 0R 0 R H9R} RV8VUlB t2p  B l—!pP ,0 L#Ġ# XK WKVKU@KX0KnV8V!0NPPS񟗆'$($"$"$"$"$"$#$"$"$"$"$"$"$"$)$)$@)$($ ($7R RmU000zx7Ru 0Rr 0sRn 0o7RWVU8VR!0NPPSL'$L'$"$&$"$"$"$T&$"$"$"$"$"$"$"$"$"$"$"$"$"$"$"$"$"$"$"$"$"$@#$^Ǖ= 0=lB pt2  B l—p <\)lB pt2  B l—p 0\@d=^l— pt2   l2p , @TlB pt2  B l—p 0\lB pt2  B l—p 0\lB pt2  B l—p 0\lB pt2  B l—p 6\l— pt2  B l2 p, HlB pt2  B l—p 0\lB pt2  B l—p 7\lB pt2  B l—p 7\lB pt2  B l—p 8\lB pt2  B l—p 8\8l— pt2   l2pH ,T`K@( 8 R0K$40#  $<@Q KO0KP@Kl— pt2   l2L p,P 0  @P ! 0 0R@1@!  T0Kɦ^ 0N4S= S* SH(U@1@# H8 C4  0嫦U00U  =JU0 0 U 0R0* R# R   U`1 `#@f TP1 P#p@e qT@# kx gP \ .  ܲk#  #?CC>f@&C/C8C|h@ -L@P 0h2 -LMplBP t2  B l2pP ,Z8 <0 @1pCWp!IW"@T`l• pt2  B l2 p,/.00 b` T!0,!@W 0 0 m 0-=2LSP 0,@[0h -LMPP "R pWO 0``c00v[ VlB pt2  B l•A0p \4` X2\"0 X2\"|smW@IX2V0CX2 lB pt2  B l•p 0\4 04 *l• pt2   l2p ,` "p0=2l• pt2  B l2 p,"`,@`lB pt2  B l•p 0\l`X80X8 P`y $X(`0X8qh@h@h@h@ 0-LMlBP pt2  B l•p ,488h -LM`0Vp0P`VJ=2 SlBt2p l•p ,4 0S 00h -0 L=2S<2S 0-LP&P@0oT0 -LMP00, =Z 40 000 p4@`P) 0 &$ 170<0@ ,0 00C  0"`$PL@0,04`090l<2S(K a( -L@P 0h -LM@P ` =2S  $K0 008 ?<0(K4p(P060( 060(202( 0(0 $Lp(0W   $P(0 S00( 4090lBpt2 l–0p \0S <2S <2S l@ x$ -L@IP 0h~ 0-0L P@=2S 0P<2S00 -L@$P 0h P =2S<2S  -LMp0  R0 0 R0>0/8 $(8 80P (Kx2|" , G[04eP I 090[P < 090QP0 0@9P02>U 0 .P@=0E?01P E 0R904 0 @RJ1?P5@TZ 8 3 2 \!l—Ppt2 P l2p ,l—@pt2 P l2p4 ,l—pt2 `P l2pH ,0 l—pt2 P l2pL , L, 4@ gdlBpt2 P l— 40p\dlBpt2 P l—p 0\@ l—pt2  l2p ,@ T6@P@T ]l—pt2  x2l— |,00 p\lBpt2  l—$0p \lBpt2  l— $0p( \lBpt2  l—p 3\lBpt2  l2p ,lRp t2O  4l—0@0p \lBpt2  l2p8 ,l—Y %Ypt2@a  FN.B Bl— c0#1A80p4 \lBpt2  h"`l—1p@ \lBpt2  0l—:pH \lBpt2  l—P 8p\lBpt2  l—pH 00\lBpt2  l—,0pL \0@ Pl—`pt2 ` l2pH ,@ T0@P 004 PH LHlRpt2 ` l—4p1 \lBpt2 P l—p 40\PCi@@%I$pC.$ -LMl`ppt2 p l2p , H P81S[ l–pt2 p l2p ,lBpt2P p l–0p \@-l–ppt2 p l2p ,@dTP ,lBpt2p l–p 1\lBpt2 p l–p 1\  DlBpt2 p l–p 1\i@ p-LMPgl• pt2  B l2p ,d B`0 @`0P MT <H0`2xV0`2x@i@t3ADi@Xi@li@ -LM0Ap`S@I$tD$H$D$tD$|D$ilB pt2P  B l–p 0\<2l0<2pt2  x2l– |,00 p\lBpt2  l–$0p \lBpt2  $l–0p( \P8S LHT lRpt2  l–@@0 p\6lRpt2  l–@0p \lBpt2  l2p8 ,l–TH pt2P  10CN>C 0Cl–0b "!HQ0p4 \lBpt2  T8L! l–p1@ \lBpt2  l2pH ,lBPpt2  l–p:H \lBpt2  l–P 8p\lBpt2  l–0pH \2<2 0CL(<2T(P(i<2l–0<2ppt2 Pp l2p ,LHT lBpt2 p l–0p \2o<20C<2PFP0=2l–Lpt2 p l2p ,l–Ppt2 p l2p4 , TlBpt2  P(l–`00p \l–pt2  l2p ,@%I$0U0U 1303 22a0S106SH0H060 010 0-Ql2x"@P@L p,l”x"*0 p:\00 =2S 0 &6D0 0-@LPT6S\0&\0`0V`@0h 0-PL@C640F0h -`LQPp 4@T0000 L00 R0S R06 0 -L@ P 0h p-0L P\` 0S @R60 0 @ 00<php -@LTp`; 0S8 `PU# 0 0l0t\0\0\0S `Pd@TQ d@T Q`d@TQY000x&\01x2 x0\0Si@ -@P0Lp<0`0C<0 R 0S R06 0 h -@T`Lp\D 0\@0P0 ;0C 80 0 , $(\LpC 0\Q 0Phw p-T`@PL\ 0lD0 D0T\0HPbD@D0 SH@P0\000phU 0- L 0PS0 000@, 0hr -0LSS`3 0 00S8 @T1 Pp4 <D 0' 0S P%40S %%88 8pc4@T@p +%20# 0 000i "888S@P @000SR$R$R$R$@T% pPtl 040U01#.#8*"*8 #Ƞ00PpP40Sd@T00wi@ p-0L`PCT0S@l0D000C! `0(p 0-=2LSP 0i@0h 0-0L @Q 00S P tl 0{ 1S Rl0P0h'Q0h5i@ -0LS8 p 0D<  T0$ PW@S4PW D<@ 0?D`0 8&888 D  0m,l0Pmm j@0 00S -`L0Pp="RC0 00 @0!000lRPz\  1R11d\0@6 t 0s@00  ip@lPG iDj@Lj@ -LMPl2x"p ,!BP x0S QE\P*(0KVPk~p`4(0$, 3  h (0Kl0p@t6S\06\ ` ^``pV\ R`0`0`0 \ &?lt 0^0x0\0`0d0 KP -LMF`T V@4064 ?040lK?*$0KPPP@p$0 P,@ 8$0K<0@@DP6*U40@&E -LM<`@@,Pp@  S0 2-6-0G4 0 T>\0< 80 ,   p3, 00<S4 !4 0PP^ Z00< `>8 00c S@1`301 :J$JJd ə@``V00, RP <bP7 8:#: \ &0^ 0004 S804E I ᤙTP40140 V, R ,` D<4 0~p P(K0<90D04 p, 0P -LMp`$0 S0S 0S @R06 0 @0 0<00E K8P< P0 @O0040$K(K 0@@PP(0$ 0 $Px0S <2S l@s$ a<00$ -LM%0`80 0,@+P P@x pP@p 80$ဠ00R@ 40 ,p [80< % 8 01@08 <0<, @0 0,0D40, 05804 000p!Zl1004 0<DE @ @4@p匀`40S@@& 6P00(K<2Sl@ [,K0K  0 Pq@P  @b 0804 90004p00D<j$ p-LMFPT D06D =0H0D0Kp 0KP` 0@, à   P 0KT0X@\`6 VD0@ -LM p@="PR ` ` R0 6SP2`,0(KP `2`,0 Q Q Q,    , P Z4  l `0,0 4P= 8 ~P0 8` 04 0,4Ru 0\4894 R001; 80;!   00T00 ?0\0D 00004P񟗞c$4c$ d$c$0 H!, 00C0SE0 40`<080h 0 R `0{ 80N`P0,0Y@0i(`0v,0`K @0`Yl0,0>@0`M 0 4(* CCTj@tj@Chk@CCC0.S 0!C60,ʠ 40004 40 40QM0 PU< 0P*@0, R00@`>  0^$0ʌ@ @0 P 0 $ 040$0@( 0,  ,  $::5 0%(0 ,0   8,0, S @(K1910d0'@ <0S8l2x" p,2P0C" @0 00C3 R PS0Q8Q&< R<@F\D 2 @ 0S00h01&0\0&\0xS`0`02Pc 80dT@@ <080<0<00嘠60&@p$@<2S(   k@k@ -L@uPh -LMP0`="R @  K0  0p0 8 $K(K? P@P @(0$ 0 }$0S <2S 00& 6@P@<2S Gl@ N$ -L@P 0h -LMP0`="R @  K0  0p0 8 $K(K? PA@P @8(0$ 0 $0S <2S 00& 6@P@d<2S l@ v$ -L@P 0h 0-0L P@=2S 0P<2S00 -L@P 0h p-PQL`@p#9U 000ESQ 000 0ASQ0pp -LL0M , 0p="R 1,+ )0*T d<0@ %0& ('$RD9Rl 19R Hڣ R 9R 09R00b@qP, 0R9(KL9R R R RTӼF 0A?CR< "8R, RU0008R T`K( 6 R0Kl—p, 007 0P0KQKO KP 0  @0P0 00S@1@!  TKɓV ڸ6VUx"l—1@  p,5  A4 XKW0K6 SL4 XK U0KVK喓 R 85R 0TFǕ 05R 0Rr 0l@@l@ -L@P 0hE -LM=BT (Km. 0 嵢 , l2pBPxb \p,@0 D 0?00 P Z, 0(KooCXl@ -PL `p=20Sc80 XQm0 W 0p0 @0!S00@00plP,\T@ 0\@00 ;0CPU D<@ 0D@00 ;0C4PU lN06@ i | 0 00Nm7p@lP00l@Lj@`l@ 0S0 0trp 0-L@Pf0hh-0 =\ X 0 `\0d hP($ 0-@LP\T 0HD0 D0D0 SHH \0T 0h -00`L@pP(0 ?00hd -FLT H0S6m>6 400e @P 0A-LS꼅$$$$$Ȃ$i%#`:<20<24l2p ,2l˜x",2 0p\&l˜P0x"0 p\6S`P6Sx"l2A@  p,=SPx"l˜@ @0 p\6`SVv 26Sp@6Skx"l2Q@  p,=S@x"l˜@ @0 p\<2&0R`<2@6Sx"l2Q@  p,$2@0Sx"l˜@ 0 p\6Sl2px",l˜00px"\@dTd \l2x" p, @<20C<2P'`0=2l2pb@xR \p, 08 10l˜x"@ p0\@dT& "l2x" p, @l˜x"6p \2 <20C<2i#l˜p 0\  l@l@ 0-@LPP PPnK0 0-=2LSPX20QX2 @jT|2 6S nd6SX20CX20 06- -l2Lp $l™xp ,l2p ,b0`2 PZl2px", P@$L$Ј$4$<2奯 * 0P@0"0R2 2 !Q l™,0x"0 p\e KP  t#j>060 D07 ` @40&@T P? !l™p 0\ ;2<2@:!0=C 0Lp@Dp @@@\TD ;0C`@0P1T*pD 0 P@PD PPLp\TT"P@Ue:@TP!0  6@P P :0@00 ?0C 000LT\H@D@D 0Fl™P0x"0p \ n mel2pb@xR \p, 08 10l™x"0@ p\dZk l2x" p, l™x"6 p\Kg "P001"P|Cl@\S$l@ p-T0L@`TP @T 9S  @Tp4o -04 10@LP  >00t*R90  q0@-P( HT L) 0!"4# 8̓ t\0S \0S  RJTPP \0SX00 P Pp0: p0C*:p0: _0C*:0p30 P  0 0@-Q 9S$$܏$$$0@9I )Q 0@ 9I) 0@ 9I)0@ 9I)9S B -bLV@pȐ\P RU00S ʜ\PQ 0P'S% 0QL 0! "4#8<V+*t9X ",0( 4;2( +>`P @1VX ",0( 4;2( +>$0"` *1405 6478`:p ?;P L<$+4"2L)540674 8<2L)! 0"#4 8̃ˆL405 6478;P8p 4 ? 4 8\,Q0P , 8K00K0S@P`P`D0 @@ DKB2MP`0 K ཌྷ?c`LW? L -L^P`p@ P@L) 0!"4# 8<^P@+ -0" "202 0-L@ 0 & 9PL)p 0&09l#R 0 ㏪lp30|$ 0-LP@@T0@ $?:P(; W ,0 04804@V0 :0*:1 0C*:,0 0@ p,H`P0@pDP0` p0@ L#D <P`0@(!(Dp#L440@>8m@m@m@ 0-L ML@! 0Y"4#8 0 K00SPtɔ0X R1X R0K! 00P000SU\p 0(ɄK0p 0xm@Xm@ 0-PL@z00P0@T0m@ p-@LP`T0S @ 0 0 0 8 80P8 ph<m@ 0-PL@T0S ,@ 00@0@0  0m@ 0-LMP~@# 40  0   l (00(0 ,00,0$00$0K08|  v(n@n@ 0 -L4 8<Se\n@ 0-0LHPT JT LL  -P00 -*LR@ XQ\0\0\0:X\0*R*R XQ\0\0\0 :X\0*R*R XQ\0\0\0:X\0*R P ` Rd0d0d09` d0 P PP Q00090)R P8 -L@h -@L R 0S0S PP  0S00 R0  004o 0-@PL YU 0)9  @))> 0 9Y 9  @@9 P R0 p-dPL `R@ 0S0S  R  P00pp4o -LXM@ %,  0D P`p0 %4 8 < @ @0 4P `p$8, (<4@,@0D8,(K|n@ 0-LP(0U@  D0hpt3AD;An@ 0-LILPL @,08 H 0 48  -LM@p`t91XPU UV =t)1L)p 08`X`p 0di+ Ki&n@#>$ 0R1H < p-L@P`ph  0-0PSL S 0X0 *X\ :P T0S 4@0TT0 b@T0T00X R\0\0\0:X \0   ho@ -`Lpw Q9 Q7 Q3 Q@ : Q, @00S"  0R& 0000S 00S0`X0:\0*X`L:PJ 0@L:PJ 0S\0 Qi 0R\0 Q4o@ p- 0"# "L@P0``9H:UH D0 20l#PP0`9dpPlo@C -*ML 0** 0SR !* -L@M܀0P$0  `R00p- $ 0R$ K^@K:*W [ 0 Z0KW K[K^pK]pK\KL @VK+L HNK +L X>K+: ܲk> -1L MP U$ . ,@KS* A*P$ xW! \iV#`V P0 48<S@@T (T *P < +*$ 0R KzW oܲkp> -LMp)(0! *@@"`+P 48#\, @ n 21C0a1 @   )P0 48Q Q QD H r0 $ (,)  )) 048 <   )Pa0 48<@(0) *4+8<SL, 0RM(KO0 0 PP0   #0 $ (, Bo) 048<#,##Ƞ 00 $(,0"̠""N 800PPPW00PPPo ܲko@to@> -LM Ly@W ßX9 "10 0 0 ʔP $̠$$$H  @ 0 P$ (< L  "\!4!!̠""HP 0@00 ( !" 4#`8 ,0 W9 * Ʌʅʅʅ ` ~@`9`d0)40@ 480<(0`PW$@0S8@0 --LM K00,< 0!/ K -hL@P , P  p@q@ -HLTp` +^JT L p 6%Pd:S +^ 4q@ -HLTp oJT L p %PPL9 h P PPo 4q@ - 1LM` hpP( @`0o/K\@{P ( 0R)$K_K $1 S h a0$0K 0RSJ/K 0``p` @p@`pW`p$V|rܲkedAHq@$> -@L`p  P匏PL v X)R_ くp)t R t9 RX9"100PVp P Q0p9  0S00Qp p V#t9PP 0 S0 S RQ  PU p t9PPUpp P t9 P2T!   PP (Cq@lq@ --LM K00,< 0- K --LM K00,< 0- K 0-00LS@P H D0  lP"P P00kp -LMS8# 0 J,K fP`XI 0̐K:0 . #0h0 0, 0h!0 P` Lp 00 H D P P P l0 0l00 { B0 + 0 S ?04X@ `p XP1X#\ "  "?04X@@,Pjc(K 00P@K00@@|rq@q@ -L,Mh$V0,0 . +^jV* L p H#P4K "4@T@T  6#pPP (0 @  `"P h@+^  P@8T, 0R5(K @ W"L)04 8@r@\r@r@xr@ 0-RL0 0h 0r@ 0-L M@P90K0 p-X9PSL lp  ŌpI`T L !ㆌp\ !@T \ 0Pr@ 0-L Mɠ@P 00K0 -L(M0P ,0 P0 0 L0 厌`P <K PpyW H D @ \q P 0P048 L2 $(T\= pWH0SZ  @Qx Pp9St \pq $0( 4L8T\r P t9 X WW \q0x pP 0P L1U% $0&'48 p-LM`R@P ! P $88#Č@ a@0,  @Kps@ -LyMD0 , ! , 9SM S ğ, 0Ri(KL)! 0"4# 8  t@X R`qX0S `V  `pW R 7AX0S3  RL K 0 yKLcP  |ß@ h1vvPXh.KL0vP 0Ch1 uv`0 ! 1 S L K!(@K02 RQ 0 L KS/K 2"  @  ! "1 @}K  S ! ie 1AS[{/K }OK0@TPT[D0 L KP PP A0P0T0S`L)000000000K LK\1 `0L 1002@3 48<}K(, {/K 0 40L  8H0  l@P L K]\ATDT[0 L KPHL) p L0KhOdIֈ L KH7ܲks@t@s@0t@s@|redAl>Hq@\t@t@r@t@t@$t@ -LMLɐ 0!"4# 8  tpX0SP  qX0S  R p (KoPW ?00 咋bVF 0S`V> 0S> L)0,0 p h0㗿Q@ @4 R 0 S@RXQQ 4 R 0 S@RXQѾT 0 8xY,h c0(Ko'0S*]4P@: <(\ $P2"0CR202 0S00jᕾu@? ;90: =!"#0123456![8 1[ <0@n!1H0!X rLXɀɀL V\ bt " 2p9vP"OӉ"R' 0S0202妉@X t PZ p  Q @ ‰ܲkt@u@|>u@|redAHq@\t@n@n@v@n@r@ 0-@1L PR "RE HT P0S J0T0R R R 0 0hZp)R \0S \0S R`w0 lP L)p f00h+Hv@hv@(v@ -L8M0pXK@`P 0( Xɔ\048 L1 $(T\ 6( 0Rc$K"1   P d X1U8@K `0` P 0 4 8,R* R R 004 80 0 @00 @ @ @Xh 04 8,P00 $ ܲkmarcv@Cv@CRAMv@v@n@> -LPvM0,0 ! %((0"4#2r 40  $yK_P l ! Xß, 0R(K@ß@ h1ArP [h.K0rPcŸ h1=r@P[1 S  Ά`P  ȆP !>KXIA 1 1K01 <Qp_ 0S%40$ $yK! ^PK h1qP@0 @PH048 1 $(Y |!h1 q[X h1qw[r@O<1ZL K 0 0P$ h1 q][VR Nh1B  (8@ 3 100 $0@ܲkw@|redAmarc>CRAMtw@w@s@Lw@ -LM0  80 pX "10!P040 QpiV0` + 0㨀00 ,0  0 \ 4P0\X0048 L1 $(T\ `V X0S\`V㜅Y 㗅0(K0U \ 0P,\ \ 0\0 4 㮅. 8L 0,0 000 CmarcCRAM -L0M0RX ,0 `S Rp@T  ㅅT0p900p APt0\@X0, LK 0PK]P4!Ph1 pP2 hNP0 `0 0S @00$@S p TqT  XpW@d, 0TR(KT0P T 40T0 P3ZT  ܲk|rCw@> -L0MOp \, P T0 F PQ8  c 0\9l PH r ?Pg/0p #18#hV*@ P@VP# P L@K 0 .  x`  -HP `l, 0RE(K  "pX 7 " P2 P PPp@ P! L)540647/8 <S 0` +` &` !`x[? I2Tʘ0\T9 x9|I @ P0 x |&- P R0 K0:(>*08\`P@( L 0 4 80P 0#,##8  0L" 048 <  " "4"Ƞ 0 @| p9S 3#  0@@ T0 TU T * T1A p =`P \`TQP`P0ST9V L) p L)0W\IT x:S P @TXʘ\l  T0 Pd `Y#V#`F dR` TM`L `8@  BiL p hphP9`SQ 09L `@ p qQ!L) p ` , 4S PL @p0SP&$<$$$301 20@L  p>L9p0 ODP  5L) p ~ᶁPp BPL  L9 p0h L ܲk x@Xx@Ty@8x@x@px@>y@T$Ŀ$ z@y@x@x@x@y@y@z@tz@z@y@$8z@ -P4LȌ?; ,H  P ,#LK09=8< >:; $? (H3 L \(@,P, 09=@8<>Č?:;P|H Ȍl0`4p,H3 8HLH H0LHO0X0嚂L"RE 0SH0L202k(XP( s8< 2KT0s0S   <P 00h0  CR @#00D3  @0 QPZ2Q80L@K0C80L 0#L 0L@d@1 r! 0X @P @DX3 0|Sl : $Z 0@1 r0@嚀P`p@ČDȌ,$Z 80R L#( 1@6K0p 16K   ` 0CSv PL4@L<` 2K0L=ā<# <# XYY8cP@XpT $PPU@`W4P @$PPU@$CT $PPU@0Q0C 0#@T@3S D\ P, 0<R?(K4Q @  HP0h0 $@T  =PP X 0SB*KL3Ds @s 83S# `< ,{@ 0-,!LM0PS4^[!;08P@ @)  x⹏!09.3<00,@K  y#S7΅p 0 `@`X 0@P崙0@ F8o{@{@4ox${@D;ACH7$p$0ko - LPM , L9p89:=@< ;P>$?(<L  %P\ X A P , 0RZ(KL@K wX0X # -LiM  L0 ,0 = <Q0@>?`@9 8p ᔑ唁ČȌ/0P:̌p ! ; a唡! /T`Xl 0O| a  .K Op 夜q ȁ b?KKAsSO<@  !  ʃ|kK  ഑ 尡 mKcP\  |Q xa X ڀ!@xX Zz(|Yv$ 0 ATbK~KpWP`P`B2MP`.K ~pc0`Ap X P P` `8Q 4a c|( $ ㉓,q 0 \ (|P @X`@A HQ DA A @h ?$(Yt p [K]KpWP`P`B2MP`]/K Voc@`(!\|Q0T0R d  0 P`\A 嘡9S@ N?K0@81 4A ~KP`0PU`@p0q , JK( $ x VFژL9L) 0!"4# 8̓ t 0X Ra 1X R[  QP 1AL)p x9`QX, 0RO(K$axqVꘁ們L)p #u| U(|Pr$!x1Rnq封p !""4",H1 @  < D! dXO@b0  ɩ !tꀡdW lQU 0 #ܲk |@@|@|@|@|@d|@|@>@-L)@ 0!"#48 <29 -LLM` 00K\0 @#X@ P\ L)! 0"#4 8<4  L H  ?< 80 ,00 H@4;T$P0 T a\0P@t 0 dkVTn 0D @0 TKpP0S[W \D0t L 0X$(^ ,K &L ty908 :=<;`$>0(?P ČȌ<L "l!4!Ƞ!"D"X Z?`90:;=@>P8< (Ko}@ 0- @0L,(0 :0 9 0X*T:<}@%%%-0 4 8<S 0-,08PS 0L(0\@ᱯ0 -LM L ?P@ D0HL`P0 0@ P 0   1 (K04 0@L0L)p T 0,0|@ 0-,0LS8P 0 ( @\0h p-`LP :zHLp" !]P0@pPqIT P R 0<0/`@Tfphq% -2L@P 2S P P z"`g=pP P y0S0 (  R(J00P2 = -LMP0l0p 0h0 ` Ph 00000 ,@ $ bR00S40V<0 ,"?110AOHL( 0h8p 0 0(0 40 0-L \@ P S  L) 0!"#4 8<90q P02 Q " R;P0#2  P  00-P0 L 0 0) 0@ QH8LH@0@ \:*808 X:T*000 `:d*(0( x:*0}@,%%!%(4%4%1%P%8% -LrMt% 0L K@, PPFyKOPP$e h1cP L@T $h1 cLL K9, 0 R(Kh.K0PcP 1 S L K\@ h1bwL@L K$02(K01SS L K@ [w\@1@P`0LK h? @PL)LK5406748 <00@4P!(@,P * L  8 H0  1X0 ,w@m0a 0 0 0 /0C B0 0C B0 @p L = B] P0407 P!@! " # 00123568 9 : ; < = > ?  "2H?0"X: v(8Ly01`X99   \Ɇvt   p.6 v @ 8v00!   08   B \90L)\)(0*+48 <0# #Ġ#+)*(0PY RvV@ t PKvHv@W BvXSL KLZ 6vܲk|rT}@edAl}@t@}@n@n@}@n@(>r@ -LFM@`KO_Kp@1 , @K  \ J ἔ l@! g 1  \ , 0R(KܲkD> -LzM@`TpP@K z  K肏K,6PU @ @BU@ -LM ( h9i)Pj 4k8|WN@ P -L(M⨢0 P,0 P04 8<S S `2, 0R"(K<$0 0@ QH8LHdAP  <$04P  FmPYU<00`PU 0h0lP TPK$  $L)P L 98:p<= ;P>`?< L#?1SDOpPP0U ! 3(00  D0 X`P HLp !]PϪ0@pPqr0mqiܲk}@p@}@>~@% -LzM@`TpP@K z K肏K,PU @ @ⰁU@ -1LMp@, h9i j4k8 XP` @P@K  |, 0RX(K  tP 0! "#ČȌ̌h  ;tp6 @K  ;+@K @P+P!0 "# ČȌ̌h  ;~p 0hkIiIjI ( @K;@K  A $tP@@P,ܲk~@> -L_MQ‘0\$0 @ \% goKpKcK@$ 0RG K2S " R7P@goKpKcK P 2SgoK i7PP 1SpKcKpK Z7PP 1ScKcK L7P P@ܲk> -LM@ (p0`0@@@<30#@ !@"@^!0 " #ČPȌ̌ h;0 hkIiIjIΌ; O0  @@@ M-RLp0P`  4K s@ spO0 0 \90\IL))(0*+4 8<0###Ƞ+)*(02s- 9P2P000) 22s# @$ ,$̠$@L9$`$H:? 9;=>@8p80<@(Ko}@ 0- @0L,(0 :0 9 0X*T:l~@6%d:%h:%@-L)@ 0!"#48 <9 -,0LS@P` 0(00  L |p2T0S ppPL8p  0 (0 t~@~@~@ -L$M0K$"`P=L)0K0P 48<@0 ,  .  8   0LY@ty40 !0 "# a00@1X R#X ty 1X R02I *(KLY 0! "#48Q8 <02A 0O0 K  HP  80Y! 0"4#4 8<S 4 L)p ~@~@|@ 0-L MLI! 0Y"4#8 0 K00SPtɞ0X RO1X RK0K! 00P000S/ S 0S$0S,0S> U4@%x@%`@%@%@%4@%\0<' \Ɏ$ K0\0<&p 0\0<\0< p 0,L 0  召 xm@Xm@X$ @ -LMP@`t)q0X@T& T A%B%A% B%8B%A%A%V V <t)0L)p 0PV0X`p` 0d9+ Ki!0FSV ViV Vn@#> M-L0R TKL9',&&Ƞ&'D'X? 9:;=@>P8`;p?P4 (8N  0]@^`\\ X0 Č_@Ȍl5`P05 eLQXpEP \ E0LRQr5BPPTp tᄋ4UL H0 jt p | x Pp `t08P 4` +@0 , <0 D@ 048<`p ` p 8 K `pP ` p <` K tpK@@@Prʠ K @@ Pd 00 0 0 0 0P\ K |K_LpKHL  2. @   0@ 0@X*X\ :PDh 00#媚 0   LɚX 048<@KQ \8 #@$,##$T$h P`0@L0 p$89`妀( | =@:P<0dp  >;4` ? 8 ́,Pl @h vdKlpKpWP`P`B2MP`l K /_cP`DU 0T`K@0@|pSZ PIDP 9SW0|K@| x 00K8K T@8 4 P LxPP`ULL) 0!"4# 8<P`Utɚ0X R;  0X R3 0@P1QiL)p WPxT9S PR L)Xp (Ko0 8 řT\ l9|@|@|@ -LM00K0 @(&@ PLP`L9`]!\ Pp"@^ $#_` p( Lp Z 0`KP  0@Q0@5 0H@Pt@ pP 夀pP0H t 0c9C  0 Q 8@Qᄛ4T P0 0K0 @ PH0 D@ T0KtK0S@80 4@ @_\@ XP @ < 凔ᦛᆄ8Lt K PNY\Y@%^  L9HK`p ` p KQ l h h0X`( ̂S c_ t K N^@ K | x KG^t K x@ R0Sd `0 ʮ 0|`K@`p|` xp pP `0K Fp`7NV>F DKT. P T`p0##8 K 0`t)|01C X R pWh (K\pQ\Kl h P T0`##02, l`KLp| 0 pP\`KlK`Vp\` Xp `D LL B0l@K0@ PLP| d0 PP A  0l@K00LP| P@P !P  0 0 0|PRULL)p  PR 0S 00@0 0 0X @X0`*\ :嘠ẟ etX@@d@ 0-L ML@! 0Y"4#8 0 K00SPtɔ0X RM1X RI0K! 00P00 R- @R 0S$0SR4U Y%Y%X%LY%hY% Y%\0<& p 0\0<' ɄK0\0< \0<p 0 @Xm@ @ -LMP@`՟t9q0X@T% T Z%Z%(Z%XZ%(Z%(Z%XZ%V V t)0L)p 0PPVX`p0 0d9+ۦ KiV@#> -L9@] \L^_  pX~@ M-L0Rp` z KL)0_^0\]LɐpG] \0^_48<4@s ǏP`7"#@$#$#\$d$x?9 :;P=`>p80<@ Ki @ 0- @0Ld`0 p: 0 B9)D0D X:T*<0< t:|*404 :*,0, :l*0@W% [%[%dC%J%|Q%@E%tD%Y% @-BA 0 0#^0E-Bl pA `P (  0 8 , 40<`. VP8o-\0\   0"  P1 0<08o8o 1 0c8o8o-1 0 8o8o -p`@QLU   iP 8p8 10!  \@8o8o8o -LM `, 0 V@Pp+  00 `!@P&  0  S  hP"   00 ,k(K P  `P   & - 0L @P`,0S (0  L pd-ppP L(p  0 (0t~@,@ -`@LP pI0S  U R P L@ P L@ 0h000 L@ 0L0i= - 0L0 0X0 *X\ : 4@T @T -LM00K0 @D.@ PbP`L9P]!\ "@ $#`( ^_` T Z 0`KP 6 0@R0@@ 0H@P@ P ĀP0H ㄐ 0c9C  0 Q 8@Q㣔4ˉX0 0K0 @P0 L@ 0K0 @ \ P儀KH0 D@ \0K0S@@0 <@ @_8 4 d@ `P 凔ˉd ` `>@ VB K QFQPY봐`L9pPKK   圀K KQ l h h(` ̂Y ʁ K ZH K | x Z8KX 80Kt0 p@ pPx Uʳ 0|K@ | x x Yʣ 0|K@| x P 0K EP6NU>E ;0  ? X \@0##@ K D0SDڴ`@t   1X R02 X t R |PU  @D  RN P Q ! `Mp)90 |KTl yD^&`@P|\ K ` X l@K00TPˠ PPD@_\ dKl0KQ d `   PK`P`P ` T``T` H0SP  lP lpP} |L8@P uTl 0Tl " K PPlPK```K|` @pPWt K lPK`` @psPG` K ` @`dP8lKT | K  QP%l0K K @pt@  @>PlPK`` K `` @+PY \f  (KY@ t Rp0S@ |PUx`V@x\5 X%Y#0dQzdKl h uX \P0##@@P Pt@ pP zH^ P`@P ` lK| K T H@TP`@P ` P )  0 0 0|0X`Wt|^OF|KC|p@0rpl T*lPK` K `T`ˠ  @@@`pPiD\`0@X ( tP* |\- ; 0l0KT@S   @G K  pPD`D0O\ʗH^X Y tPpPU |\x^@|K0@Ÿ|P 0@$ p l Tl@K0 K ```T`0 [ P`p(P Pl@K00 K P t`PPD`VL`0@X- t^/ |Q2 PU5 lK+T0 !0000 K P`DP0OUH\XY t^pP |Qx R PU\HPH\H^*P븀X 0 0@ 00X 0崐X*\ :帠咙 y(*r8@@@@8oX@@D@ -L MLɐP! 0i"4#8L8 K00STt 0X RM1X RI0K! 00T08 R- 0DR࠳ 0S,pWT4V q%q%q% r%(r%q%^0>& p 0^0>' K^0> ^0>p 0H@T `t9`X T@Xm@@@@ -LMP@`ᔙt9q0X@T% T s%s%,s%\s%,s%,s%\s%V V ؘt)0L)p 0PP\VX`p0 0d9+⚠ Ki辘V@#> -L9@] \L^_  pHML) 0!"#4 8<0S039X~@ M-L0Rp` + KL)0_^0\]LɐpG] \0^_48<4@s ǏP`7"#@$#$#\$d$x?9 :;P=`>p80<@ Ki@ -L@ 00 T=P0  H p:09X*808 T:t*000 :*(0( :l*8@p%Ht%Lt%\% b%`%`%r% -LM  0d8 'py% -LM) 0d8 'py% -eL`Pp\< (00p04S80,0d0804p 00 , 0@07< w&((0"4#220&$ 04 @ 0i[C@@L@WEVpy% -P L d&@ pP` 1TI t1T) *`ҢT1T* L1Te/S`,10S ` 0 `P `P0T$ ۫0 00" 0`0 eyb@ 0be/7b 0U %40$ ( Z`krdAhdsd edAk~gdpy% -HL!88#!kP1 嫦p" H0020p(P00`|4Q!@04@aT@!0   L S@00dD0㶗@ /  o44 @+0804 D⥗@ oL RkCC 8 8-#TLL%p`P 0@> ަ6k 8 8-#L@(PPp 0`!pP 0S  0㍦p 0 pPk -L@匫0⾫<{%0L00) -p`0L aP$  a@P P00 `(Pp 0P,0X@P00 @z ikkkp@pX@x@ -L똁@ -L똁@ -L@800S SP 0S0k -0L -L@\p``h# 10 0 P 0PW h@ @ 0-PL@V0 00h -- LM K00, 0 K -- LM K00, 0 K -- LM K00, 0 K 0-@0L@PT@T vP00k 0-`0L PRT  0@ST000@m`T 00k 0-PL@ `P 0 @ P00S0 0 00k -LM q 1@T  P0 1T, %0T( 0T% @0T*0CT*0T0`K 0c%@PP@ 0RKp0T h0TP  @80T @(ܲk'B&B"B!B$BB B(B%B> 0 0 kk kk 88#4 P00kPკ 0 / $ \k -@L㒕4 R00 0S00hޔk -1Ls@ $0<0u 00@˔4kk -pL0PS`\\0`@ L 0?V0C0奔kk k 0-LMDP00@K0 P  0R0K0nܲkk> A-L 0 R kk -LMp0PS  @ 0RK8`K0HD ɌPP 'z# /ܲk k@> -ĠLp@W `P L @?V@W00 h崋d~X0 R L@ ,0?S?0C00堋jk k kkk@k -LMD@0 ( $K,0  ,K 0RK؜ܲk> -LMD@0 ( $K,0  ,K 0RK応ܲk > -QLMK 0K 0SB$ % p-LMPK@` ~TCJ |4QZT00V0S 10C x 00Hk80 P0S0SPLk@ P P 0S00]Lk@@ -H L@T00 ((0 R00@EHkDkoL@ p-L`P@P @ph5P , P @``00p ph&d@Lkt@r -`@L0S P@T <0 , @ThLk@@(D;A@ -@L ;hj 0-DPL0S 40@T  )@T000PkLk p-L`zPP @0 0` @0!# pt@ 0-XPL0SH0@T  #@T000PkLk0@-\P@ 0R R R  0R RT@@\0@0@0 hk -LM](0Q ge"p A@ p-`LQ 0R p 0 S0\ P  \ 0S@@PP    \ phv pa0 -L6U X -L0UH -L*U H -I L$U -LUI - LU -L P -LhMa0@K 0 Pp~ 0RMK@p P& @lPK1@0 T0\0X 0 T0P 0 L0H 0 lK@ <K0@ lPKP@@ _ P @ vP @R P  TH1 Tʺ,嬚% % ܲk܂@ A@@ >@ P-L  0PjAo(m(Q0 h+`|r( ៵(o fQ,( fQ5:( fQ9( 0fQ\2p(?* 0fQv5p(@* fQ+( 0- 80fRPP@LT  `,@T05p( fQT,((i[( fQ~:( -LQ @  Q@hk -LM`r0`@ 0 P# PP P 4x 0RpKTH PK DP7 P1  @T; { P \ !0@ 0K\ 0K0   h1 R`1T1X!P!@10!01 $- @ 00@@; P  @KKUP00  00@@ ) P  00 0qx僙 P hyK2PLqyKx ܲk@looTkoo0@@o, ><@L@ -0L0M0@ 0 -L0M`0L P ,0 PQP ZJLp P@T@ .P I0DP1S4h%(%(%(%(%(%(%(%(%(%(%(%(%(%(%(%(%(%(%(%(%(%(%(%%\%,%%(%(%(%آ%h%(%(%̢%(%(%%(%(%%4%(%%(%(%%(%%;@PTIY iY``P \)PQP Z<,0 <S`(K pH@K 0   ^   U  |P KPPt 0@^S t >PPg 0@^SDݼ 0H@K 0p SpP  ļG   廼>  0@^S尼P2p/-t Y l壼h0`*`l0嘼P8噕ܲk@D;Ao @@$@s@@,@@(ԅ@oH > 0-0LSP@t   0hx lk -L@P P P P P# P P3 P& 0 0 0  P 0 |0 lP  P D P `ooolooo4@H@ -L@P P hP  \4dP 00c0XH@ p-LM`KP Kp @@F0 z PPP0@S00S@ P# K^P T 0S T U  F T"T  0 4T F +00H@X@ p-LM`KPKp70@S@ PK T00  00b0 0 '0@S@P00H@ p-LM`KPKp 0@S@ PK RT002320 0 0@S@ P4 R$ 00H@h@ 00Cs0 -@`LpP 0 @0 SR0 ӧ P R @ 0a0CSa0Q-S   RD@T 0a_S@ ThT > >@@ -L(M 0sS  P `PLKV>  Z a0@S( K$ \R0S  0S0SQ+0@a$0Lx U TA00 01 (KP0SK }1 岺` `|!0S PPB`aTU Yp0K8 0@ A00cP L 0 7,U`&0S@  @ 0a0C0S0@SV P0P000 R  a0B0S(0K +00B R0:S 0:S_0PE$0L000C SP0 ZW괩oo@$k% 0-@QLPJ @TZ0 Q-L`ሀp@00fT*P 00fS 0c00f000f0\o`o p-@@@`08PcL0`000p\o`odo 0-@QLPJr @TZ0 0@-L@~S~%<%h%p%%ر%h% %h%8%%h%8%%h%X%h%%h%\%%h%ȳ%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h% %xx6 Q 0@^S)\V Q0q0 R:@0 00 `P0aU 0R 0 0CR0:E%0S 00C0x5l%0Q*LU@0Q* 0 RE5 Q* 0004$0Qd帄0\ᔔ $0ST t吤T000 0 S\4T00S0  0 0 @04#0S*cC3Q`3 be#C0 0Sn0RR0B B  0S 0S S0R SU K 0RLRr 0Gb 0SQ P000B Q6br00CS0吢% G"8:|R0B0 S C R0!H"010Q? 0$RC 0 0R "p쑟000 0 1R R 1 1`1蠡 G0000R010 0QH L!<000 0 41R R0 0R0 0p Đ P* Q% 0Sp0PQ 0S|0\^0SRL0 @N `oXo\odokkkok@o -P@L@PpP`P0P @D@PPP P  00`do`oXo\o0 00ohoo4 P00 0 Q4#5khoo0k0k -L 000kk -Lt T8 !0@]S@00@ SE0P03P0cp0 QR`TWpD@T7pD0u" @/TA DaDU9070S0pDU A D00DR Sa0D_TS0oPOPP tPTP P xPXPP 2P@A @a0@SR2\T( 2@P2@U tA @a0@SR@0@_P Q:P\P00 \Tbp P@8X0U0hSp P@I\P_P 0?SC%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%d%\%T%L%D%%%<%4%,%$%% %%%%%%%%%%%%%%%ػ%Ȼ%%>P 営 +@<P*@.P @  k`o@loo@Ȇ@܆@ P 00k -(@xL0P 00@ooho0k p-LMPP`V Dxh@8@0 ,$0`x(k@@(t3A,@ -SLM@ 00S S h0Pd  0^0?l 0創000 P  0 P kd@l@D@L@T@\@0 0 `RkkD;A -鈠刀pL`Wt0@@VW@@ LT0g0C `pW` ?pkk k -1L `Rڴq B0R !0F]S& VT V1 VK VZ tQ-@@T cP: qP8 PP@ 0P0C0(A PU @0 0 S 000P@@00CR 0  0P0X 0000@0 (0 hkkt@@kkk k -DL4M088 S, 2PLKHpKPKTK ` 0L @@  L (TQ 0P PL0P P Rd P0Sl0HH, 0R (K0@,$UkܲkTk@k@D;A4r@ >r<0  4 40pQ 0hotoloopo40,0, @pQ0 polotoo<04 40pQ@ 0potoloodo cR(0$0] B   0 0poloo -8@LP 00@P 00 kk 0-H@LP  Q 2l 6S Q X0X 0S 2H 8S i T y$0u00 kk 0S00po -pL0@SSHP S 0S i `0 Q00 2| 6S Q n0000SXP 0  iDitpolo -PL`eHps@P8 00CS0 @TR]@0S S' S: SJ 0S 00J 0 00C0 4 S 1!0S 2!8S 0S 10S 0S x10S 0S HpX!00CS0D1 R 8嚳,喳 0Q/ 2 8S* 0 RT T U 0Q 2 8S0r00 CR@@DiTP`c U\ 000D 00CS0u po kkhoto@D;Alo@doH$A -L\  |o - 0L0S |o -L\  |o -鄐@L0Mp`0 ,0 P \ ,0K ,0SP11@5@T00 P(Kxo$k -L\|o -LM@PP` \p 0KPV 00@0)V 00xo 0-t0LM R8K L@PD0T 0S@ xP UP 8|k$ktk -LM @K< 0S0B :00A0 R 0 -k,k -LM$\  |o -LM$@0 0xo -L\  |o-0   xo -0L0S|o -L1L`MD0 PP(0 `pl KtKx KHtP 1l R*x0S@ hK0@@( 0R$$Kl RW 0pK| KP p| T@hK0@@$kܲkkȦ@@ > p-L@P`P 0S ppp3p - LR`P; R :R0p0E@2S P @T:00E` RZ p|0"P@0pS@ hP WPT:00E0Pp$k؇@xo -LM@ 0P  K -LM PR@ ` R :R0p0F@2S <P$ @T:00FP RZ `0P , 0"@P0`Sh B\0 KV@P(KT:00F`0 , $k؇@@d% -`pL`@2 RP P @T$h0 $k@ 0-LX@PP " 0 S0 00 0$k4@ -Lp`PU0FS to۰@0@S S P 0@S o`@X@ - 0L@ hsTT p0\ dpPb`\ 0 40WP$p$00hV&rCԄ@d@tk|oh@ 0-LAPMKQ0!0P 0Q#0StH0@0Z0 R0 R Pb`d00K0lVdS0S P D06 8E4r"plo@oVk"p@@@@(t3AD;A -0LS 0 -L\    00R0 0 0  p-L`P mpP0S @0 @SlP@pTPT0S@0 @S P@pX@kkloUkTk -LMrPl7KP j PJ@KP bP0'K X@@l@ -LM KP K K -LM@KP b 00k0 k 0-dPL0ST0@T . . ,0/@T+000kkr -L@L0S <c@T ( a\@ThUk@ԉ@@L0 P 0S0R:0S>00k@@ -H L@T00 ((0 R 00@#kk0o@ p-`@LPP P 0S 0RHphP 00@0 00 pphkd@k@ 0-LM@KPPP8 -L,MD @, 0hS ?lSC 8pLK@# "HPK@ x` 0@P幮L 0P尮L p@ ePTl h0h hp, 0R (KS bS 咇ܲk@( @(@0@oo > p-QLM@P00CS%%%%$%P%|%%a0K0, noP0S 0S0Kp- [ol ToT Mo< Fo$1 R? o0 R o )o0S 0 R 0 h1Q 80 |00S  0 pP v00 0+f`4kkkk ko4kk|r$r -T0LPD00S 4 40àLk$rak -X0LPp@0P 40à$ L  k$rak -h0LPp 40#D"B ,0S 0P kak$r -$0L0S $r 0-LPL0@S P0 T0  0$r 0-`0L @R PHD0NPx 0Pxbtkak$r -LMpP` P@P 00$ KP $P $40à0 L 0$r0oak -tLpP` Pu P0S %40CBD 0$ $r0oak -t2LLMPQ@(P p $K  pG`0+ P pjG+0ڌP0+ P @, I( K\"pP ( R 00CS 0 H(C-0h0 0c @0 (0l p`  pK:7pP(0\ $@<0<00C<0S+ (0 (0 @ (0P$(0 @ P(0 ,@0P(4@8P(0<@@P(D@HP(0L@PP"4(  00CS 0 HF} 4 0( 0 2&(,wd \;k -<2LM02\@ ! haI PE   GPP @ !0[qP?@F(Kc Kp l 吐 P h` lP0CK 0f2@P00S @08!.Pc0Kp l 吐 0 P h` J@P@F0K T*S' FpP @ 0@H0 D@  00K< L P0 @ 0p , 8 4` 00PK=2@P!0p!0@Lo|rH@D@G-@0 084 0<0   0 0 84 0M<0   R0 P ` p@  l0 P ` p08 40< 00 (0$ ,$  084 0<(00 ( 0$0 ,, 08 40<0 (0$ , 0 8 40<0  (0$ , Ѝ!>!> 4 0 0-8 40<80 (0 $ ,<  -LMlIS@1 08 ,0 < 9 P8$Q `8! a p81q 8A 8Q 8a    $ ! (00 ,@@ 0PP 4`` 8q88pp < @?\\lK lK<00@ R < 0!@0 0 @ 1 $0 Q! BK@p0 0041 ( 40@,001 0#1 1 c81 `0*dH,a n`0lȠp (q p,(1P,&4 #'a01 ` 0eZ0 0 ( @#1b*,1 c̠1 c<1 ,1*00 (1n00 1dLp0'P#0  #0\00 0,00 10(1 0`#0&@#1nc81 `0dH00 000 0 &#0` P#0eZ00 0 00 b*1 *lȠ0(1 p0'a#0 @# *1l̠c<p`p 1 p0` ndL`p0& #0P'#p0,0Sp0  \U00 0 $ 1 t x 倀1  1|   !P `pP  ` `p Pp Pp @ P p @ tx |0!",#<  D H! L1 @P`p娀嬠 0$L%\&l'|(*,̠. !",#0A?@P$P`(`p,pԀ0ؠ48<@q@@pG@q @?P P8A4P`0``, 0R(KP p  00@1Qp P8A4P`0`Aܲk >G-QM= 0`p0Fjj hq,f>0-: 3:*fA*Q 0, ::,!,,,\V0 !0!"Y!0` 0ЍLooܒk !>1s s0<0 0<0kk@-;@ 0$@@-:@ 0$@Pკ$0 -Lh|#>o4o -LM{00p̠`0@(P \(, 堀0,0 ( @z,KX\z P@P\0 0S@0%050%\z$K{kPokkho(o(o -#LM0pŸ @ 40, :Bq PPz 00 0bC2S0c0S U 2@8P 8< Xz(K`0H"\B"\$t \q 04, : "1  1b < 8 @ P`@P`P`}p=<K !\!P@PD` $@qD$A00SA  -L8MD0L`K(pX@K$0 Ar 00#0 QW8@ ;P 00#0P(U0,{ 0 +x0@ll0 W Xdy$ 0R K,ly$ ܲk܎k0kkpkhojtk$k > -LP`p  APP  P@1J# [pP  00 RAP PpX @7 -0L R/  00 0   he00 R 0  0llc}h dxXX hxLA !@ܲk(o=Cpa0,ko%%4oPo8%\@ -xQL@px0SI \!0Z0j005@*ZD `.44 ;0,( ?V0 0pS PV@1@!c G1` 0`d0dS0 V0  @0X  ohx,<44,[ 10,k$ktkpk܎k0kkܒkho -LlMd@0Tp$0 $ 0RL K  @ T`P0Q$  Q@1J#U 0K < Z@P U?[ Z@PQU@ K@.L@KPK(D,0N,K(P}ܲk > p-LM0A0w0S: !0S0C01 a0S ;0,$( .?0@ aK0P` 0@L X wx,<44, 10,k$ktkpk܎k0kkܒkho P0-LP `2/@T,/00C-0 pR 00P`U%  \00 N @ l3)^Q<0PU TX 0> n1 ^2p* K<0PlD"[0R =X X R h@X0O|0 x@ 4`S< ph P26B 0bC  R7AQT7Rx 0P20K |K0Ph `@800 j L0l0 |K48d R 0@@PSPT00S40,00@8V` w0<S t0X@lL4 K0T0@0TV ^< tv*D06040H0D 0  H0t_0PD@0 :@^^ `P`p4P8`2@8P 8< d UL 0.S#%@DP@ L T pX :LPH =8jHt TN8jt0< t*D060<t X@L0T04 K @P>V UF40H0`1@0P 04 O0gt` t H y\@  ;0S9@0U5:0S\ \ 0S 0S 0S0P R @ R 0@4 R(K0S  R P`0OTS/0 0OR 0 C, l5.)0S#Q 00K}P0 L00@PQ -L4M  $0 0<0 @K;   1KB Kpk -L4M0@ $ @K <0 3 K@k 0-L M(0@ P b$p!0S(0 K0S   00 p $ (0!Z(0 .A J p-0L@`P5 P p0p0d0p0|000pp0P d0P |000pP p0p0d0 |8p3Pd-P 0-@LP 0h(ꌊ@ p-0L4M"`@l1Ph P 01`l1D P <LK( 0P H0 t  Kpꤊ@0k 0-L8M @( ,0 xP!0Kp!H 0@ $ K0[S< L@KLK0L@KH0 0H0 kk p-0LS@P p R R`d <P0 <0p`81P0 S 'P 긊@@Ċ@0 <#<0@0  p-0L@ S & & & & & & & & & & & & & & & & & & & & & & & & & & & & & & & & & >"P8#`(0  ("( Q&*0(00 $0 e0b$000p` PB8#`Pp`P\`P0PP`8#$ $0V0$0000pЊ@.Aoo -LM0 0P0,0 , (0U@$p0`>*V2S/00@0 S\#&"&#& #&0"& #& #& #&#& #& #& #& #& #& #& #&\#& #& #& #& #& #& #& #& #& #& #& #& #& #& #& #&@#&h@`T  m 0P,0pS(0$p@0`0 0S000 (K`@T (000 $00a$0 `ᐐ@`|p@`d0\@`0pd `㰐 @` pd@.A@oo0@- 0P840 pP_ P5 Up !0@ 0@@op !W@D 0pPl0 p0S00 0H0 <0 L0 @0 80 0,K/;fpP,0L@ TP#0SG S S; ,P \0,0 dY,P S0,0 < R 0 DD Q0DT0 X _ p,P>H RR 9 {! 07  Yu 930`2oLQ, <@ L ,p H0Sl0,8@ H ,p X@ @ P @ d @0P0L @0 8@0P@ 0 K0@0p YPh 0p f *! 9]3]@<P 0P84<  00uk p-1LxM0ha. PP0@' PP 娖Kp K PP 0K$P PP 0   B  10h@P0 00,  h& ?& ?&?& ?& ?&>&>& ?& ?& ?& ?& ?& ?& ?& ?& ?& ?& ?& ?&>& 00 H000 d1S  0%000ʚ;0@/ - Li$@ -LMPp00匀0CS<t0|S q x ` 0H0,  Kx0S@|0@`P|0s@L|D`4f@e`408`;40'f@}e@@0@ Q/0 @K/ -L@m -L@b -L MH@Pd1S p K0 C1 0(K pP (( L 00S@ 0S0 S%*G0" KP 0S0  R*f(np(j0S0 S*[ Jp<Q"[00b0"[000"[00b04p -L@ h! `p0PS` :` p`#JPdchsl -L -L0MPKP@p80 ("0`"0-"P0Ca! ab@!2n10!0\#3n20!0\ 1STt!<2n10!0\J3n20!0\B ,1`c 1ST!<2n10!0\/3n20!0\' P0S `c0 S Ϡ0l $ "Bbl0a `31Cc   K$00L0 !>Q$IQmnų-H0\<< 0S 0P1 Q k,ok P0R 0D 4S1(S0S 2 SELF0P000E-`0Pf 0@ 0 @ f0`p 0 -L@P 0`pd?P 0 00Z?P0 hR? -<1LM0@pK(1pP@!, @ҏ|00B`@ dW, K HP , 0R'(KD| K0x t |@ PIK %Pd| K0|@ x t Pp P000 iܲk`@X@!> -LpM80Q|,0   PK|Ah ᫿dpA$0h 0 @ 1|0 !x 00 t 0 0p 1 l 1 0S0h0 0 h @ 0d 0LK0`0 0\0  0X0 0T 0P Ͽ h  K1 P/`P , 0Rn(K81 P0K0 @=10 @ Q0`K PK` ` ؀ Ȁ 0 P `P0S` 8!00  K 0 f>`P000 ]>`P 0!  0R>`P 8! 0100 嘀K  P`P@00TP T   P0P@T P`;hܲk`@!> -"LPMx |"d0K, d wCPP *D, 0R(Kd0 h Kd PP`@K4 Ỿ \K[KZKK(4K[ 0D K xRKYPKXPKHP @P -LM<0 0ps` \, <l .0a 0 cA 0 , .0#10    00000 n04 8 h X T*"!Bp2P@@00 Y 400 00 X T*00"!B2P@ hY@0 4 00   0 <.>, 00 0^nP`U TG*AT1 @f0P  00,80 (KT/*. A.0P @@0 0 Y H400 00< 0S0c<0la0 , LB@>@:@b6@yLv&(u&t& p-L M@P0`   0K`P0SKp -LMBPBp (` 0@@P/22 V/*@ @T**0S 0 PP: x(P 0@P  R0S  ➼P @)(&(P -L4M 0 , 3SPp%\P!10C8S1< R (KBB 5(  0@iP 'E01 1\$ @`L 0 Sj*6  0GP_`\ @0SYt SLPL L 1S D  84 41, 0 S  4@@:P 3\0 @,`K0  P\00SP2S@ H `< @ 4@ 8@ R R7 < 2 S< @ `4@ 8@ RY{  wRL 3R@P Q: 0R_*21C   0 @@DP a@  @@@DQA L V L 0@ c0  00K4K8KP@0 D0 0 80 1sY Q40000b0a1!1H L0SY wD X 1sB Q40000b0a 1! 1D@ 0  0H0 1s0 11s* @0DY0$1  'HD 00" 0D00, 8D! &40!1J40! 1F !10>0>0 1!D0 4K 8K00K90 D {4pk`@kۣe@t& -LrMuD, LP  ! 1 P 儀 KG`P @0pW `P&d00 , 0Rg(K0! 0+`PL0$ 0 0 `P P 0 `@K 40`PP5[S `C[ Bt&PD 0@`PC[Ta !a ^  0S0q.(K !p0>00b>0q 1 ! l$dz q0G 0gP p@ DqpP( K10   h !t.  . a0 S1Q>2=12>303h0 5T( 0! 1 1 hK1P Z pD@h0Q q.0C 0b 0pp@Dq  ! !@Rʴ#[Rm0ˠ@1 1 1Q8  @ R ]h l Q!lKR 0c!d d hK d0KA PH\3:h0\d% * d b 00b$1#[0d0 Z!0Q$*"!B00  000 1#[0j1 hd ` /1ܲk!>ۣe@t& -LHM@aD1V@$0 p 8Q$K 0wP P %嚁 K %呁Z0d0  0\0 ` 0T0 X  0P L0 *0D0 H  0@ 4 8 <0 0<dK7 ( , 00 4p -L@\P @1S<@ -L$M (18 @ `@ 0S` P 0PSU *0 S   0 S  R:p(K00@ T T@ T T TH@ L@ D@  0T0S' T L  0L0  T LL @T TT D H 08#8;00 0 40  8 G0 0  ~,&,K. p,%W0<0 w(1, 0(1,0, $,0 , (00(0, 00CS 0  c00P L0 @(1? 0(1 a$?< \$0 0` Ȍ. qΌ@P 00 `YKp -LM pR`$K0.>0 0`. 0 @P`0 5`P0@ `  0`(`P0S   . . 0`|` -LM @R`@" 0:#:S%0:#:S z'zW BP @  @ Ȍ PqΌ00p @P K0@ 0-LQ@ P21C 0 P I QP P0\0 ?"00P0 -0LS`@ p2PC@0 0 000 p@P00R00S p-@P00L? @""`!Bٶ 0P?F"`p p-1!1!0@!00>0>0PL 1/*"`!B ` 10a 0`0PP PPP0P:"!B00` 1 0 10a0P PPpt&0h|r0hs|r -0LHM,0 0@ L0 T0$ ( TK BP T0 P P $婆 K奆@x@@@ -L8MA 0R<0 0 !]O0S $0` a1(K *0!@0P0 ` PX ,0lx0PUM +ٶ0@c 00 0`Cp0K 8@ 0p X/@F 8K80 PKD KP0 L@ Hp 'P& P EPU 0- ,04 Kj 4K1@K@``ds0 30K2K0@ l<` `F<K d(K, ( $ ,oЌ@ k@Do@,@܌@ -6儆LM|h0zYQahhhV*f 뫷:& C=`0Q00`P 0  Rp0dqP $a 0 0ş40S 40800娥 8 0%S00(00 P0Pp`&0-0<5(4 81iT$ &Y S"Y 50 @'0 p:4$01 0A R4@x4@@ P  kp@P0@0`d @0FP`pP`pX@\Ph@lPp`tpT@`d*1@@@3 T! P%-Lx/@p8]^-TP q#0S @P0SS[2V\S@$[녰HU0S0 @S`,c,ß 0@@ `aP#0B00S 0 "M0S:\d20S P ,K,00ŸR$09$0 0 @Pc Hr 0! 0 @ 0 0 0 @P`V P=U @N 0!1APU`V8 1P5p!pp1P, \\1P# HH1P 441P(: !00kL !0@KMfdb`^\Z|roo"> A0ooo oo8oPoPk4@|''0oo$Cxmqor r CܲkHoz&hopH@0k|@؎kP@5p45pot 3|@oy&@y&@z&č@` 3؍@0k,o@d@<@@̍@@@@0\00\   P\0S0 0S\0\00P0@-@PT! 0|S \ R 0S\ R\0\ 0\0|0S|0S\@0\0\@0 0-L@P\0PS00 0U 0S0e00 -0LS@ ^ 0Rڭ00C0 0\0 \0 0| |0S - LR@ \0S0@ R0S\0\0 00S0S -L P 0 0  -L P00 0-dLW\0PU @W0$0$NKVPU 00DK0hV8/k4/ko p-P@L`V0$ 0CR0 S 0S  0R:V0d0p KV0d0pK 0-PL@V,0@V0 p-`@LPV,0phV 0-PL@V,0 @V0 - L M, V(@,~V T4 Qb0epP , ,V(0 S@0P 4`  "100 0c4 0 @X 0eP00e0,0p(,OV40 0b0(K"> p-LMPV 00t8Vt0@T PDV0 S$ `D0 ZL0SV@Tx8/ko4/k(@ -LM`@p!V$0S $PP0 9L$0Sd@000,0hU0@ p-LM0@SxP↎U 0R: `  40 L 0 BQ *xhU8@ p-L` 40 ;8 408S@RPPp 0-LM@,0P00xU0S h0XX K0SD R00 0S008hUo8/k@@4/k -QLME hp0OO$ Bb!R^V )ڀP@peU21C Pp, (P! PlU0S 0xx K0Sd X00FU RPpPpU 嘂喂1p">o8/kt@4/kd@H@ p-ZL" 000X00SZ0P Z 0O Y,@` PPppYp `0ST0 P0Bc&0@0@?Pp0YCC@Bc p-L M t0Ϡ`$P ` Al31C0R D0 R 0P@`$ $P `   $KKpMb?B p-\0LM`PP0PHH0@^ ,0K(P $@ ,` 8KpCoC Co -LbLP0 LS@hQ RP L N 2S00S. U 08  EL00CSL01SGU00040 0@408@0UL0 L0!0L00S000i_Zp80 7L0,0CSL0|00|0(!R/$0 0@$0(@0RT!0HL00CSL0ʴU T0S 000,00 @L,00@H0 0@0 @<0 0@<0@@|rxkooo 0-80L 08T 00CS0@P0S _Q,0, @rR0hPooxk|k -80L  8\ 00S0H0 R :Q404 @,0( KRhPooooxk|k p-L M@$KJ $0PQ@c=YB@DB ]BT00U00S Kp0Tڀ0`R Td0@A8 P8 41Cc0A0( cCC -aLhQpU (0"  l1 R. H00CSH00LSP0@0S4 !1 1S 1A6NP("0 0@P `HS0S h/SH00CSH0ʀEY000 0@@0P 0 1S 40NP(0 |roCHoo -L ;x0P l l0@@@LR\0\QT00S <<0 R@hI$;d'oxk|kooC Co|@-A" J1S 1 0<S RZ020CQ^1S100S^0Q:0P(0 p-0 !L$ Q$b1@sP 0<!0 ! 0U 00C0p0 #  1 0 10 0C0p 202 (("<00 0-0LS@P P R000   00C0lv0hoo p-LM0`P@P P \-P Kp 00 0 0$( $ 1K0 , $01KP K(00(00 00K*P 00CS 0 00KP01K(00 (0 -LM`Pp Q B  Q D00BS 0 K0S@$@P K40K,@ (P 4@ 0P K ` -pL2`0C8#8S2? P@U R 00 0 PU@Z000S0202S'2'/P P8P%@P!8hu'00202So 0- @L`vTP @00 P ,\X00@2000CH 400  @2$@0o@Dk -LM,0,0 <,vPH P[ PX,0 2 0SRH0 @ `P0 0a 0q 0 @       ,8 S 0@S`S  0 `S@ R 0s 08C8SA 0`S@40s 040< 8 @ @cTڃ ?@cTT' 02` 0Q q '0a'  o@ -L Mp 1R-2P4 , !`' f@A M  d@ C ,0 dެ0SR020V400(K040 042!Pb, a' 1PQ0 ' *@@B@BA 0 00 d㧬@@B@@A  d㙬00202S''0'0 -`LpkPP ` 0 S  S0S<0 ``0BS 0-`$@ m  ` -LlMPp4@P ` 0匀K0 0  0`0CS 0 V  KhVP0` l k` -L `qP@1 00qW 00 000   Q$  0R0W0S 0WP( 40U  1 2 1 1s 0U0 P00 1 21 0-@ MLPPPPT 0Pu804 P@u0@K04k@o@olo -P ph` L80@03P9 00R2 0s% 0` 0 0  00 0101 1s 0U0 P001 21 / R <0R  |r -LM0 000p0$\ 1! Y 01 0!,0 X0 R4 8 \C:0BF  c03P? 2@`v`  V1@K0 SSBC  c03P< 2@pI00!0$ P1! Y 01 0!,0 X0 R4 U Y(K@020Tp 10 pR@ @Tp 10 pR@ ڷ2,^  1 @2 1 1s1 21 0$ ^ 40R00$8 0 0$C -LP,0 0 ,0!P 0-@L PG R 0 0 00  0 ,  , 00C00hF 0-<0P@QL 08 1 Q000S00,0<0 R 8 00CS 0 D0hn0< #4#0@1 8$o p-@LT`P <0 @Tp0!8 00CS 0mpo p-P$`Ll 0*O  D0H@T p -< L0`SP<\2 0@ #4#0 1000`,04@0TLS* [4 8!pC4 `!ܥ8P4@8p08 1000`,0@ <0+<@ - 0L@  h$0 0= 0 0 0hp 0-@L PF00  0@,00,0   F0h 0-@LTP@T <0 P ,00,0@T0 0-4PL@ 0h',00,0 -LM, 4$pQ8 1@0T `0PS`, U@4Q<Q q @ 1@0T `0PS`" U@<0S,0@$@ 00 0\<08 00CS 0 <lP<0lP 8A$o -L$P @p FA@ `V ]E◃ 00 0SE@ -QL|M`   h S3 @5 ?L3c 4 0 ,0 ST00 O㜠  0PI E@pTOQM 0F0 00,%= E0S74 00 ,0S @K@@pK40KW T R40KLK80D LK cPRL H D H0Sl$43C" cb 4@KBP  0(K0吀K0 P Z0K0K $P  , 00C0Z@ @ R 0 0 00  0X l , 1= 1H 0> ,0 $ 0,000C0YJPD o 1E00Qp0 ZP唐 R00 000 wDY40j<0 P,00,0  B 00 0 @,00,0  B UD<0 d DpGD0Z. 8  <"!B$0 j[00SHڈ!43C" cb @K@4pK@0K,8 p@!Q4p 0 , 0p=)A@ -B4p 0 , 0@40 0@ , S X8 ,0R  L 0R 0@=9 =L H D0 4 d0R 00 g[s a 0#SP ]C@ ZMbԎ@C?BQ -LM0`A8@|ZszJ $3Zu 0S} 8pP - 00 040PP#(*80QU#PU 0S!0S 0,0 , <0  ,W 00CS 09 p0 U^ 000 4 0(0 D<0@ P'gC  ,0 D,00,0[C  ,0 C,0@ R0,0- JC   ,00,0!<PpP @ .4.0QUPU 0^0S1ASp@kP  8p@<0@00 04 0@  PP p   o/k$o -LM0p2`S" S PK 0@(P(0 $@ ʌ14K 4 K,p P 3KP, h0 08, 1]/0@ 0$@4 R 0S00040 -L0MH L PD  0S < <(K 00 0P 8@K P< D 00CS 0DHI@D Q$L0$@0 P Q"!BP, P< ,\) p2BAD:$@@2H  P Po 0@S@ 7 0P4`92  0 0 B 0 ,p\2 l1C0R 0@\L  D 00CS 0 H0  ,K< z,0L 0z< DH -LM`p,@$K( KtP]U  K$0 $0 $0t  l j@P$0$d(004 R4P$ `(00(0$ 00CS 0$D/kpo -@@LE 00C0/k p-0L M `Q %0040O$KBCd31C0A#!B !_$@ P  1P 01   @(DE@@Kp/k/kMb& p-L M,0@ 0P ` $ ,0 14\0O$KBCd31C0A#!B !_$@ P  W@EKp9Mb p-LP`P( 8@%0h0V  0S RP18` 08#8 1 40!O 0$@*00!4004Ppp p |r 0-@ MLHPH 0@Pj0 ,D0P@jK04k܎@po@$o -LM40@`8 Vc>0p `Ha@e @0R @P0` P @ (K @N>0`0`,K@0 @P0` P 4,0, Nk -LMp4 8 @P 8K` ~P*840 @10@0!0P,0 P@8 ,K ,P8 0,0 B0R,0 P8  WP'00K@ (K4K  IP`@Z`J,K ,P0 ,0@T0P,0 ` J 1P'00K  'P -L M"0(0, `PP 0pWy W P8g 1(K0  0PPL0$0! 0@;00 0 PP1 I 0  0WPP @0 Pp0 ,K PP;, 0l0b 0 RP0Tq@ P41<  T T (1#209P0 pS00S 0S T P P @ 0S* P0  0 8`fvPT$1 !SP#P3R0! $0S UbP`D4pkk -LM0h d2 0l" 0 `2 pP (Kd8p |hJc0? 0 P lp hp p d b TʟH" 0K L @2 <" #>KB/K %K(q Dr q q 8r 42 L!  pPA*(1\ @AhPU  \P , Ra 0 ;pP{00@,K`d 0` pP00KP K?(1>QH mfP `" 0PT \af 9\'L? p $ R\B \BP0S 00S00?  R$? (10(1 0,(1 Z ,7 h"PU Xr , R 0 X2P0X2 00@`d,K 0` P00KP p?W8pGXr W0S }! 0X"0 000100\00`00!0S00 pq 01  !H1 ` p0D1%K>0#6`0@1t00#6l08!x 41|0P00X1cL@KT2 @  H %K\2$P = 3PP1 4&#QeP \e`"P 0'\;L?  pNp ?Ppp e 00 B0 ydLN l@ " 4Q奝T0S0# X00 id2O/5d000@P^P1dT00zpd"80@0 Q0Q p 1  Pp0 00 0  d80 e0@0@0@0@0@ 3 '\\e`"P 0d4,0S %KPoT"l2%K ( Pcd"80   L?c81S# L R  S (1 /  1S/0D 0R %K 181p rp >d@SAd"21C0 \  P=p0]0`@,1  0 001 0 00, 040 P4  X, G< K4K X@@PXJ08K2P% 0G 8 hP4X8 ,<00<040@4 00408 40$ 4(00(04  00CS 04 p@ d2 8d o4 0Q0Qp <f4 8P,6 z<Z4 ,oPkVk4p/k\;k 0S$ R(0(0(0 , R$0(0,0$ (0, -Lc 00C0o/k 0-L@P $ R(0(0(0   00P00XP*U\HcF0@,c$c 00C00h0ooo/k -P@PLP` pP 8@{P@ h3H H00$S$0#H0]/00\ R 0 0 0 0ch -`Qp0 !L`a m,@T~ 00S 1 r $@TS 8P v-\U 80< S \+  (0 (#00 Y0W p10< R -0S(0K800 Y0@ <]/0400 (0  800 Y0' ]/0400^ 0 04P 00 Y0]?  0S \P  > 0@@ 0-L\M0@ S  K\0hKPTPPQ K eP Q hKP ]PK0 0-@L8>4P,0S40 4080@8P>0h2/k/k p-LM`>@T  04@T 4 xR808080 u>K(0P80) 0-0  2/k/k@ -00LS`@P!$ dk(,p0S U U  R0000 0 ( y0S @02#n30S80 \X 01c(0Sf 81L0S4 0R-0808080  R 0 0 0 ( / R 0 0 0 8  $0S0 0 0p ,@T 0I2U@ 0$P80 Q8< R   N.(0 3p ( I(0X"d10Cd10004k0S2S>  @0SX  0 $ 1 8 `80  1 @ 10SC8Ph0]/@8@= @n 8j 130m~qH y?$ ]b\0S\: a\5 i R 0TP 00 |0S   ՂP  PR@@oHoxmq$@0o -L  -LM@Q K00  P   @-88 @2 1 0!0 c@kQo -L@ R 0 S1P\PP0Q  1S 0S Q 00 Roo -`0L RP 0@@< @P @Phok 0h!4)|r -0L8 @ fh -L`Pa0@0 0p 40,`` PdqޘH GG:la 3 000!0000P0Sl O<8 0080 0S  <@ R0 0 @8)oo'o -L V00Kpo -L 000@0@0hb -LP P 0-PL @ጕ0hX0SLL 0HS900S 0C1S0!S0%5/k0kpvk/k -0L蘏@ -QL@M40S' S -$K 0P l Q0P 0`@K@<  8<  0@T   0pP P pp0 0`P@05f@ dሕPU`V0 0 C(o0ko@ -LM`p@0 K !6P$ K @P 0$@|0 @```0pCAD㳿0@P@$U<`KNk/kko/ko(oo -PPL* 0 0cC61@H`DH504 Spڲ d0&Qh5#D0!B  %0#.h4oo/k(o -82LP$M`@ p w 3Pu(K0X papR@Xp!31Cw5 X>0, Ã0ɃQ #0@S00*0,40T0a  H88!>0 C6 00 6P@40  04 0P @@@PP  Y0 0cC61p00@4 0ii00S00#00!P0 ,t4 @d 4 d(do0k(oNk/koo@@(@ P>0 à 0Rl PR 00S 0000S 0- PL@ồ0h p-0LP`@V0D  Ppph+00 h R 00CS0 |r -0L(!(M10 ph  `@0   PP0S (Ke+@8K" 0P + p38K,  #8K+ up38K,8K+P |r"> -H0L h  R@0 00P00|r -L @ hgFP -L@ hY A7P -40Lh!  @*Phh|r -L@ h\ P@0S8@0 -LMbp<0 P @2Pp8 hp (K)0 3 @\[2`00Hp408P0P)30Sprp4P 4 10S 40<404 00*  4, 4 |00S8@0@0<0 @PR00,K  lpPA,0SL0O 80340@ 0H!Q+40  400402,P0 0  40; 8pWpWD@  `0b 0R0@ b0 @ U30@S2TYet,0L040S4 p|r\2p!CeL@P Q 00 RH0 @0 P00 S00 S4PooT0 L0 P 4P 00 S(0ooH0 @0 P0 S0 SPoo -LM Qn00 mQ |R  RmRRu X2nRP wRy aR<Ÿ<<"<2<aUP , @ T<wSI aS T1 a@T- -0S 1h0 Q *a0nSZ0 !0P0R S-p0(8, l R`( ΄ H@` a@T, P0"U00S0,0 1PU(KP0S8! lP a`aaa(Koa\ 0}a4 q(xx x0xnawT@o<@@$@4@@@|r@@o4@t3A\@@@Ԑ@ؑ@@ȑ@@@@|@@@L@ p-LM-P0A0S`=!1000  (08  (1!! 0T! 0p@ HL 2  t@`d|TKp@K04 `0P#>L@@h@@@@ؓ@Q@0@X!00X1X!Ro -@L 0@ko -LX0 0,X0!00 @dd0$@d@X1 &\!R 4Q808080\!R|ro 0-PML@T t0@ PP@L(&L8@0( oU000K0VT<'ok@@ 0- LP1`00@ Qd0`@ T@sdAz 0ht='oX0 R 0S P 0S  R $0k p-LM@KP`P0p R R 80S@0S xx 0- 0-PL @%l0p 0CRl00p0 0S008 @!00CQ 0h-% p-PL @%l0`S 0 R0@p00p@810@ S00l00l0ph%p8 8R P8  R P@ @0@0 @80S@@00nS -L@ %P P00CQ0000S00$ho$0k(@ 0-PL@ f%^  00@00$h0hT0 R 00aS0 @ 0@0o$0k(@0@-@PU P S! 80 0Q Q U U00 R0\ ,@00S00  ! 0 P 80 f$ $10$1$ 0 -@$!0Q0""!A0 !!Q0 1(0k10,0hD!<1@!0cS#3|r, h1 018 4004|r84 R040 0S00@-  3R $0   0 0@ 0$@ -@0<0L`p8@T@T T (0 ( $-0PS #@T(0P0S0-06- p-1@0L` Pd$@T T8<1@ T8!< @@!#p1 01#@p 0-@0LS@@P02 @0S04@ p-1@`1PL($`嗾08<1J 0P p<@ -0P ArL $@$01 1    (0,X A 011`00110`@1100110 1 100 1 10110011Q 0! 101 R101 o'#QEBX1011010n3\0 $Q 0  0S %n (0kHo -PL<0`Sp! P80  #0-0@,"<0S W@00CS@0@a80   80    -Lp`PP0WM W8@½ν@0T@0<`W? @T T (0  @#(⨽-00CSL'L'|L'L'L'L'L'W (0 W0-0ĕ+@00@0x"W s"@0 0@0L0 j"8w #-0S+@00@0Ho -@`Lp PT`@00 V06p0 0 -LM0hlpE_0! E_U 0@@=@(KP 4K uP!,0A004P/1,@QQ) P0FO@0J0 ]Q@00P @K s@0 0 庰XH <XHpQCCD@ -L MT1P @8p^@ O?(KP 0 0 0 PT (`K PW  0 D1$0 SO?"(( 3 K -L MP0ES@$`@V U U; T* !1, 0 $ ( 1$  1$00$0 1$00$0 1$0@0$0 U $0,K0$0 0 0 (0 2@PV@ ,pK 㪯@P @ K 1$00$0  1$0 0$0 0  -L4M4 8  <0 0 , 0K 0 , 1-m+ @0Z p1x#@ 0 K @P080` 04@@0@ ``P0OZ<0 00@ 0@(K`4@ T@8@<0.000@ @0`@ PtPT@L@\@ -LXM 0( @ P``@  TKp寀d1l!8@ X@ @0 < `0`@K640 d &0 l Ơ 0, P ( 0R$K 0P 5[ @P0` i)ܲkl#> -LM , 80; @80 `80d0l D &Q* NpKΆ0"t"O!P p , 0R(K p"0@  0K 0 -cp 0 @ @ |` pP @0S꘠^K  0pPV00S   0 ` p1S16 1S1@0P A P  O000 X@ TP d` ` \ N  04pP81dK0p aP| 80g d0Sc 0Spw D] 0 (ܲkt3A@0k@|#> 0-@P(LºO0p 08#801  dQ0S  PP 0hg0S(0k  @0-rL`1MhA 4 $P`E⟺d1!S0 p1l,0 4h!00, 4 S<  (0.10  !1 !00V1 0!10101 Qd!0R000h1d1l1p181,  40 0 0 (K(W`(Kou|r(0k -@08@-0LPpA/(,|0 Wh(X#X0@P `L"0S 4"000 0@@0!oo -(03LP0#8!0@3PD H~ 0@CE`$ 18 8 + =  SD !1R.00S45 8  1 R8#8]/Z0W \@8 8  !0@3P`R ᪹6N8 88#8]/0]/BZ &@O{}8  ]?P  @0`|@ᇹ$ 408m(0k@ -L M8P~R0 Hr{ X00P4h!R 0 S  R (0 11P R4+1#@a_80 }$ 1O10,0 1,   (1S0(1ʅ 1 R9 0,0 E 4 F000 I$00Y00S @T T @T,P -0`SA Sy S@R T (Ko`40S -0S (KY1l"@a FO@J, 4 E3׸000 EѸ(θ<0SPE(Ko趸E᳸,@ 80L XC 40SN0PGP0S (0(Ko(0 8  @2,p34P00S,0P00S@ @@E⎸8#8]/090 (0 !11P((t 12S20 1Ņ&oEj(@Vb,P ,0S@ P0S@ 0-03XEO|r(0kHo - L N -x0L@T@T 80  82 $ 1  @T o -(0L@@ 608  10 P XQ(0  !1 1 !D (`1Q1=Q 08  10 P(0(ڷ(ӷ(0 -LM@8  P$`0A s  lphdQ Ki6!00008 10! !1 1 0U1 0!10101 K(0k Pp-L`P @T U  80 @Tp P-L@P  h -LS`p' P1PUM PU @00S(040T0S  0P W PUX+ R  P% PU PU @x 00S(0 R  0\P W -00C0So -LPp`P mP U 0 R Q 00S U U U  hcliP @T0P \ 00S U U U @T U A -P0 UL@p #R#0R = B @`P  0S  `P (0 0P  U r R 0i 0i b0i@B$$10CS$10$0Bo 0-LP fC$J/@-0$10o 0-$0L$!PR @$@0 -`L$P!R p~z0 @ ! 0 !1@ E T101)!0R1O 1P 0R 10P0(0k -L M<< 4@0 ,J 0@jDKob'4k@o p-L`P 0S @ T0p@T R0000 0  R0000 0 } -pL@` PP W` P 00  00S00@ P0-LPP@@@T:P T 01 R0D00J뼕@ 0-LM0PS Q@ R  R 0A@S0@ 80SK` $P  0 B0 00 0@@ 0 @8S0 -pQLPT\Q 0 0CW .\, @ R W`1`!P$0 70S( ި^ 0 f0 0 0pf0@ fW0 @P0S  6 7 *$|r -LM4 K -LDM 0P@, H0 D@ PP #0S c@T0L0 P PPP yP@PTPLP pP a`#P \P3@ @3@03 @@   #@pWl =KB 2R20L h"H2`ly PPJy, X 000@8 @0$0(@H,0 P0408@<d0Hp0TP^p`W @  xT @HK axP A @0 B C  D! EFG@@nHXD!00pC,00j, 0PR=(KU 0pW P P P`x), X 000@8 @0$0(@H,0 P0408@<d0Hp0TPp`W'(!ܲk0kpp0k0k pt3A@Е@#>-P  0S 34\^ |Q0S :P00 (0|r -QQL Mp`1Q1 $0K`P) Dv$ P^$0 $0$ 00,00@$0 84$0<08$@<$DD@` K(K``P lE(0@ (+x(T %(0l lh  0w` -@LPp`(xT  0R U T  h  M-PL0 0S R K P Φ -PLM0  0S R  P  K⸦  -QLM@NQO G`PM Z: @0C -00C0SA(0L> 0  0R>802P U;P00 U"@#0 @@0p P( K0E0"@E0`0@P N(K@@,  ` Q@@P -QLTM| Q0JS-@P |P -00C0S(0  800JS @ l@ P00P0 =`=1X 4 @PHK`0 \@ p80K lhK8 TP h0 dP P` L xPZ Z ZD< x x H@0x|p0 p t 10 0!P,0 A eZ,Kt ݥPfp00KT d  @P80 l80KhKP `@ \P X 4 h0 L =PN0 RA :#:jc0T0 d0 0@P8K lhK`@ \P 8p 4` h X` P L0 !P2V6 0S@10S @T000Z8, ᑥP ,0 0T ,0 50 0 00 (K Z(K00 t ul`@ 0 0RA P<  | D0, LP ,0x 0^x ,0 tt Zpp U | <0dZZ|0700 -LM D0 pP/ uDP   0@ 0$@ 04 0@80<@$ @D  0@H0L@\ X\ 0@(0,@ d (0@ h08, 1x00000000 04‡08‡0U0 - 11=H - 00 05B/A#b 00=9 =\2 01A !L D p0^0 H0@1AD0]1! !1$1$0S1(1$0S1,1-001(!M?3!O/ 0 8 u Nu u0S`00`00 S`00`0- 0B0RS) 0S X01 `01 h01 l01T1@0@- 0!t00x 01 111!!2!P0S lQ  QuDP1SP0D2HB-00C0SS 0!1=1A2H!B/A#b!0O1A/!0O1A/!0O1A/!0O1A/!0O1A/"0O2B/ "0O2B/ " P`!0P`Pc$R(0@L2PB$!`"00 l 0S00 p 0S00 t 80 Q p00|0D@S00CT|0 0@P0T@0|00- 0B0SR 0 0@ K4K, 80/4@?@#bL3c1!(K` h0x ?A3c 0\"l00@t!|01 A = @0P` @P0@X1\A2Mb?B -L$MRH0 HD Q`V pWV (K ,3hA1!< ,0 4 p30 DP  c2PD@ 8 U; !R5 @-0S1 ,0Smꐅ'''̆''t'T''(0 "ZWi4 R @T@T ZW00@ @ P fpGC@TPU80Sa1P8 0 <0Q P0 < 0S P80 0 0S p0<S P 00S 00 <0R P0< S P00<S P@0Sa L L[@ 004P Q Q@p 000Q@ ᙢP fpGwD R 0b SH 3010H 00|roo -LxMP /p` &sU|! X0@00( 00  00"0 ( 0 , P. 0 0 R& 0@80<@00CSn''x'`''P'0 @ 0$@ 0(0 ,0@004@$ @D cP080<@,HL 40P0T@<X\ D0`0d@Lhl U$`X x0@p0t@0 x 0|04 0@0@L  LQ ` s0 0 KP0K0@|PK`d3D!0P`  R 0 00x10 00@A00=9 =1r R0 !(K$04 t!$0 l! pX$ H0@`1dAL0h1$X01 !W 0@1A 0 ! 0 $0@1A !L0Sr X@1AT01AP $1SS S6 SX 0@X1\A !0@1A pt 0@1AQ y  BbxV 0y000000x0 | 400F0@1AD0@(1,A#0!,0410 8!40<18 @!3D1 H! 0L1$ P!(0T1 !HX D0@(1,A3018 4!3D1( H!017P0S 0@1A:k -QL8MP0 Q PU RPH H  @U< (K8hD p34  U 1/#TL @ r TP T080  LX8Y0!0  P0S 3#P<\s7@T `8 8  8 @T 0S HD^030#P0S 04L L@ 勠PHDeA`H D 07@T , 8 p(0 80 -0S S <\-0 0 S' @T<0s6@T 0 8 p(0  80 -0S S <\r00 So @TsL/Q\ HD^030#Q0S80080 \ HD^030#P0S80080 H\ HD^030#P0S80080  R`80080 `R0Q (0HD^030#P0S 40L Pj@ L,P ,HD  Be, H D  L 0\ HD^030#P0S80080 \ HD^030#P0S80080 \ HD^030#P0S80080 H\ HD^030#P0S80080  RO`80080 `RG0Q (0HD^030#P0S 40L P@ L0qP 0HD  Be0 H D  4 0LPL,@ VPD,HD e B, H D 74 0LPL,@ =P,HD e B, H D 4 0LPL,@ $P,HD e B, H D 4 0LPL0@  Pp0HD e B0 H D c4 0LPuL0@ P+0HD e B0 H D 4 0LP\L0@ ڞP!0HD e B0 H D 4 0LPCL0@ P0HD e B0 H D |rloo -PL`p @ 0S:PVPR00S P0 @ ᗞP00  h  -LMP p, oU`&,0 SR00 SU0 0S @V  cP00`,  ؝000V R S  DEP`@A <P00t3A -L MP K -L MP K p-PLP`  0S@U@R00S P 0 P00pp p phx p-PLP`  0S@U@R00S P 0 ܝP00pp p phO 0-LM\PQ Q0 \\ 2 1C0@T P 0K0P L0 <0K00,0 00<0kk@-R @ Q\ 0@- 0-LMPR@@ KsP0T30%K00 -L MP \Q`@10LS4객'''d'T'$''ȟ''`'8'',''Ȟ'''L''t''̝'0S s p9@P 0dSd00S@0S KD30S,-@ $3@3 R ß 0:@Ÿ 02@2@FP0 P@20S  @|2"@ 0@cFP0 P@L20S-@820S-@$20S-@20S $K@P $0@A0G@ 0@ @P}x1x!à0L @p @Pk810S 1@` :@Y 0 0b 6@M 0 0@B 0@: x0T@3, Y@+o0koVko0kLkpvkoxmqoooo p0k0kt3AHk(r -LKMԝ\, `p @ C 0B>S񟗐|'ģ'ģ'ģ'ģ'ģ'ģ'ģ'ģ'ģ'ģ'ģ'ģ'ģ'ģ'ģ'ģ'ģ'ģ'ģ'ģ'ģ'ģ'|'ģ'ģ'ģ'ģ'|'ģ'ģ'ģ'ģ'|'ģ'|'ģ'ģ'ģ'|'ģ'ģ'ģ'ģ'ģ'|'|'|'|'|'|'ģ'|'|'ģ'|'ģ'|'ģ'ģ'ģ'ģ'|'0BMS8T'8''''p'Ԩ''P''ħ'''p'p'p'x''''Ȧ'''T'0'Ԥ''̭'''''''''ة'D''Ԫ'''l'ث'''x'''`'p'T''p''h'H'('''p'p'T'0' '''p''''l''p' '`''P', 0 R(K 0 0 0 :n :gʟ 0kʟ 0b d:NXʟ 0|<ʟ 0Jʟ0 L@P00X00S 9I @0+P00CUS 0S @_`pd 0!I\9\)rL 0i,90S00<1 <1  O?K^Yȟ 0Q͠ 8MHȟ 0?80Bn  R?KHA DQ @ 1,PH@ 0PP"0S 3L 0@- 7  M )G0MK 4 410tǟ0 L@EP00X00S 47 (W0 0K pPX 0S0ś S00S 7Ɵ 0R |6> d6mXƟ 0; 0]Ɵ 0+ş 0"L 0@ {0 S<0Vt KOK嗕 jL 0@E`P5\ @5R V0ş 0N  5JE` 4A<Ԥ  ~j 00 0QT@  @T h4@!`ğ 0@ğ 0 $ğ 0ğ 0L 0RL 0y/|3^ l3R  0dCNK 08 lP81 CRS0 ß 0XŸ 0OϠ 2Ÿ 0gŸ 0_tŸ 0WL 0@8Ÿ 0~Ÿ 0uL 0nL 0-eL 0\L 0BUL 0:%LT 0PC*kAL 08 010|`*ܲk==4kPGk=/k0koo4CVk8C3p$r0phoX;koMb4ka oooo$C= CC6ppa0P'plo4po|rHkHGk/k<C4k/k9kLGk@(p6p(pho8k8k(C#> -L@M0PS, ` 0B S@(K!\K@P\00C S 갰'<'H'T''`'l''x''@P -@X0q S P ,K З@PP( Te@PX <1, H  a R=* @q qqpppp,0 ,K0 A `XK 0@Q X dT Q  @ L 0〣@P |z0'0kxmqH2l?*A)'(6%T* 00  RoP0S RC40, 0100 0 P o 0-LM@P Q PK ?P 00 0 崗8 㯗880k -L -Pl`LhA @ p[ H4< 010lp `Px`  @@|ro -`L PA F4 01pPU P0@S  PUiT0P00000 0PE - Ro -U0L0 u 0@T `@T D0S`D0VD0V0 00k 0-@L P0PS -0S 8(E0h1 p-@0PLhQ`p%`P PQ 08  10 P $ @ 00``p `p|r 0-0QhALP0( <0S P0S0 -0 0Q 80 10 P PP|r -4 Lh(0K (#T |rQ0hT |r 0-Q0  S  d0RLPhA Q !1D0(0h躢0 0- 04|r p-LM`\P0 R "0@ywKp(@K0 iP1P00U00SVk"pxvk -LMD `X@ p@ V0<0 B 8 K@P08KTe Q MPJ R @<@@P#@(K00@TP c ZQx!0p!O SA,J`Z@D D@<@PP ,K QP,0S@ D 0D0 D D0S xD0D 0 GpD 0@@D0U 00R  0@k yCCk2@ -L M0@SpP (`K P K`G -LM0@K`P - pN @  t3WP Kl 0k -LM @0,0 @ P`p0 c5F$0@X0 @  , R @0SW0@ 1k -LMp,K,0K  P5 0`@0Kʚ; 0-LP\ 0Q 0 P0@  0k -LMp,K,0K  P5 0`@0K@B0@-,P@@40T @0S01k0@-,P@@(0T @0S01k0 1k -X0X@0LSL }?’D0?< A3c 0 0 C1kMbkp@-RRP` ڔP`0Q @0p$0@p rP`<0Q*0P`Q 0Qo1kx@-P 00$\  $0(@1k -L,M@0\,0  p \p J00@PT 0L`K   4 d @`0T 0 @$, 0R(K 1kܲkt3A(@$=A#> -L,M쐟, LKP@`p d  0PP , 0R(KdP h0@T @T dP0@P ܲk1k1k#>-Q00CS''''- L0 800 0 Gkk 0-0@SL  0s21C 0`0Q U! 0 0@ RP0R @0 0R 0R000 $44C1k1k04@X@ -LMp,K,0K  P5 0`@0K@B@-HpDP@0$ 5^0`@0 @0S1kʚ; -LMp,K ,0K  P5 0`@0Kʚ;@-HpDP@0$ 5^0`@0 @0S1k@B -"LMp`D@ @0<0 @`Rc@匒P0l^@`  @   1 P` A$ 0@ V 0$@ 8`K0K00@R00 ,@  8KU0 0@0@Q08K@ 8 4  8 4 (0@cT@PTP@DT8K(, ,P5쀟0@8PK`4P8`,P`5q<@0^@  0OO$[P`% H FX%`>(`< @P0H 0 @P@04 00(K1k1kk@Bʚ;1k 1k$$ 00S0008kk -L3(KP\0@pY0HK@ H D Kkoʚ;k@ -LM@Ÿ  (KoxD @ < 0ROᓕ"D ppY XV0@K@ @ < !@KY P` p$PW`8 40 }VGD 80K0Y@00 ,@ @A 0Q 0-* 10 0垐 P,0.@00Kp@? - Q`Q(Ko WPd 0@U0@pP(Kk K1koCC@B0S P(0P 0Rɚ;-R \D0\\ ,00\00Q?BC   R 00R0C@-\ 0 l  0 0@=Ɍ 0@ ͌ 0 ` \  0 l\ 0S0 0=Ɍ0 ͌@ 0@ -L M4Kp :4PK`,0PU`0`S!X0  V 00(K X0࠳0X\P 0@P`U -L M0Kp >`0K(0Q SJS T 0$KSP\ 0T0SP 0= @ -LM# 0  RXP`P` (K 4KP`0`1P`PP`0P@`=9@P` =C0 P`4pKU V  R U V ,0R  R 0@K,08 @K cPR@ < 8  ̮80@QS 4KP`0@=9 =@ < 80 ?B -L$M@PT` KDK 7` G0p@ 0T<0 0 0D0 @@ 8 4   i,Kl8K000S ,@K0P% U T R 0@0 80 4@  0 $0P cR8 4 0 0@=9 =8 4 00 Q0 $0R  -L,M`PVpT@T PK 㝎0PHW  ,K(p ,` {0P>T0; DPKPPpK8P4V4SOK8KD @0 <0S VD0K8PK`< 0P `QDP @` < 0P@`=9ADP @` =C<0 0$K0  L @P0?B -L MZ  4K]_ 00 `p04` 0p _ P, #4K  㓎PX P (K4K PXP400,0%"O04@`00@=)@ -40 0@ , o@B -LM@pTP $`K 0P K Q0PU0 0P$@K č0P0 p-L M`U $@K ^P )PV   !KpC -L0 R0$KT Q  R  Q h,}P 80QU 0R  o@o@ p-L M00N`P%T ,K ㍋P U  K ㅋPT $08K#!B !,0K0 80 4@ PU  0KKp`C 0-L M@P K0 PK WP0Sk$0$ 00:   Rpo00  -LM@`P" 0匐0cQU  Bt,K0K y y0L0\0  b0 0,@V(Koo @$@ 0-<0L4,0,,(@Z@T0o<@L@po -pPL%ڔ`P0^ x@ 00bW00 0 ^@P Umo4kop 0-LŸ  01 0S Q Q0!01 0 P01   0]C401 0S  0C40!0C401 0 P0C401   B4:B801 0S  0C80!0C8010 P0C801   B8"<1 0S  0!010 P01   @@T@04koopo 0-@LH 0 P 0$0P000004k 0-PL@0 0@  @  c0cS@  t0  @0PP@080  0 PP@04kop -00@ ALhhC - 0@L[hC p-P0LϠ\ @?᰸ RphpC@-,0 2TsC -p 0tLQl0"\0`P/ 1./@ Ribq@BCC -0@ LApX0`P/ 1./@ Rh;qCC -p0@LpٵX0`P/ 1./@ RhqCC p-4L,b\I  000cSoSb SA400!!Ń1у10000 0bSG SA400¤!դ!Ń1у100000cS- SA400h!h!Ń1у1000 0 bR RC400$!$!Ń1у100\phRC80#< Ń1у100SA80!< ո Ń1у100SA80!< Ռ Ń1у100SA80!<` ` Ń1у1000 P000@o}t4kpooooo -H@L0S 8Y40$00 $4kp(4k,4k04k -LMhQQ-@ P P@ K0q p@P0S7 aQ =@0S`K00, @P0Sp 0 p0S |`Qp0d0 L ,`0S , 0$4k04kp0kp,4k(4kC' -L0L R <@<0,0 $h$4k,4k(4kCp -TL@0T 04040 0 0$4k(4kp'0k'p p-LM`@PU  p0PU0S 00CS0 x0S00 0vxp@ p-L`PP @A T  PPp p-PPTLP`  @_00 0@ 0Dphn44k p-`PLK@T00. 0@9T QphT  Tx)ph 4( CRQ3'x@@ -LM@P8`p P  !0Kp p-LMP@ R00xhR `2)0 S ` '<0 0Sxh]x@@ -L`p$ PP @P `@@0@ 0 P' p-h` MLP\0 T@ P! ! 0D$ @P @Kphpȗ@D4kP' 0 p-`@LP|0@ 0R0000$0 0@ Wp p-P@L``0 00 $  $0@$@@kp9p -LM`PpA ^  0Y ^0S  @R000$0 0  @T -p@ -LM`4@K($,pPP@@D@T V p-`PL@T00 0R@T Q:phT  T(phP4' CRQd'ؗ@@ p-LMP@ R00xhR `'0 S ` <0 0Ssxh@8@ -L`p( ;PP @P`@@ @R 0 @$0 ''X4k -L'L@ -L@(P H0(! 0 0S0# Q!!D0S 000|rHor p-0x @1P0Q0HLH00APx0 0CSx0 kx00CSx0 ᲱPHph|q 0-@L fH0P0$S$0#H0 11S!1ԅ 1ą0h -`0@ L@ h1S 0 㳑P0S$ $000㨑pHor --0LS@ S'08   ]?0S 0CE⍑{0-0_x0S0 S(x D0 !R 55030505`@|rHor -L M(rha 2,K,@K0TS Q0L00S $ 0T cR, ( $ c1 !,0K\0@t! !`Q0S> 0S)%   0V0-0 !000N 00 KP0U $0S000S 0S0@ 0S0S0%@k) ,, ( $ |rɚ;6eĐrxmqr 0-`0PLhQ b!1 1- @O000R0h8&|rl@ 0-D0L hAF!1 P 1- 600090h|r -p1p!`0Vム`1L`X1@T= Hq@T8 -0t 0C0Sx0 0x0t x0p S5p0 dVpPL L"1@H0 p L 8HH 1Q-0S!! !G@TP o!!"1!S !1 1o|qoo4kp -<@L 0D,0, /C!b0 h$kL(Cgfffp0 0pp 0- L P0(@S 000(0P(@0-0 000p,00,0 Q-L@0Q0P (0@ ,00CS,0㞿 -@LTP`p" p@T $0SV V$pW V V V $0S 0 @TUp9$3$꼘@@ p- 0L@P`0S @p@p00C0 Rp -pL@`TU@ 0P$ RU00000 U@p 0-$0LS@P  >P 80@ P0  00h6 $$pȘ@@ -"LM0rP,0 X0S ڈ2xx q0S0CX03 <K S P0S P ~ 500S0y , 0 Rl(K R P!0S@ @ @0S V0QI Q0(0BS0A0- R 0$10  0  01' Q0S  Qn00000 R<K_1S RZ0000 T"#0 R000\  $$ܲkp4k,@CpVkh@#>8@ p-d`@ L0P0 P $0S1P0 Ppp -LM0p@/P`` CPP_ 0 0( @0S* 000h!"PI$p @RTR pP= T*p 0!R20,00Q0S Q0!R 0S S0 R 0Sʵ!BR㱽8k#4i#0g#(d#$0T  ^#ę@x@̙@@(@@@@ -PQL 0 Qp0S" `0S 0C8S 08J@08 J 5RZ 08Z `0SEC -0LS@`p3 0S$0S  0PS'0U 0S P=Pp0S00S0x"0l!0S T!p0 0!i!4k`@H@|@@\@ -QLM0P0 4 ,0 (  0 Qp0 $ R 0  `0S 0C8S  08J@ 5R 08Z `0S`0 R , R $0DS 000!,K4Ke!C4k@@ -L MDp@00 @#0S $2 <0S00Wc 0 QP @\ ` 0,0 Q0S00Z 00 P WT @l L!00S  D!0S  0S V 8CR0S00 S00 0S ᴴ ,00 R 00CS0h d(KPq] 8CR00@ p4k,@p@CVkԚ@ -@PL` pP  0hNV 0 4kA -LM08`, J|pP4 ( 0 $ 08JE00C8S0PP4Kx08Z,K| CC p-`@L PP  0ph p@820P#! 00"8Q#(p@-(0 S<3(057<@ @00@09780<S3 ; @@0@008<<7P`@ +7P`@ :00;@0$TP7p"p -LM80PSH`= |pX9@Y (@Ġ 00 ,0  40 ;8 40D(K :P020P`00 @$"X W Y 4POT @SD4K@0XW0  0  pppQ S 8Q20 R  \  \ | 0 00|  | 0!|  R  R | 00010|  0001| 0  0| 0< P0S 0 SPvk -LP @0 R 0P 0P Rp -LMa/, pP@NP , 0R\(KOP?= c080 4K  (O 00B0 S??( K Q02\ 0A1@T (0 P @  NP- @TZ \ 080 jOP0.S a0B0S8 a0B0SW0B$*Zܲkp Bt3A0@#> -L MPp`* ((0"4#220 $04 D,K:P 0 @z(K, h1gPh ,0եP 0t _` ,h1 a,0< P h1,R, p<@|redA@`@ -LM`00PK  0 NP 0RK00[S  00C0 S00•0SLpQ @@Q oNP10ܲkvk#> p-0LM`@K Kd0 ]PP#0 K0 @@0@0  K0\S Q`0 QX0 QPL0 0RKp,X$ kܲk$:&\1Л@0#>A@ -PQL`. 00S`S%p0@T@T 0S bNP00SbP020$ 0440apCWPE@p -L@P TP0@T @T 0S$@T@p@D;A -LM0x,0 ` P@T $0s (0u @TU 4@K zMx #MP RVX H8M"D00<(8(0000Q[ 0#4PP0 7@PK$88@#D0a'$BM 0KC@P VPPpT00S 0S V 0Sh 0SO @2, 0R(K R 0S(0 @ L&P0&0T0U0StƟ0s0Sh @pPP0೼0  " 40 $@ 020$ 04  6 %ş00a6 0W 0S" |$ 0#(("#4@!| ,40T,((0 "4#Q r  H0R<5 (p 5 "88 #$0a0""p  4 "88 #$0a0""PpKV {0Sx v|t v@Co>KP=o@LP 0u03V0STU@E( K0^*S@ K0 PP 0S$ F3\#  >< >@ oKo`HLP X,0S] S7 @#002TPPp㸀K 0N>PP VLnLPa 0K)P 0S \ @ X@T@T $0s (0@T@9P  ((0"4#220 $ 04ă\ l `@P 0pP@ P` K 7KP pW (0 P @ (KP @VPP|@ Ze`@P 0P@ P`Wܲkppp؎kDoks@@C @ĎkȎk@( @@D;A@@L@$@x@,@ (㟷 0-P@L,00S,0 0hd3 -0LMp80 < ,00Cs,0a 4K4PK`d0,l PU`QMJx0pL1 Ppt x0@ =9@pt =Cx0d0Y*<0S /PP`P`80 0@80<@PPT`8o *s(K /HP`P`00 0@004@HPL`@0 0@@0D@0=@P` ?Bp@ -鰀L0`S Pp@0@S 0PSp0S P`p@00@S 0PS  0֊  0Њ0ukWk4ukak -|0L0@S㥵 PR 0D00  0 (0 BR Lp ppp@ p-0LM`@ T P@T $0S (0 0 (0& 0RKpd0K KTP(0,0 Kr(00(0 gpܲk$> -,@L8(00(0謝@ p-LM(0@P; e gP7 X``00 U@0 000@ 0$0 P fP 020$ 044$0$0s H `^@00S xp pp+(p@ -LMPH 8|8#@T"p 4 `0 ,  44"j02,0 40(" $24  @0 a0, |@  R lV 0O  , |@ ?0 R0Q4O0@ @,|  RD VD0(2 0P`0p0 @8!@P0 04KP  (`80d0Fp,0P 0 06 0@l , (K@0(S  ,04(At3A(@A@@@(@@@@ -LM< 80@ S8 0 (0S- [[U) r 42R#<0SgP<84 @ 40!+ )Y00p@` pP`W (KXYyᔐ`0@ Pp ` V, 4  4 0S0S004 R(pK0@'<0@` B@HP <<< <e/80 U|YsPUPU 0S @ HP HP e/WEVpp -LdM\@ <0 s  <( 4"4&, Pg< ,$ !$*,R^04!48#8S U20Y *00!8P#QF 8 040 (@LP@ ,(T 00, <\0 4 l0d 80\<4 l0 < 8,t X <0, L̠H  X0|,P0dT0T\0Dd0l0Čt00$80p40t0D0 (080 ,08X0 008`0 408h0 808p0 <08x0 H08|0 X080 0#dX0#T`0#Dh0#p0#Čx0#|0#0#$80 D #t40$H #$L ( ,0"l0 #\"L408 #"̌<0H # "0X "( -(0L@T @TDk( p-0LP`x1 @P00p iP @ 0T R000 pĞ@ -0L@  0  00 R 0  0Xh% 0 0S0 0  0 00hE p -L@`PppPA DQP 10T' TU4 5:Q$ T U:TU R000 W 0 00U*00DX 0P L@ 0R 00 p p<$>̞@@ p-LS`P@/ 0 0S0 0Q  0S P0N0Q 00@@pP 0R 0000 4ph00Q  0S 0N0 00S00@@Ppph -L MAjl@ pP `@ Y4 @ Q  V0@<0 0S* RQ< 0S%0 0j 0 @ {:R  W3 #0 58 5, 50 %8 %, %*o0Sj < Ph>*\< 0S!  0@  i0 0D cD0I  Y4  0LS@0!*P: 0E40R\!: d0 R00S,0R0#03P0S<08  , 8 0 00j0 @R , q 3P R] v @000@0!Pb (K@4< E>* W?: R e 00 R0S8,0R0#03P0S<08  , 8 0 0@ 0  i0 0D cD0I 0Y40\@ * W %0 :4 S R!*0 80@< @ <0@4@< 8 0 , @#40 8 , Ğ@A-(p@p,@ P$`(p,A -LMpP`@P    0  K -LM` QPpA:0A @T<P6 \B  T?: U 0  T: 0U Q -  2 U: 0S+P0pe000 0P T T0S*@B0ep0 R000 b [#Ğ@ 0- LRP00 @K @T0@@ R000   00h -LM@BPpUp^, `F WT  @,0FS@0$P(` 0@ F,@ ,0 0 BS0 0R 0 0 ,00  0000 0 ;P R D00  @(K0S0 000 @ ; 0W0 0    ᴫP ,0p 0@000 0  PP  0S00P0P0@W Y@x0 0 PR0 R P P0000 0S0SU RUpa0pp0@-P@ R( 0S%\ ) \ ^ \@ 0 0\0 S 0  0S R 0 000@ 0 0  R P,  R/ 0\ 00 S 0  0S0S 0P@ 0S@@0  @0@ 0 0 0S00S0@ 0\@@  @0@- R 0S^ 0Sk0 0R 0SI0SD \  R0 0 \0S0  0S R( ^ 0Sm R 0S 0R 00 S00 S0 0S    R 0 000 0 \0S0  0SR 0S@0T 00 S @0  0 S 0R 00 S00 S0 0S    R R 0SP0U 00 S P0@  0 S@ y -LXp5 PU?P0S`X`V  0S@ W`RP 0WPP 0RPPV 00SZ  `X `V 0S` -@LP' ( 00 S\   R (0c\0 0lS0P 0 \/0 0%-P( 00 S00SP (0c\0 0lS00@-P (@ 00 S00S@ P (0c\0 0lS00 P 0S0SP0SP0S  P 0S0SP0SP0S PQ00SQ00S0S000 Q0-PL <@Dsp40@-HP O|0@0 x L0 0-@LTP ($ @T0@ -LM0PS`p ppS0pS(`@ $0X@T,L<D H0W 0S0S0SdP (@K0,@d@p@@؟@@4@H@\@@t@ -LMpX,  $`,@V P,  P 0U@XPU!  0,@02$` 002 TV 0@ 002T , `F V 0PU -LT0T 0 lw>0 fw> p-LM@(@K`PT0K P  0 wKp\$>> p-LM8(KP`@ 0  @K ` wKp|$>> p-PL@T0`0 )wph` > p-LMX(@K`PK P T0P w@FKpl$> > p-LP@` f T0PppT0Pp -LMRp0 S`( - S& S ZQP1@T (  ( P0S( P0S @0T 0S (KiZQP0z03Q0SPP P P X:0 R  i Xi4k -L MT0p (@\`X `0 .001 P\@\001@P$<@0S!  0A@4  / (0X 0( (K `" X (0T`@  X  0  0 A ,@:@@@@ p-@LTP` `< @`T@T  @`T@T  }@`Tp -L8M⼢ ( pWaWW "2 2`Vkt0Sd 40s 8Kd"| X X P@_e @ @@@Od $ P@P_e  @@@Od  P@P_e  @@@Od  P@P_e8  @@@Od h P@P_e0 H @@@Od , @a W `V aWX T0 `V( 0R"$K L 0 s g8K qxj plܲkx@@pZA@4k@ @@@@Ȣ@Т@@,@4@@@H@P@X@`@h@p@@ @@@ԡ@H$> -0$S(00P 0@ p0Lc 00# 0 (pT0` $`0 `0 . pl 0 Q0pp`X0 0h,  9 X6 آ@@ 0-@LP0000h p-$0`S0< 0C0D0L0bD0 PR0@00 `   80 0C 80 V 0S00PP`ph(`0  pphp p-LMP00 P 8 00@RD0< ,0bS`K" *800 S@ D0< ,0bS: T`@T@T R000 (m`0 u@Txxp 0- L,0P@T  @T0h4k -L @R RT  0SQ  RQ 0S 0 00Q 0S04k p-LP@`P 000p R7pp`0  t p -LMD ,0@R!* pK70D, 0Q0* UPP  `VU U  Q0-P,L <@DXU0D ,0R1;0h -LM`P<@D>;PP($K00 0 U00  @PPE  pWT T 0 40R0"40%\0 -0LM@ 0 pH L0R `V= KPP  WPW_ \ X0,\  `eH L0R0ST\ ,\ X0 T 0 0R0  70 P3V Q00# 0D0H 0C D0H $Q00C0 R000  R 0``0$00 S$ D ,0R1;K0P00x0S |=P0P00 R000  R 0`0`0x X  A@d -L M p`W@ 0S:0 0Sp Z  JXP040`@ PPPP8P,P0P\P70@0@|0@ 0P X0L P$TpDPHPxPP000P0 R 0 S 0CX0:0t0Ph0   ( ` `< c0Ql d0p8 ^ \1\0 R 0 0`(K X*`0<`0 8PBtP0` 0V5@ 80k f Qpp>0>0S! ! 㶐P11"p"l00pp0SV\60D D0D0D 0 0 F0Bpp$>4kL@4kppg(h(i(h(0@ P 0Qp21C c p -L MtptP`@F ` 0 04`V pPKHkpT@T> 0P \| 2 1C cp -P1LH1\@1Pp  U00S`@! 1 Q X00S@Pp PVP$1 VV$W 0X0Q0S U   !PW \ 0U00U <000 R i!O"p"pk4kp -RLhM  !p @ |@ , pP@ P t l PT t%PP00mP} d0  t h0 ` \0 tp t p 0@ZSK܌(((((((((((((Ї(T((̉(((((((((((((((((((((((((((((((L((((((d(((((((((((((<(((((($((((<((l(X((0((x((p(((H(((t Z t  P@W00 S}  z M, 0Re(K> mh00h0 h@   `0\0  `0S @`h00P00h ,Kl  R_ , K2l 51:Rb H 34@L``Pl@ \0U  SX  X h@XX hx dX @bTZ P W00 S 00   @DT\Q Z  P W00 S\@@ 0  xP @eTZ PW00 S000  z @Dh00h0 h@ K  `0 \0 hh h   `Vx-Pu`\ sd`d th  h h0Rh@ Oh@L 08CXo 1>A P`0l@0  dl@ h d 0Rl l000b al  b``P^h-h *h @' 08#X` h#h  h @ 08#X` p 00Bt@!0000L Qt@ p d0 t*P 0@ \0p `0 t0 Pp p@!00D0 0 \?`0 t hthh ^t0+@\@ Y0PCK l XP C0K`\` th @ h Ht0lPh@h @t0 h@ h < ( 7R `0S l  -2P l@`Pd U`PX X hdG T@ Y  `h@ 00h  \ h \ h  ] L0 H@  ` 0S S S`H@L0CK&@@CD Re ZW P W00 S   Q @0hXFxP` T@ h p \ Xth  h h T hh  h0@ 08#X` t0h@Lh@ pP PCK l XP CKN\ Rt0t@ \ th  h 0d0 d@0Tt0Po 0P` 0P`  @DAP@W00 S   ll PU):l0Z dX @bT:Z P W00 S000   @D0 @D%0 @Dh d X0@cTZ P W00 S 00   @DTP  @Dh Z] PW00 SH  z \ vV U-K,Kl ',Kl %2T> &BP l0`cl0  c/,K @ 0 发0d 0】QP` @Dl@ l@00 d0 P0P` 000P0S  Rp @ &  0#p h@ h  h@ 0 8#8@L0 H@ 0 L H  @|Q pL0H@0o `Pu  P@ l@2A \@QLK<@00` !0@0^S!0@0^S^<,ZD PW00 S   !0@0^Sܲk@@@x@\@$>p@@P@W00 S   !0@0^SZ l0/PX H@L0CK @F%`P?X0  HL0CK 6^ Z| PW00 S>00  ht@0?`0 t -L@MQ  K" 0( K 0 K(0 --0 L M0CQ0  0( K  K0 K( 0 0-LM@TP 0Ps40@ R 884k"p --LMP 0 T,0@ R vK4k"p -@Ls@ -L A -(0LM \0&k --LM00 K --LM 0 K --\0LMh!80 1 Q @@ 1  0@K|r p-LM`0@< 3PK0 0\ 73[P @ vP >o 0RKpܲk -p-LM `Y 0@PP P00 R0PP Kpp -p-LM@ `6P 0@@ @,0 R0@@ Kpp 긣@ --pLM0PS0 P `AO hP TP0 R U;H0@ 0@L"p4ḳ@D;A4kk -@0 LH@00S S S  HhUhHԣ@4k@ -LM  0@ -LMP`R80#40#00S 4!R8 b10!#88P$H*,1pK@ X]P1[0 1K]P ~ -0LKσ0S  c1 #880S$H:P1L0P1(i0 Ho p- @LTP`T}p ] @4! 081 ,!001~ppE-鰠0S㨀 p嘀` @00 q0 pP A8Pq 0S2  0S 0N0C5k4kC5k, ,0,0Q0 ÷ 5k5k5k$#p-000 \ 0   5k5k$#p5kp@-`-\PP0\ @3 0L0 \S5\3  T! 0L0 \S\ 00La L ^ W0LRA0L0S7 LTp/0 S a ppX\x\@@0 @-paLQP`ࠁ@@@a0L0S*\0 0@0 S008C8!0000@ 8 R#8 P P PP@0 -p0E L`a0Sܟ(П(ğ(ܟ(ğ(4hU,hR$hOhKCAL@0@D@(((((4QT"(1 T0`!10 p0 0c0C1 0S/0cd0N:\0h]0hZ0hV0 P@d6"DpE0 L=@@8854kC5k C C@ C@@@̤@@ԧ@0@ -LM40p,S0 @h, 0' 00 @(r 0 P (r @BVW 0Rp,eQ sQ dQ ,Y h00T 0 SW@@A4k5kCC<@ p-LM0P S S` S S S S 0 S S S S S SPx@KP @ |x0 S S xT@@ -LM R R00P R R P R R  08 R R# R R R R  P R 0S?8@!Cx`0 08#h(0BHT)P0  /*8P#800 08#h(0BHT0 8CHt Qs (K,`KBPs *'5kC@t@ -@3LM `R#(SP3 P8CxnTNT K@yTYTYTyT{ (K(Ko8C800 nTNT |K@pyTYTYTyTcH2 Rp @P) p Wp 0S$ QYa P0 sp p0p8s PZ @ e(,@ x0 8s dPCr08s<iY0 00(KoS(KochT@aA00c10F0 0c10 d2(Ko[P! ,'P,  ,んL(KoM4k5k C@D;A@CCC@̤@@@ Cب@ C@@ -L8cY(Cx02B  $"0`S/ @P 0PS( 0(P0  (PW WV W0S (B(00R0S xPc0ISFx(l(`(P(PQ0SD@0@S (PWc0IS(((ĵ(cY0   0@00,|00SS P@~5kC C C@5k<@ -LM`p(_&@0 S SPP S@S(K,KP0, R ڜr?P QPqP |i2p 0 ?(P,00aZ<Wf 0@$'p4k@@C@ -L0MȠLK8 LȠ`CxT )'#3 Q W ß0SأP @$0 @S 'P0  '$0PPS @U ,PKpa 0Pl,@t H# T0(i PKtKX,0sq aT,",p RP 2"PP@ PE ,U @D2 |B@T`Ÿ 8C8s S<2 P(2\ 8C8s S1 PP!001 R$ @p 0S# 0'P0  n'P0S S0WpT(KH~@{,@F0S @P 0S 0&P0  @'P0S S0UP p0@S 0S 0&P0  !'P0S S1pTA4k5kC@@CC C| C|@0@P@ -LM0 S SPpp0 S S P S S{ Sy Sw  ` S S `0 S SPᐆ0S @@0S c&P &P@0S@ T T`` TPz9 0 D B2R@괾(ľ(ľ(ľ(ľ(ľ(ľ(ľ((ľ(ľ(ľ(ľ(ľ(ľ(ľ(ľ(ľ(ľ(ľ(ľ(ľ(ľ(ľ(ľ(ľ(ľ(ľ(ľ((((<((t(ľ(x(ľ(ľ(ľ(d(ľ(ľ(ľ(ľ(L(ľ(8((ľ(ؾ(0 S0` 0$K`ML000 000 ğ$00s03S0000 TpD {000 T0@ q\l000 T#0@ 000 T ,`Km@P,80@ T ,KbPq,  RR@@ Rv30 Th ,`Ka@P,e j0@ TZ ,`KS@P},d \0@ TP ,`K2@Px,@0@ |TY0@ vTI0@ p,`KP)0S ,0B0 0B0 RS 0B0 RS Rtl R R R P,00(000 ;0@ 7 0@ 30@ /3000 *,KP, 10 ,K& K(0K@P,"[2[k0@ @P,,0@ & K(0K@Pf"[2[,^0@ @P#,0@ & K(0K@Pc"[2[,E0@ & K(0K@Pd"[2[,50@ & K(0K@Pe"[2[,%0@ 5k@@4k@B@Cx@4k@@@X@@@,@ 5k -L8H4F(,#P P h:Ȫ@ܪ@"p@N- 21CWk 32Cakd0 $\H0 \<0 | (0("404 4uk`vk@uk-0 $ Rl0\`0S  Q 1S0Ġ 8 8#$ $ 0uk`vk@ukE -LP@p`V `P@ RP -LMR,0 pP ' `0S` VP 0 S00űt@P 0 0 00 0 00CS 0t,0 -LTMpßAP!P3t x0 h 5:A T`Kp |  tp&RPh |p Q ㋎h(KX 0p 10R0x Rd P` 4K\4PK`x0,0P0d0 d2`PQ( 1(`1 ^ 08<10l0 " @^0p a0SQxQ% 4K*4KQ\ V0U 00S@,0d Uc\@ < 8 Y<0SM!43C" cbl (0@@ 0 S A B` Kp | t pQPh py @N^8!Fl00噻h &h R @@^h0#S Zs. SVt ph PU0R,0dP00Ӡ@ 0R@KLql 0 @ @ < 8 10e@P6 `d Vt pPh h  $Cɚ;P'pC8@L'pQʚ; -LM0@S`p 0PK ,QP KP P $PK QP0p -LMpw0 WX0_BSeo1ǏF$8pW4P 0` 40K, P(KMb@B -LhM Qp@P  Tㄑ  Te 00CS 0 ?s (KT 0PK0 PP< 0TpHP D@ 0 4 ,0 8 p8p 0S3W00p8p 0S*W( RP0  H KP80c,P`pǏP D0`0@,P0`D0H@00S 80W pP  P #P -LM`@Pp~rP 0 K 0 0 0P p] -LMpP`^r@P 0 K $0 ( 0 0 0@(0KP@ 8 0-0PLP@ PP02P P 0R0000L'p 0-@L{P" 0PP0 9P 0@R (0@0hl0 \  0PP00-0S v(@\L'pP'p -L M< @ D H 0 , 0 DH00Z8 40 782a070` 0PpC @@# Z!qPP . 0,0  0 P  <040 !<0 0! ! 00CS 0q Z,0  ^, 0 <0 (K$> -QLdMx | 0 PX0x P0R!Rx l OX@K  L KH0KDK@ T`KP@K` d0 h |P l @OPP RK l 7OPPE (@[uP #U U|0S `l OPP \ d l OPPP hl OPP  R w(KAd 㣋l 0 0  `@XK`0 h d 0S l NPP\\ `p 4K640K, h"`pQ\ 1#e(0@`6,p\ 0S( 1(`1n[ 08<1p ! @t a[l  ` x0PPr0Sc R% 4K4KQ? W08 00SR,0\ Vc\@ < 8 <<0S0 !43C" cbp (0@@ t 0S PJ@&[F p0qPU (V0R,0\ S00@ `0R@K5np 0D @ @ < 8 @Zɚ;P'pC@@L'pQʚ; -L M0@S`p 0PK $NP KᚽPP $PK NPA p -L(M0@S`p 4PK MP KᄽP,04K#!B ( $ ! (K pq -LM@oPPA 0> `f! K -0LS0s0s S-0p0B!`R?R? 8#L0 CR Q8#8dQ0d08#8>gfff0  0(p(pR  Rx0x0'' Q Qx0x088 RA8 -0@ 2L /0Q p00  (00H >1>1>1t00  |0S0 0 0l0$0(Q(p0(p p-QLM@`@00CS((( (,(000 P@Kp-@h0`0X0KH02 0 @嚂((p(p (p (p(p 0->L@ 0PT;:h0h0h A(h =Hh 9D00 8 P0$0 0P帺00(p(pp( 0-LP 0NP.8CR0 -@L`^VpH h10RUV hp t0`0t00ЯH0U h10 XH R N|rCp@ 0-@Lt0P0t00h: p-LM@طP`H0St0t0$ 0  0S H0St t  0  0S 0t0H 0tPP x06k p-`@Lp 40l#"B P㒷H L00bO 0$@H >RPPp1P91pak 0-@@Lp 40#T"B Pk R00 0S000h踶0ak 0-@@Lp 40#T"B PI R00 0S000h薶0ak 4 0p-#Lp"B @`!r r p<0P<0@`00@vp0P<0akH6k86k -LLMP(K3 "  1ˌ3Š"10A0 0c90S |0S \P \5 U. -- A 0@0QR  PS000S S S  A R0@ 0S R R| R x x0R:(0 (0oP\- p04KP0 0B0RS 0D 0$D @ K`Ҋ,$"njǨ@\, Z84KK@^8 d0@`K@`1pe@` H H0RZ:0 00R  RS P81Ì0K4K@eȌ@6̌^4 0 , 8 @`K Xh Ld @`(0,|qQ|@ɚ;@@@k_k@@@ȫ@ -@Lt0 | hެ -.H0LS@ t0h0t0H̬Ȭ p-@LP۵t0p@ @` 0t0t0N<t0&p -t0L@@ 0  P HPt0@0t0~0 0S Pt0@0t0 - L X_ X X X - X00"# 0@d 0 d H PT#0?0S X)))x)h))P)0r8#(.a0HS H0 `0HSs ))))))))))))))))))))))))))))))) 0 .0Pc0>*pH 1 P``0O0@d  d r>V0 H>{  0@d 0 d  HV P 0>eHb 08#(08,!#8 Q0A8#(}zA0H\XSNP 0@d \ d H) Pj ;^P!P(P'P)X)P0 l 0@d 0 d  LH PH>SB >(p$>dA p-LP@ᙴt0`   U Wp0 ߳p 0-t0L   % P"20#0 P0S  @@T 0h0@T00 P0S P ^T @^? -LMPP =(`$pK @P $ @P` @P $ @Pt0:t0s0>0> p-`QL@ Pd aP]Up -LM2@0 SP 50 ^ B?@0CS+1 ? R  t0 ! W0N>N2n @ :t0\ 8CR㬳t0 :t0>%`(pKⰎ >< PP ( PP0t 5*0t .8C8Ac Q.PPQJPUZ$>8@ -LM0`P0 ,0 8" p4b at @0  82#3᧲Y  Gᠲ\#0h  R|  VR8 0H0XDVT V(ڠ0@ "?0@V' 0>H * .` . 0O0@d P d p`l?ʨ0H0X VR  ^NSP)0p`FH0XH0@X#82Tt0!0t01H R`1l#OK P@4Vpp4b ŚH0CƲH0@X\8  |0P| 0y @w$0!s1Fp0S7  㙕 0@jP< T  4QKP, 0 R(K  4 Q 02R#ܱ #}ױL帺4K,  oܲk6k|r$>(p06kp 6k$> 5k p-L@PX` (Q+Q%t0 >;.t0.}<ph蛱p0t#40#"Bp0t HQHP  ( Q HP ak Q-L@ t00t0t0 0t0 0) P P  -Lt@  0R'0 t0! 0)P P ܒxQ  p0̌#40#"BH0t 0t0h{(p0(p -| @0S00L>0 Q>|  00CS0 ttkHo -`pLp80 㨀@u  0@D  D 9@P ✠% !,t 00S t PWP|@$ D 20P== t {RyW  b @h0(PTh ?R](0Sڜ0  P H Pt0@t0 0S Pt@tt  p [ t|  0S- 0S  0S 0SI 0SW~ X+ | ut p 0@$  $ h0 t@0   th0@t t    0R40,50t o pG0 #Y!   A0GS p0S P 0S 0SM @T T   t@(0 h0S&  .H0Sqtp  0S 0SWt W W@ p p(0 S|PPKPY T 0S 0S 0S >08#8S>>>t  ^W0SpSn l >(B8CS@1@#Td@DT]0p  x t  (Wt{pp !W|pl 'W`pi W X@0|S W 050;- (0 0S050,| ntWtW   ^tɌt z Tx 0>(NxW 0S MtWW9 tl 0W4tW   >Rs kQe0>t>tW  |@ P0 P p p P P 0 @Pp0 P P W 0@0S Ftt/C W   t}\WˌtxXop0̌#40#"B0t )W}p ^W~p > R @l0Sa&| 㙑z (p((p (p$>ak p-LM4`K@P0t2Ɍ0tXPt09t0Kp -4LMh1p40 0P00 < @ 8p ,p 㨠m@Zí0  0S\ `@w0$($?Aas P0S Pi8 R , R,0 8 0^t 0  @0#P30#pᅭ8\ 8 0#p  0S00SW#W00n㨠p@ kf0  0S8 |0P 4 $0!41@@0S  ߐ|"2@pPu =(0S( :` 9@P%0T: 0TT X<归pP<0S X` T 0T 0T 0T  T` 㲭h1@/ b\)8 R +8w(KT =  S| ㄐV  !1RpP 0PCʡ#W  ] 0%>0S8\, w 8 8 80S, 80pᳬ#pp᭬p|rCgfff6k(6kp 6k) -0L@  (0 P0S0 p-P@Lp# 40#"B `@ $r0 t0191p$0Sp191p 0Sak 40 -LàLP@Ap&0`  VW 5t0`.H0S` e$ ^ wPʤ0  `t0`ak -LTMPx0 U`' J:U# :U J0U :Un F:U s:U x:U 0Uy x:U2 p(K`:0S 0 S 8 |0^ @$01F0S S )9@$pP 9U'0CU*0CU9U[ I0CU 9Uc 0U?t @   5,0t ያp09U 8U&A? {p8Ul 8U :80S8t 0S$0St^p|8UA r|8U t8U l8UnH0p0kt @p0,#40àL$8t  P X0S Z t0(0(SpJ  @0h 'D0 @0CpKl0 p H@ @ @pP; \c 0 \ap \b\LW&L7Ur 7U0 0S x0A 1 Rk80h l0&20 p6U 6Ul0p0Q0CUU 0Uxt0p;t0Ϊx6U? 0Usx 1 Q-80* Pp 0Qp| p%0Zp pp  fp 1 RL {P|pPp , p p Ip%t0p;t0{@  P  bf| p4@ p`Tp#*l0S l0T20x   pP   l0 DcpP [ 1 @T0S0 RzR 00CS0 1 80p00 ! 00 !| 1 )E7 1 Q80| 0p 0)㬪x08x0 @8x0  x07x00@x08x00 x07x0c㓪0St0t000t0t0X㈪@ =ݩp(0Sw0S  pPyt  0    00C 0 00003!0 !00l # B,0 000-0S 0x 0 QR BP0R 0P R00c!0R#<0k-H0P R 00c!0R#<0k p-@LB`Q@# 0 R00B0C 0 0 0A00P0Q  00b0<^,00\00S0 0@rp 0-@LP0S US 0S\ a aR QPb0bU00S0 00hF000 0 -@L`ߨp^P V  0 PbU0Pb+ 0 b PP 0eS0 1S00PS0eS0 0PS p-@L㜨0`SP!  0P0Q  00b0<^,00\00 0S00000CS00 0Χp -PL`iV@-Q@)pQ$ 0S`0`Q@@   P 0ay0 0S00`dd0Vp@hQ   -@LP >OrP 0SB>Cr000 p-@`LP >jrV`0 0 0P  pUB> Vr -pQLP@p1 Q( Q* `0Q! 0Q a a0RPP `P  0a 0 0S 00pe 0W R 0   p-LP@ᡧ `R4 R0S) 0 0 0P \  a 0 10 0 P000  0զp0 #0 00  V0¦p -LMp]0S" 0S 0R ᫦p$K@@KP@K $Km莦00h! 80 1 P w]|r80 1 0S Y]@ p-LM`P8  @T \Q Q 0 S 8xAKp`]at -Pp L80` 1 @T  ^ 0\ `^` -Pp L80` 1 @T  ^ 0\ `]` p- P80L` 1 @T  ^0 H\ `]p`p80 P0S0SP8(p -L@PP*0S( BT 4P: P0-LP@0P QT 4Q08C(R0S T0SR\ 0 -h0LPpU` @T * \4@0  ^PU8(p p-`0LP`U @ T*$04@S  RPUph8(p p-`0LP`U @ T*(04@S  RPU}phة8(p -LMQP@#P P CP U Q4Q0S0\ E 0 $K*A$Kmϋ 0-0 L 0P0S@ T* 04@S  RPUt t0pS00d0 \0 LL (00h 8(p@k4Ck\Qk8k0pk@)<(p+pk8A)$ 1S!P@7k/R0?? S9?R0!03Q?  p-PL@`p21C0Oopp@-X!Xa0P 0cS@*<1<81 ,1 ^  ?!("(R 30bS01\? ^21C0Pp0S6@ 21C 0Qҁ0S00lS0?p, 0 0cS00o0p=k0p0pk"!B ?0?\P 1 0 SXQ \0\"!B ?0C?X@-@P$ Qࠡ \00 a0 0l 0^Qʲ1 0 a0b0  R( 0 0 R`0 SQ1 a 00a01 a 0S*cPQ- ^0n\  S ^ 0n\S1  `0S   D00ccD 0b1  `0S  0  b D P0 0c 0-@PL1!xl \TD 1 DP (\ TX HL d `0 0" ( ,04 8#>t tl?@ 1`@@l@@,@D@p@@İ@ذ@@\@@@l@P@$@T@l@@@ȯ@<@ -LpP`A @A1 00100 P1D001 DPD p-L^h0`PU @ T*,04@S  RPU 000ph蝢8(p@(p -QLM`  p$R KPP VU 0 @@cV@1 `d0 0 VpP  뀱@`@H@0@ D0- 00@ 1L00@0 -`LQ@ d0d0d `1 01P 1 H0S L DP1 01P  \ D21C c+p@ 0-1|00!L B!1@ P 8e018U1:11@(p\*p 0-@PL 㛢PP@0h0 0-L@㋢P@0 0-L@P@0SU 0 + 00 0PP 1  `0S1 0S P00 p-@L`QTPt@P h 101ᜡD0 001a 00@0pዡp\*p@(p -L@pP`!W P1T% 21C" cUPPD# W / [1D 01 0P L0\`XpH0d@`@P @ C @@Z = 9@+p p-PLP@. w`PC  R'000 01  *1! $ DD]1D 01 dP`P1 0@ ,@1 p0 r17pD \㐡@7p p-@L`TP\@P P 101ʠ0 a 100pῠp\*p@(p -LM@Pp `QP P R*P`bU1f0Z P 0j0!: D@D00(`0!`01`` 01dPdw0 0 `0 P  vP&0!0g00,0 pZ 0j0 0 PPS,00< -LϠMϜp0 Q10 K0 h`P} W0,0 ,@K,nDD0@0 0 0㵠`0!`01`P `0d`1dP00W  pl 000 S0`00 WEVA @ PP> Z& 00 0bW1! & 0S  ;O JW1! 0  00b\! 0 [  Pd0Wp00 [W,(K,42 0ʚ;@ر@@ -LM^ -LQӻRQ`pP PP 0 \@ @ 0S*@cTS5X V 0!0 00P0000f0yPP" 1 `000 0X0j 0    0S 0S00P 0PX 4 -LM Q-Lp@`8W 0 0g 0 1000,P% 1 Q PQA @@AQPQ100D00 0g0 `` pt`@0 0 !o0p0p -L@P  ` -P@P`N^LpL P <03@T0h+p(C7k\*p -@ ML 0@&*0< 0@p崐崀崠`0@ @P#5  0@PPH`VpDD ዡ(Ko4@\*pT>,C<@ 0p+pk7k0CD@0p[) -PLMp, Z ,  0Q`%,` P`U0@TpcXP @P0U U1Q  P P@U`0X#@gT@!  x0X PU X`p0S P P0gX@cyTPP P, 1 0YpP XPp 0 ]1777 -L`RPp/Q+U" 0Q*U 0ScPPV`dVP U 0@`T@! P $3 1- *t@@`@L@ -RLMp`@0,0 PP V@`;,K⼠,0S PP3 젠 jR",0S W gpZ @1@! @`d UYVPx0Z0 c; 1,, 1:1,?0p -1L`Qu 0,0Sp* 0Xcp`!Q@@T P 0D P0 S`:X4`X  `V00S 0 X@1@! W d 00dS 0000 X  V00SR`` pP T)1 Q PQA @@AQPQAD00X@@X 0Xpc`0 100 2022RP0S0SP00 -LQ@ 00Q02 0p - LR0@0 0S008 R0 0 R8#82 0p 0-@QLP 4T R(iP P@00 0p@ 0-@ LPP 0 -@Lp`@T PU00002 P02@T P7 -LMPp, 00 , K6@P P P `0PTP0 ,RX \ 0`h 0%`hW00S Z,00 0(KW#VgXg0PUSUY  0 `Q ,0 0P@, R  0 R0W8\fEW3PP00W00SU& `0,  0 0f 0 00 00 0f00P0@,0 0 1u b@PP  gP0 XU( ,0S 00S VU 0S:0f 00,  00f 0@,P V0 1e 00 00 0 ? @ @ -40MLh @   0K|r0S R$  0S$ 0-80$ @P @$P0  191# 0#R 00 40Q 0 ?SRP@-8 $3O 0$@P 0-80@L$PR R00 0S000S?0?0h蚚 0-80@L$P7 R00 0S000S<0<0h 0-!80r@L$ r 0P0P<0,  3,@03f00P00<0<08k8k8k 0-LM@0P9@ %@ 80 h 0@=K0|r p-LMP@֚@0`h 0 @"Kp|r -LM0@P`-@ K㴚0p 0  8@P,0Ph!  0@|r -LM0@P`-P K㇚0 hP0p PP 0S000VH 0V`< 0V003ᾙ `|r8k8k -LM`P@S p0 @ᡙK -@L<@ D0}h - LM^P` 0S \  0 (K*0 V 0f Vc ?V` [V] v*l2V"0CVA `4pK⾟ `42 PAT0O 40 0@ "T2 ,0 1U1V\ U0V= 0V 0 RZ ?- V O@V V 0 0000CV 0V 0V 0 V V0 00 0 0 0  0Sy  Rv  Rs \p 0 f3 003 0  V  Vm 09P $%CC -LMXP`40 p" 0S \ 40K0 0 @$K83RO Rr R  R  R *@W  R8  R R U@R R RWT 0S%0 R00 0000 0S \ 40K0 0 @S5 0S00S S0@ 2hmi@P R`1R 0S  R  R \ 40K 00 @R R R@W 0S0*B BQ@@R񟗦v)`v)Lv)8v)0T@00T@00 ~P 7@n0tP(P@ 7@^ P@x 7@VW 0 S0@K SEP!@G00Vc V `@<|r! -@L 1S   -LL06bh -0@080L06Sh -L ML H32C0bC^ (K#0 0Rx ̵P 0 A0 <^,0 A@@0@@D0@D0@0C C<Qaq0 @P(0 0??<PXP <  a0 h!  @ 0PX 6000 0嬴 Z 头+pQ0p|r 0-0P; 00UL@0 CP6⾄e0h` \60h耄 -pRLP` 10^ V@ @@ 0R 0 `0aR \^P 0 0 PT`pV`0   0 1SS 0001P00S 0 00!RR 0001P000$0S $ Bг@$10 -LM @S 1 !@ PK { 0-0@$1LSP S TP 0$A000]P -L@<P  0S 0& 0  0S -P;0SpL`p3*vV@ ; 1_7p ` pP U@0S0#S0`G -LMp`$ K@P$0$P 0S  00CS 0$<9@ K(K r@P $  00CS 0 )  @p0@P(0@@$< -LMp`$ KaPP  K(K 7PP $  00CS 0 X $0$@  Pp0PP(0P$}< p-L M0`@ K 0 !PP* 0S* $K PP0$ 0KPP Q $ R 0S R $ \PP   00CS 0 PKp$P ;<$K DP -LMp@ KPP%0 SP 0S` i0`SV  PP!0 0 0 $0vP  00CS 0  ;7P; 1V 7P  00CS 0 p-LM`@ KPP x0$ P 00CS 0;x -L@M\ `, K4 0 lPp 0@ P0 L@ \0\X T D @ <0 H  0SH0 ~Q{H00SH0 v\  ,0R@$ @4K00KX KHPP@bpPH0r 0c0Qp 0Pp8  08 R !pPJ80X0 8K upP@Q& X" 4PU  0X05! 0305  ]P0U @@X00P0Sp U0 cW,,0 0@,00@0,D0/0@D0H@p,  00CS 0 0PK4PH(K\,;H0S wW #W -L(M0`Sp @K P02(K `D < D K8 (@ $P 4 ,`  K@0 -L`MDKPp f@P8 P(@P`K0P,0  000 0 0000008 $ <048@0 PP$0S DK -PP, (00(0, 00CS 0& 0 (00(00 00CS 0 T84PP @80h9080 D8,`9040 08,85k -LM0p@ K$0 PP $`0A?AS  00CS 0 8%PK $K0PP 000  00CS 0 $PuP$PP0A?AS  00CS 0 $$P 8 8g@06F8  0\'PP ᳇U0S3@ -LM0pS`@   0KPP,K PP (K,4,08 $@ .  7 3S PL0,T 4 K>P,SUH< 3SEk,S47,8,S0P8W 00CS 0!83SP0 0F6!PP 8< 00CS 05 5#03P8. 00CS 06~  ,PB A,0 , ,0  ,0<$PP  R 00<SPP ,S47,68,]S< #P5P, (00(0, 00CS 0 40@ 0,7g@5k@ p-LM`@ KOPP x0$ P 00CS 07x p-LM`@ K1PP Kp K09PP   00CS 0k70 $ P  -@PL' Q 1S 0 Sl0 R0S0 0C#qW P`Z0 ` 0WP@TP x)P( 0S0 0  (0(1pP 0  0C0 00C0x71p -L Rg r R@0T0  (0 ( @T@T ( e  ( 00C0( 0 S( I @T@T1 & Q `R3 P  Q 0Q(0  00 0P pLW@P@T J P0S$P @TZ@WP7@TPZ&P00$Q d0 R0 D)@ Q 0Q@1plo1pho8k4)P 0S  0 8k -L M`4 0PS t2R P(K Q 00\<2< 82 A0!/@!b0SP0p1`k iP @RA; 1^ ` EA P  @l@T 0X0 P 0 0@Cp0PK 0sD 0sA 0SSB , p 0X0 0,@D000  0  {045\,K , ` PW,pK‡@ g, `F 0V0C 0,00C0  B sPqO7Pl` PPg`P$C1pgfff -LM<  24 Q Bh 0A"q#Wk1 80 O400  0,0 0S Wj4@PW P0@S$00Sx S  F=Pp W ,/QWO40P@`0 `0W!@M 8P @VJ0 1P55@TZY(PM ,P,QU @, 0@0, .W,P00S  0 lK00@0 l0CdP h0 l DP < _`PX@T TDK|:TP "H$0`$K`;$@K 00 0 ˠˠTXKD K 8`PX0px00 P P0 $0(00@ P,@z: -0LS@ 0S0S S Sl h0h P D wMP @8|$0$ 7@ 9k9k9k9k - QL@p`5 PXP Q00S0v03Q0SQ<)))0)))p)X))))))$))D))))<) 0S -X (Z % v- 0Sr i'呲 H V8_TPE PC 00 0 3@P  80@ 0$@80<@,00@( @ 4 00 @5U80(B8Sf S7 S5 l?0S( S S L6xv R 00T0P 4 0 a00400 0l 0ZPU0p 0"PI UPIRN ,40 0c c 040 0 b0b0 PXP00Y0( %W 0S80 P@Q 0P7W PXP0Y0P90 P O <@1p4@,@$@8k -` ML Hp`@000 p@0h0P` @00P@ @0(0P  $K1pH@h@@@ش@ - L^p( 40 <A/P`PU``0 0@`0d@P`^$0$0$00 $0 <0dC6OQ  @ 0S 0S $.p0Wp1p1p@1p 0-@L440P 0P x40  ၀40  40<40040  8P0@ -LM`@P Kp`H@ DP @P 40 @[K4040040t4040040m400408 -L M@!0 C6B6cO`p`VpഁQ 000S @d _,0?0AS00`1P&O0d P?0#6Po ?Q t0Sx0"0 ?QR B "0>] s1 RP܁@T  P `O&!0OQP@Td1d!h0\ T1 \ HA0Ms0~pW (K4K 0H ,@K@t2 PD,04 @r,@ T`5P<  jEPD < PR.JD 1`PU&J0O U 00HP`F<@T D1P @40;40< TDE0 <D0\ 1@ > D8 1P(`80 p0@80<@(,  /40lP`904040K | 0h#<0CX:L`@圐XMphQtp Uh 0 `U 0t\p^@3p1pH3p(3pr|r6p,3pt@X2p40040z -0ML 0 0 `p@P0ʠ @ @-PT0T` P'HH0P h@lP`p@tPKh!5Nk@3pH3p(3p03p1pL3p@0@-P@ R( 0S%\ ) \ ^ \@ 00\0 S 0  0S R 0000@00 R P,  R/ 0\00 S 0  0S0S 0P@ 0S@@0  @0@000S00S0@ 0\@@  @0@- R 0S^ 0Sk0 0R 0SI0SD \   R00 \0S0  0S R( ^ 0Sm R 0S 0R00S00 S0 0S    R 00000 \0S0  0SR 0S@0T00 S @0  0 S 0R00S00 S0 0S    R R 0SP0U00 S P0@  0 S@ y -LXp5 PU?P0S`X`V 0S@ W`RP 0WPP 0RPPV 00SZ  `X `V 0S` P 0S0SP0SP0S  P 0S0SP0SP0S PQ00SQ00S p-` ML<@ p-@LT`P@P  R0T 0@ PPP@p0@0@@P -1`LPpP* 0S'ʼ弡 0R1P )W0pH0@40H0 9,0(`8R|0S; |P 8m@(1PnW,  W @0@00 00S 0Rڼ0P m8 RR:0.S 0  $0@ TX p @0 0 0R 90.S 9kh4pCx4pP3pp4p@4p -L M0@0a1, 0  +=0 Z0 0P` ,0  p 0@0 0Pp@`Z !00,0 0(K M-LM p0, 0 `0@P`pG  P 00 Y W 4  ZW,0S (KoW(K, 004 (Koy(Ko -L\MP tp\ X0 T PL T 0@0@0 @0@ T0 \ P@d@ `P P`P`U P0@0h0 P @ h LPL04l ,l@\, 1h\ 0OS"U`U P ,K|L 0)PPP@|0sI ,T\ :PfT0p PPT|00@(KhT 0O4 0 T SD @ "40\@D`U`H P H@@h D0Lp @PP@PhP TpPXV0sP TP P|0p 0@V P@@@h@ tPP @Th h0|$ɯ0 QdP0 S`T  0O 0 @UD PXV@4 K P 0R< 80 SHP\TP L 0` B1LP|)P; @UuU+;TP0t p H@@ @<@K0@ PpP0LPP@h !V 0Lh PP `d0K0@d0 `@ T@0 0T dK)@U:#U*+;<KT  PP|00@@- R00 RP00 10S 0<0$9k 00@Q@- 0@ 0$@!001 - L0; S ܗ4p -@(10 LRhq5 40 $  \k4P$V x 0P P x 0S00 T00Q0Se4PkV<40<40P 0hxP PU  V0P 5$|r@ p-P MLddd 0 P裙dH0H `VPP@P U$@Kp4kԵ@4p49k89k -@ LP ( R,0,0,0,0$0 00Pg P -LMP,  @0=   0R 00P0 ^,0  0R q0 Y t/ W> X. WFʁ qp tq U<9 Xt0   0 0Su0000rtuXYTU0SVt0 TY t6 q: R Q W t0 00R XY V qrruuXuVzrQܵ@ p-L M0PK0%@ `K0S 0S  0`%PKp  -LpP01 0101 P`u 0P@`PU`P `400v0@0 @ -@L0>00C0h585p 0-L@P>UT0040P0T$0 0   R085p9k -0SL 0R& 08 p* P` 0S@ 0@ 0p $0( 0S 0 0@ 0R0 @  -L M0P@T$pK `K$0   0`x@P ]0DS ***P*$* 0 0 @K 0 @ 0@ 0$0 @ 0$  0@R  0S v 0 0$  @ 0R 0 0@ -L M0SPIJ@PN d @ 0@ 3 cPQ l0S\  0@  0S @ K  `V $ (0@(, P$0#0If0@S (Q,0, ,0, $ 00T 00F` pK'`@(K 0P ( `P  *0 *0!* *`!*T *#@@T $0@P(  0S^ 00@T$0P( 0 0@(z@0SL P ( R,0,0,0,0$0 $0 ,0( P((0 $0PT& $ 0P( $0  q@ 0R:  0R& `P(0 @ 0@ ($ 7@(0$ (0S *(0S # 0R$0P( 0 0@.@'9k9k -LM40 1\h10 ,0 080 G\C`VB p pppV4X 0 P; ,Y0 = @PMP$ ` p4  00 08 0@$0  8 0 ,0 00Y40' Y Y P\ P(K`P`(KoY0P1, 0 'P PU|r -L M((@ $8 0@ K@4k85p -LM 80@ `%0 R\ 0 [  "P|0P0C,P SP%0 ,0S 0 =$xP U 00WL0$  P WL0$  0  R  0  ,0S L0$ w # 垜圜@@ -LM,( 0 080 R0 0`(40 S P< 00  , $<@0/S D 0S/S 0S/S0dS@0 c0/S ,,0SɌ,80SɌ,,Ɍ,@0S , ! 0U D0U 40,P L0P  L$0Sy 0Sv 40 ,  00,P !@PD R,Z, 0 jb, D@0,SɌ,P00 Sx@T$  "P, P#,K0 p{W^ ,P,P00 S SJT30 S ( @<@ <@ D 0S/SY0c@ 0/S^0/S ,`jnj ,WPP,  (00CSP  z40S,r @Q p!0.SM0.Sʌ,HIS,hR 8 @0! RN r T+ 00(K0/S 0 db<00@S@ p0S4 0p03R0S@,PɌ,p@B ?@p "pt,@0 R1L0$ ,  0p " , 00S L0$ 4 Rs L0$ o p@0 0 jȌp,0 @p45p@  -L(M0,0  p0(40P 0S 8+0m`V/ R+ ,0 80CQ 0S/S0/S{L Q0$0 R3  0/S dq P8刑 ``8傑00(K P}8L0S < P `Pu,0n 0`"\ RU $0S0$0o0S8$(0`0K4 PP 0PK@4` H0 D@ 8 `8l  00d R8ߐ `?`00PS8Z45p4p0@-P@ R( 0S%\ ) \ ^ \@ 0 0\0 S 0  0S R 0 000@ 0 0  R P,  R/ 0\ 00 S 0  0S0S 0P@ 0S@@0  @0@ 0 0 0S00S0@ 0\@@  @0@- R 0S^ 0Sk0 0R 0SI0SD \  R0 0 \0S0  0S R( ^ 0Sm R 0S 0R 00 S00 S0 0S    R 0 000 0 \0S0  0SR 0S@0T 00 S @0  0 S 0R 00 S00 S0 0S    R R 0SP0U 00 S P0@  0 S@ y -`LV@3 ^=0S`PVPU p` 0S`` TPR 0T 0RU 00SW `PV p PU` 0S``P p P 0S0SP0SP0S  P 0S0SP0SP0S PQ00SQ00S0-t@0t S0 UTR p-@LTP `P`@@T@p 0-@LPT P@@T0 p-@LT`P@P  R0T 0 PPP@p0@ 0@@P0 L0PP 0S 0RP5p -LM 0 `0p00Ġ R 00@4l 04 0Q$0 $PK @$00$0 08P#8@$00K0ukHk5p@-0@ 0@ 0$@\0`@D0H@80<@,00@0l0 0P T L @ 4 X (    L0S X R\0\0\0 QL0SX0 X0\0\80080@0D  D R80SPPPT0T D0T0 PT 0P0 PT 0D 0D05p6pD0@ 0CD0S80SPDPT0T 80T0 PT 0P0 PT 06p5p -L@p`\ L0S XPPU L0S \ -L M0   K0 P K[*-2L?0\ \ x 0S00S6px0S 40  0 R  R x 0\0 00R0S R 0-L$@ P R 0100S P 0$   00$0@- P@P -0A0@0@P -LMH4P08@t ` @P|@0l0 (@0LPp儀<@0 p  $Kx@,@@x@ -L M`0P1p ^0Lx@10P @Dl@8 <0@WKd@T  @T\h@T < @Tt:k@P:k@@$@4@<@ - pLt M,0S+ 0 ,\`0h h0dx<0@@pP`0LP T0X@DPH`Z bBZ ]YNZ Y el iT -L M$`R @0"( Px  0PXP 8@0H @`0 ,0 ,04 00`KP `p PX``@000p @0 00 x@0h0P @0p0P| YϊB?0 \ T @TP P01Ps #X 10CR c. \P X@T (^$K @T 0Xe\"!10C c RP X@T\ \ L x@L@@ @d@@@@@<@L@T@D;A\@l@t@@ -pL@T P` 0 `@S PQ 00 R 0 QR089k49k p-0L@`T  P @T P pH0@Q @`0(0S pp89k49k 0- @RL R000 40@ dP h0S& 0S0 00@P0@0hP00S S t0$d 0?x0 R <0< Cp0Q@0t0t0t0!Ce:kVUUU -LP  p R R000 @  h0S 00hp0\@0t0t0t0!Ce|@ 0-0LSP@@000CSx00 H0H d0S0d 00dP@0ٓ댺@ -@LcD@ 0tt0P \@ 0P0 PT 0@h,c0SP0 P0P0T00@T6p5p -L@p`Pll\ 0 @@|[P  -L`pch@PT! 40  R 40@40$ 0b0WSch@PTW 08 h0S bMhbT븺@@ -LPp` ]c0@!h0S b 0 @PdIcl0@Sh0S )b`;cd R% V@ x0S'PD @VP x0S40&40 X,40;40@Ud RhP) V P @PP x0S40840` 0Z@P Lb  Gb Bb@VR ǒĺ@к@@ P-L l00Csl0 @  S 0@0lhY孒@ p-`LV@P40   R000   pl00l0!Ce@-Q @P -\ 00 R 0@RoH:k -1h!RL ePpU. `PU 4 00S40` fb@amW`pGZ`V Z c'P0@X PU`(< 9|r9ko'5 $@@ p-LP`\@0^0$C! I p\ {2P @0  0S p@0@  0S pp$3 0S p p-LP`@`T0  ,00%VPpQ* - L@0 1+ -LM\@PT`o T^dP[TYPW1 ,p`X\ nPH\ 0S d RE@$T@7 0\ 000   P00V@@T@!0400P 0400 R R 0S 0S $1 0\7@1+@@\` @Pd 0S ǭ$0 @0400P  4 $0<$08(p p-0L@P`    eP$0<$0p7$0<$00 -L MQp@@ @+ R t1\ \ 0R@@@A 0,P K0S S S -P0 Ki`HP0x  KiGQ0PU 0S0S PU-P $2+@$ ㆿ0 00$ 0lGP*89k49k1p -QLMp`0T@$KW00 P@ $W -80T 0CShL@80  h80S@0 h|r -LM8P@U08040`pI<40H`9U2 V$zP7U 800CS80 0,0@40, 04  KD0SQ 0<40 KiW v 0 W ,:0p @T5p|r@ػ@@ -L\L'H0Q P ,h$h @"p(@4@o -PLM8 < Z <08 1X80 Z 4 wP 4X0 80c<0p.,1 R$ R, ) L0X@S0 `Y%:P,K,pPT,@  L0X S@Y:` pP P :(K0` 40` 08 0b< p0*40p " <- 5pL:k<@6p -0LP@U3 PU0 `ᦻpP &@p P 0$0 p0 00$0$(0$0 /0B0Z 0YZ 0@89k 0-p0 ML@d@P@XX 0PP)< <<0 P0PPK0hLC6p@4k5p5p6p5p - L-@ -0 P0@L`p!\@  p Rt0t0t0 @  @ 0EL X000 Rp p0t0 @ti][:k:k6pXk 0-@L80Q 90L0PP[pQt0t0t @00@0=[ `  00CS 0x -LxM@( KPP$(`0W00# 0 0P$  00SP PP  ( 00CS 0 $K(@K|` xp (0 0u P -LxM0@( KpPP $K(0 $`hL0$ P  00 'P0 R 0圠K 0 / PP  (  00CS 0(f꜠KP  P 吀 p 0  0" P0[SH:k -LM Pc0d h0 l D @ !P $ 0R) K@@K xP0PF 08KD K PDL@,p 0P$048,0/Xܲk%> -LM̀0p$0 ` @P $ 0R$ K@PK 8@P0PF@ 08KD K @PPK D@DTl @Xܲk%> -LMß0,0 P 0 0p0 PP  00 ` L P,, 0R(K,  LKT KPPL@  0T 000H@K PP L0S T LPPp>0P 0@KP K PPP P00S-P  SP{20S P00SP  0PPP PP  @K[PP 0@@ P PP P 0|PPP <00<0L00L L00! PL0$% 0 @d0 `@ l0 h@ 0K5K P @0@UKl0KPL @EP0PP0 } PL (00(0 PT L (00(0L  00CS 0p LlFP^(W 0FPPV|ܲk\;k%> -LhMp0`$0 @PP $ 0R* K0D cKP `P \  0 X@ .PPt@@K 0L08K < @ L 0$PU iPjWܲk%> p-LMP@P `K \ OP Kp/G\ BPdd.< -LMPp$ K,@P $ $0L`V  00CS 0$@,0 $ @ 00CS 0 T$048,0 @$ -LHM@0p P80 dK0C\ `0 d < 4P P KPL@,`0 P$048,0 s -LM,p @o,K0 Kb`P*00 P0 000@0" d0 A0C` 匐 吠 <0h` `p K0"0 K`P V v`0L,(K, <`| ,0,0 0, $/ 0 @@0 <@ H0 D@  0#K3K @0@cK| , H0K@@P 0,`0[ !, (00(0Y$ ,0  ` L0$ `00S< `PAOK 0 0 ,0 0`P  9 40 0, (00(0,  00CS 0, < Rv00`Pn,k00 0o` \;k -LMP @0  @!K -LM c @K -LMpP  0$S00PS  O 0@ 0aP x@ T P(K0 `V(P x@T PE ` -LM1, ΄ 0 P夣Up1$048,0, `P+PT @PW X*Y,`, 0P PTW X00`(K0`k:5p -0L p@T @V 0 `zP$P@0$0500 @$0@0$05p -LM80`S% x K0 P00PUp p@0S 0S PU@0S W @@T  m 0p 0 g 0p0 a 0p0|o45p@ -$0@@0$0Lp`P 00$0 0 0PP4 0PUU  $00#X00S$ R0 00  0 P 0x03 00C0PU x +|5p(@ -LHMD0 p<0 hK0C` d0 h @ 8p @P0TP L`0P @P$0  ~@ Kx40 r P@ 0b@ -5LQM☕0 S, @p`fPPK Z 0QPP , 0RV(KD00  0CKP 0 p PP̀ 40C/P0UK 0PP10 H1S +PP%&P  1L `$0`0 03PP 00S P`0x@ `SL` X $ \! -PP`10 P PPP  \```PP`8$$`1$`$"2` 00$ p0K` PP"`!0@`$0H `$$`!U$\$9`0S` `2`1x0U~X000`P `1 0` E`$0 `r``!0,  ` 0PP `PO`!00%0<K @PPG10SX1 PX1 0SX1 K X!<KPݩPx\d  "P P ` +X`  0$ 48$`! $`10d!`$\! 0 ?X;kܲk%>^1k5p89k -LM,0 0S K- -L M,0   <0S-K K -LM,   0 $0S-K K -LM,   0 @0S-K K -LM,   0 D0S-K K -LM,   0 0S-K K -LM,   0 0S-K K -LM,   0 ,0S-K K -LM,   0 |0S-K K -LM,   0 T0S-K K -LM,   0 0S-K K -LM, 0  0$  0  40S-$K K -L M,0   L0S-K K -LM,0  0S-K K -LM,0  p0S-K K -LM,   0 (0S-K K -L M,0   h0S-K K -L M,0   80S-K K -LM, 0  0$  0  l0S-$K K -LM,   0 t0S-K K -L M,0   x0S-K K -LM,0 0   0 0S- K K -LM,   0 X0S-K K -L M,0   \0S-K K -LM,0  0S-K K -LM,0  00S-K K -LM,0  d0S-K K -L M,0   0S-K K -L M,0   0S-K K -LM    ,0 0$ 0  0S-$K K -LM,0 P0S K- -L M0ASȷ**t*t*t*t*t**t**t*t*t*t*t**,0   H0S- K00 K<0;0 -LM,0 0   0 0S- K K -LM,0  `0S-K K -LM  ,00S K- -LM  ,00S K-40040 -@ ML̠ 0 @PK$K p-@PL@` P4< ? 4  0Pp@@$ -L|M$`@0p\*  0 PP00W00S 0 ! @`mT   ` Q X00S PP$K K PP x00b0at f@ -LtM0 P KlPC l m0K0 @  000CS6x*@*H*P*X*`*h*@0K4;DL0P@|0KpPK`D0H@dKX0K P$`80<@,0 0Dh\P@tPH`Lp 0(4@@TPX`\p (K  $ -$pP0 LR3 ``L0S $0 0 @ 0 @" 0 D `00c@  5  0S` ` -L M$p0 40 R0 0,0 !P`Q VP! , 0 @0 RP 40  P000c@ , (KUP -L(M`0 p0K@0 ,0 P L H0 D@ < P8p 4 @( W0 PKX@ Y@00 (K0 PKX@ Y@00@0 S T R@ ` -@<0L0C<0P`p Q0  @ -LM(0`$p @PK 80K0@ ,P 8@ 4P K 0 K -@0L00Q00\0S  1 S ppW P`V  R(RU0 ` b 0a0 -L0L$  0 R02& 40/P -LtM0`0p@a 20 S] ,< D00( ,0PP100S-PK S>PH K ` 00SP< PP8 0lPP1  00Sb  0>PP%40 H<00<0(K  0,0@0,0(ZPP0S (w0P#  00l PPSPPK 00 000 @ 0( PPk  0PP@;40  00 wY@KP 0@|@ xP PP -LMPhp, @P t m000(K`H0 00 A @P00H00\ R00 @P 00, @ |r -SLM 1 P   K00 `P0 @@嚾w=0tP  0hG-M@ `^0n 11"2`6$Bqà7LN%RA ln20C" `c'x\1@ W H Dppc4!410S 1P! 00W: Qpc0 2 0(\{>L 0Cp"(40 0ǁY000Q 0@P` < B2MϠNlppЍ8pC7pųE.7p7pnm&>&>7pk_k0@-P\0  U0 @  R 0U 0  Q0a R.00  \@ R (0U 0 P 0000(>0&>E-@Mp 00 Q.\R00S .0Wࠃࠓ0ЍQR J \.\ 0 S.SQZ0.SR.0Wࠃࠓ00P^ J0 S .SU \ ^ZX \0d `h`cV 0 S  ^Q 0 0LV \00SQH\ᠡ'P0@ S  ^R 00A\  Q00SRQ 0S0C0^ Wࠃ~\_00W @0'!000c00 Q 0l T0#02SpRs  B0 S 00l bS0a  ~0 R0M 0 Q0F0 s R .R 0'>0@-@0 S0C R .RN21CP 0 0 R 0e0@ 0  @@  ^@%J 0p 0 ^ BJ0r0 ^J0 BR0000@000  E- @@  0S ~? 21C0 CPbUP U`p@PEupG8 0`P0@Sw@pPUpG&J 0`Pᐠ0@SwPU@J 0P0SU@ J 0P0S 0S 0&>p@-@?0|03\0SP`@ 2 1C 0 0q  ? >1C0 0C 0S0 00n 0C0p 0S p/SN 0S~0S0 00n0C000Bp/SN V:0S~0S0 00b0C0/S 0S0S0  /S 0S 00L 03 0A0qQ P@ R .RQ4 0?AcQ 0?AcON -`PL@p`@0!0Sအ0 <P`lPh1 X!X10QP4!<1>A Q  0PP 00C0$#Bb2 0a 0>'R2 !0@~`l"`  Bp@31C#0 ` 00 @# (i7p7p&>nm&>QC8@0@- P$@ 2 001^   R 0\$0T0U00S 007p7p R0S  0 -S0L@ h 0-PL@ P ,0 0=x0 -LM@pL $0P PK0`K3   4 00     S0  00S K$ K[ PPH$ Ϙ$P ʘS $0 $0 T $0 $ 5$ #40$ 5$ #40$ 5$ #40$ 5$ #40$ 5$ #40`$ `0$ #40S$0d   S0$ d00#400S0$ d00#800S0$ g0004 $x0s`00#8004 $x0scW 剻Pm z V XT0 s0^\ S0 0S0e  0|0  -QLM@PP0 Q( `,K4K0pK#rp :CR(00L0 40#B@(0!L 00 x @00 s@TGP0SD:0^  0p,V (0S  U,(K 40廹`PV,` !T00T01 01x 01R(00L 0(0L 00@ x @00 s@T(Q. , `$K( 0L0 0@0$(0  ̠L @00 $ (0 L 00  (0L 00 x (k` -RLMp<  @1 11T  B^T Ya<0IP 0S[Q `P00K, K40K8,8K 40%@P0@#pC :CP80L 040 :0 80 L 00X 0@@0@ @0@ 40T*UH xl1PU` P80,L 80 L000@40@T0@ :8, uU.@(K80L 0 400 0280,L 00 80,L 00,̠ 80L 00 0@@0@ 8, C0h0Q 0S<@@8嫳 -L MQ`@0 pw W<  h@  i2iPP  98 0\ B 020C!0s s20C@ 0WFX8@ 5PP10\ B Z! Y20C@ 0W,P8@ Z 02B!0C0s  ZX < R8  @0(K4K,,0 C<  -RLM`PP0R (K00K, K40K,8K 40PF8@ xpwC 8@0L0 2$W y  00 s00( x1\a |9 :C\L00 40  0:80 L 00 8@, C@0h08@ T Ჲ8寲8@0L 0 4 00, L00B 0  0$  " 80"L0080"L00",80L00 8@L 00" 8 0L008@"" -0L|MT00T0R1@01`  0K1P 0! !TATKV 00 -L M`< @0 P4p S0 ma4 4(K"000p r <t0\x |04  `0,KSt0,0  , 0K,< 0cP4 @0 Q,08 040@0 `0Sd, 4` 0 0A 0 Bp0t <8 Q< `X, Hl0B , d0 PL@ѐZ0D0P0 00As00 S0`` Xd0b ``` PX0t0b>x c @SPQ0| `P2|0s L@塐Z0D0Pኳ0sa,t 40u@Pp0, Pg p@ X,0K@P4 Op W0@|0@4 , 4@ B@@8p@7p -LMP p 02@$p  0 !P  0P:0RT0S$pL0 X1$^D   !T00T01 01$pP0S5:0lP`P00W0S W#( K,0K($K ,0 PP$px~L 04 0 0, $pP K$ -LM4p`P4K(K 07@P$,K(04KѵP,(0L R:S 0S Q0Sǰ$KðP,庰 -LMQ@`PdX 032`DnP6"\050@0 0 P呵pPX 0\ L `X H0N a 0PzpP 偰00 -LM$@ 40   -LM04`<0  <0ZPD p,K8 K0PP40K,08KBPP.0, L0P*0@SL0 @0S0S 0 P 0, L0 @0S&p"(KUP0<\PP0<00<0 -LM4p8K,K 0Q@P80K,08KP30P,L0P *@,0PL0 @0S\ 0` \ ĎP d 㾎P 0ϯ˯pǯ(KT0徯0@<@ -LM00( 0C4Pp00 @4K,KX @D4 0`P1(K,04K呴`P-(\0L0 R (0S  @000 A @D\0 0S (坱`P 0\ 00T00S$Km(j -L M, ( S0 S0 p^(0S$K``0\p \H 4`x0sA ,K`X H `0Ld0 /pP@,L0 @ 3  P,0x 4qP0 40X`0S( U$ q@0S (0, (0K,p pP(S0 `@0\p,p\ W,,pH@<@ -L(M(PdL ^p4:dX0  a<à  0, `PX0d ,(#d X4K>< K,0K`P( ,0H S\00K H 40<K媳`P00(\ L @H 㥍P ⡍S0 0 T0 0% 5#40% 5#40% 5#40% 5#40% 5#40`  `0#40S dS0d00#400S0d00#800S0g00040x r`00#80040x rc000,0SKVD  @  D 0 @ P: ,0 @D0CS,03(0\ C(0V`P< K0 (4K A(X>}`P0K40<K`P00\ (L @d 0(K0 0(`PL R S0 `, x0s P0H0  H L0,`@0P,` H -4LhM0,0  H x @00 T |  d 00 4| ` dS0t , 0tR/(K@ 0Pt | Pt @40p@ * 7K0P Pb P0t0 \ X  `\0 0R   S R\ q T `m 0Y 0R S .SY B0l0 D0 h0 p@KdhP K<0KPB`HK@0PKW@P4@PHHPL 0@ s 3S00S9 \0S`lp R PP pChh I \ X 5V\ `lp V0fl2l Q 0\0"'t V |  ᛹0t0 N\`\ 0\`S  P X0S@H` 0 0  #H@7K ދPd(pd0,0`0x 4r` <0SPZ V<` PRH׬ v 3`x0s00 @`Rw T 00R00SS  Q u  0Pt d`0S  Z Rt ` <D0KwPt p D0R |0 0;0x t5\ X d\(p\ 0B,00.S  R R0.St`R <` T d`0S  Z R= Z | 0  |  ԸT0  u  0aPt |d`0S  Z Rr 6 | m0 40@hQ`K0t0 aH)t@ ]P t Y` <D0KPhp0S T x 060D0| T   d00S  0Pt 1\d 0A,0l0(0p0\;0t #x tq0 6t 0x g0`60 <D0K@P!pQ T  &D0 |0 m` <D0KPt p0|SD0 x t?060x P0t@ 6t@ 0x P060 D0t Bܲk0)> 00  $00 0-L`P @3P004  0 0 -LM0K@`DP00 0  -LM"0K@`3P0   -LM`B`0$0 ,` (  h0PSp 0S\, KU   0P$  $K[[h++p@ p-00LSP@0 0< 0S  [`P  0P *ph0S 0S p-``Pd0,0d Q L0L@ 0@T  T0@0 @0@ ,00@$( Z ۉBZ ։ e| ҉ t 㗊p -L  p(`P`R x0`@0Q `V<;$0 :$0`" -L8Mx0Pp &@P (KDPڈ7 U@ 0` 0``T@ T$0040  0b@P(K@ H H :U@P x0, PX 4 0R S  V P<;`, ;40k040,0 L@ 0 4 !0 4 !0 4 "0 4 "0 4080 0$02 0$`08  24 \ 8#8R$402@SQP  0 400 0,0 0 @400 0002SL0 $PP80S 0 40S0 x0 0 40,0080 0$ 00020^t 8 0Bp \n:0L k0Qh 8^e 4@,0!< 80x D 0,<0r8<00 L< 2!?04 H @D000H0`T 80D 4t0LP QT 3R 0D 0 D x 2tQ0 08l0l00P S@CXP@l0 4p0J0@4 C`\ d0Ad @0RX O@@0 40,0P 0 R,-0,0 |QKP00B P< P P@P$00104P0010h0 0`b删 x0g"0#4X0 <0! .X@ $ 0@,00@0H&0%40| e0  x0x40+H#13 ȭ@Pr,0L@ ᶇP 0|0,04 +4 ,0,0 yX 㥇PD 㟇P, 㙇P Lo@ȿ@п@@)> -LMDKh p | , P咶`P$ # `0S    `P$ -` 0S`P W/Ko`, 0R(K`KZ 0`PKKZ 0A8ps @0,00C 00K(` 00u`PP00S` cx  0 #40S` P $0 lmu0 0 @` V$0P 0S`5V`R0 0  00 0 0JHx0s00C KP3  &`x P 010o0i0KKZ ߆0 d1 "0 0 d` dXV [ 0%`0吀Pb밀B_Z㯆PhZ BZ㧆KZ Y_:Z㟆KZ 3 | 㚆+ܲk0ukH)>E0  B40R+P:+:+:+d:+:+:+P:+:+:+:+:+:+:+:+:+:+:+:+:+:+:+ 000    00 005w-|`| @!0@`$dP#r"XX 0' @(?0# O $ Y `@&0#@8^nCCX좙N 1s s s (0<0@00 0<0h=kx=k@ R00 0S00@Q $ 00!0?A0100000@Q 0 S 1 91 0-L M Pd @0 80aK0 p-0L@`` $0D VP~4%(P%(P 0 0"$Upؿ@@t3A$@ -LM0 pR 040`V  PR00` X0@0b4` c SPQ 0P -LMp 00匀0CSDt0|P`S u*  x 0H0,  x0S40@` X0b5 ` PVQ| @P 0@|0@L@P|P`0D0v&@ % |0s0siV8@0<0< 0 < -L@p- -L@e- -00 LR@`Pp Lp0V  -LMPPpWpP 0@ BpT{nvg pPᱰh 0 npᥰ p-L M80@SaPP Kp$`KY0 00 4 0 00 000^\ S0 0S0T0XV 00Z0 -0@,LhL0  4p -LM0 ,0 @P`0pS( d0R`# :GL, 0Rb(K謐K =d K`P 0 !0 04开KY0K00 x L` H` 0 00 ,x0 "0.00  K0#`P0  0  0TKV KX0K+0PK0NKP K Y0[ 0Y0K0 RK0g-ܲk4p)> -LM0 ,0 ``0S4p( d0R# :Kp, 0R(K@K 0@PK@K⫃00 xp b0 00 x0  000 `X 0H `0Cd0 PPP˨d@L冃L@ 元 L 0#40%[ 5[#40%[ 5[#40X [ [5[#40$[ 4[#40%[ 5[#40x `r= !4 0 0 %[ 5[#40%[ 5[#40X [ [5[#40$[ 4[#40%[ 5[#40x r \P d KP)  b0#80 [ `0#80c  @0S 002y TKV KX0KDr0NKP K>Y0[ 0Y0Ke@ PK K 0H YKL @ P P0  0  0"8l,0 RK0Jܲk4p -LdM@0 P,0 H L x7`LL h1L^|0 `p  H0U `HP]LƟ, 0 R(KP L0^\ | PL x S0` T  0S x0Q 0 0 x0@x @0` 0T 0Hp0 Ppt (0 d p,L ~| L ``0P vTQ   \  Zt0SHpxPf0 R HK \P]HPp Tt t   \ t R S0oT\atpgP\H0 Ht 7 KPJ00 0 0 \QZ  LK LPX x X \l (0h0 Z T\QpL L|  mx 0@00L) | ZQ+0 .R=| PtQ Hh00 \0 0 PB `0S ᜭ | 1T R0S8x H@ BK⒁7K ㎁p0 ,0d 0( xp pP BK }0SLxl00h 0( 00lxpP 0S | L}|  LN`\Xd x2p 0@P Q | Lp^x  0S\0d 0$0XQK |  RE X0`@T9 `X H `0Dd0PK pP'P $4L0@x0ps` 40  0x0s $,$8  0P$pP L@0S 0PL $ R RRRܲk|r)>@t@@P@ 0-P@QLqQ0h -LM@p0`SP40s0s0s (K0s(0sX0s\0s`0sP0sTq L0$  0R ePT!88S(-S0 0S00 00 z L0$ z0  ,0 s 0,0 0S =P0 S 0, S p 00S~ S  0P,0s L0$  0R P l0  0[P00S 0  ,0sp 0,00Z0_80sb 0800^\ 0TS0 0 S0 0s L0$ X 0S PQ00S 0 S0S000S0S0S0 0S0 0(KoS0 0S0dZx 0, S PsnL0$  !qvPTA0sMg00sz80sw<0st<0s00s -L M0,@KP4p`l0 004 0 0~ 0000S `K Pl S0hd240 S0 0L004 p 08@04 0Xp 0d0 $40 S,0DTS0P 8T04 d0(04d \0 00@\0`@ 000 Kd0S 0S`X H a0C$0"@(2"(@1<@00 !!   x0s@00!{ T0XV P0t ,0CT D0>\ 0^>S04 0S00 0\0Z10m -LM@ 0S4p00 0 <@00 !!  0 0@@Km -LXML T 0 SP 4 @0UP PS00X0 Pd0 0S P(KRX0L4c cb SUaQUs8` 4p L0P h d0 \@X`@ dPQ\P H dD u` X0@P0b# c8! S Q3P< @0   0V: X`d0 ` `6, P0K.QThPP80K0@0Ud D0jh@HD0cS0! d`PS0!\ lLS@1@!L P0PUCL0ST> @0Wd0X@Pp@ lP L l8B \AQU<&`d0 ` `6, P@K.QdT0@K @P,KP8 K0lPP`0K,08KPpPUX^OTL0$  JP 000EC -L^M < 0 ,0 |!  |Ax! S04`a  QKF}xx!h d  0S! 1  Z?K0@zaxA`1|q2` 8#8R1 dAT@ 0`! \1 @ x1\ |qh!d0baZ_K`>KPU`X@X\0d A ՞50pa `2 PV1Q 0t! p1 0 W p!l1 |V/KS?KROK@P KH1VKwP PH!D0X! cQ!L! 0S> PR `Z?Kp`p Q  ha dq t p! l! L!A0 P0S 0@ `pR Rh d t p ha dq l L!A0 P0S .xa\} |!ahAd0faZ_K`.K PU`XX\0d 50pa `2 PV1Q W p!zp!rx1^K`PX`x1ZK Aq 0x0g0|d PQڜ1 00e, 0R#(Kx0s  ` \ !0x p40 40Ȍ< \ p@0D @ 021KlPR KK w1K1[ 08$0(@K0 -LPMd dP dX 00L dT 4SH P Sv LX  LTd0@0 @T0ReTPa 0@0@TZPTX ,0KPSLTdD Z 0MJ TpǏ p X4 RHPd`0@X0@031@ a< QT>QD @PTA 0CL0PP\ ] PXPV X8 UA D8 0LT40l@Q  ,0T0\0(KY  LP\ *L T0d D 01 HDd0X0C03>\ 0C` @ < X8 9^ 0nSZn< ^ZRQVp l0 T 0\0 4 ^d0 ` RlLDd0S*d0b\ R X0P H` \0b@ 0l5 \ Qh0 |tTl0pP` P `5>VNP1V0hR3Q ʧ Ld0 0SXU H d0PpppŸ0 @L}z00Dp0t0|P`Sm |0s] HT\ dP`0iZ! /L d0Rp:LdP P00 LT 8\ Q,H0d 0S* 05L\0P00T \d H0XPRH 0Kd0 P&P\ 0,T0MQ0A0r@U];0s\0STT\ 2x0SH `0X| c51 a0 QV000 -QLMP P- K@K00,  P0S0H@K00, PQ0 Q=k=k -1L@T6 W@1 0pS0pQ*ڴ 0SP#00S PU R |`0S l0S Sh 0㲸 RW@0L0PH8p4ukak q+L8p -pL@` PP <@p ` 0 0 0e0$IH8p@ -pRL PP` U @W@1 wpWP`I@8 w0  0- L@p)PP@ A`@0S @Z:0S 0S 0s $0S0 $ \Vo -0R,(SLpP ` VA 6 ፦P @TZ,@(PY IP Z,(@Y 0-80LS@P0S  R00Q0 0008q P PP eHcH@@ p- L 0`S t0 PUPU 0S 0S_@ZdppH8p -0L@pTP) `0S8 XwPV 0R`@TV 0S -0@S S$.z.H8p0  0- L@`$;0pS,,6T|  6T <6T 6T( 6T 5T P5T <5T) g5T@ 5T- 5TL0P0MP 5T :0CT /t5T l5T d5T PT5T ^H5T ;T 45T0S i54T0P;0 44T 0T0P00 0CT0P04T 4T l4T \4T PP bPX4T 0T 0CT@0P00CTN 0Ty0Sv g80@SP m0CTw 0Tn 0CTc0P:0`3T# 0T 3TV PL 0 P0 0T0JiQ0PP 0 > i@ i;0P0S0<0.@(tP%H0P0!0PD00P0=0"0OS$,t2`LP 0S0P 0PP 0P00P0S0@0 QPH=0P0<0P00S i;0S1 0R 0R 00 P 0@S0P@@41 @P  1 0 P 4000T :00SP0T L0T P@0T <0T| P0lPP080kB @~fmB fB{BlB sB@f@oB@nB @wt@|B@vB fB@hB yB}BzBjB@xB@gBvtCC=kqB@pB -@L? D0S HQ\T0\0L \S0\0 -LMS00 Sp p@`0\P, 00  R400404 0@0 @ @`0 h0 封 ,00:0`S$P d 00S* P 0 0 $  (Ko(Ko -LMQ`/  P 0 PR@T% @T 00= 0 000 (pP Z4K P0 v<0S101@T(K4K Dt+ -LL̠Č.Č@!̌K M0(K.0 01K (@ 1[!0 !K -LM@ 0  $K1K$@ 1[!0 !K -LM@TPp8@ ' 080 @T 00= 000  0(l`P X4K T0   <0S80080 @T8(K4K T50  00- LQ@50PS00  0- L@70PS`  0R` X0 0rpX0: $0S71 $ PQE :0S QH p P!$00S":`V. 0  0`  < `0 @ 0  s+0$00 pP` #P0S[P S `0 0 0 0 o<@ Q-Lp`V Q CiQ Q `QE ?*00@ T"r 0iTP0 ;Dr17`q @P `P 0iT& 0Y#Y#  ]wP ` pw Q0 0Q Q000000` r 0 0i 0 -LCMq0  0 $ `1 @R` P62` P`$ 0R& K,IK J/K0_`P(p 0SPq(`D1(0@ R0#1K0@ (`:ܲk)>0@-00 \ PllP \@0 SP 000< 80P 000nS0 n00Q Q 00 84 004 <0-00 \ PllP \0 S P 00 000 048#0A S@-2*Qf 1@ 0S'<+<+l+l++|+$+$+0@S 2S K S 0S0S Q0A0@S. )ڀS S) `S 0S0 S 0S @S00Q00Q`S pS SS SS S0S:00:PSS 10 S R=k -LDM@dKP@pqT@D` @0S񟗾ꔔ++t+\+P+@+8+0+++++(++++++++++++++++++++++++++++d++++\+H++++++++̒+++++++++++|+++++|+++@++++8+ ++++++++++++++++++++x+++l++++++++d++++++++X++++++++P++++H+@+++8+++0+++++++++++++++++++++++++++++++++++++++++++0 W*W$ KF$0S; K W0܇0a2W 0\ :0S b0 bS \* 00a``000 0 0 K10D`0 K10D00WW 0P :0S b0lS P*0 01@0 WG*W$ K$0S 001@0P:01V{ 0P:01WgWj 0P:0Sc b0lS] \P010W:0 $("0P010z0S2 0< 8mP 01ff0S 010c][`Y01@S0P0 K10D`J0 K10DD`B@>0@-P@ R( 0S%\ ) \ ^ \@ 0 0\0 S 0  0S R 0 000@ 0 0  R P,  R/ 0\ 00 S 0  0S0S 0P@ 0S@@0  @0@ 0 0 0S00S0@ 0\@@  @0@- R 0S^ 0Sk0 0R 0SI0SD \  R0 0 \0S0  0S R( ^ 0Sm R 0S 0R 00 S00 S0 0S    R 0 000 0 \0S0  0SR 0S@0T 00 S @0  0 S 0R 00 S00 S0 0S    R R 0SP0U 00 S P0@  0 S@ y -`LV@3 ^=0S`PVPU p` 0S`` TPR 0T 0RU 00SW `PV p PU` 0S``P p P 0S0SP0SP0S  P 0S0SP0SP0S PQ00SQ00S,, 00S0000=kP8p R000  B P8p0 R0 =k=k -L$M@0Q0  &2 H00SH0<6  0RKH00CSH0ʴ6@ 8#8 & 6 2K4 K ܲki )> -L$M⠡0P(0 p8#(`HK908#83K6X @T@T 0S 0Sᩈ@Th00@T! V 6 8#8 #K&  ( 0R"$K0HK03Kx6 P u DP P Tܲki Qk)> 0-Lb`@PQ \0000  h00h0Q0h =k -L`AplH0PU ,0S @A@,PUh 8(p 0-L#,0P@T @T0hq =k 0P c l p-@LTP `P`@@T@p 0-@LPT P@@T0 p-@LT`P@P  R0T 0 PPP@p0@ 0@@P -L M<@KP`p clD1,` 0 P 0S@ 0S  @TKT00 ,B4Q =kT8p 0- PR0000 0@ L 6 P  0h0 -LpP@4D!`0hP 0pq@P 0S@0S`x@h]T8p=k 0- L0@SP 00  0@ 6 P  0h00S0 000000 p-`@P LP 0Rk ph<@@-Q 0P P P-@0 QH0 LD  p-0L@`T$@T kP 0 RP U 81 SPUppp=ki$ 0-H0L@PT $@T kP0000=k 0-<0L@PT@T 8kP0=k -1LM@ T$ P$@T kP0SP 00P$ 0R! K@`T SP4pK`k 8k ~P@T PEUw=kܲk)> -LMЀ 0R$0 $Q   Q$ 0R  K$@`T RP4pK`j Yk AP@T PEU:ܲk*> -L(MP R0P,0 1Q  R P 0 0S0CPR PQP P, 0R](KP0@l1ZS RLKO8  yjpW60cPU   P@$ 0X@p PEW U`0S <K ՙX @ Z UP0 0eP 0@ <K8j  㸙P PEZ @P ܲk=k*> -LMЀ0` V$ ! P0@T PPPU4pK@T PU `i j yP $ 0R K rܲkP8p=k*> p-$@LT`P@@T= 7jP R000(0 0 PP 0S R000 0 0 *00CS00$ R( (080(0 0$( pp=kP 0P0 0- LP,4 P@ @ j 40$    0$ (0@ 0=k -0LSPp $@T @T iP  `P"  P i@E0/Si09S@P 0@T$@T iP000@p 00  (00( `(=k 0-01L0M(Q@ T $@T [iPP @ T(@Kh0 (0K'K:@P <Pis@PD@K hh '@P <P<V`@P 0RK0E=kܲkx@>(*> 0-0P @L0 PP R,P,00 J0P000 B4P4000 - L@ R! !  110C0C11%g 10P RZ -LP`p@QT 0@SpW@0@Sp@0 0C@0 fH0T0H0P U p-L M8`KP@ Ah(P L PKp=k p-L`x l0P@T &0B8R#8 S61S@T0ph =kC 0-@LS P1@P ^&00h -LM6   ij+ -6@06L>&h0 hc 0-6P0L6y@T b@T1S kr&0h 10P  R! !  110C0C11Qf RZ p-L$M`00 0P@T@T 6 6l8!#8R KH< K@T  0RKpܲk=ki @*> -pL#W`P,PU) PU7 0SXQ 60@^)*0 0# 0 0#^ %gP Q  gP PUP^ Pp-L`P p@Q Q P @P 00 0@s@@ R 0R p脷+ -L`0pPUPU D1W6 @T@T 0 R0S fP@=k -LMX, > 1`V@ `V; D1, R@T@T 0SPU 0 pR*0 0# 0 0# WY  P P P㨑 =k -P0LS@  PP  $) 0P0ahG ꤭+CQ -0LSp 00C0 SP@ 00BR0 SQP@T`U 0S U0S; 0`V`V fP fP0gS"\ 00L0 S0gP ^0P@@00L\0 SL0!l/@!b00RPXP0S =kgfff p-L@`P PP  R 6p@u p-ppp p-LMK`e@PP lPP xPP_P 6 -LtMܫPU, `p@ ;U ;U^ ;0SK`P ;U{ ``, 0R(KD;UH 0UM 0;UF P` ;崖U D;U }P0CU0CU*0CU 0U 0CU \ 0@ 0`0 6 0#80S @H`P````9Uz &N0CUW 0CU 0Ug 0CU`` 少B`h06 F@T ~P9U5 @0CU 0U; 0CU1`` 0 9U :0CU  0U 0CU`PQP` ȕ`J8U] 0UI 70CUn}`P<1Sj  0`0 kH8US <8UV@1`` 0_ 8U 0CUJY`P"`P ` G7U x70S1?`PLPK 0K*`P 00 .t0`` 0)p0`` 0$p@$`P1S  p0`T C00 `P6  &q< 0 \&   00 `PQa PU^ 0S[0Xl0S S S `S S@ d0 d P`q00 `P{P+P3 @T#D1 R00  16@/ ] m} P0`D1O`PI8#( ht 0   h  (0B8h0 "00 jD1`` 0el *0`0 ]b?P` P `S L@K +d 0KX0`0 EF`P `P 6`PPK@ 0K!`PRO@ c@ c` `P0` t0j`P `` 61 -`@I8#(hK {6h<8#(r{@S6 n@262UX 5UT2UV 1UR1U@KR@ c@ r01hh[`AB@8#(.7h0@h`Vah# P!"h0@h`rVLhbO` |P{@P Y00 Q`+ܲki$ii$zi i$xi Jii i L*>i i i i$i i$~i ?qi i Fi@6i(Kii -hah!0L0S0T0P0@ PT 1S 1 RP< T &0S T$0@(0$@0Q!R<10 RUmT00PP  p<P !=b p d3=k=k=k@8(p@ -L@n000  0@^h=k -L@Z00S0 0000@hs=k p-1!S0#RL:6 h0 P0 00   h00h0ph0  p0h0 0 @0 l@冝\0@P `0S ph000 0@@0=k9p 9p p-QLU` @ 0(2phHp p-PL6!;6!1!1!`4T3   R 0x10  0 h  R0 H10  0 @T '1S 0 0@T$Q j$Q1@ @A,040@T 0 R 010,Q@T<0 !ph긱+؜++;ppr=k=k8(p=k -LM(2pSU8 am00S P, h0C00 0(,0  ,0(@`(000 0`Pm0 06U0l00@0a0 p@(B  @0PU0doꄷ+ -L M<@< 04 P*  Kh\k@T8p0+ -0LS@ S 0SQ 0S 0Sh< `PT 0S  t`P ꈷ> p-L4M`00 PP% @ P' P% 0 80@T P%00t 80@T(PP@ 0R KpJ K.0ㆍ0 ܲk=kx AAT*>HH-0#" A0: 0 A  AQ0A0A{k*>0@-PR@ 0 0!\!""0"!0*>@-pR` @P@@ 0 ,>#!^ """!1# d*>*>   -"LR@ \0700`"R p-@LT`P7 T T  n jp/p0S 0S0S @T  V Rp3000 00   00@p@T  l7d 3p@0^  0@000X B00 p=k=k=k=k -L M@*PK0pK `P5BT+@T(  K_P E_P00CS0 R07004` 20C2 ;_P2 0C2 `$K  -L M@pz*K0K` BPP*0[P$K00[ BT@T  ^P  ^P0007 @P!  ㎻ ⊻00 p2 S0"00/B 2 02^P202~4Pz7P -\ \:6S0d0\-P@1P0p040\0\ )q2i 1i i i -L@ᅊ02< D0C2" @00/00 2 tk 0-2L@@1pSl0 P@m 1l pnPc(0m  020L 0hX+ -PpL`ZD1W(0 68#(^ 0!  (0 ,^PP  4^P11<<88#8#8110 0@0@00@0@0@t04 !48#H) 1# 6 [ $3Td # TQ 3T00S 0Sj \i ]P i\㡙1 2T& 2Th㔙p2@P p0St HB@ D0RW@ 1 00Sa@`10`@  @ 6`xj1@P p0S? |A6tW|1@P p0SF i\A0S H1R0T4 Z ^`P   kpZH00H0\P0Spm000 0@@0,000 0@@0!cY000 0@@0=k9p5݆ 9prp;p -L Mp@AAP`2@ V[(KT# 4 PD  `X 4   PD @  3@0< 8 SD RXA@@@ R+ ++++++++++++++++++++++++++++++++ ( PP 804 0C@808-/@4K `@.K  Y@ 7^`P7@ P @ KXr 4K E㲁PQ; kf@PI 1 01@n 0.K =PA@a.K 0wP 1  6  ?@TG @P0D!P`1 4 O!1R-@10!Ra@`10a! !/00@ 0@ 0 0@0@? @ ҸA@Z7@@ 0]P@i 0 7@a1k@ʚ;Q0\0ᨁ0 Qp-LP`0CQ:pl0Q p%0CQL6@@06 V 00p0p0p2i i + -Lp`P LP 6AUp 4 20S00 0@0@0O   R R 8,bZ/Q`@ D0RH00H0RZ N7LQ`IZ40 3A0 3@ 1 00S၁@10@  @ 60P` @`0S HP`0@  0 OP`P`000 PP#,@rp9p 9p@ -00L @P 9p p- L`@PP(  084+0 p0&0 1!0 Tl0n m L 0p4@P p@+L+9p -@Lh=k- 0  \  \ 00SP \`0S S S 0S 21C 0>k p-` LPP0#U T u@R0000 0  Tpp -P`QppW@L hTf 1R' 1RP  0SZ0PS000000P 0S 0S 0S @P @P mP4   R01 Pp`PP`p \ P1P!p PU00@  01 PU@PP  @P0PP!$圉P5i 6i( -L@`p  PP 0` pP0  0,+@ 0-L @PP 0  T.*0P P 0 P+@$@ -pRL` @PPU@ -L  v0P *D+ 9p8@ p-`L@T P @T HaP ct  S@T phmp9p-0S  0 00Sp@- 0@PcUe\5*0   0`Q  ^ T 0SQ 0S p?R00S eQ 0SP 0S pr3p 0\à@-0@    @ @0 -P` Lp 0  0S0@Q :* 0 RQ /  \0R 000Q ^f 2 @ 0  @PP0S:  0   @ 0PP00 -pL0S`0S 0@T  0 0S@0SP U 0Pl P 0 -p L@`X0 TpP0@@ 0 0 @P<0 40\ 0, ,0 0$ $0p 0kk+++++ 0-0LS@P 0p 0P 00h0 -L M 0Pf"0 R (0Q0 R0S Kh1) 0P h0 l0d P*00PDP K,:)(8)X@9p8(p9p`@kkk9p@@ -LMⰒ`0P@@PRPU%U〢xx2 Ew erQk*0PSh 0RS BQ:`aU"0S`1 @q RL!``0@ 0  @@0S  WP@TX00S0 CP@ 0p ((1, K0j,0@S2\P P Q0g 100 0  dW 0 00`0 R 0g1000<Z(0LS9pkk@k9p+>@ -LM Pp`@ 0  @@0S  e WPqWP}V UV PU Rl Qi 0\0R- ( P pRx T 000Sp` 0 @ 0S@@0 @@ 00 0 00CS 000 ^)0S  \ R0S Q Q  0S'  P0S `V 0FS 0  P P 0Sv PU| P R 0S; 'Pn@ T0@S@@Q 0S,0S   0S@W `  pp0`V  `ppt0pS  W0@ 0 DT@ Q T00S 0S ` 00CS 0000R 0XX @2'H.'P080 $0,@|@@P@`@@9p -L M` @ 0  @@0SPU00  Q *0 R  0R  Q 0P(K0S@0"0S  0S Bf100U40 PPU  0U 04 RPU10,0 @PUl04QlPUe 0 pP 0\ P  S 0 0 0R !\0, 0S0!Xp1Z0 0  "00 p 0 0# ^P 0 R !P0  0R01p Wx0  "0  0 0#\c TP_P]k Q0-L@P0h&0 70P  @P00T00S00T P0 -LMP < @ 0`Q80 4` 0` 0<, K,0S@ Pp+ p@0pS @UP Q V Q 8CR nP  0R:TP T00S p0 S <0 00 0 V 4 ` 0 0 4000, @RW VR 0 0@SM@ @R8 00T00Sp@T( p@T" 0H(8CR0P ,0 SPf 0Ud P  0R:TTP( P6@P 00 00 00P@ (KP0UP08#x0S: R 0AS0AS R0 0QG80 4P4 ` 08#800 QS 0 00pSS0 S 00 0@U` Q 0 S R 8CR0SA 0 SJ PR 0S 00 0 {P@HP PEUp@O@ n@Q R#3p0pS' 0$g$ad P 00 0P000$ $9p@@@hP 0R Qn n0R@QPn0SQ * 0Sn0S Q1 \  -L@@PA- 2\ \@pQŸ2 00l0a6# a c$"cb!0b0a!6# a c("cb!0b0`# ` a` P%"^0a@0b@7#0lc! c a$"0a0b6#bc#! c a("0a0b#b`! ` a%"^0a@0b@7#0lc! c a$"0a0b6#bc#! c a("0a0b2#bc! c a"^0a 0` 7#0bc! c a$"0a0b6#bc#! c a("0a0b2#bc! c a%"0a0b'#Q0 |0x00b0l6# bc! c a&"0a0b"6#bc! c a""0a0b1#bc! c a'"ky7 p-L@L0`SP~P 5P0  hpk - LRp` <0S 40 P 40 0 R 0S 0 R 0S P@0H$H`UT0D@`fPUV00S@ PU P80080CkQk -@L pP `P 0 0 R RPPU 0 S 07: S cRP0 Q 0S R 0 S PUXn0nS f@T 0 00\ QP C@P Sn -Lp`@n00S +@P @V PW 0P 0 RQP @PP PP -nXLPpn@`F PZ 0SJ Vn 0@S``@@ 0S T  0R0S @T n`Q; WX00S 00P 0PPP R 0 0S/ 0S Q 0`0P0SPV``@00PP0 0RXp`P pGW0T@R"@ -@00L] R000 h肼0  p-@LTP` X0X aP P 0< a!0S00@@p7p@k@k9p0 9p - QLp@`0P& S 0S-` XpOU`  T.,,,,,,,,P,,L,,l,P,,x,`,,P-` PG @ P` @ B0 ` `r`!-` 0S* yGc`?c`W @T8`0 0 0` @^\*c` `P`9` 0S  0` @ --`1LM@0 T, ` 00 A p@T3  0 P!0R!R 0SP 0 PP P  PPW  0QP 0 cP Np@TW 0 cP N(KXXp9pʚ;0 R0%3 %'@k9pP (0 P0 Q@k9p 0-L@PP P0 A09p - L3,-00 R310 P0 @k9pt;p 0-L@P0P  00<0 R  R 2S@k -\L`pP@P 4 #P P%U0pS*@kx3, -< LR@ o00C0S 6 40 40 n040n040 -0L pR㐀` PP%U p@P P P #P4 #P 0`S*9p@kt, Ȱ-P2 S R 2 S,00CS,0 R0000 0 [@kp@-@` 0 PU1! \ *0 00\: Up lp@N 0-L@0"PP "N"0  0 CO0 -0LSP' @T=@T NP,00,0@Tp, "0R8@#xT0W0 &`P O,0T0r,0  @ 0``@00 ``p@kP -`pL PP# 0@T \ x0$ @TP0S 0Pl 0S 9p8(pt;p 0-h@LTP#h@T  R 0 0 0 R 000 0 0  0S0C0 Ch@T09p,@ -LM`hPP!00@ ,P 0`pXP`TpP`X 0S R 0 0 0 R 000 0 0  0S0C0&  P7 0 0O0 @`$Ph R0 0h 00  000(K1k 1k9pX@ P-L 0S 0C 0 h|@ -@PL) 80CQ840Q 0 x Q00C0B@PU Ը<hX 0 h9p:p@@@ 0-L MdP@TX0T( @b@0@@ 8,00K0]@k@9p9pkP-,@ -p0L @R  ¸P 0@ 00@ R 00@k9p -LLM`pK@PD`L< 00 \\0 X T   @0L0 H 4 0`c K -LTM0P,0 ppKt D L@lP 0P @P 0 @T ` 00` 0 0S DL  0lP ( tG,(K,@ 40 800800 S 8 ,0Kp`P ,@ 80080,P 40   z9p -LM,0 Q0A00S0C0`00`SP 0S0C000S9*  p@P9 @0 W  㻷`P 80S0C80$0`040,C RP` X00\ R \R\  0᳨ -Lp`P@T 0 R P@@P@!@P P 804 0C80 0 R @@T 0-80LS@P 4P 8 R 0800P 0SP 080P fP4P 8Q 844P30Q  R 004PPP 00 q4 -LDM8ǟPp, d @`P/`  000 0WN W W) 0`0 dƟ, 0`R(KZ P 40  @0NK R4 @040  <0804 ,(0 00 00 {,4X0`0 (  @P7`  00Y40 100h0n0Pp 7`   @PO tP  6PE @0  @P< 40 < 0`P 80S0C80ŀ0`0d R800C80 d JP(40@ 0R40 0S $Z000 ` @k80Sf080G` b` _` \  PP OP40740 0RX0 d P3,P  0 W0 0@ 0<09 n0 X0 0 PT a PE0S Z@8008040 J  |007 /P `P ص]` h @ 0Sj hHHh h80n 080n dX ڦ  P P P4040774040cTX GP\ 40 dP`P ㊵ ` 7P` 4X740 n0 X0 0 T \ 80S\0C809TQ`.@0S @J0@ 0<0 0 S h y 0h0 r o00C0S640040n04 < <4 n01ܲk:p9p+>@@ -\1LLMp @1X PU 0/ ` W X .p(KV R 0 0 0 R000 0 0 `V hg0S0C0Pl@KD^I0 0h $n  1k9p9p0@ -LHMpPU$  R 0 0 0 R000 0 0X  `V '0S0C0|hPU R000 匴 Kd@KDI0 0` $n ~9pX@ -2LxMP 0, T0 D  Q`pf @KDH0W0h0 唀 dP 0NK0  b?Yl 00  T0KHW`2 WV'T@T$ 80@ 0CR80 @0S @ @P 0<0 0 S   T0n,, 0RD(KP T@T 0 \80S0Z @GWV Y$0S! ?HP7` @  P800C80~ @0S{ PZ GY3`A`080ܲk@ +> -LPM`PKpDd HHd@ d0K\ T 0 X 40 n <`p@0 0Td 80SK080d -<0LS 4@P  # -40L d0S  - LR@ <0S 40  - LR@ <0S 40  -LXM p x `@Pt@ 3@& 0 t0 &30#P00S, 5 00 R' @PP 0t03 R00SI TU000!000pKDGxpK t0l hp d T (K GP,,@0T 9P,A@,P 0S 0S40 0A@P   040,  0P, `@pKD\G(0K#x`pK8 <@ l hp d @` @,PP 4`P0t039p9p9p P-LPP:0A ܲ`P0  ֲ@P㜲 ̀Pp  p !G  !Gひ~`@P0P  80P($0 0o9p@k9p -L M@ 0p%Fl0l Q  0S0 QPK@t;p:p8(p9p@0@-000 @ p-@PL,`FT*^1 @0 CS  @ Q00T0#Sp p-P`8LF00  00 @p -L Mp 4  , 4  R>` 0 Z0 PD 0`@PD 0 10 0BR0U ` PPF@ TXU00  S@6 ,0S3 00S 0.0S+ 0T0 S, ! 4  R R000 վR000 Z0 P P厱 㿱P 0 S@, 00PUP U 000004 @ (K 0E -LHMlKP DE1pWX6R pWR  R@T 0 X P[0S `V 0S?0X0 @T/ X6 0ST 0`0 0 L P;0`S P 0S  00$l0 0 uP 000@TT@ L@ `@ pW(K 6l0D1 0l0 0 tP0 00=k -L(MP@P`0AS`(KHK `ZE 0`T<0 H D 4 @ S pdP H0L 0CPS ?,?,@,?,?,D@QP@L``L0㢰<0@ X < : 400hS `300   `L@`U @%T R0P U`P  ``0h!$qBK K ,0K21C0b ?A1c09p@,|rgfff -LpMl0`S( @1 PKDD< 00 P0   @0|0 x 60p0 JK0d  `90pS PU 0S ( 0R!$K 404 H n0(0 080@0< 0帠 0 tP00000ܲk(+> -L M 0@0 SC,C,LC,C,`P,P @XCP00S?X/ , @@  XD,Pp @Z `Q 0 70 0BR0`0 FPP+p W@00P0, 0 0(KP,P C@P00S ; ;C1@BP@,P P@,P B 0-40L@0PP X 0xWP B8000a0h400400hL@kCgfff -L`R@pP TU B@@TS S *@C0 0 80@0T@S# S U *@eBmC0 0 000U 0S @0`v P@ @8`U 0S @000 -LM`@pTPQ T< T  0p $K < hQ@` h1S p@ KpP;h1 Q$180? Q 0001 0  V0@004 0 a `R \0p40 pU P Pd`00C0 00C 0㈮ (00C0000|rC,d;p@k --LM0 pR,0 \d2@TX P@T3 0 !0R1S R SP  BP P  BP` R5 0Q 02 0BSMI,I,I,I,I,I,U 0 `0aR  R  40040IA(K 0 VP pK;A8p240`U  0CP0  0 `0aR  R0 0 UP IKP8 r 0Rz 40040U0APok0Pk9pʚ; -p0L PRp`P @8V P B$$ $0 ph4d;p@k@k@k -LxMŸ Ÿ @ ,@ ^P@ `, 0Rp(KpPp YKDBYQ00S p|p 0 X  K t zP B &Y $00  0 0D! \00 S! T*  00 pNK 0 p Kh RP  &0 4 00n 0  0 0 0D! W@ < 0p0(( (0Y4d;pܲk@k@k@k<+> p-0L PRp`P @6l0D1 0h0,P0 $ $0 ph}d;p@k@k@k -LP ^@P @00 `p0Z 0尦,嶠T 0 @0 0mTd;p@k@k@k --LM␩P @ 0U, X0 T@ @  0SDPP 1 0S`V p㠬?, 0R(KQ+p_V V(p 㾬P7p  0?ȟh1P堀 0`0 `00V ]PTP`tc<P `/ph  `PK 0 `p\ KT0KpPT`80080 NK 000  d p 00 <Q 0 @0 60@0|0  |  0 K0P  㬫@P7p  ᓜn@  K0@w04 (0,@ n0H0 0(Y0 0R K T0KQpPT R} H ($T`800C80T n00 0T <060T 400P80080Q 0 0s03R0#SQp QKpPQ 0P ?Q   0PEpPa @P@ ^ 0S0 Z Pa @T @P P 0S @@@ 00 00 <0P 4 00 040H $(<060n   400@0S 0S p@T 3$0X 00X08 $n 0X0 L @P @P P R 4 0@P@T` n00T 80p080#P Q  "`V:pQ 0SS0Sܲk|r@kd;p@k@kL+>@ 0P 0CP>@t 0C!` @#2 40P 0CP$0PN=@ 0C! ̇ P P10"104 P PP10N  0\30S?000S \ -9LS@ 0CS9 06 9S06p@-@P`0#U@T$b0#PU0t0# ^# 0S0R  ^P0,0,P#p->P0L0Q00P0S>S  -R[, \,\,[, \,D\ 1 R,,> p-0 0 8LS@`) 8PS ], ],\,L],\,\,X],\,\,:0 00CS\,\,\,\,0:0p080p080p080p8S 000;08X 0\<0<0x8 8"R -41 \ Q+> Q-L QQ20@Sl^,t^,|^,^,^,^,\^,d^,7P"  P P nP P,$`0 lH @ Q-L QQZ$P> 6P? P? PG 0@*S`,_,8`,_,_,_,_,_,_,H`,_,_,_,_,_,_,_,_,_,_,P`,_,_,_,_,_,_,_,_,_,_,_,_,_,_,_,_,_,_,_,_,_,@`,HP 0P   `P lP`@ 7n@ -LHMDğ0~@P p`,0 . 0<K =p h h0S]h  h "-0S: 3"-B 0|8 Z ?0 "0Ql0 @l @0Sl0 P P 0 {|8 p<[\v;0[Sq< K0 R  P(K 0C< K0pQp <0[S%@<0[@S@B\+>/ R-L@`0T T 80H 84 v>0Q0bC @4@ -"-0LS1p`o Qo1_AP 00S   R` V0 00S  ; 00S 7 17 ^ V 00S  ^Q 1GT@# P 1'R! 1?0Q w1GrT@k4h i)(0`K \ ,>P@@ 0-8L P& 08#QQ B0S108# Q "-0S1 0P0Q@@P0+)00 @ D0 -X@LQS QN Q` Q`  V`"-0S6  (pP VK  ,z  P<, P PP<1 R P48 S8Ĩ4S UX %00Sx8<x8 J4``V"= Q2 RPx8<x8"-0S8X p ``PJ -@LKP+"R2 22 hL -LMp1 ֖2i 10#v e:"-0`0P0P U` O0S KP? 0 P8PT  U `\A"= R!  0 Rd  d 10b 00 R" ->2pN, Jg01f7 1f7 = S"-000 0S"-000 0S"-000 >S"-000U-fd@,Ak0tC@0 0000  0@-1 @T^* T(0T^  T00S 0 000008S  0S00 000S8 0C8 @0 R 00 0S0 :[0(0CR 0 8080 0̫|8.  0?/ 0 ? 0/? 0/? 0 2"@,d~,@P&o,o,o,o,o,o,o,o,o,o,o,o,o,o,o,o,o,o,o,o,o,o,o,o,o,o,o,o,o,o,o,  x8 01S^="!B10b>00 0 >= p-OLTP`@@T 0R! 8P V 8Pp -LdMP,!@0|  ,0 p` 8P.xK  U rKQ 8P&lK G LKC0XXL00 0C 0 x )0C| P, 0R(KxK  &@lK `ܲk`z,,u,@l-> -LM 04ab 8#8$0(S( p"hc S( 0R+$KV#NK Z0F898#8 HPK1 ߔ#NK 8Kڔ  0ܲk-> -LMP0a4ḑb8#8 0S, @!hc/ S, 0RW(KVpfN@H$H"00 G;8@D@H$hOK  !("(0V08#_ #<" a0b1p z   Br@ 000S0 LPK gOK <K b " 0> pb Aܲk-> -LM`V, @ p& 0PK0KJ`V0[ 0p0K t  o kK gV@@K. , 0R(Kܲk-> -LM`04 8 $#8(0"(S$ pP# S S $ 0R, KOK  QfOKw ,QOK 8PK Q ܲk-> -LMx0Q@4`KPp $0 嬓 H7 6$ 0PR Kܲk-> -LNMPPP$ `pVOK Y ! DPK  p$ 0R KVOK  P DPK j RAܲk@.> -LMO`TPp@@T 0S 6PP /008S  1>H 0P @P 0@0/@D ?@1.0o@ -LRM`V, h l p!  p2 K0!(KH@^K  `V$ 08 p#Hhl!0(K@ tp p  lYK hVL@Kc ὒ, 0R(K ܲk.> p-x8L`P@9 0K 0 9 ? 0R>:0 "#A10a>0 00CS/D},|,$},|,|,|,4},|,|,|,|,|,|,|,D},|,|,|,|,|,|,|,|,|,|,|,|,|,|,|,},0 0  0)S0 SCLR0S i4p1S^/phph phph  048# @(R"!B10b>0 0 0C-LS\~,4~,T~,4~,4~,4~,L~,4~,4~,4~,4~,4~,4~,4~,\~,4~,4~,4~,4~,4~,4~,4~,4~,4~,4~,4~,4~,4~,4~,4~,D~,4h7hJhz h -0L0C@S 4, ,(, , , ,, , , , , , , ,4, , , , , , , , , , , , , , , ,,h4 Q 00CS,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,h0 -OLT` @ RD0D0D0?@ D0H 4eOT^Ppu4W 21C! c. QpP@  _4W hX4 -LHM(0` ,0  00C  0@p$@`P 0h d0 hPK`0@p0 l@ ,p@#$0@`P H#H$8!,pp`\ \` : \  >0>,3l080S* @4PK  4 X K0 80VKW0K  PK JKXK N  BD@KH 3P  0`p唀@@, 0 R (K\@ >0>2ܲk,.> -L(M0p,0 @0 @00P K080 PNKO0K嵐  HKⱐ BK⭐ [ PK  B $1P 3PH 0 0 L0P 0 0 B0  `!4 0<@K040 "880 "4<0   4  " c 0 0  00 0@0@<, 0 R(K> 0>W26ܲk@.> -LP@00 0-LP B@P @0 0 -LXMBP h d0 ^, 0 WK` W0Kl p 0 SV K UK @ OK IK0 0S 0C KB0KApK{ 0 S 0 0S00000p 09K 8K90Kُd h"$d@0x WKlt0 |0 *|*X*4x[@ <2K.0K倠[h0[ lLXtYKXK1K/PK-0K$$h0pK9@KU3Y0 0 㯏 J40` ᘫYPK 0 0# 0Q`  ያ 0 0# 0Q  `}l00 ㆏l000h@p `ln, 0R(KAK s;pK}0 SG0V0K`^^XܲkT.> -LMF 0 ,0 P  0Rc0@0 @a  0SPP  0@0 @ 0@ $H,, #H8P`0@pL#D< P0 `0@D p4R  *082@P@ (  %0P0Lj\ 0T@K 0P S  b K @DKd@K @ DK @0@00t K6PK5@K˪0 0lS | 0 oڨx@ 儀@ | 0\ |  X< Pa 0| 0aUP!0Up`$@@U ( K L0Q 0#0, QY0#,0AڠTKT K≪x08#̠DK#8t K@x0 6K50K|U|eP |  @1Py 0jR 07 0R@ @ Y TKT KOPT0Ed@E 0TEP0#U 04@K|0 /TK B1PU0KP0A, 0Ra(K; 01P0 0. >0>80 $ 0S0 10PP ;01P0 000S 000010PP 0S: >0>0000 >0>// /@ >0>/ܲkl.> -LP@00 0-zLP ՜@P  @0 0 -LtM 0  ,0 00 0P   .P 0 R 0 @ 0S p,0 再P`0P`P`@P "4 <00 `3 00 "8 80 040PP "40  jLK0>.. >0>.nܲk.>G-p#00`400$M400 !0 0 0  Q0 @  "$""40  0 4,4 ! 0 0$ ""40  0 4,4!  0$ ""40  04 4! Ƞ,Ƞ0 0$ ""40  04 4! .0 $ ""40  0 4,4! X$Ѝ.>8G-#p0 Q0 B ("( 0!0##4 "0 "  0 4,4 !0 $ ""40  0 4,4! 0 $ ""40  04 4! Ƞ,Ƞ0 $ ""40  0 4,4!  0 $ ""40  04 4! Ƞ,Ƞ 0 $ ""40  04 4!. 040# 0'  040# 0'!h0 08#X 87 ("H0('08# )Ġ87_   `P@0 4#0#00.> -LMx8`p 8 rP쐟 0 3 `1C cR0堏?XU Ux85x8 0堏?O?,@:0,: 0 @oCh, 0-LM8@SP 88 R 1S00 08hn -L(M@p`QP,(,,؜,8K00S0,0K00S00,0KPPK0+0K)0K*0K)  0  g@ @T (K8K  ]2K Y8K  S2K O8K  I2K  E8K -L\M8Ft 0x p ,0 h l tT  0RkhT 0 @j h@00S  P` | |0@$$,0@H p#H80@ L#D<P`x0|@ 0@|D p4Rd ` *t0-@PX@ 1 t +P 0 BjR 0 X 0S X hT ЉX00@00l@!!R x@d0 `,X!8X8U.h"H l0x@El0⠐!1 0 0dP@K8#8  lcX T@0pdXGtTP@\  0@a0g T@! l0n\ dX\ p.P@ 0W 0pU` ,P`v jX RPP B;+1P  t\ @PK 0 * 0l *\ w80P[l04@K!T0X (,P^xdK0 l0 !!t0+, 0XRd(KE pt>0>!+| $X h00Sh000d`,XX.hE ;X~+1XP0 0pt>0>*X*X V+lxE⠐2pp>t0>*X* X 0S:t*X*p@>0>dKX *X t*X@ p@t>0>*ܲk.> -LP@00 0- LP@I㪗P 8S0 0 1!1!0 0 -L,MP T p L +0PH0  T )PH0 0 gR H 0S TH < < [00 @0@H#4<<_  0 03 00 "880 040 @ 40L !R^ \ P`0@0LPCoS 8@K9 @ LT< 0bY[H@0`pD @0 D@b 00gT@! @;D @   dL0Y@`p @D 0WpD  0VP+Pg PgY P P U`` P   P L0CoP"88 JL0 1; B*1PP P0H@0 7( P*P3 0 0 0PLP!0<T @ @0L} 0@P 0$$$$ P @  L0kH 0 0 0 T)H(KP T>0>)H~)0H0  ;H)H1HH P0 0PT>0>f) -L,MT pPP 0P,0 L T0` 0R<@K ; 9K7  LT Y*0PD0 T F(PD0 0 BjR vD 0S D  D0 @  fZTPITD@PH  0@a0h T@! L0H * dZH +P@ 0X 0Up `*Pp? jZ RPP`` B;J)1P  H P@@K 0 )(0L @0S"T(, 0DR,(K ;D&)D1D P0 0zPT>0>(D(D PT>0>T(D P T>0>(kܲk0> -LP@M00 - @LBwP  -L(MP `0P L ,0 0H0 z)PD P g'PDD 0 iR 0 D 0S P@D P /H0\ 3\H01D0, ,400<@K30  9K  HP0eZHD@`P @  0@a0fT@! @0@   dH0Z/P`@ 0V 0`Up )PpN iZ RPP  B;I(1P   Dp@ >&P%@@ 0 ##Ƞ#\0PH0D 0 0 0 P', 0DR3(K00 Ši(P 0p 0LP>0>'D'D ;D'D1D P0 01T@L P>0>u' Uܲk0> 0 S00RSS   -0/0RL ? @0#200   N000N "" N04\0Nx8 2S0S H> 0H>0S H> 0H> -LM8@S P0  0S00 ?$   0 p-LȐ@\P p|8  8S 0S >0 >p` '(P >0>p 0Q 00S:` BV  1R0x 0| 0 0  C B  R  0 00@0!0 8Sh@`10 h\( \(0d 0-LM@KP } 'P P P K0@K \f 'P00CSꤴ,,,,, ,0>0> 0-LM@KP E 'P 0S,,,,,,K0@K |- v'P0S,,,,,,, 0>0> -LM@pAP,0 P0 Y 0 0帡t:P)0 Yl:0 $("10Y_:`A8!#8S,0 P `A @~8# P, 1 PI0SF  Y@: 048#8! Y03:`C8 #X00 P `C@8#8P 1Y: 04Y1:0 $ 20Y :R0Y:/0{(00*0s0\ H>(0H> LW0\ H>(0H> J 0-\PL0@  0S0/00Q 0}0;00 - 0L S`0 $"!@21C0d!P2Sp 2S? Vt023S  Q o02 - 0LSp00 $("8k". bSf@5S 21C0bAP2S3Sbi 3SV ㈅ h5S @h5@P$0f T0@f@h㛑0h5 -@Lah荑A - 0LSP@ x>Ȑ 0\p`x> \  8S 6hV!48 #880@ - 0LSP@ t>Ȑ 0\p`t> \  8S 6h(!~48 #88@ -L,MPP 4>04>(K8S ^ 0$P 0  L } 8 p0Y40 `: 0Y:0D < H @ 0 S@`  S| `pY: 0Y*H>0H>H0S 0SD0H  p>0p>PL 804$@0<0H2 @0Q?q @Pl"000 2 R 3 x87x8 x87x81Q3#5y51 R\ x86x8 !000 o6 `1\XA@08 #8<8R8 S808`>0`>UH` 2SD` | SyRH>0H>s+@K ᇁ $PhPf0Sc0< S < ]< R ZP D 000t0x86x80D < H @ LdBt3AD@0> -LM@PP 8S p 0 `P:0P:0S` 1:2S P*V 0SX 0 SS : R X>0X>H>0H>;^$P0Sx88S 0 0  000P  pwPPPP p-`LQP@ P   ΀p 0@S 㢏 p -LXMȐp\x |0  (K8S @P0"0S '#Pd>0d> t 0QX0 PP "P 00`\ \0 VT  0X5:l d p h ` SpP  SlP 0P`X-: 0X%:00SdP  2ShP  SRH>0H>+@K ] #P0` S ` l d p h ` H>0H>l0S 0SpP 0 S: R X>0X>|;~#PPx(0BS @P# P 0h>0h>aR8 tX 48#hl> 0l>00x0\ xHPl h0xpx86x0= d0S ?` R ?E(Bx 0 :G P 0xdL KaPx0d04[SC +x0K x S D"x0<0| P0T x 0|0 c 8xp p \ ,L K"Px00`0\ 0xx0 x7p>0p>nȗH0  4[S *d@0 <0Q)[A?0@#[ #[  0@S  ^ H!80Sx8 ^( Q& x ]aP7H @0xRR0 00#[A? !!20[0P0C0S20K}  x@PPg20[.0> -LM `QpP@! \>(0R\> KČ Ƞ,Ƞ508 B#8  8  -LlM #R0 (K8 p !0&`0 " $PT #0P0 oX :% 0X\ %p:\0x0 t0 ` |0 p0 l0 h0 d0 X0 0 S pP  S xP  5|P 5:S P`X: p0X*H>0H>xQ 0S| R 0p S`1'R!L>0L> 8S `\ QP>0P>`010 / @ |0PP `P TP(48R# 3  p0S  :HT 0S :Q ;@ :0!|  G~ 'C~0@ 0  -8~?0$0#ḃp0X tt0x @8S  UR9 2S6  0R ` a0S hP ] *SYR 0X0 T2S tP P SMRH>0H>G+@K D} ;!P<0S dP 8 R5S30lSl -|8 WO x t ` | p l h d X '8S x8 hQ ?Ud R ?600`8SP8SMt0XS ,1 R x86x88X t 30( ; 0 Q(5I13lP:  }6 >`P Px86x8 L K P00d]PH00@  <008 A?![ L KPh@ 0> -LMpW( F`(K(0S(  Q 0  0@`W1(PU e @P,  PfjU; 1P (0S 000C `b 0r@P  2P ((  -LM`x, P 2S  `2R >0>o(0 0 @R0@ pXE L0P0W0S5x8 1R2  o 1R 0@*@P 8SX pQ$ k`*P2 1 0 1  Z, ox* 0 pP+ 1<1!1R*@10!Rq@p10q! !X 0 0@0@ /00@0@½0 0 @0@}bꈎʚ; -@LH 04"48#hV1ھ 0R p PP # 1g)@ 0S"@P0>00>0S0S | `F0>00>mꪪ -LM` 0PSp :@00S d,,,,"PP0>00>#2K 01R0S= 0F0f8#8 $#$"K  {00 fPP  $K2K  {,K  {2K2K  {,K {2K  {,K {0SFKꪪ 0-@L@P000h蓿 -LM`p!28#8N8 ,0 @P0L(K2?=Q 0, S PU @0 0@0@e`00 S0 00#  P00  P4 U 86` 000 @4`b`@P 0S00R0@P(o, 0? ޟ `  -LMP p@@T0 T*   P 0 $a8Pp@& 80|  `P@R X 0P(K(Ko豉8S8S 2>3>t@x, -LMhpV80  PU >0 > X P  s(Ko@>0> < 0R40  ;U >5, %02 >5:0S@@TP0P  40 S00P 0 <0S 8S! 1T0#28#0"=00 40.  0S>0> 8S 80 0 08 hVa < 40R  <\l \KR>0>F8S>0> 8 S@ 6  TT T 6P  1}@ 80(Ko08S `' eP:8 SF l50SU0  0 >0 >0 0@X0@F(K|8  8S0 u0S u 0008S+H, ,,H,,,,R >0>R8S ' P >0>R8S `' P8 00# `0`S x8 ( 3 "0@. $>0$>8>08> P P  x8O 0@K0@(>0(>v  P,>0,>m P  22 "% ,0 (Ko\TPT4>04>00@  POu0SDu04"0C0 0S 0 BQ.0S*@0!0 8S@10 \( \(0S 80 6 X 0U 1 XP>0>O K 1 0Rx |   00C00 3 2C 0%R &80  0 2P) ,0 (Ko $P 8 00+ @R P 00 0QPd=k -  jLMp 8#800  bY>*"*RX,  P`YNh20\`, 0 h%020/,000bV0 0j0Y.0 h 0R 0, jY΁h "0h00 0 0h*2 0R j  Y.000C:0(K -`rCLM gŞ8\P# &80 00  A?   - 00c:#: Sʲ00h:#: S>0>@gV @< 00h:#: S  0$KmI -0` L p' ^$ 048#N  10^:0BPU @ 04 #2$8#8"&0EPU@ 04#28 #8hy -LMآ@` p2 0 S/0  9280  $"" c("(P54  S0  m x8  A?   %80 040 2(K!0S81  &8 480 c1 Q051Մ5Y8  C PbV>V. 00H $H p,0 傾0D8S0Y^@0Ł04 0C0- :0(40 0 QPh @@3S  P(8  0b0 %,Ŀ0V 彿0 A?   x 04 0b:#: S40 (KoW@0Q5šh%8hEv<''<- 0S00\ \0S0S *'SS-P\2 ڰ\- ʀ\# \ |>0|> \ 0\ @\n\ \\ \0c/0T -LM, 28 40 cV> 0@p,  Ƞ,0 %- 0 0cʠ,ʠ \Nʲ 0j:#: S; 0bY.:#:SXP`YNh20\`  0 h%020/,000bV0804PeY.00c08#8:#: cp!  ʠ0Რ,ʠ840aYN0h00" R 0 0@0@,(Ko4, "00  h50P00 h5" Q 0  F84 bY΁h "0p0 00 0h* 2 Q804P e  Y.000C:0(K 0-P@L !u 'u0:0; >B0 [0C\8%#53c0t0d D0u & 64 0&,0 l (p08t (780dfh -`PpL! @u' u:0 0;p1p0 0\4[BCR8-S0T 3535t0c0u x0d 0p 6 h0&06(l 8p0(0t ȗ x0Px00x08Sx00x0dfh -LM⤟?\, p #?\ =x?\ l?\0 `?\%x85`0& 00\ ]>\) >\ >\  0᡹`, 0R(K>\z x>\ 0\J >\|8@ p>`㳀ᴁ`>\1 ET>\ L>\ D>\>h`P >PX  P1'R!| 1?008X98S8SK 8p R 4`=\ 0\ =\H=h؉`P80 ZT=\| L=\E D=\<h`P> RV |8: x8 ;4`x8{<\ <\ <\l+gG`k<\ <\ <\\M@K! 8S#49 LKM0K`t! IG`MD< @R`pF`D;hu`P>xȘ  0S774`4`x8x82t;hc`P,@ Px8;x88S 8Six8   ' mP4`:hA`P |8 0Sx8 <4`x8x8@<000=^00p0S l:h!`P0SS0`021Cc  F`PpW@P`x8 :0 0?00? 000?00?000?000?000?S S S S00 0?00?000?0`0`  F`8S' s`x8`900zx8`#500.00q8S48SX`e@8h喈`P_8S\ 6A0AS2`Wp( 8 p( Sp(  88 20C$(ɯ`=7hn`P7MK! E`P1M0[ SN@ M [4)LK0s4`!. 0`7hJ`P|8@ 208S74``6h8`P8!S x84`20x8|6h%`P0S x85x8  r4`06h`P|8 W 0Sx864`x85h`P]@P 8T` 8S SX S` 0d5h߇`P+`8xS >`15ḣ`P8SK @% PF PX x0 `~(R  x8KU   r`qn4\) 0\cPP@P 0{S`̠K|P 000P@PS 0|PSO:|`E  | ?E`P BP  `98pLK:0; M0KC@0>i| .x8 ;4`x8'8(s0\ 8S80\  @-@[ \0 H \00S \0\ ^L1>R- H01 110 #0  101$ 0-XL@ % Rx 0| 0 0  C B  R 0 00@0!0 8S@10 \( \( 10xQ RZ0  0,0@-P@ R( 0S%\ ) \ ^ \@ 0 0\0 S 0  0S R 0 000@ 0 0  R P,  R/ 0\ 00 S 0  0S0S 0P@ 0S@@0  @0@ 0 0 0S00S0@ 0\@@  @0@- R 0S^ 0Sk0 0R 0SI0SD \  R0 0 \0S0  0S R( ^ 0Sm R 0S 0R 00 S00 S0 0S    R 0 000 0 \0S0  0SR 0S@0T 00 S @0  0 S 0R 00 S00 S0 0S    R R 0SP0U 00 S P0@  0 S@ y -`LV@3 ^=0S`PVPU p` 0S`` TPR 0T 0RU 00SW `PV p PU` 0S``P p P 0S0SP0SP0S  P 0S0SP0SP0S PQ00SQ00S!!  p-@LTP `P`@@T@p 0-@LPT P@@T0 p-@LT`P@P  R0T 0 PPP@p0@ 0@@P 0-HLPT ! P@@T0 -@zL WnȔ\ 0p Rv>0p0 -&L @ 0S 00P@1> 0-3L P@ 00C8#8S0 p0 d 00C8#8S0x8|(6 x87x80|8 8S ! 0-3PL@ 008#8S0 Pd(0R00x86x83 x87x80( 0000|8 ! - 0`00 0C00 Lp  | 00C8#8S0 X@P0PA?0000RP^/! 0-8LSP@B еε0 ȕ0)R002! !!80C8 R  Rx |   000C0C00y 10xP RZ•\ ,0  0d@ p-LP`h%R @0@S Qh% T|0h50`V0Pp 0-8LSP@h1 RR u0SV 0S 4x8Dt1 RR h1  C2S 40 9S  "101000 Rx |   000C0C00 10xP RZ•\ 0  x8 >C80~<0  B u[d@ -tLP@ {0t1 -L@h{ -0P00p00 0`@ \1`A00|L C ;0SS0 hu K wl0<0hi -1LMQp +\1`V>X!^7 9 S02 @")("(0 Pȗ1 2 10S'  2S 00 08x(0C1200 0mmh d -PL@ p[` \[ kV @[0S  k[00[0 mB <> a0<>[@ -@L`Pᅰp@P @Phί -LMhP08ph@PJ 8S9S7 Ჯ00 0Mb>J0>X@, |W(8R/0V 0S`Q  q30 8S 6Q !⌮8 &0W0"! 8 S 8  oaW 8S S 8;SR 8S S P 8S S 8S 8;S@@ -(8LR@`(8R p-PLȯN`@q2PQ phGp -LQ@ 08Py40Py $ ! h$ -LPp`d@P ㈯p0S  0S 3 #0S R@ծ:0S  -LpPm`j@@D@T8S h蹮 0-LPr@P <0p0O000妮 0d #=CH00+D@ p-@LP! j02 8  PD娱 <⤱'`808phwD-t- p-L@`1PPT>0T>   ''Tj8p p p p-L@`PPT>0T>  p 0-@PL|#-4j0t1tP ]0hF0#  :y p-08D!D1L@(88!81(8 (1Q( 1@(0 1Q0`0 >ByPP# |8 p0`B y0P0P2    p h  phXXPLDP--h--(Ak($P--,-,-d@\1>@ 0-H/0L000000/0P  x8 00000S /000000001|(  A? ` 00000000 P  Szi 0<0 p-L`pPp1GT@X)1@$R@ p0R@8SFF x(x10S: :  4)@R :0RE @x 7$ /0/0@@ @@)@@0SS S S@@/0A? @@ 1 S@@|8   P@@p @@@@@ 0'  P Pxx @;G P@ -LM\0p-4K , 80 h4PK`Y @'0' <0 $ P/ T [P , 0Ra(KX@8KrP*x80x8  [@TN 8KcP/08 48KUP T1@!P@T P08PB<峫8@ 9  0`3!⦫ -'➫8 %<嘫 !⓫xXh @ P\V8KP <倫8 4ܲkt3A@@@@L@`@d@@1>,@ -6LP@hx80x8p@s [4h1N08 !'p,h (h8Sx8 m'00'049 :0@;h @@- >0303x8 03x8  İ    s6/A ?0/ ?0/@!|8  00x800N@p }v =(:00:, + 4J6 |8  0r00 |8cq  gN@0> F >t<!0x,|<6 p@ -L$M␃6 p$  x8tt# l8.t8^Sx8P0x88@S~ P`GS08>U@ S8PSPV 0RU`@V(  Hp2x8 0108(R7   /8Sx8  49S&^Pp(0S  ⪢0p80Cp8⣢t80t8b$ 0RV K p8  DK `P p 0KQp$@U|0@$@E`P\  7 S1 0K $0RS1\ s}6\ 1' R! P:図ܲk@@@,1> -8v^p`LpP`Vo`/1G*T@ x8 0  8p RhQG8 p` -L@ h! p-LP `w@P =0S8;S08P@P ph -p(L@'8 Sx8>00p(.x8>6 . x8XX  P8(0(00 (00t8hk@@@ -0( @RppTLP`> T3 T 00SX 㡪 p@tPU. 㕪0000PS S R  ' PJRM 00S$0-0/-0-0-W 0S008SX EPPX X 'e[[ e082S  R RR 'p34 P'p3|S1>=k -8LS`p 0 X000m@PbU8SS@@PP [[ CeH2S  Q0׈8SP 0.RP P PP 0.R 0.R 0.R 2> R% 0S 0 $(, <4!4"<#Q#:Q@Q`Q Q0 0@S QQQ8S S x p0  08#Ƞ;8#Ƞ,40x00S 000C0@- 0000t 0l 2@ 0 0220 0 " 0\#40@~1>*00 40 x R 0   .0 0.0C 0@-800p30C0"\"h"D@P` 0-|8L P@+  0 0S$0 R  s> 0S%@0!0 |0SxP@P10|P @0u0S 0 0S0 R40  0000d p--0P` 0 @ 0 #4AL0  c\\  0#40 ", 0#80 "$ 0A-000p<>8 0-20P0 @P@D@L c0 p-$1L R> 0C0S0S2Q` R 0S0qS R0Pf  00 0 00@0@0SX0 R00H0@ }cp`0` (40,$ 0-0P0@PT@#@L ac0 0-0@0@ LPTc0 p-8L`#X@P   ;0 B 0P1 :cp -(Lp"hPP @  K0 B  0` c  c -(L"HkP  0 0 K -(L"HYP  0 0 K -LhHGPP&$x 0 $L&  p@帀 -LMSPp" +@Kp b0 0  b00CS=-;-=-;-;-;-<-;-;-;-;-;-;-;-;-.@K b@00P@ `6?J&40`P0`T]Z&40`|&40`A  04"#400<00Pa|8 R(K00P @`  bb00@`  Wb00 (@"h  Jb08#h&4  0`@0P`  8b00`P  -b08  #hP00P00P{ b? S0C0P 0 0S  bP b08  #hPw a00 (P"hiz1>w1>@@ -"0L@M+pK0`P 8a a00  0d0C0t1> 0-00@0PL00C0d0C00 p-@ TL`PP T000p; .1ph;@ p-0L` P@P 00P  0#40 b p -L hP @P&x 0 .0"(0CT0;8#("4@& 0p 00b0 0 -L h@ PP&x 0!0 &W(0C0"hpp 8# #80   00b0 0A Y.038# #80% 5C40 -0L `LpP( @Q" e0 f0!0C0 03008##80’2 C40  0#40 b -R0 R S * S *SNȠN4 Ƞ,Ƞ0  @0!0 7Sȧ@10̧(0 6($K8S  PR 0"A笠p` pPt0 80d 'V 6 @0 @   P f2>3>$@@ -LM@ P 0iSS2 0 S@P>0>! 6K  =] pP>0> x8! 2S3"[R>0> T4W ]00@(K00StT-S-T-S-08x(I0@0 P0`U  ```"[  @P>0> @0PS00`7 < "!0< S2 08# < 21C0b10"R`08#< 0<<0021  ,2  "[2R P < @ 1 "!8S}T-T-Q-T-Q-Q-T-ptP&pPM 08puP00  \' \0K \x8  1  0@008S pT00' l\0K  h\  d\00  ]\0K  Y\' T\ P0@0p+x000OWa8 >0> ꈎfP@ -`LAAP@Pp Q22P PS 0iSSOpW0 |8  0S 㲁ḠQ k PP 1 018P!1R1@10!PRA@@10A! !/00@ 0@ 0 0@0@6  ԟ 0m7P@ -LMpQ@P ^000嵟@UG ڰUJ PU| Ug >P0>U  U 0U("(`P U9 UH( 0`P> P0>U `P 0 {PPXE`PH((8"(#8Y`P 8S ("(;`P 6 !`0 8x("(`P 6 !M0 80`P @@@ -LM8SS, 2p1S5  0@,Hp` 0@P DP`  0@  #Dp0>$K, h1S* 048#8 (0 >0>,0 8 P8  0@,Hp` 0@  PD`p 0@P #D p<P`0@!(#Lp4,0 (@hl! ,@0p1 8 R 1S>P0>F E0@$@Ap`D0@#D <P`C B0@!(#Lp4  $KkP -LM8SS0S (K  0@pH,` P0@00 ,@ 0PK` 0@  D` 0@ P #D p< P`0@!(#Lp\!4pR >0>`1SZP>0>J0   00C8#8S0 \ 00006 ! ,80 0@@ -L,M8S8 $K  0@,Hp` 0@P D0P`  p 0@ L#D(0>8 \1S*80 H P>H0>8@ H vP4 H(  04Sa b04S 044.J@"!Bb>00.D 00 , D dI8 ,@0h9l@H0l9F E0@$@4`D0@Ap#DPC 4 p0> 048#8 H0 L0 QPa b0cP4epX:d d`0X8 %< % *0PpX`*: 0X&:0SR+@K CX P0S0>x\1S:<Qq L I<04  0Rh00X @0 X` dIL0lh900l9F E0@$@`D0@ApPLC #Dp<P`(B0@!(X D#Lp4  tx)40p9<@4 W L@ PD 8PUh 0S 00L 0  0 $("H0D8S21Cqpc>00 00 ? dIL`1l h9  8` 0@$P`D`P \` @P``0K8P 0@D@8#D<P`  D  0@D@!( #L4P`  p)8` |pcW L0 PH  8SBL|200S|2;  0@p,H`P 0@pDP0  p` @P h@ dP ,hP$$0@`P H#H$8!,pL`@0\1`A& d0 L,uaL 02 ' !-$8 02>0@@ -LM8`SSP0S K/pP>0>1 S p ^O y| V P' 0008S|200S|2 6 0S00Khp02!Ι L80@Qp 0Kha<@@ -LMhJ 8S, DJ, 0R(Kd1S8  0@,Hp` 0@PD0P`p  0@ L#D <P`0@(!(D#L`!p4Rp: >0>\1S*<9   @C P0΃! lPKK1> P p@kP  @>0>@ V48#8Z0 P a b0cP4epX:d d`0X: S 0PpX+: `0X&:00S0S^ PP Ro@K U *P0SP  S7 P xQD R 0S>  Q 1S `@2 tQ  0R  00 0    P^  K/P 0S  0S8[S ? !  0@p,H`P 0@pDP0  `p 0@ L#D <P`0@(!(D#Lp4 0\`!d1& l \ş8T 0 PPk _  04S#  | P r@K "U kP0S0SP @@T@T@ PP K0Sp F E0@$@Ap`D0@ P #D<P`C B0@!(#Lp4p^O 1q匁|1PQ T  Px3#  `VX  0R@@"!Bb>00 0 R dI0l)h900l9F E0@$@`D0@ApPL #D<P`C B0@(!(pD#L4 tx) p)0@ wT  P@PU\ `0S90 $("H0D8S021Cqpc>00 0 dI1l h9  0@`$P`P ` @P`0KP 0@L#D<P`  0@(!(D #L4P`  p)` |pT  P@h 000  L0  Q|200S|2r02lܲk2>@2><@@2> -LPMtPPP, `@p00CS, 0R2(K!00 0CτlK1.KPV`P>0>00`@ StQ 0 R 00 0m`呠 P6y ᴖ$8 07ܲk\2><@@ -LM P` 0@lHP 0@p PD0p ` 0@ P`80 4@ 4`L8!D<`P0@ H#H$8p!,\1S  >0>(K`1Sa b0cP4epY;:d d`0Y40% -LdMTCt 8S, x 0C, 0R(Kd1Sna b0cP4epY:d d`0Y# *0PpY: `0Y:0SRo@K R P0S0PpY*X 0Sx0SSjX  txP x KoRx@!t0x l`KPP t6Etx 0  0@,Hp` 0@PD`0  Pp 0@ L#D(0>Ox t0Ko  2RRt L80 <xx \1S>:ܲk2><@@x2> -P0o0@0@pL0P 0 0@0@WM i0bS 0bSB0S>0>0SA SC  048#80\a0b $("(c Q00\0S 048#H 0B8S0SS#R 0Q' 4'  4 8  czpP>0>0S0S1S 0SRapP   0S   f~  z v r n -"0LM'`K0p?0P0@ YQ UQ 00 0C 0 "40040 "880 "4<0 !D  4Q2> -"0LM@'pK070P0 `0Q Q00  Q2> -"0pLM0 0'PK00`@ \P P00 @  1S0000 P 2> p-@ TL`8PP T0 00p; W1phdD@ -L`p P PZ @2 01P! PP0  00S00 00$(SS"(08#( 1S{ 0S08#(u "40 0@ C Cq0CB#4Ac B a0b  4*7Q: k)PPM /00@ 0@J m0S10#$ @ ⊻0S  0 48#800 0 7 dQ!1R@10!PR㬁@10ఁ! !/7P10108#(ꈎ M-LM0, 8 #X40 0@ P( Z c @ ;8#(@#< 0 ,o1 0l!"8 0l!"4 0l lk14 0h!l"880h!l"4<0h! Z? 0@h1lA,@&,( ?$Kk400$D<@ #\#pT l#4<[@<8@ FEpDPCB040[A0!ʒ8 Q $Kd@ -LM` pPL Pc ,c1 0`!"8 0`!"4 0` `_14 0\!`"880\!`"4<0\!!D 0S0 c 0 6 ?$Km!~ \80P 0#40  002<8#(#< $K0@@ -L M0 0S` 02="!Bbo0喎Sp 0 00  0 2P,  ,0Pc W?0 @\1`A$< 0`!c@"8 0`!"4 0` `_14 0\!`"880\!`"4<0\! 0S\  10, "4F0E04D0 "88C0 "4"!Bb >S1 :!ő8 0H@ 0@ [(K 0#40  N0 02N=8Q#(@08#(#0@@ -LMP pP> `c c1 0`!"8 0`!"4 0` `_14 0\!`"880\!`"4<0\!!D 0S c0  0 0& ? Kih!R @804 KJ@40<@@ -LM0 0S` 0pu0S^ S0 0S0    P l Pc 1CS brMW?0 @\1`A$< 0`!"8 0`!"4 0` `_14 0\!`"880\!`"4<0\!!D  < 00cS3 (0e)$ 0 0&  ?(Ko"!B10b>0!Ð8 0F@ 0@Y(K( r "4F0E0 4D0 "88C0 "4S  21C! c.  PPP^08S S S o0SoDo0S - L@ R' '  880C0C88 10P RZ 10P  R(  (  \8\80C0C\8\8 RZ -LM8  8s8pȰ 4 8 ? 00 [`p, ZVr Vo P\X00@  X0T @ V 80( 0, 0T , F \X 0P;  0T5 \08 8S= 00 S0 0F0Z[0[`٥ Y00[` 0 V0A 0Z\04 0R00 R0S, 0r0300 (K\ Q 0S\P0P  P\@ 5S40040 0 p- Q` `VLP0 0C0^S@0 0C0^S@Tt咾T`PP\䊾UDph腾V 8偾V@@$zTp@@s@@ -LMX ȠU@p.h, :U 8VS/ >0>8VSx8(Z4 6D8S808`>0`>8VS8S< 000 608  Ȑ000(8d^/  !ȗ \080iۋ 08ta P9pP  ''H0 0  8p p MpP,@@@@ -LM@480 0PpX 3S  21C0d1 0"i謐 3S  cR@eV @h5S @h5@Pe0e T0@e@h+W0h5 -LMP@`V>04 @c4p  ' 0h<ꫪ -LMP@`׌ 0pS0C 0 S h'?( 0c  ' 0x꣋. -p21C0g1@LMĒ o?X t0` %X 2X0/:0O00 Pᦐp  8Q- 0-LMT0@+;:0?"  7P 8hf p-@LPf2`0S2,0,  * ph貋 -=pS  21CA@cPL` +di8 l)h 孱 L@p |8  >S  21CA@c PP  dY8 L@0h l9p0   hzP- 0-LP@V 0h p-8LS@` p0S8P000P 000p 000p -LM8@Sx8 8S `P XU0S 2P wpP 0 p KFS F 0<0hp@-P \S`0/ S0, S(p$ 00S 100 0P@J0Q@0SA PLZpV \0R*@p0 - @0 0000 L 0\ TEP0PL @0Ba$!B30b0@/LP T耖C5010   [0 R!0S S01000 % !!00 p-0`00@L@LPP 0S S 0 [0Q *0 QR 20a0#20p -RL pP@pPT @t&  P E` -LM4@ ,Kt 0@ @ PK|-(3> -L M0@ (KJ 0 @PKp-:>D  tQ 0 S"0!B (3>-<JQ !0 S0:>0@-@ !X 0lS  1\0}>EN-E8 BS(00"S: 2 1C00 2 1C008>GD  tQ 0 S"0!B (3>C@ P0 \l@ p-`PL @HSTP4M@T(phH FPphA@ -LM$@ , D P6  p  D1@(0@ :KkD0P2K`00 P`4K\D  XD@ TDD PD0 < K;0K1<1< K 0, 0R(K ,ܲk=kD=> -LXM4PK`p@ @T@0 40K0` BK3K姚PP 408 0B S800 RD W$KQ x@KD  0 t0 0 p 0l n ՛ p-PL 0`P t0@T@T D1S1 00  Pppp=k 0-LHM@T$ 80S0Q 0S XPKD R 0T0  L <0n SD0兛K0   400404@ -0LTM0p,0 `04"48#88#( BRp0  , 0R(K 0h TK d0 qCPKd mCP TQH 0 R<0@\ ` \ <@ X@ P 0X0SG PPSF X T@(R@@0 PG YD 0PUA  R<0S L@KPK 0`l@4Ak1k;p,@@0 $!$("( BRW- ^ 04"48S 0 000^: 04"48#8 S  S p-4aLx 1@T0 R*phȅ\.  @00C@0待 0SP 04"48S 0 000Q: 04"48#8 S  S]@P@00C@0叅P@P;p p-L@&p0`2`0P 0PP0 <0R UphfQ0Ak;p1k -@? L0 <0 (- -LM , pPh   ^00 000  00(, 0R(KQ: D`V WVE P00 T0S 66RcPBʬ2 R? BP; Q 0 SA 00C00S0 000( D1`Pp< K0r A @ 00C0 P000PT B 40040 RT LP\5 P0T@<1 P"40 0400PO PT 0P0  00C0 P000XrSpl@0  ?KI Ra 0f@?< K04 ʹA$Jܲk1k;p(C<@=k -L4ßp0PS0D`0 32 D   c4 U' U U  0@0S 0s,4     00< 0S$ DmxV 0"00C0Q00 40D;40 P Q 00C0 PmN0S<0Vl  <060 NPDQ hl0 0 0 p40L;40 R0<0PUPU 0 R 0< Q0@P0T@  0<?0@ R0 < Pm l 00 0@P< D1p y< 0l000< & P0T@<m@ 000k

((K000 0c0 0&@T 00S1#0`AqpV `V 0 R4S  p3R Q$00CS-----000l000& 0SB 000[000& 0S0R 0S QQ 0 R(0 0P P 0 R 0RP| ( 000$0Sy s:Sq0$0n0R 0S QQ 0 R(0 0PW PT 0 R 0RPJ ( 000$ RB02&> 0$0; 0 P07 0 0R+@T+ @T( 0 R(0S0`4S2 $`` 0(`(0S3@$@0 S `0(@0(0$0%000,0 R -L$M\`0Q$0 P Q 0 R 0@RQ0001S@$ 0R. K06 KpP  0 000004K;D KpP@㐀0S 0  0 00 0p`6J@ܲk1i => -L@7L0Q 0Q 0D!P,0( 0Sp -0PLC 6p<0\`L0`@T- D0@T( 6<0\LD1 S^V0W  ߕ0 00&  ԕP 000W  ȕ000p 0-<0\PL  0@LP 0D0P D1^6 L0R0 0\<00 R U 0P 㐕P0000p 0- @PLIr0 R404 <040 0 40 hP 0h00 00hڐp -LP T @0ST -LM8Ÿp D0 , `DQ_ "000040`8@ 0-@LPT00!R00P    a1@<Q pQ}@,jbH}@,6X  p@#6O }@ -L`RM  S 0R,0 P2Q 1CQ 1CQ -, 0R(K0  0S?0S<1SS81SS40 S1d2U0 1CU- 1CU0 %l@K@ :8\K 681FSY0 ;0K< K8K  0 0pR @K0)1U  p@T, @T' 0 RP 00W1U" PK@Z 7K88 76`K&X X7  0p1nLK!7Ą88 76 FHH 7\Q00V@Y`KHH 7Fܲkii@ii =>@ 0-@LPt$ T" U0Q^ D1P6 \\ 0 R<0T L0T00=k!Q Ƞ Q:8 10: 00* 0,

,<4  4&$%<'$!8("8 0 01@T%@T" l0 (0U3S3S80 SZ0S R000 R 0@@ -LM(@"xPPŸ0  ,<'4(!"40 <0 001`UP P @V,@ @"`V l0  3S3S, P0S 0S$0S(0S安Y?, }P 0 ! <(4"40 !<0 0 01`@V(K3S `V l0  3S,, SP0S 0S$0S(0SmY0S R000 R 0``@Xq -LP@("h!xL0  ,<4 ,4&$ <'$!8("8 0 01@T+@T( l0   P3S3S,  PZ0S R000 R 0@@ -LM(@"(0  h p, 04&48#8 0APT 08 40 @TL ؈U3SE l0  ,0S00S` 0S0S0S 0Sf , P0S^ 0S[$0SX(0SU0S<0S90S6 0S3Z 0 4ZZS 4 8@ @T8(Kl0,(0S Y Y30S80S , R ,Q80YS, R 40S80S0S0S0S 0S 0S0S0S  Pe30 Sa8@ 0S -Lky R 0 0 0 #04"48 #Ȁ  1S0 0 0  0 0  04!48#(  0!0Q 0000l  | 0(@@$cSp04%4, $&8,$#8!8$,000Q 0(@@$cSpӇ04%4, $&8,$#8!8$,000!0(@@$cSp嵇04,%4 $&8,$#8!8$,000(@0@$sS`嘇04%4,' $8,$#8!8$,0001` `ox(@cSpx04%4, $&8,$#8!8$,000!R  (@cSpZ04%4, $&8,$#8!8$,000!(@cSp>04,%4 $&8,$#8!8$,000(@ -@HLP 0H0 0-@HLP 40!80S0C8080H0HP$@0 Q Q H0(P 0QTP0L 8RH00S 0S$0S(0S X0 Q0P 0L0,7H0A p-@P` PL00P30800p -LP QpI P@ 409@80S0C80R00T0 0 0@0  P <0S 6@P 80@0yoP0 P@0P100 0\@<0SS `V DAdT P P 0 RĈ100rop -LLMH@PT p``KHpD.40P 00 \ 00X0  T <04 袔40ᗈKn 0削 p-L@` 0 \ P@ @00@30(00ppha -@@00LPHPdl0  叟'w R 0 0 0 R000  R0 000 0 kvh0|p -@0L @Q0(0 Q803@0 hꈷ> -LM@p P@0`<\00 3 R 3SA80S>? 40 ^E 0PS5岐0S P 0 l Y0801 0 4)4 S*$GPq1S@40 bP @0 00 080ᾓ(K04  00#0l0H  FP@xBϠt, j`PUPE.10C8#8S1}, Sz: 0A3P04$484# 80P P0S P10  t1t!08#8,0 ,!XJ,@^9PUPE108#8X1,, R): 0AP04$484# 80Pm@ 0RPO @0!QJ 0a긁긁(Koa000 @Xk fp,|pTAkXAkLAkPAk -L M@0P 0` RG l0 J 0S&0S/"\! `1Q 0S<00 s 0&,80S/  p80@0@P0 K180S Q0h!1P 0800(0`c bL0S0ha@@ 0 KH@spP 80S 0 P1 p|r@ -LM(C^  ӜP7  2 @ h!0$10?u, R000 03 $#$0("ȃ  10S!0 0 0 #@D"DH$H00 1 (Pcpԃ $<&$ 4(!4"H%<@ @@1S0 (@cSp廃04%4, $&8,$#8!8$,000!(@cSp埃04%4,& $8,$#8$,!8000(@sS`儃04%4, $'8,$#8$,!80001``,t 0 Q<l0(K40 o009\Ak0|p|r@ p-@``LP 0LYP  0DYP  apVT@$@ -L@Qp `V @TX@0S 0S@U l0P (0V -L M⌠P@8K0`pd ( 0P00P0#S m( 0R$KU|ܲk=>=> -L`M \,  0 \ Ÿ, 0R(K|K /0 (K!0 0a T0c1\Tp q@@ R |K1S q w Tp Rq w Ypw YpZKZK`,K 0S WX `V00P0#S w WV4 @T*:0V0/ |KPd -LMP` \\! \ (KQ p04"48#8g00S03#!4@K,0    08#8,#0@ 4KK.K-K@P ^7, 0 @P( K20P ,@ 0 @ ("(04"40âX@ p-LHMPP` 400S Kp\@KD  0$X0  P 00T0 4 0, n 垢|@ -L\M0`Pp(0 5 400S X00\0( 0R,$K|@KD  8Kx  $Pp 00t0 4 L n 0P嵅T 21C0D 10\ $ 0 [zܲk|p`Ak@=> -0L pp3tCkCkk -LhMD0`@ DK> 0-PL@P9 04$48# \04"48# Q\00AQ\<0 p0 0QSX JQ :<0p Q\0Q:S\0h0X0X08>> -0LP F0|CkCk -QL MP@`pP $Kq0S S *P% p` `a븀PP# `V`0SP| N@`Pl0 4pbPP|CkCk}pCk -L MKjKH 0P.Ϡ< A$0/@#b  8#" KQMb 0-LM@0 01@0̌P@@K0 -LM0`,0 P P   0S lA, 0R(KUp <P 1@CT0 0p2Y p- pPv 0`S P S PdU`0S S@ U@UT# DSS  ,    1Y< 1pQ 0 0 Q ~T1PU0PU 0(DAjT<Q 0& L0S S DK( 0<K;0K@ 0<KA80 _PD  T00T0Am pP  0 0}H0 0@H0L@D @P80S0C80<^ᓁ<Z xܲkp$p>> -PUl#0`000L0Sp  AR00U0S1 ! @ 0R:0SS S S S S S S S S " 00 0  P| 04"48#8SWQ    0\QP1! 2 R@P 0S!ԑf(0 (0 0b0(Ub!0U00P0 U00 UX: 00 01D 0NSA: 0 0N 000Q 000A ("(04"400  0>0>00>0p 000U0S 0("(04"40 ;R!@` ^}p@@ -LM@P  =P h! --L\Mx0p,0  0p0 @04"48#XdU <&000, 0R(K 0$U$Q  0$P %000IpP%0000(S(e10  @AQ.8..X.X..X.X... .X.X.X.d. 5 R 5 R1  0004 R U0000x0 14 R 4 R TD#U  10UR \PKLK@l`K  0 HKK0Kk0K[0Kl@K\@KL@K* XK)  hK)x0K0`(LK 0{xP 3 RiLK^T@ڴ000TT .T .T .T .L .T .\ .D .D .\ .D .\ .D .D .D .D .T@1O#U0 0U R 00S 0)SCU00Us000T@|2 R1 Y0013000tK 0 00Pt @@@@1 (0~xPfvU500 5<@K 0 ;0K< K0s S80  080 Q FeP 00\  0S 063 LP0  0pP000  001>|p`Ak p- LM@T`@PK0`0P@ 0T PPd@PK\![0(( b!("( 0P0 xkkCk -L4MСP@( ` p;l0- @TU (P<  0`Pl0l0`@  LK# 0L P( 0RD$K0 DPl0l0`0 9Pl0l0`X@Kf  0+P`HpK  0 H0KG K 0 KAKBKCKHpK 0 H0KG K=uܲkT>> -L MQ` 0SP  K ŸA0`_P 0BS l&.<&.<&.<&.<&.<&.<&.<&.<&.<&.<&.<&.<&.<&.<&.<&.<&.<&.<&.<&.&.&.&.'.p'.%.<&.<&.'.4&.4&.-P$R 0 P`_]PUP 1 RLP  0P Ki\ d 0TA 0 @\`PV8 ,A0S 1~ q 0 p\쀟P0S ul@k{k  0U  0P Ki[ x 0 Ki\Hp0Sa Ml@屁`kW글p Dkop pCkDkCkTp$pCk -LM䓟1 l, @PP #(00(0, 0R(K0S|s(`V  0R 80S0C80Hß00 0 00(0 &x#`V KK > p-` 0@01PC e BLr& 0!0e 000e0 04"40e8#8  $#$ p -0L `RP pP 0S nPP 0@010 0  00  @-&@D0P 0P0 00Ck -@L+T`p 4 PP  &0D#1 p0id -@`LPpP 0S 80S0C80H0 0 ,`0h|P @{(p p -LMxp00@K`P  0 g0 00K/ K,` `P 0RK<0Vrܲkp>> -LMq00@K`P  0 A(0 00K/ K,` `P <0V h1 R 0R U1<1 0& 0RCK1  0S2 0S3 <#<V( D1SQQ 0 R< 0S 0S <#<V4V8#8V4V8#8V+rܲkCk>> -L(ML 0 01CX@ (@PT0D0 " Tp XpW00W0SDTT 2T gXP@TD0S 3 R(KW @R0W`B: $뤓L  (`P < $000T TT3 R ` VH ,3  L0(_P 0WF *L  W@j<K $:[Q; [R 0S)9 ["200 "S9 K /` $TZ L (QP 0<0 $H0  000S0D0 t,`KA |$90[0S SN S" 90K@j L 0!P00P0f:0[; [0Sl@ L0 S`PI < T$:0[0:0K:0[0 0C0K I$:0[0:0K6T3@L  (`PL0 (`L/@j 0@j :0[; [0S~ h$L `(7_P :0[0:0KL0(P'@@j @j CkDkDkCk$p - @LTp l` P R0P00@ Q0U0C0 $R000 hBDk8php -销L\ p`00S 0CP`P1@ 00S 0CP @T 0 00\pDkDk$p 0-0PLP @000P0p$p 0-LGh0PPT 0@0C0S0\ 00 0T@@P 80S0C80000h|gTyp$p p - 0p 01 cQL * 0  0Q  0q03R0S %000Rh妎d%00C0R R00 \ `0#$0$(!44"S @ D0 $!$("^:@T\3  04 !4$ $8(#8"8PnU#ڲ 04"48#U  !04"408#8 $#$  04"40a8#8 $#$ T0 `P $ 0 $4,.4("(8!(#8Rcڲ 04"48#(Q P R0<00 ,#@U00C0Y 0S00pp @T0` 0#$04  04"48#Ƞ\ 04"48Q#h0\s0010S >K>>o@p @ pTp@CkDk@ p-LM@0  Q0e `0 PK  0S S S! S Kp !K 0S08# 0S  0K08# 0S0![ 08# -LM2P3 ` 0  4q @!4g8#8!,# $8#$$. ,8#8!8S,PL !L5LP+H0 P0 P07@0@0@dܲk>> -`LPP$0U0 @T  , 00S*0 0    TpQ Q 0 W Z00Z0SQ Q 0pjWQ 0,SPZ 0J0C 0@  IpG -LP@T7Rp`h P' @P T0TpTz Tw T9*@P @TT-@TATT *@V ᓾV ፾@"Tf SV 0Sk @!T$T;#T ヿ0 0 0@0T+v0 D 0!R񟗃hW.W.W.W.W.`W.`W.`W.`W.`W.`W.`W.`W.`W.`W.`W.`W.`W.`W.`W.`W.`W.`W.`W.`W.`W.`W.W.W.W.pW.`W.PW.4W.T-@ӆG 0@ 0 {$T5TVs 0S0 PR @ 0$1S S\@|oPP@ 0D !S񟗖X.X.X.X.\X.X.X.X.X.X.X.X.X.X.X.X.X.X.X.X.X.X.X.X.X.X.X.4X. X.W.PY.X.(Y.Y.hl050@+l0#5ql04l0#3l03l0#1l00l0x 0@P&0BS@ Ǖ@Rl0l0@0@0@@l0l0Rl0l000@@l0l0 Rl0l000@@l0l0Rl0l000@@l0l0Rl0l000@@l0l00BS@x Ǖ@@q @Rl0l0;;@@l0l0Rl0l0;;@@l0l0Rl0l0<<@@l0l0 T T=TV 0S0PT PX P@l0@00l0X1TF0 0 0@0z;0S@ 0q  0@oiVf 0S @000 @y TTd0 0 l 00@B h)l0@ 00l0Zl0@0 0l0T|r! -P p04 48`G#8SLB*0S010D fP9*@P2 ! 00 A0p! P p  P@ p 04"408#8 $#$  0 0  0 hp0p -LMP< 0p01 cX80 d((K 804"48#8P, @4 0 [0 408`04"4:18#( 0 :04 0 $#$("(Q0Ա40:0ı0c 8#8 $#$ 4 0P <0 S04"40 <0 P0S? !x000x0{4H00H04 04"48#8S+@9`PJ 1`80 @@S00!1,(01(Z0 @10 0 0|202, c൹,8#8 $#$<0 S  <0 PP 8x00x0>\ <00<0 00pᗻW7/ <00<0202%$p0p -L8MQ 0, T X `P0  H KH`P P 001P0 0< 0Su DK@` cXD K`  P\ 40  0R 80S0C80000 0 00(  \ q \ \ L > p-RL@ P` PP @p@pkS dS5S 0 PphFmSpS)`1RP9  0 0 0PP@ 0S@ 0 Rl0l000l0l0P@@ T+P( ٸ,@ ߹0 0 l00@0PP 0S0 S Z@ @P @-@" --L M0(0 P l0p`@ +00S** X@P7& q0y0 ` x("(04"408 P 0(0H 0P PAQ[($KQT`0P 0S 04"48#8QS0S , "\00\0+04 40$p - QL`P0@+ 0t03Q0S pXQiTo.n.n.n.o.n.n.Ho.n.o.n.o. p.n.n.o.o.n.0c T{ _p i 0`S1 R 0SN 1p-p 0S1 R 0S/p0p(0pTU0 p V+pjZ81@4 pPpP9 YIpp60 V8p( ip9p|0 Pp8sV 0 P P 0 {Y0y`[=kEkEkp8@,@ @p --LML2pP( 82U r PUF @0 l0lh@(hTy R 0S8 RR( R 0RX#  !0@P l 10S@0  (K 0O@< (0PF(P0(0 PUX$ l 00S@0   (K 0,@ (0P (P @"$K0R 0S 0 @004  B4 0 ֶ@pEkʚ;$p -L<`@41à PddUp !@0P0@AW 素ᶐp' tf/|Q Q V# 01V 4 #tfܷ4<ط (ԷNq p@-@1M    QP> (19C8# ("(8S 0 Ӵ (B(R bA9C08#8(R00Ӱ0Ѡ =0 0S01AS0#!8#(B8 CP&8!̱P ü&,0 0 20 PqBN|1S(  S < t0b? S Q Q c|0@ P1Pp0P 20Sp P(0p S1*(0P!@Ek -L,MY0@S5 S Q/ ݵ/(K(0 40 H <0 <0*0S`` P PPɵpP7 PDP D T08 # R; *1 ᯵7 (4 H < 0 0 (0 *Y0S S  @ ` P0 , 8  <(4"4!<0D  <4("4!<,0 0 0 D ("(04"4000 ,:8#40* 00S <# <4!4"<0: 3 #0T0 <(4"4!<0P <4("4!<0Y Rx R4@0a8#8#!<< !8#800bSY 0S|RK R4 @0b8#8 $#$(0"0"(`0!0 Y Rf R/H Q<IU@0 H  0刈 `@  @ |@ 005(P0<@@0 `= >0?@0 , 80 =^400q  x0 0 Y Y 40 c("(04"40%Y `\0P0x 0 05()* 0@ 0 , 8 7+,1 < 0S;0H P0p TEkCkCk -@Q`RLMQp % 02K R RP VPU00U0SRF R R @00`eV00S RU 0BP U 00 㘵<( 4"4!<0 ㌵ <(4"4!<0 0 6S-t0 ca? 0@X1A PFp0P0BPd @0 0@0d (K1|2H |2R(K  P! 0 0$ 0 P $ '{pP| X X tT0 Z 娀0\0g  Y10 0a aS0SD0Dp0P0P!= SB `0`S% 000  ! @P }d @0 0@0d P0@cP !}0q [0 20   0 p0R0P000:0:TP!Xy ᏰT PqHEkNq8k -|`崒LP@P |! 0P0"!U00d Un 101 < LP  yh`h``h` 0   (0 p?  R 0S0s4 0S0S 0s* R  0S0S0S 0S 00 40000O0@0@eƩh``e h` 0S T10cS`!0bSAڤP  `1R 0R 0R6 S &02 &'  = #P 00 0L R |0@  @|1Sd SP9A h@@ 0R0%p :W PPE UP  @@ 0S PP  9R      <(4"4!< 0  <4("4!<|0 00 0 00(0IPU R 0S:D R  \ 00@0 P1 #  @ 0< 0\41ʴ@T 0K0( 0 PlP |Q PǟX!0 b0b S0| |0 \ P@P a1 n0dPR ?S0 0,1(1\ \ \} Q 0T!R 00bSz0c^0ڼP !R 0B" “ N1ǁ h0^ 0O0@0@00 0h `nh` 1^0n Σ 1DZǡ0h` h`6VSʨ@ 00c0a0PU0U00L0O0@0@ RP 0R P U[t0 0t0P  00cS(10cS$ U = @ 0(xOPHKd`K⇫ᄫQ Q 1P0P 1 h0@|4$ 0 ?008SP70S @0PP0S*Q  T10bS00dSڨ@*1990l0 lK  Q101P 00cS10cST  t0KůP t@ 0R0%p D*G|0 @Pt0PP th0O0@0@t0; 0@@K H@KG0K0\K d@KKc0Kx@FK0 ^  ^ ( Ҫh Ϊ00 0 RC024A@T9 \ 1@TH 0RN 0#3Rʰ@P HKK 0@Pps 0@H0KG K D d0KKcK0`0 K  `0A Pqܲk$EkOq(Ek >>`@OqPPQk|aq8kOq,EkOq0EkEkOqxaqH?OqTEkCLEkP T!00bS 0 @PR00U0S$ Q0SP `10cS 0\1Հ T!h`V'P 00cS0nS 1S:6S P (PRPU (|!PQ U 00lS0N00[(@6S7 1Ũt0 U@At@ 0 0bS000= "0<"? 08N@t0`0`SS1R!P1Q!781S 1'0 1h0@S6@0L0  ZB  P 6 Sʠ@4#00S^PQh` VhPe7PZ 8C(RT R ʠ=t 000t8C80CSB.<..<.<...T 0bS R 0bSQ0Qh0S 0 0R@P0U000H0^0 Hጅ t0Ńt4P3CN0 |1S S  @hA <5@5t 0S x@ PV&T5P3CMȻ 06 0 ( 0 H 0 00n6 GP )0 00cS@h` h`@6S  " S ʨ0lS|ڨ&6S$! 1S !10cS000`l/0 P  |0S-08\ @ <10cS,l 1S  40d'@0?0oM A$1T'P1#0Q  !S | R l0  HP 0 @ V*0bո@? 0 t 0p!0bStŨh1Vha 0 0bS 60CS񟗀..L.@..68C( R0@S0S ᵤh0K @t0tP  t 0>HK 0PhHK 0PP u p 0DPo v &(@t0t00006@C2  a f00 cR 0\JTT10P\1000! 06*@0*?08Lt0`0`SS1R!P1Q!P1 00C0[\!0$0bST{h/0  0@hA ;Ya@dd _@P`@Ph`  P 7P 0@ ^2 ^ 9P101[h`V  0R H1 0c0cS000K 00cS 00C0b0SH00@00/L10L1h`8#P 0 0 Xh`}@ c?KP 0R^  P0n aS0V0000 @@h0|OP0@U0@| | R l0  HP 0 8t8> R  X< 19 0S6 63 t@0 @0S |0S P,!S0b.S:h (10(1 < @t0ătrt ,?0Sto lRmt`? R  X^ 1[ 0SX 6U th0P@@h|/0 U @ | | R l0  HP 0 ᶄ0  t0ăt" t0t t0ăt0tt Q f ⭶@0f 0Su 5t K0@"Ấr5 ,A(Ae0 0R0 |0S~8\   <10cSxl$ 0Pc/00 S | R l0  HP 0 6@Qt 0p!0bStŨh1UhQe0 1R& P40h#0?0J ? 0  t0ătvt0t0S t0o@bJ2t rJŸc ҷ%h"c @Jt0Ńt 0S9 @T*Pf 2P3C?JT P b 1P3C/J T 0  t!t0 ?0 PJ0 @F 0<00 f  @!608#868C8S ڨ  1'0 1oP0 GP!P$1PI8a0'0 !<\0 0@\0`@<J$!0, 0cS PdaqTEkClaq PqEk -L -0-0L@08C8A9Q/h1 !S0 Q xQx<0 / I&8 S0Һ6 uBlEkCx@ -L`Mt |0`U@t tPhUtPf -400`S:70 10 0h0 5t0VtPr 0\ P1P!R,nx Ux0xSP"P3 ! 13^hhX0W0U1!X x0d d @ 0\b0c3QX` . X hPt0 \:0 t0|1S Sd S .0t0 t(K1Sh r0SH1X:S0!0bS`Q Q(; 0b` R0a0aSTt 00aS  0Q ^ 040@ t Hx ^hhX|UyH40 @ Voj p aX pʃd XXp I r0 S X RW0!0bSp0ODH0@P)H0L@D}pP ,IX00S; 㝢1 0X0 0ᑠX0X0x u 00 0x 0S0 (p  h(t00t0DpP HHX00S 0X0 0X0 00 x0S =x0 P @B t0 1R B X40 <(4"4!<0p <4("4!<\00 0`#P7P` 1Q!0\ a6`2 S 0S0S"("(\0 04"48#800 cQ0ՠ0 ڔ& 0Q 1("(" 0 0202r R 40 1 0cS!! 0|0 ( |1S S S  ("(04"40| x00| q005|@ 0R+ 00H l @t tQ*l1lX\l@0\0@0tP 00 0tPP  10cS0P`!tPdQQ 0 S   4X0|0 T ,< $8 #$,,p.T0K,A  l4TK 0T| p ,8d00d0$ğh00h0t0Vh tP    Ut0 PtP 1 0cS 81!S3 <8!0000@N 0RJ h#0?0F40? FF;0@(0C8#,("(#80 0Pl 0|@|0H 0PP2tt L0 p TKߡp 0#10 " 0t0FRx 0;P[{7 t 1@0S0KT@K 04 4TK(K 0`ᱡ@:tP ' T#R1p < 4("4! 1|< ,|1S' |8 $|( K\0 :0X! 0RKphXwPT 00|, | ^J8RqܲkQq`aqOq>> p-LD@P`P00T00S 40php -D@LPpT Pg 40 X0 00h0W0vP 7S -@ML0  0 @ @N,K4.>|aq -L,M4pQ, @` , 0R(K0S PPQ 0@SŸ5P: PŸ0 P- U V) 001L0 @ L 0t Pn @0@S D^ < ,$ !$0,0cS10cS 01 RV @ 0@PH DY <,$!$0$L0cS10cS`F0l $#$("(RD }* ch1DQ2*t05t0 p10dSmpA0^/t10 00bMI0 R\ 3PAP @PV<@K㶟 P>Nq4. -L(M@PQp` (K0S0SJ UU 0ES៕LU UG 1 R VA 0S a  0R:<K`  <0Kc[#[`0pUF P3 @08S D^ < ,$ !$0,0cS10cS09 0S0S s娐 0pP *0Sl0 R L03PAP @P < K0PJ{-Rk.>|aqNq -LD@@68C8S S\067çh辧6S,0 R3QAQ @QN 0-@LTP R0000 0 kf@T00`q 0-L@?PfR? 0000.HEkDEkB?QkCk -L4MşPP,  @L0 P T X  |!|0D @ H0H0 0`0lQ@ PN $0D\ \K TP0\  PT0\ 00@ 0P@ 0P 0 0LP0 ,<4P $!$P 4!,.

?>?> -@xLP|P`F |P4 P@, $  p0:0`0#$##̠  0 s;0(@# 0 0S 0 0 P P1 00 001@ [0+ 0 80 0(  0@`P |1S S(0 0 S0 0 0H 0 00(0S; N1p`0p 0-L M@PPf 0@@Bf 0@:f|0 l0%`h0h` 0;S<00P 0<0S@uUK0h ,(m`aq@0r0j0r0p04h0a P * 8(C89H C1S01P:000<00f PqBTEktaqEk 0-@L&<t0P0t070hv; -L4M`0`(0 <t# |^ p!0 RJ70cS608#8(R62 &$  $ 0S8<CC;( 0R$Kr(0-0(00 t1C1 S01("(8C8S&ƱS0ü6,"0?0_?2 R$ |@T! 6Sں6Q@0 R RP 40 X0 |1S (=PP X0S L6Qʰ0 G P!P 8QPV$1 A@10@1|-0100tL [5t0K^?0 4KLK(0TK<0 8@KV |0 80K7 K(0`40 (0P:[<C0X0ܲk PqNBlEkCCkz4.|aq,?> 0-LP@@@>T0 p-|0L@P@`P 0`V GPDNph薩T0 Q`(!10bQ 0 0`V`!pEkEk8k 0-|0L@@P厩P l0GD 0S 0he40 \! 0 `\!0Ek8k -LM⬢pW`, P P0SR@ Q㖟K"! * @P 0S:QR K /_@PW2[S S) @, 0R[(K :W2[\ SF S  KPP <KL0KW X DP @0 5 <K 0w8P  VKLK0o8@P @\9X# @ 0  0X0 T0 \9/ @ 1T0 @ 1X0  KPP T1崾wB W[0Q00 Q Pq -QLM K0LS.h.d.d.P.d.d.d.d.d.d.d.d...d...\*0 * #*0SuO @[) @K00, *P0Q 0l\P00 @J @1) 0!Ekpaq PqhEk`q,

'^D 40PK0h &$ 0PK0h&Fkaq,\p 0-LPq6@/0h5 --LM@0pPY,0 *Zc (08 S0 8` ᯓX(K(`H6 4 n`PQ o`P7`; @  ("(04"4 0 80  0( ! 310#10!4xq !400 R2 02,00,0H (@000:  P`A`Z 0 8 4R5(0S9` 4 4I5 Fkaq - QLp`@P 0u03Q0S1Qu/\/X////////X/////8///////l0   0 m) 0 mɶ,9PZ  XPl0L P-Pl0   0m讑PU5t2@p 6PPT#PP 4l0Ln Pr5l0p ]  h!P4ڦP-PHel0 > 0S 0S$0S(0S$ 8Pl0  0S  0S$0S(0S9P <5l0@<4,80)40P00z)5@!P}4Uo3l(0S5@>Pl4 !PPTᨽPO 0mS4l0 (0(0  w x =FkFkaq@>QkCk -QLM 0S K0S0S P0@ SAP T \  0 0HP30P @0S   0BDk-aq / -LpM<ß@Q, p PU ß, 0R(K`VP0@Sp kPg P 2 R W 0| S 0x0 t | H0KHK0 %GPKH`K@K | -# 0 0HKg2P(2p0 Yi |x 0R:l@Kd`K0 |x@\PK0 c0KdK| # L 0:2PXK [&[tHK p0L0p pHKH K@0K0  @KHK02P| t m @KHK02P _6> -@0@L@R@hM --LdpM0\0p0 ` 0, l0 h 0@#2S S5 hPɟ, 0R(K0 G0K 0 S *:X 0S000 0V $#$("(8#X 0 dR' U00U0S 0000` G0K 0 S` * p0K⼖P p 0R0% *?cbᢎK0Q0 0S 0S0s 0S Q  0 0R 0G[Yy YPH@Kߑ0HPKGK d@KK0ґdPKcK0 6K0\ 0S V 0S ( 壶PQ (@ h0@_PU 0\h0 l 070S@0   h KNV l 60S@0   hK 0W^ l0  h0Sh@K @0S@ )0áV l0  h0Sh@K @0S! 0㰡@HK h0դP 00 00002_  (0V0(0  0x0SO 0000S> 0s;0S R00d00dSP U 5PU l0  "A@(AT PUm @0 ^l0 #0RQ ,0S00S40S80S0S 0S$0S(0SY; ($0M@P4 \ l 30S@0   h K;MV l 30S@0   hK 0N@HK h0/PRhPO 00 00h0 @0  YK ^ l 30S@0   h KLV l 20S@0    hK0M@HK h0P @Gl9@HKhH@KGKdKK 0D0 _d@KcKK0`0 , 7PAa0000 +P5#0R1]0S  0-@ (@  0\@P}> $00"!Q$00* ( +PUm000! 000Q!  0 zH8 R 0R( R 0R( h%P@˜BJK00000 0aqܲk`@aqʚ;h?> -LR0傼0Fkaq-Q@P P*R 000P{ 00!aq4Fk -LMP)0Kp @ឍ)0[ !#R)K R 2 (0/0(0(K%aVT 5,  , 001S %1S T5,  , 0701S1S1S ,1S Q ( ͐Pk$700001S41S81S 0SN S 0SD S00S S000(1S 1S  ᛐP @ @ 0 000 ("(04"4#0庐(1 0 ! 04 40)[Z Z ៍x#(0/0(0l00S 00S0 0 0``000I(0C8#8 $#$("<8"( #8"000 0.B 0.)@[T T` b"(0/0(0/ 00S St) +0Kⱌ@0+ K*K*0K* 0*[48( <"4!<#,## 0000 1S S0 R0 0(0C@0@0@0 R00C@  00C@0@0@ 1 00K(`00,<$"*)0+ K00(0C@   00KH00,<$"*)0+ K 0嶐0+ K*K*0K*0[0 +0K1 0 + 04"48#89C40aqCk -LMl4 8  +0K`+ ["2S S (00(0墌(K( 0P "2S S  _ 0PP`P + ["2S0 4* Ks0S000y 04 8<,<$"*4* KZ0SY )Y( 0S:Y )Y p 0S 653 R1 (=30 PU)PU& D10 R@T@T W 0S 0R Z 0S `P$00$0w040`O0@Y0@ )YuPB8 R LP  0.@ D0pR@ 1 00Sa@`10`@  @ 842@P `10Su 1-4 t 04 8<̠<Č,ʠ*K) K)K}P>  048<!$!0!̠ 0)0[p:("#! !4!(0 Kp*K 0)0K RP  )0[R 0 0Q3K`P)000 00 0}Pt@gH00H0l 00 0e-000 @@-aq@4Fk=kr9p 9pp -\0LP1  0 ($ 00 0= 4Fkaq --\0LM R1   00 0 d K 00 04FkaqG-@0 0P8< 0#40   0 ! 0 8<0# RM` ' s`BP0 .0.. " A1 "4 " "  " "0,`0 (V 0 Ѝ08 <0#40 (0, "V-00r`F0 0! #0 P0 .0.. "1 A "4 " " "0" 0 `# V  08 <0#40 (0, " V$$q001 !4 0# 0#(0# 0# # , 0 00 P.( 0. .A 1 ! 4 ( 0  .,00!80!$S!L`  [tg>tc> -LdM`AT0 2P 0P0 0000 0@DU 0 N0Q 4, 0@P.,4P l $( 4 #l!<` 8 < p !Lp @ L ,!T P T `!a$|,.X |` l ap#Xh P ` qp !8 #4P!01@P@,Ġ Q H0 .P0DP !XPd 1hQx !|$D@1\P `Qa@ 0#pq "t  D@\0  H0@dP!x0At0 Qt`p "`!0',p !0p  "0# W,p  0v0(Ktc>tK>t?>tC>tG>G-Mhp`@ h@$ P` L$`\,` , .\ p &`PX  ,$,X. .  lH$p th $d0i ̠x|P la !Q`#<`<4P, x0 ` *L#Ƞ0`!|@$0p $x@0P(@%P @,P0|`P#Tx0&D#d<0*!40 "0 #T4,  (8! pq "0. *@P 0p qS`A8` 0#!( !0  "0# l"p0tt唃l l@匓 la"< P !Q`p`T LDPp0`p!L##t0$`!t@0$X$d@ 0@l0@#D0*̠0 0T0l L0!D0, "0*Ƞ #夒  HP QP!$x`@P0Pp Lb@ "*0%PQ @@ a H儀 0# "X !  "0#x!| 0쁟쑟'x h@|P.<b0*( p `FA %40!!x!!,!P*t[>tS>t_>tc> -@LP00 -L@P`pP W0G-Ml@l0p`Q @A 0\0.` P̌pd`0% @l``@ P XP`d$` ., .\$@P ``<#,ɐXD,l  8#d #.@`倀h ph ̠ x laP!Q`#<`<4P, tx0 `*Lp #Ƞ0`!t@$0$@ 0|P(@%xP@,Pt0x`P#T|0&D#d<0*!40 "0 #\4,  (8! pq "0.*@P 0p qS`A8` 0#!( !0  "0# "0!L.l ℓ!瀀 tG>tK>t?>tO>0 0@-@$ 0@0 0 0 #EgvT2ܺ -L@M@ hKY ph( 0 @ 00# d ,0*0 0#`a0"00# \@dȟ0! 00#X@Dlŀ0 0 0#T@$(0, 00# P@ b* 0.0 0#L@0"00# H@ǟ`0! 00#D@̀0 0 0#@0n)+C0,0O B0#  <`G' 0.@0 0#@8@@dE0"00# 4 0$00#0`ǟ` 0! 00#, ǀ0 0 0#nd@& 0. 0 0#  -P@0" 00#<@|0!00# ` h@\Ɵ0 00#lƀT@<0,00#@@& 0. 0 0#  +,@0" 00#aX@0!00# `D@ş0 00#̀0,00#\@% 0. 0 0#  b)H`E0"@ 00#@@dF4@0$00# ` ş0! 00#ˁL0,00#n$ P.0 0#  T0b&P"H@`0"0# ğ<0 0 0#lȁ0! 0#d@d$0, 0#  HX0b. 0.0#L@, 0"0# ğ@0a 0 0#4@ā0! 0##h0n 0,0#\@  * 0.0#P0`0"0#D@ ß0 0#ll΁0! 0#P#,0 0,0#`@ 4 b( 0.0#h@000# L@Ÿa0 00#lˁ000#T@"0 0 0#  % 000#\@|` 000# @@\Ÿa0 00#d@<ȁ000#H@"0 0 0#  ,Ab- 0@00#@@PQdK0P00# PP4aX0`00#``Xe000#<|` 0 00#` \lˀ000#D@? A10N@b@P, P0@ R?W@pG 0 ^?W@P0 W(K (Ko貄@, 孄 G,0!pc?WP -L,MT  1>?0@0c80 X1"0 @ D <0 08#8H L0 T^!\8 0!pT..l<@ #48 <, D[2K30KT80-KL[ C1PK4KP .KP /K0pKP4K  {U'DP  0#<0 "( 0#40  Q XӃ, 0R(K-ܲk8Fkg>< 0@-@0@ $0$ 0 0 0 #EgÉܺvT2 -LRM@ ` hK```aD  h! \ DAhp\ 0"hQToD0#@ d0 `e[@̏J " 0%`0# ` flL i``  & 0$0#p苎dKp\ȅ0 0#X h 4D0`  n (T1 0,X0#pl1 fk{T1P  l1 'lˠPꪉ] 0. Th0#l1  `0 @  *g{ l1  @0<` !Pa n`PdL0%h` j0# 8nP 0 `ae[ #`L 0$` 0# X䝟0 hc;4p|0 Lq |Hp &ˎ }LdK0 p靊 0# pT PlP )fk` p|0, ,0# lˠ 'H |@PY 0.茊0#H@@|0nidIP0%0# l1  H0 g{ ( l1 a  !0`j` 8`|d`e[h0$ 0# АdKLa al͎ )0 0#  @0lc;`0 j0`p *` P X{` 0,pfi0#pH Plˠj[ &8@p 0 .gz "00'@  L0Z48y<0b-d1 LP0dLx n x0fk 0 ̀l1 d1l0g{P x雊0,0  X0 e[ 0  x lˠt a@ t艆X dʟ 00 @!@a@*L1idK 0L jȇ  ` 0 0t``al@qd n 0  h hYt  0P 0P P|g;@p <1  L1Xylˠ eZ @p  0 p T 0*fk jp g|ภ @P0 ਟ0 0 < e[꫎@   00 H1g{ 0 pmvmznܼNS @L❀fm 00@0#@D@H0g{  0  Pl PM舂0na0 P0#    P T0` 0fk00#̎00i$ 8Pl1 X0  P$0 PĐlq dK 0'b,p hQdp` P} 0P `p h 00lˠT1P $Z g{0q 隁 0ppfKXa0 $!@ 0 @@Pa018Ba  n @ 0@ a0g{ e[lp @  0@p`dI 00 0 nb)h0Hr `la p `0 01lip 0  la dKa pPcH0gy  `0`h P 0`l 0` P80hh  e[ 0P 0T P 0 g{XT˄  0 aP 0PP0a8@  0  hDL1fk e\ ᜐ@ 0@ 0h@ lˠ K Xp! `0 l! !0p l0e[p  ab*  pL0<` ༐  0` 0L!`dK 0}  Hࠕ00! b+ ! T1` ` 0e0i  0 `, 0``L0lʀg{Pp a  T P\vfl0   0p0p, pP0ig} @,1lA l1@Pn 1 @  Pfk @P@0H` 0Wl1 0P荁Pl1  00lˠP g{ 0 eZX0 pP `  %8Pj0$ 0#Wh0 PdKPHahnਐ0*0#  gT0 !P`Xj`@pì 0. 0#  (xT1 %`pmnpX` a0,0# @ @lL0 &pe[zlˠ dK 0  0# fk '88 h0  (` T j0$ 0#a`0g{dKHP0* 0# h )@Y@0 P i `LP !lɀ` Y0jfj 0. P 0# &PnPP ` 0,a0#@@ d0yflˠ ``dLp 0 0#]jX1 %pp`gz` `L꩎0$  'e[ 0#` H0d g{p dK0pin0* &0# P1h fk (  ሀ hpPj ̀ 0. 0# !0hq 0`[\b,0b;(! 0`Xq n0,lˠ@ a{  0#T@I`!  0P!` ꪎP$0 P% 0: HQ 0 (夀,`L;] 0p0Da % 0dc (K -0Q^q?`p@PfUpLpV@@Z* Q :@ @0Z* Q* aoZ@ V @@Z`* -L,M01>?0@0c80 \1T 08<0 0!D @0 ^.L H0 T0#\pT<!!l##4<30K, 80D[@0-KL[80 .K2K8T N1PK4KP /K0pKP P4K  U'DP  0#<0 "( 0#40  Q\ {, 0R(K%ܲkxFkg>< 0@-@0@ $0$ 0 0 0 #EgÉܺvT2 -/LaM0 @ lK,0 .|1Ahp PaA ad`lnDi4 i80|/0%1  d0 ac 00#l1 p `0(p0 nd-c Hc1@l ` 0(T` 0\,@1 P\0P Q\clD0%X0H@aqbacT\Οc< Ȑ X0' &@0 P,1 T0Q T "aDc, 0% P0H͌@`lcTc< 0* (0X A1 L0 PLx  "d Qc,lDnad<͟H0% &@ H0  "aq@cTcP hAcq͌ 0ᜀ0*L  #@(|O`0 x @ \-&l@`0 ! b @Q? `P0`?SpP`0L`@  gou@@pb u y?0YP@p q?0Y@P 0 -L M0`P(0 p0K  !62 b1 R<0Q0^ ~?@ Q R W 1  !1Pt( 0R$K ܲk@g>g>G-G-M TXLP@D PAhp!(1,AaP`0Q4ap8q<@D1 HL( P!T1Qq0@0XA\Q8``adqf8<(,0!41HLPQTaXq\p0@$H',#H8P`0@ L#D<P` 0@ D4LP`(HQHa.9.WiQa0@,aLQHL4,,'P&Π`Q a(La(g Lqp(1)HHy ਄ aqGo#Π0@Lq,Qt萍%ࠍp(A䀍C(J_`N p'   ણ^`0ܐؠ@RP` P%`& P`P'`(Vp  ,!Rp~ p #p N0p 䐍@)*P`P%`&! "0!p) *@f圑ph pf]` P`!QaGoZVN`qdR_`~@DJ/ Jx|!. !1N?1ARO0AQ^`QaVoaqplqxq|們儡j!堁夑1AtQalllh !t P _!i!wPQ堁WPaQ^iP#tQp(y`ifWq倫$`at(ᠡil ` kh PY ≑ Vᜁ p$P夡Qጔ(媤Rᄠ .PPpP`蔐P%`&p)*  tx3ᘑ}1Ab_`>q弁^fAa0@408@f^P`P`,P0`- $( p!j?p(P`Pb?`0  . 818<4!,00 @$! p$(P,`0Q004@ݍh> -pRLP`& @D1>0A W@;@ RpG`@D  Q*H0 0@WH0L@W耀cW.:P eq@1@ T@D 9 `phP Qq@1 0S@DRH0 0@H0L@P7q@1 0S@DRH0 0@H0L@SH0 0@H0L@x -RL`p. @D1>?0A @c X2:PP p@1@ @D  pj?X@<@H@ ?X@D @pXP p@1@ @D Pp@1@ @D 0-PPL 0@ pPp@0@0D@H0L@0g> -0L@$M80 4@ < @L H <HH8 4 @ p ` P8K 衟 80K @ 0!D#L"$4%T'\1t0 , &dp xAP H 0KL0` ੡@ 1L N@D@ 00K @ 0!H#HD8%X"('X<x&h0@ @DH0L@" 0 pPP0P<0PP <~4p<H00@<@P`P`(KoPPp`"p<@pPPp0P0< `PPp -PLM, 0 . U00@P0` 0 @ $#4!,<p,0$Dh@d0dP`` 0@(#8!(8$HP`0^``0(Ko`o -PLM, 0 . 00@P0` 0 @ $#4!,<p,0$Dh@d0dP`` 0@(#8!(8$HP`@^``0(Koo 0-PPL 0@ oPo@0@0D@H0L@0j> -PLM`( M 1A@pt1 lA0@$#4!,<$DH1@A <1 4A 0 @q(#8!(~8$H? ⨁@D( 0 8PP0)?PP@+85o@00@0c8( 4<"$$ (  QonP@8o0P0P@8`oP@@` o 0-PPL ( oP@n@0@0D@0k>G-: @M;0@$P$8$0$$ Q|4q aP,. .`.8.\0.$ a04p Q,@$ @$`$8$\0$$ a3p Q,. .`.8.\0.$ a3p Q,@$ @$`$8$\0$$ ad3p Q,. .`.8.\0.$ a 3p Q,@$ @$`$8$\0$$ a2p Q,. .`.8.\0.$ a2p Q,@$ @$`$8$\0$$ aT2p Q,. .`.8.\0.$ a2p Q,@$ @$`$8$\0$$ a1p Q,. .`.8.\0.$ a1p Q,@$ @$`$8$\0$$ aD1p Q,. .`.8.\0.$ a1p Q,@$ @$`$8$\0$$ a0p Q,. .`.8.\0.$ a0ql A=P0,@$ @$.@Ѝ  $(,048<DG-4@ M;0@$P$8$0$$ QqA= aP,. .`.8.\0.$ a04p Q,@$ @$`$8$\0$$ a3p Q,. .`.8.\0.$ a3p Q,@$ @$`$8$\0$$ ad3p Q,. .`.8.\0.$ a 3p Q,@$ @$`$8$\0$$ a2p Q,. .`.8.\0.$ a2p Q,@$ @$`$8$\0$$ aT2p Q,. .`.8.\0.$ a2p Q,@$ @$`$8$\0$$ a1p Q,. .`.8.\0.$ a1p Q,@$ @$`$8$\0$$ aD1p Q,. .`.8.\0.$ a1p Q,@$ @$`$8$\0$$ a0p Q,. .`.80.\0.$a p0qP*0,@$ @$.@ЍD<840,($   - L k>H0@-@P!0 Q8 #Ƞ 0 ^D0 -L M((K0`"x0i@P 0 8#X "U 0AM00 2K40 @4pK70 40 0X5@P)4 0 8#X00 U0@X(K -LM((Kj"x  <0 @  j@P <@0 8#X "U 0A]@2K40 00 P }@ 4@ 0@v4K0 00 4@00@0`V 8 8 `5P4@ ^ @ 4@ 0@W4K0 00 4 0 8#h00 V0P800S80 4@(K p-LH`P0$H phJ (-"xL` @P08#XU@ (-"xL` @P08#XU@ -LMR`* p0K 0(8,< 0$4 00 , a00, p###Ġ""H"TZ0@P `(K -LMR`* p0K 0(8,< 0$4 00 , n00, p###Ġ""H"TZ0@P `(K -LMS`4 p0K0 0#0P 0(8,< 0$4 00 , 00, p###Ġ""H"TZ0@P `(K -L0CMS `B0K4 pb`B0K 0  (8,< 0$4 00 , 00, ###Ġ""H"T 0 @P 0 0#0Q0S`F0 8<, 0(4$ 0 ,0 00, ###Ġ""H"T0@P 0 0#0Q(KG-P0X\P@0T 0c|àE,80a5, ,E娕0q  A `&0`g`0D`&0& as1LE#8##0A5 nP%0H P%0e as1#A#̠ #ğ0@@$@a 0L@$0 as1#a#̠ #|ğ0`&```0P`&0& as1#4##0Q4 n@$0T @$0d as1#Q#̠ #ß0PP%Pa0XP%0 as1#a#̠ #xß0`&```0\`&0& as1#0##0A3 nP% 0` P%0e as1#A#̠ #Ÿ0@@$@a$0d@$0 as1#a#̠ #tŸ0`&```(0h`&0& as1#,##0Q2@$ n,l0 p$ 0cgqA!Q!1!ĠA 00#0` \`#U0 p0 0cr#xA" "lQ"40  .`40t .0. bs2##̠#(0Q1 A aP&8 x0P% 0c er#@"1"̠ A" 0 0#0a|< p# ` r x@"1l"̠"d@ 0#0l0`#&<&(&' 'Ƞ'p0 `<><><><>G-0Pp8` <@ W0 tTᰕW< |0 0cr#E"805" "Ep1  .c80x .0n bs2<ş#A0# #$$ 0! @@$@b40t @$ b0$s2##̠#(0 Q4 .l0 p0p. 0c r#T"1"̠"|T 0#0l0P#, l0 e 0cr#8ğ"0A" "4$0  @@$@a(0h @$0$ bs2##̠#(0a3 a`%$0d `& b0s2S#|# #$tS 0! .a 0` .0n bs20ß#Q$# C#$ 0! PP%Pb0\ P%0% bs2##̠#(0 A2 l.0X .0 bs2Ÿ#Ax# #$l 0! @$@a@0T @$0d bs2,Ÿ#Q # #$ 0! PP%Pb0P P%0% bs2##̠#(0 1 l@$ 0L @$0 bs2#t# #$h 0!, a0H ,0l bs2(#Q# #$ 0!PP%Pb0D P%0% bs2###(0A0 n,0@, a0s1|@#( p #A#d 0! n < ( ,,H,T0 @P<><><><> - RLxM0 00@X0Lp ^ p0XL< 0^P`X L 0 XL8 0^X L 0 XPL4 0^X`L 0XL0 0\@\p \0L,(8( 0X0PP(($.8  .%<!...Gg0.,A.40 %.( %4,G0!,,, ,4l0a,( !q, %8!HgA0!!!!0$P!!4A0QT0 " "! "VA!< " ", H 8 D 4 @ 0 < \` ``` Vd////\////\/////840P(\F($ 8 P, 0 l% (Ƞ $6$& *|aq !40` 0`0 5ap %D q%ȠPQ` P U*d*  0儀 P0!P "0%P@ pUqhE`QX APe " ` !0# ! "0#  ` Xwh////,////н////D/0,4t(,X*̠*(48t ğ0 (4P !Q*D40d t@x lP !Pq#@4(h8@`| ,p q`Q8` hP 40&\l`p  "#`d0ß!$D0&x`@ q aQhp@0#| ! " ! "T[3|#LX[ Q!M[al#d3A0  0# "! 0  \\ 0  0 0  \ ^\ 8KMeXKJeHKGe(KL2"!M[X[T[aQ|2|" AHD\2T"! @aA<2<",Ƞ9P[ 0 0# "!@9[HD1!!aQ1! ,Ġ A 0  0# "! 0  SDpa(8l 0@0XHP(($.H1  .%<!... Aa0.,A.40 %.( %4,@0!,,, ,40a,( !q, %8!`A0!!!!0hP!!4A0Q<0 " "! "@PA!< " ", X 8 T 4 P 0 L O<><|><><>G-M 0dğ 0@R$2.  B$,,$ ,8 1, ..4 4<.ğ0#. 0#,? H0죟  ܣ))a.4??0.Ƞ1 0.L? R!?! ?@q !8A?d @?0! 1?Ð 0 7  0@ 0#@##a0$4??0$Ƞ1 0$? !R?@! ?q !8?d ?0!  F1?Ð 0   7   X) "0  , "",$" !!1"! 8!8#8 !0##  2# " 0Ѝx|))a.4??0.Ƞ1 0.L? R!?! ?@q !8A?d @?0! 1?Ð 0 7  0p@t0#@##a0$4??0$Ƞ1 0$? !R?@! ?q !8?d ?0!  F1?Ð 0   7  H X)t3333UUUU<> -LMP`@p TDXHL\0K 0P ,@ 00 0p, P`#@#"#8"Ġ"0 (KG-M R? H0|t l))a.4??0.Ƞ1 0.L? R!?! ?@q !8A?d @?0! 1?Ð 0 7  0@ 0#@##a0$4??0$Ƞ1 0$? !R?@! ?q !8?d ?0!  F1?Ð 0   7  X)00 0 Ѝx|))a.4??0.Ƞ1 0.L? R!?! ?@q !8A?d @?0! 1?Ð 0 7  0p@t0#@##a0$4??0$Ƞ1 0$? !R?@! ?q !8?d ?0!  F1?Ð 0   7 H X)<>0 Q|> 0-<@LP bP@ 0T00Fk@Gk -2LM @Rp`0  @P0ČȌ̌!2,2! ) !0 #,# ,!T"0  ! ""4!4<$"00#"0#  ,8#0 , ,!0)!S0 -ቝ4 4 40( ር)# 38 0(ˠ <0 80S)v0 p, @^ 0 (KT 0SQ0PM FkUUUU<>|>|>7 -L MP@`pP DHL.$ . . Ƞ,Ƞ  D,, ,4..D, @.$ @$.`0PK p@$,4  0 ,@  v 3 0,40!0 0##$ 4# ""# !"!!" ! 2!26:0#`p4 P!@!4 ! $ 0 (K3333UUUUp@-0` R" 0@Tڌ0 P 0 U 0S 00\P ppLGkDGkPGk@Gk - hL0@ 0h bq -00L0 @00 @0@ l 0h bq -L M Th P0@L 0H<@!+0 ,80@+K0@bq@bq@bq -PPLD h0SA (1p\ a 10 ^ 0S 010  \00a P à$L ` 0 0@0@ PEi<DGk@GkPGk 0-@PL0@S 0$ 00bq`/ -@QL^ ppW`%P0S! 32C0f0 !   \P0@0଀ 0 000ഠ  @DGk@Gk -0`QL\PPU@pp0S w32C0d0 !   \ 0  ฀DGk@Gk -LM⸡00 SP@ Q1p`^1 @0S% 0"0 V U 010 R010 R Qt 32C0d10 R @ ^t`VX mp(KV ^32C0d(K @ pP ,P0@`@00 000 F@GkDGk p-@LP0` R5pQ 0ES32C0dA1 R U 00  Q 0 S Q pPd_U( 00  PDGk@Gk 0-@PL <PQ 40,<0D'<Q>'0h0bqbq -Lp~'`P H-_W P'_<0U40<@ P'@PP8  bqbq -0LLq0SI RXڌPPU 0S00S  0 0ਐ)U=32Cel `P4 0@#"B c!^0@c^10 㨐  l. `Z0 /l0XX0P 0Ac^P BP =PDGk@Gk -pP0LS`P @VP#:32C0f A 0S0C0000SP P0  0S ]@GkDGk -L MpP^ @0S[ 4 <QV 1PR 1 PY`:4 R 0004 R<0K P00K0@#0,04(K 3 2C0i 0.0S  0@0 /00@0 @|0  P p, X<0,04 R<@GkDGk 0-LPL0@S 000 {0 +J0bq/-0PHGkP0S0SP0S SQ 0S R0000 0 00 000 0-@LP$PL<PLL0 0-$@PLP R0000 0 PL$0 -L M4 0 , L PP ($ 1>< @040K0 @@P@  00$@ @,(K| p-0LMQ`P KpL 0@00 ,4K K'0P,U0  000\ $@  (00(0  00CS 0[LVdcTGk -LM 0S0,0 0S/////QR 0,0 ,QRL le00  0 p202$2h0 0,00S {Q0S$@PP0S@p,00a L 5( Uء 刋P, P0S@pP,  X 0@0(0@S ,[(LTL,QR QR 0 aP, 0S,0 B0T1 ,0P` 0SP`0@0! 屋P, 0,0 |/(@ -LM -8 8,0L0,#Q ?000h&x -LMpH4Q P, 0S Q nPm` [3#@0CX@@ 0C@[ 00@'0 3PRP 0,0 N RZ <Q4H3  P, ;Z  ,0 00<  @010Y 0 S 0 000 0 00 000$  (0100" 04`@ 00@8PP Y 0 S 0,@ ᄊP,  ",2 Po&, , ,0,0 0S <0 b[ 0, 0 00S Z D0D0 0!000S *32C0bt!10 @ 0S P,  ,@000Oz00@0!<, 00 ,0S00S,0 , R, Q 0 咊P, Q 0D ሊ, 0 S Y 00 0 00 0ct \ h X /DGk@Gk(@x -LxMds\, ^@$2 @3^ 83^ , 0 R(K3^ 1C^ @P 6P  E0S///////////////////////b0StPK$P@KZ$~ZVJ  0t0 p 0R0R+*hP p0QYhLDP L0QYDLLaHaDa@aQ@-@ \0Q  P 0 SQZP00Q0S @10  -LQ`.R.\V&  \* V  R b\`FPXVp`V @@lT@!d YXp*** *@h@0@L@ -LQp`-R-\V% 0\* V 0 S c\`FPWV`V @@lT@!pd dYW*** *@@@@ -L`RAQ=8 Rp.0^p.W& 0Sc^pV$ WQ `dV pRP 0 @nT@!  P 0@*(=*p7* 4*8@d@ @@ 0-LxMPP&@KtX 0 | x p l h d ` T P \ 4 0 ,  L H @ < 8 ( $ QK0)xGkh0,//@ -(2L Pr0S Q@0T{ P:  00CS+////////p/p///(/(//////////(/(/(//`P XlP Xll0@0T0P Xll0@0T0P WlP Wll0@0T P Wll0@0TtGkpGk -pP00@Q0SL-$gQ X0S X!00 lPP& 弦P  ! Xl|P 1S  RT~ 1`l PPI 0BSI//////D/0P  0R !("( 0p P @T\tXtTtPtLtl P0S l 0S 0S 01S 060#0 R0 P 0R !("(  0!S0!B("(P 0S 01S 0j0#0 R0 P0 0R !("(  0!S0!B("( 0S 01S 0\0#0 R0 P0pP 1,rs(rq$r 20P &r rfrrr10P ql n0P 0pP qqql YP0S l0P L0S 0 S01 0 R0 ! V0 0R !("(  0$0pP ppp0 00M0 S077P0pGktGkTHkHJk JkIkHk0HkIk><>IkIkHkxHk|GkIkGkGkGkKkJkJk HkJkpJkXIk0Ik -LM@`l PpP^ X^ 0 0J( KlPUJ P 0 0U2XH  (0EU(*XH e@A0?P00S 1\1C20A\,0@D0 0l/P  0CR0(lZ$K( K lPNU0S(0 X 0`0`[R -LoM<@T0,0 4  pUq q q q ` 0!R 0S 0S  R`, 0R(K0CS/////P K Up 4@TWP 00   <K pU! 01S !<0K 0S ("(K<K 0 `K  P  0 EU  `R1P 8#81  0!df(U!K  1 PR`@e0fT@Q 0S0! 1 `A  0S !<K1 RTP! ("(K  P9   01 PU6@e T @\P 1  0= 0( "(K 1  T! 0 R!  0V00CS T <(4"4!<1 1(< 4!4 <1 "(K |@KK$\ D |T\ 1 <0K 0V<Ku1<K  [T!<0K YR 0SR <0KVܲkpGk> -LM@ \,  `G PK  -TYA 0 pW  0 =0SY( 1lKD TP, 0RM(K #,10S. 0S lK$ SlK  lK$Y  l0K2Vp 0 Vp   0S   Q ("( lK$lK$Fܲk> -L\M,ɟ| |@, `x p)PPxW 0l W x0 -LMPP] <`V 40S 1 QQ*0AT 00pp0 S0S @T0,00,00CS80808080000000800000000008080000004 0P,0$04`V 0@T<,40 pP, 4 03P, tGkpGk0 q0 n (-"(L; (-"(L (-"(L (-"(L (-"(L (-"(L R@R-LPp` A vz q!m   -LM 0pP@$0 4`K3 0#0P\)  0#0#0QA#0P0 Q3@R 3x 0#3O$ 0R K 9ܲk>  0-LMP K9P !4<"D\0 @  %P=z K0 -@L PP00 -@L  PhP Rp-L@`Pp! BP @ Op p-LM`0P0 000S0A Q B,@K 00 0#0QZO 0RKpLܲk̮> -Lj  Z (-"(L l 5 0-PL@P PP000 -@ML0,K - ML̀@0@K 0 0 -LMhKP@ @pK_O 00 RX  Ta1*080 Ÿ2l d@ < @0 hP P t 0XP0 ` X T` L"@HŸ0@ QkP00f@KPNZPl  PTT0USPO V`1źP @G 0X 0 `T` X  ePl P0l 0 嫺P. XL Pb0SI `pK0@ N000l]`e0 pS6 0PU :@N000lH``{0 S  P Pl90SX b(K "X<0 , @0W| X55# b1#  @ 0@^ 0-@P LX 0#40 "( 00  0#40 "( 000ܮ> -(0 $ , 08 40< 00M -@Lz M02 -LMT4PK0` p$0 M #4[  Z 0R300%0[0%0K–\@ 4[  X 0R300%0[0%0K 0Q1 0Q11 0#P1@1!@0#T1 zL$ 0R2 K1 0#P1  0R300%0[x 000#%0K  0R300%0[x 000#%0Kܲk> -pLP`@~Vz_1 0#P1`F |V@  ᄩb0`R1!~ z20VS  21!0#P1z_ T`h@ -LDM⬀0dPK`$0 pC@L!L@0\0#0@@T (,L$ 0R Kܲk> -LDM܀0@R@$0 P`(p n 01dPK@xL!wL@060#0@@Td TK$ 0R Kp]LAܲk> -LDM⬀0dPK`$0 p@FL\ EL@0\0#0@@T ] YK$ 0R Kܲk>H -LDM܀0@R@$0 P`(\p 6h00dPK@L L@060#0@@T K$ 0R K\pK@lܲk,> -LDM⬀0dPK`$0 p5@KX K@0\0#0@@TT  GK$ 0R K9ܲk<> -LDM܀0@R@$0 P`(.Xp 00dPK@K K@060#0@@T  K$ 0R KXpwK@ܲkL>G- 0M0|l L\ ̠<Čh4x HX $'4%Č&'\(l * p$́  00Q >I?("(J -""LM 0`, 00 P" 000 @Pp 00#00  "  0p0#0 0  ,G,0@W0 (KoJ -(LM|"X0`Kp U@T Kd J  dT l> -H$H0p!`L BP@0D uJ0 0h諿 -@LfJcJ `Jh\J -LDMBl0 l`0Q@h ` 4K,0  ߦl@D0E@L H P@ T l R L0Kd0 `@ P@X \@ 4K \DKŦdKdP[$0@L`Xd0K@0Lp#D <P`d0K@0D#L4p d0K0@#4<$D,d0K0@#<4($LP`d0K@$4$@pd0K@$<@P`DK<K0!@"\ D0 @@ thDKD KDK 4Kl<K \hd0K0 @\Pd0 `@ X@PE@TX@ \P l`0F@LPK`PU`P`LP H` T``FvT` tDK>I 4K0;I$, 0PR(K)ܲk>|> -L4MX \0  X0H T !H'< \#H@P L <@ D @ D@XT @H 0Q@ < D0 8KI(K\ 8K< 0KT8K8 KPKP[\0@$L`XP0K@0Lp#D <P`P0K@0D#L4p P0K0@#4<$D,P0K0@#<4($LP`P0K@$4$@pP0K@$<@P`8K\0!@"8K 80 4@ 婥0K <奥PK0@ D0P L < 0 < D0 |ꋯ>!ʿ!տp@-(0`"dP  0". . @0   0 .0.   p蔯> 0-0 1 0LPt  s 0@,00@01k -LM Y90 0R40 001#((8, "X#H`p $  H   %`V Xp  $8,  8 ,0S* 1k -4L@qHSth -L,M H D L0 `@ LPH  Rr \PLԣP 0: SP  @0 @0 0 (KL@1 0P80 0: SPt0D@ 0 ?Sʧ LQ  10P ?HK@0,Pᒣ ?` UL20 R02 0 P\V L#0S0 P| VD0S0X0S<0 @0 , , 0O00p'T P @<0O ȟ P T K /<@0@Y80 4@ WQ @,0O0 p"XI8WF80< Z @0 L@@0 0t Mt0D 0 ? SEHRB0T R800  0$5@ 0p RT001Tx?>   cp i  0S0X d @JTb001^ pQ?>   cpG C  0`0CW^ Bb   R 01Q 0110l1X100`1$ő\ 1 0R 02S\0 P3Ѝ 1 >0   r  R 10 01 -L$MH L  p ?j0OO^P`1`>PL 0  BSLaeH L08`0?>   cpH 02ᠢ0!EPL0` p2RLH `08?>   c 02L!0EPP| 00`1ɯ D @ QL,0S PQH 08 bS180 1, !1!40 L00 0,<0 h1< PoQLL `0Oς  1>0PO>p@P` Q 804 \0 0S. 04  0 S ^,@ 0O QD  RH  0| ?(KLH,0p S0QJ 0H 0 U LKkİ>>@4@@@ -LM ,  @_ 0?8  094  ?n40 0-`, p ᰟ@ ,8P804@0\ BQLT4 ABQ0 CBĘ,0UPT@!4 V< ᰤx<0PQ`004P`1`#Z ,功V`!@V`YL#20T 0U00 RH3 VHY@0SJL#20T 0U 00 RH3 Vt\AZ@0YL20 8@T@!@`02 08\Y YPL20 80S@@2 08` BVPZ,(K004`~go,@T, PL#2, P\08`V04`V PT PL#^08@T04`V P P  -L\ML< 5 Qp< @ <`000 00 0<@@P(0PpǏpP @p8@ ?@d_l8 4 @ 8@`4!4P a, QU.QU10P1@ 80<Q8 4 < @0@P @ ?  b<@. _@Pp@ȟP 04 Q 8 <( @@8`04Q SPQ C` 0ᜠ<0 \3R 2<0@, 0PD0 Z= 0Ҡd ` @娀ȟ 0ʠ`@PdK ? |0 | <,,l0 h@  @ 0h@ i@ ` 0 F.lKPঠ ȟ0),@@ ?OD 00C0<0, 2R0S @3CL#020C2 0C1kU @@T@~ -LHM\ 8 0pSPo0@0T8Z8Po0LO P` 0OVʲ 8@<4 S?؞0 @8\00 P4 'L0O0@8 ? 8`00p S 08'8S`0`0`QωX 0 !00`D  @0 @@40R<0 8 08PT0ZPp$P`p6^`0/ 1> R,6@^`0?0 0,p0P`W $ 0 $ 8 b4 D0@4 DL# 00 068Q`0 80/0cQD0@@< P088P`0%X3Q@_`08 0P+8@004(Ko#cUJ\ 80 0LlDW} \P 0,c 08 şR\p00p  0(K8p$8 `$80@_ P L×8 n     ? 0@3CL# 000\@4Q d0@Sq 4R 820PuWI8`@D80V8 0P 980M000 `3RT0T !000l84S}`06C cB SWAQWS3 P`080P 2 8R`0 0 0 8   8P ?0@3C0L" 000\`2Q- d0@_X@ TP S c6Q SPQCX K T 1R] 208p, 0PP0 Z8X K ጝd ` 8娀 ?L H0 僝8@P0`OdKs&,L K lp h h 'L K 8` F.lKPd `0', @?P000 0,RT0T!000\p8 0;&8X P , 0 P 8X Pu 0\8 0 ,( 1kU @@@@@,@TL@@p@ -L,M D `DL@ pP(K D P4 L 0S 4 0/ @GP00a0 S0`$Q\Q\0/ A ?P  4PR\0/ ?P@ 3 ^\0`ω1/p0@00 ,@ g 0p@WXtpP ?វ0 , @30^\0/ ,0>L0 L1000 R!H \%2R> `2^ 0L1/0 H@040  B ; 0@4D@@L#0 0 Q0C0q 4aVh^0D 0 K K _G0NL@ H 0x < 0Ox0K0@/TʲSt0PpD 0(080 v P  oPOP`O<e`0d/ , l1 \00.QP8PPb0 `L=x L0R @iPx PRLx00x0i   ?> 0@3CL#@000|0\ L10  YD0 0 1kU @@T@@ -L$M@ D DPAP(K@D P, L P0 $h0U 0 S 0S P@Q0N 0R P3,C^02SQ0 @_ 0 <@ 8P 'D @_P 80 UAO>@P `L H  Q  P 0@4 S 0R  0P  PU 0P0O0@`0D  `Yp 0@_@, 0[T P Q800cO  vU80pY,_ %1k@ -L0M L `LLH PPT P0 00S  L PD L^U #0O0@00S T08U ZO 04 R40 p F0SFp W^ T K D@ < 8 Z?ቚ `0 , 0 K 1>0 108\` 2Rψ0O0K` 0@1 >00S] 0@ <0 T Z p T K pQ8 4 }Z8PK` 1ψR` 1> 0 #0P @` ^$  j$ 4 D0S@4 DH0L# 00j 040Z0C40  j! 400400L8@K0AD^@@ 0 0 R#A4"\ 0@ <0 S 0@ <0 @K(K80,@dYn \^ 1/X`0 0O0@1>0 AR!0 \ `! 400C40 i! 40040T0 RY3 1> 020$  B$ 4 D 0@4 D80L# 0 ^0C 0  0Rυ0O0` @1 >004]0@ d! 400C4000 c! 400C401kU -LM080 00 @P4P @ß 0y |  (Kj  V ,0P* 00 ,0  V H#0S0C0ß0 K 0P`p40 8 L00Pl0p 0 R RPn 0   R P 0P`04 H`b 0 Rl 0  P  00d0X0 0 QN 0P R R QK 0P  P  Q9 0P  r 3R QM @eP 0 Q P0S st0P0q 00 ,0 {H#0S00}j ^ l0S sX0l0U0h R 0l  r 30l R 0l  l  0 Bh  0h Po}@el 0 0 (0 m>@,@@X0l@4@T@ -LM $5S. @pd`  | 02 f V@ SQS K t@0@ P _  10P|p7 K X\\O\ (K^4KKx0K !P0K Po0@@ 8K0K!P4Q@K00(00 0K80`S 2 K Ze㼠 ᥔŸ ?p^ Z 1P` OP`@0R P R80P0(0 Sn A0S] ,[ P0S[ 0&`pQ d0 c|> @SPQP#00d0  c6 0SQd "| 80O`p X_000K n ^P' 0 S@P0(0SK ,YH K@00,K^P,0 L0@_0 ^,[0Y0[00L00 f0@000 R0^0@Kk -LM $5S. @pd`  | 02 f V@ SQS K t@0@ P =  10P|p7 K X\\-\ (K^4KKx0KP0K Po0@@ 8K0KP4Q@K00@ P p00 80S 2 K Zo㼠  @K0@ P?@Ÿ0 Pp_ Z1P` OP`0R` R80@P0p0Sp A0S_ ,Z ^0S] 0ZZ&`pQ d0 c|> @SPQP#00d0 c6 0SQd "| 80O`p X[000K n {]P)  R @P0p0SG ,yXD K@00,Kc]P,0 L00  Z,Z0^X0yZ00L00 Z(@000 R^0@Kk00 R 0  0S DKk M-L4M00T S@0,0 0T0 SH  `3Qt 0a0S QARQ< D?@Ğ@c.d 0P0@0S@TT 0 Ry T1 0ppi @T HT00,K  \P@ ,P W0,0 P@(K,0 @ b4ɯP L0 T  0\(P@ H@ ?Ḕ @P 0TPD@ /< 8 N T 0 R T0 0 0 @0@T@0\00 H8@d0<s c>rc, S|qQP @T  0(0 ! (pǏSvP@  H@ß 0k@ {H@<4 Sʳ H RHd <@D4@D_@Ĝ0e.H@? 40`S H00ßD T@Q4 0 T T 0 VT@ 0 R T 0 0 @0@T0Q00 H 0@d04# c::@m>t@,@@a04@X@@@ M-LM`  0 00SS p0S `3Q 0a0S QARQ< D?@Ěc.d t@0d P>0@0S@TTD`  0&PP"<4 S<7 0 嫐@ Q> 0 R5 00@0@000 (K#3 CP 0@ 0P84S 0 ?S h00h0P  0m&a0m>t@,@@ -LEM P 8%@  L?0h1R 0  P4 UR00 0a QUQY00 @PP Pb0b1re R1nQW@Y0f00Y{,K 0KfP P,00C!,0  0PP Ԡ  \Kؠ  pK 000@K@_ZP `0 L,1 0Q0 0@0 ,P P+ @0P|r@@Q Q7   @4K00 V@P>40 0&d̠00 V4 d0# c4! 0S#Q d03|04 @L040D 0 0c@TK00\@Kܠ 0S @P40@L040 D {4Q@ \ -LM P8%@  =0h1 0 R P"4 UR00 0a QUQY00 @P @ Pb@ 0b1re R1nQW@jY0N00YfڜpK4K 0-P  04  B4 X`V) 0  LK0  @@ `00,K*VP ,0L @4!\@_M R   |r1p0@ -RLMM@ 0 0BRS> 0 P 00@S1 R4P 0L0( 0OT \&0h R"P00  (pa+ 0 Rd 0@0@0 00 P(K>-8Pp) P P 0 R030P @0A#O1 g00S0P'1? 0@  `HAR-8Pp# P P 00 030 @0A#O1 g0000P'1? 0@ ` HA -8Pp P P 00 1>0 !A `gPP@0A#O 1"1?0P HA`p-8PP`# P P 0 r3p1>0 R! "A@e0 0@A0#O 1#"1?0P01 FA` -L$M p4 P<0 7\ lQRl \@ R^Q V0 #4000400,K0 UKPP<,0Q@4 ,85L 0 <0, (K,JF( 0 0S80 & 0H D 00@@,@^3*.D RH0Q84 Q0085@0L 0 U0H D  -L3@\5XX SS 0 R@0Rh0 S8P0!RTTcLKkC-0 LS03Q% 5p00P5,5MS ڬ4S9Ӭ4հ4S@0Ӱ4Ѝ0t0/Oq,,REQ `PNo,P`PLH0` 0`O/0U4e85X< 8P 0` 4 @( X0<0 8P 0` 4 < K\<@$0#= ,K ,0P@S { 0hy 0P@:zL@ =S P@(K 0@@ p-00LS@P0 0h0S  c`P p0  1yP zcp -LM, `2 !\5SS0 74d 00  8@_d t,`p`p<@D_@,<`Vp` p, ,0C@$0(@[`4P8`,P0`\0(KWTT@ -$0L Pp`  [@P`@0 S@`V m[@P  Hz0 0x @~y -LM$0`bp PUMT500#0PP00U00S@ $KPH50@x @ z 0@@^ 0Q wPTaL$0`B:$0 -LT@d@@ -L,M$0PH ,P L  (K`20D0 wL0H DPPc\L DwZu`2D0OO[/ P`$:,@K@fDP],PLpcPg?L3P#L3P#h zh0 S, 40;40,T?(5`(0/ `,L  40@yP@ L080p ` ,0 Lz,2?80@`\ p@0\4 0f0PH4LD/d  `1, 0P#Q,@K0D@DP ,?r75$%R ,0PS$% ,0SL0K 8< K80 4@ < 0 5XRD  H0@0 -L$M8@pT^$K `P@ 0 [PZ, @ @By 04 0 4O  4$"0@<0 8@ @_@P< K @@Pyx!y`0d  , l1. @\$Q00 (KC@P,0xx,(0 L z, , 0 R,,00000(q>^@ -LMM8X `SKl , p[LP0$U5%0S' S ` @T! 0S@ -<1LM4A0!00hq|_PP1au_PP P ] KO`PP  PP 0   B Z_  ] 0P 0u/ 00 `2@  , <_CcP Xh 0S" 0 dXႻP!h `R YIhx00S $0 d Q0@2pL@4@ -LHM\ \T \ X  P@ 匐P X00S S S T0@0 UP  45 S:05S*P(KXT@ 00KuPP 0T R4 p 0d ` @  8  PD , 0H0 > 7Z 0jSXj ZXXRQVP 0,0T DL @a<L0T@ƠPPu8PoPL0 0Sf45 R , 0S 0 $H0t03U0S000T P PT850 p0L0 0cS0!S<0 PDD\D D 0D 0,0K  <0PP<0 T 0R* 00QRZ 0 0 RO 0XiH |@ T @0D,<,<,0LL 00 Uj 0 \ 0pP00P @@b b3a R`QVRTUR\0P0  85@0L 0G0pP500 @ 0 R 00T 0 @ 0 \r 00"X  R R \T@0y 0 TC P,95T40P*\ 0S 0S 0;0T4 R U @(T000T0X0 H\s0 T4Q8 R 0 T0PU P\ @80dK@ T04 0`@Q T0  0d d  R T0d ` 00q0 #x@LkX@ -L MD < @ @0 080 45Rp(K <Pp < , ^8 T^ @ 0p00@@ \3),XVS ,KD 40>pW@$P(`,4D00cZS[ 0 L < pPu,9<0,p ^p @ 0 @T? @0P`<0ppWX6885004 00 P41P `Y c PR\QZ!R` ?ST@0pW@$0  S(0S,KD 40W>p0P` ,pPL9DL0$   @0` @ 00\RkW@@ 000O8 05RNpH,p -LMLD @ `œP0< 0@ DPK`?O# $Q R<` @$0@PPQ0@ ,P ʅ 0@K0`0@TPpW0@ ,P ZP8P @\D K X8P0O0 K 80 S0c0 jD@Xd 4 <0$@P 0u`p 0K0u 8@0@8@ v00T0O4PP4P $" 0@XDP@  R\ 4  $ 0@K0@TP7"0@ ,P 0pW`P8P  (K Qp0@VPwP`p8P V{@PY`4` D0Ky -LM L0 p @ `T`P @  0004r@ Vl`KU,PK 0PP vPUP ,P t @ 0 R 0 10АAQ, S x` ?U P8x00 40 G< 40   0 R x ,0L0 1@ɯT   00 R 0$ 0pǏ0S#  x0@S,0 x x@ 0P` 7P R 7@(0c c9b SaQSP``(K@ 0 R* 1 0pP`( B b5A R@Q2  Q   00St p0  R 0@ T |  PK | \ t@ 0 R @0 0ppp ,0P`P`WX tK0t p | @Q04( lß2 b91 R2Q0@( "4| P(`80 0@(, 80<@Bo"h00036PP (7P dV RPQx0@L, 1 0R00 @  ( R% 0$ 0pǏ0SR @^ ,0!P` P`Q 0S00 0@0$ p@0SR^ 0@L ,0P` P`Q0SR @PP 0 0,0 S00R U 0@L, 0 0Q @PP0$ p@0Sʬ0@0! (Po010X ɯW1 !0 ((pǏ1p|r -L M P0  000S P K-\0\ 00P P 0 S0Seqeq R0S  0 -hpP L`@ 0 01P  R 0S0S P0Peqeq -0儐h倠L`@p0 0PP 0S0SP !WPP|reqeq - 0L0 0Ceqeq 0-PL@@ 0PV\0 -LM@PQ 0Sp 0mQ 0S~V0S00S L $0@ p0 0P! 0 00 0p R0(@ 0@p0t@0 000   -L@M 0H QL I 0YIDpKP`(1hAL,K 0 @`nP+,0S(\% P 0L (Q  R0.SR 0.SH0P 0@P`Y X0P(K0YX|r -L8M0P( @> P@; (p0\@ K08@haP0 `pvn@P (L0( R-0[.0[S "[0R4 0R R iT(04L (0K@P ( T (QVT$K@(@|r..@ -L0L(\;;m 0-L`PT @HP004  0 00 0S 0` X  R R  0S 0000 d  R E00CS@111111$1$11$1T11p11811811111 000L 4000L 000 @00 ;0 00 L00 00 00 :0 1s s s 40<0@00 0<0 0<0LkLkLk@ R00 0S00@-@0@Q 0 R 08 0 Q 0 $  00 000!0010@Q@- 0@ 0$@!00100000@Q 0 S 1 91 -LEMŸ` , @00i N?KpP81P 0S]  0S00t 0 R 0 0  p  cpPO  cpPI0*000`1"810  R00  0 0#50S Q00t I~PR 0pP9MOK  8 0ppP,0 E 5M810  0S00ttt 0 8M M, 0R!(K_ M|Y M00 00810 8L ~P 0;0̵ =ܲk9k4p8> -L MPp@0 0"&!R0 :R4, 0 R00(p N`P 0 00, 09NMP`0(KS40040\( \` 2 1C0 00 \` PKR-9kx;k p-L M0 0S 0P`@P dP@i?Kp0P`0   m0   l -LMPp00匀0CSBt0|S q$ 0`x0 H ,0 Kx0S@|0@>d`P|0s0s@L |D`rլ@N-+`408`;40Ȭ@A-`@0hv0h u0 hu@-@ 0 \00L0(0Q S\  0 p @ő\(h0S  @b -LVM 0,0 `L0V(0|1 pP0KKU  t! Ÿ, 0tR(K[K UPd Xd2@S?K l1 \Q HQ hA XA vp 0p [KL Lb\1t Pcp1QKF/( tpa\o0 SI* R^0YA:xa 50|@p - P0 @`L 0bpP0e 000Xp 0 R0( 0Op0t@J0@0@K@:k 0- @0@L 1PP0d0:k -LM 0P@  0P$0d L0p( P` 0 R00(p f 0 R 0O0@000J $K0@0 0D0 hA 0@d 0O0 @|r p-PL00@S 0 R 0 X R `T& nJlJp0 d R 0 R 0 X R0  0`Ed AdTKEJp0 d R -LMPp@`VK+Jx0S #J00S B dJJ P 0 R# 0T!X R# 0 R! 00!X R00C0  B  0P 000   0 d R 0 d R c5 00C0000 00C0000L $0@00 4 -LNM0,0 P#0p QQ@ 0;;  N?K@P  Id, 0R(K81` 0S 0 0  p   0 R  0S00t000K@P  K@P{0000ᰠ81000 000000 00@PAL0LŸ( H2RUK @0T1  0H! O/K   <@P" 0 Ri <@0@0 00 8RX 0<1 L d0@P/ <ta0 0C000C000000008H\  0S00t00t0y* 0 8H HI婱<Da@PMOK E< 8 0Y@Pb 810)0 <@0 @ܲk4pLkLkT> -LEM80p,0 0 PR` L L0R 4`H, 0R(K'`ZV  aPF!0  QQ6PB 0d!X  R R50 000 000 008 P8. 0 0C000C00005b2bV  `___0X d  R MOK   0P8 ܲk`>4p -LNMp `0,0 8 < L L0RP @_81V G8PG _\I<ZI , 0R(KP L0R 0 R 0,X R 0 R 0,X R\  Z`@P<@T 0 \ T!08,QQ\ T!0,X R 0 R 0+X R\* T 0: S00SH1 D1 {a8 PL! P T0 00 RT  000000T!T000 T@P < @_P!R P1YGLVGHH!RT 000<_PTT!0 0C0 RT1T  000C0C00T0000</GIH<0*d RX @,0P@( ^G8G<H00 0 0] 00OK :@P#|H <^@ ٯTh)0d RW ^@0<)d R* @ ^@0 )Q30(d RA0 <C] @<^LD!0Rt HPSQ\ @1 X  T[P!R8F @TL @P0  NK :@POH80PL1 P PP PL 0RT0RP  0\ P800P00S;R30S T!T 0 0 0@T0DA 0H T1 0: S000 .R <9^@_<GnH1 0S0X! \1 @! <(^ @N 0\ T!P0S[ L 0 PL1  004400S* 0Q PL!L00p00S P! 0 RPP00p00S@R P1 0: S00ST P0S%B@P 0 LT 0RdXQ L! 0S L,%0QQ@L!000 RL1L  000000L0 00L@P L!0 0C0 RL1L  000C0C00L000XP4\Q@OT!H 0 RTT00  X"6"6@!PL P@P7\Q7 @!RL1  B P00C0 R L 00C0L000P! 0 RP1P  000C0C00PP0 0081 P@0 P@PL_TE80 D_8LE00 0 0 OK 8@PF<\n PT!`Un \1Si &_V-EU<*EFBP 0: S00P 0 FMOK T 0@P X!R L0 0C0 RL  000C0C00L!L000 L^D$h0!Q_L! P H1S@t 0T\Q KXP 0T@!0@00T T@000<yL1 00C0)P00C0(ܲkl>@t@@@@Lk -LMq@`P 0 vy \00 p00R] uP 0 \w 0, 4 0 ,Tpp VpSP (K 04KpL  LS 0 R00t`` 0 R00p@@2PO ? 0 R00t 0 R,00,pP4KJ 0@   \00p00S\00t00S   uP\00t`` 0 \00p@@u0h tp0,0 4 0 4K 0pP  P 4K 0pP,  VT0000Q 0S 0;0Pb 0S_ 0;0ZE@ -@P 0` R00p00LQp tP+Q 00S  ( 0 R00ttP  0:0*0000004  040#0S]O -LM`@ 0 P00tp  00AK0 R 0 P 0p X  R R 02& L0$ (P 0 d  R  0-L MP L0$  00K00 RN  K* 0 RO 0K 0$@ 0 R 0 00D0 0 RA 0K(0,@ 0 R 0 00@0 0 R' 0K004@ 0 R00  $0H0\0 0@\0`@ D  0 00 0 0 001k -@L80S{ha -L MPp0 S`0s0s0s @(K0s(0sX0s\0sP0sT0sW L0$ % 0 Q00p00R s@P 0 RQ 0X 00S 4 R@L0$ \ @Q 0X T 8#8RQ  d0X0#8#888d0X0 0 R%d0%X000d0X00 $00T0 R@ 0 R 0#X  R R q L0$  0z@Px p 0 R 000 ,@ 00S@g S S  0@PY$0,@S: ,0s L0$   0S00p00Q r@P l0;  0?X@P480s 000,0s L0$  0 0 008pu 0 R00(, 0 R @0 @00@0,p] 0 R00 $ 0 R 40 400D00@Pq@ L0$ % 0@ k[0d  @0d 00Q T0 T0d0X0, 00 So*n0 d  R 2 000 ,@ Iq>]00s^80s[<0sXqq00ss|<0sik0so -pL   0@0@0 * 00 0S00p00 0 0 R00t000 0 R00(0p0X0 0 Rf 0 $0 0 Rf 0 , 00 0 R000D040 0 Rd 0( 8 <0 0 R000@0@0 0 RO 00 D H0 0 R00$0H0L0 0 R00d0X0T0 0 R00l0P0P000S;(0 SL084 (0(  0 R 0 dkT\P``0 \0d0h@0 $0 0 R0 ? h0OdkT0 ?0 ? -L80S= 0-L^ P 00S \ R 1S1  01S  RZ(@+[@ 0@@"00000 -L` pPQ @PQ @T@a 0PP QZP@6S@S  0PP@ -L M @p0S Q#0 HPA(Z,6倢 0& 0,K6 8%P2(Z,0aLPQ8 8000 ,  00* 0 R0,& 10C1,"(K ;<S,0S$9, ;18@X@ @ -LM;  ,@ -LM @`0PQ $0: & Kb`Z,6r& 0 K6 $P$`@Z 0L \1 100 1 , 000 ! ; t@@@@t@ -LpMp @P P`, !(p(K: S3 (@Z (0X  0P , L0  0pP40PQ !R0 00S0805 0d0 YY ,&0Qp0 0^  \   0˄ mX@@_1eq1k@@ -LM @p ` RP  Q 0R 0W p!:(@Yl6 ^Pڜ6 $ 000W $`hYt@@\1 -LM @偂,Ɣ 0PQ(K 6 6,K #PW,60 RR 4 $0`a00 ,0Lp9YY P b 00ab P 0S =  0S7  \P 0S P3 0S'  RU 400cXQ`e PM 00` PR 0\TP,m1 !P!000 , B 0 0C0&,? $0"zU 0X1S101P!P P 4a0X ` 3PP ;4e0P\ 02 P!E@@@@ -LM P,剢@P40 (K6 6,K "P0 Y,0@TL% (fX!\1@0! 0,0C040* 0C R0,& 101,( 0(0T0 0d qa P 00`A@ 0Thdp P0`  ;40,10@@<@\@ -LMRP`0 0 0V0 8K 0KPP 8 0 B18 0XpW/ HK  㘐K a ,K6J"P ,80L QAB T  0y4K  0P  4pp40 06d!0 63O|0@0 @L00 D 08P  2Q(K 0 h  q< ,&T0 74K 0 P x4@ @80( K20h4  PA0 ,6 PPP!0 6 3O|0@000(K,h UGA0( R 6,K !P w,00(0 4K 0 P  4 P(0006  0, &402O|0@ ,0@L{,0D,|H0K S`# *@` z6Q` R0 `0P80SK 2@6 , 40P;40,M80@SVv 04C0 00 0m,<j  0l4K  0P [40K0H0 6Z , &402O|0@, @L ,0 D ,-P 3 D0K0 H0Kp "(K@6pD,K PM, h0L  ,   0K6  @P100 0 ,q4 X 0 0 0D0K 0 a 6 0 63O|0@,00@L00DP0@ ,@ -LdM \0  00 R x X 00 L Zt 錐`P|  00t04V@| ,K/l0KRPx :,\:! (0( 1S@ Z* @ T'P|0S#ڜ10$ ,( P0p`e | ^ ,(0 ( 0P 0e 0@ Rx(Kd0 L10\X, Z L0Kxpp0 p Y@[ TN W$p 00t 40/R40p M p0L`,\00Y0S( Z& $0PU"*@| R0 ,0 S1 |0T L, 0 0Q@@$0PS,p 0L S,0 p W(0 30@O/P(04 3)O|0@4 R`0`h  (0 0@(0,@@P x@ j0@f|r1p@-0 : Sl0@@0@- : S R Q0 0Q@l L0S d  0 6d 0p0p -L4MH L HP T0 D PF D 0F$!0 S T^T THL0/l40D}8@ $2ŸhP0`00(80 0@80<@(, 40@< 9Q40P0O|0@R @PT0LS࠳@ 0 < D dD0< &@UD@&0"!h! B 0 <@ DL6 #`@ Xࠣpc4 *1@@4 PU  RD0&L0,K"Hc0P,040 4 H48 4 `FX p@DT 0?^00S <^(  d40@(K@1S D F DT 0B,KH %00P0400 <,0^4 40 ;40t q p|r1p@ -LM0L $0 00 X! 0000@(K 00P(` 0PEpS$S@S,6 6@C,K6  @P'0,00L LPR$@e`S0)P 9 10#870!TY ,$@,,1k -LMpRP P|00 0BRSPuRv D  W'   X 51 6` 67 c SXQ,K/ 00PPN -0 F8>,0L f,0@@/ ,V W0``1 aN0 ` PRQ0G0/,K0 `PP   ,0 00 P(K  L0( 0OT R~0Sz (   f0O0 @030@ `2 PT1Q&  PCl n(K< d4 0OT! | `X 0  ,K/0EP H S00 ,0 000ȟY`% / @P000.@`T`\00S4 0`0|0Q < @00S Vi<@ 0S p@ L000KPL\ Q8 pK06000D 00 z D0p t R\ 0!RX p@L0$  @ 0YJPH `l\ dh P0P t@4N40  x0 L0\;0H CLp8 K06H 09X}l@ p0&JPH -0SH ' pL0 00KPH L D0R0  0;0p8 HtK060 p,p0D 0VY p~@ 0IPH 0 T@t0dt00S_ p L0 00KPH 0  5 @0Q1 0Q. 00 Q* X3@H@ 8 p2K 00K& pL@ @PLP V00D07p8 KPh0H@ 600LD\pL8 K0608 pK@P060 03H@ pf,pD,eH@  K x K Rx -LRMl! #lA0  ,0 4! .KL0S㌀ `0<0l-1K KKNlt 0R 00h1 Z@pIl!_Ÿ 0\A XQ (@K⼐h`@ QKd hYK MOK DA Pa H T `a La HL0@`"00YP tŸ, 0R(K 0#68#80C S񟗹,14141<141D141L141T141$10O Po 0Q5!,@ @P000NK/O?K@P0<0:0806(1gPeܲk>@@ -L@ -l1LM`1`hq ,PP1PA,P <凹88 K,PP q*  kPP 0   B , S 0P 0  0,0 `2`K_ ,L0S   , +0@@ H @ 9k4p- 0:k -pL`P0 00V000  0@0@ 0:#:0 10 00 (0X0p $ 04@,00@ 0@@80<@ 0L@D0H@  T  0000T0 d0P000S;(0 SL084 (0(  0@+` \0  \0d0h@  01k p-L M0@P$`P dP`FKp0S  00ʚ; p-PL@`L0(0S S0S  ph= (ph m -LM 0P@  0`P  K+L0p( P@ (C/`P000'0@0 0,0 hA 0`@@`|r -@L00PS` 0 0 pU &&0  pP0! B!H(& -LMP`V8(&p0!R BpT&& 0P 0 0 0 p pP10C1   &@10C1 0p -L8M"P0 Qp 0 ;;I,0KpP 8崭 c&(K,0 `0 0 0@,0 0 !@:! !0000pPN DK0 D0 0> K4K L0S `0=@K.0<0K8 62K 0C3K L0S `01K0@ 0 0. 00 K/ KhA ,D K0@?pP L0 ` 00Q!/pP 0! B! 01000,%~000  pP ,00q \4p|rd@ -`@00LSPk=p%L L0R _=%pU  O>pP-0!R" 00 F=pU  |= !0 00pP 0! B!Hլ&=p!=  >pP 4p -LhMP @, 0 L L0pR` =,0T X%,PU%<&0& (K\ L0R0 0 &0   PY  =P08h t !Ry 00qt 0 l0: S\ X  &,0P`0 hd ! !h 000PP Y 0 0-@PL֥0 0 0000hq<> p-P`L@ť @` p 0-@PL 嶥 000 00 0gq> 0-@PL夥 @ P0iqܳ> -L(M`eP@H8 <0 6vG @PTS `0K$  0X ! W01,K P@ 0 4 `,@P `@PTV* 40 S 4 j  0L <0`8 `_ 8000 D08 0(K80   0800  -L@@@DT@d@ -L(M8 `P (Kp@4 P* 2P@T% 0S" 0S0$ ,(00 S ! 140,K0K mP ,  @0 0C"0" 8 4 0+$  04S0!0K,K >P0  @0"0C0 p-LP`0㤤(0@ `0 pgqT> 0- LP@$P .P 0Q0 0P0X@> 0-LM @PVP(0$ ΄, P R 0S B^R P5 P8 0庬t@> - L@P嫬X@> 0-LM @PP8 0嗬@Ĵ>]gqYhqU0 K``  0, 80P` P(Kf4   40 ,80 PP   0 ,80`P P  4800P, P -L$M` p@ PZf ^ 3: @g `@ PpK 0-@ MLP  0P 0P 0Pxx 0P` 0TP@ߢDD0*0<0 K04k`@iqh@P,,0 S 0 SP 0 S00:S -L !Q 1S 01 0AS 10 ! 10A0喩唩@@ -L !Q0兩8@ p-@L !ƌ\`"S  QP P 0 ]/ `p Q0S  0  0 00`pU SQ\@@|@ -@`$0 L0b#6<@ SpTQ&0@ P P%/TP\P<@0!PR00R0S0 !P /\ -LP@!ƌ0C  0S0 !hg4@ -`LVP`PV@p$4 0SPP 00 0A S 10  ! 1 A 00CS0 UX01SZP `FPU -@Lb (CP  0R000 00 0 p-"fL@P  00b0fS 0S 000  p僨偨@@ -LM@p, ,P0, a@T; 0S"4PU(0 ( 0=p,P ,P(K 80A0C0 ( Q 8,00,0 PP  0 =PE, -X@`@$@R -PL@ṟPP) $F%6@,C0p0!a @ ppf bBPP@ 0 0!< R$0(0$ (帞PjqXkq -b@L$B 0@sbBh裞jq 0-0L@1$ R(0(0(0  R 0 P 0S P 0PS0!P 0S 0CS0=0PS0000h垧0l@ -P1LXM@`TPpF pTK0K‐K( 0@ , (0$Q\ $ \0K((0$0^X0 $ ^0 !0SU000 0Rp0 P ^0\Q,0@(0,0\QX0(00P0W0X S(KmXkq 0-

)4` B6_O((A<L 0 c<000C0l4pi "101(04(0(4(00 <L 0 c<0(p T2PKh 0 000Ÿ<0 00, D0 LPPb0 X` ,K400p 0Q40KPPo U0!_@ P6b(PK  0eP07^4: 10 14(0 ^4(=4E(PK !0H0005@k^4L  0PK9 5@_'(4xkPG((0?C  PK 0q^4\xmqܴ>@@@|r4@(@@p@@PK`P@@Y00SVH4(0 R^4'4(@<L 0<cP T  PK08^y'(0  !?(0 Q-L`pP#*@JV  0P T   @- 6@004@ 5@80<@ 3@ 0$@ 1@(0,@ 06@P0T@xmq -LM KLH0#&R*0R*0a"!B10brq -0L@TP" Pp` :S0x Q *Q@T (0" -0St0SP@pTV T0 RZ 0 0m$ 0`U 0oNkxmq 0-@L P0 PT*,TQ0Nk -RLP@ F TV 0mK 0 0.  . Q! 7 -L΂n^P`Up*S N@ Pey0,0 h  h rNk.  . Q : -L(M@ .  ^P U< p#: (K  P e!fV8  @,K , 0S0R*@VX 0 PP  @TF (18P  14@K0@ 4 0@ `'P)4 R @Q00000 0J8 p4 R|$< e<@ wP 8080$8 E 00VkNkr -@dPN`@ RL @pp .0  @ Nk -0LM R' 0+ KKX)  ]/6/ !X0@$ H 80@$ H K:xmq|qNk/k@@ -L$MD @ Xa 0H#Y*qZp1H`00X80 N J$J>00>0Sp1x# Z00 W0~Sp8  Wz3X@3 8 ,0K @P 0d,S0!D <0 8J`  ,4PK@ 04@ 0P @a m ?Z<0cX@ (KNk -L M0`SpP6 0SA0SR4KP40 0 $*@,Kd P P,!&R*<堔0R*0`"!B1 b 0 00  000 JU  &0 ^0S(K0t[@&g 0`S00g `[ ,$0 60S rq\@8oq>00  % -L(M@  pDL 4KT4 0 < 0 SRS@ 0 S: 0R  48 \= \: [`,K < 80,  00y0P!4@,pT 8 `,:,0 @T @ `\ 0 8,:,0 @ThY4K%(KHAf0S 001@ \0S 0Scf4K%0C! S, 0 0 h0Q @ T00 ZFf@ 0@ `S  @0RV< "f @0 4K` %PS |@r8oqLoqlA|r -LPp눀`0t@"f 0R 10 P f(e*9(Nk8oq -LPM re 0RZf 1   e Pqe 0R1   ehK@h`Kt!p *\0@P0 pP`1XeP1 Q 0 hK!PR UYeZ YeU1h K@U@PQ x0*1(K0@p  P0 [00 @` P@meV8oqNk# Loq@ 0+|K2Xq@ -̡LM Oe Q 1 R R AR   Q;* 0 1 S0P1* p X00W0S1 $1 hWp 0`$K0!&0@P0 `P?pX(10 0 Q *0h6 0(0  X00W0S X H 10  0 R0 0, S0, >+$K8oqpvkNk# M2 -LMP$ Nl@T`p(KT,K, Lh0   P, 0 Y nq'@ 0 p-LMP h`K! ̃.' 0@P0 gPKpnq 6 0 -LM\ ~h(K!p@ 00  0@P0 CP4 1W , 0( 0cP`Y8 0:P@zG`W h 0 &@P(p0x Dh1pS /W 00S,(K, `,,  apnq'Nk|r@ -LMp@ `.` $PK @ 0$@ P @kX K -.L M  8  0(Ǩ0!Y# 0@P(0 P0 ,(KZ1P ,0 `0ap`p T1ph  a(RP4K@  0 4@ ;#P7,P0U/88 ,0Z0S$ :@`p4@ P00000 0 %(Z0 8,0Z0S$W ,8 Nkxmqr -P`pWL @P( (0 @0 X|0@P`:P@`XW%&* <&%  Pp00Cp0@xmq -LM>0`~0^p@0P 0` `P @P 000 T 0 00 0GP  K0 @PXVT''@@ @ p-LM1P0 @|`|0 h0  `0R0 P b 0K@P0 P 0`Kp"8mnqr'NkL@ p-PLMP*@`Kp P \0#&R*H0R*0a"!B10b %JUxrq|@ 0Q-L@ 00SD00D0p@-x|0\ @!@1Q% \ 1 !R`#`3P Q#3Q030 "SaP^ Q0#02SQ#3T0#0 2S%ppP 0 S(0$ ,00\1P -L`$@0@PS:b V@cp V:E f@U>0e S 0SR F@U0P@0F\2 lU" R!0e S9A U R0ST0l0U 0SS1:Q0P@U 00b S9R R0e SYD0S0e SI9@0S,  `0R 1P `0R 1 -@PL`@T `0P 0Q-L@ 00SD00D0h0@-D0DQ 0$@ 0TT0ST0SH H0RL L0RP P0RX X0R 0 00R 040c@P4@PP80S@Q 0S@ R 0S00 0- L@PP D0 0U:$0U#300 0 0 P00P0 Q-&:0@2 8P 0Q:0Q4(0Q*00Q:40Q:<P 0 R 0Q:0Q4^,0Q*LP0Q:0Q4 0 Q:\q$0(0@-P Q0#03 P 0S @@1 Q#3PQ8Q 0T # 3P R0T # 3S RLQ T0#03P0S T0#03R0S<Q 0T # 3P R0T # 3S R\004T # 3P R0T#3S(P T # 3 Q R,T0#03\0S 0 0\q-$ (,(0 R:,0\3400R:40\34000 -LpPU/ 0S,`@T1 T R& @TP @0 Q 0` {0S0@  0S@@@`mP iPU 0 00p 0 0  R P; X> P@0T 0` @H0S0P  0SPPP`:P 60SP0/0S0p  0SppP@!P0Pp0p 0 0 z0S@00S0p  0TppPP@p -Lp` R 0SPU 0SY0 0`R 0S0S @TP R0 0@ T`@0S0P  0SPP`PP@@ PRi Q 0S R 0S 0R 00  S`00S0@  0S@@@`9R 0S0Q 0@ ~0S0P  0SPPP@pPm@ 0R 00  S`0_0S0@  0S@@@`QPN R 0 00 0@ T`@?0S0P  0SPP`P1P.@y R 0S0P 0@ P0S0P  0SPPP@ P @ ` -pLWP8 @TD@0Sp`W`V p 0Spp U`P@ 0U@@ 0R@@V @@TX  p`W `Vp 0Spp` 0-PLP@" #3Q R  0 S R0P 0  Q@@000 0@0P  SP 0S0#03 P P 0S0SP0SP0S  0- LP@P'$ Q00R03SQ PD0$ T(0, 00\ H00SP 0T00 -PL@p` 0!S8@ T- P $ (0,0 0S*:@@P` $ 0S X:W WP 80P L0P sV@ 6P@ A-P @\q P 0S0SP0SP0S PQ00SQ00S p- P$` UZ3@L<MLp000Q0|& -0L @r&h~&0% -0@L  A%p3P 0000%0j& M-LM4 040` P @xh 10 Sp!z3S0CD  , , K00K0 PPFY`+,PU (0$ 0TI*,Q $ (0g (0R,T:00R4T*P* 0@P@T :,P,  ` h(K0g00T0@ , K00K0 PP  P40`@y z`, ,P `$0T* , r 0-0L@P!4%P 0! 000 Q00000 > -QL M8 <0 4  0Q:$0R, ,(K /4 8 0PZD0 D0$Z(0, 00Q 0ZU Z , D0@000 00 Xk < h P2 Rd $08`Z p1p!Q`!V< @ ( l@@P PU < 00CSs2s2t2t2s2s20S]40S0QO jW -$0 Z p1p!0 R <0 L0 D08pl ^0l 0l04P`@p0< 0A, P , P Z 4 _[$0Z p1p!4 U, O4 N0,0 H(0  00S @a00CS0a0,0 Nk@ - L@T0000幈Э޼@ -L` PP1 .@Y T #pN U $0R P@T,(0, 00,000  0@@ 0-L M 0@RPP xk0S PK0$0( ,0 0 $ (,@ @NЭ@@ -00h t@RLA>00 p-@`LP$ 0 q= UpPP+  @{PP@ 0/B000cStePPP@H0/B000cS 0p$@@@@VUUU@D;A@ -p ML`8@0P(,0!0 @04 0P@V (0 L.P) \ K& Q QA ,(01 !0B@@0S!0S W@T PP W|p \@XL@>@0@h@@L@@nq@@l@@@@nq @@ -L M䒟p`$0 , (, 04 0 |$0@"Z78X 0@P4K08"P< 0uU@ 0Lm, 0Rq(KP`d pt x| Z $PP 0 $04@ <@X@H0D0L  P0FT0T  XF T F0T0j(0$D ,FT@PF T `D0FT T  0lPPnL^ܲk@@4@X@@7B@@@@@@$@T@@@@@> 0- L M0 \0\0\ 0d R@P 0xPUh 0`dP@LL 0Dd@D(!yK0h/nqm4k(@q0@`q8@q -Z%ZULp`e   ; < @$0X+*@0(PS$@d,P  << xD05 0P004 48 ,0S      o(P$$ bP!  b `h0@,408@0 dPtu00LeRT$0 -\0L@  Dh{8hzGT((\ P1\@0CP1hSq`qnqxmq p-0L1PU *T`P\@T P10P1\xS0\0T0000p0 P {@P \P 0 @Pd0. d0d0S0ܵ>>woNk@q@ -LMPQ`p,P  k, V3 0@U@2 $(0, 00Q[ TO ,0S(0 S$ :(0` Q , R00S 0@$1 V ,000f,0 `YU , vT , nO@ P f0,408@@ `$`( 0 D L H P T X < ,   0Q 0f S :j(0(0\q 0-LM@P yP $ ,0PgP8 -L@P`i (P,`0p4m -L Mt@|0(x`Pp!p1PP1P!\  0`K,0 S00S40S -PL@pᤀ40 0JS`!`1 .P_P ,0T$0( $ R 11S63bS$i\q -LM$0  p-L*"*R@` 00 P 0 080<0@0D0H0L00,0(04000 $`l@d0H00AP 0 pph y@|hq@ -L`p PP` 0@ -@QLP`p @0S@0A0 0P0@ -LMp ,@Py 0`0 Kq -L MPpU0@`0 U (0$ ,0 0S @PP / $(000 ,,  @  00\ 0@0 U  0 , 0 0 %(K $ X00R0S@ -LP`p < @  * G  0ix p-PL`@ 0phj S-LpQ 0$ Q`!`1\ P1P!V: @P $0V* 0V  0  X@P 0U$0U* S-LpQ 0$ Q`!`1\ P1P!V: } $0@V$* 0VTP@P 0U $0U* xP@P  E@ -LM$P\@`p:\: 0Q:R*@ 6 KUP@   0T$0V :Q 0S @  /   $0S00S@0SD0 0D0 @0p  48 000 -. ^NP@LMU`P@O 0U@3K:$0TG0P $pU@*D0=P 0T C 0TAD0;$T,0( 00S1 P$0T'Z, T0S 0UHT0S $0T<: 0@O@@$K@  @ yT0S 0U T0S $0T : 0q@ } x O J -QLM` 0$ Q!1\ P1P!Z#:  < V$0@ZlTv 0U  U$0R D0[L00S^nP 0U Y10SX Z:U?:0SH   L`H H`R D0T0ST0 $ 0 T p00V00S49@P) U&$R D00HpSW Z $U* @ % L0S $ 0P  -L M`$ Rp1 p!Q@!@1T00 :(K $0PS  Y RO 0TO0U,0 : 0W7y3'D0 0S,P  0@ 00S$ D0$0  0a c , K00X 0PW $ R 00S W* aD0 $ h@*@`h@P ' -LM<0 $`8 ( 4 ,0\p 00 ^ <0P 0,0 @0408@ DPTP K ۦD1\ @E -00CS2Թ22222Թ2 1S x0S0T R 0S@ @ \ ePp0 #50a,#50 ^T h!\31C0a 1 0a&1 %\  @ `1kNkoo\|q>|r -LMRP4 0 `P p 0@00 S P(K@ :#:S (, d  Q 00S Pt00@T Uf,&nj,  0, 0 4 0 PPCX 0 Z00W P2 H40#&Rz\ 004 4 60Rn:40 0CPP 400 4  RT#00,0@7`p ,0 40 Ƞ, T 0,@Ȍ, `p0& 0 W0@0 -000 _c 0Px4 0  C@P0r Ux40   20@_ 00SP P> 05400 z P30,@ >0>009xmq -LM ʠ,ʠ\ 0R lR >0. R 0^  0P  0-LM@ʠ,ʠ\ 0^* @l^ >0^ 0T.Ơ0 H R P 4d 6R0  0mP 88`0S*#8xmq -L ' -LQ 00 ` P00 P00S#@-@ʠ,ʠ\  0R lR >0. R 0^ TX2X2X2p2x282@2  0@/  0@,  0@!-0 " 0S  ʠS,ʠ\ 0R lR >0. R 0Q  0 0@-@ʠ,ʠ\  0R lR >0. R 0^  0@ -LM ^0 ʠ,ʠ\ 0R lR >0. R 0Q  07 -LM@ ʠ,ʠ\ 0R @lR >0. R 0T`V0TK p e 0P $PK0@ $@ P @  -LM00  0 0 , SpP 0 ed`Va0`0S0 Z > SW UU )YN>0^PUK  i:#:SD0QA0S>x3Q;,  C r  p0 h0!6@ Q 0@T; p@@1 `,K0,@P,000 R  JZ  0U@(K 0@pW P P @  0S  @S @$ 00SS@@ S R1S``/ 0 5  @ S S x0 P:00 z 0u  S0`  XʽW@ k 0K0 @P 0L 0S 0 @ kj 0CZ p@ C먠 p0 S -L,MH T H P :#:S0D >0 Z< *2 P08 40 \8 GP L 4 S TD8 0P4 H4 PXP , K Pq ,P. 0< R*L10,<$ QS` 0R]:D0<Y!0000 ( 0 0 0 R" Y0 Y0,P,  0<Q PH T8 LD8 L 4(K@ Y@  Y@ 0R0 , < aP 0S0000S 0S,00 @4` @dP bP00 PH T8  040 4  -LM`@00 SpP (K 00Q, KgPP00@0S 0 0K PP000, R 00CS 0,C0,0 00@SP 0 0 00 M-LM0Z,  (KYzpP` ,:p@ Q P`ZY M-LlM00S@#vzD0 | x0 p XKl`Kt p 0]0@ ,0 妡0  0 0 0, K0 tK0 Px F,Q *@@R (0 ( , @RRP@ZP  000000  ,@Q, 0OpW0 6OtK Xt p 0ʡWp@t0 K@Qx(K0@-P@ R( 0S%\ ) \ ^ \@ 00\0 S 0  0S  R 0000@00 R P, R/ 0\00 S 0  0S   0S 0P@ 0S@ @0  @0@000S 00S0@ 0\@ @  @0@- R 0S ^ 0Sk0 0R 0SI0SD \   R00  \0S0  0S    R( ^ 0Sm R 0S 0R00S 00 S0 0S    R 00000 \0 S0  0S  R 0S@0T00 S @0  0 S  0R0 0S00 S0 0S    R R 0S P0U00 S P0@  0 S  @ y -LXp5 PU?P0S `X`V 0S @ W`RP 0WP P 0RPPV 00SZ   `X `V 0S ` P 0S0SP0SP 0S  P 0S 0SP 0SP0S PQ0 0SQ0 0S0- @0 S0 UTR p-@LTP `P`@ @T@p 0-@LPT P@ @T0 p-@LT`P@P  R0T 0@ PP P@p0@0@ @P -LTM@ < `K Kp@-d0 P0U#F"``@ 0T !P01Rb`0^pNkq 0-00LS@(0P PR0 00 0  (700C0(0 00 0000000  R 000( 00C0 R 0  0 xmqnq 0-@PL(0hK -@L(hZ -(0L@ & R4 000(  00C000S(0 R0000 0| 00  0@@ RH0 0 ($ $00000 xmqnq -00L0CS00@008@0 (000 00C 0nqxmq -@LPP`p  (00C0, 0 0, U ,00,0 `$pP(Z 000 0-(0L@ R 000  0( P 00C0(0&0   @@(P-`0   ~(0 D0 0h,00  @ @nqxmq - rL\R2$ RP@L0R P U3 @0Q  Q*60 0 0R0 4 R0B60  B0CR0 \4 `LV`@DPV 0 SAP!@P@ 0R:P U1n\ `LV`@DPVʹ|n60 0 R \ `LU`@DPVNknqq@@ -LhP \0*0  0P 0@ 0P mxmq@@ -LM0  4 0  P, 80 < @  (2(b$ȟ. 0PQ<0 @_TO T"vM4(00\Qh!D0R A0R @0 Uh!D0R 0R d (0 0R0HA :#:S 8 l40Z C$1P*VR, 4B  ,F@<00@ 8!"&0@(Ko 0@ ?SʭRD0@0@T P0U ?@P 0QʙP(KST2pxmq1p oq|rnq6pp@@ - LM 0n`0gV@P0U,>0 N@ U $`KP% $J U(lhh@ 0>0>0 0U l lNkwowo\qrL@x@@ -錒LM™0 @0 ,  0 @@>s^ p80 0b\0 "6!v21C!@cw `ך0SG 0PcW@"#<:21CcT F0 U` ` T 0P08@0D0H0L0 R 0S0!% 0%0" 0%^0 c21C cls0S 0pePcUgk 0, >0>00 00 >00>0h 0 P00C $ (0 0, `\0T(XL(K,^knqNkq5qxmq@wooqwoNk@ 0-L@\ $0X(P 0hQ(PA (P$ A000A -L$MŸ`@0@VPU8 4 <0 /<0@PPOTF` 1@ ?S,) Z 0s ,0 S(0 SH1H!hD0Q>P`0@K  0 @0 ,@ PP @(KR0D0Q Po0RO 0@VU10@< 8 K hV (H@0 Q(0ST2pxmq1p|rnq oq6p -LM0.`p,@K 0@(@  , ,@T P000(H R000(0  0  0 ,@PT$KVk p-P(L`4@ T` (@l00C0, 0 0, pT?(`A AQ0 x10  Ǡ00C0( BQG 000Ȍ00C000S 0  00C 0 R0ƌ00 $0S0 (p0S (0``p(`00C0, ( @, Q 0  0 xmqnqy`Nk -QL&P`  pW& (0\`VP @0Ds(0 0(0 (`AVP !(32 -LMP0KS4 0P , :  .0 P0@T( 6P` P ` 4000pH( R000,0  0  040@T(KSi @ 0-L0LP@L0;0 0P Ed0 $0dE@d;00h;H2oq -L`\p/@P(0$!  R (c!P\@P P W (0 0 (0 R(0P@\(y(0   0p  !  -LM00 `pP@, 0 \     0 ,0  , 00 U~ 0 A,0`0 0W3 0, x 3X00S100v03 R0S ̠@w@3PVP, 00Q (0X 0) X0TU(K0 , x 3X00S R   00 0v03R0S , 00 0$# $X T 0  ,0`0 0 00 ( -L(MH L0 80K@0L0p 00K@ ,0 PS0 , 40 Sʔ 0K80K 0S @PoD#Q {x L 0 0S @#6:1Y<   *0D @0 L@DK P`P`Y ,0S<Y< 1@D0 @@ 40SE < R p(K5 H @P (    Q (p;( (p4 0S Y0@*A0DKP0`0D0 (p*00S 80SPL`0`0j00`Sf*a80@SfP`8P 4` a -`LPp@T6U#:0`V @@d:$H04$ 00 F$0T.0S |h9@l09TX0&h<90d#8 # 5.VqqqNk 0-,P& L@0hr -LDM40< ;pBf 80S0l0 40V70#4@hKL0@TLl P0)R@(0@l  R00 S (j@(uPU@ Z0 ( \LhKY 40 P](K\2p -0@LNk -LMp d9aP U 0P 0S U@ P4# @TPU@$  0f/`P0S U@`0` hD0@Q@P404$09 89qq8@|rnq -LM`@P V 0p @ZUJ 08 L0pP  ,$  r 0-PLqD8@0` 8Pd `@0@0S T0qqnqNk0@-dd ,\O 0C2dS03S<0<<0!R?CQ@00@0,0dH00xmqVUUU - LM p 4 X W00S7 R= 6& 0PQ0 P`@ R 00R0SE 10 1D `(0 R  01001 X W00S(KW  X_ 4 0S0S0K,0 000 \褟`p4@, K00KP @P4p@T X* (06(P(0 #T`^ TNV (00`8!00 0X8!0 (0 ```@@ @B`G,04 S0K,0 000 c040(0C40(0s$1 0$1(@00  p00p01Y0100^,10,1O0@ 0SRH+ h p0Si l0RO (00 z000Y| PlW0@Y Y1( K0 00' @ 0(10(1(W0004AtK@P`, , K00K4A0 P``@.00  0$#0 @  0P:)(00 "0F0T0  , 4K4 pP  @o00 0$#(@ 0$#~[0  (@T2p1pxmq -LM肟0rPo!0PU` V0P!@ 0eSB101w1Q d0Sop:P1L2d R@D0^`@ ",0 lh0Qr 2PU> 0O Q ,R0jaZ``X@@0 *W( Z``X@@P ( p0S; T  0P( V <1W0J<1 0$# P (`HPP 00(M( H40(0C405( p0Q  \ RnoT2pxmq1pnqnqnq -0LMph!ԀL `B6``V  0[,``V 0I`0d640< 0B6C0 P3@2U`<6,04@Z0_*(D6|rnqxmqoqoq؍@nq oqmq -3LMh!D 2 P*. 0KWi @5 ,0R0S1*W 0T00000 0R0T000<0 0 *454P(5"8p@Wm 0 00, 0 5 AQ4 0!@?CSD00D0W0 #0/Q R 0O0S@PoV 0a0c0K┸W,!,0 ȟ00X@T@0@PoPU`Q- D0Po0Q RO 0@Vm@mUi@iU` 0a0c@\0 pt+18p0W1800 ,@ PN|rnqxmqnqVUUUT2p1pD@Nk 0-0LMx hD0@QP `,5\t)0TH/PG+8@a%P (za$0 Q|rnqnq oqmqP@p@C( 0@-P@ R( 0S%\ ) \ ^ \@ 00\0 S 0  0S  R 0000@00 R P, R/ 0\00 S 0  0S   0S 0P@ 0S@ @0  @0@000S 00S0@ 0\@ @  @0@- R 0S ^ 0Sk0 0R 0SI0SD \   R00  \0S0  0S    R( ^ 0Sm R 0S 0R00S 00 S0 0S    R 00000 \0 S0  0S  R 0S@0T00 S @0  0 S  0R0 0S00 S0 0S    R R 0S P0U00 S P0@  0 S  @ y -LXp5 PU?P0S `X`V 0S @ W`RP 0WP P 0RPPV 00SZ   `X `V 0S ` P 0S0SP0SP 0S  P 0S 0SP 0SP0S PQ0 0SQ0 0S0@-P@ R( 0S%\ ) \ ^ \@ 00\0 S 0  0S  R 0000@00 R P, R/ 0\00 S 0  0S   0S 0P@ 0S@ @0  @0@000S 00S0@ 0\@ @  @0@- R 0S ^ 0Sk0 0R 0SI0SD \   R00  \0S0  0S    R( ^ 0Sm R 0S 0R00S 00 S0 0S    R 00000 \0 S0  0S  R 0S@0T00 S @0  0 S  0R0 0S00 S0 0S    R R 0S P0U00 S P0@  0 S  @ y -LXp5 PU?P0S `X`V 0S @ W`RP 0WP P 0RPPV 00SZ   `X `V 0S ` P 0S0SP0SP 0S  P 0S 0SP 0SP0S PQ0 0SQ0 0S0@-P@< R( @0S%<4\ ) \ @^ 4\@ 804@0\<<0 S@ 8<0 < 40S48<< 4R 0@000@@0@0@8 R @P, 8 R/ 80\<@0<0 S@ 4<0 < 40S48<880S< <40P<@ <40S4@8@0<8  @0@@0@0@40S<80<0S<0@ <40\4@8@4<  @40@-4 R @0S8^ @0Sk<0 @0R @0SI0SD 4\  @ R0@08@ \<<04S<0 < 40S484<88@ R( 4^ @0Sm8 R @0S @0R@040@@S<80<0 S<0 <40S4 8 < 4 R 0@000@04@ \<<08S<0 < 40S488<4R @0S4@0T<@0<0 S@ 8@<0 < 40 S484<44 @0R@080@@S<40<0 S<0 <40S4 8 < 8 R8 R @0S8P0U<@0<0 S@ 4P<0@ < 40 S488<@88 y -4LXp5 8PU?P40S8<`X<`V@ 40S4844<@< W`RP 40W4P8P8 40RTP! @TV p80 #R 0Q:p '88 880 a0lS`1@P11TV@808 V0b#6P  Q00,000Q P 4$0e 4l  el pRxmq@ -LM`d0pSOL`VM PUDTU 0 4$0S0 @0,K@ @d@P DTU `VZQ!00D$RH4H4H40D$H4 D$0-H4 P 40 4l0  l (,0(Kxmqq0)#> 0-L@T4P$SE^P T40T44   l00l0ST$P4RmP0000 -@LPr"D@0D 0a cD 00C 080S00S+I0S 40;40 8 0 0S T40CT4i!D0S0HṢqq p-h0ML` @P0 K@ @?P0,d(4KpRq@ -L,MD PH "@tIL e!HL 0@0  DQH L0D@0 0Oᄤᣫე< D LD  ?0 PD#<0eX!@aIp6!H0T4 0o@ 80K4 P0|2|"@`\|P`0 @<8Ld H< @00b ccQ3R 3X᐀ H0 R  H<@00` ccQ3R 3Xᘀ L0 (!LP0SVL , 00 0vD0ED <\< " @0O@ D L$@D? 0 8K 0K,0K@P!80sf40sc=QR!PL0 0R0  \RH408 ;40LGH庡 (K8!PL@GqqN3!Ce@O3@ -| 4DK#6:Lp@lP# (4@$0cOF#J06T[Qd@ QP!@P?0O|0@X i i40 ;8 40 @hiD @ 0-0($@,0LP0%P 0000(,P $$4R@00S# 0@ P 00 ~t$h00bh0@P L0(,$0L<0>\0@ PLoxmqqA -h"LM@d0Vp@ 0 08PP00ST S P"0V 00 6(K$40"!B 0S p@ @0OD0 K4#R0 A0  ZPHQCN@ 0p ,!N\0@ Ipp@t>00S(  0=P" P0K 0 PPL0 ,|KPPL0E4 0P44;L$@  04 000h0P0h0LoWkNk0A<Axmq p-x1L M@t: \ \H\P C0`[0\ @:KLP$$G/ P6 $88#Č@ a@0,  @}N'0@4 C0hP Kp\\\@\\0 ONȎkPA|r\A -LPEM0`,0 p`0SB S @P@ 7, 0R(Kx3Z ( `PUDTU W 4OF#J64; 0#剭@P0+Ȯ@PDTAnU` Z@2@d B~KpGB>KpG0C0C+㓮@P+0.D0GKL4  0C@PD p$ t4 xt Hd @P0d0CS]3x]3]3]38]3]3]3@j00Sx0! @\ `XPPV  {_P@ 0B@@P\ @8\P 300@00Sx00 0000S1  N0\ $0 P@P 00S \\@P&\@8|N0 ܲkNkqxmqĎk>hA p-`QLP@@Tp -LMp` !0@,P@f TK0$@K0@ $ @ `cPV@P$(ⷸP R000 0  U @nqxmqVk -70#L0`M)x0 000p  t P| D W0X$80 S+:S %0 80 S :SQx t`Q$ ~EPSU$X |lKi@ lK ptQ  PS|@(K@P3P#hD0Qx0S,#t0  0OF*p#J 6|Z4 2"`00 L|d``뼂@`6Q@0<0 t0SM d2d"hD4h2\@0`"040 ]@  Pp |< @0`| l00l0x0S0 k |Pp@`*`(зVZJ|(0Kp# p倀| K40x;@@P40 6|ZpW$`Yj Z *||(0`S0S PAXCs8Z p|lK|Z Vk\2p|rnqo!Ceo@ 2 -Lp@Mt0q0 t0 pP09LK pP00P00Sp00p0xmq00  -L M0 S0d @\0!@@@:0P  0x@Eh d0@EKhD0P 0L,LoqxmqAqAqAq0nt`Q70 a@P$0S, d060>0. V  b 0 K@P0 P  ahJ K f 0d 0f#&Bd 0S* 0d 0c#&d A P-0L R.  . hJ<A 00 0 -L,M0P ` Zj @<0"00S_ P@@ SP  Z00ST K0R00} 0@0@TT0 C@ @ء0 h< L  @00KP0 H` Dp ,@ 8 @@ 4 W 0S/0 PK0 0`@/ V @ T00T00S`' T A0 0C0 S/ V(K" S@f0 PK0 0`@h! X00R0S T0 `Fy0Sx6 BO`Ph T {\A|r -LM< -L M@H \?pP` 0 \p:@P`0s P,  (0  X 0  0\00 p0\P P(K(],000P0\`p \:@`pPUY   U  R(,  (0 (0!,PU (,PP 0 P[ R, PPU ,K 0PPP ,@(,X,000, (0 d, (,tAhA -0LS0S\PIxpD0 0@`,PXW|A M-LM 0  0 0U@` | x t 0 |t\7zx0KpP` P(㕳:@p Q P`|@T 0x@K0`@ P P,0 P ` KP a ( a  D0(@V( { @V 0Ql :PK`@P|`\P ` \ Q 0S @0000$0S0 =0(KS`p00 @P`@P |` VPK`P`0xP t` ڀ0 |@ 0q|tP  (  0 S0@0   (0"MPK`2@P`P ` PsNIԲ@ 0 S0pK p`K, K0 ,` 0 xPK``PK` P`XP   `Vm 0^\ ,0Pq (0S(@᫲㙲G @ 0Q# 000^0 =ڐ,0Pq0 S@ 0R01 R00 ( 0(@s \0Ux QQ`VB0! TFPF@   :0pKj x@R,AAAA -LM0`p @0U `p KT0 Z 0-LM0@. 00H00 0 PE0S P0000| R0S 0 Sj00    Q$0$0$000 K0K0hPQG(A4A 0-LM 0@C^ 940 0P405  0   0 S 0 " P0  0 0S    R$0$0$0  0 0K0hK00 K0h (A p-LMP8414a@0TH=L0S @T U0 0S3 0 0 R(0( 0@ @T@T|(@T 01 P 0S0  Q$0$0$ 0<0`(@TKphw 0DqTqLq -0LpWP  `0V0 ` 04@0 0h!6h!|r -LMp 00@"0Q0\{  0SQ 0 0 0  0S 0  0$0p0$<0@60\0< !h1K  AP"|PK`| H000P`@P0 @0S 0  0$0p0$<0   0 0@0 K  0x0 h 40  L( K0 P$0P0( @(`0 @Qd&x 8 0#40"!B 0S@v`ATq|rNkWkhd0 TqDqlAQ00R0 S-LP P00S00S0P00EtAQ00R0 S-LP00 P00S00EA p-`PL@ POt00P30@ _p p-`PL@ P6t00P30,@ Fp -L0M PU, `@X 0S 0S0S0S $TL HK0EUS  T 8(D#h"x XŸ@KL2XU`X p42@0TP0 V l0P ! T R ,0S00S40SO 000Z00S @0S p0:0 S8  sP @Ul, 0 RT(K#L^@0S W 3S@0S<0S4 ,@K ~sPV3XQ PX s~,@K hsP 80SH0S 40X XsP \HK @h80S40S 3Sܲk>-Rk>> -LM@`@ 0 :, l0< x P kAq喏u`PUPE_10C8#8S1[SY:A 0?P04$48,#H d,0 P C; 0,0 l0 1!08!x#W7@X,PUPE#108#8W1X*qA 0P04$48,#H p,0P UPE1(Kq,0, @W XqTAkXAkLAkPAk -LM@`h2P< P,0 E 3SD,0SA00S>40S;80S89 0 Qz 0@S.0S/+p 0P" R㲀 0S0s 0S! R 0SJ  0  P 0 1(K 0 000  0, X,  (Ko04(4 S :0  0CP @0 ,00 ,较0S0S P ,0rXq -L4M✒ 0 , P L SP"0S/0Sq 0S 0S0sh ,0,`Sf HKH@K@KL0K 9P , 0Rh(K 0 H0PK@PPp\ H R 40<0L0 Lw0S$[00S40S5 @0P@忘P00S 00S 40S80SQ2 @p0@4[p@30 Re100S40s80S p+,<4 4:00p08P0S10P0 0h!ܲkQk>|rQ- 0`SࠑQ R0  R 0SQ0S0 P0S0 P Q 0S 0S Q1\ \ R 0S0S 00S0 \ 0  2  0 2P0 0  6A0AS-0Q"R 6Pp  p P01:0S S*S P P1:0S RࠁQ^$00Q=kOk -@LK   h 0- LP< @ 7  2P00 00 p-L M`0@P$K 0 T  0R& KphoAcpT00  \a00 PQ K0 S  0RKpܲk4>A>̶> R-L@p`p -@L@Pԑ -L M0@PKDa@p$0 o8K0 @0K?K"P 4 00S 80S0C80$ 0R K<0S80S0C80&"#"+ܲk> 0-@LTP@T Q 0S noP0 -LIM0p0C S P0 0R&KF`P KkoJOK0 01K/!K-KT R000 0 0 6ܲk2i > -@LP6 -LIM⌡0 0@pT( ` @T 0 R BoPPT0007P0P01 86 @P70P0( 00006 0NKR/KPP80S 0  0 00 0@p{F( 0R$K6MP]ܲk1i > p-P`L@ 6 q0PP700  PP@ p6)P -L4MPq0P 0 @`i R0 10  0 Q 0@00h  BRh 00 , 0R)K:_00S 00S40S80S h SnP 0N K.0㞛D m?100S<0Sܲk0r>(A$> -LMh0@KP` D$0 X Dn <1U  l0 0D X0K"pP 0R K.0U@ @a 0p.?U X0S  +U X 800C80$ 0R KX0S @Q t 0X 0 0@`X 80S080Xw  +|ܲk\A`AhA4> p-0L@`T P0 mPPUʘ@TU p 0D! P 40 <0& 800C80phk0r -L8M`0@ P 0 Q0 `0SP  R000 XP 0RK $pP000 0N K.0㾚  80p>ܲkAH> 0- 0LPD! @P 40800C800<0& 800C8000h -@LP pR" 0S 0S RQl0S ` t0$0P Xx001S T `P  a0S $`P0004 i -LpPM 00`Q0S0, 0 P6h0H0SyUSu HPPoHK,Q-0S x |0S^RvL9 RUV H0S |0SV|HG@[T h0s @0@0@0s @0@0@ HP 7d00d  \(0@0Y@@gG0[S@0[S?0[0S[P &04"48#P , 0R(K P 7 R00 Y U  0 ) 0(0D'(00@0@&$ `00 |0 0 p0P0 P >_S<==P d0 006SC2P d0 S0@0@f0@0@W-0S S / K.04 =#@Kh kP0 000`$n0 K.0| Aط>>oo>AXAAHA -LtM`S, p@ n 8#QP 8Q _*8T!0CT*8T 0TW;-P x8Q p8QU\  kFP, 0Re(K08T (8TL 1CTK 1CTF 8T^ w4T, 0CT( 0T% 0CT" 7T^0CTs:Z 7T2 7T 7T  1S  P`70S-P07T\ 0TZ !$7R/PUPU  0P|P[6T :60SQ 0S0S 00S` X6T $0CT86T0CT*%0CT0CT*!1CTM1CT 5T 5TPT5T| 0T{U Zq 0s % S $0s l% S 0s @0@0@0s @0@P0@4T [,0CT14T 1 0CT 0T:0s !P`Q R@ʻ 0A0@0s? PaPU`V@ʹ 0AP0@1P3T 0T@ i2.P3T| 0T6`P@3T)L3T& 0T" ,,Pd0lL* @ P} U4P KlPh ` fP4K Kp@KKK0P 00 P@0[d0@0K@ [!|x0 K@ KH0 D VP Z 0S00 h00h0X,UP@h2 PE(0P0>0@P0@80@0@QA0@0@@RP(RP$UC0@P0@P &04"48#P R 6R00&04"40K KYP>0SA9P,ܲkliHMi iildiHANi4WiHeiHii "i %i i i>h>Ii i Qi 1kFiRi Si !i A -LROMğ  Sd1  0R,0 `  4Q 1CQ 1CQ -T, 0R(K0  0Sm0Sj1SSf1SSb R_3X^ 1CX[ 1CX0I dP P@QJ@0`SE0SBpKg  g Kg@T00   1FSK00K)` d1x , p\`K g\P<0X@P80T@40P00  \P X@ T P ugP <@K{g0)P2X  \K pgdpWGpWD 0SY L`K \gLP<0H@P80D@40@00 \K LP H@ D @ )gP|1X2 WOKA -LM@w@0T0 @T 0 R0 KCN@T -LM`pV 83PU,P  0 , PUE D1S@T@T@T 0Sx,0S 0iSl PJk `2 R ,  P00^00Sd Va0 0N,@ ,0S3 ,  0S9  0@hl*P hl* Z 0@hl+P hl+, 0 0@+P +,(K 0@*P *1@P ) 0@)P ) PZ,0P6,` ^RlʗRV 0 0bSPRXWVU P y=kQkdr$A -LQMq@R  R$ ` $ 0R` K\a0S^ .S\ T 0  QO .QM Q0  0 n?R0n 0tPK0Kpf0[ K T At [R A0B0S 00 R@KXe K [4PK}e00 <0 &04"4  0 oe0 n0ܲk<> -LlMp@K0`X 0 Ueh0 `0PKl Ie0 000#0 QK ܲkooH> -LM 0嬐K8 ,0 %e e\@KxPK`KHp0   pK囀KdpKcKpKK40 00 H PL, 0R (K<0 R 0  5wܲk>>Sk\A`> -L@\\ 0SQ  R lPGPp P GP P UP#P PUU` dP  dP U U00 0  00  0 00  00#0  d  zdPOkOk -LMPpPDa0S"$K,1@T T P0-@TP0`0S 8 ]58 W50S 0 @ P `p pP@ P`pB58`0S 8800 658 n4Sk=kAAhAA@A -"LM0PFK @8,0 d  d&04"r0`1KSkAAx> 0-LM$Ql 0R@0  *p0 S:R 68J0 R 8 M4 0R,K00BSp0 S*0 R 8 94 x0 R PL(KzPP  ܲkSk@AA Ok>> -@L0000#0 -LhM䡟0`(0 BP T @0S)TDKAb6@D>> -LM`\@pPe:U VT @T`00V00S 0S 0dS1!P00Sp` @P"J 000 00 0000!0000! 000 @TP Z J0 000\PZ0` W V00S \ p p W 1 1P00Spb 8#8%QA A0T@ @P"J 000 00 0000!0000! 000 @TP Z J0 000\PZ0 8#8%XU\EPEJ0PPZX 8#8%QAAp0,$T!Xp 0~,$8#XLpGRp<8#X8#8%P @@ $K 08#8%XU\EPEJ0PPZ8#8%QA A0T@,K]a<,$!$',, %PK0SP@ S2 0P 000 00 00RP& R 1P"[2[[0[0!0000 0!00P00S S 00S S00S 00S 92 62AAP PQ2 0 Qk0S S00S S0000S p-LP`000S S p0P P 04"48#8 8#HP V 6S p00S p0@0p -@Lp`W00 R# R 00S SV 0S PU P P (& "(04"40W 00S R X P (P Q &04"40 -L`QPp P P20SRPV5 @T2 0S/m 0A AP YZX 0A3@P Y Z?P 0z03R0S0SW P 40 0S 80S0C80Ň00@_   0 0S V 0S^F <X: V Q Q 66QA P4 400S0 80S0C80MP P00U+ <<P  80S0C800A 0i -LM`@ 0R0% ::PH 0 0QR0%p A:W= PEU@ R0 U00UR   bEp% 0PcU@0@P  c\ (0KZbP ( 0R:0PD (0KHbP ( 0R0%p *.dr`@0 lq -PLU%@ 0 PU `\0 00 pW \PUPQ0 D00  0 00b0 00C0xqlqtq 0- 0RL@ * ']PP Y[070 ƹ 0 0C 0 0 -|pLj0Sd`00P LP 0 0@ 0$@{PQ00hwolqdr -LETA0DqS00PU 90P0C0S90a(0 0@(0,@IUԀP 0R*0S`0 R 00 0@004@ 0, 0R:\P00XP 80S0C8000 oK#wolqdrQktq8r -LTMt x 0tx ,0 P 0` Sp C:W, P@K$\0|0 ( 0L @KG0KHK  PP`  @0S 0`0  80S0C80S0P0  0$0`@T2 0 0@0@[ , 0R(K T0K`P T 0R0%p *L j-pP-l P(l,0 P00S0U\0 @X@ 000P\l @  㫸l0 㦸X@\0D U  P  04 8<0 0h4<1d Q   048l@ <,<$"* <4#:Q  0q03R0S l@\ m @0T 0TPQ 0 00dS& R000 NZl@TlH00 O0@ 0$@l ȟQl@0000l0 l@00 0b0t(00C0`P " 00@0@$ 00@( 0$@ ZH00W `0 0C00@`'Q0@ 2@0x x|  048#,("(04"48#8p0 - + h0 0@` h0l@R 2@0  x@P 04"40e  0`P 2Ix0Sl&00`6Q@6 Qt460Sl0 IlPl D  0l@484 <S  ZP| ZPh p Rl@00J,0 8 0 l$("(04p@,"48(#8j"(Qd (K0 0Sw0J #00ITR *5 Rğğ0R0<0 0;PP lP 00Sl@l 00@@ P 048QkQ@-; Q! Q `0 0@`0d@Q" Q(0 0@(0,@X0 0@X0\@R^ RS R@0 0@@0D@Rx3T303 33R00 0@004@R80 0@80<@ 0 0@ 0$@0 0@0@0 0@0@0 0@0 @ 0@P0 0@P0T@H0 0@H0L@} -L MQ@ KP 0@S P*0P P@0 @Kh20 Kh Rk|q p-LHMPP` 400S Kp\@KDX40$,0 X 00T0  0P n )A p-LHMPP` 400S X00\0Kp\@KDaX40$,0 X 00T  P n ) A -LLM `pf PP% 40h@KDS@ALaPL 0RS00L0 S0SA Na0N 0RS00N0 ST`, ALaPL00 LQS  P`0 R-\QPNN0`@TY0.S 40S X*,` 000 04 0RfQ 0000 S 0C`00c 0Z UV -L 0S; 1 0( 0*m qUP/ܲkrQk|qи> -QLM@PpU UTP0 SRL00SSHDXE,p LYA@> ;` ?T4?R2T0HP4 R0I\/ T& R$ T"0X0Y`P UP,0pcXj Y X`Y@   TP X0j S -L M(0(  @ $(,L<4,4"| W@P`( 0Rn$K1T0 10SPDKT0 C0KD K -LMp@`N K.0 冁P| K.0、@ K.0z04 4@C$ 0RK ܲk, Awo> - 'LM0`,0 0pČ A A AT A AX AlRkQk3 A) -LtMş/R 0 , pX 00 S0% :Pg   ` P 3V ,+Vm ,V V( 0R0% :PP 3V000011`PP 0@S0% :P= 0$48#8 R`P<V 0Z0#X( dKQ0 S0d0Kc K \@K L dK0=P 4 RP 0 l0K~VPp3@P $(ß, 0R(K 0R0%@ ,:T 0 0Ra`Pz0S 0S0% :P 0 @2  0 l0KBVP l 00R6:0Q l0K3VP l 0R':0@ l0K$VP l 0R:0] l0KVP l 0R :0;l 00R0% \*"@@KHKZQ0 H0KGKc 0 HK 0@P_ 048<:Q0  D0 0HKS㈠ P x  p 匀 p`K 4 21C0$!10\ R dK( 0K J"1\@K  B⧭0 $(, <4!4" -L@M|0'T,0  `9 RmOD, 0RK(K(Tv 0/Si:0000 (0(0 0@XKPP` PKW`KXPK3 XK 0XKt@KPlKs`KtPK  048@T 0 ]PP0Q @T<0[SD @K$jP0K (0XK :@P 80S0C80T47 R PK K.0}h 0Q!}PK0( KN(DL 0/S0SPp ( 7Pw ǟG(0@3!_;0[0S1@ @ 崬` 0:0 000@S26   @@2!<,2!K 0@B"P 0S. " 00@0@0S! 2A0 0@0@\ 4t4<4444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444\4$444|4D4 440RP0S " 00@0@v0Ss " 00@0@h0Se " 00@0@Z0SW " 00@0@L0SI " 00@0@>0S; " B?0@1 A00S- " <0@1A"0S " 00@0@0S " 00@0@0S " 00@0@0S " 00@0@0S " 00@0@0S " 00@0@0S " 00@0@ R0S " 00@0@ ܲkSk0r$ A A AQk@> -4#L0M0p,0 P0T0 0L0 R0% :Xz HK RNT0 H0KG KX  e2@T `@TH l0  v0:S,0S00S_ T , NP0S 0Sk X NPQ 0"0 # Vd !0OP] l 10Sf J@  L0~aPI LLPF LDVF l h10S L K] J@  L0aaPLLPL, 0R8(K40S80S @V P0KiRP P 0R0% c*$0S(0S @V0L0 `jQLT0@PP PT  L K #ܲkrʚ;`@drP> -LMR8 <0  0848#800 ` 4 pV PUPU 0 R0'0   PXUYF 0'X00SV `pS00S0 @ 9P@7 P1 P0  0 0  < R+  `! Q R40,0 @ ,K -M  )M00S <4 A < 4 `00  0   8 04<8#,("(#8 04(K100S00 Q q< 4("4!<,0 0,0 0 $("(0 0 `_4 1k=k -L M4 !000 0SJPH 0 ,1`VC @T= p,p @T 0 RZ0P P& P' P  0   @pT,0S`V p(K000P BrLP0,0 rP    pp40`=k -L,Mlş 0  S0, L0 @P` K:X/ @T@ HK@@K`L0 TG0KHK[LHK( P 0 $("(04"48#88f#pAZ P#4P#4#4#4 R* Rp J@l, 0R(K RWp`ZO Z* Z y|%4$4$44$4 P0KPP P 0R:0S W0  J@0[S S T KPH`Kp |3  0L K28` VkJ@Py  IPVD V:J}J@2  <`@0[S?0[0Ss2 @P 0S 0S 0R0%0"` :V  0EP NJp~p<`8` ;J1 ` `( K0(` KZ &4&4%4h&400 00880!000 P 0S0 00s00J18 00 {H0L 8 0000PK4 P0 PK0000W`p 4?0[0S:17 0S&04"43K/?0[0S S)  P0KOP P 0R0%` h*LI>ܲkQkood>`@ -LM  0`,0  0RPf " 0@U-P>`0@ 8$H0S 2  I(M, 0$ R(K 0 S` p K:WY @: 0@ MP. ̟! !=0@@8DH@T{ JTe T TLP 2@0  @T^4,4+4+4+4@,4< R+P(8,H`0@(8,H0S 0K%OP  0R0%p *  ;@P $(T5 T  :T TS <; R 0Ps0Kn00S 2@08 8< @T 8H 0@8H\Uh >0@L*084HT[ TP 2@0( (, @T` :T0ST 2 00@0@  Z K.0@w 0PMH hT00S 2@0  UxT :0DSdqT:UT 0S 2@0x x| (0K@P !S00S " @00@@0D@0SXA00S 2@0` `d @TFUS'0JP  }3#00S 2@0P PT @T(U5P'0JP  x>00S 2@0X X\ @T U&0JP  g100S 2@0H HL @Th&0JP_  K@0S 2@00 04 00S 2@0h hl @T'U%0gJP= 50S U U`%0UJP ePP $5 8X`0@ 4$D8X  /   <  1 EF  >FC~00bܲk|qSk`@d Ap>ʚ;Qk Aoo -ࣟL M`0@pA P0`p 0'Su1   V WV  F(K0S 0SX 0S (0K  #* P,0:Sb @P 9PQ0MSp 0H P4 r 0/Sj40 ̣ ȣ0Sk S 0Sn S  <( 4"4)<(##$#(`p 040  0 0@4(0@, 0S0S0S (bJP0 0@0@ 0R0% 4:PP 00R  3 0 0@0 @jMciC07JP4 0 R_  Z 00S0 0 000S000 00KQKP 0 0R0% *l00S St 00S Sh> 0@ 8$H#|qSk AW`@ 0-PL @R 0S0S R  P @0$ S00 00Rk A -L $030 .0RkRkQklRk -QLM# @P`p, ( @P 5", K  pf`0, K $K -`LWr4q0@!0c48q0!0c4<q0P 0c4Dq0 0c4C@@D0@ 00Q0 00Q D&rP@10 R 00d  SH,0 0C# L0 DpPP>P@ꫪ1k -, 0LRP*L0 ORq, 0S*4@pD`@` @X4<0,0 H8@H00 Qk,1k -LpRk(Q0( ,S  3S001 001 R0P -L MQP@PE0L,SE<@4?4?4?4?4?4?4?4?4?4?4?4?4?4?4?4?4?4?4?4?4?4?4?4?4?4?4?4?4?4?4?4?4?4?4?4?4?4?4?4?4?4?4@4h?4a0 `pP0S b@XK-P2\0 P@Px0 Kh\0 KhTP000 PKhRkRkRk>hqdrx -L8Mlr@PP$ ` 1$ 0R KQ<RB4@4@4@4@4@4@4@4@4@4@4@4@4@4@4@4@4@4@4@4@4@4@4@4@4@4@4@4@4@4@4@4@4@4@4@4@4@4@4@4@4B4@4B48B4@4@4@4@4@4@4A4@4@4@4@4@4@4@4@4B40Q:N0K BVN0[0M0[ 01PڢQ: V0KsB%[00SVV0[0(Q:L0K( aBVF0[00Q:N0K TBVN0[0M0[ 01Prp oܲk|> A p-PSLMPK0C`@0%T  @0FPx@x -LMp0 @$("(04"48#8(``V`!3T (P  1T +T (KZP*0V':.0K A,0[S! -0[.@[01PY3T0V:*0K A3T)0[)0[1001*@[PP<T000 -LM"0K@ pA3T!0[!0[00QQsC@P00U00S ; B1` T ` `@U* 0A PGB@ -L,M0@,0  Ply /  DK)0D SPll 0 R 0 0( T @3T 0T6 T PP p3T0000aa 0V 3T T#T00T0 @AA2@P  t, 0R(K<T<T A+T+Tl0 3  l0 2  )0[ST0P0T0 @A@@K B@0[S` SS ZZ 0SV l0.  )00 8SPllfP@K  ,1*SPW 048< ̠<Č,ʠDK= )0D SPllT (@P  00Qwl0 1  )0R0SKAl??0[0S SK?0[0S ܲkdr> 0-0L0@SP ڀS S #A0S00 0@0@ 0S 1   A0T@00@ P @P00 0dr -LM`Rp"@3 1:S? S VM*  hp  `bV @0SV;0 `bV(KV0PU:0 =0K B00 <4("4!<^00 >SM: 0V R*KA"[04"48#8 00@P  @+00h N`*0p@0@P0h @P=,0T0h `@0p@P@P,,00h dr -LM@` 0)S0p(P 0 0Q( Q0%(":P*0@P  (K( ,0K!FP , 0R:0( ,0KFP , 0R0% *80 EP00@dr`@ -LxM∯0 ,0 ! 0S \/9I 0@@/9I0S @ ? ? #=0@8H0S " 0@.P`0@ ~'R!P00`S5 p.P0`0@0@0S 2   ?, 0R(K (QDP 00@X0@ 2  0-10`p  d-Pd Q0SW Pl 0Si0Sf0Sc0&d,P0`0@0@0S 2  $ 0P ,10@#P (^`,#= 0@D,8HS4,'= 0@,9IH,8H 0@+8H= 0S$0S00@0@0S` 2  $ VQ0So ^d P 0Sn Q0Sm 3S. KP' +P0`0@0@0S 28 8< 0S 2    0P 0S0S0S 0S0S 0S$0S0p@0 0 $("(04"48#8( 0 P`  (0BSc:(R 0S 0 (000S T  0S 0S0s 0S0S 0s )P00 @WP0T@ 2@ @D 8V X@ 0R0V0S8 K21C0x10K T8`P 0S @S0 R(P0`0@0 @0Sp 20 04 fQ Q ^ ^ Q Q ^  ^ p6 ^00S P 0@p00 G>00@0 A^ g0S 40R&> 0@&p`@Sk AZ`K  .0PKj .0j@0 RW  0\PP0 L 0-PL 1@hT0 R*0h\  @00C@0@00C@0r -,@L= hdr4 p-L 7PG AnA#!B30b0020aA00 S0P\!* n4\4*0 R0S 8ChV N#!B30b0020a4A\4:@ @0@D @aq#ph Okhq\Qk0rr@ A -LtM1  `, 0S 0S 0S0C0 MRM.0>V Pv 40P`80S0C80\ȟ00THy<@ȟ0048  ȟ0PD0YT v@<rT `@p0 0@0@@D <0S 28 8< p7p lǟ/ TZpK 0.00`Kci .0^i<@88@ 0@$ Q  0 :6 R0 &P, 40) 80S0C80w`Ɵ00 0S]0SZ0SW868 (`$Ɵ`0p@@ T@D  :, 0R((KSZpK00 `K.0i .0h8 0x DY 40 0SPI 80S0C80%000P04Y74@P \  0nSlP 04 0<@Tt0pTV00E &0 0@S S 0S S <?<2 Rp pR: R0 Q.RS*P 0@P  R1 <2 0Sp pS:0S P0 @30S 0P &00  P ;P"0SP 2PP2@P P %  0x  0]PM <0S " X00@X0\@2@@P @D P 7^+ ^a (^&  0K 00S`0 0 0\00S]000Y 00S SN00S SL\ U9<5() P80`0@80<@<0S 2H HL 0S H00@H0L@ &  doP <@ &Q _QZ 0 Tܲk8r@rdrQkQk1k AQkL AQk> p-L M)  0K@ `PP 0T Kp00e  TK :TP TP 0S0![ P P!K 0Ko< -LM"3@0S0 Y 0 P0S "101202(K Y 0 z"00000202  :2<2) 00KP0` ` ,< $4 !$ 4,̂&<4 80 Xpe XL 0p 00 000 00RT R= 00   804 88!   4#8!8  8#8"QA"A"8#VK V :V 0S0"gP0Sw 00S S00S S *0K;"L 00S00S Pqaq\r\r - 0L(S``58pP77Q PQA @@AQPQ100D000 00 (A(  ( ` 9` 0-0L@P ~:P 1 0'S 0S S% 0S S  00h([<P000S000 00S0 0 000S S 00S Sʚ; -@PLQ000x R5h0 p-PL`@s8 U  U U -p0V 0 00p0V 0  Q 60p0V 0 00p00p 0 pQk -pL@y80h00d0 p-q``.Q00SLP@ P{أ00/U00S00=U00S0d00U00S P 80S0C80@0 0P{001U00S 0P{000#U00S 4P{0403U00S 8P{<0P80 80S0C80 0<02U00S `P{0`0p -L@ `Ppi \0NS?T\00S #0NS/0N+S1v4w4|w4w4hv4v40u40u40u40u40u40u40u40u40u40u4hv40u40u40u40u40u40u4Xx40u40u40u4v4w4|w4w4hv4v40u40u40u40u40u40u40u40u40u4x4u4 # 50S *0S 0S 0S0S0S @T' 0S P 0S0S0S 0S U0S 0S l00l0U.^ P P Q{ P  l7P U U00AU#^ 2^ ^P { P  I7U U 0U0SR @0S3{ բP8n  '7PG U U U0S? //^PXU{0 Sw0S+ Ul Un00Uj1{ 㞢P07  6UX0QSQhUM0 SIdRB0S, 0S< S@ 0S70P{ kP  67l00l080S `PW4PU30 0S0S0S0!1 00SP  <4("4!<0 -LM@0pSP` @  @VK{ p0 -@PL {h輡 -`0LdlSpdl {ޡPP" @ 000S { ̡P  600S 0{0A ỡPX07 0640S 0{0A ᤡPX4  45`0S 0{0A ᒡPX`  `58P 0{0A အPXPP8 8 5 -PPpQLMP@  K8T<0S @` T P RT:00S000@TP" T `0 R0RS0)S B 0 }P000@TP .P -LM@0TpPh+ `U` 0S{ΠPX P  00 zPP@ {㱠p{ @|r -PL@`p Pm 40P480S0C80f00$5D1 00 0 \(V A 20Qp  Q Q: 0X p Q* P 4P\ V<`20^p  p ^*\Q  Q3 33:^*X0 \ 0 X ^ ^:P3 -L8M 0p,0 5@W`PT@ h 5 JP7& 4@ 0p 0@ 0FSD4d4444-0T0 0Sh$0S 0S@T5@T, 0R(KU R 0T0 U R`Kc4` 0 Sr3   U RXKQ4X0S0ǕU 0S`0S0S0S Q 0SPgP@K$-4(0 L0 0H KG0K@KPP -L$MВ0,0 #A0D L0 Q0444444444444444H4p444444444444*, 0R(KPH 4PE 0P0a V(p2W@V   3PpphPLPK``2W@ ;2P PpP`@@K2pP`P `P`PpP 8PP d0SpdP`pDPK`P l0p0HPK`H0 P PP`P 0Pp0HPK`H0 7ܲk> 0-L@)R P\ U1@0@0S*@ P00\0S C1P 0 :RPPC2 0@ 0PP@\ 0S @0@ 0 :RP@  R-L@p`2PP T V @  Q2P; c11077 -L4M(`P, PP @p )R <@h0 T P, 0R(KX 0PT+R? 39R< 3R0R,RH .R *PT8#8Ƞ*R〠Lxt 9R 3R0R.R +R *PX RRJX 0SO P0RRB R RR0B<SN@444444444444444444444444444444444x4d4P44444444444444444444̎44444L40B P Q񟗯@444ؐ44p4l0   P ?10 0 P0P0P)R PHl0#90P0 l0#:0P0 l080P0 l0#80P0 l090P0 )00S0P0 l0;0P0 l0#;0P0 l0?P0 l0:0P0 l0P0  00P0 P0 0P0 l040P0 &RZP5 X 0S<0 BP <R<\44444444444444444444444444444444Ԓ444t4̓4|44L4444444444444444ȑ444444PZ l01l0PP 7 7PPl0l0Z l01l0PP77PPl0l0l01l0PP88PPl0l0l01l0PP88PPl0l0l01l0PP66PPl0l0^l0l0<<PPl0l0^l0l055PPl0l0l0^55PPl0l0l00/PK pP\? ^l0l011PPl0l0l0|^66PPl0l0ul0q^88PPl0l0jl0f^88PPl0l0_3S[,0SX00SU40SR80SO5 R; ^I PH0 SPCAl0>^77PPl0l07l03^66PPl0l0,l0(^77PPl0l0!X#R R R& *P>R=Rl;R <RP>R=Rv;R <R/ 0P 0 /P @ PR BPPEꌎ4x44P44d40T@ 9P TK0H @PP#T0L@KS T /T000 f/ 0 /w R R!Rp$RnRl #R R PX_ Q0 0PKP pP Pl0|X0 0S 0 0pPm5RjPi@R 1RJ/0 0 P0P0"@R d1RQX 0SY0 @R 0$1S SPFP@IGPPDX 0S= 00:5R7R1R 0BS")X 0S)0PP P Pl0P00l0l00 0l0l0 00l0P^ P ܲk|r>й>! (R-LPp( B(0N0P @@0S1` .P  0 0 7+P 000 0 0 0 -LMP`Uf.P1 @0 0P <(4"4!< $K= 0 . 000+P @ Z?.pP ; -1-77 0 @0 0 000  ^.0@,Pp -LM @4 8 4<,$@a8#$@D  X00(@0 |R@y4`"-PP@q P  +@Pl1 (@pp ᶊ @ 4 ,0K0@PZ400("Ƞ0l08#8 $#$(",0^!"( f , 04<8#,("(#8 0 0L08#8 $#$("<8#8"(0  0S/P!  R4 000,0) , )<)00`,08^,@PP7@(K0p -LMϟ 00  0 <000S U- 0 0   000S U 0< 0   000S( U  0+ 0 0  P P0S|K`P V@ n " B,  L,0S) 0S&0S#0S  P0@ |0K-`0  '|P- 80S0C80(!&U I`P 0SX  X00@ ʟR|KX0\@   W 80S<  % d \ 0 $(:0S    R *8#4"<# #$# 00s 0X@KPU,0 PKW0K0X0K( 0 0K K0 ( 0`PPB H0 0@H0L@  0S " P00@P0T@ R 0S W 0S00  1<1 KR<0K @K@`P0 S 0  W h0S Q 6   R R Q Q Re R QY Qw R 1@0100 K ! B0K|PP`@1 @01 W l0 0S,20Sp  p S:0Se RcS: 0 P`|PꨀP `P```  1`PPDAVƟ0 0@0@0SB 2PX0 0@X0\@000 0SQ< 0 00S Sl0 48#8# pPl  \00@ |K-`P  Pt0S1<<1P " 00@0@6Sş0 0 @P0@P3` 2P 3`X0 0 @X0\@v400  P|@K$*@ @ ]T0SQ8 Pe: 04a 4P0 0S  ,00 0( p`P0S " `00@`0d@P00W)U l`x0p0@Px0|@ 2p pt   0 `XP 0V0 -)P(`00S000 00S0 0 00S 2Ph0 0@(`h0l@00S S 00S Sv@T @T 0 R B**PT Q 0S  !0S 60S00S(P 00S8 0 D1  00S2 00S S&W h0S  Vp0 0@p0t@Pv(V `0 0@`0d@70S4 " h00@h0l@)0S 0S ,00  ܲkdr> AQk p-LM@P 0`R :P" 0S* 0 @0@P0f @P"x 0KH.P  0R0% *TD0@P0  x0 01 xdr`@ -LMP`8 夻P} QPy 0^(pPq +)P D!( @@0( 0@0 0`0Y0 V 0* BVp  ܅`0 0@80P0PPPPPPP ʅ0S 00S P P24`K<2 $)80H!0 0@0@ 0 K4 2@80P S & S S Y00 @A(K ⋅2  2B  !2 !` j'|q{o> -@LT @T 0 R40S C R004   -000 @T$|o p-TPL0Sp80 @`T  @Tph5$|o=k p-@L x04"40 d`04"400 PR ph W(P 00S SkSk p-LP0@ Ġ#Č` 9(P 00S 2T00 40 00040phSk$|o 0-P0P@LMKP0`0 00P(( 00@8$|o{o{o -LM 0R0%@P` ::VF  0S & 00S0SB S1@0S 00S PU PU 0 R B'PU 040S 00S0C 0 0 (0Ky,P ( 0R0%` *hd2@P $(60ST 0SQ0SN0SK0SK 0 $("04 48#8! CP6 $#$ PU? PU< 0 Rpd Bi'P 00S0S0 0S-0S*0S'X8 40S SS0 4 0SS 00S6 $#$("<8#8"( 00S@m0i  +'P6 $#$("<8#8"( 0@ 0004`@|qMbSk$|ol0S S S S 5S GSS  p-`@L(P '0V00@ 0`p -LPMp (t 0,0 x Aph Qt p00d0 2d pW`p  0`0 pP d @Rl )*` R@0  08R#21C@0` Z ` pWp0S x`t P @3@#ha , 0R(K @& @  P[X00d < P0(0T , 063P0sW !HP`Q R@?< 0A 0$@h040\ =0 ``V ) l0`08V#( 8#X"!Bd 0P:l00@   y`08V#(21C@0#~Q0@ 0$@Z K.0zSD I0@ 0$@`t0p@u ܲk(Tk A> -LMp0 oW, 0`1P`U, PV,`U,$ W,0 Z:, &0 0  *0V(02,200 @ &"P,`UWP 00S P3P#,(Kr S-`Lp@`PQPR00S`RU  mP ` V V*` X + `P00X00S U  &U` | -L pS0`V 2P@T 0>CS0`Vh@0$E D UQ0( #5#3 0꠽4r=k,TkMb P-L \  R @T 0 S *01 0 S00@ 0(B% pnA$A 0-@PL` 0S[ 0SQ P d1 RMX1P U 0SCP0 Q -LM؂2\( P@} 2\/ 0\ 0C\% P( 0R$Kx2\Q p2\2$ PP@2P @Tn=PhPpPU 0`S" 1P 0@@ 0S TPVP 0@S00S 'T P꧵00S8`K^- ^7  pD1PP2@P~DQ "0 0(0", 0 0$@m00S3[S&04"43K00S ܲkliHOi Ni4WiHr(Tk0r> -0LS/ 0\"\ 0S\0 0 ( "0 , "0 0 " 0 4 " D1zP 00S0 $#$("Q(Tk0B#>r -Lp`Vh0`00L~0$0(iK0@ 0@$ (qC1k -L8Mp0S, P@ `P` 0@T, 0R(K  0@TG 40`1 ]V@  > D@VT@ "0 00@0@& 28SS C8Ss P  0   `VR @( T`P 80< 0CR80A A@X  `P@2 Z K.0GO0 `@0 P  v D1`P@SP`P 40 `40@|00"0 0Ba0 `:@PL`0( P`40 `^p0t 0 28jP?8C002< (00 28\ܲkSk<ACMbSk>Sk -LP@* 4 00 S D^ 00S 0S2ST0t 00S 0  <0D  0hQ  PSkC -1LdMP1 `, DP <@K6 < PG p  2S  V R 4!4 ɯS"`X85 1 b `< 0 @KD`! 0 <|0 t Dn 0~d, 0R(K2S < Wa*uQkܲkC1kSk> p-DaPLP $0@S0SA TP $0@S 0S3 T0P S& T0 R0 R$@0S0Q S P 0 R 0S 6R;0Qp0h0Rer(TkQkQkSk -L0P@p S Q40 Qh藯08 }OkxA2 0-|LP 800T0@  0@?L0< #5: /#3 00 000uMb 0-`PL@T P0hGD 0<<0 ,,00hPTkArr4r4 -LM@h$0S$RiPU <`V D2Q p Q~Wy 20S\4444H4\44(41 Q>001 1Ba!0 GiP 000028!,10 1 Q! `V p p<00 00 PZ pL 0  00 ?00l0 d0Ba  040( SkCMbSkSkAA<AA -L4M$P!|$ @` l0S   T( 00S $ 0R' K-000  00  00@T R K.0tL8 @0  3 ܲkXAA(> -LHMpPh0@,0  Q 0S0S#  D1`PQ 4 ;d0 30 SDX 0PU 0S `, 0R(K0S 0S`0Z0S0 `0 l0 h =@Yd0S'`0 L 424"0  @T P P 0 `$ 0T^   D1V`P 4 d Z0 200CS&4d4P44D40 m P Z K.0K@ K 08 @hQ T R 2S 0 R|0 Rx DvP dQ02dQl0 0  Pm0 0 m Ut<Y ({$yܲkCSkAQkQk8>AA -L\M⤕0P,0 P`0D0Tk A,|o(|ol4SkQkSk9pL>SkhAHAl0GS S S S S 5S80 P0S0SP0|o l -L@M<0(0 pPC 0PV`K .0 @I08@ 0000 .0 @I8@0 r 8 m R 0p00  0| ̇L 00C0( 0R$K$QܲkAA0A0|ohqA\> -@PL P000h`TA -@PL yP 0Sh000KtA 0-t0L PR0`@P n R 0800  0| sh 00C00TTk0|ohq 0- @P L寿0hp4 -LM  PK$,  D10 m@P d 00 @00SD1(0 R @00 0 pp    0: 0`000 0HKd`K\PKPHKGKdKcKQR S ,04!45K4%KT P0 X @ xK @0K0@( 0KMP @K  x(`w0(0@0 w0Sf S} 0S ^ 0Sz ˠ,48@#8) )$)0 @@2K<2 K0@@~Z "P`00@0@"00@0@2@X\$P PX\$ 80S0C80 , 0Rk(K; #1=1 <1 KKȠ 9 00S0 0 0mL1 R:P 80S0C80C 00S S{ m0R 000 Ry m@ 0 @@ 0P 01 0 m @H$H04$48#Ƞ] K.0G@ 0 (ܲk0p|qSkAp> -LM0PK$0 , 0D!S m@pP d 00 @00S00D!U( 0S @00 0 pp    0: 0`0@0d`K HK@UR0 UG0KH Kc0Kd K \@K vQ0S R 0 (SK 50K ( 0KP @@K v(` x0(0     0 v0S S ^U +"48@#80 @@","0Q0K K@@;Z "P`00@0@"00@0@l2@EP PPT$ 80S0C80z , 0R(K1 <10 K0KȠ Q; 1Am P m@ 0 @@ 0P 01 0 m @H$H04$48#(PZ PU @@K va@@K\ 00Sn0 0 0j& 04"4P ,5KP@K4\@K%KXP T0 " 00S SU|0 R P 80S0C80 K.0F( 0Qܲk0p|qSkA> -LM0 006  @0000 0 -L4M@0P$0 dUp^ h`P^ *G 0S: 0RV0 0S0R0S^0!00S[ R 010  0| bWt!00C0 .00R KF HP80@1{$ 0RA K1 R 8 .00R KE P800o 0 0 0Ba0R K.0 @E8@0 <4ܲkSk0|ohqlAhAAAA@ACMbA> -Lh4Mdr0\,0 T2  0 `PE  00, 0RK(K0S 0Sf 6 P8| PL M  0!00Q0-P 0V0 0  > @TD1jD 3.00Z KXE P801#0PD0Z K.0 @@E8@0  .00Z K4E P80t0t%  0D 0  H0BaxTTkܲk0|oQkhqSkC8AhA>AAtAMb -LBM@A>PA -LM@@0P,0 0 <K p0 ~rLK zr`V( 7 R7@P yǟ, 0R(K  K.0B@ K.0B 80h 0R0%P [:Ui \pK Ar0 \[48\l0 \d &300  L0[Sd @KH |UPnL0[S` PP@ 0PA0Ph 0? K.0BX { [0[0S\&04"45K6 R  K.0B _x  0KP  0R0%P *w5@P $(g[0[0S S<5 RQ D4MP5 RF )B4 R !垾<K1P4 R/ +U m0 00S t4 R  K.0-B m0Dl D1P s DP o 0Xk 2# S =0m @R@U@T] 0m P  0@  " 8#8S240040P @PT8 P 0  0T,C P'Ub 0SV  U  2S022"0  0,U*P  K.0A@'08 PnU m0 00m \\3 0 0A"0!R00S 4000m )P  @w0@P<P$ oǴ0U00S 0!10 M40  V 2  0=0 R < <0 0)/T0T 0 $ܲkSkDrAAA`@|q$AATA>AACSkAQk`P0S0SP@-0s l@0@0s H@0@0 @0@0s0@0 @1k p-P0L@`TP @T 0S mPpr -LHM0P\p 0S K UP40 d@KDf`4 0P0@ 4 ` \P X` p -L@PDp㕴0`S h00S 04!40 5 -LTP Q 0 R  0-q |0@0@@0D@| T 0@0@80<@0@@0D@0@80<@Sk@A1k -LMh#d@0p<K,0 p ȡPP` ㄡTW80K1   K0K 0K00K0 <80 4`0X@  @ ؀ >0 0000 4 0000 8 0000 < 0000 0 0K<K0K0KT0P 0 0@00 K@ ᆥP8UW K1 R`, 0Rc(K0L@K0 0 } l<L08H 4P0`D0P@ P`0`@00 0@K 0K<K00K@ VT0P 0 R 0  R*> #310" cb ` l0 R Kz K.0g?1 PP4`8 0,+姻ܲkSk: QNAAк> 0-\0L@PT@T 0Sd d0RP 0(Tk -LMԒ\0 P,  2 R v K.0?d0 , 0 RT(K`2@T@T T \0 d0d R⃡P 㖠pP] HK @`K(0H0K @PL A L A GOKD 01 10 0 1 D 0K PP D!\00\0P800C80 1 R v K.0>$  K.0d@>P K.0>8 $!0P fpW 0 R pWD0 R v K.0~>d0 8$JaܲkSkA(Tkܺ>A4A -LMt\0 0, 0 P2 R  K.0W>d0 (%P, 0R(K固0HK0 @ p @Kd`KGpKH@KPK (\Kd@KcpKDH0K0 ` D 0KePP%\00P\0 D!<1@T T \0d0d R @T R 80S080C0 R @K K.0=d0 8PqP `P P0 R  K.0=8d0 8$`ܲkSkA>(Tk|A(A -`@LT  D1!P DP 2S@T -L8MDSDs@0T 0  @T X0 P @@2 R T5X0 \0O P\00\0@T 0S00S@T@TX0 \0PUO X06@T 0S00S@TR@T 0@ P P:@T R 0@00 R 0R`KnP\0\00\0 PP T1 R N K.0=d0 ,P`P 1 R\0@T 0@ P >P000000@TN K.0 -PLڰ h0@#10#T`p7 p@T 0 R0@ d0P 0/P 00Sp`0WV`h00Ch0iWPPh0`0h0MPPh0p0h0 -L|\000Xz 0- L@P |zP P`0S0`0`@0hX0 -0L@pT&@V HS0S \0`0SPU P0S0@ 0S00S(Tk -L -L|M`0,0 PeU1;|P |0 pP X0X00X0X0X00X0X0 @0P@0D@8H0T8< H0L@PTX0 \0 X P X0 PUP o ㄀ 倀 PUa 0 R0md0P 0⋝P 0@  x K 00 0 Ph ^*T@d0@ T*|  00 @ KB R0S ʦ 0b c2^R:Rh0 |0S h @xKd@ 80@Q h00 P0S h0 #10#0R0S PA , 0R[(Kh0P0h00!P Ph00Ch0NPPW l1 RS Z K.0t:d0 88P>DP0`p S X0 ` KPP 0 R Z K.0T:`d0 8 ,&`P X0pPP`0TP``p\凶PTPThh    FRV Yܲk1k 5SkAA<> -<LMP0ȠKD HK ,0 dpKP   `K    x@K0 @H0KG K0Kd0K Kc KhP Ā ` p @ D  0K&P 0D!夿 80S04$0, 0R(K080ܲkL> -$0L@T @Tr -DLM`0 dKHK,0 pK`  ȀK  D  x@KP0H KHKGPK0 KdKPKcPKh` p 张 嚭0PD8 0K@P 0D!= 800C80T0$0۬, 0R(K巵ܲk`> -Lp1pQE1 RA @T; `P@T V@ $00S0U  RPU00S $ @TV9 U  D1P DP 2S@TV U[i耬0 R  l0p D1kP DP 2S``ӯU `V`QkQkrASkTA -0 LRPb0 R)$0Sp! R 000  0 @T P@TW]00CS0 |hvp# 8 ~QkQkr(TkA -0PLr尬@`PN BTf $0* SB* 00 @5 @}T6 R0000 0p @T kP@T dP @ 0``000˫00  0``I@FTᷫ2S 0 R0R,| vP `L?ᗫ`00 R$0 R rQkQkQk -LQM0P,0 ™<0K` d1 @`<K `bg7 R 0h \ǟ, 0R(KpW! <7 R 07@P Q ` K.07@ K.078 0<0[S 6 R <K K.07 ;0[0S 0R0%p :W~ WOKF ^7P 0  48, hK l d`K ş> K 048#8 $#$("(@P@PVL@ HP $KP  <(4"4%&LT0T @60$%#5$L D%#3 000 0 4 8  <,$!$ , PhKPpQ% 8`Q 01`P:0SQH t4 R  |8p僳l4@P $(-HQ 0S X\> 0 A< m0 00T7 3 R% <K K.0 7m0 D M?KlP 4 0R0%p C*@TD3 R  `83 R @ @ 0<K@ @u'0S~ Sx 0 S Kl 0 GK#1K$K f 20! 00[030K 0["# 000KKK0 $ (,< 4!4"<0 0 $ (,< 4!4"<0 @ P !P8BK &8<0 $(, <4!4"\ U*X1 RP ` K.0l6 0h:E Rp0 p0R@1*T:0PU7 ?5@00S0 R  K.0G6 80 R ` K.086 0@@Td @0 R  K.0&6 0\8ܲkQkSkTrA4A1k6Mb,TkAt>|qA`@A\AA AALA -LMP`-Q P-R 8Pјr p-)RLP@` :R P!P @p@phS S @phP  0 0 0@P @@phP 0S0 S [@u @P l@" --dLM0p,0 0 0 0 0 Y P`0U @K3 0 P @ < 0 :R) ( pP: @ d @0K  ȦP4 00 Y @K Dȟ, 0R(K 0S0  0(0 pPW pP700 0 :R,0K@ H00  PY  cH R 40<00 p0  0#$#̠`#8 0v00 0 :R0 q 0\:( 0K P P@0( x l0( 20 K`+ 0 :R ,6@0P 04 f0S100 _W0S 2A0 0@0@\ 񟗥8;5>5H>5>5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5;5=5=5h=50=5<5<5<5P<5<5;50S " 00@0@ R 0S " 00@0@0 #0 0@0@0S " 00@0@0S " 00@0@0S " 00@0@0S " 00@0@0S " 00@0@0S " B?0@1 A0S " <0@1A0S " 00@0@0S " 00@0@t0Sq " 00@0@f0Sc " 00@0@X0SU " 00@0@J0SG " 00@0@<ܲkr>|q -LMP`Qp@ (K0SP0@S(P& P 0 R T  0R0V0S  0p+P vP Y@@< 0(p` @ېRk>r-1r -L,Mğ0唤,0 Pp`0@`L 0SP  0S 0S0S HK0 T H0KG KHKT 3PU  S PUB @0 l0  v0S,0S00SS , P0S 0S$0S T P0s[ 0 0@0 @P0 00bP"I 00@0@Xm l 20S4P0 @HK L0PLP (0 0@(0,@40S80S @+ , 0R~(K 0so0scL KX& !0@P l 10SZP @HK L0PHLP(0 0@(0,@0L0 M(0Sr kP0`0@0@!  00@ 0$@;Y" Pu0S 2( (, 0 0c [l0@PP PT @ zL KAUܲkrrʚ;dr> -L0Md Q, L @Pp`0 8#8^[F5E5F5E5E5E5F5,F5E54F5E5F5DG5E5E5LG5\G5E5-0L0 X<L, 0R(KPV P n00- 0@S{ 0L0 n90L0 3PT 0SHK @G0[SP /0L0 0@S2 R 0Sp 10L0 V 0L0  T+0L0 ㌤|2`x 5PL X!/PL n գ͎0 ᭘T80L0 HK 0@K G0KHK 0ZL s000hp1 R 0SL0K,p 0pH0ɣP< DKl0S 0S 0s S0S,60 ~Ps 0pfP0v@0  dnP  PL0S10L0 8, 0L0 ܲk=k AQkQkr>> A A -LMßPp, S0@0 p3@h0 3`K 0P   X K, 0R(K`T 0S 00 0S/00 0Sz 0S 0S$0S(@Ts 800 0S 0SY 3,0 0 pP700  0 R((10"(100241"41#01!p0@  0# #$#8`00 0HQ 40< ^  ^2@02, l0 , 2(0H P3 o$0S(0S900 e 0Sa100 ^bHK[0@KHK Pe@ ,KHKH0@嘢P 3S@Kx ^P 5@Kpܲk|raq> 0As0 -L_MP  >m0`0S0@+  @0S00f+cYU ,0K/2pW0/Sp l(K\2 ,00 SPC/R 0u/S @0 tKL H0  0Cp0 l D t` 7P/00%Y0`, ,0 0@fP?p  0P 0p@0H0 0CtKLp l p0 t` D \7P p,0K1pl`DC\?C@ 0LKP 0 p 匠 <7PP 0`K 06XPP 0 iK-XPP !1R!1R!1RPC`Cpq -L`p# P@ P! P9 T00PU0S+ # P@00P P P00W l`FpGW@ L@T0gG F`p(p@ @0( AD;A$ As@@-@ pϠ0Cl$ !B l10b1 0!0c"0 0cb# a10` bP@p|r_ No@-@R 0 0#\P0S SS0S0S  S 0SQQQQQ!Q1Q!Q1R 0S  R@R  0R\ P0Qc-R 0R^ 3! !\8#8S    2  0Ļ>P P  0S  P P  0S  -R0 0c BSR48 R p-@P`x BRpR0 BRRR P0 P 0Qc R-L" 0S 0S \ @`R 0S  ^00NSa00@R  R 0S0  R000Sa@R P0SbR 0PP  R0QcR0S0  RR B0 0Q0 0QQ 0S0S QbQ- * 0 0 QaR *0\ 0 S Rb` `!  0@-RP@# A0La L\0   S00`P0S 0zP R00@P0S ZP\\ ^0 `0ȠR@-,Ƞp` Q R2RHV}GR0pG@00 0 0  0 0 0  0 0 0 0 0  0  0 0 0 PU @"Vm> 7("B 1@W b`0`WK W300 0 0  0 0 0  0 0 0 0 0 0  0 0 pG0 W `W 0 R 0,8(2C"B0 cbR  0 R p0\d0LL'82C00c08 P @@ R,B B[q p-@PL 0\("( 0$H,8L2C! @\` 0%H c@`R,B BR,B B,0QA>A0AQAApqԻ>0@-Q@; R,P0 0,0,! ! 1!4##!#$" " 1"4##!#$""1"4# # !@D#$""1T"#T (P0@T0,0!," 00Ի>Q  0 " p-L`P@@Tp -PLM0@`. 0IK$1  0K0R0pK Pd@0 Pd@0  Pd@0` `&$K` S-L@P`0 @R1SVPQ00QppW(,0\h0p(S\0 p,00L  P  %9$0( 4`,p$P0p@550% -@PL$Q ,0S 00$0 -L@MPX \ `0 (K$pW 0 0,  P, P`4`< (0  0AS_b5Dc5lb5Dc5b5Dc5Dc5lc5Dc5Dc5Dc5Dc5Dc5Dc5Dc5Tc5Lc5 U, `F0P U, V\,KX0`P@,` ,0H0PU8s, `F0PU, kV\,KX0`P0S0 8P U, `F0PU, V\,KX `P( 0P1:=0VPT0 # BL !0@UᲠ:,0`F,0 T 020CL01 @PT粠V\,KX `P `4`0P =("((8#R  = 0 K0̃"(<  \`d \(PERQh U, `F0PU, V\,KX `PH @< 0 h,̟0 \ 0 Q7h威PEP 0 000Php0P0 S.l0TL T l L T0H H/D DP L0 Pv  \; 0 < 0  ,0H,0(8S0b0 A, Az>> A !A$!A A A AG-0l0 $0 #4R4$p@0,0% -$PL4p^@F (\ 0@c T#*0 ``T*:d Q@T*00(0S, 00000R00#3,05$ 02,0(00@c T: lQ (0,00 d Q`4d Q(0,00@$`0 (P4 -pPL`@$PU 0S0 S P#( T b4Q(0,00 04d Q,@0 S 8 50P 00 -LDMPT  8 8(K$X PH QL  \ 0 @D@ P0P 8p<`<@ 8 SH5́555@5455 5p555(5585`55055545555L555<505$5V_ L`F0zL Z0Sp8 ? 0 0VK L `F0zL  Z0\"'`?P  Ud 'w\`Pd JRh? 0 0V# L`F0zL Z'4,<'<$00 0 p80 0Sx  8T\aH  D00L@P(08pS<0S  A@ A!ABx!A!A A, A >>!AD!A A A AVK L`F0zL Z<D b 0@  0\ 00 0S^ H0 l80S'4<,'<$0 0 R DP1 l@L0T l0 T/^p0P(P8 7 0 07 0 0`l0pPX0Xd 0P P8 < 8 0 0G-|M00\`0 S\ 0 |0  2R0 Q2B@P0 RPU0@ @@@ |ЍU p0 RpW@0 00SJQS03<X 000Q\ 0|0 Q@ 4T $D@0 ^U010!W0!P808 0200@(0@L @$0, 840p  0@ , `Tp$(ń0@p@`p0 4 01# 1 l!c0  ll 0S@BpB @0 D4  4Q40A0 0440|0 2R0C8#(@Tw 000|08"C^B4 0@ T< P`0U |0S (aR  00 cRU  0( 0 [S 3 "R< 080 0  0bC1 @000000d0U0P0S PZ $(,80>P00[P030"S @  7 4^)  P0 4 @0S80 0  04L0#04 0 @!@00 4P @0 !0084 0@00400@̠$0(@,`> >>>P$ R 0SP-$^ 01 0C$ 0 B0P- $P | 0  !400  0-@PL0$Q P*UEU IU[U(0S 0,$D0S 0,$@0S 0,$80S 0,$0,qU0$00gUqU 0UG-p,l A?@0CR0Mx8|P0A?00`0`0, \0 00@ R 40 0 0t%Q!\!  00 RY*PUW  0 ^@ 0@ST@ 0R 0R`  0R' 0R" 0R 0R 0R 0R 0R  0R ` R 0l#PD 0@H08XT0 H4."D H @ H0D 0@@U*0*S -PPL@$`Q00V0SQ0Sn 0Sh  :TRpp Wb0S *R(0P(@ ES_ IS [S gS. Q TRZ:Q Rt0ST 9QN )21C00@S90PPpp,P~0(0,0Sq00 0S {8 0 80 #4 0 8q000S 8 P T  0] T XP ZB0SlS@ 8080 #4 080 #8 0; 0  0  "4< 0 "88 0 04 0BL0S0c00s3Y) 00 S&0B2l 0ĀRX'  c0#2c aq00aQl0S 8!JG H800SS@SP ?R 6 0S   0p W p  0 S,0S ^* n88 0 \p,0S ^:W0[0 p0$0S   0$ p0 0W p  0 S,0S ^b:u 0 \p,0S ^|:W0g000Se 1 R !"* 0   1S 0 S,0S \#= 0 \ ,0S ^* n880 R I00 0\U n88 n8|88!if 0SC{[00hg00kI00+ n8[8R n8S8z J8 000C 0 }0 0^a , 0R  S $0QPS 000 0 0  0#4 0 0#8 0 0   R  0S[   0 0S  0  0#4 0,0S6 E0 0  0   0   0  R 0 0S!0 00 q00L0D 00pCL   BD8 8RʟR0>>B -LP@P$`V q@0 T00?Uʄp吐"!B 0h 0 P  0 T h 0 @ |P p> -`tL\EPPUl8 H 0XT 1#D04 H00 @ H0D 0`p0Xd0x` 0\*,0lpA?C0ChQ 0BSU``0Sxlp\`0 SdTTT4aLD4A  !t@(4, 0! 0A9!0P933;ӗӅ@! 0@D00tx0l#3LPlptxpTlp:8 H 0XT 1#D04 H00 @ H0D 0lpxLQx0NUp0`0hlp= tBPPX_tPUZB UPh0S 28l  @RP 0C!@ 909hP\l P80 `Z00` l0\00 RtZ\ R80 b0L l0\00 Rh0S( ||18  0@R0`1  @9H!0900CQ lptp@ lpt0Slpt0 @hl0t \l P80 `0 l0\0R0 R S xp00c Sx0`0 lpQ`Z>>  -LPptDQQl8 H 0XT 1#D04 H00 @ H0D 0pWl` ,0l`A?C0CgQ 0BSl```\spDCD3a83L  !3, 0! 0A9!P0922;ӗӅ! 0002 t`0 BQl\t\PZ0L`0l08 `l` 0HX T2#D04 H00@  H0&D0 ` p BR` l``l`^j \ R80 b03 l0\00 RYxx1 8 0@0`1  @9H!090tl` 0CA`Rtl`l`8 `0`0l` H0XT 1#0H0tQX Q!\l P80 `X00l0\00 R XR5Q3l``-X>>  p- 0!PCUQL@`tP7l0\0 Stl0 P0`Qt08000 al0l0\0B0 R l \,0 aA?C0CR:Q800l0\0+0 RpOt0p03VQS \l P80 `V00fl0\0 0 RVpVp 01P? "# $P 00S P0S p-PPLp$`V (0S ,0S 0@0 @0@040  0R b R0q0*0R0,  #@8(@)L0D, 00 < @CL   BD`21C 0 0|` H@l@\@t@x h@p > -L M P\p` (K0@R1S  P(0 S0082(0,0S,2,0qV`f, V , `F, 0HSUV00V0S Y00é?Z00ê?40 0[-(V `@P@ 0Πh10 €0 $@B, 0A 4 TP 0`,40Xp00 L00(8, 0(@L 0(0#`D 0 (80!S  @0S D0S P 0`\ 00$P儐删(Ko404 00 0M_55> -LM@ 0 0=K@0`>GN xN 0Q09  d0xQxA H0LQ40 , ,0 0 | \0p@-P0P ;L0`&N,;<0 @P` B[$0K8;`p@XTklTkTkG-X1p0\;^M0100110\[`1@ 0T'+ 0 P\[3P`1!0 \[\1!@0T:`P@0 R P0`T 0\+Ѝ0<0 R0 P\[PXA-\p10  W@? `P! 0 00P`  ^`  P0EW#10\^ \^ V P! 000< 000 \( +-Ӳ0Ѳ000²0Ѳ0| G- M0@SR 0 0`1V0ಐ Z > VEP 008#88#800 "$ 0 c\ 0C0PU0:0. \e0nPLuʰ 0PU00*Y   Z  0000C^ Zh \$ 10. ⨄pP0gUڔ058#88#800 "$ 0 c\ 0C00`F,4 pP0gUu $058#88#800 "$ 0 c\ 0C00sPUNڐF058#88#80 0 0"$ 0a PA~ VA$3pP0gU+= 0%r0P UF058#88#80 0 0"$ 0a P AM ЍTF0 5 0C4Ÿ82 % 2pP0gU/2 %qP UB F058#88#80 0 0"$ 0a P A T0 5 0A4D!058#88#800 "$ 0 c\ 0C0p0P Uʸ F0 5 0+-058#88#800 "$ 0 c\ 0C04p0P USF0 5 0 0@-0@P 0CU0 0 ! 9090 0@S0p p 0<010)EQ )<0803ӗӅ1(0  >> G-4@ MP '!0t`P0fUڜ058#88#800 "$ 0 c\ 0C00,4 Q*04 0CⲐ Yp 3+ 0̣` P0fUڸ058#88#800 "$ 0 c\ 0C0 0\3QU" 8#88#800 0"$ (0a"(R#A IX223pӗqӅ!0` P0fU}t058#88#800 "$ 0 c\ 0C0 0$2QUq 2  e^`a`0>8#88#800 0"$ (0a"(R#At1  QN:0TkpP0gUF<058#88#800 "$ 0 c\ 0C00 0 Ѝ0 5 0S00 5 00x0 5 0X 0 >0< 0 >0Z 0 5 0>><>>>(> -LDMh 0& p`W6@d <d @0 SU 0 5 d  \ˁ\@ 0S0#d0Yd1!0Lşd \ @ ,5 B,UX 00b0 0S0d0h 00?@T  @TQ=0! ğ`K 10\ B ` Xğ` 0Q0CC!10 \K \  000@  0S 8#8  2 P 0 0 `{3p Rʠ`   B10 \ h pP T  X 0\0 \3 \㳐43 ! \ಐ0PU1> 0 L` A010 W`` 0 P0S0\0Yil 0Tl X0@pװ 0#!T R 00" PU`QO G@2 R 0> 0 0 Q0CRA 00 B 000`0 0C BS`0 W> 00L0 # L R 1> 00P!Q@@PE 0Sc0 N!! p^L Y BL pI H K 008#\d0S P@ 0^ `(K 0S08#x 0 ` 0R(K0 rC dPU@(KP=TX< 0@-P@0S S t0 0"$0C0 0< 0 #40  0 -bLP@ Uzژ058#88#800 0"$ 0a\à A882(RpgPPŸ+0Რ08#88#800 "$ 0 cZ"0C0 0!a0P 00eS' U:x0 %`Q XLL0>8#88#800 "$ 0 cZ"0C0 0a0  ;㳠 0 0 0 % 058#88#800 0"$ @P0a\à AX 0 >0>@-0@0Sڀ  0#4 0 L L000S00 0 0000 -@L@ ^pP`A 0>8#88#800 0"$ 8 a#8S2 A00  8#, #808#< U0 0 \  0 >0 -LM`pPP00 @2RU+t&(+oԅ@010> 0 R@DT0ş  5 0 ^ !0S  W R0QS38#88#800 0"$  8 a#8S2 A0,S@ T J048#88#80 0 0"$ 0a P AZ㠂P 30 10> 0 ("(("(  0#40 P0b\à B U  Bp P0 10> 0P U ,0P&M C@   00i00S(K00X048#88#80 0 0"$ 0a P A00058#88#80 0 0"$ 0a P A tJ0 4 0gT0H . @4A0 5 0 Q>><>0 ## p-L@MXPKX T0 H `l @0D ( 0 , @P KpP@ IT@D@00B@@ -LMO- Y I* Xb$\(  O-`Q* @@ P@ @Pp$DL%T\ @pP$HH @ PpD%\TP ` RPb⸪in4_cksum: out of mbufs p pgQMW@PФP``$($,Q@Qx       x         @Q@ Q x        Q0@cA@0  0  0  Q@A 0Q@Х@PP484<  > A(  -LPX5`5h5p5x555555555555  $(,04@DHl"A( (0 -L0 h8|o5Uk -h0Lh1S P q00P0S p3 p3|rr -L@`PPT T pT *p00 p@P0T0P@iPP"A 0- <LM00CP@ S 555555l555554偩1??3 0 008 >0  0   00#2+!  R5555 00 K0"880A10 00  Kr8 0A100 0L0 "AUU33 -3LMS`p3P:W) @P0@0PU (P c(KQ < @@ l, K00K1P , P UJ U 4 $C@$;03$ 466cR 80  "82<8\!l\<  0 R00L @U[ U; T8H"<0S(2@0 :#::cR80 0@0 00 R !p10P1\ R 04 K04 1hxp,0d1 R PpD!,P01\ P,1R' ,4 K~,4 h00@0 R p 0P0\ P0R 04 K_04 hplp` ,PL0\ L0R ,4 K(F,4 0h DB"Ar"Arrt6 p-L`p P 0 RxL lz3 *x`@P00000C0twL c3謩o"A4rUk 0-PSL@2~s 00H00H00 R-L@/ R-L@/ R-L@/ -L M4  @,  R uRu B,  tR RQY10P%40@0C`s0 40 * U( @  x  `  00 Ep6S 8 Q q U:*P400Cs40 (Ku, RPE @`04 @D 00` tU: PP p 5DP T1T,P @ 4 4r#A#AD;A#A$=Ap@#Ap#A#A#A#A -QLM@|hoplhi`eP`$@[H4,UD hQ$A4$A2AL$At$A$A$A$A Q-L @ p-LM0PK  % @`P  0Yx5 0- L@Pޥ 0hD;A$50 -0Lp3 0-@PL> `S  `0$$ L000# $00\%A> %A%A%A -L,M` ʟPQ 0S @0S @Q9% (K @2S' %.9!  p@A0D0S, +4 3D 4 P0 D9L <)09 < 9 )TH 8 0 @ x #0DWS񟗤66666666666666666666666666666666666<666666$666666666666x6666666666666,666666666666666p66 66\666 P0spA0A0S Q ,Q, 2 8@TJ%40S %%vD T |h4%0%(0 0@%$%%( 0 4 D1?3  ?#%{ u%odj`@pT 04 Z DW p@T w04p@TC ?%90!1 H*%t$%\O8OSp<#B %$40S 3  Z p%p1?3?3t3t#0JS$Jt %L30St 2t  W <%60S %08| thKA; @@ l DW!p `@,   db^LHYgU\THy<%(as5e'>T>%An@>>>>>$%A<3AD;A%A4%A0%At3A<%AD%A@h@%A@%A%A%Ap%A\%A"A,%AT%AX%A`%Ad%A`_@l%Ah%A@L%A/A@B%AA%A *Bn@x%AA@xB%A />p%A000 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 2 R 2 R 2 R  2P00 R@A0P0A Rbs_notimpl_%s: args at %p-(O @mmap@r_1@r_2@r_4@r_8@w_1@w_2@w_4@w_8@rm_1@rm_2@rm_4@rm_8@wm_1@wm_2@wm_4@wm_8@rr_1@rr_2@rr_4@rr_8@wr_1@wr_2@wr_4@wr_8@sm_1@sm_2@sm_4@sm_8@sr_1@sr_2@sr_4@sr_8@|c_1@yc_2@vc_4@sc_8 -pT`@PL Ld8P$1( <0D $00HT!0C00wwww -tt0 hA (0L H0 R{hT( LP!勢0P1xmq|rr|r2-@tAPr?0RW` 6h6t66` B`p Bp` B`RE0C`R9`$666666 66` B`p Bp` B`p Bp` B`p Bp` B` B`p @R B`p R BRR `6666` B`p Bp` B`p RpPP2-BtAP00O0RW` 6`6l6x6` B`p Bp` B`RE0C`R9`66666666` B`p Bp` B`p Bp` B`p Bp` B` B`p`p@R B`p`pR BRR `6666` B`p Bp` B`p RpP2-DtAP?O0RL` p6L6X6d6` B`p Bp` B`R:08`R/`66666666` B`p Bp` B`p Bp` B`p Bp` B` B@R BR BRR `6666` B`p Bp` B`p RpP%t!$0000%t!$00000&t!$0000|r0-2P? @P4@54?3P0p-2`? h@tAPPP`5P65?3`pp-2`? @tAP 0Pjen x+1PP0OxPa2 7O|roxmq<r(A\0007 p- L`P -7@PRp^E6G6E6TF6F6HG67 p-`PL0e0@ Q<00  \@0T!t1*4 t t!40L0C0$Kro rrrrr=pvkNk(AVkVk|rxmq(A -t L@Q00 s h(l8h蛚0  "!唚d Vk )A(A@-@Q >0^ 00\R 00$0(000 S-LP`% S S 1!p $pU4W @ PH `@H `@P h`bbp@ PH `Z* ` Pj $@L d(r rrMp@-`R0 0@PU ^ 0P@PU T0p@ЍT -LPᠠZp` @ (0@Z -LP Zp` @ ,@Z -LPᠠZp` @ 0@ XZ -LP Zp` @1@ \Z p-LM ` 0  @K P`P@ ,P% :8 ^  @ ^ 8: S@21C* "!B 0 :0^ 0 Kp -LM@`Tp*  R $ PR @0PS L   0 P  @R(K @ x -LM< \ 0P 00c80 0匢Xpw `tŸ Zy0 K40K  0 0S 40 Ro >*"*0L,  080< P @,T> 0\:00Q^ (KP 00b, :#: :cS1!\, ,8  000`Q!0S P 0pW@21C0,0,0X ` 21C0 0@T\ 8,0 0 S0@ p 0 , Kp p 8("(8Q, "*46*, (00S 0p r  -L$M$( 8 R`4 080 0 VR"PpPP%4V@1,K080K  `V 00pR00SP 00 4 $00( 0(K -LM`$(p Q,0W80,  PP p 3U00S 0S  @,K(K QR , 0 00$( p0$K -LM\@P$(`3*KpȌ$  K$K pP$0 0 $P(0`p0. . 8Nk -L‘H)A ->0^0PL@`P) 0Y`p@00T*U 0U  0 J0SjZE Z pF Nkrp)A -LM0(KpR(0 $ '`00^*P0.Ơ\|@ : c21C!\ c050:00$00$  $ 0S`V 0* Kq00$0(000D2 -Lp@@`  ,Pj2P `00  000$0(0  P0@-@P# T!00Q:P  RR*> 00 0 bR !. .0  00 >00 >a 0Q00> 000 -LM4 8 @<0  8 080S 0 Q 8Q;6;6;6=63p(K刖sq80< R,` T: `@aQ40pPW ^ U:>0 >0 S00P`8< 0pdWp! <00S<0 @8<0\,` pT: @gpW PV:`e PU4 00Y00   ^e Q:>0 >0 S00`8<pd Wp!0fWp!U <00S<0 w @`8<0P,`k `gpWPU@ePU4 00Y,0  Y Q:>0 >0 S00`8<pf Wp!0dWp! <00S<0 2 `@ tt娖 0Fc0 0 @, 0 : 咖吖r)A*A)A)A>)A -LM@xPQ $3\ b  S] 2"S0"?pzw1Eq1@8 l1 8g2XRR0S Z$ t"10@T ``"$KmPP2 RJ D2D R ,, A0B%@9Z$K31  .+ 0!!dpܔPPLZ2 : Z18l 1 0\T$KmH1 1R0 \a0@PLŠB%0P @`1۔cؔ`Ք]ҔΔ $KmȔA0>+A(r AX*A*A*AD;A$rr`>d+A= rr,r>8r*A*A*A*AH*A|*A*A$*A4rr$+A\*Al*A*A*A+A+A 0-<@L40P 0|1x!0h|rr-0 .!  !!-0 .!  !!|rrrrrrr@@-``6,`t`6 !!@@- - xp|p`T! 0 p?`T0 !@Ј! P :PP/ U  Q U  -Tp!W R X!P Zp x U W( Q U0  !@Й! p? pG!@- ?id !iDЍHoȔReset vector called, LR = 0x%08x-DMO- @0lP @!1 ! ,OTiDЍN  0O   ! -- -iP00V00S 0[0xK@P00V00SxKDP00V00S 00x1[0xr1A p-LM@<8P SP`: 0!10 Ғ0 ͒ (ȒĒ忒$庒4巒00S @D 寒H嬒n唓8< t壒l堒H \囒 0H唒1AL@>2A 2AT2A2A2A 3A43AT3Ah3Ax3A@3AD2Ad2A2A -|1LM @ H`0SC 0 !41vhQT!@  0`FhE V&: pN@ 0 P 0P P 000S" 0S0 . |<  0`E\0 R  0?   0`E0xmq|r3Ar -LMT@\ 00 H  -LM \`Pp@  0 `0!T1 -L(MCpH #D 000 0, !D3 #3hQ UPR\TXpH0H XN@# D :S1D ` 0 PU X  E(KX080  $壑DH 0HN@t T*2 R0S H 0R6BS 0"0S0C80  H0D4 00 , 08, 40$EH0&R 20S 6S 2"0S`` 0 P!1S0 @ 00@ P<  X E80K0H 0 P0SL0 ; 00 H X@0S <0H0x<  0DH 0-< Q <  0 R80 H0D4 00 , 000S 0S0 . p 080 \LDH 00rxmq>|ro3ArNk 4A3A3A 88#4 S #00S - - 88L#Đ<0h 40@ Q: 22P@|rpvk - 8LM8#tP`pB` 0P0V0S @Qv WS6S6S68S68S68S68S68S68S68S68S68S6DS6\^!0KY`P `0S a0S^  Q# F`0S`` `Q@1H#R) PG  F`0AS .00  0 `Q! dF`*n 00~0 0CS xPW8@0SWp p+`(r5A,rrr@-@ 0 @@00D| 0^D@ L0H000L0H0 0404550055 0404r-@P@0S 0S0S00 40C4P0 Q L0H00C0CL0H0550C0C55r@-@@\,\) 0Q0RD0 0D0 0@0 @"  4400C44 0Q  L H0 0CH0L H L0 0CL0H  %5 0C5%%5 0C5%r@-x@Q0000  00 0 0S00  0謋o- 0S Q000000 0 B 0S H Q 000000  0䬋o@-0$,@0S!*4*6 ,<10P  21C0P : #P 0S ( 8. :(#8 #:T000 -LMP`0 J*&!*1! &::06S1P!? 2C 0S06 :X# P PpT0j0pVP*@ 0H08T0j0pVP:8#(00b00 R 00S0(Kl0p0i@ T0PD0\ P@0R , K [  ,hprrrt6 - :8LPP# M Pp#7 2C 0S0. :#5`/\000 0000 00S@pP\ 0R $ Kl$ hp :#5` 0@H8rrrrt6 -LMq0`SC N@$:8p#*! #P9 2C 0S00 :#$1L RP( L000 R#80S pP\ 0@R $ K$+hph`pP\ D0R $ K$$ hprr|rrt6 -,0LhQ  0@|rr 0-0LM8 @  0 RP@8 0 Q `1S 8tPpP\ `0R  KP: hpH8rrrro|rt6r0 0 <rTr-  0 0 0 2 100s00#:$ 1  !!:10!\ 2C 0S0 0 0200 020r@-`Pp !:H$$X 00S | $:1 0P  21C0P :#500C0 p-LM !Q:0Q*0b"!B10b0 @ R  R 0S0P 0`0 0`K 0KP @@0| L000SKp`PpP\ D0R  $o hpqrrrt6 p-@LP` T pphP$ !:1  T0 R 0S0S R: #:Vk 0-LM\ ) \0> 0+ 0!0 00@S8hPpP\ L0R  K< hp80hrrrt6r@r p-LM0!>00P @+.  0;>00 0+. R| 00Pxl`pP\ P0R  K@ hp 00PxrVkrt6r0Hr@-X0@P R 0S \ RHr@-X0@P R 0S \ RHr00@-0L@ @0 000 0P0P 0 0 0 0 @0 0 0 @P0?00?l0 0|rr LrXrPrr4rrrprH6rx6r`rrlrhr8r@rrrr\rr 0 R 0a B0r -LMP@ D 0 S S 8 < 4 \3\#0 <0 P34 080 >0>0S00 m <>D 0+ 00)@ 02@ @RsDD JZQ D0 @46ZS#PP @ ): RyP 8#8ZS#;4D )6?> 1@pPU@" WU>0002 R apP\ 1R , K, hPpU@DJȌZD 0(K 8)6 D;#;  1 0!@QD0:JD0 QpP\ 0R , KY, hptPpP\ 0R , KB, hp\0\ 0 <0 P04 080 7 < 40hr8r|rrrt6r@rrr@6A6A5A p-``LM^P @ 0000@^KpHr p-`SL@P .:8#*l! #8\ 0"!B Q 00S:#50 600pƊrt6A p-!:LM@ P0S zP[ :#l1L R@" L00L!00S@aHx$!$1 0S : 00 00S`Hxx`pP\ 0R  K hph`pP\ T0R  KDn hpS|rrrhr t6r6A -L5 0 |oxr00 R$0 Q! 00}xrVkWk -0LM0S | 0@T00 KKh~L00.*@ @@@0@xrWkNkVk 0-0@0 0LP$0   R00 Rt P ` `000@0  0@0$0)$7Ήxrroo6A -p3psLMP00L 0, P U4 0So`q@P E201^ 0"!B  APP0 " !B 000 Q P hPⓈ UYZ @: JT * P  J T:bRDB$r,0쁟!i 0!a !0Y!0T@1CD ?FD@b$J@$B!`!0C21Cc!8!080!01@ @@  0  P  0P 0@0 @D(KX 21C! cL |레or<7Ax7Ar<rtrTrroorrdroooo7A4kȈoVk7A|o7A0o7Ao`|o6A7A -LM0@0b8#Ƞ\+P( `0p$0`!2 0SP H1 R 0R 01 R/ h'28#80100CS0 0X0 R ȠpP\ 0R ( K( hplPpP\ P0R ( K q(+hprrro0ort6 -!!:LM1p@!T, $ ,0P`j0S 0j0(K 0P00  O  0|900000"0,0!B0L P @0S~0or0o 0-LM@80[0 00SP @8)8\PpP\ D0R  K4 hprrrot6r -0L0Όn`VPp@ZJ%:P %6;#;K jV! /0?0000?娇VkVk7A -LM@\pP4 \`0`$: R.UP, $6;  #; 1 @RPpP\ d0R  KT~  hp00`$`]|rrrt6rr8AH8A - 0Tap@L>0h!R ?= ?0R% TWP 00#! @R00  00#!H0S  S 0 0iV0S|rrr -LM P`X%7*P&!*D1! &::6 Sp1 p!P!) 2C 0S0 :W#@@PL0HS H800jV@: 0SYp0h@P\ D04PR , K$ ,hprrrt6 -L(M`~X(~P2P " BϠ01l! 80 !8Q} 2@ < Pr 1  4K@ B0P @4 0 @Pd4`V YH* @8`JVZ=8 $$*(":X1 0"P- 2C 0S0$ *"%0L0000PQ pP\ 0pR , KD, hp< @< #8< Q @0(0@0 40(P@(K4o0oCNkrrrr|rrt6|8A8A p-LMa,:8#*! #P4 2C 0S0+  ! 00+0 00@SP8xhPpP\ L0R  K, hprrrrt6 -!*(":LM10P"" 2C 0S0 0* `" !Q:0Q *0b"!B10b 0q -P!LM`@V%F   0j0P> :#5p\8 Q8>0( &#&R+:0R(*0a"!B10b @PP 0T0U 0 D  D 00)G#&R:0R: 0a"!B10b @PP 0T0UD  D 00 0L1 R <1p01P1\ 1R , K, 0h0p 0j0$  0S@ 0 R0(|0h0p\0PH0\ `@0R , K0, hpqrrt6rP-0!R0P  0S 0S  R00L00 08   0 000|rro 0-0LS@P 0SP1000T' h1S 0 T 01S 0S 0S  R00l00 0X   0 0 00P$00rr|ro - 0LS@ 0T0000r -LM@PP ` @ 4Q 0 `R Q 0\` @R^\fT P^ @<4\ @TV \ 0``` *(":1 ` 0 p^" 2C 0S0 :#5 PL  0S |3 R `3Q \3 R 0RD3p83P$3\ `3R , K, hp@T22U  \ R V TK*PI @ `B ^ d2V^;`p(*(":1 p0"\3 2C 0S0* !" 0L0 0SS  0S 181 R 1Q* 1 R& 0R# @T :#5 PLd Ubh 0S 51Lp0SZ 08Vpp P\ 0R , K& , hp0S t0( 0S 0S1 L0(-80Hp0Xprrrrt6r -@PpUL`  0S 0` RH  \Q% R U @T ^  \ 0h0hS 5S 0h PPU\  ix -L|orrt6Vk|r -`PL 0S 0Sv000pCWp 1VT h1S 0 V/ 訡0s1!VTE h1S 0 V> *t00t!t t1 $ 0R10O o9w1S 0S 0S  R0000 0   0 0 0h@00#! 0dP0  00#!00$00r|rrorDrȈoor -LMP8  80e S030#U00 4 %*4 %!*! %::86S1\!p 0"!B Pi 00Se Xd:#u@TY W 0S$&Rl:0Ri*0a"!B10b`"000ScV4  0 =%R55SSH0SL L R0R01"0ATD0`0óD0D0` 1Z]   wD0`00D00QE4  4 0 ZXpP80S{0Q 4 0SL 4 0S H14  (K0!00`S ApP\ 0R , Kw, hp0Pi0 S  0S x08  _0S D0(0S 0$00qr0>rrt6 -LM`t PP X "&R :0R*0a"!B10b0<0 < p@@@@V  Y g (K**(":10"P 2C 0S0 Y : #50P4 80  4>0S< (#&R:0R*0a"!B10b< R8 D0< 7\ 0  \ @ @p%R5 SH0SL  0R01X'0QUD0`0óD0`D0`] P` < 0@V 6 Z0 0 4 R000$ $004S VV 6 RR 0RO 008 00S <Q %Ry5S<SH0SkL R0R01&0ATd 5V2  < <<D0`00D08V  @ @D0`00D0W@d <D0^ @[008 Hu00S_,5 Z 0 *:$  0S@ 0S tpP\ 4R , K, hp}<0L < 5< D0`L R225S&&4< 0S 7 0S4  3L,0SW 38RCp8P\ 3R 8, Kl8, hp  @ @hH}0S- (3((W0P00 0P V 2 Z20 0 \ P @ @p%R55SSH0SL L R0R01H"0ATD0`0óD0D0` "Vb  @ @D0`00D0 P`40 0S\  0S ^ 1Ls<<D0`0D0%@ t@Pp P I 0!V   E  < 0< @o 0PSt `r40o Wm 0Pg 0S^ 0XX  @ @ l0HK 0S H0X 00H0|xrqrr0>rrrrt68A|o8A 0-LM \PtP0 04PT@i80q,0 0t8Ȉorr P-LPF 1h1S 0Aq@p`T P 0S ` U  Q`PV Q 0 S- 0S0 S 0S 10#U@T% 0LT# 0D0 0 0S t0X 0S T0T0000H0P|rrr -LM0DQ8@8p@y K@(@0S1[ a A Q88'`pP张\0 S ( K( hx@p0[ Q pP\0 S ( K<( hptrrrroot6r -L M4 @PU 0L04 P0H04"h1S 0 2000 00  12C 0S0`= 40C4 : #%4p0C40 01 R 1T( 1 R$ 0R!  @\BrTP0 Y@0 T 1T,*(":10"P` p0P0\ 0R , K[, hp4 Y@@ 0S 0 0S \040 @H0(K0 0S $0$0 @|rrrr|ort6 -LM< @ D 0@@0 TD n @ @0 08 0 40 8 * `(p":1 0\"X 2C 0S0O :#50QP `F @ P "`0 0P2ZH  < <L0H 0C L0H 4 R 0`00Sc 0S|  0S 42HPU 2P R)0S?  0SA@T(K 0S_ H@P 1Z < <5%0C 5%`Qp P\ H1R , K( , hp0S0S 0(08 0S  0S 0LP 0S 40S l0H 0S H0XP 0S $0X0Prrrrt6 -D0L0 -D0L0AQ̰6İ6Ȱ6İ6̰6İ6Ȱ6? -L M0D S:(K J0D@ Q጖K#:8#*at@80 TH 8 Par0f0 R 0f0p,6@T) @T$ 0$"*>!00PQ pP\5\, Ke , hp@T0D6Q0D4@ID5p:#:S,050%$PQ,K Pw '*(":10"P 2C 0S0 ,00*"%0㘤0@Q*gx4P :*#:"*S3*X4X$$@Q  0P< 8000 %*(":10"P 2C 0S0 000*"%0㤣0@Q**t#0@Pp?t30 P<0 VP3X#$Q,K P p8 0 P 8, <,!*(":102\"w 2C 0S0n < :#5x 0Q40 c<*ާ0S p<P\ (2R <, K<,*hp  8 21C <0f!0001 0+ !;0 0o P 80,0 0K PMppP\ 1 QR 0 K0 hpp4P\ 0R 40 K{40 |0hpp)pP\ L08R , K(`, hpdrrrort6onqro|ro0 )Р)0 ) ) 0-0Lp4 40"!B P* P(ڨP0 R00 0l1R0C00p1@C\PU T 6 @^@D H0L@0ĎkWk WkpvkWk rr -3LM , 3cD#\0s C0S xC0S ( ("$PvL30p82 娂P@ n 0Sk @Pvt OK{2~Ϡ K,2 ( <Po00 @pP_"0S? 0" 2J 42@@p8W10` 60 S1Z AhvevcvHP!,0SN(K<"0 <" L!0<"0 S00S0GS666|6|6|6|6|6|6|66|6|6|6|6|6|6|660S @0SI "8"8 #$#v vvvvvxvw3dOOܲkrrĎkWk Wk$9ArH9Ar rr$@9A9A@B9A9Ap9Ad9A9A9AP9Ap> 0-LM0PS K@P K0S@00p @  0@@r p-40L ` LP`N@^P@@eN@ 0,0 P 0P0L pvrVk9A -LM40 ( L >~p@g00^0P PmU@`L@ $@K00  $ 40>ZUzj KcvVkr9A -`1LM0800 0(0K pP (KKpP@0(4 P 4 Kp0p , 0 pP0@@ 0_  Kp0 pP0 00GH 0-LM   $ h(0 T!P + 0.Tf 0T!.@ T1:40  4PT1L@E@0T!L O$Q( 0800` E`0$0004 K0t|r\E6A- QQQQQQQQ RA- 0@P`pQQQQ R@-M Ѝ@-MЍ! !P: ZŒŒ#! !P: `B!,aB 0>ZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0 Q@-: R (2 R R -PPPP RrPP B PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R- RP1P P1P RrP1P  B P1P B  R010 1  B R0q0`0q0`0q0`\0q0`0q0`0q0` R 0\6 R B0-81, Ġ%̌T$\D#L0P  R0 Ġ01#̌  R R B0-81, Ƞ%ȌX$XH#H0P  R0 Ƞ01#Ȍ  R R B0-81, ̠%Č\$TL#D0P  R0 ̠01#Č  Rp@-@P`R p0-@P0R0-@P \, 0L 0l4 @P0R0-@P \4, 0L 0lRQ@P0QP: p-QLM@P` S 0V pxpS`@rP`&0-@P0R0-@P \, 0L 0l4 @P0R0-@P \4, 0L 0l51@P0 p-QL M@P`S K 0V Kp  Kp K@rPp`(Ƞ 8!"(,Ƞp@- @PpS`b `c0#3 Q. a l^#(8.(030# 80 (3#0"P@p.8BA Q ! C2Q -L@P-S'pU#`S PW0#03d g0U f  e00#2 S06"l P@X t@P` r0(@pP@-` a@ \B@-@0@-@QP a0 120^0 0100 -L\M@P`p d5w`^0p(KS P  0W p#83K8#8ẃ[0 X$,8`K("X&3KK0<AZ0@L0"[[[2[x h[[$[3[xhWkp@-c@bP`T !L2pQ:P: -LMz -L MKrK K0-@"P#040 $ R ((0"4S8uk40 $ R ((0"4S8uk 08uk 0  0{Do -l LM0S 00LH0H@ @@@0喟P ,0 $Lp븋ox>vk|vklyk 8C9A P0-L 1R 1 0xA00hQ 0ȟ0T!S S00S@ 0S S00SQ00 R R 0 -R R0Q @a0ASd6 6\6T6 6 6 6 6 6 6 6 6 6 6 6 6 6 6L6Xn 0Q00@ @ + DSBODorlvkhvk9A -LMaPXBn, K00KV;n0嬧,`.VǟP@fwǟ$F@`xǟx 0E`PdnD0 T0b#6`P0X7 @T:00C)0卞`0*V0c140 ! I@9#9S &@0^:6BAD@L*tk0 1`0b*V0PX} I$ITyƟ0 C\ fs:00C *0K0 C\Ub:0ܥ0C05 *9ş 0B10a\0tJ:0 0C0t5*"`ş0 0B1\<0a03:0 0C05* ş 0B1\0a0:0 0C04*ğx 0B1\0a0:0 0C0l4*ݝXğ 0B10a^0:$4L*ǝ#SA E2T PC  Z @C0pßS@ ^㘣N@PƠ`@&l0@  0e@Ÿ: @y: @r: @k": @d4 9@]hB{o  @P: RTL2 |$\2 0<8Ÿ0>0>0 a"&2 !A  $ t1!1XT4T X!X1X T1T!P1  !0 4 "$ 1 00 2<y0 @|0 (Kmmm(:AlykH:A r r rpvkrrl:Arrrrr rrrrr| rC?drC"r rx>VkrUUUU roXM6VkK6VkH6VkrDo:A:A:A -0L @R  @)"0PtH0  "!   lljCg|lAG 4 =B? S4 =B? SAxlVk0kp;A$;AH;A:A 0-LM@P |dl)N8`P:巛P0c 0KKNP$0$Kl嵜vk|;AlvkX;A -L(K 0 h<$AVk -LM0$PK@%@(H@0  pmUP@ W 40;40ּ1  $K(PT,0K` 054 A$,|0@,0K40 0@ (P4 409040@P ᵻ@P04K@$0L0e/-4 ,4 409040 ᘻ@p -LMPpGK@P 0  (0H `pU@P V 40;40k$0   1@p000   p-0@`L P`@pd70@- @$T P@  @ 00 0 00bS- 0 $400`S - L  @$B (0  -0L00p p-LM@P0U` U U x1 zx0 03R0S48 L#ȠR66666 MP pP) @P <1Q Q 0RS 0R S J 0 j0 j 0 j 0 j x@0@0 jP0 c0\ j 0L j 08 |j꼋o>>;A$Q @ᴚP phAj 0ph8j6j20 @ ,j)jx%jp"jhj20,Xj Lj20,A 0-00L0p0C0SPࠃ @^   0.020 ^H6H6666<6l66d666l6d6x6 0$ R0@$0 @@@@X 0SC <0= P$RFD1R;B0CS0h<0= $R2 1R:BSV@< =04R SV@@ *<0= $R@@< =04)A 0-lPLU@ <0 l 00h<i8>A 0-@L<(0S08āPPr<0 p-P@L{<Q `3:Qi R0 000 0 (0 B("(( R `00F<p `R0000 0 d0`\>A 0-LP@@< @V00h%< p-`L@/< P<PUPp p-`PL!< @T R0000 0  ;p p- P@`L<0S@  R0000 0  @;p 0-LMP0 K@0  ; R0000 0  0R Q ; R P0000 0 RK06 0-@LP;00CS000@@;0 p-`LP;@@@;Tp -`pL@P PP Z0P DPP  0-@PLP 0M;PW;0(0S|Q(0S|Q 08 R0000 0 0  0 0  0 ; -@L;8 0C8#88 S :h&/ p-PL0@`` p:0S000 `@@:{p -@LhH - P@`L:0S00p0 0@@0p:0 0-LM0@ PK00l0p0lP:l0S H0 0l0S:p K0?6t>A -L Mp0`$ K@$0 :  lR0000 0  0R00|Q P P 0S0SP00000PP P 8P0C8 8S P0 i08S.:$ R P000 0 0$ RK6|>A -LM@$:0S ,0 =00S h:>A -L,Mp00PK@` 0 pP KH@K$ 0$?6 0-Pt@L]0h r -LPpX  `^@P @C0 `P 0tp r' -L4M0 8PK( @`p $KXK  0l@p P @P    a,@T`?6 -LpP`@P P 0000 P`刕 %%%Ġ_0 P0pPm -LpP`@P P 000 00P 00Cp0{PN -LPp`q@P P 00 00P `A@0V01#Z 0 pSP& -LPp`H@P P 00 00P `V010# 0 p,P 0-PL&@P P D0U<0 0 0 P0P00u' 0-2P LP@P P 00000 0 P0P0 -LMP `pP0@P P 8 0 0 0 pqP' 0-LM@PP@ 0$ Y:㗔  ʔ  Ɣ  ”$  㾔@w8 0-PL@P P 00$0 P0 P`0' - L@eP  dh1>A-  8 -PLu@@zpp\`9\T W 0m6 t!r -PLpu@@x``L\ T V i !r -LMp`H@P\P  `@P 0c;K!r7 p-LM`P@@\P  P@ 0@I;Kp!rp7 -L Mx@T K\ 0Tx@@]@]8 4 0@]Kh]@o>A r>A!r -L M0S` Rp 0@ 0SZ" S <00SO >0"0Q] 0PP7 04SP1Z00= 00S= ;<00S9  R00 0S 0 480 00S$ 08 <04@P(K  0PPP"P0 SP R00 0S 0 480 00S 0 480@P? N -LM0*S$ SD AS S08 <04@  (0, $  S (S S |c08 <04@ 0$ $K0 480 @ P``0S<0S P` 0@,P (` ,H`P,0Kp0@PD0` p0@ L#D <P`0@(!(D#Lp4  0  8 <040>A -LPp`@P P 000$ 0"U0P  0lP? -0LS@`LbPP `G ^00 R00 @ ` 00  0#40   0 0`P=00;000` P`70:0 0p0 p%00( R00 R 0(P\0 00 0 000000C2Cp ]P 0 0  `P Q` -0LSPpF 0SpB`P p=  M00 P600;000p PpP0:0 00 @ @[@B Z (0SL77 7 7@77h70[0 R 06P z\q \P p 0 00[0$ 00b $0[ |a Y 0(c0[0 Y 0([0[00[0 TpPpTA 0-Ld\P P1\ H1\00 0`Q! 0$ P 0ă \ #\ @ 0S@ S Q PT $xhYTP P ?vk -LM0R pO , 4 P`,  VP- 0`S0SI8 ℎP @4 {P70 0  r84000P 0R ,P ,(K Q-L^dA -LM< 0p,0 @P= 9`P pßp ^`KD PK=@KL \  0$P@^2 u |^#30 r^x@T ^ 0S[ 0CS27|7l7\7<7P20  P X{77777777777777 7777777777777777775^x 03 0SP U0S %^x 0PS@ QQ 0A0_S7^x P0@S@, 0RJ(K>0P!0H^@^<^0SP$]x0P @R]x ]x ]x ]x ]x ȠAĠ?=꼠;긠9괠7갠5ꬠ3ꨠ1ꤠ/ꠠ-꜠+꘠)^7ܲkt3A|AAAșAAЙA AA%AA?AtAA0"0Q_C 202202  202,04@KS!2$022003 S2ձ02ű0 4P :pPX 80S 2 71 - 1-;`2 `  ~X1 -\`Rq0Sm$ P 1!2:2A2<2  P 0S:yWP 000   뼠 :/Wxr\xP7 50 ReP`< : P` X6vk??7766 @0@-@QP0 2T?\0S 0R00@ -QLp`@0P/2^,?\0S& 0R#@P 2`$,V8`P2 00 0SxP7`- -PQL`0p$2U!2S 0S @ P 0@ P00P00S 0S  -0`L2SpPP@ P00"P00S@PR -L M P`0pQP  P 2 L 0S@ 0S 9P@(K>0 !0QqVP 0 0P)08 <041S,0  p @,0@S 0pS Z [ P U U?vk' p-0PL2`S@2@Sp0Q 0Qq0s q0sF r  r 0Z Q 0-LP@᪕0h/ 0-L@P T,P 0h6[<60 -00 LQP`p p@ 000P @pR -3LSP`p p@ 3P@pS0@-qr@P\^  0@00@0@0 p-0LM` Q08`000 2S020 23 0S0 0|Z03S0 @00hmZY040T.P HbZxh!4]Z00$PWZVkvkAD;Al(7XA(A8A -RL(M000 `  L0 \,UpP  PP D# 000 p 0@T08 <0$@ Y0H D0  08 <040T>0"0H@Qt0@uL  R  TpPm  PPe 42 0a0 p 0 @ @ @P P\s0@,0  Y0 040  8 0<0 P 0 8 <040P pT 0@,H, P`0@D00P `  p4 0@ P#D p<P80` !(< 0@p#L4P` P`  :T@0s PH K `P`(KY0P`0P`!TP`TP`T N? 0-0@0@PK@2L  0 0 S :;;S 0S (0@0@0@0cS -L@` TPP p# @P p 0 0p00 R0 P0  !40 00pW00  S0u -L`Pp@P P 0000P0 P0VB000%$00@0P0p P 0-L@P P }>0Pu0 0-PL@P P  00}.A0 P0P]0 -LpP`@P P P 00 00G0P0p`0000hP; N -Lp_`P @  0L 0'̠''D;0(T @0pPE@@  p-L`P<@P P  0, 0f0C P0`*Pp@ 0"200 0p0C0S_0S 0@ <0= $$R 0A0 0' -pL@` SPP p @P p  0 0_0C p P0  0#$ 0 pW 4R 0$ R p⯇0u -L@` RPP p# @P p" 0 000 R0 P0  0#$ 0 pyW 0 $ BQ pxnR0u -pL@` RPP p @P p  0| 0_0C p P0  03 0 "4 0ip<W >R+?0u -@Lp iRP @2 OPP @) p$00 0` S$770878787\97 87 8797:7:7;7;7[ 0  00 ;0%@T0#30Q@@\0 @00 30 0  B0 @:0@T00 [0 0030 0 + @T Ɔ[0 0030 0 + @T 㮆 @\0 @00 30 0  B⟆0 @:0@T0000[00 0""Ġ " 030 0 + @hTr03 0 "#  0 #200eb[0 0030 0 + r@ETO000K[00 \0#? 0_@2= [0 00 ;0P@#T-0#30 !  000  00\00    0 :0-@ 0u -L@PT 9Q`P e @P \ T0 0x10 R0 `0  !40 00XDP@hpڅ0T00 T"" 0T00 T"" 0T00 T""  0T200 T  0T#20 TT T(0T, $ 0T T T8 T<040 TTT(0T, $ 0T@3T 0PTP0u0S=7=7=7=7=7 -Lp P`@P P l 00 P `o C0W0000&4 0`PR p-ML@`0 PPP0\3 : c 0PKp -L M`S@P VP K ]Pp PP% T%J 0S0a0a010 @ B Q0B RJ 0 @POP0D@T ;J -LMPp@`$@ PP   $0K `@@@@+P $Q 00  00  O K -L MP $ 2pL@1O`P @+ (K $0K@@@ p@P$ R@ 00$000$ 0S (0S T0 @zO K0 @ N -L,M@`,@ pOPP @I ,KN 0@@@@ p@P7,\: 4 0 < 8  0K@@@ p@P, R" 00 0<0 ,  08,0 040  ,0 0Q t 0 @O(K@ O(0 @O N -L M@`,@ p-OPP @( 0K ,0K@@@ p@@P,0S@ ,0 ,   ,0 0 R T0 `@N(K0 H@ N -`LepPᲃ d0( 008,d 0&40" P T i 00 @c00 '7<B3 N@ $P0 0bQ 00  0  1R0cN^N'88# '40$ 80 i  00HAL@WEVL7XA 0-HL!88#P!X 4@P 0 @( 40bS@0 000h.0wk -LM  0gF7L7 -LM) 0ZF7L7 p-0( LP,@l` R4I7LI7TH7TH7H7@H7LI7TH7TH7H7 0S0C 04 @+0804 D4 $)a07&$@៤|#php0 0 00Cs 0 ph@04 $)a070K<0ph'080$ @D P8$0@D0 -L$M 4 ,000 0@P^4@2] 0, PS 0 |@(0D $@0 0DH0@ 020@iP@@p0D4D24  Py6 0W*(( (h(%D P`@ W :;0@!0 L00@ ,1 p0,l00J7 -00 <02 (K (Ko-0: 2 0@Q  R0@L0 H@ L@[L0@S<0 8@ T W<@[ 000!!0@0,P 0 C(Ko0uG7 p-HL!88#P!2`P 0@ 08040@ ;40D .#@᧣"V ph-0"080 1p Cph-p#@ᇣd"wk 8 8-#TL%`2@P 0@ |-0p6 E2PU 6j-.0" "2 K]&C | 2<2wk Q- L Q 0C@000S A | - 88LM#DP$)2`P 0@ -p0 ̠K6pP@0T X,@ @@S 2Tp 0, 1pP202Q (6,2T0-.2 Pp W T .)2 02 .!pP2T02P 2p02 .p0 3wk 0-PL@r6060tN7 p-`@`0 S00Ɓ0,( L0LP2  0\ 0Q000CO@Q4 hK (w$00X0ph637?D;AlI7p6 -LMK 0 K? -P L d M@4 &\1pP 0@ S,@$K 9T ,9T| K0CT 0CT 9T 0S@< 2,9T '9T Xl9T :c@= Q@62T 0T,  0@& 0 @t20S @ 0Py3@P 5@l3(2T 1T C@ 0@1T 1T@@ 0@P00S 0"  04"40  BR !@%I 0@00 0S!Q0RPZ!  00002  <4("4!<0^LZwkc@c Q Q@c ccedA c@qdQ ccc cmhdpd dc c c cQ`dc c k~rdA@-0Q0 ""D0@ 0p@-0Q""H"T *(,d @P` pA-0Q#l#x# 0""H"T 0@P `p0G-,MLQ.#L$@( #H#@@. 0@@ "$"h"DL h`@ ##x#T0. 0 @0 @0,ЍR\ \ 0L0_S BR00 0-PL2  0p@P  5000 +0C0 ^P0 000h-꠆0  -LM\BP<0 R,808 #t'"0R0y0!R8 t ` ( , Ps,4@P  0K@ g , 0 p4 0 rp@P@0` 0@4K R=: Z? 0@@ 0@`p4K`pʌ< @<< @T 0X  `p8 Y1#,@PP 0 Q(K0 0Do(wk' p-LM@`  GPP @  0`@vGx p-LMP  `@G@P P @ 0PPP @[Gx 04<S-P08 <041 (0, $! -LMP  qGP=  0@Pd`P 0t#GZ   ZGP& 0 @PM`P  G0S`W S Q 0S QP-` ` 0-L@PP 0qP0hQ -L M0  pLG`P  PP  *@K {%0*0K \ 000 0`X F K08 <04@0 @1A 0(,0 $00 ! N 0-HL!88#P!XZ,@P 0 @( 40bS@0 000hB'0(wk -0L"@0, 0p0C0Sh200S70S<0= X$R L0R hh$ <P P  -L4MP `e, -{ 1(0!0 1,0!Q8d0804  <00SL H {5@KD WpKL FK0!pKP {{ z 0@'<7X@**((0 "4#220*$ 04  0HK0, 0R(K$ {N$ܲkAAWEVLt7Al? -L M0,0 `[p-@ (K 0dP@EP @D D@ 0K ,0K @PPP@P,\@  1X ! 0X  xE^% ^00000S, , 00000000S 0` 0 @08 0 @0Qvkvdud@ N p-LM@P $yE`=zD @L \ $ 0ZP  |$Ex  z$Ex谝A -P L D$`,*pP 0@ %@  2V -2Vh <2Vm 0Vp R @%2V 2V 2V @ @ 0@T2V L2VR82V8  2V_ 2V0"0 @1VW 1V e/=@1V! :10S @0 .@P  0@Px1V@ .  @0S<@2 e@ 00e/ky@~ 0"@w Ql@p 0 P@i @d%40$ H N@(wkrdAud@pd Q Q@qdQ`vdhdtd@AedAmk~gdLt7 -LM  0re7Lt7 -LM) 0ee7Lt7 p-0( LP,@l` R q7$q7(p7(p7p7p7$q7(p7(p7p7 0SH0C 080@S08040D;404 $)a0-/@ᨚphp08 0 00Cs 0 ph@04 $)a0-0I00ph080$ @D EP8$0@D0p0 0 -LM8 , 4 0@P_82^ 4  , P0 R 400@|( < $00H0@ 020@i<Pp0L 820 4 YF 0@Q _  0 U0&!:0 0L00@ 1 p0,l40P-4 0 00 /4 0001 (K (Ko/4< !;0 0L00@ 0 p0,l40)-8 2 0@Q  R0S0  -,"P 40O(Ko R 8#8 S  0 ;0   `o7 p-HL!88#P!(`P 0@ 08040@ ;40D @ᖙsV ph#02008080p'p qOph#@rO(wk 8 8-#DL$`p(PP 0@ g#0p, 0(@T0 !22 022  ILOs,C# f 2<2.| (wk A-L@Q w7v7v7w7v7v70 0 \0   H 88 30O@00Do 0-P@L,(, Q 90,070k -LMK 0V K? -L M0   ,0 L2BP * pP  <`Kv@ a0 P<0K0 K2 K1 K;@K/PK v|1@0 P@ @\ @ A@,, 0 RD(K 0@,Hp`0@ P D P` 0@ #D p< P`0@!(#Lp4 0 0@ ! 0 8 <04 1 #000000 ܲk N|? 0-0L> h0 @\PeP 0P1S1S0hU0hv? -L0M0P<0 ,0 00 40 80 pPF0F{AP Pp`( @@K P 80K @@@PP @0S 0S 202 /  0 + Pp` A@ 0 0S<0S< 0 Sk d Sh  Se (KP000-AP Pp`<00S S| @3<#0S 0?0S:0 0@ #D<` pP0@ #Hp8!,P`0@0@<Q0 P4p`<0  S S%0 48pP 0` - 88@#tLMP'%`P 0@ P 2 P0 )PP p0W Z,p ppS 2WP , 0V%PQ0"42 02 ) 0" W-.208#82.5PP W2"02OP 2P02..0 YP(wk - 8 8LM#T%W%Pp 0@ p I  P0" 2 p\  * 0P 20 Rp(PT00` @u(  0 *, 4P,(wk -LMp2p2"0 S2<24pS2ס(92ǡ n, 0D"0Q000OO(`D" I0" [ 2S PF 2>Y@ aN0 0s0 |0`0D0@J2KD'DL0@K( t$ P00S! !0P ' 0)(K  _  0 00 hd 0P  PCHC @<Cvk@f7?D;A`q7p6Aud@0k(_7vdAAA p-2 1C`L P hR0000 0  000> L@Tph3`"rxmq p-P@ `L<0S R0000 0  ph 0@p-LP`Sꘇ7778787D7D7\bD@ P 28 1C0P `0p@@@,A`"r 0-0@LP 0 PPU@0`"r|rHoN  0O   ! -- -i@0IPP JaP P/ P `NAP GP #Ph AP Po HP }U# JxPs -U .U ,0E@Tl@i1 (0E0S-0E0S-U TTxpW ~0S V> P b#P AP.U,U`` /U ,0E@TR.Un =9'P =5'P' VLU* .U2 =+3P ='4P5 T|0,S 0Pn .UU V/U?P{@ mw uUP \Pq,0E0Sm?iPPmi ?`PAP*@:@P`j 3P /@ +'{Pl@#P@\P P@ kHW" 0(S( H P "`P00NPP@PV@\P`i~N`P}@PyV@\P,i@wNpPn$@P @lOP OPuF@qX1Pphs j8P  8P+ MP TP TP TP[ 48Pm $8Pr 8P} 7P$ 7P P67P1OPg,0;P*@|`&x@uT q@nT!j@gT"c@`T \Pg H0E0SRPNJ Pf00LUAP@=951-)%!0fLU?PfLUW MUo LU !P@* P}exL0EpW0E0)US@@+U*U T+U*U0Pb WZ?V Pe00OPo]PkE4Pg&PcXPd^kP]@P PUPQMIE MULU NUMULUC NUO@-`P ?)jP|b=#pPlbMULU6 NU4 8X1Py F!P4b v0@Sa bP ?jPanV@\Pa @@XPaH 510 Sa$YP +VR P0La0LJ> P> @L10Sar    10S`g 00 S00S`Y "r4ALA@ALATAAxAAAALAAAAA1J )A$A AAȟAAAAAhAA?:Pb5AP P 1P* P,c 4P1@* Ppc @Pc-@{?wP0c0=lbP8#@hPd3 bPd5\P0d [VQP[N@RPVN PddQ=H0P =D1P@ @/P+fX %*% P!4fJ rP@fx 3@PLft qPjXfp?P@|f% /@l phpf b yAuBf ofG0P=fCzPg@ P6 g<\@? g6\@g 4g0 0,0iPoLoQo -!H L P 4 L P 8 @P < H@@D LPp PP` 0 00 A p-LM00 KP@4 `0K(0c K"(@P @P 00 h7Kp00A p-xLP@X70`00 X04 @0P P0D H0H H08L 8@P`  phLA7<777&r 0-LMP@K dPK0 p-LM@ PK ` g P@ n00Kp -LM@0K 0K @SK 0-L@KM000dP0  `0K v0K 08 -LM@0K 0K @!K -LM00p娡P`%K @ 0PQ|0p1| Rp7L7L7L777770|0`VHP00& K0P,% [R- R&0[-&0[S*0@h0l@%[ $!B30b 03hl% [31C03Oh0l@% [31C03Oh0l@|00|0&0[S hlwk0G` p-LM0P00 #\ K0b`P6[  !76 0 600@ |fp@ <wf0HA@Aaah2 2 P@o 38@=TL6x\@600x5x耢AA7D;AAA -L fp3訠A -QLM0P@)0KQ0)0K)4 `()K0"(*Kp 0@` pP &2*[0 Œ4 0("( 0*K`` p 00(K Q0 0)0K)0K p-LM00P`V000K0K4 (0K"(@0K @00[0PKp -LM0@`SP  K0 `K0 P0f"pK0P P P0 0!Kp PPP -LM0`004@P%K&KU0L00C0HP%0K%0K4 (0"( p 0 pxP P&0[US20T0@808 <040@ D08`(500$K耾777ܢA 0- PL @MP0(? 0- PL0@B(0( 0$0 0P 00(?7(7777 0- PL0@)(0( 0$0 0P 00(?7l7 7770  0-LM@TP(Q*0R840D d00 8 -L5A -L}5(A -Lw5PA -Lq5xA 0-N@0@@P@@eLᨥڰ0 0h rNk -LM`\XVU*0Q`Q 0`0 . ~N,1@pdJPP ? :#: 0T05*JWZ/ Z,K00K LP`0` 0L000S pP\l0 \P , hJpWZr(KNkrrrt6 p-LP`cP pN@@N^P@@e0 ph腠Nk -LMp@*PO>00>N0@!@`dɢPP > 0d 0V05 jVJZ/  gZ,K00K ̦Pp0p 0L000S pP\0 \h , hpjVJZ0(K 00b 00Nkrrrt6 -PL `,p ,@ ,J"1d!Z0 !!@160 !! 0 !PU PP 0@  PU0!! & ?o`sZ|0  , !T 160 !$ 00, 1o#r#r#rxmqp&r#r -X L M0K@K000S  P \.1k&rA -QLM`pEڌ0SJ 4KP 0 *S  R04` 0p ,0 =88.(K4@K0 , @K31C01@@ HA>pA 0-L@ `0P?0d0D!s "Q 0 b 0ht&r&r&r(1@- @Ơ3 1C 0!02@$!Bb  @130` 0Na3QM0 RT d00 R00C0 R@TЍ&60cQ*d00 R00C0 R00C0 RYѭh&r -0L6f 0bSQ0@l  q 0bSp0 VZP帀i\00C 0@ c0 ` '0 VJ0L0cR01 S 0 S$0`` 06 06$0`x&rTo|&r&r&rpo&r&r -1LM졟d 1!\03 4K P,0  "!8 4`K04@K0TT f 40SG DD!0 fÁ0`S0c!S 18 0!! A00    0  ~0 06 &06&0C6X 0@ 0@[p0 (K00SUo&ro t&rMb|&rCA(xkTopoȤA,xkl7x&r&r0xk&r06 &0C6 B&0600 0 S  -@LP g -@LP [00 p-LM@PK,400  `P  xh:,`pW0@0h04 0\040 \0@ 4h0\xhؤAAA -00 LR 0*\p3 p-0LM| @0x0D L0p p0P T0h h0@`(PKX \0H`<[@<@00 ( $@ Kp\7L7777<77lA7 -Lh0040 \d -Lh0040 \d -L`{dPPU 004 ,@ 0;P0 410*0`PRhA0S 0P  0 K 0$$L04 P T0*4\@dplpt`0 H`X``h`|`x``` $3 d0l "3*pt`0 L`H`P`T`\X```Lx*Du*<r*4o*,l*&r"rХA&rwk00~N@1p@d!PP > 0d 0W05JWZ/ 㿖Z,K00K $P`0` 0L000S pP\0 \h , hJpWZ0J(K 00b 00Nkrrrt600s0Hzk p-LM@4P 0 0   P Txh$R`04 `o,0P x xh$ At]! AR 0S p 0P p0 P p-L M8`K@P 3TT080K@ 002K2K0 K1 K\08,0 :P Dd$2[2[   [$KpV$0u`AAA p-L M8!@0PSKp8`K S@3@  U002K2K0K1K8 KX08,0 P @*$2[2[  !$$0u̩AAA -L`8P P@ P P$0pW  P ,SS( 6HxT@00;00000Evv8!00LABDA -LPCFMHC\P, `<1  8 8ß#*RpP 88 0 S 4! (@P@ |$0iQg41 "0 9P@0@`  0O 0 @TPM D" \0(8!0 01Sz0@@ 0@P`衟P `00A@#T@!Qa ?8#808#8?@ ?8#808#8?4<(08$0q !n P P (1SH88888S@, 0R2(K'$%$!$0!4 d0! R(0#<.0OP`< 0,1KKOK,8 8 'l8 -LM) 018 'l8 -LM0 H 0 ",0  9ᘀ, (`dp@F Q%00 |0  0(K@,0 PLŸR00 y00! (Ÿ0 @00 c ;0008 < 00i10 > 600F 3@C 8^@4@ 0  @/@Sd@ ,0P 00 00! (\ 40S 0  0<8@00i10 0 >@0400:@e33 0004 \XPH}<,(ȯP*8A4ADA̭AAATAAAA -LMp 200l>@ TP 04 @`=Up20 ?P( 00  G0@6 0T R P0000r P 0 s000tU@ 0@]0@000]$KP 0  00 00D000G000>0$ +P` 0 0@  0@$ 000$ bQڰ08\{P000  0 @ȯ|AܮAAA`AA 0- L0P@K0h ȯ p-PL@8`P+ 00 00000 0 (0 S0$0@00 @ ,00( 40 ,0, ,00 40h0ppD-8P*88 -LMP \`Qp @p @T V4 0`D @JIT(  @zkzkt3An@<3A A - 0L00S@ 00S00 00S.0 0  -L M<`Kp@ P I0<0K0 60K@?4 K7@KSK00 5 KP3[8#8 K -L M@pK0@ `H0  @ 09 K!@0K080K4  PP 0l3K0P ,` P@  K ^0@0K18 K40 9 K3[8#8}  H09 S" 6 04"40(Q(A 04"40Q. 04"40P3(( SSy 'NEFX -LP@pA@`  0S  D'@ -0LSP@(`p0\! 0>U`P 0 S0%Ll2@l 0 0!rT@2 !  0`00S0 W00P0S@T R@@1 `@#`A -@ LP j0 0 - 0LS@ 00 0 ㍳  000000$ 00sS 0S 0  $ ḎooQ - Ll0p0X00 SX0S -0@L0X@ -@0L R 000S 0S  0谎ooo -,L\ \ 谎oo 0-0 @@ @ @ @RLP t0S pl 0t@0R Q0 0#0@00 SQ00  0000 00 S  (-"H 8TL`P#x. 0T% 0CT 0S :h 0@Sh00 : Sp0Tx0S \0 R00h 9h :m 4k -LM`0 QPk U Rd0Ra0 0@ QP  00KPPP0; S Q Q Q K0<00 PUQ W \P\ 0l@L00Tq @JP ;; S"  0 @0E8 U:S00P 2UP 30E8S0E8#X8UP 00Q108#XQ0 *@K  O ;q 0 9a0 0[0 0U0 0O0 0I0 0C0 0=0 @070 010 <+  0pC p>0Sa00 RLP hWD0W@ ;g 80Q= 0Q1<  p-0LM R3 00S 0S, @P`0S0C00  0AoQ*0 R>;  S0S0C00K K 4 0 Kp谎oo{kooPH 0P 0Q \0SX0S  k zk-00 Ƞ Ƞ,1XP zk -L@M\@`  # 4\ :40S P 3\! 63\k D3\ 3\ p  0lP3\ 3\ 3\ t3\@< Sh$0< S<1S\P i P$3\= 2\ 0\m 2\0SIP2\ 0\x 2\2\ 2\H 2\|0P       00  0P0 0 0 0p  0lP!0p : sPPB o 0R 1  is5PP@]0P     00 Ph P$010J  0P0  ?p | | PP| 0 4 ՠh$Wh 0TPPh3W W WW @W W@WWW@ W @zkW WWzk -LM\ 0\ 0\ XP,  1 P0\ 0p XQ 00S00XP  1 r 00 Q}f~fvt|f 0-LMP@@0@0CS088@- @.@zk -h0L Ƞ Ƞ,A0S 0400E00CS0zk 0-0 (("ALXPU 0 X0 \0S 0 0 PEP zkA Q-L, ph00*0S HA p-\0LSP*x0SH1  X@T% 0S" *0`0CS0000 R00!0S/0S&0 31C Pd0Q!ژ 0 S00 S P0 9pP0  00괎oCdA4ukak|F8lA -D@L`p PDB0 p ؎oo -(2 00x 0PL@P UT20SL hh0@ 0l h0 0Cp t0$PUDp`h0$ R0 X. P*  LPh  0UPhL|10S,fX 0P(P E (㸭h   BX xPh sPhp`ml@0@@7 ,2{kAoAzkzkD;AAoܰAA0Q 0`c  <8S@08#<@8oS: S>; SP 00S@? -L@Q hM8M8M8M8DM8000000<000000000000000000 -<00000@ L! pW`V 0S \ R P0 U*\  0S  ,00 S 0C$0!0v03 K$ R PP0S pp<D00D0$0S0H R0 0P ph9100$0S,0 0S  D0%0 000S <0@ 小DC 00C0S 00S 7 -0LS@+0S  R000 0  B , P8e_ 0- LP00 @P 8Pl 0 -80@ L<0PD0< 0D0 @0 -`L@mP P*$ RP%D 2pXp0#<10# 0%0 000SI ,0PPD01 U 0 0PP1D0#D 0 D00D01p$0S 0 <2S!l tPP $0SU0000<0@ PwAA -LM@pPRP@ 0`HČ <0 `eP@@o Kp8 0-LM@,0P0  K0KKK0 KKKKKK0 -L M8@#hPP @ pP@ 0Č.0 TPY0@0P $(K`} 02K*K2K1PK0PK/PK.PK-PK,`K+PK` `PP*0[  @01K `2`K0K/K.K-K,K+K -LM@0K p-LM0@SP Kp `PPV e0  K 0K0 B0K K 0 KPKPKK0KP 0-LM@,0P0  K0KKK0 KKKKKK0 p- 0LS@ ,` P 31C  P 0SpC A p-LM@`^P 0S 0S 0S 0S P Kp  0SK0P 0R 0 00  @00 -LMp 0K`P@P KPP@   0` @ 0 P 0$  0P`0 @ 0$@ @  -LM }00 -80L 3( 1C@PhCAA -0LM@ 0K0KK0K@K@K@K@K@KK p-L@BdM ~0AT 0KK0 K0KKPK`KK@KKp -L@MpBTAd#0 $K$0K#K!PK`K"K pK@K@KK -L@MpBTAd#0 $K$0K#K!PK`K"K pK@K@KK 0-L@MAT 0 K0KKPKK@K@K@K@KK0 0-L@MAT 0 K0KKPKK@K@K@K@KoK0 -\0LM@A0KKa0K0KKKKK@KZK -LM@A0 K0KKK@KKKKKEK -LM@ _0K0KK@K@K@K@K@K@K1K -LM@ 0K0KK@K@K@K@K@K@KK 0-LM@ KKCTK KK@KPK@K0KK0 -L Mp`@PP   K !0' K(0K&`K%pK (K$K#K"K!KK -L Mp`@PP  (K^0 00K/ K.`K-pKJ_0 (0K,K+0K)K*K$K -L Mp`@PP  (K!0 00K/ K.`K-pKJ!0C (0K,K+0K)K*K$K p-L MP@i`P  KE !0# K!K$0K"PK $K KKKKKp p-L M`@IPP  Kb@ ^0# K$0K"@K!@K K$K@KK@KbKp 0-LM@*PP8KB0 4 R:Q0 Q05:0!S S -LM@P$K`pP@ 0P @ 0 lP@ 0 $3@P'00 -L Mp`@PP  (K!0 00K/ K.`K-pKJ!0C (0K,K+0K)K*KI$K p-LMP(@`T   00x -@L40(0S (0,0 @,000h~k~k -L$0S h 0@0$0S0 0 0@ h~k -LMP`p1@T(@T 0S0S: 0S:( lR,0,0,0  B @0e 㽙@P 0 P` p0  0,P eq(K 04P00 0 P 0P@  8 0~k~k -LM@R@QhB` v@P 0$0@Pp R-@ 0Kb@P+ 0$@ 0 00@S00  P  00@Q 0 0 0$ R 0S~kP0 S  0 S   S0 S00p@-0`4 \P*0 S @  ^:0S ^ 0Sp0S@@VU  -L@p`PP 0S 40S P P P S P S:\  R @0S B -L0\/ q \ | q \| q \ | q \| q \| q \040Pe' -PLPp 4P L0`V@@V4e LPeXPe0 0 ! e<0h - PpXLP 0S @ X0@SP `@X0  X`@Ph -LP`p4e @PP Pp`0 00(  $ 00 PP0@e㦗 -qLM@`PP 0VDP@ ŗ `ᮈ$K-K 0OpP `,[Z* [+0[V ᨗ ` 0`8P g` -LLPp4@P? 2`@TD @e プP: L0 T$0P pQS 0S* S \0 \*S 0SP e 000S 0S@0 R 00 P T0 p 00@ S 04S!4000LAdAXA@A p-LM8P 0`P@PPx -LM@A 0 K0KKK@KKKKKK-<2S\0 R 0@404 ,/ #30Xe/X0I 0X0 R0X0R \0 S08 40 L0 P TK 0L @P \\e ;PX| \X0 AX0\0!m\ `0XgWe@Ta >P@eU&r8,8A -LMI0PS`@)pK (0[S$0[S I0@S   0pP K * -#0LMAD(0K0CP(K #@K'K&0K%K$K"K!K`@P  K p2 @P0 0pW@W  @ -#0LM`AD$0K0CP$K #K"0K@K!K `KKKpKP K @2 P0 0@TT -LM< @P0 `e k`PPv ,0 00-0 3,  0 P0? @./12 00 `Q 0XS b 0S^  R00 08 1 8 04 )PP98pd@ 0pP5 2@RT0 1 00, K+@D 0pP 2@;TP@D1P0@, K}. 0pPP  (KX! 90S%  PT0 ^0 0 S  Q 0 S lg P?0@S@0?0LK80S? B4100 48 0PPPP0P  H P 0 1 0 <`48 0PPP0  0`"R 0d 0!< 00PP ,@K  H ? A ! 01 R101 01XQY QP@S G B'0+1X P@0Q0U0SU2G? P0U0T R 1\\ T 0\0  0S 0 4 \\T 01[O.&H 0KhP!  -LCMXJOKP@D`K p0,P 0  !@ &W@ p = p<0d &@;E0:PD`d  Td&@ d&Pep &@ d&` 08 , 0R(KOܲk|AAAAAl? - LPp `` ;W @T| Qq XqLW ,q@A̵AA0@@-  @ 0 4$(8XX"(#!\ R0S$0\ Q ?XH ?R R04. -00LT`V( 4n49 pW0P0@0 PR@ 0WPf8Pf0Pff㕐0 0T0 -00QLT X Zp`000 PU XP P @X0@PpZ` -LMT p4 000 P50 @0S0 0S-,4  0S'`T00 @B P P0  DPZ P T0S 4 ` 0S(K U 0S 0  K  M Ku TP> ~P 04  0 00  0`PP6 T0S  !0S00 0  ,  0S00, x0 l 00 P00 <~00 ( AA\A,AAxA -LLMh0`,0 P 0P P: 0S=_0`KTpK`0K_K0 ]0KZKYK^K\K[KjR@[P00T00SbPT00TT<8PfgX 0Pfaf^0T0, 0RR(K 4"4f わP @f {P 0\ 2TH0S 00S 0SX KPXpP< 00S T0B 0Q1 0CĠ YKZ0K B<f 1P8 <X 40 `P y fqA00>0S Sf Pa T>p00  P0S}?d0 00  00>0S0 S1 C00 ^pT p 0pT  P s0 hf0 R0@0/T 00ܲk̷AA88A\A$AL ?8xA@AA -@L/0S 0 S 0 Pk0   @   ,D  -t0L \ |0x  -t0L \ |0x  0-t0L@\P 0x|  0 00h p-@0@0LQP`' Q 0CQ Q  t0V  ph0 000000p000ltmt -L~ 00s ^ 0 Q-L@q ĸAиA - p0P0aLV@/ 0P+$0S ( S ( 090S p pt00S | xP l0< 200SkX6k -LM@@Q LDH04  D'P Kt8 -L M`Pl@1 RR@p 0P @  i$KT @P ,@K(K  0 t0\  0x| @(00Cs(0 ,0,0 p( ,7P  X6kܸAA -LMR@Pp` 0-P t00t0K@\& T 0K@h0  c t @0t00t0 l0T 20 -H |  0K]X6k -LMl!p00Q@U 0P Kut0pa`Vs H0SHP`{P t00t0d0P 0 t0\ 0Kx|` 00 X@T |@\`0  @\.` } \p`0 @ k8 p-LMt0P`\ x| 0@  0  @!xxl0 20xX6k -LM@l` pPP(K 0+PPt0 \ x|  0 PP(1@W1 1W1 0CW PP0W& ;1WxP0W! 0W|P00S P0P0P PP00]PX6k]t@yt \tzt  -LMAPTp` 0P P0000 a0P0CS0[k p-0LA`TP 0P Pp000l<0   0P0CS03kX6k p-0LA`TP 0P Pp000l<0  0P0CS0 kX6k -0L @  0 h躸C6k 0-P@PL@P @@PXP XXPDP 40S DP\P 40S 0\00\ -`@LPp @e0@0XP X]0X0DP 40S\ 0D0\P 40SU 0\00@0CS0 W t0 0B)t0 )0Q4 0SP-00S PU@ 0@_ 0_W l0 h!Zt0@0t0᭿00PK\H4ukak(8X6k|r 0- 0LSP@ 1/$ 0 (080 T 0<0 4 0L0 P 0d0 h ,0t00 x 0|0000 00 000h*AD;A@B88Aʋ -PLt ` p@l0  t0 0t0@ =t00S x|X6k -L|PApT` 0-P P000 00P0CS0k - (L8Mpxxğ(" , a\0 㘿 PR7<q 8@0P@ }, 0R(K480l0< D L0p0P \ h0d\PP@` t00S x|@P900ᵾX@LP᭾t0pp @   \㿏P E R? t0 00b ᕾ@K0C0C @l ɟPP4W4 1 #P-#P)PTP TP P@ @$K3"  D   0PL0 0 @L00a 0, K&PP @4T. R4T 4T0 @P Rs-@W 3"  D  0S P 0 000 @@ 0 0 0i@P 0s 2P@0 @p@ @3T1 3T$ 3T0 ;@P 0s  0,P  ŕ@ap 00K0P @O0  R Rh 2Re  Zb*Z pP 0@80 0PP0 L@ 0 8K <0 TP X @ 4 H Dp Á@0PSn 0XA80#8 @Pp0Z Q @0S] Uw n@0%KYP%0[@000 KPP 00@^ࠁ0 80KX0 0P0 L@ 08 X KT @p <0 4 H Dp L@A0 @P  eP2 .@0, KP,P 0@0 X KpPX KprU~fqUhU pUAdU@iU@fU eUkUmU jUoUnUlU p-L ȠM Ƞ|,@   AdP0 0 <0`0CS0KpkD 0-PL0P@P0  ~PP0 L00h40Q 'P ~00hHATA0D0 0$0(0,0004080<0@0@-p`WP @U13*\0 0!`! T070C>1 g2S p-P`L@ 夀@d0Pp -L` $Rp |R60h t44p0S* QG ^!1P!B00^99`999p0S:0 $ (U **0DS;9999P9 0U T񟗾9999999999 9L90 @0PU p T;9`9999999999pX0 0C\ X0 d p0t4 4S 0t4x4#ptX0 0X0\ Te  p0t4 p[^ 0 ^8 #8t$,R10 tt$H^0 x40 ^8 #80:^ 0 ^8 #84.D,<*@(8&L$P"H d0(l0h hh @ppp@ p@lPh plPYpl$p8 0 $@\0`/ h x4$S 0|4h 04Q t4! St0t4P0x4t40CP0110t |, h 9pl0d 0 l0d 0,0h +plhd0d@"tDl xDV谹AAAAйA 0-PpLP d@~Tp@0h~ -LhM ` dPPpK l@P <0S SZp0S$KD0SlV@P -LhMp t 4`KP?@P @0S<p0 St0 SX80K 0SX@(K -LhMp Pp@`KP p0S<0SW,p,4 00*Pig0P$K - 0Lq 0Q 0\00` 0-LMLP\0@ @T  @ @T@PK0LF -LM84@4 00 -LM8@\` p <~PP@ 800 o408 4 0p@}40 40`@ -LM`8Pp40 40pPP ~80@ 0n408 4 0PP} -|1LMQP d1Q& 1CQ KD1Q800Q* Q< QD0 0 & 4$K KL 0$ S;#0 0 nQ Q QD0 0  H0 0  0P H0 0 8@ 0@T@p0 GT` VL0 0 L0 0  }nUDUU@ 0-90L4@ 090l PBUlPPPTPLP LLP8P 88PDP f0}DP0 -LM90`4P@090l  Rl  @KHP fI}40D@PH@ 80@ @P@0P< @ Xq  4L0P@ 0PP 0PTLg @8dDf|90p090PlpP8pLp PpTP Tp9 p-LMP0`@P Kp  0K_ TT Td0DS Q020C0 !1*h0\ 90   @ 8dA Q-L@[Q W A,A -PLLP /L0L08P '8080\Pfj|d\ p p`@h0!R hh 01dp@\` Qp-L@` pdQ` `P h0!R `P00-P00Sdd` QP0rp p-LhM0 d0 @P`Kd0T@PKp -AML MP0004P`p  @ X 0S@00SX 0@SP   00S@ 0@S@0s 2Rw 2R (K$ Kf0( zP($\`8 @P]P0h TT2TP"P @@f {Phz 0Td@H0yCKpH0($ PpH0PHWH0PT04` H0 18K!0P gh0P1<0PW @0 $(P0 $(P0$ (P 5 K 00S S$0  @v0$0 $f {P(  >CRz?C@$0 i $ XliSm0h@$0 [X0T0H0j^At3An@ԺAD;Ap99CR0S ^@ T0 ?S $0R p-0 (L("a@0P1s s pD0tP<0@`㗰00@p0tP<0p萀kkk 0-@@PLばt R0t0 0S000hί -0L Ƞ Ƞ,Q@0`P@ ^A p@ T0S@ᯯpꐀk -LM⤑P0@, `pPt1T h1T& `1T<  0p, 0RA(K 1T 1T 1TQ| |P0|00 |P 1 Q0K0P P 8 D0R0 KP0-00,"000ܲk}fpUAUvtnU~f? 0-LM` @.Q@@v0@0CS088萀k p-LP0`PH0@T p PהP p0P Pp 0-\0L Ƞ Ƞ,A0000P0CS000萀k -LMt0@`, p 8 D0@R@PK 0kPPD ᐔP, 0R7(KSPT0S0.  T P0P&U 000 ᔮT R@0T0U0S T@#T@!PK T UPP $] v#PPܲkA? 0-\0L Ƞ Ƞ,A0000P0CS000萀k 0-D0 (("ALTPPfy|P0萀k 0- 88 #PL*0AT 08P P0PPT Hf y0P00|P0萀k 0-TP@L 0 p[|P  0h袏00ქpM|P0 0-90L@0Q!ڌ 0 S00 S P0 M0w0P0CS0TUtƭ4ukak9 p-0LM@00P40@0 K00 K85`0 D0 H0 H 0LD 6KpL9A`1S`-T1S0T0 cB80K1 0 !p0@ 0 1SWpp# 0P@Iφ  0 pΆ  0 pOφ  0 pRφ 0p p(K80S00 1S480K^Eφ0 1 ᆕ4A p-L?L`@P€ Sh 00@0@p -LM0`S qWDq $ D  H PH!2@  D 0(KP0RFC Q<00D 0W@ !b PA \> R \ 0S0S  QD(K0 0F?C, D \\ P \ 0S 0 S  QD( K00F?CD \ gD1S BT\1S t`DP ]K0 \  'D@TἫ(KK gD_W - 1LSPp @`1 1S`@ !gb1S 2S a1S 2S h+_ tgYhį_ lgYh 0-a1LS@P \PEPP5v0X 0 PA&r 0-DPLMXa@ $K 0$ P  \K0ĀkXF8 -@Lp`PP DW30, Xb10Ya1P @ A&r'9 0 &rQ Q 0S 0-@LP3P l1p!PP @  P@T0*? -`lp1pPQL @ ,P@T i*? 0l 0-PQL@ gt00ht廪 p-X2@SLTP`0X2S0P T2ph3 p-LM@0PPH0Sx`KP P  0Bx -L|M Q@pP` - Q `p 00P 0` KiW@ p-PQL@ 0hP` P`PU php p-1LS@`P 3SP php 0-@LP90P0Q P  -42LM@00`40p,K00( K80P(@0 ,PD0( ,JH0( ,DL0@,(P0 $@ P@Pd1 R7 X1R :#Q<~14AS20 ,!t K0 S #Q0At ]1S 0 @}LP0$K,(| @P $0 \0\ UUT03L03 l-9SD;A*?(*?Āk*?x*9*9 -LM@K K 0^PK R00 1p@-QA 1CQ 1Q p00S0C0p@T)^&Q# R `VPU1T^QRT Q V U 0SS0SSp! 10! 1 0! 10! 10pA !01 !01 !01 !%W A W@00 -LM P `p 0S`s "30,0 0,0 $0 0@ < 0di1`ST1S Q qAW 0!0llc0 !0ddc0Spp@AHP0D S00 d24p0@S0  000 0S 0 pS .,@0 0(Ko} 00C0S(K1S0000 PE 0-LM0@S P  0S) S# S    K 0P  K0h   X   H < 0 n@t3AtAAD;A$Z8AAAAA -LM` ! 0@000p000 00P,K $0PPl(K, 00@00$ 4$0PP S x, 0000 S k0 P #0 PP  ,0< 0S0000#000 P T#0 P ,00S0C 70Sh _c00 04@ 0@G:S 0S  0@S<0S =Q X0S| S~ 004 D0PS4< @0PLX0St 00`@P`@> VX 0BSP2 X RW .:R,1T0Y 0BS7V9@V9@V9V9V9d!`!}@!{T!yP!w0Y0R0Y0N0Y0J0Y0FP< igiX@Y@\@`@Y0PX0.BiRi>0S=}`0T04> H0|P ľAȾA`Q@AAA<+?AؾAAAPA00 01 0@0 T0%(KQ( 0 R* 0Q'0(00 (0SP( P0(0 (Ko;c`q0(00(Ko00 0!0(00(0Y9pA@0S8@0mk -LM@P4`0P3 pW00 00 0! T@  0 P0(Kos0+ R  RW\'0(0(KobT@$ 0AP(KY9A p-L!M` 4 0PS  0RKp0 "K@Kb PK1Q K1@K L4 0 `mx ܲkA0? p-PL 6i@`@ @0-i02408P40012` 902`pX9X9 k p-LM`2 <2PK0@!2 _00004  媬00CS0xxH7 p-LM`022 < ;PK@ 2400004  00CS0xoxH7 0-L(M@0PP=0 KKP4K KK2 K0PKPPKPKPKPKK0 -LM6`pI $K=004K40K3KC0 & K00K.K-K2K1K/K;=0P4K4K@D0,K.K-@K3PK2@K1@K0@K/@KP08 R06=04KP.K\@ 03K-@K2@K1@K0@K/@KP64K,KP6L -\ LR`p@P<0PS 0\ <0R@ Q-L09 -LM0S  0 Ƞ8,Ƞ#8 P 1? -LMP@` CP d0 (K, KpP 4 08 Ƞ,Ƞ#8 6 8 2 ,_,;0P4帀K\0 2@>K ` Xp PP L H0 d D` P6 = [>0[4S\00\0  >0K 0S/e9e9e9d9e9C0[S\0w0\0@PtpK [10ERt0 T  !B200 p0 l p0 l !12\ <R@Pʃ1T0 P0p0 tP lP 0S;p@0@S,P  0S00S0@pSWXtK 0< \0 S0 00 I0T0 0T0 0T0 0T0 p 0l T,S+Sj(ĿAA1? kAA8`8`Q@lAdAXAPAA8A@-@0 , 00\#^? 0-@L PAp030,# 0 0-PLXP (3|S $CT r0@T o0 0-LM@d\ 7>kP s gK0\h ?\P d X\l \? @PP M TA̠p34/ P(AA m9A@o9 -2AML@`3Pp0 S 0#C403tM``  P  4X+K303'k9A 0-PL@XQP%|3S" 61S kP8  P 6;601S kLP م6 ;&600  BQr0C 00S: BQ  10R!!  10C10 -@PL XP Xh p-L@XP\ ↛`o|3S ,3 030S 2 S|# ゟphɚp0z -PLX`p@P ]9W;I9 WW" 0 0@0@M hAW i蛚0 0@0@ p2S0@i艚t0A p-LMP0 0@0@`X0 K@ 1S`KpM@ -LX`PcP 9@ U UUpp#R 00@`0@ 00@0@3=03PUpheC 0sLA 0-3P@SLSS XP P 070 -@RLp` D ; 0 0P P;PPP7; \1 7; 00lA -LM`XpPP 9@ U UU(K3=03#P(Ua ̠Ap0L  @= 00KP 00 U00S0 0@0@C3 0&ȣ+KA pU)0[PU)PK00 0C00 0 00 0@00@ 4  [7P |P    J4Sp0 0@0@@o9A 0-@PLS 47P 3S XP P 070 Q-LX7 -LM0S  0 Ƞ8,Ƞ#8G P 1? -@ALie30CS3h3 A03ve -L M@Xp`P K@0FX@*0K>0CGT*K" K)K(@K'K%PK$0K#K"@K!K&pKP -L M`X@pP K@0XND)0K?0CHT)K! K(K&@K$PK#0K"pK!K'K%KaP -@L {  h p-L M@X`PP Kp?0XF"0KB0"K K!KK0KPK PKPK`K0P [0[ p-L M0PX`0Kt@P Kp?0XF!0KA0!K K KK0K@K@K@K`K P[ 0-LP z@@T T =  ~$ f& ~b= (0h ~ V'A 0-9P=@L9 YC ? 3pP pRP5pStP ~tIP20t3xP tx?P0x3P 03P 03P 03P y030|30u 4io ci ]AAA p-T3LP%XXN9`@L +l<00S 0@M30CS3;ፗp ⷛl -L`  9 8#8  )2S<9 9  h@@ TP pp;QP@@0$vW -LPXC@P ֗po @^T9 1  R7P1 7P3 H D = 6 kp3S 9@0;9 h觛|  7P@h,~hږP hӖ0ALA -`LPX@pP@ f01T 0CT!  00;@4T& ᯖ0T 0T0,c@ @ @608#8@6 0 R @6@@@ g@@@0@7i 5i 6i( -@LpP`p &s % (@@T ( T hEhA -LPX@`MpP B %l@ (h@@T ( T &@H$hA 0-@L B030S7  7036S$  , %XPP= 0 08#8 0hgc [  0- L P# @@T #C T !0hKA p-L`@PP@4U0@p -LMP`pXS ~@P ' K2"A3$CC DDcd7a$ K@P4 08 Ƞ,Ƞ#8G `q$=\!^0C p6.p0PS00Sh#0@S$տPf   0Pd# Pl#d3SP h3SM l3SJ ѕ*@K|9P H y414!9!,1,!1!0` h1!43 1\0p@8#<3  A 0s_ 0i$#R  Pᷕ  \|X l|S"0"5Aj90v9A1?A0AP{9hi9l9t}9|94~9f9f9j9AA2S -@PL @徾P @h -p3 @SLx#l# @Pp $Pt p87 -3 @SL## @P $P 7 0-L@P ; 1P ; 00S0]@ -LM`4 @P@[P09@ U UU(KA⩿PxU} $$$\04  S44 ,0KP嗾,p 0 0@0@  ppP㰔@|P  ~ ,Q /08, #x$ Q%@ 0KO[2[ :,: 0#AS, Qp0: 08#xQ30, 5:c, YPP0 0@0@j ^\~09DA Q-L@ƽ -LMP  0 Ƞ8,Ƞ#8" 娾P P3? -L@堽P hs p-PL9`=9i⯗\P \οP6\c`P `ſP40`3dP d廿P0d3P b03P 03xP V0x3pP 0p304phC <hC $hC A`AA -LM?`PB 0@8#8႒Ⴁ @ j"K2KT,K t@@LOt30 r0pMP j@xS pt3`/  p!p卿P c(K0K2Kt,K NpꂒႡ j t3 @p303'x9 0-PL4@S 61S kjP8  P1S k]LP i}6 ;&606;600  BQr0C0 00S: BQ  10R!!  10C10 -pL@P`ጼP V VV& 0 0@0@hS V i`9i;9 \ `2S 0 0@0@iK0u`傿A p-LM0 0@0@P`hX֒0 K@p堼p 1SMKpA p-3LP4`P㘽\P㕽dP㒽@b@_㩒3`0CS39@L f㑖00S 0@Lᢏ30CS3p M 0-@L P f030,# 0 0-PL(3S $CT h0@T e0 -LM`@PpΆP @0?0(0K(0K:@CJGĠHC6 (K%K#K"0K!@K'PK&pK$KSP K 0-LMP@0( P@(4S  0P@  H0P@  08 0CP@  0P@< H0P@ 0P (0P" -LM|q0,K@p $0 %M@=P $ 0RM K 00.Ke- [.0[48 !#8 ! (  "(2S<8 #8( "h908#h 0? 0808P#h PPC 0K Q 0 U A忙ܲk04? H3? p-LM@q_`/0b37Pi 7P 0P= 4( P 4 P4 EPf 0K? [0[ [ 0DP ?&P hC- X!~Kp  4$4DT 6> PP hC c τ07PhR$\3/ Poۼ9@0;T9<@3 Rh,ѿ. @P ; d1P 0@ -3 @SL## 0IP VP q7 -3 @SL## 0.P ;P V7 -L(M< 8 0Pp寶4 P4 9@ U UU(K PfUk <0$< 08 奶88 ,0KP,6`H00#(("(, *B)@ , / \ j,:, cpP' P0`0@0@40 0@  ;HPP v@ 41:,\ \ 0K0 0@0@ û[9DA -@LXT30CST3h踺T3 0T3X Q-L0 -LM0S  0 Ƞ8,Ƞ#8 P L4? -@PL 0P 0h讲 0-@LP`4300# 0 0-PL,3S (CT b0@T0h_ p-L M@0 !DP_`$K0 K$0K<0C@K#K0KK"K!K PK\@P  >KpXA 0- @L(,0 $BPP 00 $A0h 0-LM!P00 @ 債P:98L##8 LÅ <9)7 L37L3 C L#K0h3S:PL3 @@㡊 "0K! 0TK04? -L M?0!DP^`p0(K(0K KD0#@K'K"0K!K&K%K$PKո@P  巺 00KA 0-4pLM@P  KPP1  ((    :PP8 叺8 剺8AA p-p  4p00LM `69@3 03$0 S$2 * , KP%40 L#0,@@& L#00000 0  PG @,@  dAx Tҵ`P ھ ζKph)ǶKph"Kph3\/ `9女9?@0;9㺋KphAALA0A9 -PL@`p嗇D1T% 0CT-  04l@4T 0T 0T0/┋@4T6@ @ʆ @ @ῆ@608#8@6 0 R4M@@ @DA@i 5i 6i( -DSLU@p` E $P F%# EbE P h h,AA p-LM0@0 P`WE P |[x%#EE PF K,[x F K !ALA 0-LM@$ 3>ϴP ׽ ˵K0( ?PP Ƚ L張̠03,/ P7売AA9 -2QMLP`3@p0 ZC#0#C4034_``  vP  4x⩬K303'9tA 0-PL@ϯP61S k_P8  P1S kRLP ^p6 ;&606;600  BQr0C0 00S: BQ  10R!!  10C10 -@PL 傯P hC -PL`ps@P 9W;I9 WW" 0 0@0@ hW iD0 0@0@ < p2S0ki24l0A -LMP`3pP K0 0@0@\帴㺅0 K @儯 1S7M@ -3 @SL## eP rP 印7 -@RLp` D ; 0 0P PPPPj7; ;1 ^7; 00lA -LMP0,0 @p`ᵮP 9@ V VV(K3 03P/V] ̠A00 L @宮 ,0K` 0, i@ 0 48#8 S,0 0 0@0@C  0뼃0 0 @0@B,00@0 0@0  ]7P |P  n +040m0 0 @0@9A - @L#97P 3S 劰P 㗰P 7尯7 Q-L -LM0S  0 Ƞ8,Ƞ#8 P 萁k 0-LM?0@ PK0KF0K0K@K@K@K@K@K勱PK0lA -L MPp@S ᯹P XK!1 @2.@1!3#ss KL@P &0PS00S(#0@S P9   0P$# P,#&@K`ቂP  0 9!0 1!0@ 0phPኀ%  HtR 0A" 99A0A9p999A p-LMQP` ?0@0 0K 0K0@EĠF K@K0KKK0KPK`K߰PKp -LM`p&PP KG@0HD (K(0K'K%K#@K&pK$K"PK!PK彰P p-L M@`PP Kp?0F"0KB0"K K!KK0KPK PKPK`K地P [0[ -LP i@0``pk`p@_@P@Pm@P@PoP 0 0@0@ p-L M0P`0K孬@P Kp?0F!0KA0!K K KK0K@K@K@K`KDP[ -LM@卬P K@0  K0KKKKKKKK'P㡶A 0-9P=@L9` Y4 ⁆0P խ0堮P40S4P ̭4嗮P10438P ­8卮P083P 403P ӭ03P (03P ǭ0300Ĺ 4帱꾹 岱긹 嬱AAA 0-3L@VS㝂9P@00S 0@N0  0-LMP 8#8,2S<9 0@\<3  ?8 0@Q<3 P @@ ++!<0T< 8d #8 )@< ?Z8,;;1<# <#=k -LP咫P9@@ "p" Sogd @MT9`   De7P( 97P z$ 6# 2" . *03S 9@0;9D h@ްh:,ذh4P h-LA0A -PL`@p/P@ d1T# 0T  00▁4P@ 6@(@ & = S2 @S# @ 6@|3606b0 R @ @ ~0}@@J|3  `$ `|3 ` i 0-@9,=PPL9Y 8,P4,S0P /0P10034P %4P043dP 0d3\P 60\3PP 0P3HP *0H300' 4!  AAA 0-LM@  ?P  K0$ 3>PP  L̠\,`3,/ Pf\ҬAA9 -2QMLP`L3@p0 PCL#_ Ϡ,͠0 L?  lC4B0bHL30\\  2H垬P  0堯=Kt30t39A 0-PL@P61S kP8  P1S k{LP j6 ;&606;600  BQr0C0 00S: BQ  10R!!  10C10 -PL`p᪩@P =9W;I9 WW" 0 0@0@- h!W i{0 0@0@ s p2S0yii0壬0A -LMP`jpP K0 0@0@\0 K @H廩H 1S;EM@ 0-H3P@SLDTSPS 圫PH 㩫PL 070 -@RLp` D ; 0 0P PVPPP妮7; w1 嚮7; 00lA -LMP0,0 @p`P 9@ V VV(K303<P2V\ ̠A,0 L @V ,0K`., R :0  $, ,  R0 0@0@CB 05뀃00@00@ ) a7P |P  /i  h q~,媫0 0@0@9A 0-@PLXhS :7P \3S ĪP\ ѪP` 070 Q-LU p-|3LSPp~`@P fH0@39@ 00S 0@}{0|3~pW -LM0S  0 Ƞ8,Ƞ#8! P 4? -L@ P/嚨P ⌭ hA p-LMQ8#H`@0?0 0K 0KP$4& KPK0KKK@KK`K儫Kp -LMpMP8 0 4S ,K0 KP. !0P(KJ <̠ČL8 ČD"̌#D!L  0@P( 7 ` +,XH,P 8! ̠8Č#Č"̌ 0P   ,9HP,<4("!4l̠ <($Č"Č%̌ 0bP L ,H t(9AAAtA$ALAA -L MpC^P ĬK Kȧ@P 墧0PS00S$#0@S 喧P   0P # P(#`嚬 3S $3S<听 ,勬 0P |3f1C GP@& p}O@`{P b |0| 9!t0t 1!0@ 0phyx}0|3|,D~AAAAA0A999 A p-`PL@ ဲP c!P0 @/D0@ R phM(ph 0pha LoA0k9 -(L"M"(@0K K0KKKKK K K K -LMP 2S0$!08#8  Kh/00Q0" #3p488S@`  @8T` #3p488S@ 0!B!O0,0@Õ)0 0P Kh -LM9P@` K|@υ 0p@9/  00 00 n@ j7P p7P w,3S 9@0;9Kh{LbKh{4[Kh{IP Kh{0ALA -PL`@pᰥP@ A|t1T# 0T  00|4P@ {6@(@ {& = S1 @S# @ 6@83606p0 R @ h{@ 0@@X83  0L   83 ?  ("(  i -RLM R R K0K 墥 d Q-L7 p-`LP%P p0 0@0@ph說M@ 0-\3P@SLXlSdS nP\ {P` 070 -@RLp` D ; 0 0P P$PPPt7; E1 h7; 00lA -LMP`,` p@ῤP(9@% T2 TT 3S% TK 3@!|3 S03ʤA40  @峤(Kd#喤& Dc ,0K`? ,`,``F,` V p V6,  R 0 0@0@4呧0 0 @0`0@ `z0 R7P |P  d *{03z0 0 @0@9TA8A 0-@PL@TS  .7P D3S 剦PD 喦PH 070 p-LM@zPq 3SK 7P 7P ,0 ?⌨P  D利Kphy,偩KphyzKphy,8 ?n`P v jKphyH3D4 - `DO9@0;9Kphy(1΄d ? @P G ,;KphyALA0AA99tA 0-@94=PPL9Y 4ҥP44S<P <ɥP10<3 P 忥P0 3LP f0L3DP 0D3dP Z0d3\P 0\300 4  ިAAA -`LP@p=P@ y0T 0T  00y4P@ y @ @ y608#8@6 0 R0@@ i@ i -邡ႂLM0j`@P`3p F/00 `\  @00 0! Q " $K0j 0` #@j@dc0"!B \`3< -LL  آ\DP $Kx30x35?'T9 0-PL@壢P61S k3P8  P1S k&LP 2c6 ;&606;600  BQr0C0 00S: BQ  10R!!  10C10 -LMPp`T@P Kx9V;I9 VV. 0 0@0@֯ ʧV) %x$K 0唢 P  `$0S 0 0@0@2S0kx0 0@0@<70A p-3LSPpx9`@ 00S 0@Dwu03wpK 0-LM@P YPP  0 Ƞ8,Ƞ#8D  ϢP 8P 80 SS8H5? -LIMp`sP2 08 Ƞ#8,Ƞ 婢P?8@KἢƢP pS ὢP 0$S0S? 0SpᬢPw (0S@(0@S厡P$0P 0S$0!,#x(0@S,3S ١03 `R@0S3s̡P  @ 00S0#(30S,巡@岡P0p,@P,娡 0#8#0`S0@0S8#0S,噡Pg   0@0S0#0S03s 83spW03s 83s wZ` =K0K0C 垮PKX 2$KO0` 8DKp< $8 #44"<,K ,0 )02u@ b1!9!1!1!0@ 0Phs|w03v Z0Sp ?$K3,3,3SC4 /+)0 $00B SAB Qa0B7 BSW B? 2"0 P2O TH<H5?*0A9 99PAAA:@A$AAxA -@LB30CS3h3 03BP=0 p-`L@0P9P6@0 \0  #0 0 3S 00pdJx30t# p0"00p 0-PL0PL0  p3S lCT L0@T0hJ0 -qLM0P3@0` CC;QA40+ @/033H   303W3@0CS3T ^ dR0⃜ K< a8<0>J303x:A 0-PL@0坟P%3S" 61S k*P8  P 6;601S kLP %`6 ;&600  BQr0C 00S: BQ  10R!!  10C10 -PL0`pL@P u=W;M= WW" E? 0@1AϬ äW iuC? 0@ 1A  pd2Sxvi u3H03B30CS3᪣0A p-LMP0 0@0@`X卤u0 K@Y 1SBtKpM@ -3 @SL## 0;P $HP c7 -@RLp` D ; 0 0P PPPP?7; 1 37; 00lA -LM`0pPጞP&U& UU h0l0h0ܟPCUK 0Ÿ0BD0  @办30330CS3'(K,0K PŞ,0S 04 C, 0  G? 0@1 A R"A? 0@1Aעh@ѫ 0ģh3D03X30CS3꿠0R P/00 @0A, x@ @t =7P P  ^  t szA? 0@1Ap:A - @L#7P 3S 0?P ,LP 7e7 0-LM@0PP K034038 D0DP L @P30CS3B4< H0/PP 7 H+P<D3,/ P妝AAp: Q-L0 p-LM@PP` 0pP Kp@ĠF@0  KK 0KK`KKKK3 030 K3P0CS3 -LM@P`P 0ApP KLN@0 ' K#K(0K%pK!K&pK$K"K3 030(KӠ3P0CS3ἡ -LM@P`pP 0P K@$L?0 KK$0K!K#K"K KK3 030$K⤠3P0CS3፡ -0PLM @ K@b0P[ -LM@PP`p 0ќPU } @ JGĠ0 K KpKp  >   7T p-LM@PP` 0奜PU xP @      K0 k* [0[48#x p-@PL 0yP_  s0`  }@0P wphTrpFt30 x300S0#R00S d2 S# x -L Mda0@0 0 >PP 0RLKE(pK  = 8#8  -D3S<=, =  0 !0[<<<P!0K PPAq K?0 Q0 U Azܲk9? 0-LP0@P 0 [ SsT @ 0hs' 0-6@=P6LVPuDP 'DP+DPHP HP0H0P 03P /03P 03P #03030   AAx p-L@Pr`0/r k0 o7P >qp]7P֠3qpK C ; 0  H0S D0S 6@0;6qPup#EBP pp0ALA -`LP0@pP@ q41T 0CT!  0x_q@4T& p0T 0T0/u@6 @ @608#8@6 0 R @6@@@ @9@x:@0i 5i 6i( -d0L@x`$0=0ޖ(q3p0CS3(=@x0 _ ux0S o"nhpPt_ D -LM0S  0 Ƞ8,Ƞ#8  PP 9? -LM`P(p֟0` #@P ͟0@$K2C3CS;2DDS3( K@PL(0 40 0 Ƞ8,Ƞ #8|24匚080@0<0 `R>S4 0@S4~P/ 00S@8<0S80s$ <0s! @0s }p.@K 0pP l op|e@`]XZnDT  xP1!=1 "!21" !|31#x` O3h#0 dcs 0   0PJDl#R  tlIpP r voJ"0t"t:@A :A:9?AAAAXA8::: :X :X99`99 -PL@`opQ k@P 101Ao!1R"@10!RA@@10A! !/00@ 0@ o@1017@o 0-@9=PPL9Y SP4SP JP103 P u @P0 3DP 0D3<P 0<30P 003(P z0(300w 4kq ek _AAA -LP`P 9@ V VVppp30p3 PVh֛`C@ 03psLA 0-LMP  ?#P + K0 ?P  @ 2>@ PƜ@P  Tˠ<@34/ @t<AA:A!: -2AML@`Pp ,30S(,3O\\  M(幚P ǥ 0廝KT30T3:A 0-PL@P61S kP8  P1S kLP X6 ;&606;600  BQr0C0 00S: BQ  10R!!  10C10 -PL`pŗ@P Xn9W;I9 WW" 0 0@0@H h<W im0 0@0@ p2S0yim徚0A -(3 @SL0#$4# P( P, (7 -@RLp` D ; 0 0P PPPP7; 1 A7; 00lA -LMP0,0 @p`9P 9@ V VV(K`30`3儘P?VN ˠM@ -`LP@pOP@ l0T o0T s0CT@ .l606 @$l  Rp @@l@ @@ @@ ki Q-L 0-@Ll9P@00S0ik0 -LMPp סP 倛S K№PP ^0`S00S#0PS RP@   0P # P#V 3S* 3S' 3S$ Nl; 00! 1>`!90p h|0@0@p0 0P 1hik4$ $AAh%:`:$:8:AA -LM0S  0 Ƞ8,Ƞ#8 lP k 0-@9,=PPL9Y Ֆ,堗,S0P Ζ0噗0S4P ǖ4咗4SXP <0X3PP ۖ0P3DP 00D3<P ϖ0<300 p-`LP*P p0 0@0@ph诚M@ -LP`P 9@ V VVpp303_PV,h)xC哢 0冚sLA 0-LM@  ?vP ~ rK0$ 3>gP o c7( ? @PP X TL̠P,T34/ PǔP3AA`*:A0: -2aML`P@#00p@@3@@# @Õ 0@ÕC40 @ÕB( 0@#C<0@3 0DC <@30o\\  兔<P  0 Kh30h3.: A 0-PL@KP61S kP8  P1S kLP T6 ;&606;600  BQr0C0 00S: BQ  10R!!  10C10 -PL`p@P j9W;I9 WW" 0 0@0@အ htW ii0 0@0@ p2S0yii00A -<3 @SLD#8H# P< +P@ <F7 -@RLp` D ; 0 0P PPPP&7; 1 y7; 00lA -LMP, @`pqP9@ W WW(Kx30x3徔PoW| ̠A,0 L @lؕ ,0K尓,X^084 0LT l ȘT ,084 0Z0$ ᵘZ   $00 @00@ i [7P |P  S  i h0 0@0@xC几 04zx  t, 0:@A\AA$A - @LL\##7P P3S -PP :PT 7PS7 0-L@屒P 0DiP7P 7P ,3S 9@0;90hh@*0hhP 0hh0hyh0ALA -`LP@p{P@  i0T 0T  00h4P@ Vh @ @Kh608#8@6 0 R0@@ @ i Q-L@ 0-@Lh9P@00S0eh0 p-LM@` P 套KpC K⨒@P 傒0PS00S$#0@S vPJ   0P # P(# z 3S4 $3S1 (3S. rh0OPK0` $ 02f@ X0 p10)1 01!0@ 0`hdphg@> 09AA*o0A4:-:*:AA -LM0S  0 Ƞ8,Ƞ#8 僒P k -@L330CS3h3 033 -@PL 0cP 0=h$ p-@LP0`TP 6@00"00p;x30t# p 0-PL0>Pp3S lCT =0@T0hB;0 -qLM0@P `3sC ;R' @3H /  %303厓3@0CS3T ᕞ T剖0⺍ K<b:<ᅕ3030=:A 0-PL@0ؐP%3S" 61S keP8  P 6;601S kTLP `Q6 ;&600  BQr0C 00S: BQ  10R!!  10C10 p-@PL 0刐P_ g`:3S t3 x30S d2 S#Pkph]fpx -PL0`p^@P f=W;M= WW" E? 0@1A ՕW i/fC? 0@ 1A ' pd2SxMif3H03T30CS3ἔ0A p-LMP0 0@0@`X埕f0 K@k 1SeKpM@ -3 @SL## 0MP ZP u7 -@RLp` D ; 0 0P PPPPR7; #1 F7; 00lA -LM`0pP៏P&U& UU h0l0h0P4Um ̠BD0 L @坏30330CS3(K 00KP؏ 00 O!00SA? 0@1Ah@ 0(h *KA0!) [*0[4  0 0@0A00 @0Cx00 0 0e T7P P  O  f e3D03I30CS3᱓A? 0@1A$@:A - @L#$7P 3S 0]P jP 7僐7 0-LM@0PP K034038 D0cP k _P30CS3a4< H0NPP V HJP̠D3(/ PŎ1AA$@: Q-L0 -LM@PP`p# 0厎PU?0@0(0K(0K FH0%K# K$ K'0K!K&`K"K3 030(K!3P0CS3 K 0-@LMDĠ DKD\0KKPK@KPK0 -LM@ NĠ0KKK@PK -LM 0K c P K -`PLP@p 0&PU T T Qt0T 0d d奓ThT T4 $ 7D:?ABF -LM @0K@K@KMP [0[K p-LMP0ڍP KpA8#8 K@=8#8 @H $(D3S<8 #8( "h=08#h G C U<08P#h @@b P 00 @  01 0 0 T&* -LM@0K @c P[K p-`PLP@ 0oPU @pT T Q0T 0|x @T@pT T<Q H( H7A\:?BF 0-LP01@P 0L@ dT @ 0hd.' 0-6@=P6LVP+gDP DJP+DPHP vHAP0H0P 03P 03P 03P {03030w kq eAAx -pLP\co@ @yT*  p W7P6b7P+b J6H0S D0S 6@0;6obP"gP db/0ALA. -`LP0@pbP@ b41T 0CT!  0xb@4T& fA<:AK:t:?AAAA0AL;:M:X>:H:F:8:9:X9: 9:R00Q00 0-@dLPP ;d0d0XP 0hl0 Q-L0 -L M4!00PpABdHD*0K*K!0C" K'K%@K$K#0K!`K)K(PK&K"pK@ K -LMD0 Q!00K# "0C KK0K400@@C K@KK0KKK!K -LMTS0^4pS@0NTGd!0" $K$0K#K!PK`K"K pK@K@KKT0STS0SSR R R -LMLp@` hP@ K4P0ED!0 (K #@K(0K'K!K&K%K$PK"Kɍ@P  -LM(0KC̠C$C0K00K@K: KKK0K  000K0K< S00K  S00K  S KPKS00K00K p-LP0@`܉P ,0T 1TpH00ppU@ 0-L0@PʼnPU UU0h0Si0 So n0$R \0hBd0hڌp P@000X 000P<<00h A -@dLP dԋP0d0$ 4A -LM`@q d0S Kh80Ld0 @PW: -LM@@ 000`K0PpisP* T( kP 0S@T 0 S0SxZPx (0S @$0祉P 0S (0@S(K$S0S S S00%P@00 -L@P  咈0(K0rP9 0rP 0S 0@S?0Ch0 h@4 ၃@P4\0`80 R)0S&4SP  @ 00S@ 0 4L0_ S0Ƃ M0 F0幂@0sZ 4<0SF "0`80 R@00ST 0@S 4P   00SX X0sG T0s> 0\0X04\0 1,H 8p 4 00 < L D @ ,P P"  0pi0jc P4  0[Tx0UN\K` `0f`GPՇ0HA<χ0B;\AAAAk`AA0A A8`8AA -LM0S  0 Ƞ8,Ƞ#8( P D?R`00Qa00 p-L0P@H`PT TTpa@`@ \  0a0a0<<a0ph^Dph 0-L@0PP DP WD"PHf"DP0p dA -L M#1@R#R1K Qp ` 0 3 Q p ` 0 G Qp ` 0 K Q- p ` 08P00K@0EDK(0K<0C(K K pK`K'K#@K"0K!K&K%K$PK@Kg 4 (` zP   0@0ST 0ST r P0s XKX X0J^8?D4 4/P0$*ĿAE?lkPA8`8AAART00QU00 -L8M0 U0$ S C0KB K0C BA0K@ K60 `?0K> KD0CD B@P4K=0K< K6@K5PK崮4S ) Sc  SF  S07@K40K3PK4y0PSF@  00Sp0@S94yP @$ 0R K SP @S S040K3@K;@K:@K9@K8@K7@K 0 30K 02 K10KN n08@K7K4PK0 K/0K;K:@K9@K?0;0K070K` 08@K4 K30K:@K9@K4 H0K}@P0g{PP*HC{@ 0 ;0K0C70K5 K0 8@K40K0 K+K:@K9@K3K2K1K/K.K-K,K 070K4 K3@K; K:@K9@K8@K040K0C3@K00KJ{`P@ CK  H0P@ @xK{@PH{LzRzxWH|ܲkF? -@0L@M 0K ?0CKK0K@K@K@K@K@KI|PK -0L@M0K 0CKK0K@K@K@K@K@K2|PK -RLM R KV0SV WV0^8pS@0NTGd!0" $K$0K#K!PK`K"K pK@K@K|W0S W p-LM0`@LPKxPT TT"Kp0S P}L@ 0 }0 S *S<Kph蒌HKphL{ 04SU@T@ >0U0U0 0U0 U0<L0T/ 0-D0 L@L0P 0000SC0h&L'h/ 0-@0L@L0P 0000SC0hL'h/ p-t0 LP@L`P H 0000SphK~C0 'h/C p-PL@LP`0 S RphK00/   $YC /$/ -`LjL0pW h @]P^|t 0 DpW<0  h0 oK0  oK\/|rd/`/(A -DpL`@P 0$@'C 0-(P@L00h'C p-@LL`0` R ]PH 0004 0C 0 R0  phOKT/X/4A -x0x`PL@0Tp0 @ >80!P 0$00C 0@'(/,/8/ -pL $\\!0`00`F00S"<K0@").JwPUK0@00 ]CPJ0S 00CS000k0\0 00@0,000$0(qyd(h/ԃkx@0 ;80\ PvpP 1 t%x@h@h %͠0-P  pr u@d($((A (A((:AT(X(: 0-]0St0t @0L X0tP %t<0P 0(w0S70H(<((D(A 0-|P| 0@Sp0L \0tP %t@0P 0,w0S70T(P(`((X(A p-0PL@rP pHT` TT  wT phGmt2S0phG<@< 000u00CS0v(0Ad(0( -L K ( C0?`% V Pq%-OwF$K0S2*@KP0RK"K2K2R7 0R0SR2K?2K*@K02K00C SFȺ:::::::::::0D"02K0"K*@K2K $20Sf 20SZ S08#*@KK!PK0`20pLK&㴦W?F K4K᪦tP`V000000 R  B⑦h!= K 0<@/\ P `Gq 0@P @ d0 R08#Q 0*@K2K0"K2K?      '$D(A'(($,$0(':/ -2LM ?Rp` 2RS 0RD BX2"p 0 00@0T"=@ [0'(/,/D(/0(':/ -,2L PRb  R 00 0000S]ECM0pO v00`S` 0@DB1 ` BR sx1Q 0A!da TAP00 10Q (AP pUqP+00AP pJqP,00@P tp?qP00DtDg<ECM0p|| Xptv| Djtp| 0dth(h/d((/,/8(0(4(DAAAA -LM@P` zP Gt KKopP8 1!@! 0 `C͠0C ``!(0CPX1p p po0`S @00S1 0@S oP   0P0  P0 t0  #P s sPzP `sTsL0  @ A((T/X/ ($(((A(/LAA\A0Ah(: -LM0S  0 Ƞ8,Ƞ#8' #oP I?-0S @Q 0 S  0S ,k?#=?c1P20`<Pr0` -|LEMpp, mP ݡ<, 0RI(K(1^ L0p 0 I͇ p0@0 1 m0S0 0@0@_Ctt  0P0C0S 099;9B0&0 0@0@0o -LM6 A0AS&P  K0l`Pp'C00 @0@CM<@`V@ 0S  0$KlAC($ `zV@1SWB7c p-`RL@P0PS00 0S B0 00S m00U@p -0CMLP00(@p`pVPt0nPh `n21CC=(0P4  00 pW@7. p-@RL`EPP ; k17pD ; 0 0P Pp7p; 00 -LMMĒ0P,0 2@`pkP9A0AS 2ŸB0  @kQn, 0R(KW WW G 0mW 2n>K pl01S 0 0$ BL 0! L! 01H 0 0HLnD 0 0@0@ B@  s7PB D0S 81pp 0  p0!0@0 1 ,K::4::::4:XV|A -p1LMh!p`A$ p0S@ R K$ K5P;$0 SP@! `$0`0dS$0   S@ȠK8#蠑ࠁ,Ƞ@ 0PPxPP  K8 #H @ h0@bPP0  0,nW?Cy;skAA -L M@03 @;K -LM 0 @K@*P[K -4LM,2 (B`( $ p 0S@Q$K( KPP  0\n1h K$p P0R0O R3 R? R= 1dr 0R0O$i .K0 PP 0A P 0  @rne 0.@K@P (0 S@181#1K#8!#8! PpP T(00dpPP(0 $ ꄆkAAA -L M <#83 } K p-LMP0@!`0P tP mx1-hKpB-0 hP\π Pm P0S04!4000 P P 0S PKP0[SSS0  # U? R K 0P 0 R p0 R g0P P#8 0,#A0kALo0:0k : -L M0 @" @K -LM@`P&pKUPD0q P!0[S S X0 K -L`M|K`@P  P, p0@A$|0KV0Cy Kx@KvPKu0KzKw`K *@ Ƞ,Ƞ 0@@ P, 0R (KG4s0KtpKV tK /FܲkhJ? -L M@Ƞ,Ƞ0@ vK -L8M0TpKP`0 $0 @㬜,0' PKRKT0KQ@KS@K;: JK3: 00*0K*0K& Kp0`0 /0)K(0K0'K%0KP $ 0R  KU KIPU0[SEܲkxJ? -0LM @RP `Ktp a0 S K U0 0KP [PP -@LPQ=6p=`6vP 'hhp\@P hhpG @C (;i< 0-9L@@0P`0BbP0PgD0Pg00S ga :0 -L|MĂ0PKp (0 E ͇ 0@P ( 0R$K蔠Kl ЛT2T" 0Q0Kh @2 K@K@K @K K K@K,21Cc!0 0K#0P+ K0KKKK@KPK9S@K SPK00KKN``KP21CcP U `d)KdIdPE 0*KK,@K)PK+PK l @P  <@P@PP 0PO@P 0F@Py| 0=@Pp 0P5@Ph 50P-@`DܲkJ?  * + J? -LMpP=<6@%]P)pP!818ACm` 0!jP" ;6@0;6w;<@ 0m; KkkCP C=0 iPp@p p0G-\ ` `pegP >;LA0A6 : -PL@`p;10&S6:::::::::::::::::::::::::::::::::::::::@(@3&1 @: ᆁ4P@6A0AS?4@D60680 R0q= S @S @ ' 00  0   -L@_4P 6A0AS 4@ -L8M0XpK`4 $0 %d)@P00NKX0KVKO@KT@KS@KR@KQ@KP@KWPKUPKr0d)|0& KQt0.PK d0@-K- K*0K4 0C7%0K(K'@K,@K+@K)@K-$ 0R KBCܲk  J? 0-0LP^dPp00S S 0P P:@0☎0h6:0h 0@ 00CST:\:d:l:L::t:|: P P@7P,@nPX@l`0 $H0AhSwd:|:|:|:|:|:|:d:X:|:|:|:|:|:X:|:|:|:d:|:L:|:|:|:|:|:|:|:|:|:|:|:L:|:|:|:|:|:|:|:|:|:|:|:@:|:|:|:|:|:|:|:|:|:|:|:|:|:|:|:|:|:|:|:|:|:|:|:@:|:|:|:|:|:|:|:|:|:|:|:|:|:|:|:|:|:|:|:|:|:|:|:@:|:|:|:|:|:|:|:|:|:|:|:@:0 0 R Q Q0-L@P  j  0@`T  08#0`08#0@jPj:::::::::::::::::::::::::::::::::::::::::::::: ::::::::::::::::::::::::(::::::::::::::::::::::::0::::::::::::8:      -(L`P@""4"̠00S0p a0V V 0  04Ƞ8,Ƞ< *;"*#"#? ## 000 0 000000BFV Ƞ ,4V 0 8000L0Ba21C0aT  Q  R ,{0 0 颋.P4:<:D:L:T:\:,:,:,:,:,:,:,:,:,:,:d:840,($ `Q@hQ@pQ@xQ@Q@Q@Q@XQ@08 Q-L 0Mb R0-LP 0hg0 @0C 00l @C C-0@ ]80bP 0F 0h<(A -LM⨐ bP# b8`? p0K ,K0KFMX T0P/K<@N+K0.K-K*PK)Kbjd7 d(K: 0-LL @P0PS dc000U00 -LHMhP$lCt@$H(K(K'K%PK$@K#`K!pK&PK"0KWeP Do 8g KtA -0LMPH.l$|. $H@0(K(0K'K&K%`K$@K#pK"PK!PK1eP o g KtA 0-0 @$(LL"(P0 $("(( 0$("(0h 0-0 @$(LL"(P0 $("(( 0$("(0h   0 R   V p-X0(  Q@P PL0@`[o| x phs -d@L h8#H,"(a(R -(Z(R  hRfdh -LHMhP$lCt?$H(K(K'K%PK$@K#`K!pK&PK"0KdP qn ef KA F-0-< PL@0NC Ca\[@Q \00HS X00 0R B0HSQ(0`P 0F 0hG; p-0L M`?0P.L"0K.B0"K K!KK@K0K PKPKPK0dP[Kpn fA -4L@9$   08 #(hD -4L@8$  08 #(hT -LPp`@  @ThheT @46%CA($H"(0H$(1 0pQ@ -@0L @R ,0 )0 @ h $) (0-"(LXP_@M^ @T(e0T O0A -LPp`@MA @T,hjeT $("(h,Q@ 0-@LPT T$ 00C0S 0h p-`LPV@ V@@|0 A QR@ P@  ("(0(  ("(ph p-LP@@R7dT hP dT8ep,`@0 @x@TpQ@4K? -L@0X#`P00V0SOp3PFl#0Pp1p#S,D;;;;;;(#$3!3yDp V ""2! "8S 8S FV  FNe6iD2!\ (""2!#)D !!1!#@ !}1!x#)D rVP! -lT!gP1!b#@  [$1!V#)D P0V  I D @0!;#)D 5 k -/8 +<0!& " -XL?TL?L?L?tK?K?K?L? -LHMhP$lCt? $H(K(K'K%PK$@K#`K!pK&PK"0KaP k c KA p-LMPK 0@[0 0a[0aKQ[e%%% %`  Ƞ!`0 ,Ƞ  .P 0 P -0G-2  0G-$ <0x 0-0h 60LSP0CS006 0hT(nc00 @0@0@@ 0-PPC# 0,ß  P]_Pࠁedß, 0R(Kl3 PʨX 4!R R8S S0 y q#H0820 00G\nX 484@D 0@D (@H$H@H$(D\8 < 81S'\:b ᙐ74D( 0@0'PS@ @ HF͠0 0/.000b0 q PR `@3H\000f2H!080 <8\p '.0 |8@P! X 0@ @ i\^P@ 9K 44@D+ @@H$DĊSdT[  "PP@ s$K8p0( MpF-0< N,H /cG( 021C! c.  P08U1]\1P@, !ܡB=,0  {^@P g w_s_@1B}(p  0f^@P@P ``_fg LZ_@V_P $N_ @A!ˠ0C-0 Y5\P@"(R B 6RN n  08#(60;@06(R  @[ B@UT_NJ?"VSAA8AAAXA;DxA -QpL`@aYP@ fY/1PT- |10Sp1TI 0/@4T@ H1T# @1T  u4P@# (/0m[606 0S0⸩6@ @@ @ u4P@8S 6A0AS@@ K0/@6A0AS @i ϖ1i i i -LMȢ0R,0 P` \\ \? "ˠB0L  @XX[, 0R(K >K-Y0!#R0 0@0@0@ TD D H! pPo ;H!1 4^ᓌ1[ p00p0pD0T 48<#8:#:0 0/@A@ 0S) 01  D< 1p 0 K p0C 0D<,0 $1 1 0H! 1 2F ;2 0 `T -1L@XP*10P 8RH ;x;d;d;; R8S (R8s@1D (0C8px8ps0WPF W28pe8hS V}'Z8SSTpP  GP ᙋTh4]S<   h%](AfR@ 0-DPL@WP 0W8S 0hY0⸂ -L@Q4P 6A0AS 4@ p-PL-0` /0 2@B8SN[00S 0@6R*@P X00@P X|Yt@P XuY]U-pF E10  F >1 -L MTS bP 8(Ko\BM@ W`PwW3#0PS@0@0S2 0Sڼ2cWP   0@0S2 0Sl2 r 0 r XX2X"0 F 4 /,2," F  / R0,0  n1!`)p @+0 ,p.\18 㼨崈师v q @!Mx1/XN>0@X1X!9!P1P!1!,0@ 0hV)rQ1!1#3  !N ( X0 0 D0C @<0D BD0(K(Ko[ (Ko[(Ko[A; ;:0A+>+>;;;:; ; \,trAAA -LM0S  0 Ƞ8,Ƞ#8 WP 4M? - 00 LR s  0 0-$@0 TLP,00  0@T P0 P 00 0-$@LTP P0 0@T0 0-$@0 TLP,00  P0 0@T0 0-$@LTP P0 0@T0 -LMQ@ 0?.C""0[ [lAA -PPppL* 0 $P `U 80S T V0@T404040@+7TW H0 ST404040@7[A -LM00`@Z 0| pp  0$  0QL< P$ R 800 QPR 4!P00P0S  Y00S P<0W)< < 4<8  4 0 4 @Kd d0, @@ 0 9P $000S$ 0040$0$40HP(00(0(K ][d(;&;A -LP00S 0 3@Ń 0S 0 S ?>#R 0-X0L @! 8T0 $4T0P $84X0Q;+S  ; S80  ;0R 0 S0@@@X  (RPH0RA0R #R!&R #X00X0l.LT. -X0L@lv. 0-X0L @TP= \0 C K -  !`0   [ h v D\00L  00ha/L0& Y/\0  L( 0O/L0& G/\0L0"?/\0  L0# 5/\0  L0# */\0X 0@ X h00<0L 00/X0L0 h X0+0 B /`0  LX  0h0X 0C+ .`0  X 0@ X h00<0L0 0.`0 x 0-TL,0@ 0P 0P .o0S|0 oP S | 00PP0S -TP 00LR`p @$<0 T ,00*@ hZ), \00Q0S 0-(0LP0)X0@08X0 T0$4P0T 0h3) p-X0@L$!;98 T8} +P+dU 8 T0$4` PL0S X0  p8;T$8p 0-X LP@$ `0   @08#  P=8#0T$8 8T$8 <8TDX04R 0\ <C308#(  ;8#(`0 ;8#(0T$8 8X0@ `0T*, <8#(0$8 8T$8 <80 X000 X !I0@{*}T 8 T0$4 @ @000l@X0 +}-0CAT1; 0-LTP 6& 0 08 $4T0@8$ 4@h d0R 0h Sd0 P0d@Ap0 -T`L0@' 2 1C P ^{XY$8 80T$8 8X0@80T$ 8 $84  X0  hM?A -Tp@ P0P,@`L8 T0$4T0 P8$4@,0 0,0T0$84  00 P, 0P 00S0P 000 00P0P8 T0$4T0P8$ 4X0@@ ' 0PVP0P(0S  \0P`0  8 T0$4T08$ 4    0PVP0P  0PVP0PP0P 0PVP0P    0PVP0P@ 0PVP0P 0P0PVPP0P0P -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300  00000000T0$8 4 8 T0$48@T0$ 4  006000T08$ 4@0000000000600  006000 006000@ 006000  006000 0-@L8T0 $48PT0 $4<#38T$ 80 0-(0PL@ " 0ESL<;d<;<;@<;0& 8T0 $4V>0$T8 8Z0090 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sp -L P N? p-`L@P  xU(0pL0 P8 TP0 X0h T$8 40 \pphN?AN? -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300  000000008 T0$48@T0$ 4@P?;|>;|>;|>;t?;|>;|>;|>;|>;|>;|>;|>;`?;|>;|>;|>;L?;|>;|>;|>;8?;006000006000006000006000006000 -@L8T$ 08 0-(0PL@  0EST@;l@;@;H@;0&X0070 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sp -L P @N? p-`L@P  pT(0hL0 P8 TP0X0T$8 40 \pph@N?A4N? -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300  00000000T08$ 400000   0000000000660000 0-(0PL@  0ESC;C;C;|C;0&P00j0 L0"S 0 L0"S 8T0 $48;T$ 80 L0"S-p -L P dN? p-`L@P  p*T(0hL0 P8 TP0X0T$8 40 \pph)dN?AXN? -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300  00000000T08$ 400000  0000000000660000 0-(0PL@  0ESF;F;G;F;0&7000 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Scp -L  P N? p-`L@P  p`S(0hL0 P8 TP0X0T$8 40 \pph_N?AN? p-T` @00@,0P8T0L $4T0@8$ 4 ,00,0 0@0@C0@ @0@pX0 @0@ @0@ @@0@0@ F0@0S p6@0S0@8 T0$4T0@8$ 4 00<00p p-(0L@`P# 0BS,J;DJ;J; J;0& 0 8T0 $4T98$ 8Xppp L0"S p L0"S 8T0 $48;T$ 8p L0"Sp 0- @L8T0$4T98$ 8P}U $T0$8 4 P8 T0$4@ R\ &RZ X0`0B%S&L; L; L; L; L; L; L;L; L; L;L; L; L; L; L; L; L; L; L; L; L; L; L; L; L; L; L; L; L; L; L; L; L; L; L; L;L;L; &R& 0T$8 88 T0$4Tp08$ 8@0&S 8T0 $4:89T$ 80 < T0$8 4PT$8 08T -L P N? p-PL`@  Q(0$L018P0 0T@?>C2@0 0 X  8@0 SA S P0T$8 40 \ T0$8 4`phX0  8T0 $4T@8$0 88T0 $4=8$T= 80T$8 8X0 T0$8 40 S@09T$8 8@0N?AN? -@L8T$ 1<8 0-(0L@P0  L0"SU U U 6000& c.p0E0*RlA p-@LP`4Q(0L0 P8 T@00X0( R Xph#Q T0$84  \pph+AO?A - 0LT@!P0 3@50  S R ? AZ -$0Tp @0 ,@0`L8 T0$4T0 P8$4@,0 0,0T0$84  00 , 0 000  0000008 T0$4T0@8$ 4   ! 000000 ᯀP 媀P8T0$X 4 000 0008T0$ 4 00@ 000  000AB -(0Lp L0,S@R R R (0&  T08$4! 0&.R T0 8`$@8P0  0T$8 8gPA 0- 0@ LhPP 00 3@5 ? 0P   P00O?BA p-L@P`uP  O(0xL0 P8 T`00X0T$8 40 \pphOO?AO?A -T` 0P00,T0L8 $@4 ,0p0,0T0$8 4  00 0, 00 00300 0008 T0$48@ T0$4 00000 0000000000 660000 p-@L8P$`T0 8@40 p 0-(0PL@  0ES`X;xX;X;TX;0&U0040 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sp -L P ,P? p-0L P3 LP@`( 0P?> S0P0  N(0L0 T`8 0P X0T$8 40 \pph?( P 0 3L P?,P?AP? 0-0BPL@ S Z;\Z;Z;Z; L0"S0&800 L0"S 0 L0"Szp -L #P \P? p-`L@P  twN(0lL0 P8 TP00X0T$8 40 \pphu\P?APP? 0-(0PL@  0ES<\;T\;\;0\;0&^#00=0 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sp -L P P? p-`L@P  pM(0hL0 P8 TP0X0T$8 40 \pphP?AtP? -TP 0,00@T0L8 $p4T8 $4,0`0,08T0$ 4  00 , 0 000  000000 0000 00 -@L$8T 088T$ 1<8 0-(0PL@  0ES_;_;_;x_;0&Q00k0 L0"S 0 L0"S 8T0 $48;T$ 80 L0"S.p -L P P? p-`L@P  p+M(0hL0 P8 TP0X0T$8 40 \pph*P?AP? -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300  00000000T08$ 40000000000@660000 0-(0PL@  0ESb;b;b;b;0&=000 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sip -L P P? p-`L@P  pfL(0hL0 P8 TP0X0T$8 40 \ppheP?AP? -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300  00000000T08$ 4 0000000000 660000 0-(0PL@  0ESe;e;f;e;0&x000 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sp -L MP Q? p-`L@P@  tK(0lL0 P8 TP00X0T$8 40 \pphQ?AQ? 0-(0PL@  0ESg;g;h;g;0&K00e0 L0"S 0 L0"S 8T0 $48;T$ 80 L0"S(p p- 0`@LP3K 0?.C""+K(0L0 P8 TP00X0T$8 40 \ \0 `0  ph$4phKT0$8 4`AA4Q?A0 3$ A5S ?>S @ -T@ 0LP 0, 00HÕD_ p,0S,0`0,0H3Dp , H3D` , Q( P#0B0 RSQH3D0 ,0000000000H3D0 , 00600 0060000000  @  \0  006000 , \0 @- 006000006000P3 SSH3DCPp \`,0p 006000\0  006000 00000 -TL0h @HÔDS`\p,0h ~H3DS`h \@,0h  -T0X Lp Z @^}Ty H3D` ,: S@@H3DS@0 \`,70 H3DS@0 \`,<0 H3DCPh \`,0h \0 4H×Dp 1\H3DS@h \`,0h H3DS@p \`,0p H3DCP` \`,:` H×Dp 00\X00X0 -LM(0p R R1 R  ` L0"S'  L0"S6 @H3D` ,Pd@d0h 0Sd0X0d@0X0' L0"S6 0X00HÚD0 ,0q,Q,  Qb Q{ H3DS@h \`,0h H3DS@p \`, 88p 06S\ H3DS@p \`,C2@0( L 0P80TP 0h0X T$8 40 \pph[XQ?ALQ? -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84 00300 000 00000$8 0T8T08$ 40Sz;y;y;y;y;y;y;y;y;y;y;y;y;y;y;y;y;y;y;y;y;y;y;y;y;00660000 5;00@ 005<000000000 0000000000 000 -@LP0X )  `0> T$88< 0R# C2@0 T` D 0 X0|2P0xX0 0h0h0X00X0P T$8 40 \YL0"+BX0 P L-+07pPp3\L  0m'pPX L# 0L#,0L&*0 L0&!,XL00@ L00-T0$8 4`ZpP h3#(x0(Rp0P0y h0Rd0P0t \0P0qL 500EALS?AQ?AWQ? WQ?Q? -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300 000 00000T0$8 48T0$ 4 ! $ .  0060008 T0$48@T0$ 4   006000006000006000@ 006000 0-0BPL@ S `;;H;<; L0"S0&^0z0 L0"S 0 L0"SQp8T0 $48;T$ 80 -L P U? p-`L@P  t??(0lL0 P8 TP00X0T$8 40 \pph=U?AU? -Tp@ 0,@00`L8 T0$4 P8T0$4T0@8 $4,0P0,08T0$ 4  00 0, 00 00300  00000000 0000000000 660000 0-0BPL@ S d;;L;@; L0"S0&N00 L0"S 0 L0"Sp8T0 $48;T$ 80 -L *P hU? p-PL@`  ~>(0L0 P8 T`0 X0h  T$840X  \\0 pphwL' 0L' 0hU?A\U? -dT`0LSP, 000,84!T0$4T0@8$!4p,00,00S ,0 00 >T0$8 4 000 >8 T0$48@ T0$4 000000000000000660000k7 AAAU?A -1`LQPp@(0 0GS D;؝;\;4; L0"S0&X =L0 S  L0"S0& `8 T0$4T0@8$d 4@d`d0h 0Sd0P0d@pkU?A7 p-L`P@v=0 R$(0L0 P8 TP0 0h X0( R pph_= T0$84  \pphg I=(AkU?AU?A -0 3B5L  ,0QmP ? A -@0LSp D0S8T$ 08$8T :8T$84 8$@8PT0 8`4; 8T0 $4:8$T#: 8$8T 08$8T 08$8T 38T$8: 8$@8PT0 8`4; $@8PT0 8`4; 8T0 $4:#:$8T: 8$8T 38$8T 28$8T =8T$8w0 88T0 $4:#:$8T : 8$8T `28$8T H28$8T 028T$8< 88T0 $4:#:$8T : 8$8T 18$8T 18$8T =8T$80 88T0 $4:#:$8T: 8$8T 18$8T 08$8T 08T$8< 8$@8PT0 8`4; $P8@T0 8`4; $8T 08(h%e A` -L@h 0-@0LSP D0S@X0T 8 T0$4@ 0$T8 ;8 : -@LP0\ X0,B# 0;8T $8 8T <$8 8$   L0"S 8 T048;T$ 8 L0"S 0& P0T$8 400S.|;;;,;;; ;;;;;;;;;;;0& PXjP>T0$8l 4>d0h 0Sd00d0@ 6S0 0S, ]S% 0$8T 8<$8T 80T$8 8]`T0$8 4  dPM0 +0S, PB -L P U? p-`L@P   :(0$L008P0 0?>C2@0 TP D 0 0h X0 B40 \ \0 `0  P0pT0$8 4`U?AU? - pLT08$48?N T$4$0 0iP$} 0I+S,`;;;`;;;;;;;;;;;;;;;;;;;;;;;;;;;; ; ;;;;;;;;;;;;, o9ZZ q8@$PT0 8`4: $P8@T0 8`40 ZZ =$P8@T0 8`4: 8@$PT0 8`40 $@8PT0 8`4: $P8@T0 8`4< b$P8@T0 8`4: 8@$PT0 8`4: lApA -L!h8 -Tp@ P0P,@`L8 T0$4T0P 8$4@,0 0,0T0$84 00S0P  00P0P T0$84 R0P@P0P R0PP0P R0PP0P l80P V0PT0 8$40 0S  <00H6P0PA -RLpP`$ R5 R  00R ^, W00R0SP L0"S5  L0"S 8T0 $48;T$ 8 L0"S 0& n 0Sꄵ;l;d;\;l;l;T;l;l;l;l;l;l;l;l;l;t;p@6S$8 0T8$8 0T80T@$8 800S 0$8T 8 K?K,K  <0K'P ,0 h 0 00 R( PK@P00\00S T 0<   < @P  pQ d' T0pS0T 00T0QT0L (3 5:QQ00     <Q`P  0@  4 0  PR`ʨ0S,<S S!80S Kt t0z@    0 0 ,80`0;; -LM`0, S`<@F`0S@0\  P 80Sp 0("(R R  !cP  pYpP U0\  ,0 P00SP  -\PL0pS` @0 \@ P0S萊k p-L0P@`1T`000 4 080 < 0@0 D 0H0 L $0P0( X ,0\00 d 40h0 ,`80Pl0< Pp  \ 0K  8L (HP 0 Pph@D;A;;&r -LBMp0`QP 0  NK8<̠0  xs10 ,lo1 0RK,0 NK<c1<8̠ 0Y1 ܲk@ A4@V? Q0-L@P Q Q 0h @0 @000h 0-0LP@FaP  0q, ,QP00 p-@LP`  p p -LM@ P`,0  1 0  0   p 00  'W% ,0S$ 0,0  0  p 0 W -RL M@PpA?QX@  ,   `<  0  8 0 X04 00 P<QF, z @0 Q (K;1X] 00@8@P` H D HpK pPw`0@0K 0 S SM S0S00 R 80 0b00 R 0 000 @ 4 0  0  40 0p80 0b0'SZ040 rQ 4APA -L M@00@2K R-LP@`ca  / 0  p 0 < 00c0 3 Q000S  Q0 00   0   0p0 L0tA@- @ @ @@ -L M@00@vK -L MP4`@ 4K0K 0QpP00S,a P  40R !Q30 P p(K 004 0S 0 4@ 04 Z3 04 0@  R4  4 0S 14 5,0K00 0Pp\@ R,00 0S00 0 R400Pp 04 0@p,0 S!0Q ᆀ.V?< 0P8#Q0S P @T 88Q #Ƞ   Q 0RS0R S8]? -LM Ƞ Ƞ0!8 ,Ƞ 4 p0 <0 !lP,  , "0Sn 0VP0S P0S@XT ,Q$ ,0 <!. ^<00! `(Ko-P@T 0S 0W0S 0S @40 <!-8, 0Q0R0S <  ;^ ~^0S( T \ < ` - n^<0 `00(Ko- Ƞ,Ƞ4 <l l0-P<T `p-<0< `0p-H\?|ATAA@,ADAAAAA p-X0LP\` 0 T@0 Tp.oB -P0L @R 0 T0 $.oB p-LM`@PT x0SKp0K"0 0P80  P x- a.oo$BB8#8 S- H 00S P\^ 0\@ -0L8 $0EW0S. 0" $0P`@! Tp$0! @@L@0 @`@ àP 0" T0 8 T0P@! T`$<<0! 0P@; T`$<<0; 0 0P@ T`$00  -L@MP`8<T0 p 4VP@ 0 0  00  00 00 00 3101 4P; X8 @0K8KP@KHK0  @RPZ7 <0D4  0 0,K$P9 X,Q 000YlZ  40<L (K@4K 2ᇓ  00 !20@ 5   1(Z   $0   $ 0@, R @0  0010 %0",0 @0  0@ P &@( 0P&@ BB -`Là p" P x| $0 #x 00| Tx@! |0\ 0i[ -遒ၣp LM@P`   0P, f(\0000    0 $0 ,  00100(P@P"!B0,5 0P(P 00 P% B 010(\  $0  B 0 @ 5, d0%0!D0,(K, 0?% 0B- e -2@001"L M`5PSp (K,0K(080K 0,pP  0Tp%=00 0 8K,  04pP=008 0 pP  0p$ 0p$% 0pP  0pp$ 0   pP  0p$lBBB B\B -pL`@P30  0 t0S#PUO aP3003 -LMp,0 Pt@`ph0l hl0 0X 0  0  P#0 0X 0  P,0  0 0(K$@G$ 0  $;$vBB -8 LR`p+p@PPLR@"ڰ5Sx0! |$8  3P8 p $$8 PLR@B -80LS@-Pp80PSp$x0 |$0S`3}P 8#x0 |T80PSpB - 1L@0@ ,8#8@ p\0` ,0` \80 PU@`$PU@` 3B@ @,P80 0#80PB -0pL0@ ,80 PU@`$PU@` 3B@ @P80 0M#80PB -8 LR`4@P5S)#200%10Rp 0 0QQ+ 0Q( <Q% 0Q" 9Q :Q x0! |$8 PLR@P8  4"8    hMhbiMuB -x0|`L ,8pQ&@PPLQ@ڰ5!S;2 3mP8 $0"8PLQ@B -80LS@-Pp80PSp$x0 |$0S`38P 8"x0 |T80PSpB -`u Lhl8 R$@ PPLR@ڰ5pS5 3P8  $T"8 PLR@ B -P `lLhyW plht8 R$@P 3P8 8 PLR@ ڰ5SU UPLR@ p-LM`0 P$p0 4@0$0 0 P $xh! 0$ 00 P $<xh!,0( 0  ,0xhBBk -LM1 P$$!`p0ba p  aH1@!  0 P $ o!04 <0N>00 P'4@@0  !  T 00   P@T10 $ L ( ?04$,on!$oi!'@Bk4BXB p-4LSP`p @(0@TTp -pA Lhlw8 R@ PPLR@ڰ5SX5#20010`P8 PLR@ P P Z8 -8 LRp@PPLR@ڰ5S5S #20010`P8 PLR@P P X8 -L@qPhq -d2 @LTH` D2p\4 <\0@ ,0PS<<<<<0 i  i 0S@   0S> 000`@yVT330033 h 0#P Pa i^  iY V  0T 0 $  $ 0 $ 0` $@P(BBBBD;ABB p-1PL$+` 0\[ $+ 1\O $+ <\`C 0$+,0Sx 000@XT330033 o0#P Ph ie i`]  0T 0 $  $ 0 $ 0 $@'@P(BBBBD;ABB - 0L@p4 PP0`b@D@ 0SP :0S:  Dh  @ 04  0480 ` -LMP` [L2p 4 >04 @L 84 ( $ 0@ |P $K00 y0t0 S0 4 !A> 000\ 0 506 l1l!<X0d 8 0(K$P9 0( ( @p(  `@1,Pp* W  q80S P@ʯ80PLS@P #20010p5S X\MPIW @DBPBBD;At;lN<<CQ1P%0CP*z>CP01` \080!1` d0D@ 8pD@ 8pD@ 8p0P 0P0` \00P 0PBt55(<=Q q0Q p3Q`3Q T3Q L3Q 0Q @0Q 0CQ 0Q 0Q e?Q >Q q0Q: RxR::<R0 D0v"2QQ:0S0<D  00 j h :X"80@D 188 @ 4, 04 , 3b4-,0`S  8 ,`⏏, I 8YH9a<  < ,0Q4\:h0l@ h@<0lD h80lH h@l 0T (Ko50<:< : 0@ D 0, 0Q3@ 9 `4x!0 |T0:0D 0 t@ 9 H 9b<00<0 {%&$vJ$K$$*@ 0-@LPv3 0 3 h0 0@ 0 R 400h  @ r  -LMp @Xx2hl$ P  $ 0A P   U   K   t0 S01A0\000506 1!`<0X0d 4`8` 0$K$P7 0$ ( @P$  p@01,Pp U!  0 R 80SP80PS #P 3B@@A@@]Dj P \`,7  0\B8BXAD;ABt;t`<< U 5 001 `p05 0 5S(K0010@,0K0K @ 5S P U0 4Q U 0%( % HBTBI C0CS`~<<< 8P 9P :P h0lP 4 0PP P' X8P$ P8P 9P :P 4  4 (8PP 8P 7P 7P 9P :P 40 8   8 <000 7R 0RR700t0S 00l'A>000\ @4@5,7,'QQ  0& 7Q# 9Q :Q 6QPPQpp06Q <Q \R6Q00SW6 6@060T&T6QQ H6Q <Q 86Q 9Q :Q4&0&0X  <08 6RR 0CR 880%5QQO 5QL <QI 5QF 9QC :Q@ 80Sp`Ph lt5h@ d5l80pSP0$5QQ0(5x| \x0| $x00| Tx0| $x00| T80SPp8 P 00$,4QQ 4Q <Q 4Q 9Q :Q 4QQ:74 ᇣ 0010<80 5S| 0#QQ# d3Q <Q T3Q <Q D3Q 9Q :Q PC0K<8 ,0K@ ,3,#L0P B C0K<8 ,0K@5Sx 0"2QQ% 2Qa <Q^ 2Q$ 9Q! :Q P 0`"QQ:74 < 804 @0!1QQ9 1Q6 1Q3 1Q0 9Q- :Q* "80p\SPH0l!h1QQ \1Q <Q L1Q 9Q :Q hl40P (K 80p\SP 80<80p\SP0CRIF0CQ07' 4)%80p\SPʰ060s0CQt080Q07xthMhbiMibuB3Mt;0M8M;<,;< sE s P <;(; 000\ 0 506 D1D!X0080d << P"80S"4`80`\SP! iP #20010@,0K0K  @5S X80`\SP(K 04@  04@ (xe\2R:0R60RP0CRH0CRV:00000#20010840 $5S A,0K0K84 @)5S8 40d1Rz 1R |1Rs0CRp*90CR060lP"5S X5St1R M:=B 0CSI0R 0CRAi0CR 0CR99:h00 l@ |0R 0R'T0R X0R =B 0CSBt;$P(o&$.0x.Q@p3T 0-LQ@|4 04PST4TS 4TS T4X$T0\4`$d4h$ 0-LM@\# Q (PU $0 B  $  8 00 008 -l"LÐ0PTP|EL" 2,p\$^P`"0 \3#RB.+0\3^!0 \3P!0C.\3@SE*3p0Cl!S00#A.\3P0!\5-\3S00C$QS%Q \5S453 ,#4 \ Q00+\Sp0Sd03\ `5\3(8$8888 ` ` 8(8 p,80@-@Q: ; <0! l5S0l5. U0Ŕ000!00 0 0l5AS10 0 S&00 5 20 Z0x 8#8 0C8R #80%000 <0$ l5S0l5000  p-3L`,0\#d5P1"B/\Q d5S3 z?\"@0QŖp"F/2,P\Q0@08"E/\3#R. +0\3 $6I@R0A@S5C SDH @  SDH @  SDH @#1R @Q6QF 0AQS Q #0,\3P(!.0\3P!5J/\p3 ,#4 \3*,#<*\Q3@  0\38 h5\T (((((((,(3S 0 02@ 0@02 0 0  0 202 -3L@ ,#1 \ -3L 0\ -3LS 3 0\3 0\ -Pp(0` L@P8 8  (#8880P  0-0L(@PP  800 - <L0(8P#8  - L(@0P0   Rp@-P`0 0  0AS R 0ASN0@0 @ 0@0`00 p0`00p -LM3S1 3 ,(3)DFHV,dfhvDH3,,lFpVdh3,,tfxvlp3d,,|FVtx30,,fv|3+,FV3+,fv3+,FV3`+,fv3,+,FV3*,fv3*,FV3*,fv3\*,FV3(*,fv3),FV3),fw3),GW3X), gw3$),GW 3(,g w3(,$G(W 3(,,g0w$(3T(,4G8W,03 (, R098#8Z.0(K P -LM@ 1PPJ5Q0c000‘ 0Rp`RJ%R 0 0 0J%VJuJ%R000J%R  K 0 CnC`FR p  K -LM90 0 @Pإ~ 5Szڸ5( "4 \E 000  ŕ4 (` 1BV@  $0  Bŕ $`pVp 5rK0C50p@ Q0a@2Kp30CS0A8@p#Hp 0E  $P00R00S \S$ 30C^t5P05 055(\ 04 00 1 5ZSإ(K3^30^?  %T0D8#H @* K5S5 101[Q % 00a 0"[00b05`e0 00W 0 0@0@e00 0 |P  㛦0 㖼 00ee30^(\ 04 00 إ 5%PB -LME`T/ 0 R&p0pS  5(PU $05$]005\0 @ RET 055S05P A055 -LMEPT8 0 R/p @Q (0Sڬŕ(`V  $0  Bŕ $P 00Q %00@0p RʨET ̅055S05 -LMxĐ@p  p 0` PP  <y00 0(K 000p p *,PP  0_0 0 04PP  0I0  0xĘ0  P00PP`  (10 8BBB@B -L MA0P@ P `K0x$S%@p0` @Rŕ 00 0 `Pp  L(\ `  $0  B `xBB -D0@ L@ 5P B -L MPP%@r0x$S%Ep0 Rڬŕ?0 0 ? 0 `Pp @ p KH0 x0C ŅŅlŅ(@ T  5| B -LM%r1G@`PU  Hi70 ;9P6706; 00#0CR9Ŗ 0P-(\  $0   (\ 0 00 P ,0@(\ 0 0 0 505 |k@R 0C/000 /  0 4(#65`P V THxhP4?x#x&xBBB -L M|p P "(KGEE·M @0 P @PʷP   Q- !20S' @S@@'T |4 0 D`E· 0FNM^  0@`囷P l0AS|4 ` F·FMNM^ @P0 P@ P`sP |4,K$PP Dlt, (0@,  0p1,P T i3S a|4K 00KP 0 |ė 0 03h 0\3L 0\=B0BpLBhBB=BXAD;AA 0-|4PL ĕ? ,|D0 |4, \0 / %P #R4#803 0BS030 B 0-9P=9Q0L9@ᘺS►T 1%0h p-LQP0`|4 0@Da[Wᣵp -3Lp ,0 P5S 00C0SL1 R0000P5S% 0S 00iuUN@U.  !0S 0P 5`E$ 0@0P0C0SX%0@0@x0x 0SP#0BRSR3-,#6-\TR@B p-LM@Pl$0 0P5Sx  30CS00dS& S0 S#0 R 0S x3&S 00x  K1[ 0<0x@UFRT 0-L@"P d$8oQ&0hm -LM3 S@( ] 3,,98#8 P2S/<8#8 P9P#0,\3S ( 0RN$K3,,#0,\ ?   "RPʯK ʯK` p` nVp"  0 3,,? P #0,\ Զ ͽܲk*@ -3L`^! ,58 X# U+ p U' %20 0!X PP("x P0Ö@d\`  \ Up468F 0@S468Fmܸ88 0-LP1@0h膴 -LhMTZN 0`R 3 S %21C0 h 0t Ŗ  P| 606Z> t0(("( BQy3SS0,0 00 t@&U(0RS h@ x 倠 #%,0@Ŗ00%0000, 3 @ R @0 0xP PPt (0 S |@^ ,dpK0 0Pp Z> R+ plP Z> RlP ! 5Ŗ00 (0"80, 2 @p0PUpP @W 0 0 lx % 6%0 6t$70|0 3 S |(Kx(\ | $0  B ` 0RC670| 6x(\< | $0 B 4ST SR SP , K00KM@&RUCtZ> ( a("( 0h 0t00(\ t $0  B 0 400%x3 Sx(\ | $0  B 0 R 3Ö@x\p 0 \ Z.00j8#800h@x0 duT88 -@Lp3 0CSl =l = = = = = = = = = = = = = = = =3 S0(#0*\ sPP! h #l1R 3#,3 ,#03#$6<& "   38 <\ 1 `P {_hԲBzP lPhŲ$5P9Q@0;9l '04h譲B BB Q0-L@P Q 0hн9@ 0hɽ90L0 0-PL$0 S 00Sp = = =H = = = = = = = = = = = = = = @D!00| 3 006S`0 00#336S40 0#3#0 3/00B 0-@L3P , 06060604B -PL@p`²1T; 0CT"  00◲@4T  @1T 81TM.0 ᾶ@4T6@@6* 0 R0,@ &P @ @ Wf3S Dͱ@@ N@06{x@.i 5i 6i(XB p-LM6@=@SP xP5S 3 S x(\ | $0 B 1`S k8P PK1S3 k+LP u061`S0  BPr0C3 S x(\ | $0  B V 3^| 5 \x 00S: BQ  10R!!  10C16;688 -3L` ,3pSP 9@07 @6069@ 2S2XP 3P J/5\QN@P)T ᩵@6069@ o  0+X ( -@LMT GlQ  S#R4 0Ó4Rl4, x$<0p4/ @ +$h%PÄ\`dńĄPL\)#0BS]================`===========33D0R3Bh#Wn02=?0? 0{PBt%[~%(#0 2>00kP> k2, "<0 0K c  2[ # 2#3?<3RD03\"Wn02>0 08P 8; 23:355P #X Sǻ3SS  * S( S& SL$# PUo UX) 304L)P5843S4 0@60@43 , LP====B040 0 0@ p0 `M3S0C@6<C=L=$BBBL=@L@NBB p-L@|d1PP HT0C ph>'HQ 0T[WphHB w*@-7R  G0CR  Ll7R `7R 0CR0CR*0CR  7(7R 7RL0CR*"0CR A 0CR 0CR 0R000`00CR0#0%*6R6R0CR*0CR C=B0CS000 \0h0a0CR%0CR*0CR%0CR*0CR  R 0CR0 05R/5R 5R3 5R005Rd 0CRY _:0R 00U0R 0 0B R*0CRq*0CRk0CRh: 0 0} R*,5R0CR2*0CRl 00P!!0 0CS?=============@=@=@=@=@=@=0CRC*0CR0CRn*C R 0CR*0CR  v00o 00 0\00 0h4R 0CR'000d0= Z3R 0CR :0R:00- 0000'A=B0CS00 000 0D!:B0CS0 0/83RT :0R0 0!0S0 0 S0 02R 2R00 2R3 C=B/0CS0 0P!_2R0CR*:B&0CS0 0\2R0CR*0CR4  42R g:0R* s0R* n;A@PEL)ZM&DP3 -0LS@? 0C QS!0  ,%R R: R7  0 \Q -01R $1R5 1C=B0CSQ!0 ,  0 1 -0R0080CR 80CR00!p00S  T0R 000040R 0R0R@P?DP{ 0-0@LTP+?JG, 9:0+\0 ,0 -0L@ ,(0S4$=($=$=#= 0S0 \32 -0P1PP0L@`p` ,0S ?Q0d0 0000000 B - L0BS0BS0 ,P0S%=%=%=p%=00CS<0 #1 00CS*0 #2 00CS0 2 00CS0 #3 0 #2 0 1 0 #1  0  - L0BS2@@0R,R,apP , 0Qr 0Q,R, 0\0 ,  0DRL , 0R,R, 0\0 ,0 SL\ 0 -P0^Ld@p .00S-a 8^4@0!< \0 ,0@ S @0;! 0\0 ,81S -LM LR, \㔐Ppp \k X0`\@0;! 0\0 ,0@ S @0;! 0\0` ,V LR` `@\r4B,8 0R0 0  R0 0  D0B `K 00 0 0 0  \0 ,J~c@ 0 0 0  \ 0-L@P008#XH0U #p 0U00 -h0!XSL@hd0Si{ip0,0 7TpW eP<  0 \"\[ 0-LPP 00 , 0BSR8@TB T4 0 @0 \0 ,0@㫤0 ,30#@0T # 2RS  @0 \H0 0 \Ⴄ00@ 0\ 0 \0 -L(\P@!h"x V:@0w03 fW0SP H0S 80SI SM S- @H0S]P W@  0,0 X  1 0\R@P  W #$!U0W 0m"P 4SVQ #g!$bW `* 4`4V0(@p -LM0PSD10208#x 0CSp7@`"K! 0DP`/"[V"40 @0S #00S 0 , 00#0 0 0L1S0ps p-LM`KP 0@Px1[80 0 P0![00x 0-LM0@ ,0P0CS,dR=dR=dR=dR=R=R=R=R=R=R=R=R=R=R=tQ=tQ=R=R=R=R=R=R=,S=tS=tS=tS=tS=tS=tS= 0 480#0 0 4$440L0H08 R 80S;51K1[ R028#8ʼ38)#8  0 8020#4,0@ 0#4#4080@03030 420L 4H   0480 0 0444#0 $L0H0|P 8 0+#V 0\0 4800 3 0$4$$0 H0L 0 , 0R80;HL3  0    \ 89))90b06#1&$ 0e@030KPr1[;#5S1K01K`@0f -L(\P!h"x V:@0w03 fW0SLQ' 80SMP@P0S W  V 11p02: \0 *0 000\ 0@P @W@  \O@P0 Z @FH@ 1@P" #@P80S@ W1 P8#q4SVQ #c!$]0 "! T08#HZP W@tš^rW@# ("(5$ B("(.]W- #$!$ I@ꔡ08#HT# 0 ,2 T 308#Z# ("($ B("(@@,' p-LM0P@`K1K![1[?T08#K  0P@x 0K a c P80S S xx0 , : \#꺺' -LM `0BSpK40BS RPP 0@@@[  @P1[@Q08#X 0 08#P@0U  0KqzP pKpK0 h1[  # 0^[ Ɍ #0KOX 꺺 -l(LP@"hpP  8804 \㣠ZN -鈀LP@`~pP  8864 \ㄠ04 ,3N -LM K0@0b`pP T1[1[001K1K![pP X0 ,0P , <@ ;\0 9\5 0 \ 0 \# - L0@6 \0 , h - L0@6 \0 , h("(  B0-RLM0@p ,U! 4`K0& 0 066 0  0   \0 , şP -0L@B,, 0B,\0 , 0 \0 ,h萟 -LM0@0CSa=a=`=`=`=`=`=pa=`=`=`=`=`=`=4a=4a=4a=4a=4a=4a=4a=4a=4a=a=a=a=a=a=a=0 ,-1 R45 Q8 9 S0,0  S0,0 S00,0,0 0000000 04 ,00 40,  K6P1[0?>C20000 00 40, 00040,0Q00,0 00,0 (Qp-L@"hP50S4 S"x0 :380 \@0T* 0 ,@ 00CSp x ppD 0`pdОp -LM`"pPp;0SS0 ,0L@0 \0 ,奞 0 \0 ,㔞 R R( R0匞0S S4 02. L1SV SV SWWd@t@T 0#, 0,, <4<,\ R 0S0 ,#,3PP( C@, P0 ,@DP@$d1U@@.T0 , < \0,,@0T", 0,,2P0ࣇ*KpPqpPm["[@n08#XZf@@H$H 0s@HpP$,0K  P G W\0\!, 00!\09 1P p40 ,0@ 1\0 ,0S堝 0 \0 ,0SL0Dd㇝儝Tp'IMP[N -QLMP@0(0Sw S% x0:38 \P1Ub 2W0 ,P QT00CSY0 Lx E0 , pK 60' \0 ,`P8#h 0 ,0 8#h$ 0PU0`0D 0d0 -LM @KxdP`!p ZP "[00 2KP"[ ("(P+&(0  ("(PW P, "[  ` - LȠ ^,Ƞx? ppP`j@PV  b@T03 @ )BxB -LM`pPJP*28#H2TF  T0#03x0%x05&80  T0@8W# 0 S VW  %@ @ *"(PW t0S x0S0  $ K<0bC0~P  0%@ -LM0P0CS"K` K0@XqP @ 0SS S S( S @"[1@t0SV(*("(@P V("(@P ~@T0ST(*("(`V 40g@(*("(`N -L@0LSP`0i)\\ wP p 0SSUBS) S p p1S0 ,t0SU(*("(ApP pW0SW(*("(/PU p("("pP (*("(P -LM 0@ 0CS@ KP P1S1[1[::1K1K![` 0-LM KPh@P1[A=A S 80$ , 1[ 00$ \8 p-LM0@SP x`K 0P1[UP 0 S S ,P Rx|A,P x P1[M=I SP1K P1[3;# S1K 0 0PS` 0-LM 0@ S 8PK 1[  P1[3;8#8# S01Kᅚ$$ uP +o8@ a -LM8 K@P1[;8#8 1KX0` 0-0LS@P 0>PPd BPP 04 7PP$ 1PP +PO$ -LM P@P t!@P @P`pK s@P m@P1[0S 0F8#h @P @P,@P @P @P` 6@P 0@P(1[˙0F8#h@BP 0-LM@ KPPPT1[1[001K1K1[;8#8 1K8` 0-LM0P),0 ),0 t),0 X),0 <),0  ),0 ),0 (,0 (,0 (,0 (,0 x(,0 \(,0 @(,0 $(,0 (,0 0CS0',0 ',0 ',0 ',0 l',0 P',0 4',0 ',0 &,0 &,0 &,0 &,0 &,0 p&,0 T&,0 8&,0 &,0 &,0 %,0 0CS0%,0 %,0 SK00t%,0 P%,0 4%,0 %,0 $,0 $,0 SS0$,0 $,0 x$,0 S0A,,0 0$, 0 0CS00CS0$,0 #,0 #,0 #,0 #,0 l#,0 L#, ]08#,0 #,0 ",0 ",0 ",0 ", 0",0 h",0 L",0 0",0 ",0 !, L@K         x l ` T H <&@@@@@ @(@0@8@@@H@L@P@T@X@t@x@|@@@@@@@@@@@@@@@@@@@@ @4@<@@@@@@$AAA AAAA A@@@@@@\@`@d@h@l@p@PaQaRaSaTaUaWaXaYaZa[a\a]a^a -LM0@S`PPP0S5 0( ,z0.,p KPP1[ V !K @@01K1[01KP1[;1KT![P0,,H@01K1[01K` p-LM0@SS  `x0,P K`P1[+  PP1[9 S\  S\ 0 \x -LM K@P; 0SE   KP31[ 0K1K1[![@01K1[01K1[ <1K <K1K(0S0=̅==̅=1[;1K![P 0S  ![1[;;1K1[;1KK -LM@\p`0S\?0Ǒ00 PU! 0S= S 0Sn 0 ,?0@d0 00000 PU0S "K P2[P   P0dS S2[@00\0Sl 0 P2KP0A., ?0 0A.\$ KPU2[2[;;2K2K"[c\00S-0A B8(#8"(p-08#8 1K    ,| pp }h y\? uP q N[/s q!y012 p-LM@PPP  R KP( Px026 PJ 00CS80S) S- SS0 ,i21[98#8 1KP!=P0 P0P0 'T[ 0-LM0PS@ 8 0BS@T7 R R 0S @P0 x0@Tl K8@PT [@ 0St00CS+@P+@P Rt 0BSR! ! ! ! h! L! |0!x t!p l h d ` \ ot 0BSo R@P\ L@PV R`t0t0S SY-:R@PB F1`#$%'5439`1DP` p-LM1@S xP x@! 0BS0 0S@ 0BS`Rc0BS KlPX00CS 0.\0S SI KUP![40 1K80,, <4<,\ R R} 0BS0.,0S S 0CS 0.\0S Sg  PPK P0 S SF 1[ LR00:K1K R:1K:1K![Pk0Sh X0P`S0XS0C0< Sj   PW![ 0  00VT0 V V;1K![ \x0.,R1[ :1K  KP- KP%![10 1K6P![10 1K+P3 KP ![t10 1KPd![L10 1KPY qP![00 1KP  aP![00 1KPt  KPP1[08#8 1K2 K@P1[08#8:1K![j:;1K![e: -L M0`0CS.@P  K$ K@P2[?08#8 2K@P0 ,0SJ @0; \Q QQ QQ Q Q Q01Q 0SS7 S5 SSY SW SU S SS S S)1S&@P& K@P2[#;8#8 2KK@P  a= \}@P@P@T @P~P"pK @P s@P o"["10@1&08#X UbQ00CSJ&PK r@PTp H;R  P2[;2K2[ $R 0K2K R@02K R`02K0"[S0K2KP2[;2K"[@P) 0St0S-p :R)  7@P 0ST 2[t p08#RKD:p R<:0; ,:0<8#8 2K@P 0S S G@Pj0S ( K2[08#8 2K Q>Q.2K@P 0(@ ,P& K@P"[(ɟQQ; 2<<K2K2K0A0S2[L=2K 0 \ 0SS S SS Sj *K @P"[d80 2K=@P"[7@P?0SI BKP(pK @P r@Pn2[6(0E8#X 0SSS  @PZ @PT @PN2[P 2[8 \@P ;V0E@P86#X 0SSu Ss S UD@P&0"[S00K2K2K2[08#8 U2K@P 2[L:8#8@02KU*K @P"[50 2K@P2[92Kf &0K<@P2[%9C8#R5 : @P%@PA 1SK& K@P2[#;8#8 2Kt@P0|P@P 0,\)1S 0S#$@P&PK @P"[40 2KF@P0 , 5 \D @P}`P2[08#8 2K"@Pn @Ph"[30 2K@P^ v@PX2[08#8 2K@PMSP)@E2[08#8 2K@P: R@P42[ ;2K*K F@P("[20 2K@P&PKU 4@P2[08#8 U2K@P  #@P2[ "Q "K Q 0`02K2K"[0S0K2K"[@P=@P9t0S @P @P 0 @P2[ 08#8  Kv@P2[08#802K @P2[p08#8 2K]@P @P0p R2[2[;;2K2K"[H@P00CS0S0S @PS4! A A A:40R? -LM0PSD1@0208#HtP`>( R Q ( 9 Q7Q|  p0S6  R4`00CS)0.<\ 00CS(0@0P,Z/0\0P,0.\ K$1S ( Q0x0x00AS R 0BSQQ0 0QQ| Qz 0&@Kx0x00Sx0/ P2[p墉$ KP2[p 0 Lt0pRl==L=L=L=<=L=L=====d=d=(=|===========8=Rp Q00 AR0SQ0 ,0@S S^ Qp0Q2K Q (0S񟗊(= = = =1S(  <P1*Z/\0P)<.\TQ "0KP2[:^ (00Pl)  x<3Q t0S0 02Qc 2Q` 2Q  2QN $2Q .P0CQ p2Q? 0 0T2Q 2Q 2Q~ 0 0 0 0`X(2Q 1Q R0CQ 0 0v2Qq V 0CQ 0Q1Q F`0CQ 0Q0 0^ 0 0[0 0X 0LS0 0S0 0P l1Qe d1Qb \1Q\ 8  "0KzP 2[02 \0Q+ 0Q'0Q 0Q 0 0 7A9>CS}0Q >Qv Sy ( `!h!@_;`?B' T AP A0 A0 T AT ATA APT@M A A -LM0PS 40S  0BRSR 0 0\0,0\ 0+\0 @, Aa0 , p R R 0BS%RE Rf 3 \P Ro RPm Rf040A S  Q R Q Q Q 0 0\0 , R 0BS0&, 8p&\ 0BSU0BSI0[,, }  8[,\b@"50Sq 0l@  0\0  3\02  Ņ0 , : \0 ,}㭅0A S  Q Rx 0$, :$\ Q Qh0,, <4<,\QT0P$D4\K ~ %? 1S g 3 \\0S1S0#,IK 3 \l<0 1\ 0 0BS0,, ` 0 ,\0,,@ }`V 0 R0*0\0|"0\ <  P" 00CS @ 0AS0 , ӄ@TP Ȅ0 , : \0 ,a0 6\L1 S03$08#$0K&0 ,1[ 0 \ P0qS 0D , '0p XP_eeeeT[ Na -L M pRe 0BSRRIPU1S 0ESU   R 0BS``R`F R` R R `PQ@0;! 0\0 ,0@ S @0;! 0\0P ,U: R% 0BSP P@ R > >>> > > >>4x5x7r x@t xxxx4x5xxxxx6x 7xT8 t4j 5l@`@`7j @`6j@`4z`<<4t5r@`X@`TT``\\Pdd@4zll5~~4|X4zll5~~X4|r\jr]jr^jr_j\rj]rj^rj_rj|`@`H@`DD@`LLxx5r6r           xxxx(C|zwi_do_hostdecryptwi_do_hostencryptwi_attachC@C@C@C@C@C@D@(D@@D@PD@ lD@ D@ D@ D@ D@D@D@D@D@D@D@D@D@D@D@D@D@E@E@E@E@D@D@ D@!E@"E@#E@$E@%0E@&0E@'0E@wihap_assoc_reqwihap_ioctl 7nVV V@T TxN@0 N@8N@t$N@4,N@48N@DDN@DDN@$PN@D\N@HdN@$lN@$xN@4N@N@tN@0N@8N@@8N@K #(-2>'()*+,-./@ABCF'()*+,-./@ABCF/@ABCDEFGHIJKN'()*+,-./@ABCFMNO`abcdefghik*++,,--../-@@A&''(())**++,,-rt2661_rx_intrrt2661_tx_datart2661_tx_mgt@02D0H0L0\0;51.`0,***|00 0 l(000400000#0  00 `4H< 4s"$4D#(444!,-./0 8  "%')`56<=>KVXZcfk3 3 3 3 3 3 3 3  3  3  3  3  3 3 $3 f`(3 h`,3 i`03 j`43 k`83 l`<3 n`@3 o`d3 h3 l3 p3 t3 x3 |3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3  3  3  3  3  3 3 $5 `(4 `,4 `04 `44 `84 `<4 `@4 `d5 &h5 (l5 *p5 ,t5 .x4 |4 4 4 4 4 4 4 5 B5 D5 Frt2860_set_keyrt2860_txrt2860_rx_intr:: u <<4400$,,0,,H((`((l((,?  04P H ,Fs"D#4 ?LGdthtt@tx@l@tp@@?XD + $3A,B8EF IQ7RbSjTV[\gij5pLJ p eSL#< @p  A ! {X,              $ f`& g`( `, `. `0 `4 `6 `8 `< `> `@ `d f h l n p t v x | ~                    bwi_encapbwi_rxeofbwi_mac_fw_alloc7 dKZ-B"5*#    a.@:4@x}CCCCCCDDDFFFGGG G%G CCCCCDDF G G eS./`xZYXzRC./`xZYX zC0&* ZYXzRC   MLKJJIHGGFEEDCBBA@?>=<;:987654210/-,+)(&%#! MMMLLLKKJJIIIHHGGFFEDDCCBAA@??>=<;:98765421/-+(%!  )ZYXCQR bwi_rf_workaround)ZYX +RCz i )) i ) I i i I) i) I I)i)i(h(h(h(h(h(h(hHH( h !H!!!("h""#H###H$$$H%%&h&&('''G((G))'**G++,g-G.g/G2&5F6&788F99f::f;;E<<===E>>>E??@E@@@EAAA%BeBBCECCC$DdDDEDEEEFDFFF$GdGGG$HdHHH$IdIII$JdJJJ#KcKKK#LcLLL#McMMM#NcNNN#OcOOPCPPPQCQQQ"RbRRRBSSSTbTTUBUUUBVVV"WWWAXXYaYY!ZZ[[[a\]] ^^_`a<1??????????*?7?D?P?]?i?v@@@@@@@@@@@@ @@&@2@?@K@X@e@q@~?????????????!?.?:?GT@<wlbQ@;53-/**'%!!%'**/-35;@Qblwzuqlgc^YTPKFB==========================BFKPTY^cglquz˓dfX&ئ͟8ʴ)ǎi+jlbsCv ViDz#((?-җ1h5u85;5=f>?@?r>e 5=5;/u8h5#1E(?- -(1#4T8;i= >C??b?l"?+=;85&Z2X.dϚ)m$bwi_phy_init_11b_rev2#,#H#d# n bwi_mac_testohci_root_ctrl_startehci_root_ctrl_startsr_checksumsr_raid_inquirysr_map_rootsr_meta_opt_loadsr_meta_native_probesr_ioctl_installbootsr_meta_native_attachsr_rebuild_initsr_hotsparesr_meta_validatesr_meta_native_bootprobesr_meta_probesr_ioctl_createraidsr_boot_assemblysr_raid_read_capsr_rebuildsr_crypto_read_key_disksr_crypto_create_key_disksr_crypto_calculate_check_hmac_sha1sr_crypto_decrypt_keysr_crypto_alloc_resourcessr_crypto_change_maskkeysr_crypto_ioctlbioioctlhotplugclosehotplugreadhotplug_device_detachhotplug_device_attachdb_fncalldb_commanddb_print_cmddb_examine 88888 9 7 6 97 5 9 423 9 2 9 1 0 9 9 \/|\/O|/-|db_show_regsdb_printsymdb_write_cmdchacha_encrypt_bytesextract_entropy_rs_stirrandomreadexpand 32-byte kexpand 16-byte k n;AvXaM ְdx cd9660_mountt7&x)&t0& 0&)&|/&)&?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~!#$%&'()-0123456789@ABCDEFGHIJKLMNOPQRSTUVWXYZ^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{}~Ͼ󨷵ǎԐѥ噞᷵ǎԐѥ???????????????????????????????? !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????msdosfs_lookupUmsdosfs_mount5+)+,+t*+`(,+*+`(4*+)+*`()+msdosfs_createmsdosfs_mkdirmsdosfs_renamemsdosfs_readdirbpfwriteifpromiscifnewlladdrif_getgroupmembersif_getgroupifconfif_clone_listif_group_egress_buildif_downallifioctlifa_print_rbn; &C vkkMPG&"֊/aK+d 5ӆ1 q^h,`@yFgKrޔԘJk*OņךUfϊDx%K]?!HpcwucB0 mL5&/ᾢ5̈9.WUGz+2ўfD~T; ʌ)k<(yv;VdNtے lH]nCĨ917Ӌ2CYnڌdҜI%ϯʎGooJr\$8WsQ#|!>ݖa B|qؐ_jiX':'8+3"p3-"< IxPzY e1ƄÂ)wZ{m:,ieee80211_wep_decryptieee80211_wep_encryptPPPPPieee80211_ioctlieee80211_ibss_mergeieee80211_end_scan  0ieee80211_node_attachPP ^/ f ^/ ^/ieee80211_recv_4way_msg3ieee80211_recv_4way_msg2ieee80211_recv_4way_msg1PP@@(@4@D@P@\@h@t@|@@@@@@@@@@@@@@@A@ieee80211_newstateJB@DB3!B0 @G(dB9$A!@08tB0d @40@`@RDAUL@p@T @|$@ 4@5\@X(@R,@0@ A74@6B7H@78@ <@HB@72@@B7D@6H@7L@P@6 h@0,T@@X@X\@!T`@d@6\h@5hl@t̔@7xp@dBpp@l@R`t@7|@7x@A|@H@C@J@K@@@@@I@@E@E@@@@5p@9@7h@7@A B@0'@@!@@.@@7B@7*@"BO@\xn@`BJ@h@7v@l@7XtAz@t B@@hB7@B@7\@6@>ApiBE@6@6 @0 @G$@:@7HmBZ@E\pB:^FBV@w @$@7(@@@@ @@ !" 1:7 25@608 943 @ A BC D@EFGHIJ K RSTU V X`abcdefgh ij,@T4@U<@SH@RT@\@Fd@Il@Vt@E@@G@@B@@X@@D@@ @7@@@5@@2@6@@8 @0@@9$@,@44@<@D@ L@3T@h\@@d@l@t@|@"@ @!@@:@@1@@H@@@J@K@A@@C@ @@@@D@L@f@g@` @a(@b0@c8@d@@eH@iT@j\@d@d@revarprequestarprequestin_arpinputarpresolve in_delmultiin_addmultiin_ifinitin_controlin_lifaddr_ioctlinet_ntop4inet_ntop%u.%u.%u.%uicmp_mtudisc_timeouticmp_mtudisc_cloneicmp_reflecticmp_input}E#(Dip_savecontrolip_forwardin_iawithaddrin_ouraddroKgpqrstuvwxyzip_setmoptionsip_outputtcp_inputtcp_set_iss_tsmtcp_ctlinputtcp_respondtcp_respondtcp_respondtcp_timer_rexmt.\..@.tcp_identudp6_ctlinputudp_inputPQSeA~ä^':k;EXKU0 mvv̈%LO*ŀD5&bIZg%E]u/LFk_zmYR-!tX)iIDɎjuxyk>Xq'Of ɴ:}Jc1`3QESbwdk+XhHpElޔ{R#sKrW*Uf(µ/{ņ7(0#j\+ϊyiNeվb4ъĝS.4U2u9 `@q^Qn!>=ݖ>FMT]qoP`$C@wgB谈8[yG |B| H+2pNrZlV8ծ='9-6d !\hT[:.6$g WҖO aiKwZ *C"< Nj򹨶-ȩWLuݙ`&r\;fD4~[v)C#hc1cB@" Ƅ}$J=2m)K/0R wl+pH"dGČ?,}V3"NI8ʌ6 Ԙρ(z&ڤ?:, xP_jbF~Tؐ^9.Â]|i-o%;ȧ}nc{; x&Yn쨚Oen~ϼ!ٛ6oJ |)11#?*0f57NtʂАا3JAP/MvMCTMўjL,QeF^]5st.A ZgRے3VGmaךz 7Y<'5ah,4$8_@r %⼋I<(A q9޳ ؐVda{p2t\lHBWЧQPeA~S^':k;EXK0 Umvv̈L%O*D5&bZI%gE]u/LFk_眒zmYRڃ-!tXiI)ɎDujyx>Xkq'Oᾶ f:}Jc13Q`SbEwdk+hHpXElޔ{Rs#KrWUf*(µ/{ņ7ӥ(0#j\ϊ+yiNe;b4ĊS.4U2u 9`@q^nQ!>ݖ=>ݮMFT]qoP`$֗C@̞gwB谽[8y |GB| +2HprZlN8Vծ=9-6' d\h!T[.6$:g WґO aKwZi *"4$8,@_r% I<( A9q ؜Vd{a2p\lHtWBQPA~Seä':^;kEXK0 Uvm̈v%LO*5&DbIZ%gE]/uLFk_mzRY-tX!I)iɎDujxyXk>'qᾶO f}:cJ1Q`3SbEdwk+HpXhEޔl{Rs#KrWUf*(/ņ{7ӥ(0#j\ϊ+yiNeվ4bĊ.4SU2u 9`@q^nQ!>ݖ=>ݮMFTq]oP`$֗@Cgw谽B8[y|G B| +2HpZlNrV8=-6'9 d\h![T6$:. gWҖOa wZiK *"$8,4_@r %<(I A9q ޳؜Vd{a2plHt\BWQP~SeAä:^';kEXK U0mvv%LO*&D5bIZ%gE]u/LFk_zmYR-X!tI)iDujxyk>X'qOf }:cJ1`3QbESwdk+pXhHElR{#srKWf*U(/µ{ӥ70(#j\+ϧyNieվb4Ċ4S.U2ኤu 9@`^qQn>!=ݮ>MF摵Tq]o`P$֗齉C@gwٰB8[yȡG ||B 2H+plNrZV8=ծ6'9- dh!\T[$:.6 g WҖOa ZiKw *h8,4$_@r %(I>>>KKKKyyyy xxxxZZZZݨ33331111YYYY''''____````QQQQJJJJ ----zzzzɜ;;;;MMMM****뻻<<<q//^SShѹ,` @ȱy[[jjFˍپgK99rJJLLXXJυkл*媪OCCMMU33fEEPPD<KKܽa ppB>>|ĵqffHHaa_55jWWйiX':'8볘+3"iip٩3-"< I·UUx((PzߥY  ڿe1BBhhAA)w--Z˰{TTֻm:,ccƥ||ww{{ kkֽooޱőT00`PggΩ++V}׵bMvvʏEɉ@}}YYGG AԳg_Eꜜ#Srr[u=&&Lj66lZ??~ÃO44h\Q4qqثs11bS*? ǕR##FeÝ^0(7 / $6=&''Niuu ,,Xt4.6-nnܲZZ[RR;;vMַa}))R{>//^qSSѹh, @`y[[jjԾˍFg99rKJJLLXXυJлk*OCCMM33fUEEPP<!KKݽa܋ pp>>|Bqff̪HHaa£55j_WWiІX:''8+"3iiһ٩p3-<" ·IUU((PxߥzY e1BBhhиAAÙ)--Zw{TTm,:cƥc||ww{{ kֽkoޱoőT0`P0gΩg+V}+׵b׫MvvʏEʂɉ@}}YYGG AԳgԢ_Eꯜ#Srr[u·=&Lj&6lZ6?~A?̃O4h\4Q4qqثs1bS1*? ǕR#Fe#Ý^0(7 / $6=&'Ni'Ͳuu  ,Xt,4.6-nܲnZZ[RR;vM;ַaֳ}γ)R{)>/^q/SSѹh, @` yȱ[[jԾjˍF˾gپ9rK9JJLLXXυJлk*OCCMM3fU3EEPP!KKaܽ pp>|B>qĵf̪fHHa£a5j_5WWiйX:''8+"3iһi٩pَ3-<" ·IUU(Px(ߥzߌY  eڿ1BBhиhAA)-Zw-{˰TTmֻ,:ƥcc||ww{{ ֽkkޱooT`P00ΩggV}++bM櫫vvE@}}YYGG A쭭g_E꯯#Srr[u·=Lj&&lZ66~A??Oh\44Q4qqsbS11*? RFe##^0(7 / $6=&Ni''Ͳuu Xt,,4.6-ܲnnZZ[RRvM;;a}γR{))>^q//SSh,@` yȱ[[ԾjjFgپrK99JJLLXXJϻk*O媪CCMMfU33EEPPxD<<%K㨨QQ]@@?!pH88c߼wuBc!! 0mҁL &5/__5DD.9WU~~zG==Ȭdd]]2+ss``OODf""T~**; FF)kӸ(<y޼^^ v;dV22tN:: II Hl$$\\]½nCשּׁĦbb917yy2CnY77ڷmmd՜NNI੩شllVV%ʯeezzG鮮oպxxJo%%\r..8$WsǴQ#|tt>!KKaܽ pp|B>>qĵ̪ffHH£aaj_55WWiйX:''8+"3һiip3-<" IΪUUPx((zY  eڿ1BBиhhAA)Zw--{˰TTmֻ,:cccc||||wwww{{{{kkkkoooo0000gggg++++׫vvvvʂ}}}}YYYYGGGG𭭭Ԣrrrr&&&&6666????4444qqqq1111####''''uuuu ,,,,nnnnZZZZRRRR;;;;ֳ))))////SSSS [[[[jjjj˾9999JJJJLLLLXXXX着CCCCMMMM3333EEEEPPPP<<<>>>ffffHHHHaaaa5555WWWWiiiiَUUUU((((ߌ BBBBhhhhAAAA----TTTT @6MD5FinalRMD160FinalSHA1TransformSHA1Final؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHG"(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDlɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~[/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxqg jgrn<:ORQhك[ 1Ѭߘr/Ḗ~&jE|,G$l iciNWqX~=t XrX͋qJT{YZ90`*#`(yA8۸y:`l>w'K1/x`\`U%U攫UbHW@cj9U*4\̴ATr|*oc]ũ+1t>\3֯\$lS2zw(H;Kkē!(f a!`|H2]]]u#&܈e>#Ŭom9BD . Ji^Bh!la gӫҠQjh/T(3Ql n;zP;*~ev9>YfCoEå}^;uos D@jVbNw?6r=B$7H ۛIrS{y%P;LylO`@ž\^c$johSl>9oR;Qm,0DE ^J3(fK.WtE9_ ӹyU 2`yr,@%g̣饎"2u<kaP/R=2`#H{1S>W\o.ViB~(2gsUO'[iXʻ]=!lJ[-ySeEIҐK3~ˤAb Lw6~д+MەqՓkю%ǯ/[{AI~-%^q h"W6d$ cUYCxSZ٢[} Źv&ϕbhAJsN-GJ{RQ)S?Wƛv`+t恵oWk *!ec.4dV]-SGjnpzKD). u#&İn}ߧI`fqilRdVឱ¥6)L u@Y>:䚘T?eB[k?ҡ08-M]% L&pc^?kh >\D}W7: P tAu8/;21>8TNmO Bo ,y|$ryVw.?rU$qk.P̈́GXzt}K:zfC cdG27;C$CMQe*P:qUN1w_V5kǣ;< $Y,n<pEㆱo ^*>Zw=Ne)։>%fRxL.jxS<- N=+6&9`y#RnfE{7(2åZl!Xeh;/ۭ}*/n[(!pa)uGa0a4c\s9pL ު˼,b`\ndi#PZe2Zh@*<1! T_~}=b7w-_h)5ǡޖXxWcr"ÃF T0.SHُ(1mX4a(s<|J]d]B> EꫪOlOBBǵj;Oe!AyMjGKPb=bF&[$ti GV[ Htb#*BXU >ap?#r3A~_;"lY7|`t˧@n2w΄PU5ai Z .zD4Egɞs͈Uy_g@Cge48>q(= m!>J=+hZ=@&L4)i Av.khq$j 3ԷCaP.9FE$tO!@MpE/f m1'A9UG%ښ ʫ%xP()Sچ, mbhiHפh'?Oz|Ϊ_7әxB*k@5 ٫9N;VmK1f&tn:2C[Ah xN جV@E'H::SU kKмgUXc)3VJ*%1?~^|1)p/'\,(H"m?H܆AyG@n]Q_2Տd5A4x{%`*`lc´2Of#k>3b $;" r(-Exb}doITH}'>AcG t.no:7`L knU{7,gm;e' )̒9 i{f} ϑ^و/$[Qy{;v.97yY̗&-1.Bh;+jLu.x7BjQ满PcKkؽ%=YBD n *Ngd_ڈ鿾dW{x`M``FѰ8Ew63kBqA_^;Z4ٷ,Q+:Ֆ}}>(-}|%rZLZq)GW;()f(.y_xU`uD^mm%adâW<'*:m?!cf&(3uU4V<wQ( gQ̫_QM08bX7 z{>d!Q2Ow~㶨F=)iSHd$m-if! FEdlX [@X̻k~jEY:D 5>ʹrdfGof,ҏ"W##v215VbuZ6ns҈bIPLVq z2E{Sb%ҽ5iq"|˶+v>S@`8G% 8vFšw``u N˅؍芰z~L\HjiԐ\-% ?2aN[wߏWr:j?$.Dsp"8 1).lN!(Ew8fTl 4)P|ɵՄ? Gy ~tn,fy3jXDD1Zs"*ˁc8:$zi HIĀ@8HުL H_%A@N$A UeQr% 9jyMc@hV 틕Z Vqק)N-fcqw*7 5Wa"ɠBր[t!h!hl iwW~@PճMװx QV$AV ʔUWnྵa$ XK'aU{whkldMDfd~i/IO70j5,s@IvM;B(HDLns) _ɋ}oaOw.+rץ<}+FYYEEهTNoHm| ǥcs_DVj͈prͳ]ny` E`1©\1BN"r\,rN@%/N2g@#x\n܃"ukMxnXO DH?{vw#Vu*F_( +8=6 JRft;QZylu eX&hJpFS(l\v0k)h76*g$ k%ֿh,DUueI40" WIbuU~bڨv^FESGml,gHL|3ەCh\SU2` ߝWc9^28aI37~^b<#NygCHKJf-ۄoH Ja)Yfc(` 0qt&@3/C~A^ l( ؒ0~of˜os*`ژ46K-%#= %IH6Jo8C@TzWOpA:Z„TU|5YŗZ:G:%Sj~=eI&TwQ[P]vlDȨ!帊iX`[ŗY)L;]J5ULkD$5鰽bעT/I18T(q)9H[/u@g+3-fVo*ɛ`( ')dMP˲,\26K_A !PNhذy\CPIMAC8wn\e0Rԋ@+>`xT7}02m-yyS"wuXȃoxkcZ\3]ùzv٣Byqj3ƚ`'PC=+mvN%ύHf6AN( aϩI=߹_d: }+p?PO+Zbbyj.H@,Z@"ғ-ES4n)olIIBr~V>olbfLTq*+9)XLVRf.S9v.i硦>iFt+LVvuOx39]O#2]2=&K/~~<O^?vf)o=E4ӷ+4grN=U"g`k8=ü0}8QcÐӝXyTGָaYwSW-XVcNx.F~eyUڑ0@5㶼P?!@=LXI6QpӱڍyKoqK 0ݻ맕d5w$,ϩ/ tцB*v:-7ޚ, )p@ :$7ѴyN] h1 HZ޻Bf1畏?r 3uQB}\cmd!@ WS1zݨ]3CoFq"8ԚέiGb[UgfN G[oLĎnrWxzdD]Ջ` l_9 ]c2֋~ pIPӻߘ)* mS~H~X.t;/RG'~[!<8zvOB9`55'{ɸ6g {pqT3^-ZId, =4pBwbO&Ҹ$d%FN`7>͕xE_{ ۫v"{.1ן%$r_m L=mPO%os#(ĴyI%4aĘnzn|l6AT޾'VAJJ{` ,8I%vK$%Gv XY f 0NndQ& #Phꃢ@0 /kz%?/?!M@`Iɟ'Կ@uИcnafŽ"o;h(Yy#P_w@CV/|-ҢɡHl4ma/T"2*kT:V"AӢ@f/9/Mҹ-?JDvR7,YQoz Zh{.T"5Y/mKdPIf-徐"3;䎴]4K@E?1.eUʱծ-mԢP @"8On ׿r[O/LVSTIiFXEŅc]ՊSW9j7=T*_}x:vbj Bz)^'rgP8ƌDŽZ*'JkѢ*V`C u\B&Ʉq-ls5&5 M{n0f&%HVV^c ϲc|E pPr(pH# yM;-AB G&LjMG\^ |Y#јr8S#/nqFnEV 9q +A|iCHy}B{BIZݿe\ [ ~iC?9zaz UQry吝5rNcZպ60ę _}֡{/6Y DYD̃Aѱ* ;{ B[A%zzӤ0XޘN?wiy{$[Ĭ%5P_aT1bcKU !h]Yfsc=4·~!+g\ab906;Wd/`:5F- 'zy㠌l0^7%oo;j tE'4:NiOM>dY58EfCr3c%N? (Υ'R¦սTUdpfM w&ۄgC!`X0TroSUGڿ]bVhkʃ;n-Ӧ\= wL3{9+^S_aodC x^c"&gI{ڷ"%-U^7rRyL H[k0 cq/޹ S E!5(T<)c)A|-nRPf4,0P1`sY&D\dwR3A+ٺ|o!PaH?ek«dv&4{^% ;MM1$~I,;jx`]sVz\/1Co0TyXR^/2zj0>՚1B°I #ڸ(0q_`ɣaM/Ǚ."płNؼ40y;'ƸaiH?;(ZC/v7ܱӧßn>ƼB7Q(heRwj-K'5.n\ )^XOX{iT̨g&H`K`8# ~8lI `s5GƱVL>#8d^BFzk Od^AE#\;]>rC|m~ll9`qpsv#E@]%=`GK6DήPQH<p}}d^(O= &g.yr?U+HԼ?^!@WNFRWs3NɷdŸW1O g_?@k{C=K۵cUȗn-J(JqoCCl< _P/~׿PZG.Q>pX.0_|r *,]I鎸P'WIoyR}}Yr@EEt]>uOiVA#. '`vteyvvwHNma}/ 4H<0(Ow Vܒ M"7)}V'|@|硴f^aÝ <є`AFv\;x,WGl"}NC~8<=Q8d{h'فI]j~vh]9K9 ;#Im<Eub'z\aBΒ~Brrp }ȡ[(Ob<51)BSjO[}m(Ki\j#MŌ?,-ҖXRg[HJI \EkӉ7`:SRqDIK @sg4|~q6UO/Т`?mPьGnU?墼38Wg} =3{r3O̫]ňv{{uWBdBc+ri/n+_mazgaq%9̸L!gуb>ܷν8\ =Dmn`I:T`H'W+8$ ږ%Eh;}E `P/(b4 ٠m+1+dZ0RXBA\1>26F3S75 {s{OJWdCQz(~c5_ yCdcdJ$_(͸O@C " 0 O7-{$MgQLq_-_d !S^>'_aB%rqK=;&o~~TLmDl߫I&Ǡ36~?Pa w8Pr.PwWFgOT3ɏ1 i5M\=fȦ[]oڑo/"F}F9mOCCN!и  ?X(>nH&p׋wt|% - y#;(8itb߷@!{7Ȋ@ YVvO@/{U MVi35'#WȯVeka^u˅nwU2?-ɿ[%;з$;mc fÀ(82 Tɪס2Zb,gTzuw11&o6F HjyZVLj~CRv/ t,t* M|k .TA5B=!&|,aRe1i%& !\1cr ^Iy p1 d>>̶Ոî 0rlqn/kءDVÈ9/ű1(x⤣2}o~X$Ū{s0a!-!)۳*)e\,0?Б\,ԩT _w:^VxV޾\!uQųåҶw#)Ei/z毲p[v F98/gsD)k)/Ifingӛ/~p%Q^$Slj>!DYܷ)eyCy9A+MWN )zkS< ~U3rŅ?~                               A@@@A@@A@@@@A@@@A@@@@@@AAA@@@@@@@@@@@@@A@@A@@A@@@A@A@@A@@A@@A@@@@A@A@@A@AA@AA@@AA@@@AAA@A@A@A@A@                              @@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@                                        0 0 0  0 0  0 0  0           0  0 0 0 0  0  0  0          $$  $ $ $$  $ $             $$  $ $ $$  $ $                  0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0                            ((  ((  ((  ((  ((  ((  ((  ((          """"   " " " " ((((((((    """" ( ( ( ("("("("(  ##%%&&))**,,//1122447788;;==>>@@CCEEFFIIJJLLOOQQRRTTWWXX[[]]^^aabbddgghhkkmmnnppssuuvvyyzz||cryptof_ioctlswcr_authencswcr_authcomputeswcr_encdec66666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\aes_xts_cryptaes_ctr_cryptZAES_CMAC_FinalHMAC_SHA256_FinalHMAC_SHA256_InitHMAC_SHA1_FinalHMAC_SHA1_InitHMAC_MD5_FinalHMAC_MD5_InitAES_GMAC_Finalaes_key_unwrap H!x-ML.RN8D( `hz=Skc|j9{Б/Uڅ?AZX_f ؐ53eiEVmv° GJBnI[#Q")yq~ ruo7ӎbwO$26󦻬^lW%㽨:Y*F?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@ffs_mountt01P011D0P0`000001 ufs_makeinodeufs_readdirufs_mkdirufs_linkufs_renameext2fs_readdirext2fs_direnterext2fs_mountح11\11111\11111111@11111@11@181@1(111@1H11x1<1@l11@uaddr_pivot_removeuaddr_pivot_insertuaddr_bestfit_removeuaddr_bestfit_insertNk/kNkVkVkVkNk4oquvm_map_printitvmmapbsyBUSYWANTEDTABLEDCLEANCLEANCHKRELEASEDFAKERDONLY ZERO PAGER1FREEINACTIVEACTIVEENCRYPTPMAP0PMAP1PMAP2PMAP3\sys_swapctlin6_pcbnotifyin6_pcbconnectin6_prefixlen2maskin6_prefixlen2maskin6_ifpprefixin6_delmultiin6_addmultiin6_unlink_ifain6_ifloop_requestin6_purgeaddrin6_update_ifain6_controlin6_lifaddr_ioctlin6_nigroupget_last_resort_ifidin6_ifattach_loopbackin6_ifattach_linklocalin6_ifattachin6_ifdetachin6_selectsrcfrag6_inputicmp6_redirect_outputicmp6_mtudisc_updateicmp6_redirect_diagicmp6_redirect_inputicmp6_notify_erroricmp6_reflecticmp6_rip6_inputni6_inputicmp6_inputip6_nexthdrip6_savecontrolip6_inputip6_forwardip6_setmoptionsip6_getpcboptip6_ctloutputip6_outputfill_prlistnd6_lookupnd6_ioctlnd6_outputnd6_freend6_storelladdrnd6_cache_lladdrnd6_rtrequestnd6_dad_duplicatednd6_na_outputnd6_ns_outputnd6_dad_timernd6_dad_startnd6_ns_inputnd6_na_inputin6_ifaddnd6_prefix_onlinknd6_prefix_offlinkpfxlist_onlink_checkprelist_removend6_prelist_addprelist_updatedefrouter_delreqdefrouter_addreqnd6_ra_inputnd6_rs_inputrip6_outputrip6_inputrip6_usrrequdp6_output0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-     A@!  @a`10  @`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O      A@!  @a`10  @`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O @@ !1Aa  0@` #+3;CScs 555 55 55 5 5 5!A!At3A"A"A$"A0"AD"AT"At3A   L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c            (08@P`p   0@`  0@`55( 6 6(%AxB%AxB%AxB%A A BB %AB%A&A &A &A&A&A$&A&A,&A&A4&A&Ap <&AD&Ap 0H&AD&Ap `P&AD&Ap pX&AD&A@`&At3A`d&At3AP h&AD&AP l&AD&AP @p&AD&AP Px&AD&A &A&A&A&A&A&A&A&Ax&ABp&AB&AB&AB&AB&AB  GAAGAA&A&A@&A&A&A&A &At3A &At3A &At3A &At3A &At3A &At3A &A&A &A&A/&ABo&A'A0/%ABp 'AP@ ?A 'A 'A 'A @'A 'A `'A 'A @ 'A 'A 'A $'A 'A ('A 'A ,'A0'A 04'A0'A @8'A0'A `<'A0'A @'A 'A D'AH'A L'A 'A P'AH'AT'AX'A`'AX'A d'AX'A0h'AX'A@l'AX'APp'AX'A`t'AX'Apx'AX'A|'AX'A'AX'A'AX'A'AX'A'AX'A'AX'A'A'A'A'A B'A0'A'A@'A'AP@'A`'A'Ap'A'A'A'A'A'A'A'A'A'A'A'A'A'A'A'A 'A'A 'A'A'A'A'A'A 'A%A0(A%A@(A%AP(A%A (A(A(A(A(A(A$(A(A,(A4(A8(A4(A<(A4(AD(A4(AH(AP(AT(AP(AX(A`(A d(A`(Ah(A`(A p(A`(Aeqnecsccmiplvsvchilsgeltgtlenv0.01.02.03.04.05.00.510.0daiadbibedeafdfasdeppmzlsllsrasrror_bus_dma_busaddr_to_paddrA,A>A,A> A ,A>`A(,A>A4,A>`A<,A>`AH,A>`AH,A>PTT,A>A`,A> Al,A>Dx,A0>D,Ap>i,A> i,A> i,A0> $i,Ap>0$i,Ap> ,i,Ap>0,i,Ap> .i,A>0.i,A>!i,A> !i,A>)i,A> )i,A>-i,A>Ai,A0> -i,A>Ai,Ap>Ai-Ap>Ai-Ap>`A(-A>`A4-A>PA D-A>pA T-A>A d-A>A t-A>/A -A>?A -A>A -A>A -A>/A -A>?A -A>OA -A>A .A>A .A>/A 4.A>?A H.A>OA \.A>`Q@t.Ap.A|.A.A.A.A.A.A.A.A.A.A.A.A.A/A.A/A/A/A/A(/A8/AH/AX/Ah/Ax/A/A/A/A/A/A/A/A/A/A0A0A0A0A 0A(0A00A80A@0AH0AP0AX0A`0A/Ah0Ap0Ax0A0A0A0A 0A(0A00A80A@0AH0AP0AX0A`0A/A0A0A0A0A0A0A 0A0A0A0AH0AP0AX0A`0A0A/A/A0A0A0A0A0A0A1A80A@0AH0AP0AX0A`0A 1A 1A/A41AH1A\1At1A1A(0A00A80A@0AH0AP0AX0A`0A0A1A0A1A1A0A0A 0A(0A00A80A@0AH0AP0AX0A`0A0A0A/A0A0A0A0A 0A(0A00A80A@0AH0AP0AX0A`0A0A/A/A0A0A0A0A 0A(0A00A80A@0AH0AP0AX0A`0A0A1A0A0A0A1A0A 0A(0A00A80A@0AH0AP0AX0A`0A0A1A0A0A1A1A1A1A(0A00A80A@0AH0AP0AX0A`0A1A/A/A0A0A0A0A 0A(0A00A80A@0AH0AP0AX0A`0ApI6D4AL6X4ApI6l4AL64AL64A4AL64A4AL65A(5AL6<5A`5AL6t5A5AL65A5A@````` ```dumpsys>A>A?A?A ?A0?A@?AP?A`?Al?A|?A?A?A?A?A`pB?A?A@A$@A8@A`@Ax@A@A@A@A@A(AACALAA`AA|AAAAAAAABABA,BALBA`BAxBABABACAHCAtCACACADA 4DA dDA DA DA EATEAEAEAEAFALFAxFAFAFAGA8GAtGAGAGAGAHA,HATHAHA HA HA HA HA HA IA $IA ,IA XIA xIA IA IA  JA 8JA hJA JA JA JA JA KA 8KA dKA |KA KA KA KA LA LA LLA xLA LA LA LA MA (MA LMAlMAMAMAMAMAMA$NAPNANANANANANAOADOA`OAxOAOA OA OA OA PA 8PATPAPAPAPAPAPA$QAXQA|QAQAQAQAQA RA$RAPRA|RARARARASA$SAHSAlSASASASA TA8TAdTATATATA$UA TUAUAUAUAVA,VAHVApVAVAVAVAVA WA0WAPWAlWAWAWAWAWAWAXA(XA HXA hXA XA XA XA  YA YA HYA xYA YA YA YA ZA!mA>mA>nA>,nA>LnA?xnA?nA?nA?nA?nA?oA?0oA?XoA?toA? oA? oA? oA? oA? oA?pA?$pA?@$@c@c@eaQ@X@W@@0@ w@Q2@U@4@F s%^^uhub_attachD8<8̾88ucom_do_open,8(8 8ugen_do_writeugen_do_readL8|888d8ugen_set_configp9999 uu ; u%5E u%5E     uu%5E )u&5F 2 5u&6F 0 1 3 4u0uhid_do_ioctluhid_do_read999=?R~? "?]6??&?If??J?R?7@? ? ? ? ?K??@#?????? ??H@? N? _?^??\X ? !? (!? !?E>!? !?m!?K"?AP#?[#?$?0$? %?&?j('?'??(?n(? v)?J)?*?abcde f g h i jklmnopqrstuvwxyz1!2@ 3#!4$"5%#6^$7&%8*&9('0)( ) *!+ , --_.=+/[{0]}1\|2\|3;:4'"5`~6,<7.>8/?9:;<=>?@ABC D E FG HIJK,L.MN-OPQRS T/U*V-W+X Y1Z2[3\4]5^6_7`8a9b0c.eh i jklmnopqrstuvwx yz{|}~ mMqQ@zy2" 3#6&$7/{%8([&9)]'0=}-?\./0+*1#'2#'345 6,;7.:8-_d<>| .'`0+*~5^q,?azw&12~ "3#!'4{"(5[#-6|$7`%_8\&9^'0@-)].=+}/0$1*2*3m4%56;.7:/8!d<> bBeE hH iI jJkKlL|,?nN~aArR,sSzZyY2 "3!'4"(5{[#6$7%!8&9%!8'0-)}].-_/0$*2`@#3mM4%5@#7:/\8=+g= aAkK~xX}iIpP& eE ,; c d tsrqQ'?ljbB|oOuUv.:yY{!\"12< 3>!(4[")5]#@6$+7%-8&/9'*0, _-=^.%`/z0w123n4m5$#6gG7h8fd/ 2"@ 3#!4$#6&$7/{%8([&9)]'0=}-+?.|/01'*2'*3456,;7.:8-_d<>\ .'`|0^~2" 3"5%#6&$7/%8(&9)'0=-'?.^/{[0+*}]123@4#5\|6,;7.:8-_d<> 1!2" 3!4$"5%#6^$7&%8*&9('0)--_.=+1#~2#~4'@5``d\|2"#6&$7'%8(&9)'0--=.^~/@`0[{1]}2]}3;+4:*5\_\|-+?\0345d<>| .'`|0^~.\0345|d<>.\`0^~xje.> u i d c htnbrl'"poygk,<qf;:-[{.]}//?0=+3s4-_6w7v8z9: ;<=>?@ABCD E 1!|2"@ 3#!4$~#6&$7/%8(&9)'0=-'?./[0+*]1}2}34{5\6,;7.:8-_d<> q,?azw&1|2@ "3#!'4"(5#6^$7%!8&9{'0}-).-_/[0$*]1`2`3m4%56;.7:/8=+~d<>\ aAD$bB8cCA!dD2eEC# fF0 gG? hH@  iIH( jJ>kK;lL4mML,nNB"oOI)pP7qQ9rR:sSK+tT5uU3vV<wWF&xXG'yY=zZO/#6^6,$7&7./[{E%0]}J*3;:64'"M-6,<17.>N.8/?Q aAD$bB8cCA!dD2eEC# fF0 gG? hH@  iIH( jJ>kK;lL4mML,nNB"oOI)pP7qQ9rR:sSK+tT5uU3vV<wWF&xXG'yY=zZO/#6^6,$7&7.--_V.=+T/[{E%0]}J*1\|W2\|W3;:64'"M-5`~6,<17.>N.8/?Q eEzy1+|2"@ 3*#!4#6&$7/%8(&9)'0=-'?./[0!]1$}2$}34{5 6,;7.:8-_d<>\ -'?.^`~0!]/[34{2"@ 3##6&$7/{%8([&9)]'0=}-'?.<>/+*012345\|6,;7.:8-_d<> .+*/2\|4eE a`~}kj!1@-2_ /3#!;4$":5#,6^$.7&%=8*&[9(']0), -?+'.xX%//.{0wW}1qQ|2qQ|3sr4"5`~6   7fF 8\ qQ@1!2" 3##6&$7/%8(&9)'0=-'?\./0+*~1}]2}]34{[5|6,;7.:8-_d<> 1!2@ 3#!4$"5%#6.=+/0[{1]}2]}345'"8;:c.d\|/? 1IqQ@2' 3^#!4+$"5%#6&$7/{%8([&9)]'0=}-*?\.-_/0~1,;2,;3_^4i05"678.:d<>| /1,;`2,;`3_^'aAcCeElLBAnNDCoOsS[ZxXzyzZ|{ bB{cC& fF[ gG] iI jJnN}qQ\vV@wW|xX#zZyY>1'~2" 3+^!4!"5%#6/$7=`%8(&9)'-./QP01qp2qp3$4506,?;7.:8-_*d< bB{ fF[ gG]kKBlLAmMnN}qQ\vV@wW|zZyY1!~2" 3#^!4$"5%#6&$7/`%8(&9)'0=-'?.+*/a`01~}2~}3  456,;<7.:>8-_d<> mMoOpP1!2"@ 3/!4$"5%#6?$7&%8*&9('0)--_.=+/[0']1<>}2<>}3;:~4{5#|\6,'7..8d /^^[0]4``{8aAcC  eE gG#" iI+*kK76lL<;nNFEoOMLsSa`uUkjzZ~} cCmMrRsSxXzZ1!2" 3#!4$"5%#6&$7_%8({&9)}'0'-/?\.'/0*|1<>2<>3+45@6,;7.:8-=d][ .~/"^4'`eEqQ@2"#6&$7/{%8([&9)]'0=}-\.-_/0'?~1+*`2+*`3456,;7.:8d<>| 4^    +9l+9X+9-9,9t,909 .9-9-95dd5(I*LCDEOMPJQNRK;9X;9;9,=9t<9L<9T<9Q9|R9P9xP9xN9B9H9A9jm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-udav_iff 4::H::hF F hF fF t(:&:&:h&:h8:H6:5:5: tO:O:N:@D:url_int_miibus_writeregurl_int_miibus_readreg@@9WP P Q@]:Z:S:S:uftdi_2232h_getrateuftdi_openLi:Hg:f:(g:`VV !y`V'V%V&V3V4VPVIVVVVVVVVVV}  H(02135HPPQ nY ol\k] ih^_mZ[Xj 2``` ```x     tq?=:>9;<8pq8     JKLIؼټy`ؿۿٿڿHIJprsq"`r``xȽPW8P3 & & & & & & & & & &     < < < l F F ! ========== = = = = =================== =!="=#=$=%=&='=(=)=*=+=,=-=.=/=0=1=2=3=4=5=6=7=8=9=:=;=<===>=?=@=A=B=C=D=E=F=G=H=I=J=K=L=M=N=O=P=Q=R=S=T=U=V=W=X=Y=Z=[=\=]=^=_=`=a=b=c=d=e=f=g=h=i=j=k=l=m=n=o=p=q=r=s=t=u=v=w=x=y=z={=|=}=~=================================================================================================================================0 B9 !PPPPPPPPPPPPPPPPPPPPPP PPPP PP PPPP PP PPPPPPPPPPPPPPPPPPPPPPPP: :  !R R !R !R !R !R R "R !"R "R ""R "R #"R $R !$R 1$R A$R $R "$R 2$R B$R $R #$R 3$R C$R (R !(R 1(R A(R Q(R a(R q(R (R (R "(R 2(R B(R R(R b(R r(R (R (R #(R 3(R C(R S(R c(R s(R (B@  >d lv:pr:r:q:G W WnPnPA   !^y 4Xhp9{#{{{{ rS#S&@'ah 33.U 1(Ex$ #h@:|:8|:|:0    \H::8::   &  l! eT ::,: :@0:::: B  Q  umsm_umass_changemodeXl:L:::=beeK #(-2>'()*+,-./@ABCF'()*+,-./@ABCF/@ABCDEFGHIJKN'()*+,-./@ABCFMNO`abcdefghik*++,,--../-@@A&''(())**++,,-   Pp < Bk?Bk@$BkA,BkB8BkCDBkELBkFLBkGLBkHLBkILBkJPBkKdBkLlBkOtBkP|BkQBkRBkSBkTBkUBkVBkWBkXBkYBkfBkgBkhBkiBkj Bkk BkEtA80B88B|B푠DB홠LBTB\BdB pB0|B`BpBBBBBB B0B`BpB BB$B0B<BHB[TB!BdB!tBCu*BBBP1BQ1BR1BT1BU1BP> BT>Bp>(B6A8B7AHBDAXBEAhBFA|BGABHABIABJABKABPABQABRABSABTABUABVABXABdA$BpA8BqALBrA`BsAtB7BBBBBCBB6CB7CBACBBCBECBGCBHCBICBLCBMCBSCBTC(BXC4BaC@BbCLBcCXBeCdBgCpBhCpBiC|BlCBmCBnCBpCBqCBrCBsCBtCBuCBvCBwCBxCByC BzC B{CBC(BC4BC@BCPBC\BChBCtBCtBCtBCtBCtBCBCBCBCBCBCBCBCBCBCBCBCBCBCBCBCBCBCBCBCBCB7DBTE BBG BDG BIG BLG BMG BNG BOG BPG BQG BRG BSG BTG BUG BVG BWG BXG BYG BZG BfI( BgI( BnI4 BHJD BIJP BJJ` BKJp BLJD BMJ BNJ BOJ BPJ BTJ BiJ BHK BIK BJK BKK BLK( BBL BDL BEL< BFLD BGL BIL BMLP BNL BPL BQL BRL\ BSL BWLh BXL| BYL BZL BdL BfL BgL BnL BFM BLM BDN BENXBFN BGN BHN BIN BJN, BKN< BPNH BQNH BRNH BSNH BTNH BVN\ BdNt BgN BhN BAP BBP BCP BDP BEP BFP BGP BHP BIP BJP BKP BLP BMP BNP BOP BPP BQP BRP BSP BTP BUP BVP BWP BXP BDQ BEQ BFQ BGQ BHQ BLQBMQ BNQBOQBWQ BXQ BYQ BZQ B^Q BlQBER BFR BGR BKR BLR BHS BKS BLS BMS BNS BFT BLT BRT B`T( BbTD BdT` BHUD BIUP BJUt BKU BLU BMU BNU BOUD BPU BQU BRUBSUBTUBmU BJV BKV BOV BRV BSV BTV BUV BVV BWV, BwV< B0XP B1X` B2Xp B3X B4X B5X B8X B@Y BAY BPY BQYBRYBTY BUY4BWYHBXYTB`YdBaYtBbYtBdYBeYBiY BtY BuY4BxYBzYB{YB|YB}YB~YBYBZBZBZBZBZBZBZBZBZBZBZBZBZBZB ZB1ZB3ZB4ZB6Z B7Z B8ZB9ZB?Z BAZ BBZ4BaZ BbZ4B`[Bb[ Bc[$Bd[0Be[@Bp[TBr[(Bs[dBt[tBu[Ba\Bc\BD]BH]BI]BJ]BL] BM]( BN] BO]D BP]BR]BW]p Bo] Br]4BH^HBJ^XBK^hBL^xBM^BO^Bm^BO^Bo^BfBfBf Bf BfBf$Bf4BfDBfTB f B!f B#f B1f B`fdBcftBdfBefBgfBoftBgBgBgBgBgBgBgBgBgB gBgBgBgBgBgB gB!gB"gB#gB$gB%g$B&gB'gB(gB)gB8g4B9gDB>gTB@gdBAgtBBgBCgBDgBEgBFgBGgBHgBIgBJgBPgBQgBXgBYgB[gB]g B_gB`g,Bag<BbgLBcgTBdg,Beg,BfgLBggLBhgLBpgdBqgtBrgBxgBygB{gBgBgBgBgBgBgBgBgBgBgBgBg(BgBh<BhLBh\Bh\BhhB hxBh\Bh\Bh\Bh\BhBhB hB!hB"hB#hB$hB%hB&hB'hB(hB)hB*hB+hB-hB/hB0h$B1hB5hB7h4B8hB9hB;hDB=hTB?hdB@htBAhBBhBChtBIhBLh\BPhBXhBYhBhBhBhBhBhBhBh BhBh,Bh<BhLBh\BhlBhBhBhBhBhBhBhBh BhBh,BhDBh\BhtBhBhBhBhBhBhBhBhBh BhBh$Bh,Bh<BhLBh\BhlBh|BpBpBqBqBqBqBqBqBqBqB qB qB qB qBq(Bq8B@qHBAqXBBq`BCqtBDqBEqBFq`BGqBIqBJqBKqBLqBMqBNqBOqBQqXBRqBSqB^qB_qtB`q Bbq4Bq`BqHBqLBq`BqBqpBqpBqBqBqBqBqtBqBqBqBqBqBqHBqBqBqHBq(Bq8BqPBqPBqHBqdBqtBqBqBqBq(BqBqBqBqBrBrBrB@r,BCr<BDr,BEr<BFr<BGr<BHr<BIr<BJr<BKr<BLr<BMr<BNrLBOr<BrdBrxBrxBrBrxBrBrBrBrBrBrBrBrxBrBrB4x B5x$By4By@ByLByXByLByLByLByLBydBytByB?yBAyBByBlyBmyBnyBoyBBBBBB B BB@ BA0BBDBCTBDhBFxBJBKBLBNBPBRBVBZ B[$B^ B`0BbBj@Bk$Bz$B{$BPBhBhBBBBBBBBBB B B B0 B B@ BP BÔd BĔx BŔ Bǔ BȔ Bɔ B˔ B̔ B͔ !B!B(!B@!BP!Bl!B !B!B!B!B!B!B@!BO"BR"BS,"BU,"BWD"B_T"Bl"B"B"B"B"B"B"B#B#B(#B@#BX#Bp#B#B#B#B•#Bĕ#Bŕ#Bƕ#BǕ$Bɕ $B̕4$B͕D$BΕ !Bϕ !BP$B`$Bp$B`$B$B$B@$BA$BB$BC$BD$BE$BG$BH%BI%BJ%BK %BL %BN %BO %B(%B@%BP%B`%Bx%B%B%B%B%B%B%B%B%B%B &B &B &B(&B8&BH&BX&BX&Bh&Bx&B &B &B &B &B &B&B&B&B8&Bh&Bx&B&B&B'B'B('B8'BH'BX'Bh'Bx'B'B'B'B &B &B&B'B8'B'B'B'B 'B((B0((B8@(BPX(BXp(B`(Bh(B(B(B(B(B)B )BPG)BC0)BP@)BL)B T)B!\)Bd)Bl)Bt)B|)B|)B|)B|)B|)B|)B|)B)B)B)B#)B$)B')B))B*)B+)B,)B-)B.)B0)B2)B4)B6)Bd)B|)Bd)B|)Bt)B|)B*B*B*B *Bi&(*BiH,*Bib0*Bic4*Bis8*Bi8*Bi<*BiD*BiL*BiT*BiH \*Bi` 0*Bib 0*B`*Bl*Bx*B#*B#*B@#*B@#*B@@*B0!*BP!*BR!*BD*BD *BD*BD*B;Y+B`+B `+Bp+B$+B,+B4+B@+BVH+BvP+B\+Bd+B9p+B:x+B;+B<+B=+B>+B+BA+BB+BC+BDlAEtAF+BG+BH+BI+BJ,BL,BM,BN$,BO0,BP<,BSH,BTP,BU\,BVd,BWl,BYt,BZ|,B[,B],B^,B_,Bb,Bc,Be,Bh,Bi,Bj,Bk,Bn,Bo-Br-Bs -Bt,-Bw4-Bx<-ByD-BzP-B{X-B}`-B~l-Bx-B-B-B-B-B-B-B-B-B-B-B-B.B .B.B$.B0.B<.BH.BP.BX.Bd.Bl.Bt.B|.B.B.B.B.B.B.B.B.B.B.B.B/B /B/B$/B0/BB2w>B2(w>B2Xw>B2'w>B28w>B2Hw>B2hw>B>B>B(>B#8>BHL>B`>Bh>B p>B(>B>B>B>B>B>B>B>B>B>B>B>B>B>B?B ?B?B$?B,?B4?BB?B$ ?B$0@B$P@B$QXsB$ @B$%0@B$@@B$P@B$`@B$ p@B$!@B$"@Btq@BtP@BtX@B]@B]h@B]i@B]x@B]@B]AB]AB] AB]0AB](@AB]8(TAB](pABABABo#plBAB8AB?AB?AB?AB?ĀAB?ȀAB?AB?ABRABTABXBB'BB' BB0BBW|HBWHBHBpHBHBAHBHBHBHB$HBIBIBIB.(IB:4IB<@IBjLIBOI"\IBPtIB`IBIBIBIBﾰIBIB !IB "IB&PIB'PJB(PJBIJBSJB( JB50JB@JB9HJB@PJBA\JBBhJBC\JBDPJBEtJBFhJBJBJBJBJBJBJBJBJBJBJBJBKBKBJBKBKB(KB KB OB@OBCOBHOBIPBJPBK$PBL0PBMVBAVBVBVBVBVBVBVBVBVB VBVBVBVBVBVBVBVBVBVB VB"WB& WB- WB:0WB;0WB=@WBDLWBFTWBI\WBJdWBSlWBUxWBWWBXWBYWB]WB^WB_WBWBWBWBWBWBWBWBXB  XB! XB"0XB#0XB,@XB20XB8PXB9PXB:PXB;PXB<`XB@xXBAXBExXB$XB$XB$XB$XB$XB$XB$XB $XB!$YB"$ YB#$YB%$(YB&$8YB($HYB@$\YBB$hYBC$tYBD$hYBE$YBF$YBH$YBI$YBJ$YBK$YBL$YBN$YBP$ZBR$ ZBS$ZBY$(ZB]$(ZB$4ZB$@ZB$PZB$@ZB$dZB$xZB$@ZB$ZB$ZB$ZB$ZB$ZB$ZB$ZB$ZB$ZB$[B$ZB$[B$ [B$,[B$ZB$<[B$L[B$\[B$l[B$\[B$[B$[B$\[B$[B$[B$\[B$[B%[B%[B0%[B1%[B2%\B3%\B4%\B5%\B6%\B@% \BA%,\BC%D\BD%D\BE%D\BF%D\BG%D\BH%D\BL%P\BP%\\BQ%h\BR%\BS%\BT%\B`%\Ba%\Bb%\Bp%\Bq%\Br%\Bs%\Bv%\Bx%]By%]B{%]B%(]B%4]B%@]B%P]B%\]B%h]B%t]B%]B%]B%]B%]B%]B%]B%]B%]B%]B%^B%^B%^B% ^B%,^B%^B%<^B%]B%L^B%X^B%d^B%p^B%|^B%|^B%|^B%|^B%|^B%|^B%^B%^B%^B%^B%^B%^B%^B%^B%^B&^B&^B&^B&^B&^B&^B&^B&^B&^B &^B &^B &_B&_B&,_B&D_B&P_B&P_B&P_B&\_B&\_B&\_B&\_B&\_B&\_B&\_B&\_B &l_B!&x_B"&_B#&_B$&_B%&_B&&_B'&_B@&_BA&_BQ&_BR&_BS&_BX&`BY&`BZ&`B[&`B\&`B`&`Bb&`Bd&`Bf&`Bh&$`Bj&8`Bl&\PBm&H`Bn&X`Bo&h`Bp&t`B&`B&`B&`B&`B&`B&`B&`B&`B&`B&`B&`B&`B&`B&`B&`B&`B&aB&aBp'aBq'(aBr'4aBt'DaBu'PaBv'4aBx'\aBy'haBz'taB|'aB}'taB'@]B']B'aB'aB'aB'aB'aB'aB'aB'aB'aB'bB'bB' bB'0bB'@bB'PbB'`bB'pbB'bB'bB'bB'bB'bB'bB'bB'bB'bB'bB'bB'xPB'bB'bB'bB'bB'bB(bB(cB(cB( cB(,cB ((cBO(cB0(cB1(cB2(cB3(cB4(cB5(cB6(cB:(cB?(cBA(cBC(cBE(cBG(cBI(cBK(cBO(cBP(cB)cB)dB)dB)dB),dB)8dB )HdB!)HdB")TdB#)TdB&)HdB()HdB))TdB*)`dB-)HdB.)HdB0)ldB2)|dB4)dB5)dB6)dB7)dB8)dB9)dB:)dB<)dB>)dB@)dBB)dBD)dBF)dBH)dBJ)dBL)dBp)dBq)dBr)dBs)dBt)dBu)dBv)eBw)eB)eB)(eB)4eB)4eB)@eB)LeB)XeB)deB)deB)teB)teB)eB)eB)eB)eB)eB)eB)eB)eB)eB)eB)eB)eB)fB)fB)fB)fB)fB),fB)8fB)DfB)PfB)PfB)\fB)\fB)hfB)xfB)fB)fB)fB)fB)fB)fB)fB)fB)fB)fB)fB)fB)fB)gB)fB)gB) gB)0gB*:dlB@:xlBB:xlBD:xlBF:xlBH:xlBJ:xlBQ:lBU:lB`:lBb:lBd:lBe:lBf:lBg:lBh:lBi:lBj:lBl:lBn:lBp:lBr:lBt:lBv:lBx:lBz:lB|:mB; mB; mB;mB; mB;(mB;4mB ;;mB?;mBB;tJBD;tJBF;tJBH;tJBJ;tJBL;tJBN;tJBP;tJBV;mBW;mBd;mBe;mBf;nBg;nB<nB<$nB<$nB<$nB<$nB<$nB<$nB<$nB <$nB <$nB <$nB <,nB!<,nB"<,nB#<,nB$<,nB%<,nB&<,nB'<,nB(<4nB*PpB?PXpB@PpBDPpBHPpBRpBRpBeqBeqBeqBeqBeqBeqBeqBe qBe,qBe,qBeHBPBQBRBSBTBUBVBWBYĊBZԊB[ԊB\B]B^B`BdBe Bf,Bg8Bh8BjDBkTBldBmdBnlB~BBBBB̋B̋B܋BBBBB$B4BDBTBlBBBBBBBЌBB܌B܌BBBBBBB0B@BTBhBBxBxBBB@BBB̍B܍BBBBB,B4B@BPB\B@hBABBBDxBFxBPBQBRBSBaBeЎBgBpBqBrBt Bu0Bv@BxTBydBzxB{B|BBB؏BBBB B0BDBXBlB|BBBBBBĐBАBBBBB BB(B8BHBXBhBtBdBdBdBdBdBdBBBBBđB!B@БBABBBDBGBP BQ4BSHBX\BYlB[|B`BaBbBcBdBeBfBgBhBiBkȒBlԒBmBnBoBpBqBrB~ B B,BHB@BTBhB|BBBBBBBBBBB B B BBBB B BēBܓBBBB(B!B+BdBlB`0tBb0|B0B0B0B2B2Bb5B5B5BSBȦBԦB!`B1`B@`B``Ba`B R B'R4B)RHBIR\BRpBRB)B9B)B6B8B9BL?BLAlBLBLĶBLf̶BLԶBLBLBLBLBL$BL4BLDBLTBLdBLtBLBL BL!BL"BL#BL(BL@BLAзBLBBLDBLFBLGBLH BLI0BLJ BLK@BLL@BLPTBLQdBLRtBLSBLTBLUBLVBLWĸBLXԸBL`BLBYBB/ B/ B//,ByByBy8By LBy`BypByBy@ByByByByB# B# ̹B#عB# B#B# B# B# 0B# DB# XB#PdB#`pB#|B#B#B# B#@B#%B#`ȺB#ԺB#B#PB#PB# B#B#`(B8BHBXBdBpB|BB 2B 2B 2B 2B 2̻B GܻBBBB B BP(BPP8BRHBRRXBSPW3hB`tB`B`B`B`B`ļB`:g̼B`ؼB`jB`B`B`B` B`B`蘋B`B`$B,B4B@B6ABHB\B` tB`ɈBB8BXBYBiȽBԽBBBB$B'B6BQ(BS4Bd@BLBXBdBlBaxBqBvBBBB̾BܾBBB BB(B4BDBTB& dBtBB"BB8BXBYBiBԽBBB$B'B6BQ(BS4Bd@BqBпB"B8"BX"BY"Bi"B"ԽB#B#B$#B'#B6#BQ#(BS#4Bd#@Bz(B{(B|(B}(B~(B80B@0$BC04BD0DBP0TBQ0dBS0tBW0BX0BY0Be0Bh0Bt0B0B0B1B1B1 B1B14B1@B1PB1\B1pB"1xB#1BG1BH1BI1BW1Bd1Bh1Bw1Bx1B1ԽB1B2B2B2B2B'2,B028B82BI2LBJ2XBK2BN2`BS2lBX2BY2tBi2B2ԽB2B2ܰB$3B'3B63B73BC3BD3BI3BQ3(BS3Bd3@Bq3Br3Bz3B{3BBB8BBXBBYBBiBBBԽBCBCB$CB'CB6CBQC(BSC4BdC@B8RBSB$SB'S B6SB7S̾BQS,BSSB?(Bf4Bg@BhLBiXBjdBkpBm|BnBoBBBBBBBBBB B`Ba$B0B > > >  >> ! >> >D<2w<"D<0d<.d<vd<pd<qd<4derror %d timeout on SCSI command 0x%x INTRF single step dsp 0x%08x dsa 0x08%x %s: DMA IRQ: illegal instruction bus fault parity DMA fifo empty, DSP=0x%x DSA=0x%x: last msg_in=0x%x status=0x%x current DSA invalid %s: scsi gross error %s: unexpected phase mismatch %d %s: phase mismatch without command parity error %s: selection timeout without command %s: unexpected disconnect without command %s: unhandled scsi interrupt, sist=0x%x sstat1=0x%x DSA=0x%x DSP=0x%x %s: script interrupt (0x%x) with invalid DSA !!! %s: command with invalid status (IRQ code 0x%x current status %d) ! error, DSP=0x%x %s: reselect with invalid target %s: reselect with invalid target %d %s: target %d reselect with invalid lun %d %s: target %d lun %d tag %d reselect without command %s: reselect with invalid tag our reject message was rejected scsi message reject, extended message sent was 0x%x scsi message reject, message sent was 0x%x unhandled message 0x%x %s: extended message too big (%d) MSG_IGN_WIDE_RESIDUE: bad len %d invalid retval from siop_iwr()invalid retval from siop_wdtr_neg()invalid retval from siop_sdtr_neg()reselect failed %s: done without command, DSA=0x%lx unknown irqcode %x != NULL%s: siop_intr() - we should not be here! istat = 0x%x, dstat = 0x%x, sist = 0x%x, sstat1 = 0x%x need_reset = %x, irqcode = %x, siop_cmd %s %s: unable to load data DMA map: %d siop%s: %u (%d dBm) Unknown PRISM2 chip%s: Firmware %d.%02d variant %d, Symbol %s: %s%s (0x%04x), Firmware %d.%d.%d (primary), %d.%d.%d (station), %s: unsupported crypto algorithm %d %s: wi_do_hostdecrypt: iv mismatch: 0x%02x%02x%02x%02x vs. 0x%x %s: wi_start: dropping unassoc dst %s %s: host encrypt not implemented for 802.3 %s: wi_start: xmit failed %s: wi_cmd failed with %d %s: wi_scan_timeout: %d tries %s: invalid data path: %x %s: failed to allocate %d bytes on NIC %s: device timeout %s: init failed %s: wi_mgmt_xmit: xmit failed wiiocwiscan%s: tx buffer allocation failed %s: mgmt. buffer allocation failed %s: wi_cmd_io: busy bit won't clear %s: timeout in wi_cmd 0x%04x; event status 0x%04x %s: received packet of unknown type on port 7 %s: received packet on invalid port (wi_status=0x%x) %s: oversized mgmt packet received in hostap mode (wi_dat_len=%d, wi_status=0x%x) wihap: failed to copy header %s: oversized packet received (wi_dat_len=%d, wi_status=0x%x) %s: Error decrypting incoming packet. : unable to read station address address %sWaveLAN/IEEE nodeIBSSwlanwiLucent WaveLAN/IEEESony WaveLAN/IEEELucent Embedded WaveLAN/IEEEPRISM2 HFA3841(EVB2)PRISM2 HWB3763 rev.BPRISM2 HWB3163 rev.APRISM2 HWB3163 rev.BPRISM2 HFA3842(EVB3)PRISM1 HWB1153PRISM2 HWB3163 SST-flashPRISM2 HWB3163(EVB2) SST-flashPRISM2 HFA3842(EVAL)PRISM2.5 ISL3873PRISM2.5 USBPRISM2.5 ISL3874A(Mini-PCI)PRISM2.5 ISL3874A(PCI-bridge)PRISM3 ISL37300PPRISM3 ISL37300P(PCI)PRISM3 (USB)Sending deauth to sta %s wihap_disassoc_req: unknown station: %s wihap_assoc_req: from station %s wihap_assoc_req: bad ssid: '%.*s' != '%.*s' wihap_assoc_req: rates mismatch. wihap_assoc_req: capinfo: not ESS: capinfo=0x%x wihap_assoc_req: WEP flag mismatch: capinfo=0x%x wihap_assoc_req: polling not supported: capinfo=0x%x wihap_assoc_req: already assoc'ed? wihap_assoc_req: returns status=0x%x Sending disassoc to sta %s wihap_data_input: no TODS src=%s, fctl=0x%x wihap_data_input: incorrect bss: %s wihap_data_input: dropping unassoc src %s wihap_auth_req: station %s short request wihap_auth_req: station %s algo=0x%x seq=0x%x wihap_auth_req: new station challenge: 0x%x 0x%x ... wihap_auth_req: algorithm unsupported: 0x%x wihap_auth_req: returns status=0x%x wihap_init: sc=%p whi=%p wihap_ioctl: i shouldn't get other ioctls! wihap_deauth_req: unknown station: %s wihap_mgmt_input: len=%d MGMT: assoc req: assoc resp: reassoc req: reassoc resp: probe req: probe resp: beacon: ann traf ind disassociation: auth: deauth: unknown (stype=0x%x) ftype=0x%x (ctl=0x%x) wihap_shutdown: sc=%p whi=%p wihap_shutdown: free(sta=%p) wihap_timeout: disassoc due to inactivity: %s wihap_timeout: deauth due to inactivity: %s %s: power management is disabled, cannot do WOL %s: no auxiliary power, cannot do WOL from D3 (power-off) state %s: can't map mbuf (error %d) %s: tried to map busy TX descriptor %s: unknown imtype %d%s: tried to map busy RX descriptor %s: reset never completed! %s: PHY write failed %s: bad phy register %x %s: PHY read failed %s: unknown bus speed, assume 33MHz : unknown ASIC (0x%04x): %s (0x%04x), %s, address %s %s: can't allocate tx listseg, error = %d %s: can't map tx list, error = %d %s: can't create tx list map, error = %d %s: can't load tx list, error = %d %s: can't create DMA map for TX %s: can't allocate rx listnseg, error = %d %s: can't map rx list, error = %d %s: can't create rx list map, error = %d %s: can't load rx list, error = %d %s: can't create DMA map for RX %s: no PHY found! %s: watchdog timeout RTL8100RTL8100E 1RTL8100E 2RTL8101RTL8101ERTL8102ERTL8106ERTL8401ERTL8402RTL8411RTL8102ELRTL8102EL 1RTL8103ERTL8110SRTL8139C+RTL8168 1RTL8168 2RTL8168 3RTL8168C/8111CRTL8168CP/8111CPRTL8168F/8111FRTL8168G/8111GRTL8105ERTL8168D/8111DRTL8168DP/8111DPRTL8168E/8111ERTL8168E/8111E-VLRTL8169RTL8169/8110SBRTL8169SBLRTL8169/8110SCdRTL8169/8110SCeRTL8169S%s: probed fifo depth: %d bytes : unknown uart : ns8250, no fifo : ns16450, no fifo : ns16550, no working fifo : ns16550a, %d byte fifo : st16650, no working fifo : st16650, %d byte fifo : st16c654, 64 byte fifo : ti16750, 64 byte fifo comattach: bad fifo type%s: console %s: can't establish soft interruptcomcninit: mapping failed%s: %d silo overflow%s, %d ibuf overflow%s comprmRT5222unknownRT2522RT2523RT2524RT2525RT2525eRT2526%s: could not write to RF %s: could not read from BBP %s: could not write to BBP %s: timeout waiting for BBP %s: could not enable device %s: could not allocate protection frame %s: sending mgt frame failed 0x%08x %s: sending data frame failed 0x%08x %s: could not load old rx mbuf%s: could not allocate beacon %s: could not create desc DMA map %s: could not allocate DMA memory %s: can't map desc DMA memory %s: could not load desc DMA map %s: could not allocate soft data %s: could not create DMA map %s: could not allocate rx mbuf %s: could not allocate rx mbuf cluster %s: could not load rx buf DMA map%s: MAC/BBP RT2560 (rev 0x%02x), RF %s %s: could not allocate Tx ring %s: could not allocate ATIM ring %s: could not allocate Prio ring %s: could not allocate Beacon ring %s: could not allocate Rx ring ralRT2529 (MIMO XR)RT5225RT5325 (MIMO XR)RT2527ral-rt2661ral-rt2561ral-rt2561s%s: error %d, could not read firmware %s %s: could not allocate beacon frame %s: timeout waiting for MCU to initialize %s: could not load 8051 microcode %s: timeout waiting for NIC to initialize %s: MAC/BBP RT%X, RF %s %s: could not allocate Tx ring %d %s: could not allocate Mgt ring RT3053RT2820RT2850RT2720RT2750RT3020RT2020RT3021RT3022RT3052RT3320%s: timeout waiting for DMA engine %s: could not read RF register %s: could not read from BBP through MCU %s: could not write to BBP through MCU %s: timeout waiting for BBP to wake up %s: can't map DMA memory %s: could not load DMA map %s: radio is disabled by hardware switch %s: timeout waiting for MAC %s: could not allocate Rx mbuf ral-rt2860%s: error %d, could not read firmware file %s %s: MAC/BBP RT%X (rev 0x%04X), RF %s (MIMO %dT%dR) %s: could not allocate Tx pool %s: reset rx ring timedout %s: can't allocate DMA mem %s: can't map DMA mem %s: can't load DMA mem %s: can't select regwin %d %s: invalid max txpower in sprom %s: no tssi2dbm table for 11a PHY %s: bwi_rf_calc_txpower failed %s: only BCM2060 rev 1 RF is supported for 11A PHY %s: only BCM2050/BCM2053 RF is supported for supported for 11B PHY %s: only BCM2050 RF is supported for 11G PHY %s: unsupported PHY mode %s: %s is not implemented yet %s: unsupported 11A PHY, rev %u %s: unsupported 11B PHY, rev %u %s: unsupported 11G PHY, rev %u %s: unsupported PHY type %d %s: too many MACs %s: %dth MAC already attached %s: MAC rev %u is not supported %s: can't select regwin 0 %s: no BBP id for device id 0x%04x %s: no number of win for BBP id 0x%04x %s: bus regwin already exists %s: no MAC was found %s: no bus regwin was found %s: MACs bus space mismatch! %s: config PS failed %s: can't stop MAC %s: invalid IV image, ofs %s: invalid ofs (0x%04x) for %dth iv %s: invalid IV image, val32 %s: invalid IV image, val16 %s: invalid IV image, size left %d %s: load IV failed %s: load ExtIV failed %s: firmware (fw & pcm) loading timed out %s: firmware version 4 is not supported yet %s: invalid firmware (%s): invalid size %zu %s: invalid firmware (%s): size mismatch, fw %u, real %zu %s: invalid firmware (%s): type mismatch, fw '%c', target '%c' %s: invalid firmware (%s): wrong generation, fw %d, target %d %s: base tssi measure failed %s: TEST1 failed %s: TEST2 failed %s: %s failed, MAC status 0x%08x %s: %s failed, intr status %08x COMunknown regwin type 0x%04x%s: %s disable clock timeout %s: %s wait BUSY unset timeout unsupported rate %dimpossible lna gain %dunsupported lpdunknown PHY mode %u%s: zero tx id %s: wait for TX ring(%d) stable timed out %s: reset TX ring (%d) timed out %s: can't create %dth tbd, %dth DMA map %s: can't create spare RX buf DMA map %s: can't create %dth RX buf DMA map unsupport modulation type %u%s: invalid rate %u or fallback rate%s: prepend TX header failed %s: can't load TX buffer (1) %d %s: can't defrag TX buffer %s: can't load TX buffer (2) %d unsupported modtype %u%s: zero length data, hdr_extra %d %s: can't allocate %dth RX buffer %s: can't create txstats ring DMA mem %s: can't allocate txstats ring DMA mem %s: can't map txstats ring DMA mem %s: can't load txstats ring DMA mem %s: can't allocate txstats DMA mem %s: can't map txstats DMA mem %s: can't load txstats DMA mem %s: %dth TX ring DMA create failed %s: %dth TX ring DMA alloc failed %s: RX ring DMA create failed %s: RX ring DMA alloc failed %s: TX stats DMA alloc failed unknown LED event %d%s: %s invalid channel! %s: can't set channel to %u bwi-airforceucode%d.fw%s: error %d, could not read firmware %s! pcm%d.fw%s: no suitable IV for MAC rev %d b0g0initvals%d.fwb0g0bsinitvals%d.fw%s: no suitable ExtIV for MAC rev %d %s: PHY calibrate failed %s: can't initialize %dth TX ring %s: can't initialize RX ring %s: can't initialize TX stats ring %s: invalid MAC address: %s unknown phymode %d%s: can't drain TX status %s: intr fatal TX/RX (%d) error 0x%08x intr PHY TX error %s: EO_ATIM %s: intr noise bwiuhci_alloc_std_chain: maxp=0 uhci_device_setintr: 0 interval uhci_device_isoc_close: %p not found uhci_abort_xfer: not in process contextuhciabUHCI root hubuhci_device_isoc_enter: xfer=%p in frame list startstop%s: cannot %s %s: controller did not reset %s: interrupt while not operating ignored %s: host system error %s: host controller process error %s: host controller halted uhciohci_setintr: 0 interval ohci_device_isoc_abort: early return ohci_rem_ed: ED not foundohci_add_done: addr 0x%08lx not foundohci_abort_xfer: not in process contextohciab%s: isoc TD alloc failed OHCI root hub%s: %u scheduling overruns %s: resume detect %s: unrecoverable error, controller halted %s: blocking intrs 0x%x %s: reset timeout %s: SMM does not respond, will reset ,, legacy support version %d.%d%s %s: unsupported OHCI revision ohciehci isoc xfer being freed, but with no itd chainehci: isoc xfer suddenly has 0 bInterval, invalidehci_check_itd_intr: not valid itd ehci_check_qh_intr: not valid sqtd ehciiawehciabehci_open: bad device speed %d%s: Error opening low/full speed isoc endpoint. A low/full speed device is attached to a USB2 hub, and transaction translations are not yet supported. Reattach the device to the root hub instead. ehci: opening pipe with invalid bInterval ehci: zero length endpoint open request %s: halt timeout ehci: isoc descriptor requested that spans the entire frametable, too many frames ehci: unexpectedly ran out of isoc itds, isoc_startEHCI root hub%s: port reset timeout ehcidiehci_abort_xfer: not in process contextehciaw%s: disable schedules timeout %s: run timeout ehcidbehci%s: unable to start background operation invalid data offset%s: %s: illegal block count for %s %s: %s: illegal cmdlen for %s %s: %s: %s: invalid chunk state%s: %s: invalid volume state transition %d -> %d could not requeue I/O%s: sr_wu_enqueue_ccb got active wu%s: sr_wu_init got active wu%s: invalid target on wu: %p%s: i/o error on block %lld target %d b_error %d unknown optional metadata type%02x%02x%02x%02x-%02x%02x-%02x%02x-%02x%02x-%02x%02x%02x%02x%02x%02x%s%sOPENBSDSR %s%03d%s: %s: %s: invalid chunk state transition %d -> %d %s: sr_startwu_callbacksr_schedule_wu: work unit not in progress (state %i) sr_sync%s: invalid optional metadata checksumunknown old optional metadata type %u %s: no in memory copy of metadata %s: could not allocate metadata scratch area %s: could not write metadata to %s %s: save metadata failed sr_shutdownsr_down%s: roaming device %s -> %s %s: sr_scsi_cmd NULL discipline %s: %s device is being deleted, failing io %s: wu %p not on pending queueunable to allocate work unitsunable to allocate ccbsvolume %s not found%s has unsupported sector size (%u)could not allocate memory for metadatacould not allocate memory for foreign metadata%s: sr_rw: failed to allocate vnode %s: I/O error %d on dev 0x%x at block %llu failed to get DUID for softraid volumeinsufficient boot storagefailed to write boot blockfailed to write boot loadercould not save metadata to %s%s: sr_meta_rw: invalid metadata pointer cannot clear foreign metadatanot enough memory for metadata buffercould not read native metadatanot part of the same volumenot all chunks are of the native metadata formatsrc_dev_mm == NODEV%s%d%cdiscipline does not support rebuildrebuild already in progressvolume not degradedno offline chunks available to rebuild%s: sr_rebuild_init: can't allocate vnode %s partition not of type RAID (%d)%s partition too small, at least %lld bytes required%s partition too large, wasting %lld bytes%s is already in userebuild of %s started on %s%s: no offline chunk found on %s! %s: %s volume degraded, will attempt to rebuild on hotspare %s sr_hotspare%s: pending I/O failed to complete on failed chunk %s, hotspare rebuild aborted... %s is already a hotsparesr_hotspare: cannot allocate vnodeHOTSPAREcould not save metadata for %sunsupported state request %dchunk not part of arrayinvalid foreign metadatanot valid softraid metadatainvalid metadata checksumcannot read metadata version %u on %s, expected version %u or earliersr_meta_native_bootprobe: cannot allocate vnodenot enough memory for fake disciplinesr_meta_native_bootprobe: cannot allocate vnode for partitionnative bootprobe could not read native metadatasr_meta_probe: cannot allocate vnodesrdiscould not create discipline taskqcould not initialize disciplinechunk %s already in useinvalid metadata formatdisk %s is currently in use; cannot force createfailed to clear metadataone of the chunks has corrupt metadata; aborting assemblychunk sizes are not equal; up to %llu blocks wasted per chunkvolume level does not match metadata leveldisk %s already assembledtrying to bring up %s degraded%s was not shutdown properly%s is offline, will not be brought onlineno free target for %sscsi_probe_lun failedvolume %s is roaming, it used to be %s, updating metadata%s volume attached as %sunable to create sensor for %ssdwd%s: failed to allocate boot volume %s: failed to allocate device array %s: failed to allocate ondisk array %s: failed to allocate hotspare %s: found duplicate chunk %u for volume %u on device %s %s: not all chunks were provided; attempting to bring volume %d online sr_locksr_hs_lock%s: controller registration failed%s: bogus rebuild restart offset, starting from 0 %s: resuming rebuild on %s at %d%% %s: could not create read io %s: could not create write io sr_rebuild%s: could not save metadata to %s sr_yieldsoftraidsr_concat_rw%s: %s: too many ccbs queued %s requires two or more chunksCONCATsr_crypto_rwcannot open key disk %s%s has unsupported sector size (%d)%s partition not of type RAID (%d) %s is not a key diskCRYPTOKEYDISKunknown crypto algorithmunable to allocate CCBsincorrect key or passphrase%s requires exactly one chunksr_raid0_rwinvalid strip sizeRAID 0%s: retrying read on block %lld %s: sr_raid1_intr_cb%s: permanently failing write on block %lld sr_raid1_rw%s: is offline, cannot read invalid volume stateRAID 1%s: permanently fail write on block %lld sr_raid5_rw%s: %s failed to get read work unit%s: is offline, can't read %s: %s: invalid volume state transition %d -> %d%s: %s: %s: invalid chunk state transition %d -> %d%s requires three or more chunksRAID 5sr_raid6_rw%s: can't get wu_rDisk %llx offline, regenerating Dx+P Disk %llx & %llx offline, regenerating Dx+Dy +Q singleDisk %llx offline, regenerating Dx%s old_state = %d, %d = %d, invalid new_state%s requires four or more chunksRAID 6RAM diskfictitiousrdattach: out of memoryrd%drdattach: device name too longhfsc_enqueue called on hfsc-less kernelhfsc_purge called on hfsc-less kernel%s: insufficient message buffers %s: %s htplevhotplug: event lost, queue full Not set. All breakpoints used. Already set. Too many breakpoints. No breakpoints set Count Address %5d the kernel did not panic Bad function Too many arguments Argument missing %-12sNo such command Ambiguous Bad modifier Count missing ddb> procscalloutpoolsmountsvnodesbufsallbcstatsbreaksextentsmallocobjectpagepanicpoolprocuvmexpvnodewatchescrashdumphaltrebootpoweroffmachineprintexaminesearchdeletebreakdwatchwatchstepcontinueuntilnextmatchtracecallpsshowboothelphangmandmesg.strtab[ %s symbol table has bad start address %p ] ELFbad e_machine.symtab[ using %lu bytes of %s ELF symbol table ] bad magicsymtab unalignedsymtab corrupted[ %s ELF symbol table not valid: %s ] ELFAddress missing Value missing : %*lx%*ld%*lu%*lo\%03o= 0x%lx %-*s%-*lx%-*ld%-*lu%-*loSymbol not found Syntax error Divide by 0 Negative shift amount () Score: %lu/%lu ^R Bad character in number Bad escape String too long Bad character Faulted in traceback, aborting... Starting stack trace... End of stack trace. -%#*lx-%*lx-%#*lo-%*lo-%#*lu-%*lu--db_more-- %-12s%s %s+%s [after %6d] [%s:%d]invalid symbol table nameSifting table %s: Unable to find symbol table slot for %s.No slots left for %s symbol table%s%s %s bsd[ no symbol table formats found ] After %d instructions Breakpoint at Stopped at RUN AT LEAST 'trace' AND 'ps' AND INCLUDE OUTPUT WHEN REPORTING THIS PANIC! DO NOT EVEN BOTHER REPORTING THIS WITHOUT INCLUDING THAT INFORMATION! Unknown variable No value radixmaxoffmaxwidthtabstopslineslogNo watchpoints set Address Size %8lx %lx All watchpoints used. Too many watchpoints. Unknown size %s = %s Nothing written. /mnt/etc/firmware/%swarning: no entropy supplied by boot loader RRIP without PX field? SPIEEE_1282IEEE_P1282RRIP_1991ARRIP with incorrect NM flags? RRIP with incorrect flags?isoinodefhtovp: lbn exceed volume space %d fhtovp: crosses block boundary %d fhtovp: bread error %d fhtovp: directory crosses block boundary %d[off=%d/len=%d] cd9660_vget: alien ino_t %lluCD001%/@%/C%/Ecd9660_mountroot: can't setup bdevvp'scd9660root_devicetag VT_ISOFS, isofs vnode cd9660_strategy: spec%s@%dOpenBSD#!/dev/fd/%d/dev/consolewarning: /dev/console does not exist warning: /dev/console error %d initexecinit: couldn't allocate argument spaceexec %s: error %d init: not found no initswapperfork initcfpendcannot mount rootcannot find root vnodepagedaemonfork pagedaemonreaperfork reapercleanerfork cleanerupdatefork updateaiodonedfork aiodonedscheduler/sbin/init/sbin/oinit/sbin/init.bakbqquiesbqqueuebqwaitbqdestbufq_init: type %i unknownbufq init failbqinitinitclocks: unable to register softclock intrfdlockfileplfdescpldup2: fdallockqreadkqueueplknoteplwaitinit died (signal %d, exit %d)thrdeathcpu_exit returnedprocessppwaitunable to allocate kthread_qWARNING: thread `%s' (%d) exits with status %d No KMEMSTATS compiled in %d,malloc(): allocation too large, type = %d, size = %lu malloc: allocation too large, type = %d, size = %lu malloc: out of space in kmem_mapphysiomawnusage: show all procs [/a] [/n] [/w] /a == show process address info /n == show normal process info [default] /w == show process wait/emul info PID %-10s %18s %18s %18s COMMANDSTRUCT PROC *UAREA *VMSPACE/VM_MAP PID %5s %5s %5s S %10s %-12s %-16s PPIDPGRPUIDFLAGSWAIT PID %-16s %-8s %18s %s EMULWAIT-CHANNELWAIT-MSG%c%5d %-10.10s %18p %18p %18p %5d %5d %5d %d %#10x %-12.12s %-16s %-16s %-8s %18p %s PROC (%s) pid=%d stat=%s flags process=%b proc=%b CONTROLTEXECINEXECEXITINGSUGIDSUGIDEXECPPWAITISPWAIT PROFIL TRACED WAITED COREDUMP SINGLEEXITSINGLEUNWINDNOZOMBIE8STOPPEDINKTRPROFPENDALRMPENDSIGSUSPENDSELECTSINTR SYSTEM TIMEOUTWEXITOWEUPCSUSPSINGLESYSTRACECONTINUEDTHREADSUSPSIGSOFTDEPCPUPEG pri=%u, usrpri=%u, nice=%d forw=%p, list=%p,%p process=%p user=%p, vmspace=%p estcpu=%u, cpticks=%d, pctcpu=%u.%u, swtime=%u user=%u, sys=%u, intr=%u chgproccnt: procs < 0procinit: mallocprocplprocessplzombieplucredplpgrpplsessionplpcredplidlezombiedeadonprocplimitplcpu_switchto returnedfork idleidle%dsensorssensorsensordevsuspendpausesigwaitusersystempid %d (%s): %s write of %lu@%p at %lld failed: %d /var/crash/%s%s.coreissignal sigaplhashinit: bad cnt%02hx%02hx%02hx%02hx%02hx%02hx%02hx%02hx%s:%s,sysctllksysctldlkthrsleep%s%s(%d)Timecounter "%s" frequency %lu Hz -- Insufficient hz, needs at least %u Time stepped from %lld.%09ld to %lld.%09ld dummynanosleepdenied attempt to set clock forward to %lld denied attempt to set clock back %lld seconds ?%9d %2td/%-4td %p %s ticks now: %d ticks wheel arg func boredunexpected %s wq state %dunable to create workq thread for "%s" wqdestroywqtaskssyswqunexpected %s tq state %dunable to create thread for "%s" taskq unexpected %s tq state %utqdestroysystqsmashed stack in %ssetrunnablepreempt: cpu_preempt not yet implementedfailing resume cannot be handled resume %s config_defer: can't defer config of a root deviceconfig_defer: can't allocate defer structureautoconfconfig_detach: forced detach of %s failed (%d)%s detached config_make_softcconfig_make_softc: allocation for device softc failed%s%dconfig_make_softc: device name too longexpandcreatconfig_make_softc: %sing dev arrayconfig_make_softc: duplicate %s>>> probing for %s* mapply: no match function for '%s' device>>> %s probe returned %d >>> %s probe won >>> no winning probe %s at root%s at %sroot device %s not configured not configured unsupported /dev/%s%s%ccannot obtain vnode for 0x%x/0x%xcannot open disk, 0x%x/0x%x, error %dcannot read disk label, 0x%x/0x%x, error %droot filesystem has size 0filesystem type %d not known.. assuming ffs use one of: exit %s[a-p]dkopendisklabels not read:root device (default %sswap device (default %s%s)root device (%s) not foundnetbootroot on %s%ccan't figure root, hope your kernel is right (%02hx%02hx%02hx%02hx%02hx%02hx%02hx%02hx.%c) swap on %s%d%c dump on %s%d%croot device (%02hx%02hx%02hx%02hx%02hx%02hx%02hx%02hx) not founddisk_unbusy: %s: dk_busy < 0 disk_detach: disk_count < 0dklkdisk_attach: can't allocate storage for disklabelwrit%s%d%c: %s %sing fsbn %lld%lld of %lld-%lld (%s%d bn %lld; cn %lld tn %lld sn %lld)%s: NULL extentextent `%s' (0x%lx - 0x%lx), flags=%b FLWANTEDWANTEDNOCOALESCEFIXED 0x%lx - 0x%lx extnt%s: start 0x%lx, end 0x%lx %s: region not foundextentplklog page %p, nmissing %d POOL %s: size %u, align %u, ioff %u, roflags 0x%08x alloc %p minitems %u, minpages %u, maxpages %u, npages %u itemsperpage %u, nitems %u, nout %u, hardlimit %u nget %lu, nfail %lu, nput %lu npagealloc %lu, npagefree %lu, hiwat %u, nidle %lu empty page list: full page list: partial-page list: no current page curpage %p pool(%p:%s): page inconsistency: page %p; at page head addr %p (p %p) pool(%p:%s): page inconsistency: page %p; item ordinal %d; addr %p (p %p) pool(%p:%s): page inconsistency: page %p; %d on list, %d missing, %d items per page pool(%p:%s): page inconsistency: page %p; %d on list, %d missing, %d expected usage: show all pools [/a] %-10s%4s%9s%5s%9s%6s%6s%6s%6s%6s%6s%5s SizeRequestsFailReleasesPgreqPgrelNpageHiwatMinpgMaxpgIdle%-12s %18s %18s Allocator%-12s %18p %18p inf %*u %*lu %*d %*s %*lu pool_put of NULLpool_do_put: %s: page header missingpool_do_get: %s: page emptypool_init: too much uptimephpooldma%d0123456789abcdef%llo%llx(null)0123456789ABCDEFbug in kprintf: bad base%s: table is full panic: splassert: %s: want %d have %d spl assertion failure in %skernel %sassertion "%s" failed: file "%s", line %d*FOUND**UNKNOWN*0%o0x%x%3d free slot (for add) %3d %s count %d disable (pseudo device) Unknown devno (max is %d) %3d at ??? %s flags 0x%x %s [] ? Unknown argument command args description [count] number of lines before moredev add a device8|10|16 base on large numbersdevno|dev change devices enter ddbattr val|devno|dev disable devicesattr val|devno|dev enable devicesdevno|dev find devices this message list configuration leave UKC[attr [val]] show attributes (or devices with an attribute)[mins [dst]] set timezone/dst toggle verbose booting don't know--- more --- Error unknown state already%3d can't enable free slot %3d %s disabled %3d can't disable free slot already Unknown routine /%c/ Value missing for attribute Unknown attribute change (y/n) ?out of memory. flags changed %3d can't change free slot count%3d %s changed Unknown pseudo routine /%c/ %s ? Not same device type No more space for new devices. Device not complete number or * is missing No device of this type exists. Clone Device (DevNo, 'q' or '?')Insert before Device (DevNo, 'q' or '?')Unknown command, try help Argument expected Dev expected 8|10|16 expected DevNo or Dev expected Attr, DevNo or Dev expected timezone = %d, dst = %d disautoconf verbose %sabled Unknown command User Kernel Config UKC> Continuing... addchangeddbdisableenablefindquittimezoneverbosepollselectpipeplpipelkpipeclpiperdpipewrttckoutqload: %d.%02d not a controlling terminal no foreground process group empty foreground process group runningrunnableiowait cmd: %s %d [%s] %lld.%02ldu %lld.%02lds %d%% %ldk ttyrub: would panic c = %d, val = %d mbuf %p m_type: %hi m_flags: %hb M_EXTM_PKTHDRM_EORM_CLUSTERM_PROTO1M_VLANTAGM_LOOPM_FILDROP M_BCAST M_MCAST M_CONF M_AUTH M_TUNNELM_ZEROIZEM_COMPM_LINK0m_next: %p m_nextpkt: %p m_data: %p m_len: %u m_dat: %p m_pktdat: %p m_ptkhdr.rcvif: %p m_pkthdr.len: %i m_ptkhdr.tags: %p m_pkthdr.tagsset: %hb IPSEC_IN_DONEIPSEC_OUT_DONEIPSEC_IN_CRYPTO_DONEIPSEC_OUT_CRYPTO_NEEDEDIPSEC_PENDING_TDBBRIDGEGIFGRE DLT PF_DIVERT PIPEX PF_REASSEMBLED SRCROUTETUNNELm_pkthdr.csum_flags: %hb IPV4_CSUM_OUTTCP_CSUM_OUTUDP_CSUM_OUTIPV4_CSUM_IN_OKIPV4_CSUM_IN_BADTCP_CSUM_IN_OKTCP_CSUM_IN_BADUDP_CSUM_IN_OK UDP_CSUM_IN_BAD ICMP_CSUM_OUT ICMP_CSUM_IN_OK ICMP_CSUM_IN_BADm_pkthdr.ether_vtag: %hu m_ptkhdr.rdomain: %u m_pkthdr.pf.hdr: %p m_pkthdr.pf.statekey: %p m_pkthdr.pf.inp %p m_pkthdr.pf.qid: %u m_pkthdr.pf.tag: %hu m_pkthdr.pf.flags: %hhb GENERATEDTRANSLATE_LOCALHOSTDIVERTEDDIVERTED_PACKETREROUTEREFRAGMENTEDPROCESSEDm_pkthdr.pf.routed: %hhu m_pkthdr.pf.prio: %hhu m_ext.ext_buf: %p m_ext.ext_size: %u m_ext.ext_type: %x m_ext.ext_backend: %i m_ext.ext_ifp: %p m_ext.ext_free: %p m_ext.ext_arg: %p m_ext.ext_nextref: %p m_ext.ext_prevref: %p m_copydata: off %d < 0m_copydata: len %d < 0m_copydata: short mbuf chainm_copydata: null mbufunknown type of extension bufferm_copym0: off %d, len %dm_copym0: short mbuf chainm_copym0: m == NULL and not COPYALLmbuf prepend length too bigmbplmtagplmcl%dkm_apply: len %d < 0m_apply: off %d < 0m_apply: null mbuf in skipm_apply: null mbufWARNING: mclpools limit reached; increase kern.maxclustersrequested tag size for pool %#x is too bigm == NULL in m_pulldown()unixsoaccept: !NOFDREFnetclssoclose: NOFDREFsockplsbcreatecontrol: message too large %d sbdropsbappendcontrolsemi-panic: sbcompressnetlcknetiosbappendaddrnetcon2netconacceptunp_disconnectunp_connect2unp_attachuipc 1uipc 2uipc 4piusrreqCurrent Buffer Cache status: numbufs %lld busymapped %lld, delwri %lld kvaslots %lld avail kva slots %lld bufpages %lld, dirtypages %lld pendingreads %lld, pendingwrites %lld bremfree: lost tailbiowaitbufplbiodone alreadyneedbuffernobuffersbuf_get: dup lblk vp %p bp %pgetblkbuf_needvabufinit: can't reserve VM for buffersnchplwtf? leak?vop_generic_revokeallnameilf_findoverlap: defaultlockfplrelookup: null namerelookup: lookup on dot-dot vp %p lblkno 0x%llx blkno 0x%llx dev 0x%x proc %p error %d flags %lb AGENEEDCOMMITASYNCBADBUSYCACHECALLDELWRI DONE EINTR ERROR INVAL NOCACHEPHYSRAWREADWANTEDWRITEINPROGXXX(FORMAT)DEFERREDSCANNEDDAEMONRELEASED bufsize 0x%lx bcount 0x%lx resid 0x%lx sync 0x%llx data %p saveaddr %p dep %p iodone %p dirty {off 0x%x end 0x%x} valid {off 0x%x end 0x%x} tag %s(%d) type %s(%d) mount %p typedata %p data %p usecount %d writecount %d holdcnt %d numoutput %d clean bufs: bp %p dirty bufs: flags %b vnodecovered %p syncer %p data %p RDONLYSYNCHRONOUSNOEXECNOSUIDNODEVASYNCEXRDONLY EXPORTED DEFEXPORTED EXPORTANON EXKERB LOCALQUOTAROOTFSvfsconf: ops %p name "%s" num %d ref %d flags 0x%x statvfs cache: bsize %x iosize %x blocks %llu free %llu avail %lld files %llu ffiles %llu favail %lld f_fsidx {0x%x, 0x%x} owner %u ctime 0x%llx syncwrites %llu asyncwrites = %llu syncreads %llu asyncreads = %llu fstype "%s" mnton "%s" mntfrom "%s" mntspec "%s" locked vnodes: %p, %pall vnodes: %p, %p,brelvp: NULLbgetvp: not freevflushbuf: not dirtyvflushbufvinvalbufvinvalbuf: dirty bufsvinvalbuf: flush failedvwakeup: neg numoutputsoftdep %d vclean: deadlockvclean: cannot reclaimvclean: not cleanvgonemissing aliasvgonel: not cleanmissing bdevvgetvfslockunmount of %s failed with error %d WARNING: some file systems would not unmount retrying syncing disks... giving up done kinfo: vp changed VNONVREGVDIRVBLKVCHRVLNKVSOCKVFIFOVBADNONUFSNFSMFSMSDOSFSPORTALPROCFSAFSISOFSADOSFSEXT2FSVFSNTFSUDFFUSEFSTMPFSsyncer vnode syncermount: lost mountunmount: dangling vnodevn_lockspec_badop calledspec_ioctltag VT_NON, dev %d, %d spec_close: not specialspec_fsync: not dirtyspec_fsyncspec_read typespec_write typechkvnlockdead_badop calleddead_write: lockdead_read: locktag VT_NON, dead vnode dos2unixtime(): month value out of range (%u) detrunc(): can't truncate root directory, clust %u, offset %u deextend: file too largedenodedeget(): pcbmap returned %d extendfile(): attempt to extend root directory extendfile: pcbmap. .. doscheckpath(): .. not a directory? msdosfs_sync: rofs modmsdosfs: reducing max cluster to %d from %d due to FAT size RRaArrAatag VT_MSDOSFS, startcluster %u, dircluster %u, diroffset %u (LOCKED) dev %d, %d, %s msdosfs_strategy: specmsdosfs_rename: lost to startdirmsdosfs_rename: lost from startdirmsdosfs_rename: updating .. in root directory?msdosfs_write(): bad file typebpfattachbpf_mcopybpf: ifpromisc failedbpf_detachd: descriptor not in listbpfifa_update_broadaddr does not support dynamic lengthegresstoo many interfacesifaddritem%s: can't handle af%d looutput: no header mbuflo%difmedia_add: can't malloc entryifmedia_set: no match for 0x%x/0x%x ifmedia_set failedcan't establish softnet handlerrtmaskrn_init: radix functions require max_keylen be set rn_initrn_init 2rn_addmask: mask impossibly already in tree rn_delete: inconsistent normal annotation rn_delete: inconsistent dupedkey list rn_delete: inconsistent annotation %s %p at %p rn_delete: Orphaned Maskrn_delete: couldn't find our annotation rn_addroute: t->rn_p is NULLMask for route not entered Non-unique normal route, mask not entered next == NULLraw_usrreqrt_timer_remove_all: rtq_count reached 0 rt_timer_add: rtq_count reached 0 ifafreertfreertfree 2rtfree: %p not freed (neg refs) rt_timer_init: already initializedrttmrplrtrequest deletertrequest1 RTM_RESOLVE: wrong ifa (%p) was (%p) rt_timer_timer: rtq_count reached 0 rt_timer_queue_destroy: rtq_count reached 0 rtinit: wrong ifa (%p) was (%p) rtentplroute_init rtable_addroute_outputrouteunexpected mode %uUnexpected mode %u%s: invalid channel freq %u flags %x %s: invalid channel (NULL) Bad IBSS channel %u%s: bad channel ignored; freq %u flags %x number %u Pairwise key expansionPMK Name%s: Michael MIC failure %s: station %s disassociated by peer (reason %d) %s: station %s deauthenticated by peer (reason %d) %s: %sassociation failed (status %d) for %s %s: received %s from %s rssi %d mode %s 80211scanfreeing bss nodenot in ap mode, mode %u%s: station %s purged from node cache %s: number of cached nodes is %d, expected %d,possible nodes leak unable to setup inital BSS node%s: no memory for AID bitmap! %s: no memory for TIM bitmap! -%s: tsft offset %s%llu %s: ieee80211_ibss_merge: bssid mismatch %s %s: my tsft %llu beacon tsft %llu %s: sync TSF with %s %s: rates mismatch, BSSID %s %s: sync BSSID %s -> (from %s) %s: creating ibss activepassive%s: end %s scan %s: begin %s scan invalid group data cipher!invalid integrity group cipher!management frame too large: %unull node%s: sending %s to %s on channel %u mode %s %s: no node for dst %s, discard raw tx frame %s: failed to queue raw tx frame %s: station %s deauthenticate (reason %d) %s: station %s disassociate (reason %d) %s: received msg %d/%d of the %s handshake from %s group key4-wayEAPOL-Key frame too large: %u%s: sending EAPOL-Key request to %s %s: sending msg %d/%d of the %s handshake to %s "0x%s: no recent beacons from %s; rescanning %s: bogus xmit rate %u setupassociatedsynchronized%s: %s with %s ssid .5 channel %d start %u%sMbshortlong protection enabled %s preamble %s slot time%s newly%s: station %s %s authenticated (open) %s: open authentication failed (reason %d) for %s assoc_reqassoc_respreassoc_reqreassoc_respprobe_reqprobe_respreserved#6reserved#7beaconatimdisassocauthdeauthactionaction_noackreserved#15INITSCANAUTHASSOCRUNauto11a11bturboaearazbgbhbnbrbybzcacncocrczdodzegf2fifofrgrgthkhnhrhuidiqisj1j2j3j4j5jmjojpk2kekpkrkwkzlblilvmcmkmomxmyninlnzpapkprqarusasgsisvtntrtttwuaukuyvnyezazwAPL1APL1AAPL1_ETSICAPL1_FCCAAPL1WAPL2APL2CAPL2DAPL2_ETSICAPL2WAPL3APL3WAPL4APL4WAPL5APL5WAPLDAPLDEBUGETSI1ETSI1WETSI2ETSI2WETSI3ETSI3AETSI3W,ETSI4ETSI4CETSI4WETSI5ETSI5WETSI6ETSI6WETSIAETSIBETSICETSIEU1WFCC1FCC1AFCC1WFCC2FCC2CFCC2AFCC2WFCC3FCC3AFCCAFRANCEMKK1MKK1_FCCAMKK1AMKK1A1MKK1A2MKK1BMKK2MKK2AMKKANONEWOR01WWOR02WWOR0WWOR1WWOR2WWOR3WWOR4WWOR5_ETSICWOR9WWORAWWORLD la_rt=%p la_hold_head=%p, la_asked=0x%lx [NULL][ ifa_addr= ifa_dsta= ifa_mask= flags=0x%x, refcnt=%d, metric=%d rtentry=%p flags=0x%x refcnt=%d use=%llu expire=%lld rtableid=%u key= mask= gw= ifp=%p (%s)(NULL) ifa=%p gwroute=%p llinfo=%p Route tree for AF_INET (not initialized) arptfreearp: ether address is broadcast for IP address %s! duplicate IP address %s sent from ethernet address %s arp: attempt to overwrite permanent entry for %s by %s on %s arp: attempt to overwrite entry for %s on %s by %s on %s arp info overwritten for %s by %s on %s arp: attempt to add entry for %s on %s by %s on %s arpresolve: %s: route without link local address arpresolve: %s: can't allocate llinfo arp_rtrequest: bad gateway value arp_rtrequest: malloc failed in_controlinvalid argument to in_lifaddr_ioctlIPv6 pcb passed into in_pcbconnectinpcbplin_pcbinit: hashinit failedin_pcbinit: hashinit failed for lportinterneticmp_do_exthdr: m_getptr failureicmp_redirect_timeout: bad route to timeouticmp_mtudisc_timeout: bad route to timeouticmp_erroricmp lenipqeplipqplip_initaeshmac-sha1deflaterip_attachrip_detachrip_usrreqsynpltcp_pulloutofbandm_pulldown malfunctiontcp_output REXMTtcp_outputtcpcbpltcpqepltcp_inittcp_usrrequdp_usrreqipip_input: should never reach herelibdes v 3.21 - 95/11/21 - eaycryptopcryptodesccrydevcuio_copyback: off %d < 0cuio_copyback: len %d < 0cuio_copyback: empty in skipuio_copyback: emptycuio_copydata: off %d < 0cuio_copydata: len %d < 0iov_copydata: empty in skipcuio_copydata: emptycuio_apply: len %d < 0cuio_apply: off %d < 0cuio_apply: ind %d >= uio_iovcnt %d for offcuio_apply: ind %d >= uio_iovcnt %d for lenSoftware crypto device cannot initialize!DES3DESBlowfishCAST-128Rijndael-128/AESAES-CTRAES-GCMAES-GMACAES-XTSARC4HMAC-MD5HMAC-SHA1HMAC-RIPEMD-160HMAC-SHA2-256HMAC-SHA2-384HMAC-SHA2-512GMAC-AES-128GMAC-AES-192GMAC-AES-256Keyed MD5Keyed SHA1MD5SHA1DeflateLZS1.2.3start = %d, len = %d, fs = %s ffs_alloccg: map corruptedbno = %lld, fs = %s ffs_alloccg: block not in mapffs_freefile: range: dev = 0x%x, ino = %d, fs = %sdev = 0x%x, ino = %u, fs = %s ffs_freefile: freeing free inodedev = 0x%x, bsize = %d, size = %ld, fs = %s ffs_blkfree: bad sizebad block %lld, ino %u uid %u on %s: %s bad blockdev = 0x%x, block = %lld, fs = %s ffs_blkfree: freeing free blockffs_blkfree: freeing free fragcg = %d, irotor = %d, fs = %s ffs_nodealloccg: map corruptedffs_nodealloccg: block not in mapffs_clusteralloc: lost blockmode = 0%o, inum = %u, fs = %s ffs_valloc: dup allocfree inode %s/%d had %lld blocks out of inodes %s: create/symlink failed, no inodes free dev = 0x%x, bsize = %d, bprev = %lld, fs = %s ffs_realloccg: bad bprevffs_realloccg: bad blocknodev = 0x%x, optim = %d, fs = %s ffs_realloccg: bad optimfile system full %s: write failed, file system is full ffs2_balloc: block too bigffs2_balloc: unwind failedffs1_balloc: blk too bigCould not unwind indirect block, error %dffs_indirtrunc: bad buffer sizeffs_truncate: newspaceffs_update: bad link cntsoftdep_flushfiles calledffsinodino1pldino2plffs_vget: alien ino_t %lluupdate: rofs modffs_statfsWARNING: %s was not properly unmounted WARNING: R/W mount of %s denied. Filesystem is not clean - run fsck ffs_mountfs(): obsolete rotational table format, please use fsck_ffs(8) -c 1 ffs_reload: dirty1ffs_reload: dirty2WARNING: soft updates isn't compiled in ffs_mountroot: can't setup bdevvp's ffsffs_fsync: not dirtyffs_fsyncffs_write: nonsync dir writeffs_write: typecheckpath: .. not a directory First bad Second bad %s: bad dir ino %u at offset %d: %s bad dirufs_direnter: newblkufs_direnter: compact1ufs_direnter: compact2mangled entryi_ffs_size too smallufs_strategy: specufs_rename: lost from startdirufs_rename: lost to startdirrename: EXDEVufs_rename: same fileufs_rename: lost dir entrychown: lost quotaifree: range: dev = 0x%x, ino = %d, fs = %sdev = 0x%x, ino = %d, fs = %s ifree: freeing free inodebad block %d, ino %u dev = 0x%x, block = %d, fs = %s mode = 0%o, nlinks %u, inum = %u, fs = %s ext2fs_valloc: dup allocext2fs_alloccg: map corruptedext2fs_mapsearch: block not in mapcg = %d, ipref = %d, fs = %s ext2fs_nodealloccg: map corruptedext2fs_nodealloccg: block not in mapext2fs_indirtrunc: bad buffer sizecheckpathrec_len is smaller than minimalrec_len % 4 != 0reclen is too small for name_lendirectory entry across blocksinode out of boundsbad directory entry: %s offset=%d, inode=%lu, rec_len=%d, name_len=%d ext2fs_dirbadentryi_size too smallext2fs_direnter: newblkext2fs_direnter: frag size%s: nonsync dir writeext2fs_write%s: typeext2fs_vget: alien ino_t %lluExt2 fs: unsupported first inode positionExt2 fs: unsupported optional feature ext2fs_statfsext2fs_reload: dirty1ext2fs_reload: dirty2%s: file system not clean; please fsck(8) ext2fs_mountroot: can't setup bdevvp'sext2fsext2inoplext2dinoplext2fs_mkdir: blksizeext2fs_rename: lost from startdirext2fs_rename: lost to startdirrename: linked directoryext2fs_rename: lost dir entryext2fs_rename: mangled dir- uvm_addr %s: NULL - uvm_addr %s: %p (%s 0x%lx-0x%lx) entry %p: 0x%lx-0x%lx G=0x%lx F=0x%lx free: 0x%lx-0x%lx start=0x%lx, expected at least 0x%lx 0x%lu entries, 0x%lx free bytes pivot 0x%lx, epires in %d, direction %d empty 0x%lx - 0x%lx free (0x%lx bytes) contains pivot %d (0x%lx) %s: entry was not in tree%s: duplicate insertion: state %p inserting entry %p which collides with %p%s: duplicate insertion: state %p interting %p, colliding with %puvm_addr_invoke: address selector %p (%s 0x%lx-0x%lx) returned unavailable address 0x%lxuaddruaddrhintuaddrbestuaddrpivotuaddrrnduaddr_linuaddr_rnduaddr_hintuaddr_kbootstrapuaddr_bestfituaddr_pivotuaddr_stckbrkamap_unadd: offset out of rangeamap_unadd: nothing thereamap_lookup: offset out of rangeamap_add: offset out of rangeamap_add: replacing null anonamap_add: slot in useamap_lookups: offset out of rangeamap_splitref: split at zero offsetamap_splitref: map size check failedamap_cow_now: non-resident wired page in anon %pcownowcownowpageamap_wipeout: corrupt amapamapplamap_pp_adjref: overshot targetamap_pp_adjref: negative reference countanonpluao_set_swslot: uobj = %p uao_set_swslot: attempt to set a slot on a NOSWAP objectuao_flush: strange, got an out of range flush (fixed) uaoflshuao_flush: weird flagsuao_detuaoeltplaobjpluao_create: kernel object already allocateduao_create: asked to enable swap on kernel objectuao_create: hashinit swhash faileduao_create: malloc swslots faileduao_getpageuao_getudv_faultudv_detachudv_attachuvm_fault_unwire_locked: address not in mapanonget1anonget2flt_noram1fltamapcopyflt_noram2flt_noram3flt_pmfail1fltagain2flt_noram4flt_noram5flt_pmfail2uvm_init: page size not setkm_free: unmanaged page 0x%lx km_allocvakmallockmthreadvallocwaitkm_alloc1wkm_pgrmuvm_km_suballoc: unable to allocate space in parent mapuvm_km_suballoc: unable to create submapuvm_km_suballoc: submap allocation faileduvm_km_init: could not reserve space for kerneluvm_km_pgremove_intrsafe: no pageuvm_map_clean: weird flagsuvm_mapent_addr_removeuvm_mapent_addr_insert: entry still in addr listuvm_mapent_addr_insert: map %p entry %p (0x%lx-0x%lx G=0x%lx F=0x%lx) insert collision with entry %p (0x%lx-0x%lx G=0x%lx F=0x%lx)OBJECT %p: pgops=%p, npages=%d, refs= refs=%d PAGES : <%p,0x%llx> PAGE %p: flags=%b, vers=%d, wire_count=%d, pa=0x%llx uobject=%p, uanon=%p, offset=0x%llx loan_count=%d [page ownership tracking disabled] vm_page_md %p >>> ANON DOES NOT POINT HERE <<< (%p) anon backpointer is OK checking object list page found on object list >>> PAGE NOT FOUND ON OBJECT LIST! <<< page found in uvm_pmemrange >>> page not found in uvm_pmemrange <<< checking pageq list page found on pageq list >>> PAGE NOT FOUND ON PAGEQ LIST! <<< MAP %p: [0x%lx->0x%lx] brk() allocate range: 0x%lx-0x%lx stack allocate range: 0x%lx-0x%lx sz=%u, ref=%d, version=%u, flags=0x%x pmap=%p(resident=%d) vm_refcnt=%d vm_shm=%p vm_rssize=%u vm_swrss=%u vm_tsize=%u vm_dsize=%u vm_taddr=%p vm_daddr=%p vm_maxsaddr=%p vm_minsaddr=%p - %p: 0x%lx->0x%lx: obj=%p/0x%llx, amap=%p/%d submap=%c, cow=%c, nc=%c, prot(max)=%d/%d, inh=%d, wc=%d, adv=%d hole=%c, free=%c, guard=0x%lx, free=0x%lx-0x%lx fspace_augment=%lu freemapped=%c, uaddr=%p (0x%lx-0x%lx %s) any[%d]brk/stackvmspplvmmpeplvmmpekpluvm_map_splitentry: split address 0x%lx not on page boundary!uvm_mapent_alloc: cannot allocate map entryuvm_mapent_alloc: out of static map entries vmmaplkuvm_map_setup: rw_enter failed on new mapuvmspace_fork: no space in map for entry in empty mapfork: encountered a submap during fork (illegal)fork: non-copy_on_write map entry marked needs_copy (illegal)uvm_map_teardown: rw_enter failed on free mapuvm_page_physget: called _after_ bootstrapuvm_page_physget: out of memory!uvm_setpagesize: page size not a power of twouvm_pglistallocuvm_pglistalloc: Upper boundary 0x%lx not on pagemask. uvm_page_physdump: physical memory config [segs=%d of %d]: 0x%llx->0x%llx [0x%llx->0x%llx] STRATEGY = RANDOM uvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX uvm_page_physload: can not malloc vm_page structs for segment ignoring 0x%lx -> 0x%lx uvm_page_physload: tried to add RAM after vm_mem_inituvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: pmap_growkernel() faileduvm_pageboot_alloc: out of memoryuvm_page_bootstrap: no memory pre-allocateduvm_page_init: lost %ld page(s) in initsize 0 uvm_pagereallocpagersegpgdaemonuvm_wait emergency bufbackoff pagedaemon: deadlock detected! Ranges, use queue: * [0x%lx-0x%lx] use=%d nsegs=%ld maxsegsz[%d]=0x%lx free=0x%lx #ranges = %d pagedaemon: wait_pla deadlock detected! pmrwaituvm_wait: failed to free %ld pages between 0x%lx-0x%lx uvm_pmr_split: lost one pmr Flags: 0x%x, will panic now. Current UVM status: pagesize=%d (0x%x), pagemask=0x%x, pageshift=%d %d VM pages: %d active, %d inactive, %d wired, %d free min %d%% (%d) anon, %d%% (%d) vnode, %d%% (%d) vtext pages %d anon, %d vnode, %d vtext freemin=%d, free-target=%d, inactive-target=%d, wired-max=%d faults=%d, traps=%d, intrs=%d, ctxswitch=%d fpuswitch=%d softint=%d, syscalls=%d, kmapent=%d fault counts: noram=%d, noanon=%d, pgwait=%d, pgrele=%d ok relocks(total)=%d(%d), anget(retries)=%d(%d), amapcopy=%d neighbor anon/obj pg=%d/%d, gets(lock/unlock)=%d/%d cases: anon=%d, anoncow=%d, obj=%d, prcopy=%d, przero=%d daemon and swap counts: woke=%d, revs=%d, scans=%d, obscans=%d, anscans=%d busy=%d, freed=%d, reactivate=%d, deactivate=%d pageouts=%d, pending=%d, nswget=%d nswapdev=%d, nanon=%d, nanonneeded=%d nfreeanon=%d swpages=%d, swpginuse=%d, swpgonly=%d paging=%d kernel pointers: objs(kern)=%p warning: resource shortage: %d pages of swap lost swapdrum_addsw_reg_strategy: swap to sparse fileswstrategy: vnode type 0x%xswap_off: swapdev not in listswap0x%04xdisklabel reserve/dev/%s%d%cblkdev0x%xswapctl: copystruvm_swap_init: can't get vnode for swap deviceswapmapuvm_swap_init: extent_create failedswp vnxswp vndswplkuvm_coredump: user process with submap?sbrk: grow %ld failed, error = %d uvm_deallocate with null mapuvn_iosyncuvn_getpageuvn_getuvn_cluster: offset out of rangeuvn_flshuvn_flush: obj=%p, offset=0x%llx. error during pageout. uvn_flush: WARNING: changes to page may be lost! uvn_flushuvn_termuvm_vnp_terminate: io sync wanted bit setuvn_attachuvnsyncNULL pointer passed to ip_ecn_egressNULL pointer passed to ip_ecn_ingressin6_prefixlen2mask: invalid prefix length(%d) in6_are_prefix_equal: invalid prefix length(%d) in6_unlink_ifa: interface address %s has no prefix ADDDELETEin6_ifloop_request: %s operation failed for %s (errno=%d) in6_purgeaddr: failed to remove a route to the p2p destination: %s on %s, errno=%d in6_update_ifa: a destination can be specified for a p2p or a loopback IF only in6_update_ifa: prefixlen should be 128 when dstaddr is specified in6_update_ifa: valid lifetime is 0 for %s in6_update_ifa: the prefix length of an existing (%s) address should not be changed in6_update_ifa: failed to remove a route to the old destination: %s in6_update_ifa: addmulti failed for %s on %s (errno=%d) prefix ioctls are now invalidated. please use ifconfig. nd6_prelist_add succeeded but no prefix invalid argument to in6_lifaddr_ioctlin6_ifawithscope: output interface is not specified in6_ifattach_loopback: failed to configure the loopback address on %s (errno=%d) %s: got interface identifier from itself %s: borrow interface identifier from %s %s: interface identifier generated by random number %s: failed to get interface identifier %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x %s: no ifid available in6_ifattach_linklocal: failed to configure a link-local address on %s (errno=%d) in6_ifattach: %s has too small MTU, IPv6 not enabled in6_ifattach: %s is not multicast capable, IPv6 not enabled in6_cksum: mbuf len (%d) < off+len (%d+%d)in6_cksum: out of datainternet6icmp6_redirect_timeout: bad route to timeouticmp6_mtudisc_timeout: bad route to timeout(src=%s dst=%s tgt=%s)ICMP6 redirect sent from %s rejected; must be from linklocal ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) ICMP6 redirect rejected; redirect dst must be unicast: %s ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s ICMP6 redirect rejected; no route found for redirect dst: %s ICMP6 redirect rejected; neither router case nor onlink case: %s icmp6_redirect_input: invalid ND option, rejected: %s icmp6_redirect_input: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s icmp6_notify_error: in6_embedscope failed sanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d ../../../../netinet6/icmp6.cicmp6_reflect: source can't be determined: dst=%s, error=%d ICMP6 checksum error(%d|%x) %s icmp6_input: unknown type %d(src=%s, dst=%s, ifid=%d) ENOBUFS in icmp6_error %d icmp6_mtudisc_callback_registerip6_nexthdr: m == NULLip6_input: packet to an unready address %s->%s ip6_initcannot forward from %s to %s nxt %d received on %s cannot forward src %s, dst %s, nxt %d, rcvif %s, outif %s assumption failed: hdr not splitscope error in prefix list (%s) ndopts == NULL in nd6_optionuninitialized ndopts in nd6_optionndopts == NULL in nd6_optionsuninitialized ndopts in nd6_optionsduplicated ND6 option found (type=%d) nd6_options: unsupported option %d - option ignored too many loop in nd opt unspecnd6_lookup: failed to lookup %s (if = %s) nd6_output: can't allocate llinfo for %s (ln=%p, rt=%p) nd6_setmtu0: new link MTU on %s (%lu) is too small for IPv6 nd6_init called more than once(ignored) ln->ln_rt == NULLln->ln_rt->rt_ifp == NULLrt_llinfo(%p) is not equal to ln(%p)dst=0 in nd6_timer(ln=%p)nd6_storelladdr: something odd happens nd6_storelladdr: sdl_alen == 0, dst=%s, if=%s ifp == NULL in nd6_cache_lladdrfrom == NULL in nd6_cache_lladdrndp info overwritten for %s by %s on %s nd6_rtrequest: bad gateway value: %s nd6_rtrequest: malloc failed %s: failed to join %s (errno=%d) nd6_dad_duplicated: DAD structure not found %s: DAD detected duplicate IPv6 address %s: NS in/out=%d/%d, NA in=%d %s: DAD complete for %s - duplicate found %s: manual intervention required ifa == NULL in nd6_dad_na_inputifa == NULL in nd6_dad_ns_inputnd6_na_output: source can't be determined: dst=%s, error=%d nd6_ns_output: source can't be determined: dst=%s, error=%d nd6_dad_timer: called with null parameter nd6_dad_timer: DAD structure not found ???nd6_dad_timer: called with duplicated address %s(%s) nd6_dad_timer: called with non-tentative address %s(%s) %s: could not run DAD, driver problem? %s: DAD complete for %s - no duplicates found nd6_dad_start: called with non-tentative address %s(%s) nd6_dad_start: ifa->ifa_ifp == NULLnd6_dad_start: memory allocation failed for %s(%s) %s: starting DAD for %s nd6_ns_input: invalid hlim (%d) from %s to %s on %s nd6_ns_input: bad DAD packet (wrong ip6 dst) nd6_ns_input: NS packet from non-neighbor nd6_ns_input: bad NS target (multicast) nd6_ns_input: invalid ND option, ignored nd6_ns_input: bad DAD packet (link-layer address option) nd6_ns_input: lladdrlen mismatch for %s (if %d, NS packet %d) nd6_ns_input: duplicate IP6 address %s nd6_ns_input: src=%s nd6_ns_input: dst=%s nd6_ns_input: tgt=%s nd6_na_input: invalid hlim (%d) from %s to %s on %s nd6_na_input: invalid target address %s nd6_na_input: a solicited adv is multicasted nd6_na_input: invalid ND option, ignored nd6_na_input: multicast adv without TLLA nd6_na_input: duplicate IP6 address %s nd6_na_input: ND packet from non-neighbor nd6_na_input: lladdrlen mismatch for %s (if %d, NA packet %d) in6_init_prefix_ltimes: preferred lifetime(%d) is greater than valid lifetime(%d) in6_ifadd: wrong prefixlen for %s (prefix=%d ifid=%d) in6_ifadd: failed to make ifaddr %s on %s (errno=%d) nd6_prefix_onlink: %s/%d is already on-link nd6_prefix_onlink: failed to find any ifaddr to add route for a prefix(%s/%d) on %s nd6_prefix_onlink: failed to add route for a prefix (%s/%d) on %s, gw=%s, mask=%s, flags=%lx errno = %d nd6_prefix_offlink: %s/%d is already off-link nd6_prefix_offlink: failed to recover a prefix %s/%d from %s to %s (errno = %d) nd6_prefix_offlink: failed to delete route: %s/%d on %s (errno = %d) pfxlist_onlink_check: failed to make %s/%d offlink, errno=%d prelist_remove: failed to make %s/%d offlink on %s, errno=%d prelist_remove: negative count on %s nd6_prelist_add: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_update: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_update: nd6_prelist_add failed for %s/%d on %s errno=%d, returnpr=%p defrouter_select: called unexpectedly (forwarding=%d, accept_rtadv=%d) defrouter_select: more than one router is installed defrtrlist_del: negative count on %s nd6_ra_input: invalid hlim (%d) from %s to %s on %s nd6_ra_input: src %s is not link-local nd6_ra_input: invalid ND option, ignored nd6_ra_input: invalid option len %d for prefix information option, ignored nd6_ra_input: invalid prefix len %d for prefix information option, ignored nd6_ra_input: invalid prefix %s, ignored nd6_ra_input: invalid prefixlen %d for rfc2374 prefix %s, ignored nd6_ra_input: bogus mtu option mtu=%lu sent from %s, ignoring nd6_ra_input: bogus mtu mtu=%lu sent from %s; exceeds maxmtu %lu, ignoring nd6_ra_input: lladdrlen mismatch for %s (if %d, RA packet %d) nd6_rs_input: invalid hlim (%d) from %s to %s on %s nd6_rs_input: invalid ND option, ignored nd6_rs_input: lladdrlen mismatch for %s (if %d, RS packet %d) rip6_attachrip6_detachrip6_usrreq invalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchincorrect data checkincorrect length checkneed dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versiondb_fetch_reg: botchaddress %p is invalid branch_taken: botch address 0x%08lx not a valid page Faulted in DDB; continuing... spsrr0r1r2r3r4r5r6r7r8r9r10r11r12usr_spusr_lrsvc_spsvc_lrpcund_spabt_spirq_spframetrace: pid %d not found at %p scp=0x%08x rlv=0x%08x () rsp=0x%08x rfp=0x%08x%sr%d=0x%08xBad frame pointer: %p Bad user frame pointer: %p frame address must be specified frame address = %08x r0 =%08x r1 =%08x r2 =%08x r3 =%08x r4 =%08x r5 =%08x r6 =%08x r7 =%08x r8 =%08x r9 =%08x r10=%08x r11=%08x r12=%08x r13=%08x r14=%08x r15=%08x slr=%08x mainbuscpu, rrx, %s r%d, %s #%d#0x%08x[r%d][r%d%s, #0x%03x#0x%02x{r%d-r%d}^f%d#%s0x%08xcpsr_p%df%d, c%d, c%d, c%d, c%d, %dr%d, c%d, c%d, %d[%c - unknown]und%s %08x imbimbrangeswiblxblmulSnmsmlaSnmsdumullSdnmssmullumlalsmlalstrtdaWldrtstrbtldrbtdsbisbstrldrstrbldrbstmYnWlldmXnWlldrsbldrhstrhldrshswpdmoswpbmrsdpnopyieldwfewfisevdbgmsrpFmpF2bxclzdmbkptSdn2eorsubrsbadcsbcrsctstDn2teqcmpcmnorrmovSd2bicmvnadfPRfghmufsufrsfdvfrdfpowrpwrmffmlfdvfrdpolfpbopmvfPRfhmnfrndsqtlgnexpsincostanasnacsatnfpuopstfQLvldffltPRgdfixPRdhwfsrfswfcrfccmfPRghcnfcmfecnfemcr2#zmcrmrc2mrccdp2#ycdpldc2L#vldcstc2stcNo support for this CPU type (%08x) in kernelUndefined instruction in kernel real mem = %u (%uMB) avail mem = %lu (%uMB) Warning IRQ's disabled during boot() WARNING: not updating battery clock _bus_dmamap_load_raw: not implemented_bus_dmamem_map: size botch_bus_dmamap_sync: mix PRE and POST%s: curaddr %#lx not in range_bus_dmamap_sync: ARM32_BUFTYPE_INVALIDunknown buffer type %d _bus_dmamap_syncProcessor failed probe - no CPU ID %s %s (%s core)%s: IDC disabled IDC enabled DC disabled DC enabled IC disabled IC enabled WB disabled WB enabled LABT EABT branch prediction enabled%s: %dKB/%dB %d-way %s unified cache %s: %dKB(%db/l,%dway) I-cache, %dKB(%db/l,%dway) %s D-cache %s: %s does not fully support this CPU. %s: This kernel does not fully support this CPU. %s: Recompile with "options %s" to correct this. unknown CPU (ID = 0x%x)ARM810ARM920TARM922TARM926EJ-SARM940TARM946E-SARM966E-STI ARM925TARM1020EARM1022E-SSA-110SA-1100SA-1110IXP1200i80200i80321 400MHzi80321 600MHzi80219 400MHzi80219 600MHzPXA250PXA210PXA27xIXP425 533MHzIXP425 400MHzIXP425 266MHzARM1136J-SARM1136J-S R1ARM Cortex A5ARM Cortex A7ARM Cortex A8ARM Cortex A8 R1ARM Cortex A8 R2ARM Cortex A8 R3ARM Cortex A9ARM Cortex A9 R1ARM Cortex A9 R2ARM Cortex A9 R3ARM Cortex A9 R4ARM Cortex A15ARM Cortex A15 R1ARM Cortex A15 R2ARM Cortex A15 R3ARM Cortex A15 R4CPU_ARM8ARM9TDMIARM9E-SCPU_ARM9EARM9EJ-SARM10ECPU_ARM10SA-1CPU_SA1100XScaleCPU_XSCALE_...ARM11JCPU_ARM11CPU_ARMv7wr-thruwr-back**unknown 3****unknown 4**wr-back-lockwr-back-lock-Awr-back-lock-B**unknown 8****unknown 9****unknown 10****unknown 11****unknown 12****unknown 13****unknown 14****unknown 15**rev 0rev 1rev 2rev 3rev 4rev 5rev 6rev 7rev 8rev 9rev 10rev 11rev 12rev 13rev 14rev 15step Jstep Kstep Sstep Tstep Bstep Cstep Dstep Erev 10step Gstep A-0step B-0step B-1step B-2step B-3step B-4step B-5(IXP1200 step A)(IXP1200 step B)(IXP1200 step C)(IXP1200 step D)(IXP1240/1250 step A)(IXP1240 step B)(IXP1250 step B)step A-1step C-0step D-0step ?step C-5step 0badaddr: invalid size (%lu)kernelFatal %s mode data abort: '%s' trapframe: %p DFSR=%08x, DFAR=%08x (imprecise), spsr=%08x Fatal %s mode prefetch abort at 0x%08x trapframe: %p IFSR=%08x, IFAR=%08x, spsr=%08x r0 =%08x, r1 =%08x, r2 =%08x, r3 =%08x r4 =%08x, r5 =%08x, r6 =%08x, r7 =%08x r8 =%08x, r9 =%08x, r10=%08x, r11=%08x r12=%08x, usp=%08x, ulr=%08xssp=%08x, slr=%08x, pc =%08x Fatal abortUVM: pid %d (%s), uid %d killed: out of swap data_abort_fault: Misaligned Kernel-mode Program Counter Non-emulated page fault with intr_depth > 0 uvm_fault(%p, %lx, %x, 0) -> %x Vector ExceptionAlignment Fault 1Terminal ExceptionAlignment Fault 3External Linefetch Abort (S)Translation Fault (S)External Linefetch Abort (P)Translation Fault (P)External Non-Linefetch Abort (S)Domain Fault (S)External Non-Linefetch Abort (P)Domain Fault (P)External Translation Abort (L1)Permission Fault (S)External Translation Abort (L2)Permission Fault (P)mmrwpmap_map_chunk: no L1 table providedpmap_map_chunk: no L2 table for VA 0x%08lxpmap_map_chunk: can't find L2 table for VA0x%08lxpmap_alloc_specials: no l2b for 0x%lxpmap_bootstrap: No L2 for L2 @ va %ppmap_init_l1: can't get PA of L1 at %ppmap_bootstrap: No L2 for va 0x%x, pa 0x%lxpmap_bootstrap: out of static L2spmap_bootstrap: WARNING! wrong cache mode for L2 pte @ %p pmap_bootstrap: WARNING! wrong cache mode for primary L1 @ 0x%lx pmapplpvepll2dtblpll2ptpplxscale_setup_minidata: can't find L2 table for VA 0x%08lxpmap_map_entry: no L2 table for VA 0x%08lxpmap_map_entry: can't find L2 table for VA 0x%08lxCannot allocate L1 KVMCannot allocate L1 physical pagespmap_enter: failed to allocate L2 bucketpmap_enter: no pv entries dump to dev %u,%u not possible dumping to dev %u,%u offset %ld dump area unavailable device bad device not ready area improper i/o error aborted from console succeeded vunmapbufvmapbufcan't init serial console @%lxunknown option `%c' cpu not recognized! OpenBSD/armish booting ... initarm: Configuring system ... physmemory: %d pages at 0x%08lx -> 0x%08lx initarm: out of memoryinitarm: Failed to align the kernel page directoryWARNING: powerdown failed! The operating system has halted. Please press any key to reboot. rebooting... boot device: lookup '%s' failed. boot device: %s cdDiagnostic Failure on Component 0x%02xTagged Overlapped Commands (0x%02x = TASK TAG)Decompression Exception Short Algorithm ID OF 0x%02xASC 0x%02x ASCQ 0x%02xCDBParametersError in %s, Offset %d, bit %dActual Retry Count: %dProgress Indicator: %dprobe%s(%s:%d:%d): %sCheck Condition (error %#x) on opcode 0x%x AT BLOCK #: %d (decimal) SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO: 0x%x (VALID flag %s) COMMAND INFO: 0x%x ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s DEFERRED scbusyunknown error category (0x%x) from scsi driver scsi_done called twice on xs(%p)unexpected xsh state %usyncxspendxsscsiiomvscsi_xfer pool exhausted! scxsplscsiplugscsi_cmd_rw_decode: bad opcode 0x%02xNo Additional SenseSoft ErrorNot ReadyMedia ErrorHardware ErrorIllegal RequestUnit AttentionWrite ProtectedBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare ErrorNo Additional Sense InformationFilemark DetectedEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnCleaning RequestedErase Operation In ProgressLocate Operation In ProgressRewind Operation In ProgressSet Capacity Operation In ProgressVerify Operation In ProgressNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Not Ready, Rebuild In ProgressLogical Unit Not Ready, Recalculation In ProgressLogical Unit Not Ready, Operation In ProgressLogical Unit Not Ready, Long Write In ProgressLogical Unit Not Ready, Self-Test In ProgressLogical Unit Not Accessible, Asymmetric Access State TransitionLogical Unit Not Accessible, Target Port In Standby StateLogical Unit Not Accessible, Target Port In Unavailable StateLogical Unit Not Ready, Structure Check RequiredLogical Unit Not Ready, Auxiliary Memory Not AccessibleLogical Unit Not Ready, Notify (Enable Spinup) RequiredLogical Unit Not Ready, OfflineLogical Unit Not Ready, SA Creation In ProgressLogical Unit Not Ready, Space Allocation In ProgressLogical Unit Not Ready, Robotics DisabledLogical Unit Not Ready, Configuration RequiredLogical Unit Not Ready, Calibration RequiredLogical Unit Not Ready, A Door Is OpenLogical Unit Not Ready, Operating In Sequential ModeLogical Unit Not Ready, Start Stop Unit Command In ProgressLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorLogical Unit Communication CRC Error (ULTRA-DMA/32)Unreachable Copy TargetTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureHead Select FaultError Log OverflowWarningWarning - Specified Temperature ExceededWarning - Enclosure DegradedWarning - Background Self-Test FailedWarning - Background Pre-Scan Detected Medium ErrorWarning - Background Medium Scan Detected Medium ErrorWarning - Non-Volatile Cache Now VolatileWarning - Degraded Power To Non-Volatile CacheWarning - Power Loss ExpectedWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedWrite Error - Recommend ReassignmentCompression Check Miscompare ErrorData Expansion Occurred During CompressionBlock Not CompressibleWrite Error - Recovery NeededWrite Error - Recovery FailedWrite Error - Loss Of StreamingWrite Error - Padding Blocks AddedAuxiliary Memory Write ErrorWrite Error - Unexpected Unsolicited DataWrite Error - Not Enough Unsolicited DataDefects In Error WindowError Detected By Third Party Temporary InitiatorThird Party Device FailureCopy Target Device Not ReachableIncorrect Copy Target Device TypeCopy Target Device Data UnderrunCopy Target Device Data OverrunInvalid Information UnitInformation Unit Too ShortInformation Unit Too LongID CRC Or ECC ErrorLogical Block Guard Check FailedLogical Block Application Tag Check FailedLogical Block Reference Tag Check FailedLogical Block Protection Error On Recover Buffered DataLogical Block Protection Method ErrorUnrecovered Read ErrorRead Retries ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block ReadNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite The DataDe-Compression CRC ErrorCannot Decompress Using Declared AlgorithmError Reading UPC/EAN NumberError Reading ISRC NumberRead Error - Loss Of StreamingAuxiliary Memory Read ErrorRead Error - Failed Retransmission RequestRead Error - LBA Marked Bad By Application ClientAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRecord Not Found - Recommend ReassignmentRecord Not Found - Data Auto-ReallocatedLocate Operation FailureRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorData Sync Error - Data RewrittenData Sync Error - Recommend RewriteData Sync Error - Data Auto-ReallocatedData Sync Error - Recommend ReassignmentRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data Without ECC - Data RewrittenRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With L-ECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteRecovered Data With ECC - Data RewrittenRecovered Data With LinkingDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationMiscompare Verify Of Unmapped LbaRecovered ID with ECCPartial Defect List TransferInvalid Command Operation CodeAccess Denied - Initiator Pending-EnrolledAccess Denied - No Access rightsAccess Denied - Invalid Mgmt ID KeyIllegal Command While In Write Capable StateObsoleteIllegal Command While In Explicit Address ModeIllegal Command While In Implicit Address ModeAccess Denied - Enrollment ConflictAccess Denied - Invalid LU IdentifierAccess Denied - Invalid Proxy TokenAccess Denied - ACL LUN ConflictIllegal Command When Not In Append-Only ModeLogical Block Address Out of RangeInvalid Element AddressInvalid Address For WriteInvalid Write Crossing Layer JumpIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBCDB Decryption ErrorSecurity Audit Value FrozenSecurity Working Key FrozenNonce Not UniqueNonce Timestamp Out Of RangeInvalid XCDBLogical Unit Not SupportedInvalid Field In Parameter ListThreshold Parameters Not SupportedInvalid Release Of Persistent ReservationData Decryption ErrorToo Many Target DescriptorsUnsupported Target Descriptor Type CodeToo Many Segment DescriptorsUnsupported Segment Descriptor Type CodeUnexpected Inexact SegmentInline Data Length ExceededInvalid Operation For Copy Source Or DestinationCopy Segment Granularity ViolationInvalid Parameter While Port Is EnabledInvalid Data-Out Buffer Integrity Check ValueData Decryption Key Fail Limit ReachedIncomplete Key-Associated Data SetVendor Specific Key Reference Not FoundHardware Write ProtectedLogical Unit Software Write ProtectedAssociated Write ProtectPersistent Write ProtectPermanent Write ProtectConditional Write ProtectSpace Allocation Failed Write ProtectNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedFormat-Layer May Have ChangedImport/Export Element Accessed, Medium ChangedPower On, Reset, or Bus Device Reset OccurredPower On OccurredSCSI Bus Reset OccurredBus Device Reset Function OccurredDevice Internal ResetTransceiver Mode Changed to Single EndedTransceiver Mode Changed to LVDI_T Nexus Loss OccurredMode Parameters ChangedLog Parameters ChangedReservations PreemptedReservations ReleasedRegistrations PreemptedAsymmetric Access State ChangedImplicit Asymmetric Access State Transition FailedPriority ChangedCapacity Data Has ChangedError History I_T Nexus ClearedError History Snapshot ReleasedError Recovery Attributes Have ChangedData Encryption Capabilities ChangedTimestamp ChangedData Encryption Parameters Changed By Another I_T NexusData Encryption Parameters Changed By Vendor Specific EventData Encryption Key Instance Counter Has ChangedSA Creation Capabilities Data Has ChangedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedCurrent Program Area Is Not EmptyCurrent Program Area Is EmptyIllegal Power Condition RequestPersistent Prevent ConflictPrevious Busy StatusPrevious Task Set Full StatusPrevious Reservation Conflict StatusPartition Or Collection Contains User ObjectsNot ReservedORWrite Generation Does Not MatchOverwrite Error On Update In PlaceInsufficient Time For OperationCommands Cleared By Another InitiatorCommands Cleared By Power Loss NotificationCommands Cleared By Device ServerIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledCannot Write Medium - Unknown FormatCannot Write Medium - Incompatible FormatCannot Format Medium - Incompatible MediumCleaning FailureCannot Write - Application Code MismatchCurrent Session Not Fixated For AppendCleaning Request RejectedMedium Not FormattedIncompatible Volume TypeIncompatible Volume QualifierCleaning Volume ExpiredMedium Format CorruptedFormat Command FailedZoned Formatting Failed Due To Spare LinkingNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorEnclosure FailureEnclosure Services FailureUnsupported Enclosure FunctionEnclosure Services UnavailableEnclosure Services Transfer FailureEnclosure Services Transfer RefusedRibbon, Ink, or Toner FailureRounded ParameterEvent Status NotificationESN - Power Management Class EventESN - Media Class EventESN - Device Busy Class EventSaving Parameters Not SupportedMedium Not PresentMedium Not Present - Tray ClosedMedium Not Present - Tray OpenMedium Not Present - LoadableMedium Not Present - Medium Auxiliary Memory AccessibleSequential Positioning ErrorTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyEnd Of Medium ReachedMedium Magazine Not AccessibleMedium Magazine RemovedMedium Magazine InsertedMedium Magazine LockedMedium Magazine UnlockedMechanical Positioning Or Changer ErrorRead Past End Of User ObjectElement DisabledElement EnabledData Transfer Device RemovedData Transfer Device InsertedInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetLogical Unit FailureTimeout On Logical UnitLogical Unit Failed Self-TestLogical Unit Unable To Update Self-Test LogTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has Changedcomponent Device AttachedDevice Identifier ChangedRedundancy Group Created Or ModifiedRedundancy Group DeletedSpare Created Or ModifiedSpare DeletedVolume Set Created Or ModifiedVolume Set DeletedVolume Set DeassignedVolume Set ReassignedReported LUNs Data Has ChangedEcho Buffer OverwrittenMedium LoadableMedium Auxiliary Memory AccessibleiSCSI IP Address AddediSCSI IP Address RemovediSCSI IP Address ChangedRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureATA Device Failed Set FeaturesSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorData Phase CRC Error DetectedSCSI Parity Error Detected During ST Data PhaseInformation Unit iuCRC Error DetectedAsynchronous Information Protection Error DetectedProtocol Service CRC ErrorPHY Test Function In ProgressSome Commands Cleared By iSCSI Protocol EventInitiator Detected Error Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorInvalid Target Port Transfer Tag ReceivedToo Much Write DataACK/NAK TimeoutNAK ReceivedData Offset ErrorInitiator Response TimeoutConnection LostLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureErase Failure - Incomplete Erase Operation DetectedCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedMedium Removal Prevented By Data Transfer ElementMedium Thread Or Unthread FailureVolume Identifier InvalidVolume Identifier MissingDuplicate Volume IdentifierElement Status UnknownSCSI To Host System Interface FailureSystem Resource FailureSystem Buffer FullInsufficient Reservation ResourcesInsufficient ResourcesInsufficient Registration ResourcesInsufficient Access Control ResourcesAuxiliary Memory Out Of SpaceQuota ErrorMaximum Number Of Supplemental Decryption Keys ExceededMedium Auxiliary Memory Not AccessibleData Currently UnavailableInsufficient Power For OperationUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change InputOperator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedFailure Prediction Threshold ExceededMedia Failure Prediction Threshold ExceededLogical Unit Failure Prediction Threshold ExceededSpare Area Exhaustion Prediction Threshold ExceededHardware Impending Failure General Hard Drive FailureHardware Impending Failure Drive Error Rate Too HighHardware Impending Failure Data Error Rate Too HighHardware Impending Failure Seek Error Rate Too HighHardware Impending Failure Too Many Block ReassignsHardware Impending Failure Access Times Too HighHardware Impending Failure Start Unit Times Too HighHardware Impending Failure Channel ParametricsHardware Impending Failure Controller DetectedHardware Impending Failure Throughput PerformanceHardware Impending Failure Seek Time PerformanceHardware Impending Failure Spin-Up Retry CountHardware Impending Failure Drive Calibration Retry CountController Impending Failure General Hard Drive FailureController Impending Failure Drive Error Rate Too HighController Impending Failure Data Error Rate Too HighController Impending Failure Seek Error Rate Too HighController Impending Failure Too Many Block ReassignsController Impending Failure Access Times Too HighController Impending Failure Start Unit Times Too HighController Impending Failure Channel ParametricsController Impending Failure Controller DetectedController Impending Failure Throughput PerformanceController Impending Failure Seek Time PerformanceController Impending Failure Spin-Up Retry CountController Impending Failure Drive Calibration Retry CountData Channel Impending Failure General Hard Drive FailureData Channel Impending Failure Drive Error Rate Too HighData Channel Impending Failure Data Error Rate Too HighData Channel Impending Failure Seek Error Rate Too HighData Channel Impending Failure Too Many Block ReassignsData Channel Impending Failure Access Times Too HighData Channel Impending Failure Start Unit Times Too HighData Channel Impending Failure Channel ParametricsData Channel Impending Failure Controller DetectedData Channel Impending Failure Throughput PerformanceData Channel Impending Failure Seek Time PerformanceData Channel Impending Failure Spin-Up Retry CountData Channel Impending Failure Drive Calibration Retry CountServo Impending Failure General Hard Drive FailureServo Impending Failure Drive Error Rate Too HighServo Impending Failure Data Error Rate Too HighServo Impending Failure Seek Error Rate Too HighServo Impending Failure Too Many Block ReassignsServo Impending Failure Access Times Too HighServo Impending Failure Start Unit Times Too HighServo Impending Failure Channel ParametricsServo Impending Failure Controller DetectedServo Impending Failure Throughput PerformanceServo Impending Failure Seek Time PerformanceServo Impending Failure Spin-Up Retry CountServo Impending Failure Drive Calibration Retry CountSpindle Impending Failure General Hard Drive FailureSpindle Impending Failure Drive Error Rate Too HighSpindle Impending Failure Data Error Rate Too HighSpindle Impending Failure Seek Error Rate Too HighSpindle Impending Failure Too Many Block ReassignsSpindle Impending Failure Access Times Too HighSpindle Impending Failure Start Unit Times Too HighSpindle Impending Failure Channel ParametricsSpindle Impending Failure Controller DetectedSpindle Impending Failure Throughput PerformanceSpindle Impending Failure Seek Time PerformanceSpindle Impending Failure Spin-Up Retry CountSpindle Impending Failure Drive Calibration Retry CountFirmware Impending Failure General Hard Drive FailureFirmware Impending Failure Drive Error Rate Too HighFirmware Impending Failure Data Error Rate Too HighFirmware Impending Failure Seek Error Rate Too HighFirmware Impending Failure Too Many Block ReassignsFirmware Impending Failure Access Times Too HighFirmware Impending Failure Start Unit Times Too HighFirmware Impending Failure Channel ParametricsFirmware Impending Failure Controller DetectedFirmware Impending Failure Throughput PerformanceFirmware Impending Failure Seek Time PerformanceFirmware Impending Failure Spin-Up Retry CountFirmware Impending Failure Drive Calibration Retry CountFailure Prediction Threshold Exceeded (false)Low Power Condition OnIdle Condition Activated By TimerStandby Condition Activated By TimerIdle Condition Activated By CommandStandby Condition Activated By CommandIDLE_B Condition Activated By TimerIDLE_B Condition Activated By CommandIDLE_C Condition Activated By TimerIDLE_C Condition Activated By CommandSTANDBY_Y Condition Activated By TimerSTANDBY_Y Condition Activated By CommandPower State Change To ActivePower State Change To IdlePower State Change To StandbyPower State Change To SleepPower State Change To Device ControlLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackPacket Does Not Fit In Available SpaceIllegal Mode For This TrackInvalid Packet SizeVoltage FaultAutomatic Document Feeder Cover UpAutomatic Document Feeder Lift UpDocument Jam In Automatic Document FeederDocument Miss Feed Automatic In Document FeederConfiguration FailureConfiguration Of Incapable Logical Units FailedAdd Logical Unit FailedModification Of Logical Unit FailedExchange Of Logical Unit FailedRemove Of Logical Unit FailedAttachment Of Logical Unit FailedCreation Of Logical Unit FailedAssign Failure OccurredMultiply Assigned Logical UnitSet Target Port Groups Command FailedATA Device Feature Not EnabledLogical Unit Not ConfiguredData Loss On Logical UnitMultiple Logical Unit FailuresParity/Data MismatchInformational, Refer To LogState Change Has OccurredRedundancy Level Got BetterRedundancy Level Got WorseRebuild Failure OccurredRecalculate Failure OccurredCommand To Logical Unit FailedCopy Protection Key Exchange Failure - Authentication FailureCopy Protection Key Exchange Failure - Key Not PresentCopy Protection Key Exchange Failure - Key Not EstablishedRead Of Scrambled Sector Without AuthenticationMedia Region Code Is Mismatched To Logical Unit RegionDrive Region Must Be Permanent/Region Reset Count ErrorDecompression Exception Long Algorithm IDSession Fixation ErrorSession Fixation Error Writing Lead-InSession Fixation Error Writing Lead-OutSession Fixation Error - Incomplete Track In SessionEmpty Or Partially Written Reserved TrackNo More Track Reservations AllowedRMZ Extension Is Not AllowedNo More Test Zone Extensions Are AllowedCD Control ErrorPower Calibration Area ErrorProgram Memory Area Update FailureProgram Memory Area Is FullRMA/PMA Is Almost FullCurrent Power Calibration Area Almost FullCurrent Power Calibration Area Is FullRDZ Is FullSecurity ErrorUnable To Decrypt DataUnencrypted Data Encountered While DecryptingIncorrect Data Encryption KeyCryptographic Integrity Validation FailedError Decrypting DataUnknown Signature Verification KeyEncryption Parameters Not UseableDigital Signature Validation FailureEncryption Mode Mismatch On ReadEncrypted Block Not Raw Read EnabledIncorrect Encryption ParametersUnable To Decrypt Parameter ListEncryption Algorithm DisabledSA Creation Parameter Value InvalidSA Creation Parameter Value RejectedInvalid SA UsageData Encryption Configuration PreventedSA Creation Parameter Not SupportedAuthentication FailedExternal Data Encryption Key Manager Access ErrorExternal Data Encryption Key Manager ErrorExternal Data Encryption Key Not FoundExternal Data Encryption Request Not AuthorizedExternal Data Encryption Control TimeoutExternal Data Encryption Control ErrorLogical Unit Access Not AuthorizedSecurity Conflict In Translated DeviceXS_SHORTSENSE scsibus at %sscsibusprint: qualifier == SID_QUAL_RSVDscsibusprint: qualifier == SID_QUAL_BAD_LUdirectsequentialprinterprocessorcdromwormscanneropticalchangercommunicationenclosure servicessimplified directscsibusprint: device type T_NODEVICEvendor-unique targ %d lun %d: <%s, %s, %s> ATAPISCSI%dremovablefixed %d/%s %s%s naa. eui. t10. serial. wwn.~ offline: %d targets, initiator %d, WWPN %016llx, WWNN %016llx%s: unable to register bio scsibusPLEXTORCD-ROM PX-40TS1.01MICROP 1588-15MBSUN0669DEC RZ55 (C) DECEMULEX MD21/S2 ESDIA00IBMRAID 0662SIBM 0663HIBM0664H3171-S2KZ-CDFRSS2FQUANTUM ELS85S iomegajaz 1GBMICROP4421-07SEAGATEST150176LW0002HPC3725SDCASSONY SDT-5000 3.WangDAT Model 1300 02.4Model 2600 01.7Model 3200 02.2CR-2801TE1.07CREATIVECD3630EAC101FX320Sq01GCD-R580B1.00MATSHITA CR-5741.021.06Memorex CRW-26421.0gSANYO CRD-256PSANYO CRD-254PSANYO CRD-S54P1.08CD-ROM CDR-S11.70CD-ROM CDR-N161.25UJDCD87301.14ATAPI CD-ROMSCSI CD-ROMNEC CD-ROM DRIVE:260SCSI opticalSCSI disk%s %s(unknown)%s: %lluMB, %lu bytes/sector, %llu sectors, thin, readonly%s: WARNING: unable to establish shutdown hook softintr_establish: unknown soft IPL %d"%s" at %s addr 0x%xiiclm75alm75lm77eeprommax1617xeontemplm93lm81lm87adm9240adt7470adt7476adt7475adt7462adt7466adt7467adm1033adm1034adm1030adm1031adm1025adm1024adm1023adm1028adm1022thmc5047m192sch5027emc6w201asc7611asc7621ne1619ds1780adt7460adm1027lm85adt7516lm63lm86lm89lm89-1lm90gl523smadt7461adm1021adm1032g781g781-1max6690max6646max6657max6642tmp401sa56004xw83791sdw83627dhgw83792dw83781dw83627hfw83782das99127fw83783sw83791dw83l784rw83l785rw83l785ts-lf75375asb100gl518smadm1026se97max6604mcp9805mcp98242mcp98243adt7408stts2002cat34ts02ts3000b3lis331dlit8712lm96000emc6d100sch5017it8712f-amtp008w83795gw83793gstts424e02%s: addr 0x%x %02x=%02x words %02x=%04x: %s%s: ricohrtc_clock_write: failed to write rtc %s: ricohrtc_clock_read: failed to read rtc %s: ricohrtc_reg_write: failed to write reg%d : RICOH RS5C372[AB] Real-time Clock ricohrtc: F75375 rev %d.%dVcc, unable to register update task unable to read reg %d fintek: PCA9532 LED controller pcaledi80321_mem_bs_free(): not implementedi80321_mem_bs_alloc(): not implementedi80321_io_bs_free(): not implementedi80321_io_bs_alloc(): not implementedpciiopaauiopiiciopmuiopwdogi80321_intr_establish: IRQ %d out of rangei80321intcresettodr: failed to set time WARNING: preposterous time in file system WARNING: preposterous clock chip time lostgainedWARNING: clock %s %ld days WARNING: CHECK AND RESET THE DATE! clockstattcr1: I2C controller %s: unable to subregion registers, error = %d iopiiclkattempting reset %s: unable to map VERDE registers%s: unable to subregion MCU registers%s: unable to subregion ATU registers%s: unable to map IOW registers: i80321 I/O Processor %s: unable to map PLD registersiopxs%03d:%02d:%d %04x:%04x WARNING: unknown PCI device header. mem %02xh %s 0x%08x 0x%08x NGOK [%s] Resource conflict. No available resources. fixup failed pci_addr_fixup: fixup failed. (new address=%#lx) new address 0x%08lx PCI I/O memory spacePCI I/O port space[%s]----------------------- device vendor product register space address size -------------------------------------------- System BIOS Setting--------------------------[%3d devices bogus] PCIBIOS fixup stageirq %diq80321_pci_intr_map: no mapping for %d/%d/%d (%d, %d, %d) board id failed Thecus Nx100I/O Data HDL-GCertance CP3100 addr 0x%08lx intr %dobio_bs_free(): not implementedobio_bs_alloc(): not implemented: failed to map registers: %d %s: unable to establish interrupt at CPLD irq %d com_obio%s: standby command didn't complete %s: standby command timeout %s: standby command: drive fault %s: flush cache command didn't complete %s: flush cache command timeout %s: flush cache command: drive fault ST506wd_get_params: bad return code from ata_get_paramswddump: try againwddump: polled command has been queuedwddump: device timed outwddump: drive faultwddump: DMA errorwddump: %swddump: unknown error typeST506/MFM/RLLESDI/IDE disk__wdstart: bad return code from wdc_ata_bio()device faultdevice timeout, retrying %s: soft error (corrected) %s: IDENTIFY failed : <%s> %s: %d-sector PIO, LBA48, %lluMB, %llu sectors LBA, %lluMB, %llu sectors CHS, %lluMB, %d cyl, %d head, %d sec, %llu sectors %s: enable look ahead command didn't complete %s: enable write cache command didn't complete %s: freeze lock command didn't complete %s:%d:%d: bad state %d in _wdc_ata_bio_start _wdc_ata_bio_start: bad state%s:%d:%d: timeout waiting for DRQ, st=0x%b, err=0x%02x BSYDRDYDWFDSCDRQCORRIDXERR%s:%d:%d: not ready, st=0x%b, err=0x%02x wdc_ata_ctrl_intr: state==RECALpiomodedmamodegeometrysetmultirecal%s:%d:%d: %s timed out %s:%d:%d: %s drive fault error (%x) %s:%d:%d: bad state %d in wdc_ata_bio_intr wdc_ata_bio_intr: bad state%s:%d:%d: device timeout, c_bcount=%d, c_skip%d %s:%d:%d: intr with DRQ (st=0x%b) %s:%d:%d: read intr before drq error not notifiedno media/write protectedaborted commandmedia change requestedid not foundmedia changeduncorrectable data errorinterface CRC erroraddress mark not foundtrack 0 not foundbad block detectedwsevent_read%s: can't attach mux (error=%d) wskbd at %s%s: event queue overflow wskdetwskbd_detach: %s didn't detach mux %dcannot load keymap %s: cannot load keymap, falling back to default %s: console keyboard%s: attach error=%d wskbdwskbd_get_mapentry: %d(%d): bad entrywskbd_load_keymap: %d: recursion too deepwskbd_load_keymap: %d(%d): bad entry attach error=%dwsmouse at %swsmdetwsmouse_detach: %s didn't detach wsmousewsmux_getmux: no memory for mux %d wsmux: attach out of memory usb at %sendtaskusbatskusbtskunable to create usb abort task threadusbtaskunable to create usb task threadusbpalock: USB revision %s, not supported %s: can't register softintr %s: root device is not a hub %s: root hub problem, error=%d pre 1.01.12.0usbusbd_desc_iter_next: bad descriptor usbd_desc_iter_next: descriptor length = 0 usbd_desc_iter_next: descriptor length too large usbd_start_next: error=%d usbd_transfer: not doneusbsynusbrefusbdetusb_detach_wait: %s didn't detach out of dataiface desc0 lengthusbd_fill_iface_data: bad descriptor(s): %s usbdly%s: device addr %d (config %d) exceeds power budget, %d mA > %d mA %s: port %d, set config at addr %d failed %s: No free USB addresses, new device ignored. usbd_new_device: cannot find HS port%x.%02xvendor 0x%04x"%s %s", class %d/%d rev / addr %d port %d configuration %d interface %dNORMAL_COMPLETIONIN_PROGRESSPENDING_REQUESTSNOT_STARTEDINVALNOMEMCANCELLEDBAD_ADDRESSIN_USENO_ADDRSET_ADDR_FAILEDNO_POWERTOO_DEEPIOERRORNOT_CONFIGUREDTIMEOUTSHORT_XFERSTALLEDINTERRUPTEDXXX%s: illegal enable change, port %d %s: port error, restarting port %d %s: port error, giving up port %d %s: strange, connected port %d has no power %s: port %d reset failed %s: device problem, disabling port %d %s: hub depth (%d) exceeded, hub ignored %s: no ports, hub ignored %s: bus powered hub connected to bus powered hub, ignored %s: no interface handle %s: no endpoint descriptor %s: bad interrupt endpoint %s: cannot open interrupt pipe %s: port %d power on failed, %s uhubucom at %s portno %d%s: lost %d chars %s: read start failed , %sucomlkucomugenri%s: secondary, not changing config to %d %s: setting configuration index 0 failed %s: setting configuration %d failed ugenBAD LENGTH %d Main bTag=%d Global bTag=%d Local bTag=%d default bType=%d uhidev_intr: bad repid %d uhid at %s reportid %d%s: could not read endpoint descriptor %s: unexpected endpoint %s: no input interrupt endpoint %s: no report descriptor %s: iclass %d/%d, %d report id%s%s: no memory uhidevuhidrea: input=%d, output=%d, feature=%d uhidno usable key codes array%s: was console keyboard ukbd: %d button%s, Z dir, W dir, Z and W dir, tip, barrel, eraser %s: mouse has no X report %s: X report 0x%04x not supported %s: mouse has no Y report %s: Y report 0x%04x not supported ums%s: got polled xfer %p, but %p already pending %s: CBI bulk-in/out stall clear failed, %s %s: CBI intr-in stall clear failed, %s %s: CBI reset failed, %s %s: CBI bulk-in stall clear failed, %s %s: CBI bulk-out stall clear failed, %s %s: Unknown state %d%s: BBB bulk-%s stall clear failed, %s %s: Invalid CSW: sig 0x%08x should be 0x%08x %s: Invalid CSW: tag %d should be %d %s: Invalid CSW: status %d > %d %s: Phase Error, residue = %d %s: transferred %d bytes instead of %d bytes%s: BBB reset failed, %s %s: BBB bulk-in clear stall failed, %s %s: BBB bulk-out clear stall failed, %s Bulk-OnlyCBICBI with CCIISD-ATARBCSCSIUFI%s: using %s over %s %s: isdata not configured %s: command protocol=0x%x not supported %s: bus attach failed umass%s: Unknown status %d in umass_scsi_cbumass_cmd: large datalen, %d %04x%04x%s: failed to set configuration, err=%s : failed to get interface, err=%s %s: device is neither visor nor palm %s: init failed, %s GenericDebuggerHotSyncRemote File System%s: no proper endpoints for port %d (%d,%d) uvisor%s: open rx pipe failed: %s %s: open tx pipe failed: %s %s: open intr pipe failed: %s %s: aue_send error=%s %s: usb error on tx: %s %s: %u usb errors on intr: %s %s: no memory for rx list -- packet dropped! %s: %u usb errors on rx: %s %s: reset failed %s: close rx pipe failed: %s %s: close tx pipe failed: %s %s: close intr pipe failed: %s %s: tx list init failed %s: rx list init failed %s: MII read timed out %s: EEPROM read timed out %s: setting config no failed auemii%s: getting interface handle failed %s: couldn't get endpoint descriptor %d %s: missing endpoint %s: address %s aue%s: usb errors on rx: %s axe%d: close rx pipe failed: %s axe%d: close tx pipe failed: %s axe%d: close intr pipe failed: %s axe%d: usb error on tx: %s axe%d: watchdog timeout axe%d: rx list init failed axe%d: tx list init failed axe%d: open rx pipe failed: %s axe%d: open tx pipe failed: %s %s: media change failed axe%d: write PHY failed axe%d: read PHY failed axemii%s: couldn't get ep %d no valid PHY address found, assuming PHY address 0 AX88178 AX88772B AX88772 AX88172axe%s: warning: Failed to write register 0x%0x %s: warning: Failed to read register 0x%0x %s: warning: failed to read SMSC_COE_CTRL (err=%d) %s: warning: failed to write SMSC_COE_CTRL (err=%d) %s: warning: failed to read initial AFC_CFG, error %d %s: warning: media change failed, error %d %s: warning: timed-out waiting for reset to complete %s: warning: timed-out waiting for phy reset to complete %s: warning: failed to set the MAC address %s: warning: failed to read HW_CFG: %d %s: warning: failed to read HW_CFG: (err = %d) %s: warning: failed to read ID_REV (err = %d) %s: warning: failed to read MAC_CSR (err=%d) %s: error: smsc_chip_init failed (err=%d) smscmii%s: warning: MII is busy %s: warning: MII write timeout %s: warning: MII read timeout smsc%s: cue_send error=%s %s: read MAC address failed cue%s: kue_send error=%s %s: warm boot, no firmware download kue%s: failed loadfirmware of file %s: errno %d %s: cold boot, downloading firmware %s: failed to load code segment: %s %s: failed to load fixup segment: %s %s: failed to load trigger segment: %s %s: loading firmware failed %s: could not read Ethernet descriptor %s: no memory for multicast filter buffer %s: usb error on rx: %s %s: too many errors, disabling %s: open interrupt pipe failed: %s %s: close interrupt pipe failed: %s extra ethernet descriptor %s: no data interface %s: no descriptor for interrupt endpoint %d %s: interface alternate setting %d failed %s: no descriptor for bulk endpoint %d %s: could not find data bulk in %s: could not find data bulk out cdce%s: udav_send error=%s udavmiiudav%s: upl_send error=%s upl%s: ugl_send error=%s %s: bad header (length=%d) %s: bad packet count (%d) %s: bad packet size(%d), length=%d ugl%s: url_send error=%s %s: %s: bad register %04x urlmii%s: failed to get interface, err=%s %s: couldn't get endpoint %d url%s: Invalid notification length! (%d) %s: close notify pipe failed: %s no %s: data interface %d, has %sCM over data, has %sbreak %s: no endpoint descriptor for %d %s: Could not find data bulk in %s: Could not find data bulk out %s: could not set data multiplex mode %s: status change notification available umodem%s: failed to set configuration, err=%s uftdi%s: failed to get configuration descriptor %s: failed to get device descriptor %s: failed to get interface, err=%s %s: Could not find interrupt in %s: failed to get second interface, err=%s %s: reset failed, %s uplcom %s: failed to set configuration, err=%s umct%s: uvscom_intr: abnormal status: %s %s: uvscom_set_line_coding: %s %s: uvscom_set_line: %s %s: uvscom_shutdown: %s %s: uvscom_readstat: %s %s: cannot open interrupt pipe (addr %d) uvsopuvscom%s: this device is using CDC notify message in intr pipe. Please send your dmesg to , thanks. %s: intr buffer 0x%x 0x%x 0x%x 0x%x 0x%x 0x%x 0x%x %s:notify serial state, len=%d, data=0x%02x %s: ubsa_request: %s %s: failed to set configuration: %s %s: failed to get interface: %s ubsa%s: unhandled set request: reg=%x onoff=%x %s: no proper endpoints found (%d,%d) uipaq%s: this device is not using CDC notify message in intr pipe. Please send your dmesg to , thanks. %s: umass only mode. need to reattach %s: truinstall mode. need to reattach %s: no endpoint descriptor found for %d umsmwiusbthrwitxlwiIDLwi_usb: received USB_BUFAVAIL packet wi_usb: received USB_ERROR packet %s: %s error=%s wiTXsyncUGH TX UGH RX write_record buf size err %x %x invalid packet len: %x memsz %x max %x %s: %s: error=%s %s:%s: invalid packet id sent %x %s: already detached %s: open pipes failed wi_usb%s: could not get card cfg! unknown-device%s: %s loadfirmware error %d %s: reattaching after firmware upload atuatu-rfmd-intatu-rfmd-extatu-rfmd2958-intatu-rfmd2958-extatu-rfmd2958smc-intatu-rfmd2958smc-extatu-intersil-intatu-intersil-extatu-at76c503-i3863-intatu-at76c503-i3863-extatu-at76c503-rfmd-acc-intatu-at76c503-rfmd-acc-extatu-at76c505-rfmd-intatu-at76c505-rfmd-ext%s: could not retrieve Tx statistics - cancelling automatic rate control %s: could not write MAC register: %s %s: could not read MAC register: %s %s: could not read BBP %s: could not read EEPROM: %s %s: could not allocate tx xfer %s: could not allocate tx buffer %s: could not transmit buffer: %s %s: could not allocate rx xfer %s: could not allocate rx buffer %s: timeout waiting for BBP/RF to wakeup %s: could not allocate AMRR xfer %s: could not open Tx pipe: %s %s: could not open Rx pipe: %s %s: could not allocate Tx list %s: could not allocate Rx list %s: could not queue Rx transfer %s: could not transmit beacon %s: could not set configuration no %s: could not get interface handle %s: no endpoint descriptor for iface %d %s: MAC/BBP RT%04x (rev 0x%02x), RF %s, address %s uralOUI 0x%06x model 0x%04x rev %d at %s phy %dmii_detach: phyloc and offloc specifiedmii_attach: phyloc and offloc specifiedmiiautmii_phy_setmedia: MASTER on wrong media: %s, rev. %d nsphyDP83840 10/100 PHYqsphyQS6612 10/100 PHYinphyi82555 10/100 PHYi82562EM 10/100 PHYi82562ET 10/100 PHYi82562G 10/100 PHYiophyi82553 10/100 PHYeephy88E1000 1 Gigabit PHY88E1000 2 Gigabit PHY88E1000 3 Gigabit PHY88E1000 4 Gigabit PHY88E1000S Gigabit PHY88E1011 Gigabit PHY88E1111 Gigabit PHY88E1112 Gigabit PHY88E1116 Gigabit PHY88E1116R Gigabit PHY88E1118 Gigabit PHY88E1149 Gigabit PHY88E3016 10/100 PHY88E3082 10/100 PHYPHYG65G Gigabit PHY88E1000 5 Gigabit PHY88E1000 6 Gigabit PHY88E1000 7 Gigabit PHYexphy_service: can't isolate 3Com PHY: 3Com internal media interface %s: ignoring this PHY, non-zero instance xlexphyrlrlphy_service: attempt to isolate phy: RTL internal PHY rlphyRTL8201L 10/100 PHYRTL8201E 10/100 PHYIP101 10/100 PHYlxtphyLXT970 10/100 PHYLXT971 10/100 PHYluphyLU6612 10/100 PHYmtdphyMTD972 10/100 PHYicsphyICS1890 10/100 PHYICS1892 10/100 PHYICS1893 10/100 PHYsqphy80220 10/100 PHY80225 10/100 PHY84220 10/100 PHYtqphy78Q2120 10/100 PHY: Generic IEEE 802.3u media interface, rev. %d: OUI 0x%06x, model 0x%04x %s: no media present ukphy: internal PHY dcphybmtphy3C905B internal PHY3C905C internal PHYBCM4401 10/100baseTX PHYBCM5201 10/100 PHYBCM5214 Quad 10/100 PHYBCM5220 10/100 PHYBCM5221 100baseTX PHYBCM5222 Dual 10/100 PHYbgebnxbrgphyBCM5400 1000baseT PHYBCM5401 10/100/1000baseT PHYBCM5411 10/100/1000baseT PHYBCM5421 10/100/1000baseT PHYBCM54K2 10/100/1000baseT PHYBCM5461 10/100/1000baseT PHYBCM5462 10/100/1000baseT PHYBCM5464 10/100/1000baseT PHYBCM5701 10/100/1000baseT PHYBCM5703 10/100/1000baseT PHYBCM5704 10/100/1000baseT PHYBCM5705 10/100/1000baseT PHYBCM5714 10/100/1000baseT/SX PHYBCM5750 10/100/1000baseT PHYBCM5752 10/100/1000baseT PHYBCM5780 10/100/1000baseT/SX PHYBCM54XX 10/100/1000baseT PHYBCM5481 10/100/1000baseT PHYBCM5482 10/100/1000baseT PHYBCM5722 10/100/1000baseT PHYBCM5755 10/100/1000baseT PHYBCM5761 10/100/1000baseT PHYBCM5784 10/100/1000baseT PHYBCM5787 10/100/1000baseT PHYBCM5706 10/100/1000baseT/SX PHYBCM5708C 10/100/1000baseT PHYBCM5708S 1000/2500baseSX PHYBCM5709 10/100/1000baseT PHYBCM5709S 1000/2500baseSX PHYBCM5709CAX 10/100/1000baseT PHYBCM5717C 10/100/1000baseT PHYBCM5719C 10/100/1000baseT PHYBCM5720C 10/100/1000baseT PHYBCM57765 10/100/1000baseT PHYBCM57780 10/100/1000baseT PHYBCM5906 10/100baseTX PHYamphyAm79C873 10/100 PHYDM9101 10/100 PHYDM9102 10/100 PHYDM9601 10/100 PHYAm79C875 quad PHYacphyAC101 10/100 PHYAC101L 10/100 PHYAC_UNKNOWN 10/100 PHY%s: %s: enter updown%s: %s: link %s : RTL internal phy urlphyrgephyRTL8169S/8110S PHYRTL8251 PHYnfe%s: unknown CICADA PHY model %x %s: unknown PHY speed %x ciphyCS8201 10/100/1000TX PHYCS8204 10/100/1000TX PHYVSC8211 10/100/1000 PHYCS8244 10/100/1000TX PHYVSC8601 10/100/1000 PHY%d:%d:%d: mem address conflict 0x%x/0x%x %d:%d:%d: io address conflict 0x%x/0x%x %d:%d:%d: bridge io address conflict 0x%x/0x%x %d:%d:%d: bridge mem address conflict 0x%x/0x%x %d:%d:%d: bridge bus conflict %d-%d dev %d function %dpci_mem_find: bad requestpci_mem_find: bad 64-bit requestpci_io_find: bad request%svendor 0x%04x product 0x%04xunknown vendor "%s", unknown product 0x%04xunknown class 0x%02x, subclass 0x%02xclass %s unknown subclass 0x%02xclass %s subclass %s, rev 0x%02x) rev 0x%02xmiscellaneousfloppyIPISASethernettoken ringFDDIWorldFipPCMIG Multi ComputingXGAvideoaudiotelephonyhdaudioRAMflashhostMicroChannelNuBusRACEwaySemi-transparent PCIInfiniBandserialparallelmulti-port serialmodemsmartcard8237 DMA8254 timerRTCPCI Hot-PlugSD Host Controllerkeyboarddigitizermousegame portgeneric386486PentiumAlphaPowerPCMIPSCo-processorFirewireACCESS.busSSAFiber ChannelIPMISERCOSIrDAConsumer IRRFbluetoothbroadband802.11a (5 GHz)802.11b (2.4 GHz)standardvoicenetwork/computingentertainmentDPIOTime and Frequencysynchronizationmanagementprehistoricmass storagenetworkdisplaymultimediabridgecommunicationsinputdockserial buswirelessI2Osatellite commDASPundefinedOZ6729 CardBusOZ6730 CardBusOZ6922 CardBusOZ6832 CardBusOZ6836/OZ6860 CardBusOZ68[17]2 CardBusOZ6933 CardBusOZ69[17]2 CardBusOZ711Mx MiscOZ711EC1 SmartCardBusOZ711M1 CardBusOZ711MP1 SDHCOZ711MP1 XDHCOZ711MP1 CardBusOZ711EZ1 CardBusOZ711SP1 CardBusOZ711E0 CardBus3c9853c9963CRDAG6753CRPAG175V.90 Modem3c9403c3393c3593c4503c555 100Base-TX3c5753CCFE575BT3CCFE575CT3c590 10Mbps3c595 100Base-TX3c595 100Base-T43c595 10Mbps-MII3CRSHPW796 802.11b3CRWE154G72 802.11g3c556 100Base-TX3c556B 100Base-TX3CCFEM6563CCFEM656B3CCFEM656C56k Global Modem3cSOHO-TX3crwe777a AirConnect3c940B3c900 10Base-T3c900 10Mbps-Combo3c900B 10Mbps3c900B 10Mbps-Combo3c900B 10Mbps-TPC3c900B 10Mbps-FL3c905 100Base-TX3c905 100Base-T43c905B 100Base-TX3c905B 100Base-T43c905B 10/100Mbps-Combo3c905B 100Base-FX3c905C 100Base-TX3c9201 100Base-TX3c920B-EMB-WNM3cSOHO 100B-TX3c980 100Base-TX3c980C 100Base-TX3cr9903cr990-TX3cr990-TX-953cr990-TX-973c990b-TX-M3cr990-FX3cr990SVR953cr990SVR973c990BSVRVoodooVoodoo2BansheeVoodoo3Voodoo4Voodoo5GLINT 300SXGLINT 500TXGLINT DeltaPermediaGLINT MXPermedia 2GLINT GammaPermedia 2vPermedia 3Wildcat III 6210Wildcat 5110Wildcat IV 72105000/6000 series RAID7000/8000 series RAID9000 series RAID9500 series RAIDFE2500 10/100PCM200 10/100FE2000VX 10/100FE2500MX 10/100PC4800 WirelessPCI35x WLANPC4500 WirelessMPI-350 WirelessACCM 2188 VL-PCI2051 PCI2051 ISAATP850U/UFATP860ATP860-AATP865-AATP865-RAEC6710AEC6712UWAEC6712UAEC6712SAEC6710DAEC6715UWMPX 5030/5038EN2242EN1217RhineIIrtl8139AWA-100M1435 VL-PCIM1445 VL-PCIM1449 ISAM1451 PCIM1461 PCIM1489 PCIM1511 PCIM1513 ISAM1523 PCIM1523 ISAM1531 PCIM1533 ISAM1535 PCIM1541 PCIM1543 ISAM1563 ISAM1573 ISAM1575 ISAM1621 PCIM1631 PCIM1644 PCIM1647 PCIM1689 PCIM1695 PCIM3309 MPEGM4803M5219 UDMA IDEM5229 UDMA IDEM5237 USBM5239 USB2M5243 AGP/PCI-PCIM5246 AGPM5247 AGP/PCI-PCM5249M524B PCIEM524C PCIEM524D PCIEM5261 LANM5263 LANM5281 SATAM5287 SATAM5288 SATAM5289 SATAM5451 AudioM5455 AudioM5457 ModemM5461 HD AudioM7101 PowerAL981AN983AN985ADM8211 WLANADM9511ADM9513AIC-7810AHA-2940AU/CNAHA-2930CUAIC-7850AIC-7855AIC-5900 ATMAIC-5905 ATMAPA-1480AIC-7860AHA-2940AUAIC-7870AHA-2940AHA-3940AHA-3985AHA-2944AIC-7815AIC-7880AHA-2940UAHA-3940UAHA-398XUAHA-2944UAHA-2940UWProAIC-6915AIC-7895AHA-2940U2 U2AHA-2930U2 U2AAA-131U2 U2AIC-7890/1 U2AIC-7892 U160AHA-29160 U160AHA-19160B U160AVA-2930LPAHA-3950U2B U2AHA-3950U2D U2AIC-7896/7 U2AHA-3960D U160AIC-7899BAIC-7899DAIC-7899FAIC-7899 U160ServeRAIDAAC-2622ASR-2200SASR-2120SAAC-364AAC-3642Dell PERC 2/QCAIC-7901 U320AHA-29320A U320AHA-29320LP U320AIC-7901A U320AHA-29320 U320AHA-29320B U320AIC-7902 U320AIC-7902B U320AHA-39320 U320AHA-39320B U320AHA-39320A U320AHA-39320D U320AHA-39320DB U3201200AABP-930/40UAABP-940UWASP-3940U2WASP-3940U3WWaikato Dag3.2Endace Dag3.5Endace Dag4.22GEEndace Dag4.23PhysXAT22AT24AcenicAcenic CopperBCM5700BCM5701AC1000AC1001AC9100AC1003AMD64 0Fh HyperTransportAMD64 0Fh Address MapAMD64 0Fh DRAM CfgAMD64 0Fh Misc CfgAMD64 10h HyperTransportAMD64 10h Address MapAMD64 10h DRAM CfgAMD64 10h Misc CfgAMD64 10h Link CfgAMD64 11h HyperTransportAMD64 11h Address MapAMD64 11h DRAM CfgAMD64 11h Misc CfgAMD64 11h Link CfgAMD64 15/1xh Link CfgAMD64 15/1xh Address MapAMD64 15/1xh DRAM CfgAMD64 15/1xh Misc CfgAMD64 15/1xh CPU PowerAMD64 15/1xh NB PowerAMD64 15/1xh HostAMD64 15/1xh PCIEAMD64 15/1xh IOMMUAMD64 14h HostAMD64 14h PCIEAMD64 15/0xh Link CfgAMD64 15/0xh Address MapAMD64 15/0xh DRAM CfgAMD64 15/0xh Misc CfgAMD64 15/0xh CPU PowerAMD64 15/0xh HostAMD64 14h Link CfgAMD64 14h Address MapAMD64 14h DRAM CfgAMD64 14h Misc CfgAMD64 14h CPU PowerAMD64 12h HostAMD64 12h PCIEAMD64 14h NB PowerAMD64 14h Reserved79c970 PCnet-PCI79c978 PChome-PCI53c974 PCscsi-PCI79C974 PCnet-PCIGeode LXGeode LX VideoGeode LX CryptoCS5536 PCICS5536 ISACS5536 AudioCS5536 USBCS5536 IDEElanSC520 PCIHudson-2 PCIE751 System762 PCI761 PCI755 ISA755 IDE755 Power755 USB756 ISA756 IDE756 Power756 USB Host766 ISA766 IDE766 USB766 Power766 USB OpenHCI768 ISA768 IDE768 Power768 AC97768 Modem768768 USB8131 PCIX8131 PCIX IOAPIC8151 Sys Control8151 AGP8132 PCIX8132 PCIX IOAPIC81118111 Ether8111 USB8111 LPC8111 IDE8111 SMBus8111 Power8111 AC97Hudson-2 SATAHudson-2 SD Host ControllerHudson-2 USBHudson-2 USB2Hudson-2 SMBusHudson-2 IDEHudson-2 HD AudioHudson-2 LPCHudson-2 PCIHudson-2 xHCIRS780 HostRS880 HostRS780 PCIEMegaRAIDMegaRAID Series 428MegaRAID Series 434ADSP 21535 DSPAD1889 AudioSafeNet ADSP 2141TC9021BanditGCOHareHeathrowPaddingtonUni-N EthUni-NUni-N Eth FirewireUni-N AGPUni-N GMACKeylargoPangea GMACPangea MacioPangea USBPangea AGPPangeaPangea PCIUni-N2 AGPUni-N2 HostPangea FireWireUniNorth FirewireUni-N2 GMACUni-N ATAUniNorth AGPUniNorth PCIIntrepid ATAIntrepidIntrepid USBK2 USBK2 MacioK2 FirewireK2 ATAU3U3 HyperTransportU3 AGPK2 GMACShastaShasta ATAShasta GMACShasta FirewireShasta PCIShasta HyperTransportK2U3L AGPK2 AGPIntrepid 2 AGPIntrepid 2 PCIIntrepid 2 ATAIntrepid 2 FireWireIntrepid 2 GMACARS106SARS0303D1000PV2000PV2000MT2000MIARC-1110ARC-1120ARC-1130ARC-1160ARC-1170ARC-1200ARC-1200BARC-1202ARC-1210ARC-1214ARC-1220ARC-1230ARC-1260ARC-1270ARC-1280ARC-1380ARC-1381ARC-1680ARC-1681ARC-1880AX88140A/88141ASM1042 xHCIASM1083/1085 PCIE-PCIRadeon HD 6310 HD AudioRadeon HD 6500D HD AudioMobility Radeon X600FireMV 2400Mobility Radeon X300FireGL M24 GLRadeon X600FireGL V3200Radeon X600 SecRadeon IGP 320Radeon IGP 340Radeon 9500 ProRadeon AE 9700 ProRadeon AF 9600TXFireGL AGZ1Radeon AH 9800 SERadeon AI 9800Radeon AJ 9800FireGL AK X2Radeon 9600 ProRadeon 9600Radeon 9550FireGLRadeon 9650Mach32Radeon 9500 Pro SecRadeon 9600 Pro SecRadeon 9600 LE SecRadeon 9600 XT SecRadeon 9550 SecRadeon IGPRadeon 8500Radeon BC R200Radeon IGP 320MMobility M6SB200 AC97SB200 PCISB200 USB2SB200 USBSB200 IDESB200 ISASB200 ModemSB200 SMBusMach64 CTMach64 CXSB300 AC97SB300 PCISB300 SMBusSB300 USB2SB300 USBSB300 IDESB300 ISASB300 ModemSB300 SATASB400 AC97SB400 PCISB400 SMBusSB400 USB2SB400 USBSB400 IDESB400 ISASB400 ModemSB400 SATASB450 HD AudioSB600 SATASB600 AC97SBx00 HD AudioSB600 PCISBx00 SMBusSB600 USB2SB600 USBSB600 IDESB600 ISASB600 ModemSBx00 SATASB700 USB2SB700 USBSB700 IDESB700 ISASB800 PCIERadeon Mobility IGPMach64 ETRage ProMach64Rage XLRadeon 9000Radeon 9000 SecRadeon X800Radeon X800 ProRadeon X800SERadeon X800XTFireGL X3-256Radeon Mobility M18Radeon X800 SERadeon X800 XTRadeon AIW X800 VERadeon X800 Pro SecRadeon X850Radeon X850 XTRadeon X850 SERadeon X850 ProRadeon X850 XT PERage128Mobility M3Mobility 1Rage P/MRadeon Mobility M7FireGL Mobility 7800 M7Radeon Mobility M6Radeon Mobility M9FireMV 2400 PCIRage 128 MobilityRadeon 9500/9700Radeon 9600 TXFireGL X1Radeon 9800 ProRAdeon 9800Radeon 9800 XTFireGL X2Radeon Mobility M10Radeon Mobility 9550Radeon 9500/9700 SecFireGL X1 SecRadeon 9800 Pro SecRage 128 ProRage FuryRage 128Rage 128 PXAIW RadeonRadeon 9100Radeon 7500Radeon VEES1000Rage MagnumRadeon Mobility M300 M22Radeon Mobility X600 M24CFireGL M44 GL 5464Radeon X800 XT PERadeon X800 XTPRadeon X800 XLFireGL V7100FireGL V5100Radeon X800 SecMobility FireGL V5000 M26Radeon Mobility X700 XL M26Radeon Mobility X700 M26Radeon X550XTXRadeon X550XTX SecRS300_100 HostRS300_133 HostRS300_166 HostRadeon IGP 9100 HostRadeon IGP 9100Radeon Mobility IGP 9100Radeon IGP 9100 AGPRadeon 9200 PRO SecRadeon 9200 SecRS480 HostRX480 HostRD580 HostRadeon XPRESS 200Radeon XPRESS 200MRX780 HostRD780 HT-PCIERadeon 9200 PRORadeon 9200Radeon 9200 SE SecFireMV 2200RD790 PCIESR5690 HostRD890 HostSR5670 HostSR5650 HostSR5690 PCIERS400 HostRC410 HostRX480 PCIERS480 PCIERadeon X300Radeon X550FireGL V3100FireMV 2200 5B65Radeon X300 SecRadeon X550 SecFireGL V3100 SecFireMV 2200 SecRadeon Mobility 9200Radeon 9200 SERadeon X800 XT M28FireGL V5100 M28Radeon Mobility X800 M28FireGL R480Radeon X850XTRadeon X800 GTO SecRadeon X850 XT SecFireGL V5000FireGL X700 XTFireGL X700 ProFireGL X700 SERadeon X700 PCIERadeon X700 SE PCIERadeon X700 PCIE SecRadeon X700 SERadeon X700 SE SecRadeon HD 8670ARadeon HD 8730MOlandRadeon HD 8790MRadeon HD 8530MRadeon HD 8600Radeon HD 8570Radeon HD 8500Radeon HD 8670MRadeon HD 8500MHainanCaymanFirePro V7900FirePro V5900Radeon HD 6970Radeon HD 6950Radeon HD 6990Radeon HD 6930Radeon HD 6970MMobility Radeon HD 6000BartsRadeon HD 6900MRadeon HD 6870Radeon HD 6850Radeon HD 6790Radeon HD 6730MRadeon HD 6600MRadeon HD 6610MRadeon E6760TurksFirePro V4900FirePro V3900Radeon HD 6650ARadeon HD 7670ARadeon HD 6670Radeon HD 6570Radeon HD 7570Radeon HD 6510Radeon HD 6400MRadeon HD 6430MCaicosRadeon E6460Radeon HD 6450ARadeon HD 8490Radeon HD 7450ARadeon HD 7470Radeon HD 6450Radeon HD 7450FirePro W9000FirePro VTahitiRadeon HD 7970Radeon HD 7900Radeon HD 7950Radeon HD 7990Radeon HD 7870 XTRadeon HD 7970MRadeon HD 8970MPitcairnFirePro W7000FirePro W5000Radeon HD 7870Radeon HD 7850Radeon HD 8800MCape VerdeRadeon HD 7700MRadeon HD 7870MRadeon HD 7850MFirePro W600FirePro M4000Radeon HD 7730MRadeon HD 7800MRadeon HD 7730Radeon HD 7700Radeon HD 7770Radeon HD 7750Radeon HD 7670MRadeon HD 7550MRadeon HD 7000MRadeon HD 7400CypressFirePro V8800FirePro V7800FirePro V9800FireStream 9370FireStream 9350Radeon HD 5870Radeon HD 5850Radeon HD 6800Radeon HD 5970Radeon HD 5900Radeon HD 5830Mobility Radeon HD 5870Mobility Radeon HD 5850Radeon HD 6850MFirePro V5800Mobility Radeon HD 5800Radeon HD 5770Radeon HD 5670 640SPRadeon HD 6770Radeon HD 5750Radeon HD 6750Mobility Radeon HD 5730Mobility Radeon HD 5650Mobility Radeon HD 5570FirePro V4800FirePro V3800Radeon HD 5670Radeon HD 5570Radeon HD 5550RedwoodRadeon Mobility HD 5470Radeon Mobility HD 5430Radeon HD 6370MRadeon HD 6330MCedarFireProFirePro 2460FirePro 2270Radeon HD 7300Radeon HD 5450Radeon HD 7350Cedar LERS100 PCIRS200 PCIRadeon X1800Radeon X1800 XTRadeon Mobility X1800FireGL Mobility V7200FireGL V7200FireGL V5300FireGL Mobility V7100FireGL V7300FireGL V7350Radeon X1600RV505Radeon X1300/X1550Radeon X1550M54-GLRadeon Mobility X1400RADEON X1550 64-bitRadeon Mobility X1300 M52-64Radeon Mobility X1300Radeon X1300FireGL V3300FireGL V3350Radeon X1600 SecRadeon X1300/X1550 SecRadeon X1300 ProRadeon X1450Radeon Mobility X2300Radeon Mobility X1350Radeon Mobility X1450FireMV 2250Radeon X1550 64-bitRadeon X1300 Pro SecRadeon X1300 SecRadeon X1650Radeon X1600 ProFireGL V5200Radeon Mobility X1600Radeon X1650 ProRadeon X1300 XTFireGL V3400Mobility FireGL V5250Radeon X1700Radeon X1700 XTRadeon Mobility X1700Radeon X1600 Pro SecRadeon X1650 Pro SecRadeon X2300HDRadeon Mobility X2300HDRadeon X1950Radeon X1900AMD Stream ProcessorRadeon X1950 ProRV560Radeon Mobility X1900Radeon X1950 GTRV570FireGL V7400Rv560Radeon RX1650 XTRadeon X1950 Pro SecRadeon RX1650 XT SecRadeon 9000/9100 IGPRadeon RS350IGPRS690 HostRS740 HostRS690 PCIERS690M PCIERS690 HD AudioRadeon X1250Radeon X1250 IGPRadeon X1200RS740RS740MRadeon 2100Radeon HD 2900 XTRadeon HD 2900 ProRadeon HD 2900 GTFireGL V8650FireGL V8600Radeon HD 4870Radeon HD 4870 X2Radeon HD 4850Radeon HD 4850 X2FirePro V8750FirePro V7760Mobility Radeon HD 4850Mobility Radeon HD 4850 X2Radeon HD 4800FirePro RV770FireStream 9270FireStream 9250FirePro V8700Mobility Radeon HD 4870Radeon M98Radeon HD 4890FirePro M7750Mobility Radeon HD 4650Mobility Radeon HD 4670Radeon HD 4670Radeon E4600Radeon HD 4600Radeon HD 4650FirePro V7750FirePro V5700FirePro V3750Mobility Radeon HD 4830FirePro M7740RV740Radeon HD 4770Radeon HD 4700FirePro M5750Radeon HD 2400 XTRadeon HD 2400 ProRadeon HD 2400 Pro AGPFireGL V4000Radeon HD 2350Mobility Radeon HD 2400 XTMobility Radeon HD 2400Radeon E2400Radeon HD 2400 Pro PCIFireMV 2260Radeon HD 3870Mobility Radeon HD 3850Radeon HD 3850Mobility Radeon HD 3850 X2Mobility Radeon HD 3870Mobility Radeon HD 3870 X2Radeon HD 3870 X2FireGL V7700Radeon HD 3850 AGPRadeon HD 3690FireStreamRadeon HD 4550Radeon HD 4350Mobility Radeon HD 4300Mobility Radeon HD 4500FirePro RG220Mobility Radeon HD 4330Mobility Radeon HD 2600Mobility Radeon HD 2600 XTRadeon HD 2600 XT AGPRadeon HD 2600 Pro AGPRadeon HD 2600 XTRadeon HD 2600 ProFireGL V5600FireGL V3600Radeon HD 3600Mobility Radeon HD 3650Mobility Radeon HD 3670Mobilty FireGL V5700Radeon HD 3650 AGPRadeon HD 3650Mobility FireGL V5725Radeon HD 3470Mobility Radeon HD 3430Mobility Radeon HD 3400Radeon HD 3450Radeon HD 3450 AGPRadeon HD 3430Radeon HD 3450 PCIFirePro V3700FireMV 2450RS780 HD AudioRadeon HD 3200Radeon HD 3100Radeon HD 3300Radeon HD 3000Radeon HD 6550DRadeon HD 6620GRadeon HD 6370DRadeon HD 6380GRadeon HD 6410DRadeon HD 6520GRadeon HD 6480GRadeon HD 6530DSumoRadeon HD 4200 HD AudioRadeon HD 4200Radeon HD 4100Mobility Radeon HD 4200Mobility Radeon HD 4100Radeon HD 4290Radeon HD 4250Radeon HD 6310Radeon HD 6250Radeon HD 6320Radeon HD 6290Radeon HD 7340Radeon HD 7310Radeon HD 7290ArubaRadeon HD 7660DRadeon HD 7640GRadeon HD 7560DFirePro A300Radeon HD 7620GRadeon HD 7600GRadeon HD 7500GRadeon HD 8650GRadeon HD 8670DRadeon HD 8550GRadeon HD 8570DRadeon HD 8610GRadeon HD 7660GRadeon HD 7520GRadeon HD 7540DRadeon HD 7420GRadeon HD 7480DRadeon HD 7400GRadeon HD 8450GRadeon HD 8470DRadeon HD 8350GRadeon HD 8370DRadeon HD 8510GRadeon HD 8410GRadeon HD 8310GRadeon HD 2600 HD AudioRS690M HD AudioRadeon HD 3870 HD AudioRadeon HD 3600 HD AudioRadeon HD 34xx HD AudioRadeon HD 48xx HD AudioRadeon HD 4000 HD AudioRadeon HD 5800 AudioRadeon HD 5700 AudioRadeon HD 5600 AudioRadeon HD 5470 AudioRadeon HD 6670 AudioRadeon HD 6400 AudioRS100 AGPRS200 AGPRS250 AGPRS200M AGPS5933 PCI MatchmakerMyrinet LANaiAST1150 PCIAST1180AST2000AST2100AR5210AR5311AR5211AR5212AR2413AR5413AR5424AR5416AR5418AR9160AR9280AR9281AR9285AR2427AR9227AR9287AR9300AR9485AR9462AR9565AR5211RefAT76C506IDE-2015PLL1EL1L2CL1CL1DAR8162AR8161AR8172AR8171L2Vortex 1Vortex 2Vortex AdvantageAVL2301AVG2302ALG2301ALG2302ALS4000Dual SerialQuad SerialBRI ISDNFritz ISDNFritz v2.0 ISDNPRI T1 ISDNRT2890F5D6001F5D6020V3F5D7010F5D6000VME 617VME 270655015601BCM43224BCM5752BCM5752MBCM5709BCM5709SBCM5716BCM5716SBCM57811BCM57811 MFBCM57811 VFBCM57787BCM57764BCM5725BCM5702BCM5703BCM5704CBCM5704S AltBCM5706BCM5708BCM5702FEBCM57710BCM57711BCM57711EBCM5705BCM5705KBCM5717BCM5718BCM5719BCM5721BCM5722BCM5723BCM5705MBCM5705M AltBCM5720BCM57712BCM57712 MFBCM5717CBCM5714BCM5714SBCM5780BCM5780SBCM5705FBCM57712 VFBCM5754MBCM5755MBCM5756BCM5751BCM5715BCM5715SBCM5754BCM5755BCM5751MBCM5751FBCM5787FBCM5761EBCM5761BCM57762BCM57767BCM5764BCM57766BCM5762BCM5761SBCM5761SEBCM57800BCM57840 OBSBCM57810BCM57760BCM57788BCM57780BCM5787MBCM57790BCM5782BCM5784BCM5785GBCM5786BCM5787BCM5788BCM5789BCM5785FBCM57840BCM57840 MFBCM57800 MFBCM5702XBCM5703XBCM5704SBCM57800 VFBCM5706SBCM57840 OBS MFBCM5708SBCM57840 VFBCM57810 MFBCM57810 VFBCM57761BCM57781BCM57791BCM57786BCM57765BCM57785BCM57795BCM57782BCM5702 AltBCM5703 AltBCM5781BCM5727BCM5753BCM5753MBCM5753FBCM5903MBCM4401B1BCM5901BCM5901A2BCM5903FBCM5906BCM5906MBCM4303BCM4307BCM4311BCM4312BCM4315BCM4318BCM4319BCM4306BCM4309BCM43XGBCM4321BCM4322BCM43225BCM43227BCM4401BCM4401B0BCM431358015802580558205821582258235825586058615862425/825/42B/82B1010/1020/1007/1741415/815/41B/81B8041860410/420BT848BT849BT878BT879BT878 AudioBT879 AudioBt8474 HDLCMultiMaster NCMultiMasterFlashPointGPPCINITROX XLNITROX LiteNITROX PXOCTEON Plus CN50XXCinemasterNx10 10GbEPE9000 10GbET302E 10GbET310E 10GbET320X 10GbET302X 10GbET320E 10GbET310X 10GbET3B10 10GbET3B20 10GbET3B02 10GbE643106554565548655506555465555685546900069030CL-GD7548CL-GD5430CL-GD5434-4CL-GD5434-8CL-GD5436CL-GD5446CL-GD5480CL-GD5462CL-GD5464CL-GD5465CL-PD6729CL-PD6832 CardBusCL-PD6833 CardBusCL-GD7542CL-GD7543CL-GD7541CS4610 SoundFusionCS4615CS4280/46xx CrystalClearCS4281 CrystalClearVIC PCIEVIC ManagementVIC EthernetVIC FCoEAAR-1210SAAAR-1220SAAAR-1225SAPCI0640PCI0642PCI0643PCI0646PCI0647PCI0648PCI0649PCI0650AUSB0670USB0673PCI0680SiI3112 SATASiI3114 SATASiI3124 SATASiI3131 SATASiI3132 SATASiI3512 SATASiI3531 SATAGigaCardEX110TXSmart Array 64xxTriflex PCIQVisionQVision 1280/pSmart Array 5300Smart Array 5iSmart Array 532Smart Array 5312Smart Array 6iSmart Array 641Smart Array 642Smart Array 6400Smart Array 6400 EMSmart Array 6422Hotplug PCINetelligent ASMCPCI HotplugUSB OpenHostSMART2P RAIDISAPnPNetelligent 10/100TXNetelligent IDENetelligent 10 TIntegrated NetFlex 3/PDP Netelligent 10/100TXProLiant Netelligent 10/100TXEmbedded Netelligent 10/100TXNetelligent 10 T/2 PCISmart Array 5300 rev.2Smart Array 5i/532 rev.2iLONetFlex 3/PNetFlex 3/PBCompexeRL100-ATX 10/100PMAC 9871356k WinmodemSoftK56 PCIHSF 56k HSFiMUSYCC CN8478MUSYCC CN8474MUSYCC CN8472MUSYCC CN8471CX2388xCX2388x AudioCX2388x MPEGCX2388x IRCX2388582C599 VLBCY82C693U ISAFEther CB-TXD 10/100FEther II CB-TXD 10/100CG-LAPCIGTRTL8192ERTL8190PC-Bus II-PCICache Coherency FilterSoundBlaster LiveSoundBlaster AWE64DSoundBlaster AudigySoundBlaster X-FiSoundBlaster Audigy LSSoundBlaster Audigy 2SoundBlaster X-Fi XtremePCI Gameport JoystickSoundBlaster Audigy DigitalEctiva 1938Cyclom-Y below 1MCyclom-YCyclom-4Y below 1MCyclom-4YCyclom-8Y below 1MCyclom-8YCyclom-Z below 1MCyclom-ZIQ80310Cx5510GXm PCIGXm ISACx5530 SouthCx5530 SMICx5530 IDECx5530 XpressAUDIOCx5530 VideoDM9009DM9100DM9102DM9132PCCOM 2-portPCCOM 4-portPCCOM 8-port210502104021030Zephyr NV-RAMKZPSA21140TGA2DEFPA21041DGLPBZLXP-L2Memory Channel Cluster Controller21142/3Farallon PN9000SX210522115021150-BC21152211532115421554SWXCR RAIDPERC 2/SiPERC 3/DiPERC 3/SiDRAC 3 Add-inDRAC 3 Virtual UARTDRAC 3 Embedded/OptionalDRAC 4 Embedded/OptionalDRAC 3 OptionalPERC 4/Di i960PERC 4/Di VerdeDRAC 4DRAC 4 Virtual UARTPERC 4e/DiDRAC 4 SMICPERC 58139Viper/PCIDFE-550TXDFE-530TX+DFE-690TXDDRP32TXDDWL-610DGE-550TDGE-550SXDFE-520TX C1DGE-528TDGE-530T C1DGE-560TDGE-530T B1DGE-560SXDGE-550T B1DGE-530T A1Memory ControlSmartCache/RaidPCI-PCISmartRAIDSmartRAID 2005SPCI-SCIDMX3194UIS64PH ISDNRT2860155P-MF1 ATM25SS-3010 ATMSpeedStream 1023QuickStep 1000 ISDNLPFCLP6000Lancer 10GbELancer 10GbE VFLPe121LPe1250LP952LP982LP101LP1050LP111LP1150LPe111LPe1150LPe1000LPe1000-SPLPe1002-SPLPe12000LPe12000-SPLPe12002-SPLP7000LP8000LP9000LP9802LP10000LPX10000LP10000-SLP11000-SLPe11000-SLPe12000-SLP11000LP11000-SPLP11002-SPLPe11000LPe11000-SPLPe11002-SPEndace Dag3.6DEndace Dag4.23GEFlash memoryMemory StickSD ControllerCB-1211 CardBusCB-1225 CardBusCB-1410 CardBusCB-710 CardBusCB-712 CardBusCB-1420 CardBusCB-720 CardBusCB-722 CardBusAudioPCI97AudioPCICT5880ES366H ModemMaestro IISOLO-1 AudioDriveMaestro 2EES1989ES1989 ModemMaestro 3ES1983 ModemMaestro 3 AudioES366H Fax/ModemES2838/2839 SuperLink ModemES2898 ModemRoadRunner HIPPIRoadRunner Gig-EFreedom GBusWL11000PSST-64PSST-128PSST-16PSST-4pSST-8pXR17C152XR17C154XR17C158ATM PCA-200ATM PCA-200e801 SoundMPC8349EMPC8349MPC8347E TBGAMPC8347 TBGAMPC8347E PBGAMPC8347 PBGAMPC8343EMPC8343FL1000 xHCIFL1009 xHCIPW008GE5PW008GE4PRIMEPOWER250/450 LANioDrive v1.2ioDriveioXtremeioXtreme ProTMC-18C30GL24110P03GL24110PGL24110P02Pulsar G7370 ADSLPR103WinTVPN672TX 10/100Visualize EGVisualize FX6Visualize FX4Visualize FX2Tach TL FibreChannelTach XL2 FibreChannelJ2585AJ2585BDiva Serial MultiportElroy Ropes-PCIVisualize FXeTopToolsNetRaid-4MNetServer SmartIRQ82557B 10/100 NICPluto MIOzx1 IOCMercury Ropes-PCIQuickSilver Ropes-PCISmart Array P430iSmart Array P830iSmart Array P430Smart Array P431Smart Array P830Smart Array P731mSmart Array P230iSmart Array P530Smart Array P531Smart Array V100Smart Array E200iSmart Array E200Smart ArraySmart Array P800Smart Array P600Smart Array E500Smart Array P400Smart Array P400iSmart Array P700mSmart Array P212Smart Array P410Smart Array P410iSmart Array P411Smart Array P812Smart Array P712mSmart Array P711miLO3 SerialiLO3 SlaveiLO3 ManagementiLO3 WatchdogSmart Array P222Smart Array P420Smart Array P421Smart Array P822Smart Array P420iSmart Array P220iSmart Array P721m7751650079517814/7851/785480658165815479567955/7954HB6HB4MSVCC01 Video CaptureSH7751 PCISH7751R PCIMCACPU - Alta LiteCPU - Alta MPISA w/PnPCPUAuto LANStreamerGXT-150P82G267582351Miami/PCIOlympici82557B 10/100RSAFireGL2133 PCIX-PCIX4810 BSP4810 SCCCalgary IOMMUEnvy24 I/O CtrlrEnvy24PT/HT Audio77201/77211 ATM89HPES12N3A89HPES24N3A89HPES24T689HPES4T489HPES5T5ZB89HPES24T3G2WDT 50x Watchdog TimerINIC-850INIC-1060INIC-940INIC-941INIC-950VirtualBox Graphics AdapterVirtualBox Guest ServiceIPN2120IPN222050265027502888498853Twin Turbo 128Twin Turbo 3DEES ISA21145Core HostCore PCIEHD Graphics3400 PCIECentrino Advanced-N 6205WiFi Link 1000Centrino Advanced-N 6250WiFi Link 1030Centrino Advanced-N 6030Core 2G HostCore 2G PCIEHD Graphics 2000Xeon E3-1200 HostHD Graphics P3000HD Graphics 3000Core 3G HostCore 3G PCIEHD Graphics 2500Xeon E3-1200 v2 HostHD Graphics 4000HD Graphics P400080303 IOP80312 I/O Companion6700PXH PCIE-PCIX6702PXH PCIE-PCIXIOP332 PCIE-PCIXIOP331 PCIX-PCIX41210 PCIE-PCIXIOP333 PCIE-PCIXDH89XXCC SGMIIDH89XXCC SerDesDH89XXCC backplaneHD Graphics 4600HD Graphics P4600DH89XXCC SFP82375EB EISA82424ZX Cache/DRAM82378IB ISA82426EX ISA82434LX/NXGDT RAIDCentrino Advanced-N 6235Centrino Wireless-N 6150Centrino Wireless-N 2230Centrino Wireless-N 2200Centrino Wireless-N 135Centrino Wireless-N 105Centrino Wireless-N 130Centrino Wireless-N 100Dual Band Wireless AC 7260Dual Band Wireless AC 3160Dual Band Wirelsss AC 3160Dual Band Wireless AC 7265i960 RPi960 RMi960 RNCore 4G HostCore 4G HD AudioHD Graphics 5000Iris Graphics 5100Atom D2000/N2000 VideoAtom D2000/N2000 HostCore 4G PCIEXeon E3-1200 v3 HostIris Pro Graphics 52008254282543GC82544EI82544GC82540EM82545EM82546EB82541EI82540EP82547EI82545GMPRO/10082559PRO/100 VEPRO/100 VM82562EH HomePNA82801DB LANV.92 ModemPRO/Wireless 210082597EXICH8 IGP M AMTICH8 IGP AMTICH8 IGP CICH8 IFEICH8 IGP MPRO/100 M82571EB82801FB LAN82801FBM LAN82801GB LAN82547GI82541GI82541ER82546GB82572EI82573E82573E IDE82573E KCS82573E Serial80003ES282573L82575EB82573V82598ICH9 IGP AMTICH9 IGP MICH9 IFEICH9 IFE GICH9 IFE GTICH8 IFE GTICH8 IFE G82598AF82598AT82576ICH9 IGP M VICH10 R BM LMICH10 R BM LFICH10 R BM V82574L82571PT82575GB82598EBICH10 D BM LMICH10 D BM LFICH9 BM82577LM82577LC8259982578DM82578DCICH9 IGP M AMT8255282815 Host82815 AGP82815 Video82806AA APIC82559ER82092AA IDESAA711682452KX/GXEE Pro 10 PCIEE Pro 100EE Pro 100 Smart8255x82437FX82371FB ISA82371FB IDE82371 ISA and IDE82437MX82441FX82380AB Mobile ISA82380FB Mobile82439HX82806AA82870P2 PCIX-PCIX82870P2 IOxAPIC82870P2 Hot PlugICH8 82567V-382579LM82579V82576NS82583V82576 SerDes QP8258082599 T3I350I350 FiberI350 SerDesI350 SGMII82580 QFX540TI210I210 FiberI210 SerDesI210 SGMIII211I217-LMI217-VI218-LMI218-V80960RP ATU82840 Host82840 AGP82840 PCI82845 Host82845 AGPI/OAT7 Series xHCI6 Series SATA6 Series AHCI6 Series RAID6 Series PCIE6 Series HD Audio6 Series SMBus6 Series Thermal6 Series DMI-PCI6 Series USB6 Series MEI6 Series KTZ68 LPCP67 LPCUM67 LPCHM65 LPCH67 LPCHM67 LPCQ65 LPCQS67 LPCQ67 LPCQM67 LPCB65 LPCC202 LPCC204 LPCC206 LPCH61 LPCC600 SATAC600 AHCIC600 RAIDC600 PCIEC600 HD AudioC600 SMBusC600 ThermalC600 USBC600 LANC600 MEIC600 Virtual PCIEC600 LPC7 Series SATA7 Series AHCI7 Series RAID7 Series PCIE7 Series HD Audio7 Series SMBus7 Series USB7 Series MEI7 Series KTZ77 LPCZ75 LPCB75 LPCH77 LPCC216 LPCQM77 LPCHM77 LPCUM77 LPCHM76 LPCHM75 LPCHM70 LPCNM70 LPCAtom C2000 HostAtom C2000 PCIEAtom C2000 RASAtom C2000 SMBusAtom C2000 RCECAtom C2000 SATAAtom C2000 AHCIAtom C2000 USBAtom C2000 PCUAtom C2000 PCU SMBusI354I354 SGMII82801AA LPC82801AA IDE82801AA USB82801AA SMBus82801AA AC9782801AA Modem82801AA Hub-to-PCI82801AB LPC82801AB IDE82801AB USB82801AB SMBus82801AB AC9782801AB Modem82801AB Hub-to-PCI82801BA LPC82801BA USB82801BA SMBus82801BA AC9782801BA Modem82801BAM Hub-to-PCI8256282801BAM IDE82801BA IDE82801BAM LPC82801BA Hub-to-PCI82801E LPC82801E USB82801E SMBus82801E LAN82801CA LPC82801CA/CAM USB82801CA/CAM SMBus82801CA/CAM AC9782801CA/CAM Modem82801CAM IDE82801CA IDE82801CAM LPC82801DB LPC82801DBL IDE82801DB USB82801DB SMBus82801DB AC9782801DB Modem82801DBM IDE82801DB IDE82801DBM LPC82801EB/ER LPC82801EB SATA82801EB/ER USB82801EB/ER SMBus82801EB/ER AC9782801EB/ER Modem82801EB/ER IDE82801EB/ER USB282801ER SATA82820 Host82820 AGP82850 Host82860 Host82850/82860 AGP82860 PCIE7500 HostE7500 Error ReportingE7500 PCIE7501 HostE7505 HostE7505 Error ReportingE7505 AGPE7505 PCI82845G Host82845G AGP82845G Video82865G Host82865G AGP82865G Video82865G CSA82865G Overflow82875P Host82875P AGP82875P CSA82915G Host82915G PCIE82915G Video82925X Host82925X PCIEE7221 HostE7221 PCIEE7221 Video82915GM Host82915GM PCIE82915GM Video6300ESB LPC6300ESB IDE6300ESB SATA6300ESB SMBus6300ESB AC976300ESB Modem6300ESB USB6300ESB WDT6300ESB APIC6300ESB PCIX5000X Host5000Z Host5000V Host5000P Host5000 PCIE5000 Error Reporting5000 Reserved5000 FBD5000 PCIE x85000 PCIE x16E8500 HostE8500 PCIEE8500 PCIE x8E8500 IMIE8500 FSB/Boot/InterruptE8500 Address MappingE8500 RASE8500 MiscE8500 ReservedE8500 XMBE8500 XMB MiscE8500 XMB MAIE8500 XMB DDRE8500 XMB Reserved82801FB LPC82801FBM LPC82801FB SATA82801FR SATA82801FBM SATA82801FB USB82801FB PCIE82801FB HD Audio82801FB SMBus82801FB Modem82801FB AC9782801FB IDE6321ESB LPC6321ESB SATA6321ESB AHCI6321ESB RAID6321ESB USB6321ESB PCIE6321ESB AC976321ESB Modem6321ESB HD Audio6321ESB SMBus6321ESB IDE82945G Host82945G PCIE82945G Video82955X Host82955X PCIEE7230 HostE7230 PCIE82975X PCIE82975X Host82945GM Host82945GM PCIE82945GM Video82945GME Host82945GME Video82801GH LPC82801GB LPC82801GBM LPCNM10 LPC82801GHM LPC82801GB SATA82801GR AHCI82801GR RAID82801GBM SATA82801GBM AHCI82801GHM RAID82801GB USB82801GB PCIE82801GB HD Audio82801GB SMBus82801GB Modem82801GB AC9782801GB IDE82801G PCIE82801H LPC82801HEM LPC82801HH LPC82801HO LPC82801HBM LPC82801H SATA82801H AHCI82801H RAID82801HBM SATA82801HBM AHCI82081HBM RAID82801H SMBus82801H DMI-PCI82801H USB82801H PCIE82801H HD Audio82801H Thermal82801HBM IDE82801IH LPC82801IO LPC82801IR LPC82801IEM LPC82801IB LPC82801IBM LPC82801I SATA82801I AHCI82801I RAID82801I SMBus82801I Thermal82801I USB82801I HD Audio82801I PCIEICH9 IGP C82946GZ Host82946GZ PCIE82946GZ Video82946GZ HECI82946GZ PT IDER82946GZ KT82G35 Host82G35 PCIE82G35 Video82G35 HECI82Q965 Host82Q965 PCIE82Q965 Video82Q965 HECI82Q965 PT IDER82Q965 KT82G965 Host82G965 PCIE82G965 Video82G965 HECI82G965 PT IDER82G965 KT82Q35 Host82Q35 PCIE82Q35 Video82Q35 HECI82Q35 PT IDER82Q35 KT82G33 Host82G33 PCIE82G33 Video82G33 HECI82G33 PT IDER82G33 KT82Q33 Host82Q33 PCIE82Q33 Video82Q33 HECI82Q33 PT IDER82Q33 KT82X38 Host82X38 PCIE82X38 HECI82X38 PT IDER82X38 KT3200/3210 Host3200/3210 PCIE3210 PCIEGM965 HostGM965 PCIEGM965 VideoGM965 KTGM965 PT IDERGME965 HostGME965 PCIEGME965 VideoGME965 HECIGME965 PT IDERGME965 KTGM45 HostGM45 PCIEGM45 VideoGM45 HECIGM45 PT IDERGM45 KT4 Series VideoQPI LinkQPI PhysicalQ45 HostQ45 PCIEQ45 VideoQ45 HECIQ45 PT IDERQ45 KTG45 HostG45 PCIEG45 VideoG41 HostG41 VideoB43 VideoRCU32 I2O RAID3124 SATA31244 SATA82855PM Host82855PM AGP82855PM Power5500 HostX58 Host5520 HostX58 PCIE5520/X58 QuickPath5520 QuickPathX58 GPIOX58 RASX58 QuickPathX58 QuickDataX58 IOxAPICX58 MiscX58 ThrottleX58 TXT6321ESB IOxAPIC6321ESB PCIE-PCIX82830M Host82830M AGP82830M Video82855GM Host82855GME AGP82855GM Video82855GM Memory82855GM Config82854 Host82854 VideoE7520 HostE7520 Error ReportingE7320 HostE7320 Error ReportingE7520 DMAE7520 PCIEE7520 ConfigE7525 Host3100 Host3100 Error Reporting3100 EDMA3100 PCIE7300 Host7300 PCIEI/OAT CNB7300 FSB/Boot/Interrupt7300 Snoop Filter7300 Misc7300 FBD82801JD SATA82801JD AHCI82801JD RAID82801JDO LPC82801JIR LPC82801JIB LPC82801JD LPC82801JI SATA82801JI AHCI82801JI RAID82801JI SMBus82801JI USB82801JI HD Audio82801JI PCIE82801JDO VECI82801JD Virtual SATA82801JD SMBus82801JD Thermal82801JD USB82801JD HD Audio82801JD PCIE82801JD LANP55 LPCPM55 LPCH55 LPCQM57 LPCH57 LPCHM55 LPCQ57 LPCHM57 LPCQS57 LPC3400 LPC3420 LPC3450 LPC3400 SATA3400 AHCI3400 RAID3400 SMBus3400 Thermal3400 USB3400 HD AudioQS57 HD Audio3400 MEI3400 PT IDER3400 KTE5 HostE5 PCIEE5 DMAE5 Address MapE5 Error ReportingE5 I/O APIC5400 Host5400A Host5400B Host5400 PCIEI/OAT SNB5400 FSB/Boot/Interrupt5400 Coherency Engine5400 IOAPIC5400 RASE600 HostPRO/Wireless 2200BGPRO/Wireless 2225BGPRO/Wireless 3945ABGPRO/Wireless 2915ABGWireless WiFi Link 4965Centrino Ultimate-N 6300Centrino Advanced-N 6200WiFi Link 5100WiFi Link 5300WiFi Link 5350WiFi Link 5150Turbo MemoryEP80579 HostEP80579 MemoryEP80579 EDMAEP80579 PCIEEP80579 SATAEP80579 AHCIEP80579 ASUEP80579 ReservedEP80579 LPCEP80579 SMBusEP80579 USBEP80579EP80579 CANbusEP80579 SerialEP80579 1588EP80579 LEBEP80579 GCUEP80579 LANi960 RDPRO 100 Server5100 Host5100 PCIE5100 FSB5100 Reserved5100 DDRI/OAT SCNB82371SB ISA82371SB IDE82371SB USB82437VX82439TX82371AB PIIX4 ISA82371AB IDE82371AB USB82371AB Power82810 Host82810 Video82810-DC100 Host82810-DC100 Video82810E Host82810E Video82443LX AGP82443BX AGP82443BX82440MX Host82440MX AC9782440MX Modem82440MX ISA82440MX IDE82440MX USB82440MX Power82440BX AGP82443GX82372FB IDE82740 AGPUS15W HostUS15L/UL11L HostUS15W VideoUS15L/UL11L VideoSCH PCIESCH USBSCH USB ClientSCH LPCSCH IDESCH HD AudioSCH SD/MMCE600 PCIEE600 VideoE600 ConfigE600 LPC82450KX/GX82450KX/GX Memory82451NX Mem & IO82454NX PXBEG20T PCIEEG20T Packet HubEG20T EthernetEG20T GPIOEG20T USBEG20T USB ClientEG20T SDIOEG20T AHCIEG20T DMAEG20T SerialEG20T SPIEG20T I2CEG20T CANEG20T 158882802AC Firmware Hub 8Mbit82802AB Firmware Hub 4Mbit8 Series SATA8 Series AHCI8 Series RAID8 Series PCIE8 Series HD Audio8 Series SMBus8 Series Thermal8 Series USB8 Series xHCI8 Series MEI8 Series IDER8 Series KTZ87 LPCZ85 LPCHM86 LPCH87 LPCHM87 LPCQ85 LPCQ87 LPCQM87 LPCB85 LPCC222 LPCC224 LPCC226 LPCH81 LPCI2O RAIDRCU21 I2O RAIDRCUxx I2O RAIDRCU31 I2O RAIDRCU31L I2O RAID8 Series LPCPineview DMIPineview VideoS21152BB21154AE/BECore DMICore QPI LinkCore QPI RoutingCore ManagementCore ScratchCore ControlCore MiscPowerstorm 4D50TIntense 3DExpert3D5526 FibreChannelPRISM3PRISM2.5Prism IndigoPrism Javelin/XbowPrism GT/DuetteAEONGV-BCTV3AGX016ITT3204 MPEG DecoderIT8211FIT8212FIT8213FIT8330GIT8888F ISAIT8892E PCIE-PCIIT8893E PCIE-PCIJMC250JMC260JMB360 SATAJMB361 IDE/SATAJMB362 SATAJMB363 IDE/SATAJMB365 IDE/SATAJMB366 IDE/SATAJMB368 IDExDKTIHSSIDS3SSIDS1HSSIcAppian LiteParallelDual ParallelS3 805Leadtek WinFast TV 2000Leadtek WinFast TV 2000 XPLXT1001EG1032EG1064PCMPC200PCM200PNICPNIC-II8031K56flex DSVD LTMODEMLTMODEMVenus ModemUSB 2-portUSB QuadraBusFW322 1394FW643 1394ET1310LS242 DVD DecoderPMAC 98715PMAC 98727MX86250Smart 16/4 PCI RingnodeSmart 16/4 PCI Ringnode Mk2Smart 16/4 PCI Ringnode Mk3Smart 16/4 PCI Ringnode Mk116/4 CardbusPresto PCISmart 100/16/4 PCI-HS RingnodeSmart 100/16/4 PCI Ringnode16/4 CardBus Mk2Collage 25 ATMCollage 155 ATMi740 PCILibertas 88W8300Libertas 88W8310Libertas 88W8335Yukon 88E8001/8003/8010Yukon 88E8021CUYukon 88E8022CUYukon 88E8061CUYukon 88E8062CUYukon 88E8021XYukon 88E8022XYukon 88E8061XYukon 88E8062XYukon 88E8035Yukon 88E8036Yukon 88E8038Yukon 88E8039Yukon 88E8040Yukon 88E8040TYukon 88EC033Yukon 88E8042Yukon 88E8048Yukon 88E8052Yukon 88E8050Yukon 88E8053Yukon 88E8055Yukon 88E8056Yukon 88E8070Yukon 88EC036Yukon 88EC032Yukon 88EC034Yukon 88EC042Yukon 88E8058Yukon 88E8071Yukon 88E8072Yukon 88E8075Yukon 88E8057Yukon 88E8059Yukon (Belkin F5D5005)88SX5040 SATA88SX5041 SATA88SX5080 SATA88SX5081 SATA88SX6040 SATA88SX6041 SATA88SX6042 SATA88SX6080 SATA88SX6081 SATA88SE6101 IDE88SE6111 SATA88SE6120 SATA88SE6121 SATA88SE6122 SATA88SE6140 SATA88SE6141 SATA88SE6145 SATA88SX7042 SATA88SE9120 SATA88SE9123 SATA88SE9125 SATA88SE9172 SATAMGA PX2085MGA Millenium 2064WMGA 1064SG 220MHzMGA Millennium II 2164WMGA Millennium II 2164WA-B AGPMGA G200 PCIMGA G200 AGPMGA G200eMGA G400/G450 AGPMGA G200eWMGA G200eHMGA ImpressionMGA G100 PCIMGA G100 AGPMGA 1064SGMGA G400 Twin HeadMGA G550 AGPMGA P650 PCIeMGA G200eRMGA Millennium G200 SDMGA Produktiva G100 SDMGA Mystique G200 SDMGA Millennium G200 SGMGA Marvel G200 SDIS200 BB16PCI958PCI32PCI509PCI511PEX511GPS170PCIConnectX ENKSZ8841 10/100KSZ8842 dual-port 10/100 switchRT3090MN-120 10/100MN-130 10/1002IVDC-PCX1MiroVIDEO DC20Media 3DMiroVIDEO DC10/DC20Powerstorm 4D30TGUI AccelSerial MCS9865MPC105 PCIMPC106 PCISM56Raven PCICP-114C104HCP-104ULCP-104JUC168HDMA4 serialDAC960P V2 RAIDDAC960P V3 RAIDDAC960P V4 RAIDDAC960P V5 RAIDAcceleRAIDeXtremeRAIDZ8EMyrinet LANai 9.2MTD800 10/100MTD803 10/100MTD891 10/100/1000MV1000CH352NCP130NCP130A2PCI-GPIBNET2282 USBNXB-10GXxRNXB-10GCX4NXB-4GCUIMEZ 10GbEHMEZ 10GbEIMEZ 10GbE MgmtHMEZ 10GbE MgmtNX3031DP83810 10/100PC87415 IDE87560 Legacy I/ODP83815 10/100DP83820 10/100/1000CS5535 HostCS5535 ISACS5535 IDECS5535 AUDIOCS5535 USBCS5535 VIDEOSaturnSCx200 ISASCx200 SMISCx200 IDESCx200 AUDIOSCx200 VIDEOSCx200 X-BUSSC1100 ISASC1100 SMISC1100 X-BusNS87410PowerVR PCX2I/OVersa MaestroVersa Va26D MaestroMagicgraph NM2070Magicgraph 128VMagicgraph 128ZVMagicgraph NM2160Magicgraph NM2200Magicgraph NM2360MagicMedia 256AV+MagicMedia 256XL+MagicMedia 256AVMagicMedia 256ZXXframeXframe IIMA301GA620GA620TNm9805Nm9820Nm9835Nm9845Nm9865Nm9901Nm9922CMI8338A AudioCMI8338B AudioCMI8738/C3DX AudioCMI8738B AudioHSP56 AMRCMI8788 HD AudioNSP2KNetVin 5000Universe VMETsi381 PCIE-PCIFalcon PFalcon SEF100253c81053c82053c82553c81553c810AP53c86053c1510D53c89653c89553c88553c87553c151053c895A53c1010-3353c1010-6653c103053c1030ZC53c103553c1035ZCSAS1064SAS1068SAS1064ESAS1068ESAS1066EMegaRAID SAS2208SAS1064ASAS1066SAS1078SAS2116SAS2308SAS2004SAS2008MegaRAID SAS2008SAS2108MegaRAID SAS2108 CRYPTO GEN2MegaRAID SAS2108 GEN2SAS1078DESAS220853c875JMegaRAID 320MegaRAID 320-2EMegaRAID SATA 4x/8xMegaRAID SAS 1064RMegaRAID Verde ZCRFC909FC909AFC929FC919FC929XFC919XFC949XFC939XFC949EYellowfin61C10263C81553c1030RPacket Engines G-NICPI7C21P100 PCIX-PCIXPI7C9X130 PCIE-PCIXFNW-3603-TX 10/100FNW-3800-TX 10/100NX82C501 PCINDR4600 PCIBS21 10/100E-mobility WirelessImagine-128Imagine-128 IIImagine-128 T2RImagine-128 T2R4NV1DAC64Riva TNTRiva TNT2Riva TNT2 UltraVantaMCP04 ISAMCP04 SMBusMCP04 IDEMCP04 SATAMCP04 LANMCP04 AC97MCP04 USBMCP04nForce4 ISAnForce4 SMBusnForce4 IDEnForce4 SATACK804 LANnForce4 AC97nForce4 USBnForce4nForce4 PCIEnForce4 DDRnForce2 ISAnForce2 SMBusnForce2 IDEnForce2 LANnForce2 USBnForce2 AC97nForce2 AudionForce2nForce2 FireWireMCP04 PCIEnForce2 400 ISAnForce2 400 SMBusnForce2 400 IDEnForce3 LANnForce2 400 USBnForce2 400 AC97nForce2 400nForce2 400 SATAGeForce 7800 GTXGeForce 7800 GTAladdin TNT2GeForce Go 6800GeForce Go 6800 UltraQuadro FX Go1400Quadro FX 1400nForce3 ISAnForce3 PCI HostnForce3CK804nForce3 SMBusnForce3 IDEnForce3 USBnForce3 ModemnForce3 AC97nForce3 250 ISAnForce3 250 PCI HostnForce3 250 AGPnForce3 250 SATAnForce3 250 SMBusnForce3 250 IDEnForce3 250 USBnForce3 250 AC97nForce3 250GeForce 6600 GT AGPGeForce 6600GeForce 7800 GSGeForce 6800 GTGeForce 5300 PCXQuadro FX 330GeForce256GeForce256 DDRQuadroGeForce2 MXGeForce2 MX 100GeForce2 GoQuadro2 MXRGeForce 6600 GTGeForce 6600 GoGeForce2 GTSGeForce2 TiGeForce2 UltraQuadro2 ProGeForce 6200Quadro NVS 285GeForce Go 6200GeForce4 MX 460GeForce4 MX 440GeForce4 MX 420GeForce4 440 GoGeForce4 420 GoGeForce4 420 Go 32MQuadro4 500XGLGeForce4 440 Go 64MQuadro4 200/400NVSQuadro4 550XGLQuadro4 GoGLGeForce4 MX 440 AGPGeForce4 MX 440SE AGPGeForce 4 MX 420 AGPGeForce4 MX 4000Quadro4 580 XGLQuadro4 NVSQuadro4 380 XGLGeForce 8800 GTXGeForce 8800 GTSGeForce2 Crush11nForce PCI HostnForce 220 DDRnForce 420 DDRnForce 220/420nForce APUnForce AC97nForce ISAnForce SMBusnForce AGPnForcenForce IDEnForce USBnForce LANGeForce 7300 LEGeForce 7200 GSGeForce 7300 GoGeForce 7400 GoGeForce 7300 GSnForce2 PCInForce2 AGPGeForce4 MX nForce GPUGeForce3GeForce3 Ti 200GeForce3 Ti 500Quadro DCCGeForce 6150GeForce 6150 LEGeForce 6100GeForce Go 6150GeForce Go 6100GeForce4 Ti 4600GeForce4 Ti 4400GeForce4 Ti 4200Quadro4 900 XGLQuadro4 750 XGLQuadro4 700 XGLMCP51 ISAMCP51 SMBusMCP51 IDEMCP51 SATAMCP51 LANMCP51 AC97MCP51 HD AudioMCP51 USBMCP51MCP51 HostMCP51 PMUMCP51 MemoryC51 MemoryGeForce4 Ti 4800GeForce4 Ti 4200 GoGeForce 7900 GT/GTOGeForce Go 7950 GTXQuadro FX 3500GeForce 7600 GTGeForce 7600 GSC51 HostC51 PCIEGeForce FX 5800 UltraGeForce FX 5800GeForce FX 5600 UltraGeForce FX 5600GeForce FX Go 5600GeForce FX Go 5650GeForce FX 5200 UltraGeForce FX 5200GeForce FX Go 5200GeForce FX 5500GeForce FX 5100Quadro FX 500/600GeForce FX Go 5300GeForce FX Go 5100GeForce FX 5900 UltraGeForce FX 5900GeForce FX 5950 UltraGeForce FX 5700LEGeForce FX Go 5700MCP55 ISAMCP55 SMBusMCP55 MemoryMCP55 USBMCP55 IDEMCP55MCP55 HD AudioMCP55 LANMCP55 PCIEMCP55 SATAGeForce 7300 GTGeForce 7600 GoC55 HostC55 MemoryC55 PCIEGeForce 6100 nForce 430GeForce 6100 nForce 405GeForce 7025 nForce 630aMCP61 ISAMCP61 MemoryMCP61 HD AudioMCP61 LANMCP61 SATAMCP61 PCIEMCP61 SMBusMCP61 IDEMCP61 USBMCP61MCP61 SMUGeForce 8600 GTGeForce 8600M GTQuadro FX 570MGeForce 8500 GTGeForce 8400 GSGeForce 8400M GSGeForce 8400M GMCP65 ISAMCP65 MemoryMCP65 SMBusMCP65 IDEMCP65 PCIMCP65 HD AudioMCP65 AHCIMCP65 LANMCP65 USBMCP65 PCIEMCP65 SATAGeForce GTX 285GeForce 7000MGeForce 7050 PVMCP67 MemoryMCP67 SMBusMCP67 Co-processorMCP67 ISAMCP67 LANMCP67 SATAMCP67 AHCIMCP67 RAIDMCP67 HD AudioMCP67 USBMCP67 IDEMCP67 PCIMCP67 PCIEMCP77 MemoryMCP77 PCIEMCP73 USBMCP73 IDEMCP73 PCIEnForce 200GeForce 9800 GTXGeForce 8800 GTGeForce 9800 GTGeForce 9600 GTGeForce 9300 GEGeForce 9300M GSQuadro NVS 150mQuadro NVS 160mMCP77 SMBusMCP77 Co-processorMCP77 IDEMCP77 PCIMCP77 ISAMCP77 LANMCP77 HD AudioMCP77 USBMCP73 HostMCP73 MemoryMCP73 ISAMCP73 SMBusMCP73 LANGeForce 7100GeForce 7050MCP73 SATAMCP73 AHCIMCP73 RAIDMCP73 HD AudioGeForce 8200m GGeForce 9100GeForce 8200nForce 780a SLIGeForce 9400GeForce 9400mGeForce 9300ION VGAGeForce 320MGeForce 210MCP79 HostMCP79 MemoryMCP79 PCIEMCP79 SMBusMCP79 Co-processorMCP79 USBMCP79 ISAMCP79 LANMCP79 SATAMCP79 AHCIMCP79 RAIDMCP79 HD AudioMCP77 SATAMCP77 AHCIMCP77 RAIDGF108 HD AudioGF116 HD AudioMCP89 HostMCP89 MemoryMCP89 PCIEMCP89 SMBusMCP89 Co-processorMCP89 LANMCP89 LPCMCP89 SATAMCP89 AHCIMCP89 RAIDMCP89 HD AudioMCP89 USBGeForce 425MGeForce GTX 550 TiOTI107OC2325OC2183OC232682C092G82C557 Host82C558 ISA82C568 IDE82D568 IDE82C621 IDE82C70082C70182C82282C8613G+ UMTS HSDPA010L100L110L200L210L400L800Lx10H100H200H400H/800H800H200HV2011HOX16PCI954OX16PCI954KExsys EX-41092OXCB950OXmPCI954OXmPCI954 DisabledExsys EX-41098OX16PCI954 ParallelOX16PCI952OX16PCI952 ParallelOXPCIE952 ParallelOXPCIE952 SerialQStor SATAPMC/GNIC2ToolsRZ1000HSP MicroModem 56Virtio NetworkVirtio StorageVirtio MemoryVirtio ConsoleVirtio SCSICMIC-LECNB20-LE HostCNB20HE HostCNB20LE HostCIOB30CMIC-HECMIC-WS HostCNB20-HE HostCMIC-GC HostGCNB-LE HostHT-1000 PCICIOB-X2 PCIXHT-1000 PCIXCIOB-EHT-2000 PCIXHT-2000 PCIEHT-2100 PCIEOSB4CSB5CSB6HT-1000OSB4 IDECSB5 IDECSB6 RAID/IDEHT-1000 IDECSB6 IDEOSB4/CSB5 USBCSB6 USBHT-1000 USBCSB5 LPCGCLE-2 HostHT-1000 LPCK2 SATAFrodo4 SATAFrodo8 SATAHT-1000 SATAHT-1100HT-1100 SATAVerite 1000Verite V2x00SH7757 PCIE-PCISH7757 PCIE SwitchT1/E1/J1Dual T1/E1/J1Quad T1/E1/J1ISP156x USBSAA7130 TVSAA7133 TVSAA7134 TVSAA7135 TVSAA7231 TVPS5000PT80C826PT86C521PT86C523PC87550PT86C523_2PCC-ISESPCI PC WDES1849I/O 1076I/O 1077PCI 6520PEX 8112PEX 8114PEX 8517PEX 8518PEX 8524PEX 8525PEX 8532PEX 8533PEX 8547PEX 8548PEX 8603PEX 8612PEX 8613PEX 8614PEX 8616PEX 8624PEX 8632PEX 8648PEX 8724I/O 9016I/O 9050I/O 9080Cronyx OmegaPDC20265PDC20263PDC20275PDC20318PDC20319PDC20371PDC20379PDC20378PDC20375PDC20376PDC20377PDC40719PDC40519PDC20771PDC20571PDC20579PDC40779PDC40718PDC40518PDC20775PDC20575PDC42819PDC20267PDC20246PDC20262PDC20268PDC20269PDC20276DC5030PDC20268RPDC20271PDC20617PDC20620PDC20621PDC20618PDC20619PDC20277ISP10160ISP1020ISP1022ISP1080ISP12160ISP1240ISP1280ISP2100ISP2200ISP2300ISP2312ISP2322ISP2422ISP2432ISP2512ISP2522ISP2532ISP4010 iSCSI TOEISP4022 iSCSI TOEISP4032 iSCSI TOEISP4010 iSCSI HBAISP4022 iSCSI HBAISP4032 iSCSI HBAISP5422ISP5432ISP6312ISP6322ISP8432PWDOG185008580RT2460ART2560RT2561SRT2561RT2661RT2760RT2790RT3060RT3062RT3091RT3092RT3290BluetoothRT3562RT3592RT3593RT5390R1010 IDER1011 IDER6021 HostR6031 ISAR6040 EthernetR6060 USBR6061 USBRTS5209 Card ReaderRTS5227 Card ReaderRTS5229 Card ReaderRTS5249 Card ReaderRTL8411B Card ReaderRTL8411 Card Reader80298139D81298101E81388169SC816881698192SE818081858188CERTL8192CE8187SE5C465 CardBus5C466 CardBus5C475 CardBus5C476 CardBus5C477 CardBus5C478 CardBus5C521 Firewire5C551 Firewire5C552 Firewire5C592 Memory Stick5C822 SD/MMC5C832 Firewire5C843 MMC5C852 xD5U230 Memory Stick5U822 SD/MMC5U823 SD/MMC5U832 Firewire5U852 SD/MMCRS56/SP-PCI11P1 ModemViRGETrio32Trio32/64Aurora64V+Trio64UV+868ViRGE VX86C92886C864-086C864-186C864-286C864-386C964-086C964-186C964-286C964-386C968-086C968-186C968-286C968-3Trio64V2/DXPlatoTrio3D AGPViRGE DX/GXViRGE GX2Trio3 DX2Savage 3DSavage 3DMSavage 4ProSavage PM133ProSavage KM133ViRGE MXViRGE MXPSavage/MX-MVSavage/MXSavage/IX-MVSavage/IXSuperSavage MX/128SuperSavage MX/64SuperSavage MX/64CSuperSavage IX/128 SDRSuperSavage IX/128 DDRSuperSavage IX/64 SDRSuperSavage IX/64 DDRSuperSavage IX/C SDRSuperSavage IX/C DDRTwisterTwister-KProSavage DDRProSavage DDR-KSonicVibesSafeXcelMagicLAN SWL-2210PXP941A10xNeo-4Neo-8SK-98xxSK-98xx v2.0SK-9D21SK-9SxxSK-9821SK-9843SK-9ExxSK-9E21MBladeEngine2 10GbEBladeEngine3 10GbEIOC3Rad1TigonIOC4ImageSync 1STG 2000XSTG 1764Kyro-IISTG 1764X64GXDVDmagic-PROSC9230186C201 AGP86C202 AGP648FX AGP86C20585C503 System5595 System85C503 ISA180 SATA181 SATA182 SATA183 SATA1901915597/5598 VGA6215300/305/630 VGA315 Pro VGA85C50185C49685C596530 PCI540 PCI550 PCI85C601 EIDE620 PCI630 PCI633 PCI635 PCI640 PCI645 PCI646 PCI648 PCI649 PCI650 PCI651 PCI652 PCI655 PCI656 PCI658 PCI661 PCI662 PCI671 PCI730 PCI733 PCI735 PCI740 PCI741 PCI745 PCI746 PCI748 PCI750 PCI751 PCI752 PCI755 PCI756 PCI760 PCI900 10/100BaseTX961 ISA962 ISA963 ISA964 ISA965 ISA966 ISA968 ISA1182 SATA1183 SATA1184 RAID1185 AHCI540 VGA530 VGA551155125513 EIDE5518 EIDE5571 PCI558155825591 PCI55965597/5598 Host6204650 VGA6326 VGA6330 VGA5597/5598 USB7002 USB7007 FireWire7012 AC977013 Modem7016 10/100BaseTX7018 Audio7019 Audio7300 VGA966 HD Audio83C17083C175FDC 37C665FDC 37C922Voyager GXLynxEMLynxEM+Lynx3DMLynxELynxE+Lynx3D910Victory66 IDEVictory66 ISAVictory66 USBVictory66 PowerPirahna 2-portTulip, power, switch extenderFPGA I-Bus Tracer for MBDSZB6120CXD1947A FireWireCXD3222 FireWireMemory Stick SlotRS780EasyIOVelocity128PCIO EBus2HMERIO EBusERI EtherGEMSimbaCrypto 5821Crypto 1KCrypto 6KPsycho PCImicroSPARC IIep PCIUltraSPARC IIi PCIUltraSPARC IIe PCICassiniNeptuneSBBCST201ST1023ST202140XX4018A50XXNE-344S2P4SSpectrum24 LA41X382C10182C10382C10582C565 ISAMC322TC9021 GigEB2C2 Sky2PCTN3009TN3010TN3014DC-290(M)DC-690CDC-3x5UTerratec TV+Terratec TValueTerratec TValue RadioTLAN3DLabs Permedia3DLabs Permedia 2TSB12LV21 FireWireTSB12LV22 FireWirePCI4450 FireWirePCI4410 FireWireTSB12LV23 FireWireTSB12LV26 FireWireTSB43AA22 FireWireTSB43AB22 FireWireTSB43AB23 FireWireTSB82AA2 FireWireTSB43AB21 FireWirePCI4451 FireWirePCI4510 FireWirePCI4520 FireWirePCI7(4-6)10 FireWirePCI7x20 FireWirePCI7XX1 CardBusPCI7XX1 FireWirePCI7XX1 FlashPCI7XX1 SDPCI7XX1 Smart CardPCI6515 CardBusPCIXX12 CardBusPCIXX12 FireWirePCIXX12 Multimedia Card ReaderPCIXX12 SDPCIXX12 Smart CardPCI1620 MiscXIO2000A PCIE-PCIXIO3130 PCIE-PCIE upstreamXIO3130 PCIE-PCIE downstreamXIO2221 PCIE-PCIXIO2221 FireWireACX100AACX100BACX111PCI1130 CardBusPCI1031 PCMCIAPCI1131 CardBusPCI1250 CardBusPCI1220 CardBusPCI1221 CardBusPCI1210 CardBusPCI1450 CardBusPCI1225 CardBusPCI1251 CardBusPCI1211 CardBusPCI1251B CardBusPCI2030PCI2031PCI2032PCI2250PCI2050PCI4450 CardBusPCI4410 CardBusPCI4451 CardBusPCI4510 CardBusPCI4520 CardBusPCI7510 CardBusPCI7610 CardBusPCI7410 CardBusPCI7[46]10 CardBusPCI1410 CardBusPCI1420 CardBusPCI1451 CardBusPCI1421 CardBusPCI1620 CardBusPCI1520 CardBusPCI1510 CardBusPCI1530 CardBusPCI1515 CardBusPCI2040 DSPPCI7420 CardBus5634PCV SurfRiderR4x00TC35856F ATMR4x00 PCIToPIC95 CardBus-PCIToPIC95B CardBusToPIC97 CardBusToPIC100 CardBusFast Infrared Type OLongRun NorthbridgeMem1Mem24DWAVE DX4DWAVE NXCyberBlade i7CyberBlade i7 AGPCyberBlade i1CyberBlade i1 AGPCyberBlade Ai1CyberBlade Ai1 AGPCyberBlade XP/Ai1TGUI 9320TGUI 9350TGUI 9360TGUI 9388CYBER 9397CYBER 9397DVDTGUI 9420TGUI 9440CYBER 9525TGUI 9660TGUI 9680TGUI 96823DImage 97503DImage 9850Blade 3DCyberBlade XPCyberBlade XP2HPT343/345 IDEHPT36x/37x IDEHPT372A IDEHPT302 IDEHPT371 IDEHPT374 IDEPyramid3D TR25202ET4000w32pAET4000w32pBET4000w32pCET4000w32pDET6000/ET6100ET6300IGA-1680IGA-1682IGA-1683CyberPro 2000CyberPro 2010CyberPro 5000CyberPro 5050CyberPro 5202CyberPro 5252Santa CruzUM82C881 486UM82C886 ISAUM8673F EIDEUM8881 HB4 486 PCIUM82C891UM886AUM8886BFUM8710UM8886UM8881F HostUM8886F ISAUM8886AUM8891AUM9017FUM8886NUM8891NUS201USR9979023CP5610V961PBC i960 PCIV292PBC AMD290x0 PCIV960PBC i960 PCIV96DPC i960 PCIK8M800 HostK8T890 HostPT880 HostPM800 AGPKT880 AGPK8HTB HostVT8363 HostPT894 HostCN700 HostCX700 HostP4M890 HostK8M890 HostVT3351 HostVX800 HostP4M900 HostVT8371 HostVT6415 IDEVT8501VT82C505VT82C561VT82C571 IDEVT82C576 3VVX700 IDEVT82C585 ISAVT82C586 ISAVT8237A SATAVT82C595 PCIVT82C596A ISAVT82C597 PCIVT82C598 PCIVT8601 PCIVT8605 PCIVT82C686 ISAVT82C691 PCIVT82C693 PCIVT86C926 AmazonVT82C570M PCIVT82C570M ISAChrome9 HC3 IGPPM800 ErrorsKT880 HostVT82C416 IDEVT82C1595 PCIPM800 HostVT8251 PCIVT8251 PCIEVT8251 VLINKVT83C572 USBVT82C586 PowerRhine/RhineIIVT6306 FireWireVT82C596 PowerVT82C596B PMVT6105M RhineIIIVT82C686 SMBusVT82C686 AC97VT8233 AC97RhineII-2VT82C686 ModemVT8233 ISAVT8633 PCIVT8366 PCIVT8653 PCIVT6202 USBVT6105 RhineIIIS3 Unichrome PRO IGPVT8361 PCIVT8101 VPX-64VT8375 PCIPM800 Unichrome S3VT612xCLE266VT8623 PCIVT8233A ISAVT8751 PCIVT6420 SATAS3 UniChrome Pro II IGPVT6410 IDEP4X400 HostVT8235 ISAP4N333 HostVT8377 PCIVT8378 PCIPT890 HostK8T800M HostVT8237 ISADeltaChrome VideoVT6421 SATACX700VX700 HostVT6655PM800 DRAMVT8251 ISAVT8237A ISAVT8251 SATAVX800 DRAMChrome9 HC IGPVT8237S ISAVT8237APM800 PMCK8T890 IOAPICPT894 IOAPICCX700 IDEP4M890 IOAPICK8M890 IOAPICVT3351 IOAPICVX800 IOAPICP4M900 IOAPICVT8237S SATAVT8251 AHCIP4M890 SecurityP4M900 SecurityVT8378 VGAPM800 PCIVT8231 ISAVT8231 PMGVT8363 AGPCX700 ISAVX800 ISAVT8371VX855 ISAVT8501 AGPVT82C597 AGPVT82C598 AGPVT82C601 AGPVT8605 AGPVX900 IDEVX800 SD/MMCVX800 SDIOK8T890P4M890P4M900VT8633 AGPVT8366 AGPVT8361 AGPVT8101 VPX-64 IOAPICVT8363VT8235 AGPK8HTB AGPVT8377 AGPVX800VX800 PCIEVX855 IDEVSC-7174 SATAGDT6000/6020/6050GDT6000B/6010GDT6110/6510GDT6120/6520GDT6530GDT6550GDT6x17GDT6x27GDT6537GDT6557GDT6x15GDT6x25GDT6535GDT6555GDT6x17RPGDT6x27RPGDT6537RPGDT6557RPGDT6x11RPGDT6x21RPGDT6x17RP1GDT6x27RP1GDT6537RP1GDT6557RP1GDT6x11RP1GDT6x21RP1GDT6x18RDGDT6x28RDGDT6x38RDGDT6x58RDGDT6x17RP2GDT6x27RP2GDT6537RP2GDT6557RP2GDT6x11RP2GDT6x21RP2GDT6513RSGDT6523RSGDT6518RSGDT6x28RSGDT6x38RSGDT6x58RSGDT6x33RSGDT6x43RSGDT6x53RSGDT6x63RSGDT7x13RNGDT7x23RNGDT7x18RNGDT7x28RNGDT7x38RNGDT7x58RNGDT7x43RNGDT7x53RNGDT7x63RNGDT4x13RZGDT4x23RZGDT8x13RZGDT8x23RZGDT8x33RZGDT8x43RZGDT8x53RZGDT8x63RZGDT6x19RDGDT6x29RDGDT7x19RNGDT7x29RNGDT8x22RZICP82C592 CPU82C593 ISA82C594 Wildcat82C596/597 Wildcat ISA82C54182C54382C53282C53482C53582C14782C97582C925SVGA IISVGAVMXNETVMCIEHCIUHCIVMXNET3PVSCSIVMIP9000P9100WD33C193AWD33C196AWD33C197AWD7193WD7197WD33C296AWD34C296WD9610W83769FW89C840F 10/100Linksys EtherPCI IIW83C553F ISAW83C553FW89C940FW6692 ISDNLinksys EtherPCICF32APlatform DeviceVolari Z7Volari Z9s/Z9mVolari V3XTX3201-3CardBus EthernetMini-PCI V.90 56k ModemMini-PCI K56Flex ModemCardBus 56k ModemCBEM56G Modem724734738737740740C724F7441221PCI-ST32Genie TV/FMDVDZD1201ZD1202ZD1205D-LinkMartin-MariettaHauppaugeTTTechDynalinkCoregaRhino EquipmentCompaqSymbios LogicATIULSI SystemsVLSIAvance LogicNSTseng LabsWeitekDECCirrus LogicWestern DigitalAMIAMDTridentAcerDellSiemens Nixdorf AGMatroxChips and TechnologiesToshibaMiro Computer Products AGNECFuture DomainSiSHewlett-PackardPC TechnologyAsustekDPTOptiElsaSGS ThomsonBusLogicTISonyOak TechnologyWinbondHitachiSMSCMotorolaPromiseFoxconnNumber 9UMCITTPicopowerMylexAppleMitacYamahaNexGen MicrosystemsQLogicCyrixLeadTekInterphaseContaq MicrosystemsBit3OlicomSunIntergraphDiamond MultimediaNational InstrumentsCMD TechnologyQuantum DesignsBrooktreeSGIACC MicroelectronicsSymphony LabsSTB SystemsPLXMadge Networks3ComSMCAcer LabsMitsubishi ElectronicsSurecomNeomagicMentor ARCAdvansysFujitsuMolexMacronixEvans & SutherlandNVIDIAEmulexIntegrated Micro SolutionsTekram (1st ID)NewbridgeApplied Micro CircuitsTviaRealtekNKKIO Data DeviceInitioCreative LabsHighPointSigma DesignsVIACogent DataSiemensZnyx NetworksAcctonAtmelVortexEfficent NetworksIDTFORE SystemsPhilipsCiscoZiatechCycloneEquinoxAllianceSchneider & KochDigiMutechXircomRenditionServerWorksAlteraRicohCorollaryAcardZeinetOmega MicroMarvellLite-OnV3 SemiconductorPinnacle SystemsAT&T/LucentDolphinMesa Ridge (MAGMA)Analog DevicesZoranPijnenburgCompexCycladesEssential CommunicationsO2 Micro3DFXATMLC-CubeAVMStallionASIXIntersilNortel NetworksSilicon MotionEnsoniqTransmetaRockwellDavicomITExpressPlatformLuxSonorTriTechAlteonUS RoboticsNVIDIA/SGS-ThomsonPericomAurealADMtekPacket EnginesForte MediaSIIGDTC TechPCTELBrainboxesMeinberg FunkuhrenCNetSilicomLAN MediaNetgearMoxaLevel 1HifnExar3wareTechsan ElectronicsAbocomSundanceC-Media ElectronicsLavaSunixIC EnsembleMicrosoftOxfordChelsioEdimaxTamarackWorkbitSamsungAskeyAvermediaMSIAironetGlobespanMyricomVScomAvlabInvertexBroadcomPlanexConexantDeltaMyson CenturyTopic/SmartLinkENEAralionTerraTecSymbolSybaBluesteelVMwareZoltrixMellanoxAgilentQuicknet TechnologiesNational DatacommPacific DataEumitcomBrocadeNetSecZyDASAtherosGlobal SunSafeNetMicrelVitesseLinksysNetoctaveAltimaAntares MicrosystemsCaviumBelkinHawking TechnologyNetChip TechnologyI4ArecaNeterionRDCINPROCOMMLanergyRalinkXGI TechnologySilanRenesasSangomaSolarflareOptionFreescaleAttansic TechnologyAgeiaJMicronPhisonServerEnginesASPEED TechnologyAWTFusion-ioQumranetASMediaEtronFresco LogicTekramTehuti NetworksHint3D LabsAddtronNetXenNanjing QinHeng ElectronicsIndustrial Computer SourceNetVinGemtekTurtle BeachMosChipXenSourcec't MagazinDecision ComputerQuancom InformationssystemeIntelInnoTekSigmatelAdaptecAtronicsNetMosParallelsTigerJet NetworkEndaceBelkin ComponentsARC LogicINVALID VENDOR IDcy82c693_writecy82c693_readcy82c693_initcy82c693_init: bus_space_map failed (%d): broken match/attach! : unable to map device registers : couldn't map interrupt : couldn't establish interrupt: invalid memory type %d , using %luK of on-board RAM, can't map on-board RAM: can't subregion offset %lu size %luchannel 0channel 1configuredwirednative-PCIcompatibility, %s %s to %s%s: %s disabled (no drives) %s:%d:%d: bus-master DMA error: status=0x%x %s:%d:%d: bus-master DMA error: missing interrupt, status=0x%x %s:%d: unable to load xfer DMA map for drive %d, error=%d %s:%d: unable to allocate table DMA for drive %d, error=%d %s:%d: unable to map table DMA fordrive %d, error=%d %s:%d: unable to create table DMA map for drive %d, error=%d %s:%d: unable to load table DMA map for drive %d, error=%d %s:%d: unable to create xfer DMA map for drive %d, error=%d %s: couldn't map %s cmd regs %s: couldn't map %s ctl regs %s:%d: bogus intr %s:%d: bogus intr (reg 0x%x) %s: couldn't subregion %s cmd base %s: couldn't subregion %s ctl base %s: couldn't subregion %s channel cmd regs %s: port %d: device connected, but communication not established %s: port %d: PHY offline %s: port %d: device present, speed: 1.5Gb/s, speed: 3.0Gb/s%s: port %d: unknown SStatus: 0x%08x %s %s channel: cannot allocate channel queue%s: %s cannot allocate channel queue: unable to map BA5 register space : DMA%s: couldn't map native-PCI interrupt unknown interrupt%s: using %s for native-PCI interrupt %s: couldn't establish native-PCI interrupt: couldn't establish native-PCI interrupt: couldn't map bus-master DMA registers : couldn't map IDE registers : DMA %s: channel %d: cannot allocate channel queue %s: couldn't map channel %d ctl regs %s: couldn't map channel %d cmd regs %s channel %d: can't subregion DMA registers %s: no known timing values unknown SiS IDE type %d %s:%d:%d: multi-word DMA disabled due to chip revision %s: no compatibility interrupt for use by %s %s: unable to subregion %s ctl regs %s %s: cannot allocate channel queue%s: %s %s to %s mode %s: %s ignored (disabled) : no DMA, unused (couldn't query registers), unused (registers at unsafe address %#lx), unused (couldn't map registers), (unsupported maptype 0x%x)%s: unexpected PCI function %d : 5597/5598: unexpected PCI function %d , (unable to map ctl registers): cannot allocate channel queue , %s %s to native-PCI compatibility %s: bus-master DMA support present: ATA133: ATA33: ATA66: ATA100 (unsupported), (partial support)not responding; disabled or no drives?other hardware responding at addresses%s: %s ignored (%s) %s:%d:%d: cannot allocate DMA maps, using PIO transfers %s:%d:%d: using DMA data transfers %s: restore for unknown chip map %x unmap not yet implemented for this chipsetpciide540620630630S633635645645DX651652655658661733735745746748750760962963964966968port 0port 1port 2port 3: can't map mem or i/o space em_rxeof: NULL mbuf in slot %d (nrx %d, filled %d)%s: em_dma_malloc: bus_dmamap_create failed; error %u %s: em_dma_malloc: bus_dmammem_alloc failed; size %lu, error %d %s: em_dma_malloc: bus_dmammem_map failed; size %lu, error %d %s: em_dma_malloc: bus_dmamap_load failed; error %u %s: Unable to allocate rx_buffer memory %s: em_allocate_receive_structures: bus_dmamap_create failed; error %u %s: Unable to allocate tx_buffer memory %s: Unable to create TX DMA map %s: em_get_buf: slot %d already has an mbuf %s: unable to fill any rx descriptors %s: The EEPROM Checksum Is Not Valid %s: EEPROM read error while reading part number %s: Hardware Initialization Failed: mmba is not mem space : cannot find mem space : cannot find i/o space : flash is not mem space %s: Unknown MAC Type %s: Unable to initialize the hardware %s: Could not setup transmit structures %s: Could not setup receive structures %s: Unsupported media type %s: watchdog timeout -- resetting %s: Media change is blocked due to SOL/IDER session. %s: Unable to allocate tx_desc memory %s: Unable to allocate rx_desc memory %s: EEPROM read error while reading mac address %s: PHY reset is blocked due to SOL/IDER session. %s: No GCU found, defered attachment failed Could not write PHY the HV address register Could not read data value from HV data register %s: phy read timeout: phy %d, reg %d %s: unable to read phy %d reg %d gcu0%s: init failed, error=%d : can't map i/o space : can't map mem space %s: timed out waiting for BIOS %s: pre-2.0 USB rev : can't map interrupt : can't establish interruptpciide_machdep_compat_intr_disestablish calledpciide_machdep_compat_intr_establish called&rd'(3  x/@/@س@/@/@/@/@/@/@/@\A/@/@/@/@/@/@/@0@0@0@  5'+,()*-.&#KNMOI JH CC CCUkUk CCUkVk CC vkvk CCvkwk CCwk(wk CC@d F V pQ |C@T 4 8  d ز \ BxB%%K[!0[!4J!T@VVVWWWWW XXXX[[ \\\\]]]]] ^^^^__ _ ```` aaaaa e@g@##<#########4##d####,##(###D##T# #P##(##\#0#### #`##X### @ @   ) 2i@      $$$2$!$P$@-$<"$$$$4$p $$$ $$$0$7$D7$l$ $$($5$3$H$T $$$7$@5$d$T $$,$3$P3$X $$ $$$ @ @   )l@a$l$f$ $J$l}$r$`K$dK$K$K$L$lK$P$K$K$hK$q$q$$$K$L$o$n$$$J$$\$Pq$p$$$J$M$dn$hi$V$K$K$N$ @ @ @   ) $%$|@$ $$$$8$$$$(WEVrdroot2.5M@%`8mSWEVj  08`NS<  3SpN`/mntDZ NS`@@<@T 08`3S<  3SpN`[~ [~3S`@@<@TU DSph bDS5kYA 3SMS4MS4hyMA3S>I83S>I83S>I8a}B4S>n4S MS4px &DDScDS{h#DS{h#b ]DSk1%DS'DS'ihUDS'DS+DS8nƨbPDS+DSCiQ/DS8m P+ltDSi/DS7DS7 (08@HPX`hpVkAl88Ad21#п=x $1R@7B!2M(rk|;!m4 =:~܆ Y!6Aj8=!|"@Ц/gGWwHlE^`%h7]F~|#@>y:Kn01ze eH !5}bw=O: Z ObUޠ||Qh=k!0y>>QYC6+K6di_DaެDK6] s[@1Xe=[Neq,;Mb$ LTQ1Yj@y&UXn'=yh>B@P:gz($K_3F•0Z"8'|so<`ETfPv2|`]=nŻIX0>:CgtcTMV]Nb LU4fk|# {v7ɟ+I o'Nj/9+$JҷE  V0\&oWE`v u ... export VNAME=$(sysctl -n kern.osrelease) export VERSION="${VNAME%.*}${VNAME#*.}" export ARCH=$(sysctl -n hw.machine) export OBSD="OpenBSD/$ARCH $VNAME" export PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ umask 022 set -o emacs set -- $(dmesg | sed -n '/^root on /h;${g;p;}') rootdisk=$3 if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES mount -u /dev/${rootdisk:-rd0a} / echo ! : > /etc/rc echo 'erase ^?, werase ^W, kill ^U, intr ^C, status ^T' stty newcrt werase ^W intr ^C kill ^U erase ^? status ^T cat <<__EOT Welcome to the $OBSD installation program. __EOT timeout=false timer_pid= if [ ! -f /tmp/noai ] && ifconfig netboot >/dev/null 2>&1; then echo "Starting non-interactive mode in 5 seconds..." >/tmp/noai trap 'kill $timeout_pid 2>/dev/null' EXIT trap 'exit 1' INT trap 'timeout=true' TERM set +m exec 3<&1 4<&2 >/dev/null 2>&1 (sleep 5; kill $$) & timer_pid=$! exec 1<&3 2<&4 3<&- 4<&- set +m fi while :; do echo -n '(I)nstall, (U)pgrade, (A)utoinstall or (S)hell? ' read REPLY if $timeout; then timeout=false echo REPLY=a else [ -n "$timer_pid" ] && kill $timer_pid 2>/dev/null timer_pid= fi case $REPLY in a*|A*) /install -a && break ;; i*|I*) /install && break ;; u*|U*) /upgrade && break ;; s*|S*) break ;; !) echo "Type 'exit' to return to install." ksh ;; !*) eval "${REPLY#?}" ;; esac done fi  . .. bin@ dev etc mntAmnt2BsbinԢ tmpC usrvarinstbin.profile2 install.mdupgradeinstall  install.sub md_installboot() { } md_prep_fdisk() { local _disk=$1 _q _d while :; do _d=whole if [[ -n $(fdisk $_disk | grep 'Signature: 0xAA55') ]]; then fdisk $_disk if [[ -n $(fdisk $_disk | grep '^..: A6 ') ]]; then _q=", use the (O)penBSD area," _d=OpenBSD fi else echo "MBR has invalid signature; not showing it." fi ask "Use (W)hole disk$_q or (E)dit the MBR?" "$_d" case $resp in w*|W*) echo -n "Setting OpenBSD MBR partition to whole $_disk..." fdisk -e ${_disk} <<__EOT >/dev/null reinit update write quit __EOT echo "done." return ;; e*|E*) cat <<__EOT You will now create a single MBR partition to contain your OpenBSD data. This partition must have an id of 'A6'; must *NOT* overlap other partitions; and must be marked as the only active partition. Inside the fdisk command, the 'manual' command describes all the fdisk commands in detail. $(fdisk ${_disk}) __EOT fdisk -e ${_disk} [[ -n $(fdisk $_disk | grep ' A6 ') ]] && return echo No OpenBSD partition in MBR, try again. ;; o*|O*) return ;; esac done } md_prep_disklabel() { local _disk=$1 _f _op md_prep_fdisk $_disk _f=/tmp/fstab.$_disk if [[ $_disk == $ROOTDISK ]]; then while :; do echo "The auto-allocated layout for $_disk is:" disklabel -h -A $_disk | egrep "^# |^ [a-p]:" ask "Use (A)uto layout, (E)dit auto layout, or create (C)ustom layout?" a case $resp in a*|A*) _op=-w ;; e*|E*) _op=-E ;; c*|C*) break ;; *) continue ;; esac disklabel $FSTABFLAG $_f $_op -A $_disk return done fi cat <<__EOT You will now create an OpenBSD disklabel inside the OpenBSD MBR partition. The disklabel defines how OpenBSD splits up the MBR partition into OpenBSD partitions in which filesystems and swap space are created. You must provide each filesystem's mountpoint in this program. The offsets used in the disklabel are ABSOLUTE, i.e. relative to the start of the disk, NOT the start of the OpenBSD MBR partition. __EOT disklabel $FSTABFLAG $_f -E $_disk } md_congrats() { } md_consoleinfo() { } #!/bin/ksh MODE=upgrade . install.sub while :; do ask "Root filesystem?" $ROOTDEV resp=${resp##*/} [[ -b /dev/$resp ]] && break echo "$resp is not a block device." done ROOTDEV=$resp echo -n "Checking root filesystem (fsck -fp /dev/$ROOTDEV)..." fsck -fp /dev/$ROOTDEV >/dev/null 2>&1 || { echo "FAILED." ; exit ; } echo "OK." echo -n "Mounting root filesystem (mount -o ro /dev/$ROOTDEV /mnt)..." mount -o ro /dev/$ROOTDEV /mnt || { echo "FAILED." ; exit ; } echo "OK." for _f in fstab hosts myname; do [[ -f /mnt/etc/$_f ]] || { echo "No /mnt/etc/$_f!" ; exit ; } cp /mnt/etc/$_f /tmp/$_f done hostname $(stripcom /tmp/myname) THESETS="$THESETS site$VERSION-$(hostname -s).tgz" enable_network startftplist munge_fstab check_fs umount /mnt || { echo "Can't umount $ROOTDEV!" ; exit ; } mount_fs feed_random install_sets finish_up ELFa(4"4 (.k.k0k0k0ktMtM8844`TTTۣe0k0k0kOpenBSD -L0! MP@ -8AL4@ ` \p+  0/R R  /R0S000) \' P00<Q  A \ 00 W U <00S Pܶ 2 h0-L` 0 R   1S0B@Ct1P @D0t0|$<0< 0 R-L @ R ,  0S002  -x@x @0LS ``00T0H 0S 800S$0hꀴ2\  p-L g0P `P dp\P 4@POU8 ٚ (4MPP Κ=TDkH -PLU`p 0S /t0PPQ @Q P P0 iDk$T Pp-L@P`D ph0,0d -"L<MȂ0r"`8K01.P@H =P  P0Sl `Ÿ X08@ 1 P4  0` $8 000P  10S000 B 1 0S0 S㿌10S 1!0!0S !l 7000@1@1@0,10S0(!1 P R `@T00SRT!0] $0S 0S  0Q $0S 0Sl 1h(K, (d  P< lԏ@0 -TL@PD 05 4P 050  5X(`h -LM K `Qp@Pqx1 p 0SM bR KR MR(mR wR kR!$+%$+*$&U'T$0@P 0 !$/UT0 0 @P 0xS S *Sd1#pUT D0"@9 04ˋ 0 Ƌ@P \ԅ| -L0 $, -L0 $d 0-LMK PCp@1 E 0S7 bR KR MR mR wR kR$%*T0@0 !P00 @0xS S *S T <0"@ 0,a0 \@8 \ԅ| -0L00(d -0L00(, -L0m -L P00 -Lx0 -Lp 00d, -LM$`K✠p圀&, @PP @Q` 0 D  0R00 (0S܇(Q0 R0 ,d -L Ҋ\tm -L Ɋ\tm -L \vm -L 巊\vm 0-t0LP d0  a0R00BAq 8@0P 0R0 : 0,d -L1P``8q8L  ᅁPP  / "0S P00OU0@0V 0000 00 0U0 0 0 0S0|0 0  `Ke0 f` R*Rb10 00d\$,P 0-LMPKIP \0: S D4 K@vP0: S S000K0\m @ -ELP40  uPD40S0o DP4000 T0$ 4uP 0l h4P$u0000S|TD$(4 0S 0@)Pc0S 0)P 0)PLdpS $0   $0 D0; S 0 @c$ #"=0,c`V ~㚗㗗"0spy2Q 0Sl*0  Q [0 HP Z "0  ld^0 00Q0 0 0 0  P0 0 0 0000000 0 00 00P 0 B00v0 Ha00ؐ0q@P00Cs01 1R 0R!0R 00 l R R *p bQ /0 00$00S8,,mpd(Ċh\@ԏ -d2LuM0Pb4K4K 0( P,04 0  bR, 0@=94 0 =,0 4K  1@,P  0 0̍yOKP PP0!dPP//T@ / P R T1TRMKd0K 0C8t 4 D , }P2m0-S) 忆РBKAL L P0 0$RpB.K0 B Bxpppp~0H噆0<$=a $70kT -LM@pP4 嚾PP 0S nS6 =`P00QD @ Q? P 0V0S D 0 YppV 0`pY" 0 0 p 0oSPؖ00 ,K, ?R0S@p @ `0 p00꼖0"S 0( $P 0 0Q|PH` -LM`PP( @(K,pK 0 g(0@S "$K' -LM0S S SL0 0@0(( Kh0hn>< -LM0S S SL0 0@}0(( Khu0hpn>< -0L cZ4kTЍ -Lp,P`z%@P% 0 `$00$ (0@ -L`PVpY%@P  0屮p0O  K,m="  -MLMPa `P BE@ "%P $@TY  h1l\P P@ $@TYK(PEPE)0]pP00S0#3P \PPPUp V V@唐PK 00 0i!VT   $@T(Kl4DXn< -L0 K M, 8$0@H @0 000 ?Pe bP@@  H$p#00#< 8 4 D 0a0@SM\tЪ0STcB+@ /P R r@P00SxRbRbRPP,`pWP 0  s00 2U" |0@ 0SP $@T 0KLLOPP4B80P  ! < 10D0 80080 4 H!Kps1 pR18 040DR0Q  R`Z00R00S< R 10S00S41APጿP ,@P@@ 0KH<0S 00S  00 $0SVPHPA0pK  0KrP  lP`Fv@TdU(KnhTmxn\4k -0L ]T4kTȎ -LMP@`0p dU@ 0S T  0((8T p-LP@Po`P P@wp P@N@\ -2L`M2\Ÿ\[\ @ll2`  -0L MPpP`+0 R ; $0  0j0 RXkW @PP $0UOK K$K4Dj<@ 00 @j$ddL p-`PL& 0S# nS$ 0 @@,P 0PP@`00@,Pp40oS0 ` nt 0-t0L0PS Q @Q  P,0 r300 R00n -0LS0 R3 ZP"p`0@S 0  tP "10c0\/ D'p Xo 1"0cA0 Ron -LMp K`P @PUO 3PP -LpM`P$忳p/ P0@$S$йййййййййййййййййййййййػййййййй|P#右pD3D#Q 43 R(K 1P A0pS hP( PKp cPy0: S Se ! 10bP(A૷Pkt2 Rk (`1 i tPE pPWn v(`@P#'PXUO Xi1 R]  w31 R\1]1 Y1 U1 1NX1 Jh1 X1C41 ?( < t "10c(0VPP幾(`ڌ0 RX 0 RT όP^ w3W(` `( px<!묐Tn,\ ܐ -|BLM0 j 0`PP\%D2R  0`P $K\% 2R004 쑟 000\%1RM = 0@8P3o , ( F,,@K0d @P,@ (P @P<@md@d_ .,@K00`Vp0@0S@0 @, 0C@$0(@,0 @\@`@0[PZ &0Z &t s(d  80&`p<(@dl_@TP0  R0 0, 0C@$0(@/,0 TT@L -pMLK 0@0P#41RL0S `f`0R30 @0@c$p(#0E`#` @b@cP @P   0@Q  0@$0(@0 \0`0,0 @PZ %Z %t S@P -PL P@@&P kH`P @ P | Pl pP \ PD P < 0b$]ptxL| -L 0eܑT -LM@`CV$ P$pKVh P 0S -SD01!@!= P0@0@V@Qd p-LMPP` 0S@x$@$@@P ( 0 @`$x `h 0-\ P0LS@ 0S  0S 0S00$n p-`PL& 0S# nS$ 0 @@," P#0PP@`00@, Pp4k}0oS0 `   nt 0-t0L0PS Q @Q  1 P,0 r300 R00 n -0PLMP` PPp$ ` @$KR$  8`p`3C$@0&T00S Q -LM` KpP 0P P? U @ PP@ -L4Mh0@`pX,0 ef0St 08\f 0DSH  `T 8 R P R   0S`7V ;f00@T0WSU P1' 7hhW@ TT fPL7Q,`@' Vf! 6`V 'f!@ 6`V&e! 6`V&e! `t6Vpp&e0S!! R <6`V4\0T&e0S!! R 5`V0&e0S!! R 5`V0%e0S!! R |5`Vt0%e0S!! R <5`V4\0d%e0S!!R 4`V0(%e0S11S TD`V$ue0S `V1$je!fe!be!^e4VYe, 0R(K0SJ 4`V`$He!@꒨P% `V |,}k]HpȓГXؓ -L)MMğ~KpG`pG , P@IP #T@U ᘱ` P^ Qe@ PP K@A@ A <0d Qd: D3qd A R (cd:S@cd:@S b64Ÿ, 0R(KRcp@r PeNK@Db@DO0" @ըɊ0S l 00S0Sx 8P$*`&NKᚱPaw_KZ P {K P1 R( @JoKlcZ PW{?K _cKA IP<h:#4(1 R0SQP@D ӸyʸtP zb k&NK<PaᲸ\ 學|x娸Rh7` c0k@d HHo8D@\0ԅT`<@bH -AMLM6 `Pp, &壬pJ A0@6S6\8 P:p%Xp5 `bA0V84 Vm VZ @ 4`P PDP $PP PP (0JP@4 sPnpi4 RD,`t4 \HPW4pR84 RM pIpPDp?3 ;963 R `84@ 0@@Z00S mP; Q`3 RZBKHH?P (8PI [P@0 0   P [P 0DPt0 0 04 2 0@PP B.K B Bx4HP@4P#Hp_ BK@@!`Pa +PP7 @P P P 84  x`P⨑n(BP`hftP@T@h@XPx DPP84PP84 wwެPP0D{z0S v84 w P@ PUO 0t^P 0pZ0kLT@ n|Ԕ$l&tp8@b -L. 0c_XT -GMLp1M ha d!@0P$4 @!嵪p oP: !嬪p 0bSQ`A~K pG0pG4 P- $$004 4 =K 0C0C QnPP -P P| 0$\3wA.KP0 B BD ,0kTPpLL -LM@pP4 /PP 0S nS6 =`P00QD @ Q? ᣲP 0V0S D 0 YppV 0`pY" 0 0 p 0oSPm00 ,K, ?R0S@p @ `v0 p00Q0"S 0(v$P 0 0vQ|PH` -LM`PᬭP( @(K,pK 0 g(0@S p$K -$0L0S 6T -Lp00p3 P``0@@ PPkP P sP@ aP P {ph00STTTy.D刃<s ,傃@4kyЗȗTԗ -Ljl@-0 S R@4 00 ӑR^ ^HR-0S \ Q-0L Q* u u -LMp@`r $KfiPk0S 0S $0 UR#U 0u( -0L }t4kT4 -MLMp0,0 /רpI B0@3S3tD`0\,> >~> > .卨p. 0b0CS/[>KQ0C 0C ;p KAKPD?@T 6: S8  S ZanK`F`F@ pW@ܭP  P @TDP u= =(=a\= x=t= l= U,=.T=P=L=|.8= 4C<X.D>=:<,5< .<<,< << < X< << < (< |ʋ  01 &R06 \4VD'D7U v@@^6 %WU  & 僐 b I F0F@$@J#&R 036 5%:W!vW pU71C0eP ?x71C0`Pp@0k6&C#00R* FP Q F 6 S 6 6S< 6 AM6 S<^:;AAP  0&"1. `` cc  &  &6 R R  &A!60#r0P`6 1 H$0@T~ ^ P *&R6pp 1H$P`P`V  t |r3 R0S3 R  P3T@1t K@ĕVTP  @P p *p R00Y0S 0rS Z ``? V5  U @ P0@X S P P 0"r Q  Yx^ \ P Q T e/P 00B0R SW 00B0R SQRM  00B SQG `RIpRGqaPB ? R.R<t300 Q &R&  5S 5SMKx ]pp u8PU 20 @  V q 6q0#0P` qP0ko($TX(, <0$48<ԛ@DțHLxlP""T8 P#X̝/@\dedATМxD>@xРؠ ,T480kP\dd`gfff\lPoܟLA<xxt<hĞ0ܗ@\L 0ĨP &Pɼ S{V&\q6 S F &T q 6!&a 0 . `& @P 0 2" p0! X ^ 2 6S22S \< D2^0B0 >& R 0@, & l& *6 `@P p! 0xX@@T@!^4: Q0 &R0:S P03 83Q2S*& RXC 6Sh3B@6 L!!  }6R 00 T@Y6S%%R006  P0xc5 0S 05 Q5 6 % &6HY QXYQdYlYQxY%5YQY6S%YYTDPYYQY >$PU , 0RS(K p ( p]K@@5E K@@5 E pP9 &R%6"&  P660X*0 ^PPS00SB %5R> P;X9:@X &0ST#3*&帽p  6PX&  \ 6S X*cQP60U&00Q* ^ 000S 0@6 # 06U0$!4060 !40 4 06 0!4 0  40 ,40!̠!4!05#Ƞ##0  %$0""Ƞ"$ %@"̠""    $ !$ )0`X(00ST h8 4  (0p8 [NKR@D@D6( '0S66 { &fp 6P & GX 09Q  ( 520#$ 0 0 P0C"$ "40 && 9  0@!Nav. 4 0 %9R X2 5S X R 0SR0aA006 6 r0CC C C C CCCU B!!!Ƞ C CCC CC  0C0 [0C*00S @T &U0& U 0A Ah 68FP {[NK@D@D6p+2ሥP  00 5 % \6 S(+h 5S,+` 5S0,X %?RB5( c02?  5 % 7 Q`<Ps 5P n @ S%<T E I @ 6S R@pPC& n<Q &Rp5F0%m%墹(=R66  Qk T Ujd%mpm |0m mm0mmmTq 0m m >e&0m&\ mA 6(~0#0P`6 S ^ʠ 6pm5om墬 m/m% -LM00PKpa@ 00p `mP2 `00PU4 @uT <T  0BS0^T0(@ 0 0 K?P@ -P0(P0 0( P 0`smPiz$K P@$0 R 00(@< Tz$Oz ` P-L mlD` -LM( :P( (( Q5 (K `P0 0S- =|@PS 00$pK PcU% iU, lU3 oU: 1Q@ Q 0SfP0$ 0 Q (Q K( QP($00HP($00?P($0 06P($00~*Pt 1($0$0TP@ $($0(0b{Ԣx| 0-LM 0 P`UX0Q @0D0 U Q@r 8hUꬪت$0 C 0+ 0| B-00 $0 0 0+ -00S 0 $: 00 $ 00 $: 00 $ 00S 0 < 00 00 < 00 0$ 80 0 ( =K 0  $0 $@+0S  $", 0 0 $ -LM0@S 0 K0"0W0 00 K0" W0 0`t - LWPOot  - LWPAnt  -LM K00"WP/t -L4rhT0$T p-L MP@`0KP 20S00Kp $ p-L MP@`0KP 0S00Kp , -0LS@ h?IR 0 << 0 -@LF:T0 0 -@L:ⷶ0 0 D0$ D0 -LM Pp0`-S,0C000P(K 0(P /k@P  0SK0 Q0xC$ x>  o`4i p-L0 `RP @ R WP0 00 0 0 0 p01Q @ Q >P0 000 00 p0Q @ Q %P0$ 00$0 0$0 pp0Q @ Q  P0 000 00 ppآLT 0-,PL0@S g000@0pt -0L0CSQ 0M - LP^0? 0  P@ ^00 ,00$0 hi& p-x`L@PTd0 \Sp)HP@zS8wSp$qS0pptԅ\H -LMR p, `0 P 0LS < NSPៗ@}pT   BS@Q :S@T` @a Rb:          0 Ql }@!` y $T u L &q?QPP  ( gU b  ^U XU RU  LU @  AU   @ 8U x 2U  d ,U T    H #U 8   0 UP0  P U  Ua@  U@ U U  Ut 2h@  < S S @8 U $    U  U U0S k\0 `p \$ ^ 0 R AdPd␐K 0h'k0 ^K0p4'` W xRvR pG\W KnRKlR, 0R(Kp0S i^0b ^ R@ |W0S  dP^  L/ E80A$=@061U4  +@3'5# 7 U6 i@8  < S1x 5 U2     @U.  ., 0 2 *0S2@T P`K0 0d$ @TO0xtld0-W  R0Q4@eU   L@ZU _ 357 9.@< 9{ [ wU8 @8pq:dm <Xi F LeU;  ;8_ B ,[U:   9S@ U S?  SsGp sX @ R @; 8  45 02  .stP@t$+\!"0 04 t  2PPFPPBPP>PP:PP6X0kLXĮA@P`,Ԯ1$5D]|Ŭlͯİ Xq٫Qa-ĬԬ̯īYpث̰԰լ0\%4E\}]̫xȫ$0@P -0L ]T4kT -#L`M#0㘣p , 0x0 0S`pA P UH#奙p a0@Sp"!!!x"D"<"`0`K1`x ` !Pxt KBRP4Kx ;RPXq"#""B0RPx tұ`0S0 t 4` l h 0SD PKx@K 00 Q/ PP;P `000C S61|K 廛|0`SpP O ᆱ 0l0 00 Ql0S$h0S xQP(, 0R((K` t `` P  0l0 x!PUrx庤p巤ch`EXe0 =0kPT t@ht@\gtPpX|DX8( -0L 0NE4kT -LNM0S( P@`2"IK\2A0PP2 R4: S 2"|2Q0T. ὏pP< BNK@D@D0P"p  PP1INK2@D2n*P0S9 2 RY0S$ sPP( 0Ri$KINK@DP4: S|L1c\ 0OP1OK 1PA! A P/$4R$4R$4R0 R r ePsu0Snu?00d ֣eu00HΣ@ɣ0/0kr`|x\ -LlMP@"ܗp1 F0@-SD0*))))) *)))*)))))))))))))))))))))*)))))))))))))41 0bSQ`( S+ S 10pKᐍP60: S" 0 0 0 0 0 0   QP @P PQ   Tx|`\ -LP(@`pB@D 0bT+++++++++++++++++++ t0Il 01@8P 0( ,05 01 0-p=>P?> *Q-L QP!00B0S007"0002"000-PB0S00& {2~T`(@)TV;@TN1 RJ Df@0DS>e/P孧`PI N0@PD0@08 D1 R 1Q0DS$@ e/P/@P @ 0>ή0 0T  tp@ l呢 \卢qT  D   lT\820P#! 00"8Q#(-0 P`0@p` P0@ ` R VUQ -LMPP`0 ` TP4`@p080 00 R0  ? -LM@ pX 0P`PBT 0@? i?<I -LM, (0 @? 0p-[p 0?`P 0p?,K 0 XXX ?8S P 0< 8PS$KL\ht -l@LP20p ppppqPU9,[?\3X 08 ᓄPh,K0So02P 0Sxȟ0`00h`00CS`0 X0  @PLD HT X0,, 0LHR(K*\ \UL L H D @$  LD0t0   D\ P 06T$8 P`LH 4$  06 LH 06p5  B$ 0S @L4 HD 0T 7 R4L$H4X8&P M&< 8$ 0 D$ @4 p-\+\PP `0T `e_BK0A0Abp[_0"S 04 R@TUTD@ 0 <$84p5L H +V -V~LH$Y L H$ wHTu{{+4[Sg @0D @ LD HT g0E(@Kp4WS%000ӑ%0COS񟗣D̄ ȃXH^@P0LD HT 00@L4 HD @P LD T,5H$ 0S @L4 HD %LH L H TD( 00D @ 4Gh,[p< 8 (T$( Q Pq`0OO$  !5;BED4 @D 04GB,[p0<4 8D T( 00D @ 4G,[p2 <$ 84 $GTTp80",[D @ < 8$ T4( 00D @ 4G4R,[@pC 0C`0A 1 A @TA R 0SSr 0P`@@0@0Q a f $0p`p@ p@ pQ  /,  1a*1(x p1X*v X1lR*p ``@PZ (1HF*d0S* 1(=*[P0@`@w_K`0@a0@TḀpr?K 0S@ @0P ` K !_0B 0SKe/+S 08* 8妕0kdTxT@,h -L*MgKJ0J e/ ,0 0: P P P ; KAA  R PP[( K0S@ (K0@ @0@0 5 S:5 5S:5  e/ KN e/KJ +:K@0@: J : )  vP tw@P |owPuQUQ 0ApS t$pl<, ܹй|P\ Էtȷ)A HO0`p: @P 0STHK@ @H +p 4+oPP  0(n  $O Ke/PA ?P< NKKAe/y 37 RR *@    P ǟ, 0R(KTT* 47 Re , JP7ǟ e/ENNK@D e/>K e/:e/K6 x l *UR l@Pl  0FM `@0p`p @TP0,,@ PW0 0  0HnU @@ 0 c5 R  [ ]WU $0N YK0 $[E PB > =: 7 3ğ$00s03S0)' Ke/P NNK@De/ Ke/ e/K B ? <1Y@B P K 4 :)P0M0 !40 @_ 0$t m4 0K0, 0 K)PM ,04  ,0 `0WPV(KqqHqxqm<h  0-0L@T 500S ЊPڼ 0P0# ;;S 0@ ỊPp0 @ L0P@TPdM0D >4 03@0qqq   q8 0-T0L?M0S@00S ?KK0P@D?+ㄊP 0K0qqq -lb0LPPP2 3P@8"000"0P002PU GUE&Pڀ;;SB a 0sQ8pPď CP01@P1+L0S! L0S L0ESPL0 SD{3 $1 L0S L0S L0S  0@TT0 0 00TSPP T0 L3L|00t 3 l00Q XPL63813qq qq\q8s -t0 0LSd0 \@ 0ls RBPlL$ G3qqqP-0 CR 0R0 SV00 p-43LM0S 3 3 330S 30S20S 20S  UB2 MR0S p2BIP 0: SH0D@@h2;@\20SP20S D2P> 1/$2PK ýk10S 10SA创1 ֜1 0Sx1 p1 RT 1 0SP1 P1 !000<1 RD 410S (1(0S V kU0 1PU  1@ 0ц嘜0P `P 0 l0 B00 @00@X0  0屆80w 0 Kpq   q8slpq  s<qsq   p-LMP K`@P#0PN T ,$ 2/0/T  "$$h@$$L@ // 0iP #Kpq$48 -L M0U@p. 5 005 5 5 5 5 4 QdL4TT$4@  $E&PJ0$1h4pG 4Q !AT "h"0S , P. "n0S S 0<K1 !000@0P,K R0S 10S 10S  Pd1  24 K,P 0S 10S 10S  O0 U4KQPPQPP`!PB V <004X 'H00S!(KsH@`s8   -bMLMP00S %P ;P ,00<Pb K @@ K@s -LM , 3S 0,Q, 0 SPWhPTp`P O, PPU@$P= P:W0S9 D,P p3S P 0!0# @ 1S#Wh0S X,pPEUH ^e,, rs ss $ -L M 0(K *P1`E 0 p @4 @0P 00p3P_PT+MV P@l0t 0'a h0R d0R (04 '0(K q   -a=LM$0a0T[ \ D,  0S K 0>PH0S@!0'㰑0 `pP1 }@P 00Kڠ\ &,K PP`U @10 !\')a- 0S0S 0 K=Pi@00 B'a p0R l0R l0x 0&0S, R a 0S0S(KL qt -LM 0a  ,0 Q`; K=PH0S<0 @! 0&̠ 0@  q0 21 0cPcP.QP ,K 00KPP`0!0S  0R Aq 0000PUoVU, R 0a0S0S VU 00 X0 00S0P  800S  D&(KL  ` -餠p夀LP` 0 cR. P0OTS0 @0PUo00VU  q 0-D0DP0LP 0@  ` 0 0h0   q - LMc 1100l ?SR 0Y0P! 0L H1 0 Po 0eu1!( K0@"P8 0  le00K`PPU`P`ఠp 0 0bQPaQ0 QP0PU`00VU(K     -QL0S? 10Sq%7P$P1 0@@Ȁ`Pp0& PڔP0o0 @ R@TPA%P P@`@qs,  q  d -$2@0PSL |"0S0000Ps1 11 a0Ÿ`0  ឭF1#PYX@PPN@T PU+T)P1H818!0(0p0P7000 0R`:``P&0 0 0 0 00000x0h 0S @l 0@P P0 @$4  q     s -0 0LS0 0 R ? R?;ʂ;;S p \*0/S0C7SC-p 0RP`C!CR00 Q0%2>&B P`L 0S W*` P0@ 0P!00*0@00P*-S0!P \P0307 p-t0LM0@SPSrP`K 00S Kp蠶 -LTMpz3Pa=0`P`VUTSd@`@a DpPK 0@ܱ<0PpK0@K  0K   -0 CR 0R0 S<00 -LlMDŸ@Ÿ^ \P`p^q ᆂp28Ky a=0  RQTSAAa  0@xK}1PxK0C@t1P[ 0P8 KP Pm8100CS (1 ,8,$8 #4ma=0 mxK200S y :<0 0BSR  h00S [ <Z$K,  ,0 4   $  p-4L0S$1`@ PP>000-S 00 00 00S  phT 0P0P! P P00:U0S ll00:SLQ10 0 $(01m?Pp  TT, D  P00s 0P-L 0S[XpPАРP(x,̰`P=ǰ@P  P|f@P0VPPS0    Up 0S` sst   -L Gx T -L =xT -LlM@P㐀K/p;@`0@JP z10pS P  P 0: S 0( CVp$Kd\ -LM K`V 00s@PIrF 0SC kR bR&mR wR!$+%$+*$&U*T'0@P 0 !$/UT0 0 @P 0xS S *S d1#pUT@P@P 0-LMK@YpPP00S0#3 5Pp0@ 00S S00 -0P@80     B@0 0 C8蠶  -LM8 8 4 /w/P800O0屯P|op , 00@JSh>p>>>x>>>>>>>>>>>>>>>=>>>>==>>(>>4>=@>>>>>>>>L>>X>>>>>>>>T<<><<>(>><>><>L<==(=0=H=(=P=`=l=>=p^NP 040 = ? = 0-S0S, n 0,0 h= 0m= ph-00|-Px=  @=cPYW H-00?<= -00-7 =0F,0 00=< Z  ኿@P ?Gp< I00< 00 < < x' 000CS``a$a , x00Sl~BDT0 KKP`D0X`LhT P\s 4 p-2L@`T 2P᯻!0S  Ro1@T 1P᝻!0S  R]1\[ a@ 0S% S06S 0S 0S*0S?0S;:> 0S80S50S-10S(  0R# 0R!  0R S  0R 0R   0R 0R\pps,=s0s -L@p  Q.SW}p 0S0C ပWP `޼Pm 0##!>C=S0Hcp0H S^efefhef,efdfd 0 <#d !>Cv.B B 0@<#!>C0   0##@!.CDR  k?C0  0!!!.A0r03 R0S )0B0@ 0#"!.B0r03R0S @ 0##!>CS0@ 0#!>C;S0Ipq -pPL 0Sd&/l`P00  S,UXB .UQ  a w PR00EU0@PS ZV 0SP00MR CR cR mR00000X5 $0` R% 0S P 000X% 0S" P  ᾱ#000  0R  0R 0p ᨱ\0P P0@@@@, <`|ss 0-@PLD 0SA Q0S(P4 0#S \S0#S@ᢳP@   # @!|p0Q0 R 0S  RP 00@ 00  0s=,T 0-@PLD 0SA Q0SֳP4 0#S \S0#S@ P@  b # @ታ|op0Q0 R 0S  P 00@ 00 = 0s=x -@Q@0@L@ M@!Qp$`K 0^0\$0 QT 0 K0.00P:$0  -h LM0S T`p0PU 0 P` V$Ks -LM0S. 0p0`C 0PS1S x `F0S0S  0gpGw a0 (Kssss -L@`Tp# 宸PU 0S 0S0S 0 PS 000 0+)s= -` L0S `Lp0PU p@TP` V t' -0LpW- 00S)00S% S# S! ; 0`Q@T h0S 0S 0R 0@S 00үiϯ t(  -(1LM0S`@ 10S 0/S BKASP` ! 0@0Q P00P  000p0 d0@IPP T 01,0 0 0@嶡000$Ksss  -L@L0S < @00P s D -@@L0S 0P s=t -@@L0S 0P s= -@@L0S 0бPl t -@@L0S 0㹱PU  t  -L M, P@`T 4 00 0 QqP 0S 0S0 S $߱@P ,IP P `4 K  080 0 0@®(Ko (Ks=< -0L@pT` QP 0SW 㤱@P@00 0` 00@s=p -2LM0PS0 { ; 01pW@X ,  00,0 `P 0 S0 S R30`+ 0G0 0@S@,00I 0!`P< 0$00 CP2 0@ 000 0 xP 00 P oP@00S0x@0SP +0 080( TQ(Kss -0L:P -1L@`Tp1 Q@@T ᆠPPဠP' ˭GP  ư@P GP GP @0 00@嬭᪭$t0L -x0L@`TPp X AT <P  P:0E0@t -1L@`T_ 10S] 10SY; 0hʵ P @U, L0S 0S 0R 0@PS  ! ڟ0  S;00 S00000CS000645PP VGP t0+0 00 @L00040 00P(a t(  t -MLM1@Tw pP!@T; nK`F⼑`F0S!0 G 0S0S |!  ]P  H!^F꽟P @T a= 0R0S:41㹯`P% @ 0UGQ  P a=0l0 00`G \ B L <ᅬ (KtGt 0-@LPU 0Pld0d@` ۟P0P 08 00tG(TLTtd 0S P  PR00S0-SN S S  L0 00N L0 L 00N00N L 00L0B 0R00*0B00R*Pp@-^P`@L ^ ^ A0 00LA0A 00L 00LA 00AP @0@ 0P!00*0@00P*@ pp@- @0R\  0R: -5L~MP0C  Pt50SVPP P p-L`\ P0  ᮛ@P@E"00pphN  Qp-LPY1S0S  D `P  Q@2Tppt -L$M P 0',78 `0`0gSxS  |( @PT< Y pǏWX<@PP; 0@0 0 d0@000C Sl;^0,K A,0P0` SQ0"S0A0U@tsVUVU 0f,0 @=_o P 00000 0S S T<00xQC T4 P48<% , P4@% pWXW  P*0S YP@ V/ 08s808@  /00@8 0K0C0S dd8d$ 0<S 0KS LS  d  $0  da4  | a=0 Qa- 1@a=0a= 08 0H1p30SJ0BPt -830(1$30SB,Pl 2b 0@ 2@@4^3^$*1^t:C6^ :K0NSmSt"`0:0 =0TC 0 /SP2) p0C `` @t4^  2** R @ 40@44!0`0R2^x!`0 :0 t1 GTh1   p0` ;@Qa=`00@ Q b͊K^1    `"a=0PHp D ` <@0S@pb0 @P  0HK``(K 8 l   pt$0,4(  Q0-LP0S  P P  C@$T0 00t  -LMpP# ٰ3  `0C`0K0C0Sd@"0@ "0@  d2   l2 tt2  |Ia=0 BQa- 1@a=0a͊b 0[  08P 0F5^9 1^ 2^.K0NS*1  *px1 )p0C CTQa=0`b 0 @Q K^1    *0< <0/S 0 ) p0C  Pa=0`@ <0S@pb-0 @ T0   0/S  00C0( pt,0 -LP4P -LP0P -騠娀Lp PጘP`ᆘP  0hdd T000CSH 0pu@Ps     ! --LP0M0 |0  t00S h@0S \0Dj P00D0D 4qT $ K48sTl8! --LM(@ P  ھjKt -0- LP0M0 0  0P0S @0S |0j p00d0d T.TH 尾U]8 $"T K048sTl8!$ -D0L @R {=P  0 0 t 0-L"@PpB8lPP \;8X0P W<00S , K00@!tltHL!_M 0P Q0A000  B@ Ѝ 0-P`L p 0ᬇ  0O?0@@c0@0S@ 0 @TpS 0@S 0S  O0 R 0 S -L ge_h!T -l1LM0l  y 0D8 YhK0 0(0 0,00$(0480P@`p $,00< 0 Pp 4@`pPPp e @ 1Q0^l0  L00@ @l4@T V!(K蘶!$"XX"d" -|0LM0 K 㟚@P-ID0@ @@$I0 ֭KX\x-0 CR 0R0 Sk!00 0-LM@P0 !Pa))[ 0V HQHPhQHUTPE@H00S< K0h( K0h!l"""""d" -@L0 0Q 0 $0Q0 $ h" # -L@Q񟗤T\PXĢ$PX`hpxLWQ6ꬡġ̡ (08@YWUS0SO #SHFDB@><:864;0Q xxtlhd)HT!PhH0 $#$(,"(h Q Q  0SthC <8#"h[L#X#t#####$($8$H$X$$$$$%4%H%l%|%%%%%&&(&H&l&&&&&('P'\'l''''' -3LM,MQ (K@ 30S  ld7g K(@T*?T IK@3(@D8#0O K(@*0K(HJK0#(@Db?*!0"6*20S "** P% `V"@P  0r L2宍 0ᚌ 0(" KK(@(A* K*(@ޔ1 Ra 10S] 1K@1@P 0p` 06(J@P/1)K0 B0/09K00C/0;/0Ԅ/0;/0 Ȅ/ 0 ;K0L/0㻄)K0 B0/;K 80 ᗫ K(@ *xJK(@D (K'T'(`$(\<(P(Y@t(HtPt8t@t( -@LT  p3p3e\` -L$M@H <KL FH001@0 0T 070  LF @PH @e0SD@ &0 S6 0 S pO 0 K0,0,<4 ,!4$ !$4 <,,c<0K0S@ P< 8 4 0@ =9< 8 =40 <08 P @@$4 pWş` P`^`0S%0S0S*0#|5 hl R0 T,0 0 B0 00 0406  pL`E 04!48#8DZH V40S /0᪃/@P0: tBZl?D0dD C0RX58;T4p0 S A$)@PR " PD` T#*0T@:D Q* Q:\30  0DP010UPL`LD l H\@`Q p1:Q2 Q(P@U@pA*A 0@$4,<4("4! PEU pGlWQ "0S3 0 @R !@0PRpCV 0U T8 ᤪP 000@pc@'U` P@*A 0@$4,<4("4{! puPUh pG WdlH!0S, A4_@p([0@PD Cpb@pG@p @@P^`0000S  ]d00  (KX(`@B8tHtPt@tt\$t())0)t8) tD)x)|)))))))))) -MLMR`p2pp ("(082800310 01ϧ!00010S 8KlD80@,̠<Ȍ8(2Ȍ18.̌$< ,K, (0 Ө41@PJ 10  P8#8 A$#$ :`00 V/P00S` R{?JK$@D0@D0 `ݨ> H00PT    000$K tttXt)T*%t -L@:@ 0-LPS0 R 00S* 00S0@  0㣁@P@@\0t X00 c0BQ T T0 0 S@  QP0p`4t@t@Bh(tX@) -L@eM0   )0K4@ *@K(]P  _p&M<|0lDK 1   /D0@3S*|T88xĸĹй1 6D ;R 0}0 ;! 0@00090:PW00d 0]0@KP P ,0 偧0<4ʟ@P 00pP*:UlP  :xpPrP =V hJ 0hpP00X: *K XP #V,  1{6D R k 000000 ]00z0 0w00t9 X6D |9RG 0lˌ 0D6D )KR4 0$ 046D H R0|(H0K)p0<11 6D 8R 0|h(~3p\8 0hSHXg -0@ 0@y 0J8 ㆈ/w@a 00@P7`PP  0fOK00 ⃦,}h7@6 0ST   D& F0S47 0080 ٟP F x60! 0 Q:<60  6 60<2S<&000 FP ᴦ50000 0PKPD'E0@ 5 40Kj0 T5 40K_   50<2S\%;0000U B>BS3  % 4E 40K?00@000 ' 0)[R00@ 0  0 00  0400T40 ! 40<2SE@K(P ?#K K0 KPPt<30 3@ *0K@ P030 X3@ )0K@ Pp30 3 00K P}BP@KP#<0K@P 6Po< 80Rd#80KP PTa0;CS08XTb,CP$#0P P 3QՀ" ۘ"`R0S@@ 07 2   @p a0 pA0 02qᑞPPHpKPKL`KD0 @0`0 \@ 2 X0 0    `K01,PT TK8 0j@P 0S ;:  P0  @ P R ,0S:9V|(* tX{Gz?4*\*,tAx*?*\*t***!+4t(+@+T.AtTd+x++d++,D,X,x,,,,,Xt,,-L-hpD@b'd-`O -<<0SL`p@V( = T 001D`P,*X# L0S'0S 0 T$0/S \0S /S   0S /S  \ 0S* 0` 0S3\ - @L R000# -LM )AL0&`S B0 P!09 `0004 L0S, |1` t1&  Pp(0@S, , 0 0!U A, 00C0S 0000V q0p    , 00 0S Z1014q0, p 000|t M-L,;h.l.L|...\t`.. -LFMEpFK$ 4 < @, 10x%: S00Sd@\\U|4 0S5</P) 0  $e0FK44 5 @PA0$Kd4 `D \T  X4TD  I 0ᰤ: S8 P{lD, 0R(K 0S `D0 `P 4TAxt$` \$ $004Kd$ @FK@A$0 3 Q ^30 BKJJ@0 30@`D V0D@P 0-0f 0 V@P# 0^@Pbz ܢ|4 S00C0<2 00xD tT PoP@`Ko:4Ÿ0S `2 0 ?P K #PR 1 R@ =OP9 00!PDtS $101000 x~ $`\!0S  ,GMBKJJ`+4KZqQp l$  10C1TGKpL0@ 0R( TuR 0kh..L.\t@/`/.8!//\`tl/.//n///- -LAMDp`@P0BK( HqH  0W *  V0# 00 0S*p( 0R!$K {@&P p l0 Q \XW VV00S: L0kD\0h.0- -LM0  -`LMd&0 eH"(@gP $0STYPPW $0SK(0Y,0 ,0 @0 p(p @TP @$P!>P YU3P\1(PF, p`0OQ PP(P $  @, T00000 0S 0ST0S q @h (0TP0PPP04( 6  (  6OP $y$0 -LMܡphP, h 8Ql,0S V0 !P# / 00S@ 0$@,HV  E0 @0 o 0 x 5"@ 0$@(/P @ ,峞,000 z(0P` d,@㞞@@,$0S 0S,$ 0OdT80 -0 `!pVL:0 P0WP`00 0S0SWP \ 00\ <0 0S \ PPX p-@L4֞,!PL00S `0 0S0 0 00 lSp 08#80C SxhXpXXXX` 8#80 0cP 0` 4 p```````` 0   0-LM@P0dPj iT0  0AS8,$  8 008008`0p0 0-|0L @?Pd0 P 0S P 0S0S00S0 L0 0-P0L@T04夆P T00T0S 0 0S  00S:\ p-0 0LR@P p`V 4Z40`p p-d`L0S TPT 0@1@P䲓0S孓嫓000pLXP -@LP㝓00 -!LM0P`@0@P  &Q!0S:Z !WEB pQp(0@ @8 4 0@ 7,6" 1 0 ʛP$F* 0/ , 8 K P! ?@0 0 (,0 0 0Vx 00(Kd0d/(0 , 0S*0\ T -!@6 (p8 00 0婃LԠP```j PPT P300| P00S BQP וP,m 0 -QLM a  P0Z 00  M!0S:e !  TP$6Po(0pp 0, ap, ,6R0@00 0Y0 N !!$6Po 0?5!,0@ @ 08 0#Q PP0 hp$6PopXpp0S*WS0\ -1` LV@p$`P  %#T*V&0 R  05"| P%#0VL0 R @ 05", }81$1@1X1 0-PLL@T d0h0 R \d0T@0d00000,0 PL1dt11 -0L: SpP` RHh PR@l qPq1 -0L M@P4 @P 1  0S P`(K1Z1  `PR0pQ0S P` U VL `PYE 40 X X  X0 0p8P@( 0P`0긐0 0zp$P@( 400K0!0 0p@ 0 /i&L$ 00040H ZY\T p-0 : SLP` V pupl0@@0P` 0-PLM @@rU 8  T01 00+ !0S':1 P['0HCP- QN0 R D0K@ s |:K0U TT00S:4'(#2\ 2D,2L82D28!(2 -Lp`wL1&@B_?N P1p4|PP0 1 ?G0V 0 P0 00 0@0@0@ 0$@`p H!(,0 (4@ 0Rt` 0 QW0@0@8`d00|PLPDX\2 -LM8C\c, PP( L8 @h  P lC, 0R(KXCQ6D EP#a4 pǏ #a8"0\pG!#LPPzv 0K@0@ 0 2Rl < Dh<Z8 :W4 QG @(H8 PIKQ P L( R80PhLS00`  nK`F`F@00 0PP@nK`Pp x|t1P8Dx000p 4.K U DH000dD(000^PQP*D 10 S< H8 HH T0S BnK`F`F @00P! 0P00D8  X0DfHEp@x "0k<222|2H- -JMLM0S 0, 00,0@ $0: S S@  S> SQ7JKII ᖘ 3,p&0BO?  D80 hSRQ Xp<  0R0 80 S p tB, 0R(K| BnK`F`F@0 040($P@b&1C1/1p@Y XP Pq\&T 21COP  pǏ R380S00  BnK`F`F@00 $0PP) P 6 #1@p$Q  $  R  $41 ~ x;PGvlD@;dt`Pp (.$0P`0k222- -L0P"Sn@00!0002  0b1  d1 RPe 1PGK0Ah2@000 00] |tl d\N TL zD 801(>a(?K P j 0k3T8QL84X4T@5\D5l5Ht55dPX`t3\D\353d3444|484554305tC5P3 -@L`pPXPU#!1S<000!0,!,0PU0,0 @W gP ,0PU0,0T!0>D!0 S00E㈎P7 @Q 001 R 0S R0S0 0S 0 0 S00ڄn x0 R l:\p XPHH D@:K 6L(6\646<@@6 - LTM6S `R0,2$0T9(&Rژy,1 01`9(&R,6T K0CD0C4 4 < ȑ$01 $0Y44Kh$ W*(0* RWQUPt60CO fN^KPEPE ᤑ4I( K@(4(0 0d4 `D 0\4 XD V XpX `@0  ( ,0  Ti rk  m`ß  @$P  PpXBn, 0R(K"72V⿏@(0,@ P|(~BnK`F`F@0 00Bv 6t( D0SkV(0EOo 0 5" @(0,@ R ` PkG(IcU rs   ~pE P 0!000p0C0@0 @$P0PX[{40$ P/  0:P ec P  0  0p0CX0)I P||=x%=0k7`/8PX!0СP`(0K\ XP T` 0AS<X#"#"##!0QMt R PP R 0S0S00  0P @`R*$K&   0h 0@ 0 P0SR@0 R*AL4 Q8!H`.:p:: -QLp `<P@@(T` X:: -LzMf0,0 zPwP00UQ     6Yf(pQ ,6& } P ,6 0&s &S&O KK( 0R01K1Kl1Kf   0S*1  11( \* P00P0S 1  1pG1( \:6Q&00R 0 >.9! Q ! E 0!R!0P52 5:1  11^ʤğ0S ,6 1R 0l p ZJKJH$ 0 ᚋ,6 1RK K P$0Sh# 0 ᅋ&:PM0S{ 0# u2&*P`1!0  1 +d3 0AS<&l&(((l& ?,1   1pG1[0S1 S,6!0  ,6!  iK ?P l2&1001&֋P,B H34- iKP 1&Š00&᳋PA{ " o,6KQ01,&K p,6hAQ000E0S%\!)0 R !Q0 S  1r 0`S KP ۀـh, 0R(K! |@1! 0 w000SL_HG70k8::,;`;p:;$;L;X;d;;-00 ttt0t0t -LP B/; Q-L@ ̃P T1/; P-L {P $/< 0-/LP;@P 00+8r/00,+ s+s00< p-LlM/P:@P K P0: S Kp0`rS@j Ɋ P0-L@P0 R 0 R 00ht0 R0h0l 4H0 R <0<808:0ttt<8!4k$< --LM0 0 : --LM0 0 K --LM0 0 K -L@v68 h -LQMH0@K0 PP`pK< P0: S V@@ S00S F`P P$KP T P`0 R000 ZK@ P h1: S 8((Ytdp<P<`< --LM0 0 廘,:T@-@0 0   0 0 0$  (@$, (@0@, 0000 D@0HD LH0L 330## 330## 330%% p@-`L0(&SP d0 60PpP0\ lSQ!A\SQ0 -T L@HP4T@7 fedA<< -L`p@aqPP  Ua0B0S U00@ S0a>C"PP R R4144!!0 00B S c.㘈 P 00C %`fP0Fx3 @O&6F n  P߆ @06؆  ?P00`C-<< P-L@ 00 R$hkL=8! -LM0 Z3 ?a3s ;@P (K謓k  `姇#3R 0X 0@cX, 40 t"8 @0E8  OƉ 6F&Va3 ($6[ 0( c"00]80S2 4 ,0|B 0S<PUL2   00  0 0 00 ,0,0 00000 330330 33033 @0L@0 D0PD00 550550 55d00d0d0d 0 d  `0d0 1 R0H0C+P 0 R04 0 / d0\5d0L `P@ 0R@X  aA TDTdS4=\`8=H==X=== -,LkM0 '@,0 7@'0PKAP6 `W P6: S 0WPU  뼖P)0S 6 Rr 0|SPx0Sr t&tPpvp0@P PPPP 0SM PK P(0&&<0000PFU0S 0Se.K B BPT, 0R4(Kx5x@l5 RdU.3S0 ( @@%@Q$e $R3  !4P0S 4 RxTT0S|l 4 p0S ~P, 6S!@Ƒ` 6S3Ɠ,6@ \   0P VS`zP ` 00B10@~3P TPC~d3P ~H3P ~,3P 6cS00 ,20!6 S 2" ~B~0"SZ PX %C4 tVhdP@6冐L"L2/gkg@@*1 Ra^p1OZP @0S@@0@S H6<4"D0# \P @0T!1 e1dPH1@0$@ 1R  u0k\HP>46TLX>d`<D?8\@>>?,@><>@PDXLp>P@@?>l???>?(?D?A`A@-@0SK00CS0JX0@X0FTI T00CS0)0 R0' 02P0S  P 0S DPP m PyTYT nTNT bYTyTXE@XE@00L46XHP$BB BA -0L@SJJJJ80S d`0 R T00 ,DP0000DB\L0BP@ R 4 ?0440 <啀 @< 40040 0@Q$ 8 ( `P0@_8 0K@P |0 d0PR Uw< Lx 4(K0< <CC<CBB p-d0@LP`\ D0l88 000 0Y `PpHT 0-PL@T 0!S0S @T@T @T 0 d 000X 0000 0 @P@0C -$1LlM R  1 qf0S!  ]'p@, P1 P@T P `P p$ p`0SxKiP<0X S;30hT>h>QQ p-LM*@KxPx` vh @ƻpP  v0 01Kḻp `Kp#H&i Ri R -L M K0, @m$0 x\p  006@K|P`x  `vd @僻pL  @rKzp0" K(uR$u#H&i Ri R -LM"@K dvTT0 L@Yp [Q"0[S "0[ S ϸK#H&i (R0R -LM0@KQ >v!:v  P ^0 ,P A- 0妸`p@P0S 囸0  喸 0S-|-j0lS v P`PU@KH\&H&iPRdRxRRRRR -81LM@8Kq`P  uV@! V/a&P  0㯜p@ 'PK 0uP !400`Pb@P 0 1u ^_P ᢵ $Ku&RQ p-L M.@K `uP0 @偺p'  ^00SA[T0K 80SK XeT001K,0H Yp4Kp#H&i R$uR(ui R -L M K@,0 $`\p  00 0@0P0S p$h]P\0@Px`h@lP @]P,0@Pp@tP|` K@BR@& S(Sp&0S(S0S p-x0LP5 @o T 10S T p>h\pXWx0o<OS`RV( _@4YML@M|10ld@K PctL \ 8WpP 0S=6:>[KD@K$PE@PE >kIt Et ,P 0` \ 7P L 40S >KK$@D`@@DPꩶ*0tS  X|P|@40HUZ<M$KT&UH&\&i P@ 4` 5P$Kp|UH&\&i$dOi$xO -LpD`PP hd p0 @80 0P(@PhUhMUQ -L@rD008 ,$008&UU$% -L@UD008 ,$008&VHV$l& p-L$MPP& `@ C0P  `t@TP0KpUQVVVH&\&i$dOi$xO p-L$MKPP- `@P` P` @TqX7LPK qP0 4 4KK[lOK嬳| (q{K L ( Y4 HP[P Q[U$ {@|UUU{儳VZ 01SW]KG*-K0  0S X3 Xph3*>,AT 1S1S1S(Q$!000C S0:S Q $ PD`T 0S,+,Q)V@P T "R0S x@)0S,P)K 2S*0S' ,)0  )0 )0 )0)Qh)L"Rd0S`޲2S |[`1P|!A tѲ0l HP01S H10S  |0 10S  x00S 00S `p@Y(K#H&\&i i8i4iiiii$VVW Wi| WBW(W0W@WHWLWXW@VQdWlWVxWWWWWWi WX&D& -ML MPDDpc<5< 850%,5Q$V 5QQ5Q L50S 6  U 0S 0SS0j1L@KAd( oP *Xx ᝴PW P|,P<u/hP   ( 倴P( <0 <0R$ 30S  30St((`0 D30S8))$30S   7忱Z20SP` pA00S UP媱 C`,0V pWP`eZh20S`B`R 4T0@$0$@SFNKP@D/LRKLQKn |W1 PYK4[S SoKL[ <PP%jP,bWK[1K[!Q``P?K@ P@OK@_KL[K <jP,@W0 S/K6T$00@ ᦳPQ$t0 図P0Q $K8!\&#T&W4&X#X&XXH&6i(XX, PX&XpT@&I#Ki Y@Y0Yi 4Yi @Y -L|M\pK@8 P`Kbn@ ^n0tL0 H0 0L0 D HP81 L0 , H D < 4 6  P1PL0 00 C R0:S@H P$pK@` 0$ 7P& $0@@T0P0S \@K $0K$ P $0@@ D0 \@KD V80 0p( K@WHYQTY\&H&i8tY 0-L$M8@KP$ m qV0S n0P00C SX8@K `VP800 (Ͳpv K0\&YYH&i$Y 0-L$M8@KP$ m 0 0 !8 a Pp8  P`!$0 Y,0pW @40Sڠ!0S`0 CR` #X0  @X0`!0ST`00CS`0<X0  X0000 S00 (K @ p0RX @0 R0 R ` 0BO?( ߟl V@P 0P 0@kX 00AS$ 0@@0ZDu'd'('@'xe -0L  4kTe p-LQP@4 `@q 0  00 R?`0 CR` X0X0@Q 0S q l0  0X0 R?L@QQpp0R0 SY꠶<' -pL@P`nP`  p00pT@P a@T l0 P @ TEP@0㕓#PU`pW*p'fTDTLut' 0-LM@P  K0K PP\p (00S K0p' f -L MP@ `$K 0PP[p $]UpP 0 PP[p ,00S Ҟ 3 Kp' f @0P0 R0 RP . -L,bM00  Cr r r0R0 Cr P R1 @,K@}P3,PU 0 @  0 R% PUQ 3UPE <14101 R Q @0!0@S,F(KJ00PY& uDP @ T0 RTP` \0@AP 0004V $QNuuugggU -p-M L M0` R P  0 R 0RKp  \jT ANK@D@D08 9[ $"u0kuTgxf -LM0 0PT0<0@0D0RH0!K800 S80[T<`p0Q80<`@pA(KD(K<` 0D81 PHL P0@ =9@HL =CP00 R0 w40S)`p<`@pY0Ϡ Al $!B30b ` 0<`@p@DTQ 0H` UX0 R0T0 `p<`@p`p<`@pfh?Bu8h@BC$hu -Lp`PW PPJhS@PV h Z` 9D`P/ `SPL z0Vd0PPPPPPP$0 ( (0S<0 0P000 P0000/ 0S0@ 0m0 rP0dh PX cP0$8 ZPXP .fhfhXhh i -@PL 0S@R 80$ sZ0PdS J 0 xiT,i -L,M`@VPp 0S0((H0  ipH 10@<S< p'0cP1@ QP'W0S7  0S '0S  )K :G )C\7P 0Sq PZPL 0L <0 0D 4KP0Sz&0(TP@ P"P㸖4KPU  `T0SH40KP Q ʶ  Rk 8&0S0<<&000SUx`44 6 +%00'%00#00 %00%00 H lP) P* :P, )Ps Pd$5Pqn@@T 0$q0004 RT0SHV] P X0\Y 0SR`pPUoVz 4KQ R0KH 0S| 80@  S0S00$ 1H R; P R 00S \0S3 R(KP F-P000 P000040SV000PW0Q0QP ,0R  P  > RN$/L#b DKPEھ3[ L4KPU`|"QkP0 S00k,0@ cW P0@=9 =0v"00040A Q> $0< 0bS$080$00/RR,0Z00R0S L0x!/P  10SU0@O>X0PdS 尐0H0 0C:P<)PD 0p VX P@ J(t DiuTuuuufj .fju8jkx'lkMbXk8kkiijjjhjj -LLMsC0 0 函Pp Q20S/  0)SP`02 000 R%U ^ PO0PU3 ^ K.0ʀ0K@G0"@ 0RK"S  0)S00.S /S00Q  Q `0P0PU8PU ^ K.0㐀0K@ 0!@0!0!V- 0S% ^ K.0j0K@0@T!^ K.0 Z0K@י0!@y!t 00S@P ^ K.0< 00 ]\00 0R\0m04000gxm^ K.08 0K@坙0@ @U0k`--flkLlkk-xl(lklfl -L(M⼁A0@K$0 `q@0KP0d@0(P D0 `0@0 ) R ࠓ 0 .@0@@@ PP00 00 P0   DK+ BVP0 00 ؟P`0P 02S 0TX 40$040 Q K00 R 0ku|-fm.$muf -"L,M0P Sz 0Sd "P@PPP PPPP@t}~P`\: +TPqpDD"P0KpP_(@K`$)$ 0pPU0)% p,` ߽P`@ : L0K0P < LP HP DP @P 8P 4P ͽppW t!10@Pp!0|1 0t1@0 `P `(K0NP,,!6p!0/p0N0P~ #pf&0 \0 pRp0 qHH0\ vvu|m.!|--'`---f\mm8mmKPll L0L ׻$0(  v.--g<oK p0t0 0@@.K8#8 $#$pD0@ i0RʉO|O$v/H/lO /O(vOO$/HOdOs-vPOspO 0-LMP 0 R 0@ 0 @ P0@,0 (@ $P P 匲,K PK0H0 0+80 +0  0@ 0 @ xO@Lv@@0` 'S0-LP@č 0h$(@0dS<Q<4+(+(+(+(+(+\+(+(+(+(+(+(+(+(+(+(++(+(+(+(+(+(+(+(+(+(+(+(+(+(+(+(+(+(+(+(+(+(+(+(+(+++(+(+(+(+(+++(+(+(+(+(+(++(+ ,0hxv001@U 0$ 0hc 0$ |0hXplT0\0h豍TL001 80hB,s  ts" #sstsss -CML Mw@0 @ 0 PR񟗋..D/d/.........................................................................................................................../////0 00$000.00,喌 0RKQ񟗜11|1p1d1 048< ("#xQ{ Q mjQt *td 048< ("#<U4R,O$LIF C@=:嚌NPK .0rP , .0rP " 048#8 $#$("(RCX2L2@242(2H < 048#8 $#$("(R2|2p2d21VysMpJmGjDgAdۋ2  @ Q32Ћ8͋pʋl2  / 0`S fC -*Rb L弋$<幋8嶋0峋(尋 孋媋始夋塋型Q 噋3哋-SRNPK .0?rP 1 個||V( ppMKw @D K`@D @@ 0Td P 0f$. X:. S+NPK .0 rPPM0kwtttuTu&L#huxuuuuuuuvv vpv&ut#t#dt8t t|vlO@pwlvv`vTv@v8vvDu&,u4pv pvvvv -2L4M  , P@A 0Sp S 0gԡ0S[`00CS`0cX0  X0TTڜ1PZpK""2! T`` h`00CS`09X0  X0@DT$PV @D <4("4! .0~qP ŠV x Ị0S @D⓻T, 0R(K媊. X 㕻 d|T`X喊P哊X ・8lO0k|vHw\wPw8w,w$wp -LGMMK@0C @"0C D 87Pp$0S ̟0 M 00 ) Pp݋,0 ̟ 0S  )d+0 R 0,00$- AN(=P | ̟0Tt+00B0S X[T+0 00000000`@A`@ T @D0XD @0˟@ 0\$ SE>K0C0C 5  \ )* 5\ 幫pA M.K B B0% L* R44:0  4 4 ɟ: 5啫Pt0 ʟ$0R pspW@$R$ 4S P P0s 00) /0:   ,)00P@@X04 .PH 00) 30 ) B0pP UFnK`Ft `FP@  0H6Pzp4 RPwPpU@ȟ0) h$R ɟ0RFNK@DP((0PP7|x)0PPǟ@)$ 5\ @P[7)% 5@PO#(@! @夅H4t垅.Q @y%@T0-ǟ0@r |g00 wlKIGK I0JPUW@T0S,0 p6@6x (K @uP KAPP(6P\Ɵ 04 H0K4 4KL 4 D Д 咨P %5 R `Ɵ0RP&p6 0 aBQ6 50SPU p5 %0:;:0%0<0%0:;705EKAA gP6Pş0 R `4 R$Phm%000`ş|5   W$080R$ $ NP,%EKAA 3P7ş0 R2 `4 R. 7$EKAAy4`p0SN `4 RJ 3 P΁0P@0t 0D" 3#)$U@t3Pڨ#000 DEKA A3@ R `4 R0 S 4#0:;80SEKL L @0d$l R4"F>K0C0C"壩ptwK.K B B@@@@@@2Q@ N"0 4P0 5A02 : "090塚!070L2 0*4 !080!050!0@00zaEKAL L0 P Bd$0Ri 0mQ0EK0AA `4 @h 0S 0 R `4h$TQJ O0kO$//,zTOdO -/O /}}@/ O4v@Tz,/?.A' y!+y4*xpOO {@y'*hOD/lO~}~xO/+{dv$/{8v|OHOPO'u|0v|}O+yTzzh{\p|H|y$yx}}|(*dy*xypzz,{L{z{|{,} }|{||}0||d}(v8}Oz1 *++ 0S @A0C2SFXUTDUTTT0UTTTTUTTTTTTUTTTTTTTTTTTTTTTDUTTT0UTTTTUTTTTTTU:P "0P00@"060104 0S"0<0"0:0"0;0"0:0"0;0"0900S3 3 0 4.0@>@$ 4 %FnKT2`F`F@P)' 0pD PP2)( 0PP u30%ύP  -3P-4@( 3P!(0  8啂꺩0S P#걩0S p4p3M>K0C0C 5 ?$1 0`PAy?$4 Pd ,$)+ 5\ 奧p4yh$E>Kt 0C嗧 00) 0p   0,0Q @@$ 85P @p5F>K0C0C@)& pD iP =㳦IKK,6NLN L mX6 Rwu工$0p4 t@P6| 4 &S00  4). -P 0 Ps `) 0`P0s 0) `P TQ 0)3 P p$塎PF.K B BPz᱌ O    Dp$E.K B B % ) 5ʦpT\ }/t|  ߗ ۗ{xu00ɗ0ŗk00ῗ 㺗 巗$0㱗(宗0T8Q@NHKPHXE`Bh喗p<x9南$剗/)0 S Žˤ9ɠE>K@)0CX @F4 0-8P8@L4 >>  07.T4kX~~@ - L⑤h~ -BMLMpP<y88E04`00 ,0 6rP dP jP5`- aP* uP zP# tP#LP, 000|4 hp 000C S/0 L$Gp00S84@,0S 0KP Zӧpq 1 dR 0+S 3L4  L$ H@TPp00F S.VWppP`V@W0P 0p `=P_ 0RR!>C 2#=S0V=@ PRaalaa8aa`a`a`@ Td0 T?#C0 2#0@0TT!>C 2"0r03 R0S 00C0@0TT!>C 2"0r03R0S @0TT!>C 2#S0 0RR!>C 2#;S0Sx1@PQ0GT1pW*@10S HKMpLJ 1HPK`<K0S@<0 8@ 4p Gp( <K<@ 8P 40 .P/ P %HQ 0+SL HXä Y ` gPP|MK@D0L$a%@OOO~~~T ؕ4\|prC0 S S  -`0@P@@T0 LV <00S 000S.99Oytvx -L[5@PD/d p-L@<P `'%p p-2 B 0L`@0PP 0S00L|2P $ -8L2@<0P/S @P,%P$2 B v30S ,,,, 1R_P @$P`F +V 0+S-S0SP*PM*P *_L10S I*PT1  @` PP_$P`T@D00S4PMP P100S 00St0Q. !')9s8P)PQ@pxx|xtz|yvy 000|T 00@`v 0-L@PU0 0 "`dT -|@L0p0h `0\0L `0D00 `0,0 `00vDT\TTTLT -L@`0X _P0@ _<0( _(0 _0@HTPTXT@Tv -L@$000P hv 0 0S00_(y1 @K1 P  `PPPp0P0ASP `100ST1  K,xT4xLy8Hy<,y@(yش4yD8y yyy0y 06S000v,0 0@S200 T 0PT 0- L0S( 4 @ 0   0 ,@0Q@ DLP 4 0T4+0@0h,0Tlv -0L p0q 0 -0LPU5 40 0@044D 0S%040P`0$44p Td$T(d,t$0@044D $ 0Qpqh;(T -0Lp`PP#:.0 4@0$($,T044Dt T$F P 404(0$00 4silvT8 p-L@ 00s'0@v -4LpMP7 Q $$0R($0R,0Q00$:$($? 20€0 S 0S0,$R030 5: Z02Z00 L R 0s0s* 40S 4 3 R 4S-P3 3@ 40 400@000  T3   0 0 0 $4(D0@0 00 2$($6F`Ip\ 20S C. rs SʡR4S4S 4?  0Kp@PqD4'W20dt Ÿ q 00010*b%pl P'71 4D0O4D0P0030d4tp10S) 0S6+K X&NL10S@1wK☶P(0 S 0S1 0S 0 +00 00S$00 S 0 0 0  0 0  02 0 ,0PG*0(KTyv Tyv\\ylvXy`ydyz 0-0LPU ,4S0C$(QP40@aP $4(D 0@$4(D0,40h0T -l@L0Swp D0,$R0,4$4(D 0@$4(D0,4T -1LpPW`` 10S CVYqr V0U00I0O,?   69F$4S4S  P4S* 4S&p" 0ꀀp 4S4S:AX0Q$(0<0@00,00TTyz -LP l0 P 0R 0R Q0$4(D0,4T 0-PL@T 4 m 04P X00S Cpq 0hH0 0@ p0TTyzp$ 0 010#ᘶQ0S4:Ss0p 0 00 ᘶ p-L 000 x 0Pd `?P @ r 0 04 (0$ n2 蘶p T$(00 , (0$0 0 0 VTVVVV0 0 0 VVVT -LMp@P `@_00C0 S%"0 .S0K0 $ K KT p-RL@Py0` p2TUp -LM`p$ @PL0 `pT -L|@||PM$pK(`K  ](0S0C(0 0$ 0b0 0R 0 000 KVVVVT -LMP@p`$2   e0` p-L@LMPK@%2`@@00S xT -LMP@܀,pK(`K, 0(  R,00# (000 0S( ,0S(00#D@(`K,PK 0S#@0 S$KVV@y -H0L0S00@@Y$ 0@00TVVV -P1LMH!0SK$@K0$p,`K0PK),0S(0S 0 ,00R$ 0 ܠ p@4`K8PK4  80@00l?T 40S4 h0 c\0@d0 ]H,0 ( c,0 0 h00S C$KVTVVV@y 0-P0@LT0 0S0 <@/800 0P0s300VTV -0L M 0 PK Ѐp %@(`K(0@00l?T $00S, (0S ,0$0 ,PK(@K$ 0S$ (0 c,0@0  KVT@yVV p-LM@ 0S0 K K 0P 0 0 R0AR00S t 0 d@0000"`K PK 0S ʋ"000 0SKpVV@y - 0L00S LV p-PL`@00 Rpl00 AP@*D0P0A0Q: gpTV p-2b0@S2LTP00P P} P PS PMP $ Po  P> J1PD eP PyN{yJB00S SAA00 S nrQA0S0S S gQA0S\0S SXx1@@`1pDA00SG?/=-p1 1R0R S P@0S00S S ,P@0S%0S S!, 00 S@ #h@00 S 00 SS 00pPphpvVVVTV -LMP/|||p`,K  ,P }@TP!,0PT@:0S0 0 0 0SvVV0PPV -0LMK0 ! KH0 -LF#P x0pq  T0 hH00S <@ N*.0S.0SPK !>P 5 P H>g P p>0S H P 9D>X P 8^0S= @T3$@%P\T 0S::PP>0S 0Sh->(0P 5A;}>`-0SD0eSKpd](4-@TD0eSe @D 0S Sf Sc S S/S 7S[ S00G.W S}dPx @,0S P0!W@  +W W R0R00@0#0<0WT <0WP <0WKF+Po@ @K0@0SP +aGQ0+tx;/$P%W} W W W !Ws W*W @W07S,g 07S+b07S ]*Z W W LP 0#0CS<P9&0S <P P )0K*pK*K 0K0 @0PuT 0DcSꔨ@4Ȱ$̪lL0`x$0ȰԨ0ȰL԰԰ȰtphxȰȰt 0IRQ|80S0SL80S8t  2RQ80S0Sf +0S0S0@W70S 0S0S@7@  B 0S0S0@9 , 0S0S0@)60S'0S!#0S 0S0S0@0S0SnP60S6 $6  5@T 0S5 %0D020D0 50S 5RQ45t50S85 5{RQ44~ %# k0S0S0@!0S0@40S0dSd0@h4\4p EQP < :{0S0@(4 ; /,m!8 8KT%f{"00S0S00S00 0S0@# a0S 0R<00S0@52P0  0S2P0   ,Sl2 0S0@02P&0S0S0@JP iP P !r 0S0S210S0S0@P 0S0S1x18K80 b0S0S0@Pdzw0@ P P k{ h00 1! j X0H0p0PN 00PJ 00 PPE PC -A yVxVVzVyvVlvyhyVVă@yyTytzyty\   V<08$yyy܃Dy@ypydytyPVV0L X0p0P h00P t00 PP P : 0GRQ000S00գ?0O0 R0S0,! 0c0RQ\1h10Sp10գ?0O0 001 0S  0 `p10S !1 !0SY,00"000Sv -LMS0P`pA)p (K0`!00 40 0@80 < K0 40P00S T AQ:0 6 R0S 08 R PP,00,0  ,0 P ,0S:<0S r 000 R00 ӑX 0e!0S 0f0@,Y: T00"! 0T S@D0Z00e0X,0 e0f1(K蘶D -L@0 !0S@-P@p`E5 p-0SS%0P gP' 00dP ^S0gS 0S 0S  0S  \:QfPd 0v 0v -0LM0@P3 00P/ 00P`+ P=pK,KUF@@ PP`  0@Sd`0dV0S0E@U@DPE,P `(K$yyy 0-LM@PK ^P8'P  0S NP 88 -LM@R,  r P @- R P`Pp 'Pڤ`0 C @R`0P R0  0S0@  0R@S  TP1:, 00p - LPhvt - LPhv -L hvx -LOph+ 0-L MP0S& @Ki 0s0s flP@T T0XP0 -000 0@$0 0 K0lvTyVXy`yPN -@LPFlv -L|MB0PP 0S U N0,K0 K00 `P@@00SpJ@P82p0,0 A P8  8Km8X 0 {E Z g kP, 8 8K10SP ,"P T8K8` yPYP ,;tpZ(1 w10 @1 P0 , KŨP 0K 0 0P@ nPF0 0R0 @yy0Ul00S(8K8` T(KlvPy\ypvTyVxxXy`yhvtvxy 0-LP@6@P \P0h#0 -`LP`pW!&`V@ZP PT 0 z 0 lv 0  lv 0 lv 0  lv p-L@P`P U  P V  P php -L@~h P-L 0hlv -00LP S hPy -L@% 0r/S@ R -LlM|K@P8K 08K -L0P -LAMPP2  0pq) NK,hPKp@%`@ 0S PP  z 0S*# P cP` 0S:VKy -HHaLp@P#R %RT0TS 0S %R #RP IY%PP@ Rg묐0ਠ`P@#R %RU0US 0S %R #R P ! d ,%@ P R pvlv 0-D@L0PS0P(000 P0y$4 -L M`?, %@pP@0S 0S P W @P RX Y"$@XP@ d \00T @k$ P  d,! @000S0(KvvP -LM@pP 0S `PKh蕫$@$@@L0H P`/$[ ~@UKȅlX -(1LMP, UAR*LpP; p$@m$@,j$~@`PZ0%S00sSZ,    N$ ,J$P@00@B$T:@T oxd -2LM0S4 8 2@TtPP 0|S0P0@ 00 0-SP < P  $@ $ @p`Y0%S 00sS  w #@`00@#T:+PUV 00S h10S@ @)K P ၪB)[280P40@p9d0p@d0S 00CS00`Ӥ0` V g0H v R @ a#p@`00@0Sp(Kyxp -L@{# 0 pS` R0S000S_#`PU P@000S 00vv 0-LlMKPSP@0: S@@K0 p-LlM0`0SP %#@9 Px  K(PPl00S0: S #*@ PY , } PKpyyXy<00S,0P 00S00Cyyy y'00Snxy 0S00\ly -Lp@P`WV 000CW`K@tPuZ 9X`yoQpWZVX (00S@ mU yy -LMp`p@P qV i 0 0-t0L0Spq p@Pq0T0U0000Ty -LP  00SR -L@pP`\T p200CW `20SWD200CW @w$200CW uUV iUVP@ x1P @1@T@ ZZP`!hpP`qX9p4q2P P AP!<T 0 0S0uv 0 0S 0S0x  Up 00pWZYT+00 oZ 00Su yyyy|hzlyhy -LMp`gP P @;P9  Kihp@P(q&V 0A8P 00S BP@P 0p@Pq Kif 0 K yTy0PPy0PPy< P000S SP000S0y0yP0000000   -0L`Pp@f P `VV'(` W  00P`p0@ 0 @ `000pW 000yy 0-@PL tP 0T T00 00C0 R( 00C0`0h]0lvyy p-L@Pq P`pvp P P@P40`0pi@Pp P P00xvv -LMpXtWr`#0S PHC0S <#0 QPW 0@PNP B0S "!@ T T "06 P P p/ `B0* P 000 ,0 pu0 , 0KP0K0PK` p@ !0040  6` P P=ڄA0S9x!0S5@D 00< 80  @P(!0S!0S4@ 1@M P ` 0P`@DTʵ0@0Y@XW40K@Pp6T00S  000K@P*(Kyyyyzypyy -LMpwx 0S P#0S t3tC 00S@_ 0hP0p , @P0p P70 K  00 ,0 80K0KI0@K00  i @0P`Pڲɯ`V* @T PXW5p@q P P`pR0gt T"@lTP`80S4!P00PUo-[  ) TPPx1@Tl0ST!0; Pp@@?41P`@ 8 P?P`@0K@PpA00S 000K@P*00SZ 0 P` D@ P P pY(Ko(KyyyTyzypyyy -L MP`~, )P,0@cT D dqt@P X(Kopw0x0XW0@,@p(Xy z  V0 U00 1 ,0@c 01pP`q @,0T (1(,0@d@ 0@7pP`q XW 000S (Ko@00CTy h00SeD0@@\$0 0@@(K茅 ylydyyy p-L`@PP } P p @P$00S phy -L`ppq|Ap@PqTh 0:UT0 h갅̅ty -L MKWK  K p-LP phP`pqP0  Bph4@  B@PQ php y -LM`pp@Pq AP |00Sh0 W V @P,0 $K!nKyty(P\0 0TSP0 H0 D0 @0 <0 80 40 00 00yVVVVV`zdzVV000 @00Xz\zd00S X00S P~0 @P 00 000000Vy\zXz0 0 VV -p堀0L@PP `PP  `] `XP`@yXz\z Q-L?P=0@P60 `Cp) PP 0p V@P  @P@P 0`d0`FP@PZ<0000Y$000C0f0@PyXzz p-Lpq0 6PP-p@) 崠`t T 0 }@P00CV]P r@P@P0@`@40W 00 X`@PyXzz -L0<0  000 $00 00 0yyDy y -L0<0  000 $00 00  @ T 0S0S: p\ 000  P`0 Rh0P0 RQ0@^0 00 W0W4p Q-LP`pr1P PU 0 S0S:Q R`\ x1U 0Q 00X@R%Q#@yPE(`@0 /0`p9pq7  0@P Y0$X!VP"`@0 0`ppq 0@P U0T 0/`pWz$$0S0  00mydy 0-T@L0S0dS0 PP(000P>0008p00K.S K 000 0S0-0S $0 0 00S00K,@Kp E@P0t @0S  K0 4 CK,0K0 Kdpzhy -PL M0 " P P>00K.S K 000 0S0+-0S $0 0 00S00K,@Kp R@P0t @0S  K0 4 CK,0K0 Klzty4Q PPP0SP 0 ᰵ 0Ps$0$0S0Stzy -LMK i K\ -Q0LM00SK0 X Kx -Lp@P000C0 S @ h,,@0`0 C0 ST @DT  0@TU0 `0 p-L`P@0-S000C0 S ph!!00 C0 ST00^ap -LM 0R0*, ,"0* 蔉s -0Lhds -LPPM0 pb @`V0@ , `,KWV0  , <,KM 0S SV000S`B V? i 8 fV V V 0 1 0 0s03 V V V&@  00 0FSPV V V 0K$ KO$0S0f90S V0V 0 @00SSS 0010,K0,0 AV 0 \0   000CS p\ K訉ԉdy -`LPpP`$T X P$T T T-T00@f  00P@T -L@0 s@ -PLM8 B Rp,K4K 00S S 0 8K@h2 @9P8@ 0Pz`#80 %5*$P  P P+P -PnP! `$0+SX080 p!000 l, 8 0+S0,0 G1[X!0Sn`z`@YPPT 4@ q,p 000CS9h$X@ 00s03X@ 00$aFQ 800S8 80 S  08 800SL0P8K @0S,80Pi(KshzhvtzD< S 0 Q $ 0S C xz -LxP 0S0  @刐匠匀pP`0S dR`P PP pP R000 $@$ TRttzzy -p@!`PLPQ  0 0 -LM d 0 K p-LMP`d@ 002 0@?Kp'@B -LMpxa`@@@/0 P`ԅ -LMKx K -锠PLp` ῵0@SP0000STdx0S^x0#S Ty -L P P Pp h -0LMo@p@`!0K!PK   000e @PV-00e  K -QLM@Pp@tPp0%0K%`K 0d00 fD0@PW-00f $K -QLM@Pp@tPp0%0K%`K 0:00 f0@PW-00f $K -\0\0L@S L0 P$^P p> 0 0  stvdy 0-L L0PS000@00 R+0 P00 0y wz -L@0@S -LMpP`5K+%P0 p`$ pnR sR dR @`0@SP    06 `P K 0-0L0PS@ t00S P0@0S @00S i$00S0 Z0tvx@ydy 0-L@P\D 0 0y p-0L0 S P` 00S 00S 60@@ct0P0S h00S ph1XJP0 @@@400T,0 phtvyxy8y y@ydy -0LM0  l0 `0Pp `K  0T0LPa@PJzdyzp3 -LMP @`  \Q  0R QW@X@T11: \ 40KzGp3Q 4 ,0 0 0 00S0!P$K -@LPne00 -0LM0@SpP  q 0Pn@ @d`P z4@P  0{0@P4 p 0q-  + Q 0%P#Op@q 0Q 0r S 000 KP nP808 PHZ0P:jxwlvpyyx yT@(0$0 0b0c0AV@y8y y -p0p 0LS@ 0@s@3H0H0@0<0 80b0cA6$0 tzyz@y8y yx0& -XLBP@L>D;<8804400,0(0|zh@-p^ 001`0S10tu 0S 0Sqr, R*Q'00S  0S qr 0S0S:\^00H00S 0S000s3yxvv4yx 0-L@PF<0  0S0S0 R0  -0L  0SWp3 -L  hx-  0R 0RQ^  QP 0 0S  SR 0 0 0R 0R 00 0- LP@ R  0@ 0xx 4 -@LP00h.$00S0 0  x|yxx -@Q 1LMPp@  PP0T0  `Kp@&P@ p 000  0S : L0R  @00S 00 0 0 xx|yx 0-@LPT 0S$  0 0xdy -LM` 0 , R\4 ԠP 0R0pK0 0f 0O 00f0pK0O 0@ @T U @  0d 4PP(Kx4 -L@MP`X T0 c@P <` @p < P`00X r T0s  T@0TX\00 Q R` 0@0C 0 , K00K p 0@, K00K p 0@P`wx R@0K0S @ 0bS0c S  0>PB0SH 2Q H l20SHH  S H  H QH ,B00SHH Hi@L H@D ,LD 00K@aP  AP 8K00L 4@K @sP ` p\XPB H008KL 4@K@ WP3 PQ 4H@8D00L  @"AQʸ00S C4H@800DL  @LDQP 0 `LD@@(Kzyxyyx xy -L4MP43@(3$H D @ < PP Z 08 40 `8 4 8 4 V8K0`2pq tu Q P`2YXtu 42 0@_` pH D *tu UT@P1 0@_ QP1 0 QP`p` p`VpH` Dp t u  80s04q 00 4 U80T8@K0t u U0T00" 0 0K 0 )Ph0qr ,0S00S0K@ < 0HK@K 0(Kxxxy -LLMvwJ 010 @0R0 , (Ko00S )p@Pq , R00Sp q Q0P 00 }8 00CXZ (Ko(Kxvyvly y -0L0@SPTpW"0000S　`{pI@tPq AcB`00CV0plyxy y 0-LM K @K0tu  0K0 -0QLMp 0S#BP 0y:*R B0S 0S"0S002 d P\B0S vH2 V0S YP `@P1p@Pq@P$10S S  1 ````KV@P 0@PLa0Z @Pt u Z J@Ptu t,@ (P u(y$,K  0pP h00S00X0S  D0,K r $0P$Kxԓyxyty y -L 0 0S0 hyx -<L<P(h+ 00s030hxԓx 0      xx 000z 000z 000z -LM0 $ KK0 0 i,P$ K -@PL \TL hII4I -1LX@ @@ 6 \,~0  @`Pp0S0S 0` 0?0080  W000S izIdy@y yxy -LMLp`KP p@P0[SPKT[z - LG P00@!z -0L 啧㌳4kT -LMP@ᠹP 0S 0S1 S K R3 xP 0B?S►P (KjP (0Sp`$K $0(RpQ WP` uWQP00 -L 0KM#+* -LK0[S pW` lQ@` @`T 0THP2$!1Cp`W9  0 LK %5P P P@00 PP000S P@ %0&P ILL@0, 0CQ0(K8>0>(咨z0kz<Lp 0-RLM@P ~8VP  08ꔵ0  !T#P TP @(0K 4R S 0C4B,[\ *\ 0@(KP4USx#000ӑb0CS@k$kTiTiTijTiTiTijTijTiTiTiTiTij `@ -\+\T$T 0  eBK0A0A h@PeV 0`p+Xr -X "YY P 0PP 0PI 0PB04 Rv @ 0L=y04E,[s0`@4 H04E,[`m@ H \8d H`04E,[k@ H~04E,[g`@ 04E,[Ddc@ 04E,[LP`Da: @2@ Tp  -@LMh LToo`p20p0`W` KU -LM @`, p%` poO&>@P2Ό P, 0U@(K -GMLM䐟0,0 qoK 0P@Et K@PLL 00npK`2@PΌ  0`0Vp, 0R(K忣0k -P<&> Y0L\"]280` R0<2<… 0S30@20D2 叏00CL2 0 0CH20P20Tr( $@S 0X2g0`TX2i=ST0S0@2Uz D _R 0S2! 0 Ḙă0S0?S4 0S 0S0?S0S -!0LS PU  0 0       0@P@c@@cPE@@PcPPcP@ -`!LQp 0 P 0CA2$,0 %@$U00e0PDq00e0P004 -LHMpD W@ !!8 2@  `0 @Pp1C4p 0V< 8 `*`p,0 <040(@00@P 0z@<P 0`, D 800$8(K 88(Ko8|$XԺ M-Lx0\@ P7P3!0SS`p P4 00 ,?0"10  !00  0,?0"100P0fY(Kx0 P0\0 0     !0   Pr8` -L @ p ?  0 1<00 `! 0! 0 ?  0 1<0PP0 P`| o -L M58`Hp  p7`W` 2QPY.EEwOE B1 @@P@7^WP, pMh`W` K蘻Ȼ 0-LM <\PP | p0R dK8p P!|@P D0D 05{ \8\dtd4 -LM040K00  ,K0 @娃,P\`  S7(K0pP 0 咃,Q 0 >7x "10 0 d17 @T1"0 0 0@1!T$7H( -LQ @  7 Qp -@L  &> Z7U| -L4M0t(K(0 ጅ(0`S $pK0 p($@\P  6 K170( p$0`Sp ( 6P# 2pL`K2A@ @N P0LK000 6м -LԤ -L!M(1`"( S92RS]2S\@&ZAP KP Z6/0p gA 00`( 0R $Kg]@0ҋQAa]@40k,@\$ 0-PL@V$60p -L MP$K@p`0 Z$0S  6 K"100!aRRl@0S`VXV6L5D5@_ ?05괼ԃ̽| -L M`(K@0 (PpU  `5$K A2@ @ 1P괼 p-`L|yP @ ;`P 4 8$0 $04 @4 4 '4 $ 4!00 4 $0@P lP0PP DgH<4 ,4@0`pSp@0 @HLD 4@{pP3H 0c40l@8T473P)`p岘@P 0 S 00K9PX#0S0#3  PP   “Η PU<0@S@X00SX00LS  %H20S\"0000SD"0000S 10S`\B\TRD2p` (",0QP "0B1 CFP !<H!GAnp`0Wp10S~<X 10S00S1  XSp3 0P @P PDPHx@U1 P 00S0SI4k̂؂p܃ x ЂTȂԂ܂Tl\Ă 00 0|0P$ 00C0 R0 |" -LP -LP@P-  p-PL0` 00 0@ 0T0000D S0`8``0 0 0S0ڬphp|-0 CR 0R0 SGa00 -h1L0`SPp@D @<10S T (10S  a+0@00S T 00S`0@T 00Sp``Wc80 T.400S h  h`Ԃ܂&ȂP -LP  g -LP ,  -LKP @b -L 30S:S0S6R) 20SQ b 0R20SR 9/p2 2R T"&p2HR 0R08 KPK:r D2b PKR8 K-i00C020S 0S0`KH Z\ 0S00R0S QPK000`` ``` `P 0S!0S D10S`10S h10S`@{. X`x.`0upJ 90@?S?@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ȵ@@@@@@@@p@X@@H@@"tp4r00S5BK0H@HQgPs 0D0 5 05 5U `#P*% 0HYF Q>K 0C8PZ-RP -P PI #R0%dsA404 oL1 i404 eB.K 1 B B]1 W404 S05 0 L404 HIKAAjp U44 V44 Y40D;0D;4 d0%H,A0!8Ό ,ʌ0kT|pLt -LM@pP4 +yPP 0S nS6 =`P00QD @ Q? |P 0V0S D 0 YppV 0`pY" 0 0 p 0oSPiQ00 ,Kᣓ, ?R0S@p @ `@0 p00MQ0"S 0(@$P 0 0@Q|PH` -LM`PwP( @(K,pK 0 g(0@S l$K p-0LS`p@ P P0P@T@T  6PP0  r 3R p00 R P 금( 0-LM@PP 0S TU80K +ph< -PL`p@0   0@ -4LM@4T, 8 <( @  @T  P@C BK3APAD  0`D#D80x3P| T  YゎKH p HPdp4  $w@P 0GUE0S -SF 2 1APw@Pp!8R00  @2P"< D8)W@@)T Y(p@( P" Y om@P1 @@, 0R@(K2p`A=P0P0P0, "000s20K )p `B0 0cX2P R^ :Py 00@Td@Ta  P  C1 Ήŕ!00070SQQQ4 F 0SC nS 1 4@K t!,huPPHP 01{D10AD0 @@ <0 8@ 0oS1 4@K 4 r0PoH0S @H`K0 0 (K P=E=|= p= L(  T\t4kT@QTt<|00 00 -L~tP ; Q-L@ P T@; P-L ;P < 0-/LP@P 00+8/00,+ +00 < p-LlM/Pᢔ@P KLfP0: S Kp0`rS@*  P0-L@P0 R 0 R 0h&0h#}#t0 R0h0lX& VH0 R <0<M&808I&㖔0C&<8!4k$< --LM0 0 } --LM0 0 K --LM0 0 K -L@6M h -LQMH0@K0ePP`pK<eP0: S V@@ S00S F`PeP$K]qP T P`0 R000 ZK@eP h1: S 8%((&%dp<P<`< --LM0 0 {T -LM @Tp`P0S ; 0P P 000$ -L,MD H &L0 0@  0 40 oP @q@Pl HP U@ `0YX 4\{ V 4 R08  C@Vp<@ 0S00C S000C S BV0VPpU @ P0S PUWP80 0 %0 00 ğP0P00 @TT@TQ %PHp@PX! 4  Y4 @0T l`VR h$ @T P$@T zU`V$`>SVXg 0 0(K4 $k 00 U  0L P0 I @8 <00  0@@30f0cß`D0S D0XX @T` LP@ 0 ,K pq Ÿ@TM@TJ 0P,@,4pp PB ^^I R0000 0W G 0020 0  0PP2  A R00C0VV X0Q1 `V` 0S 0SLP 0 YtG 0`$, ^^  0(4Pgp~0\/ @T3 0Q  0N P 0A@TRf LEPa 0 ||G0 F/n0 80 DtT$@ 8pTHh -L@/P م h -PL` @Pp 0eS P  0:W + P#%+@ pPt  00  cP H 9 8 pP, et  p-L@lP`~Pdp@w %p$ $00 ip , -MLM pPNK@D`+H 唇p 8G  0pia.).$KD P-L   ]0 XO<T4kT - M DLM`pP % $% % (nP& cP# VPeP  mPqP pP sP xP  UP 0 5  $% D#lp830V %0y03R0S P LK@D@D" 5 P1:9U 5$%RS 5 S  *K&Gp|  1: Sd  `KWV< 8P@  ؆p c @P`U r-ZK* $0%KR  J0P50 `V p5  J 5Z K0K :PL@@@PPtq K  @ - @)Z0K 0K0 p@x %R  eP  /p %&`@`T -5ii(KTD0`@-@|0  " 0|0  "4\ 0 ^|-0,0C/1Q0#0C/00CS00 c0 0c|0x0\0nx0A0 0b0 01 R|00|0 0-LM@K P 10 RK0 p-LMPK`FOK  { 0RQKp -b 00"00#0\ -LM@K TK00 !0 S0 0S-0 00\N-0|v?M0|0 1?01 R  00b0QЍ.A-0MP`  0S3 0 ##\0 ^+ @0!" |\|0|0@|0  " 0|0  "4\ 0 ^  pAЍ -LM⤀KR^KPEJNK@DpIoK iK K oK |`@@ TOK/Kf@``V/KQ`@@ TOK/K;}@y@u2TBNK@D/K%jg@`b`^dVB.K BTQ`M`I2V/K@=:74 i/K$K -LM`KJNK@D# I_KiK  oK P@@TOK/K@@ TOK/K@PPU/KP@@ TOK/K@@2TBNK@D/Ku@PPdUB.K BePP2U/KW  M$K -LM@K V0| 0C00CTK -LM K0 0 R0 0S K K0@- MtP @0 0 c / QB @ 00#00# Q0 Ѝ0 -0L!M`PK  0BS0KK 0SK 0S| 1##@0!\!P?1!K#$1! "41 00 R5 T 1##@0P ^+JKK0 #$ PKKK0 0`0b/40Q$K8协Kp@ KKKnK@d -LM CK01 R 0 0SCKy K 01 R -LM CK01 @R c K 00 @R0 0S@  10 R 0 S R 1 BS R ! 1LR*|-0 00\ "4\ 0 @-@  00b0n  #4\ -0LMP@K  0 S  1##\0 ^>K0 #$ 0K\ K~K` p-LM@KP`d Kp@-P`pP@0000100 "#  010 " 00000#200 #  000 " 0#1000 200\x0@0P0x010P0x "# R |0100#R0|0340P0|0#20P00000 <- 0@0#1C0T\T00T00@-@P0000 "  010 " 0#100 #  000 "  ""  020 " 0000 "#  010 " 0100\x0000x " 1 |0100#10|0#10000000 <. 00#2C02\200200@-@ 0 010 0"!#1 010 0""#2 010 0"##3 01|\0| |0 01|0| |0"!#1 01}0| |0""#2 01~0@-@ 000  |\#|0| 00|0@-@0 <0b0  |\#|0| 0b0|0-   00|Q"Ġ|0 00|0|  00|\"000G-Pp`& !0\.@0 .Q@ TPG@ G-@pP`&! 1B$0l\:  !0LJ$ ^: 01 @ 0 0:#P`@G0@-P 0@C0  # 0"00 "  \0 -ML M HK00 R)0[H [0 @0;KH K)0K A 01 R;K KA00 R02 0/K0S0H4 =K0C/KSY0HK 01 S20>  KK-K?K@A BMK@D% KK @A#mK`FK A)}KMK@DpGK A'KHK A+K- K%KJ@A1]KBPE >/MK @D%-K B 3mK5 K `F@ K%rOK-KA  RK04ş,"00|Q"$L1,"0  RK  0 0|P"0-MK@D0 K]K0 PE+-K B K K@rK!MK@D5KA;mK`F K@K  KI 0@K yXK H00 Q9}K`KpG_KROK rK oK !MK@D p`@@ TMK@D!-K BX}z@v@rT-K BChe@a@] TMK@D!-K B,QN@J@F2TMK@D-K B:7@3@/dT-K B%"@``2V-K B  9MK@D;mKr/K`F7 K @@ 10 R7 K@p rL=K!00"0 0#P1 1@0 R(KAh M-VMLM@00 Yp @h?XfKPa 00 P 0 Q 0 @ @P 0 0Q R@K 0B_KQboK` @ K 0@KH@K`KA 3P ?  ?  ?00RP` 0@Q5 R 0@Q(K -LMpK@JK‐joKP 늏K J= C HP C 3  ;  7(K -LMp`ᨠKPOK  တ&  "JK  =   j_K 0-OK+t ',#  2  2 2 (K -}P`L@    h 0-L@P ,0h -LMM KK(@2 " P" K(@ K(@}K! K(pG(@OKzK,(J p-L M A`*Q48<0 0R000KpW*@K0P `0@S 00  Q 0S00000AP0K _@PP 0L@  ;0 $* *T4h0 -LP  0R S S0RS  P0 @\O -L Mq0PQ` 0 4 l冹P 0RKKD!0@004K0 _4^:0`\0 0 Q0 B0lP0   0S  0S 0S0S0SlP 00 S 0C$0 00 ,0 (0 (K P,P( } 0)0k`$ -L\MpEp0S, p`( P5G @ Q.<000000000000000000000000000:P$$0000t6)p`4  XӸPPW W , 0R(K @ P0DSddddddddddddddhdddddddddddddt X(P(^PK2 e1P/wP00@ L Kd0K | x@ t@ p@ l@ h@ Pfd Rj0SBdJ0Sc Ss 0S+W  00SB}Z00W% @ P }Pr Z0 e$00^\00 0R1PU@ 0Q P P0  8 #"  S7 Kd0K$@ .P  R( 00S0S 8#8 $#$0 0{ 00S SP P 0 R  |*( p&(  P(L0k؇dȍ$\Qt P-L 0<5,0, (s$? 04k TH P-L@ L0yvp UW,f8P~}s8\ p-L@P`@DT'0-S;@P|||||||||||||||||@DT!`h0h ph`@T ``(0 `~{8čD -pQLP@S \ 0LW3@ \ \\PB T1 RG0 CR F0>  0aP0,<S*0 CR )00 \ 0 CR 00 \0S A \0 R \AA0R PA>hvA0R>hA꠶ -pQL@ᜡ0S:`00CS`0UX0  X0hm藈`PuPP!o0S@0`00CS`0BX0  X0 Q 0 CS  \  XQ &AP` X U& t90 CS @` VP0 AX AX A꠶tH p-LPL`@LD8  0 $  pht$ -LM`@ Q (Ko3Q P 0^, ` pP , Rp RP R0S0C000 \  R  R  R,  R P @U@00R T B0P0 hPW 0~Z  @X z $Y @ p   @ {y!s @, R m0@00pD(8<0 L @L@t @Vd1 R+ 0 (KDK@!  E41 R-(`00CS`0,X0  X00Sc0S_{ (Ko2 2:(Ko6ppW zP (Ko?X (Ko?ȍHH\h4t0p -L$M@B@0 S$ P Q 2$ 0Ry K0A0S0 0CS<'<'&&4&1 QQ QR  U? x 0 d\X!0S 0`0`p;8 <0 L @L@( @q4@KP z sxx m xhpehax5`Vp갊0k@\\hht -LM@e5e&.aT, P cT , P gT0,0 P t(@4P4 00|4   l4h$d40$` 0 $4 ,`P $40S0C0a P  dP0S#0 30S0C0@@  0PSx0 30S0C0@@  0PS(#0 @304S0C0@@  0PS0  20S0C0@@  0PSx"0  20S0C0@@  0PSh80  \20PS0C0@@  }0PS@f@2 R 0@fS@ k1 RQ PN, R\A&.qP 0S@ 0Rl!0S|;  7 /(BRbr0S, Ph 0 T 0, P00 R btbXH܇8ȍ\ t@HPX`h| -7LM@ T0 P`0gS l7`wK0C0C@ @/p> 1 R1 1R vx`9 8  0@/p[lnK`F`F+np@M10S pIl1( $ K@p H 07l(4l0kč8Tt8| -4L0M@PT`4 PEU50-S@P;99;t;;99d;99999T;9999999999?PU  ,K@?0 V, RPEUʤ30L0  0CLpK0PKH <0 4 D @ 8 _P  0@@p00 S@ 0@@p 0QPr0SX X *0@P0 0S" @U(K2! {2 wp2 s`2 oPUt _Pi 40SP 20S 2  Q 0QY 0 SZ 0 S0S 1 R00P001 00l1`PNP00P0 `1 R0S?0 `7 ( 0S0C0 e  00Ps[ 0 Rq lkk] k`0|\<\Xg^PYꨊ8L <Hg $ -PLM`P0`V#mRp1 T0@"S"A???????????????@?????????@??@??@??3 ";Rp2p2AV"P >"P0`gSX@@bP P 2 Ri x p2p P"0SXb 0E1SiPAAPAAPAAAAAAADAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAh1 ad1 ]X1 YL1 U@11 MP /  j 00 p0 @008:*  0@Sp  "" V D< <@t RTP02 4<KT#p0@0Kl,$<@T 4,'@ @0S 4 5TB "<0S; {E@ 0D0 H0 P D0SD,#H0S  H&#  #[0D0 @0〛@WP " @ #\`H :R0O@ p@4 SHwP P0P0`P0 P Rʼ 0S *0S ʟ0S#g#/0`0S0S*Iv(<bP P H":0S/ :0S+:R&Q$90OTS 90S9#-9#.90S9  x9 .h9 vP@T h{Si@90SD|"PS0[S ]kP 0 :SSp`  :k@P00 K>7T00 00 7PK0`K 0p70X p@K l'P0 0P CR 8R! 0P$0oK<0 B 00   0FP,ǟ0S' _ < <0s# < f P$0S $<0@w$h0@<0  00p@K00@ 0PPU0W<0S R0<C6 0S6 _ںP`@*P@PU✳P〕@PlB_"P00  0R@PUPP8@T 50S58 P_ "R ğğ $ 0nEğğ $ 0d;ğ$ 0\:P rJPPd %P@H$0H9#0@X ߢP0$5ß3#.h40ST4   P tp@/RP " P K(P K0BP0 P R 00 S S  㘢P P,@K yLK> HL0SPKPP 2P "0 S00`ڜ `ï"0@LKP KP H0BP0 P R 00S S S R  nNPP@DPP0 fHL0 "S5 V2  SNPP,2 @TPp I@P\ #1PP0S18 G^\ #b<0s<4 %PUTRLXP`4`$&ԅ,8$}|\HL\@(@%HLX3<p\$pHhP Dt8PdL`d00 S 4|| @ @0S 4Qt00S0XB@ 0D0 H0 P D0SD H0S H P0D0 @0a@6ŮȱP L0\P0 DpǏH B8"b0OPP @ p@4PHPP `P`U"0S 0S 0S#8#+H"0pÏ0S0S*sP0SH20S/ 20S+2R&Q$20OTS 20S2#3#+ 30S 3 43 +D3rPQ hPP.x3qr P0S0S0S 30S 3lq30SD9P O0P2 2 GP\ ` <0s <`%2 P8 (K -LM0T ,0 X \$ @P 70Sj,0 冷PH  0 S H$ |PD  0SD C.K B B`$ ,0X:OP ,0X$G0PP4 D @ jLP P, dLP Ɵ0PD\$0Xpa^P TL@PH$R P\$HpNP4/p:`@@P00T00S/ T-*P0#03V0S& H@ P@@PTT*W P$0S,0X pL  L$ 0[S]џP P0#03V0S @T 0:S*0p0@T# :ḟ/Pᴟ U P00S P:R V  R0305P1 :P:㝟Pt`PL PW 0S V @@V 0S /vgP@@@`@ß0Sk(#U0 @0 T/00PpM@+j 1`0P.000dX0n9V`0pT ``P>pP 0V0U.SE 00EPEW d`@ -L 000ȉ -L00 (@(0 m7oȉ<l-0 CR 0R0 S'00 -Ld0d0S  '80o0 0(00 00Q렶,,ȉ< -L`0`0S  '40n,,0 0 S -蠶ȉ̉, -L0 @0S0S@d -0L(M`0@0V$0 #DK$ KHPPpL00C0[PS (  (0KP(L0= Kȶĉ(0 -AML M< BK+@س$|,$ )0Kl8 4 p@4 `BKP$AP0 `T!44@P񟗰<<ddD  0#C 0xX?nt<4S  30S dCxl(nh#H3 TP/ @ RR5V(U&4TV 0V04V0S30S0S U UR2 2X"0S&U 00D S\2X 000C00W42 0BSpRdppU00W0S 00D SW T)T,000p ,!pQ,45@4,4 5dW(TpU-T4$R4$1 4$ 04@V`S@404 5T!^ P@?H0SS5V4V010S 0!0S ^ J&mXBK04A a R+#d4Q 84@T S8D 8D1V00   P d0 TR t00S 0ZZ 0F(KIJ0lLT@ölȉ p-AML M20, S P 10S1  } n`BK0@!PE10S|10p1;BKA 0`PlJDAd >WmD10SD1081;,4S( K 10S,4,;0 1K(K PZJ00S0  / ,4S 1[ BNKP@D0S,4,;+YPDP800S= ;>Kpll,L0' -@L0S) #  P`P?SRdpd0 `@ `Il0S40  ؉܉l --LMP@p0T0`0 P !0 @ 0 tkRlh0 `Sp30PSTKlȉT p-DL0 M0 4 0 8 0 .P$@ 3#3Q0$0 3@T 30S 30S@@S0S P 3jt30S \3djT3 0S44rP(.PP7bc008 0 bP@ Ul g 00 0 $4 NP`B0008U47N<24 \80PU}*82 0娙P 20S 20S 0Q0S  @T$4 PO A1Qp30S @T $4 pP  0S5 (2PA0S"81p30S 10S10 1:0,K , 2K?PH00S0   00S00SD0  KpXж `LdIJ,(L̉l0', -,L!M 0R,0 0S 00SS  0KDpKK 0pМ ! 1 q ̟P <  ><Px NH0S S A)P<0S D<0S8L0P0 0K(< 0P0CS< ci!R ; qW, 3ԋ ȁ  -; 00CS; Fi\   ^ p[@T 4K~$ 00 < M!R PP9`V E: 0B S@@R@T :0K  p 1DK lPJ ᳯ [0[[(,[ D0[@[$Č<4 4"<,`U @PP: 0B S@@R@T  9`hR^  ^$>K  8K DK0 K40KpK! P 00Sd40Sa80S^ ] [0[[(,[ D0[@[$Č<4 4 "<, 0 K0 p @P`$,0( 0( ,00 K0KK4 80< 8K4 80<p@DDKP0 K40KpK@P`$DHůP 7Xh00S40S80S  [[0[`[ [P[[p[@[h1 [唠[lXᤀ[[[\`@p[D0[H[L P [T d4@1 D|<, ă $x q  1,(p,4Ɵ&<.  01*$t$%,.t0pMDN@Po86D@ 00CS, Kq4H K1@GP ,5g-0[ [R~[Q}0[S q5 @ Ƞ,Ƞ0 4,400S le@T $ 00 ptF`'D  PP0S((0K  # P ZF`K` |ğt\hğ\pD +8$P,;FV 0t0p0S \,0KPL4ȓ0S S ß,  ,0KP |, ) ,0KPF 0RS 0S Q00-S ? pQ R>`QX>0S D0S   D,> 04 S< 0@ D00S0H0 {PN0SpNP00<0S<80S8\= \= *tl0<0 08 SHPQ 00|SM 5P>0S 0 S  aD<k8hh= /\@P000T  T 5T/00P<0S0 S PL<0S 0 S (<0S  0S DQ;0S  ;;0S x;P PTD0S ;0 PQ  ` T PvH 0 00S6  R'sP;,0 :)00|S @ 2, ,0S  D*0S00<:: U, ,0S:8 C40 `:0S,0,4KP0S;0 $j0 SJx{P0P0 CP0: S H)0S00D9  90S G9L90S 0CS 49 00 @90S,0,490;Q0hpK KP@O<`K<-PEd@d0 勠00S0P *P@K P(Kp.Ad?@>L@(0ATPЉ -pLMpL G;77'4K;70S 7`V77D @ d D"d @ 0!Gyl7L0qH /SdRdQ #P t077 0R42K7PU qP@Ɵ`@ PƟƟ!` @`0K&00pK&px60Sl6`V M PPT PUDDpPÍOK@0a(&`֟0pK & 0Ο60`gVdzOKP%şşea0%嶟p_K`pP`%VF% 0U0W00SOKD%0 \T B$%a@P荟4K, p pW^Z0=Ɍ@p ͌$@0S0DS*40KXK W(4p   p4  P`^Z0=i@ my@P| 4 0< 8 LQ/K胁P@PoK ᔟa0#+ዟa##ẝ_K`<@̝<pᮝP<#Ld0n2ZYK 0gPژ2@"R D2SOKU"a X WOKH"aB2oKPey@P `y/K ` 0[/K *Py@P $a0!廞a!峞J_K`<@\<p>P!Ld0᜞p1p0S0P 0(POK H^ (!LPH 00S 00CS0 0  0 H@P 0005Y(Kp`ЉXtPdhx@ 'HP.A`Lhx -LMH@0s0 Kbp 0Slwt@ -L@P 00s@t -LANKM @D+`5P݆P ~K pG7@Pp@68[/SN@ P K08SS/SK` 0-0L0M0@S DPK0  0]PD0SH0? 40 .PB 3K0  -AMLM4 p@8 T2 0S2@ P 0S 0S4 00P0SxjPP 0S`R֝0 S0/R0 S? L0BnK`F@+(0K 4R/S@/04B+dP5h!X0080 0\0 ,$ 0BnK1儑儡4D`FP t1p3\\ PPj 0P @,100CcSX108P 0p30$0, BNK0@DFvP X000{VP m+@PE@h00(K< lX`Dy8llDp -LM0p -PQ00pR0LMSF ,20SB K"@,^KP-PPvHPQPOK@D^K30!啜Qp$;-PPa3P PU  0At APd!*P TP(0KP@x0[SPuM0Ax`KU `@ PW!pPT!@P 0x03T0S P V0xPS ` h00S`0  (Kx!lx|` p-2L0PS 22 A2 p2 R22PR x2P 0S\(P 420S 8FP(20S 12 @1@ @叄1 @剄1 @僄1 @}1 v10S1@1 T!0`0 PV | u@Ph p@PP 0T.S@D0P008,!@TP$$ 㧄P10S 1 1  V  d0 @ R00 V   ㉄P0T 00`p`@4@hԶt\T pж|pl 0- LM0P@0P P K*0 R r X0000 T 8@,T 0P8l -2LTM!0p`0UP^1A0 @0s 0 @0s 0 P |1|XT000 0000,K0K4K(0Kd@K@$ K$8K 嫛, 80$ d0 40(`0 00v.B\0 ,0A BX0 0T P D0 rpP@uV00S 0| ?@0@_ V `@TT @P(0tpu0 Kl $d -00L((\ 0 0r?iK|4k@|T -5LLM % , 0-S ``P@&Pp00`lp $&p d0@ S 4, P$&pD4 U*@P ZY $vW 0p ` ]#pL Qp@H P9up *p &pP UX@KVT00 T0 ~,,#3"0S0jl0 `pl}`K h#0S `0#40Sj@\K \@ 圔PS WV  p@ @ T  pn0S *1p ^ h d `KN hK0P`@ 1pTK0-SP 1MeU *@P9 Q 0" Cl0S$  @^=00S (1J" / M, \1P 9x15u15ʒP@@G S*T=h=0k4k|dTL@$Tg`ԅL\D4<pr\  -L+ 0IT -GML1M a |!@0P$4 X!Q%p oP9 4!H%p 0bSQ`A~K pG0pG4 2P3 $$004 4 =K 0C0C P"P -P P @G0$tA.Kh0 B B\T0$8I ,d=0kTLLp -LM@pP4 )PP 0S nS6 =2`P00QD @ Q? 9-P 0V0S D 0 YppV 0`pY" 0 0 p 0oSP00 ,K=D, ?R0S@p @ `G0 p000"S 0(8$P 0 00Q|PH` -LM`PB(P( @(K,pK 0 g(0@S $K<0p@-PQ @p`0N S3. P P 0 CS @ Tp@-PQ @` Q 0 CS @ Tp Pp-L@P6 PQ5 0R14 40 0R+((P P% Q# TP ,,P`@PP Q EP 808PS <<P`@ Upp -LMP00K/00BP a@p)T'Q 0,<4("4!| ,K0 `V,0 0,0 00S , ,#0 `S:(K -\LM`P p 00Q 0 " 0@T K 0-LM@P  $ K@ @  $K>00P $0"K0 -LM`0P!PD $pp`E hg A $pRE Z  4P 115S ;pD~>E0 dE $ (p DTn.E 0$4 hR,P| -@̠Lp`.0'.TP! .U.S Ut! 000t0 00000s03-T0S _T _TX0 0`@T蘶 -L]KCMPE쐟MPE@p ` h+~ P:$0 0L0P < 00 8KLp H @` 8P 4 , D pD 8 (Kl0P -LAMJ_K, ,KOK&G'p`P#0S @ *P @T T } R 0SR( K0ACp <'`V440 JKp, s(Kp\ 0-L Pp@AD8 pu5D 0h0x p-`(LP㳋,P㰋0P  80PS< U@ph蠋@P -DLPCpP`H 00 @0 0@4 40 0040404 00 4 ( 0$ P` 0$  %P( ,P %P, 0P %P088P< <8 @TP @`8 -LM, P BR00S ,P50\%,BR00S (P(0O%(T"P0H<`S 00<S$0 (00S`A< 8< 0V 0Vd18S_( <a@80S<01800Ea@80S<, 0p188前P<B 0!f0<8 <0q`80S<NJ,0@188kP<$ <8 J< 8 0!a@80S1S 800PP< 0!-PU `X$Y\` -LM@P4K ㈔0S   Kgp0 0 $ 0S/ 0S  4@K$ $`K P%P 0S Ept @T `P{4pK@0PS t@ UT $1 1P h@/`40(K  p (WPʌ`P ( |(  | @4pK0S  |@ T<0 80Q |K@t X(D` -L$M@|PPT ppd @@K$ ޓD _|8 p z0S u5B0`gP, ~  pa!Br,P@QlPUT@D0 (|PGB`X,厉-@0 |P,JKi$$ P-L@`Pp\i.. r 0000SR 0 #ᄓ``P'R"R $R `R \R `F0 `F P@T:V00<|q\ Y p-0L0S00@T,``0@p Pp 00\-P*D'8$,! phpt|t -L Mp@ p P lhp` \2\ oDы@P< ᯰ,R,,Ka( 0,0 0 2KWp h0S d$A P 2[ pUAB`P $0S tA10S p:@ 8&a0S D@KP გ  {0L 04 000  @T00P06@00@@ tH0s TC$K|d(p , -L M`*/24 PB2 @5-r P0"0p P*J`P$%-0"ؑpP*,0``Sp! `"̑pP0*,@P``&0 ?pPv*@`P"峑pPm*``p(0Sj !姑pP0`*(@P``0 pPQ*@`Pl!厑pP``0p0H:E1=U80 80S ,1 AE0 !spPp``+*P UVj0 zP @`PKj0 yP @`P@j0 yP @`h FpP 5:L P(KJ@8Dt p-ML M00@S`0 ZKPE*RP *y P%*P  K@*y P\%*TJK@DZ 00.@Kp$Lt p-DAL0S8 K:$1` P@00S 0S 40 P EJ@T00Q P 03J}h@Kp00S0@ =@8P" 000S0.ph j -LMM@1~K pG`pG@P+PK屐_- ⬐1!0x6 p& V !0K @QF t6 l& =8 46 p@ 06S L0 ; ;KSK?; 05%0&$0&6@0 & 0 00& a>0K -LMMA~K pGPpG0`+0KU_- P0Kt6 ,0x6  t1d& 0@h6 0S1!l6 p& 0SS 0 ;0& 6 0ˇ 0S R0 0 PK @@ p@ 06S 0 ; ;KSK?; 05%% 0$ 0CS\0&0 0606 6600 a>0K4 -MLMq`KP @@+@@KՏ_- Џ`1V0K,t6  H1d& xF 0Kh6 00+06 k1f 0 AA+ ˁ0SP00 Q K @@p@ 06S X0 ; ;KSK?; 05%0&$0&6D0 & 0 40& a>0K` 0-TPT0L@x* @04 48#8 0 0hx p-LM,B0 KP0@0Sl0SCh 0R, 0R( E*0 R 0R0000 0KQ 0h!0aN00LH\  00 000 00*0 R 000 0 0 0 000 0 Q0|000 00S UPL`PPF00 00<0< 0<,0&Kp#, -LM(Kx2t2, (0 b0/S0S*L4 80 <0408@ 2 `4@0 0@P4@8P1AP08 ]=0R40Sf0 ]=0 i0O?0@@@c00@408@H1@!0 <0,0(`K400@T SP0@48X("(04"4 0 0p0 `020@>)04!4 @8 #8P4@00@0 R0, 4v Kxd, 0-`PL@$0 00 00@,0 0@408@0h5 -LM(K(`K3,0PPch3@_0,< 0S0S*00 P 0S0S *R 2 L S2 004 80 20<0408@ ꕋ2 `4@0 0@P4@8PXRX208 ]=0R40SyP 4 }0O?0@@@c00@408@10S (`K4@00@PU T0@ Q 48 8K \X10SS $0 S (0S 10,< 0S0S*0040 070KC,080K#K0S 0X P 0"P8#8 $#$0|0 l04@*( [ @04 48#8@8K C0( 04f KX 0-t@LP$0@ 1S1000,0$0 @408@ 000h -t0L0PP P P0S 8@8=0 00 00h\ p-L 0P0 @00S 40` 00phꏊ$08 00@~,0 0@408@ph -L@၅PPlT"~p0S. 8 `0V (2UuP y 0 GS R 2 P10 < 80p W@x1xt1  018@T R0 Da1 SL0 0P0$0 10h0S AP@(R*@ h♋( 0@0(W@P(((@1S 10t`00S P@,X  u, 00 8 $Ld -LME0P 0@  0@ p50 @`50 0S1@0 @<50 0S0;S<0@0 @š5\ 0 @ 00O?0@@c00@š4\ 0@0pPo?P P` a`P`%1?FA   ,KN,Kß000@0 @0(0 S ,0S1@0 @ß,K000@0@0(0 S ,0S1@0@,ß,K000@0@0(0 S ,0S1@0@R0000 @0000@0000@ 0! 0S3@P0 0000000@00 &0`0@0@TP 0X\AqL AL @0SD0``0L0 014S08S 0L4 P0ST0vP 0 L00 <0 0 o0 0L  v@1S00LSP0h@0000@T Ḋ 0i/@ l@0P 00 00 00X0  0, 0 $K# 0-l0L0P0SS S S@P40h$00@ 0hg0\ -L 10PU R  00 0 S   00`Zq`@TUh1S#P0@P010@P 02} 0@P02p 00h00 00@,0 0@408@vh.' -x1@L0pSPL` RHPO PU  .PPi+6 P=1S400400 0<40,0`p\0 P + 0S 00P0P0000 000 0P0 PHfWVi: i\. -0L =.4:4kT -L0MpP T+D0p@0S P0T0S0 0CS,2t345XT0 $S )P EPQ P$ d P@0@0 ($0`0@0@TP 0 00 00 0 R,pK $B@K }q$T0  Y#08 0\S0 $S P P ,K SP$ "P00 2 0 |2@T0S 0P#hM 0 (@ H2! fQR,pK $#B@K #q2#0  }e$#0 0t\ꔁ 4R@0 ,KfN2@K  ` @P ` P00P081 50H 0C0S00S H0H0S 00@  0S 0$S ,K 00P 0@T b 0i/@"~p` \, K 4L$\p, -88LMP(8` ` H pK⤠ ;iP8 cP dP71 LP.qP㤀 + uP$ lP&0' 00p 0: Sx+d|p\p 0: S 44,'00M'p7p0gSBTQ솟Pg IFP_ 0PP 000P F0 05PL 6P&]=00$0S0X 0T&fpL6 DFR@6  P_ m0u000 6`C<0 PL0L.p0L@5  Z Ipp 0SH 5pKXp5L70\K@0@T-s*d@U00S50\ .pt5 P \0SX0S D P`"` V < 8+B(A0,$ `0@_S0S*ls倃@ 0P.H0 Vڨ @ 3p^5x xnt媀pPli M w  40KpH50Y4 40 0044!BPA R0^2.|p`@4 ./2P@4 `B Y@Bp4$ (0K* #P Pp4,a0L0 Pp4(p  p  Fpx  *pd  pL ~@ 0H0S \0 00I(K4kxtt  T(  4 dD PTT \ t x|    X 8 \   T  l    (l $ j@ T t    d  (*\ -LM␀pP(K` P  ~@Pdf (0`0 000@0@U,P,P T  -LMp 0 充,Kh;PXP; 0P P0pP ,`@0P @T T00X s R 0SR@  ,PP 2,PP P;U(K 0  -LMP$@Kp A?@0CS@P@ T ;P% :P0P $`4 R@X ቄ  @4;T $ B@D \ x   -BMLM`,KL  D4@P P0pP,Pp1@smP p WjC.K@ B B@D P$ D 0K@4H4 AQ SQ^ CQ BQaIQ/ LQEfQd XQlQ5 tQP$+hap ,K{ 3@P Y,Pᵄ@0 S P4  D$ {4KP 4K @ TP4j  }Pl  uP Hp   hP    ^P  ,K( !@P P1pPI ;T] ,PP P0 00KpP `P  0KD9KP7 9 [9K00B1  H$ H$ H4Q? H$0AS,P H$0AS,P- ]P D4Q`|L$P@| CKAA ]L4p(K    $ H l    @    p-LM@PK <@0C`SZ`I0IIIIIIIIpIIIIIIIIHIHIIIHIIII40040BKs 1PP ;U30 $lP0 * P(x$P"x,x(xxx x8fx0f ;V xx@h -PL# {P@ PL ;T i8)|`P0 $"(40 0 4  0s/ }S X "1R0 Q R$元P " =xp i2h1 P T 0   00$P 0@RXq 00S0` `0`00000S% @0QP0  0S0`0S0  000  000 0 00`8 p-LM@{ <@0CP&S@K 0@ 0 2T [P 㼋@ H$H08#8T K#0pL0K0T[K0K0T`KH0 0 S0K0TKK5K4K4KDp @H$H Ġ$Č(0K Ƞ0,ȠKd0;h` 3K0$,$  2K0K2K _^ P  0@K  0 s(0K!0K`d0h@dhPpKP0  p@K J} 0l p hp dP $ p@+(Kx p-LMP0     "p@+` 0K`pw+T0L0@ `ph+ 0$@Kp! -L4MPNpK02 | `PP 0S C+XP@P08 P @t4+ @0 KlB  p-LM{p(Kh\ -L pR2XyP|$ @0Rx1 10Wp Q^KPE+[yJ yPKM.\P x6S 6S 0  MP 60h@ Dx6S 0S S SQ``P`P`P PP` <0 S0PP0``"@;t 0$Kp VKA$ $nNK@D[0S Pn@T KPl-d/x#  -0L0 S 00CS00Ӥ0]@ \00! P 0 000p0 T0 p LPQ(0  B000蠶<,( -PQ@`Lp x x x0|0 `t0Pp0pl0 h0d0 `0 \0 X0 T0 P0 L0 H0PD(,<840@ -3LMؓ ԣԃp@ 0`bPep 0  0#PWp P "P9X3XPT3`L#'x@8@`"U00ST P@`\U@@ V 0pP0$T2 00d "8u 2P"2堂 \00A S-Q5T"d2PP"@C $0CSL @ᙊ$K'p* +$+<+T+h+x+++p@-<@< `P 0000PQAp| -$0@LP  8h -d@LP PHGDg0,0 ( 0@ 0 h+ -L 0LR RP 0R >+ |00-PPp0Ll Pd6V\!Wp@ LH0P 0(,024+h ,, -DL@ `P(0( 00000 S褶8 0-@AL81 PP,1, 0P  R0 L\00P  BRʔ00 0 0 QT0@0<0UP<@00{00耋< 0-DP@L0000@@0 0 0 0< -`LepP[{0 SPfu% ࠟ0S @ OPB000000 ᱭ`PV p 0@*\Jb@P`0 @0O(,8,P,1 P-L`h 1 @0Q0S 1 00P\DX` Q0DQD0 Q@L00epP00CS04@0U0, )0@0CSp0@0B0@p00 \PP \, 0O008,h,G-鄠儐Pp0 0S0 0 BS00R \P@`A-D0D@00  R P  p-P@0|`00t0L@l0@d0@`0@a0@0CS0 @@00 ph&p訋 -1q00SL-P`0L00d P100CS0#@00 0@0CS 0`@0x0(000    -LMP@0 2TPB ,K A@P zhhhrhb`"PYm 0 P40S0`00DP, 000S SPp PSP aP SPTAZ,KPPU 1 ,0Q.0 Q@L00Yd PvH00CS0<0A004 [100CS@ 0@00I,  zj@p0P@ e P P \0P 00S Pp(K,8A,,, -LMP0@ T T4pP- 弐0帠S0@0+@P`P 0S  0  0Bp3PPP0T@,,H4 -0 CR 0R0 S00 -@0LP`rPe׬`Z !`0Vh#`c0SUJ L0SF I0S\\@U`T xRP 0`!Sb/*0S@,0@0w0US8080h0US00[`zUSPX*\00S` lP E U 0@0^S00\P0S蠶,xЏ,, -LLrLLL`~@0S 00CS00PӤ0I+PuG  Q/0 Q@L00b P00CS0^A0w0V S0`0CS@ 0 L!0d800 S0!00 U`!00000 +0S0#3 XPP 0S0`00F` 0S0`00<V @V00 00 0 <0 `蠶@4,,, -3LM, 0 0 S@`TA9P, `3@, P00T$bpP[ {00CS00P0CSp0R00:R2 jh0 0@D0R|  C@DpP h"000S S TJ02`V00 VP\00aP600CS0qA00i f0!0CSP0 !0{|!0h1 hWAP 0 0@FR0 @D C R0P쀟0 R@L00apP00CS0"@0@0 0@0CSp0X@0-0,000,0`(K,, p-L`P@ P pP@T*p, -LPp` \ P  |@0UPh0S \0S@ Pp `0U0U0S<4 -LP!\@`RP@/ pP0!S|P H;<0<80P , V0f-(-@T - c L@p)"pW0 WP\00` PW 00CSP 0 "0a00 R0 Ch"000S 00CS00Ӥ0x0S0  ;P 0S0@ AP X R/ڈa刡0 RP\00s` Pd00CS0J@A0 0B u?0P0CS 0P00d X00p 00S0#3 PP YyW d0 00l0 pD0 00@00S <00SWpGp蠶 4D- -L M4 pSŸ`2 0BP00 p30!00P `X`1 P00CS0\A00T Q00CS0 P!0q0S p>0`>PsP0 nR pR lR 0P0P00PP 4=  Q =0S ==~PI==QP?P0 nR pR lR 0P0P00PP d<  Q <0Sz <<JP,0 0SS0 x<0S <0S( p<0S r ;000 8@P P0 nR pR lR 0P0P00PP 4;  Q Y;P+ $P\PP0S!SH +E0S, 0S @P ; ::;0S[ rc T:000] P 0!S4  P0 nR pR lR 0P0P00P\ 9  Q 0S+ EE U9`V 9sPaGTPPgTPXVTP P0 nR pR lR 0P0P00P\ 8  Q  P(00090SP0 nR pR lR 0P0P00PP 8  Q ) 80SP0 nR pR lR 0P0P00PP t7  Q it'00cS0 `'0S TT70S. P0 nR pR lR 0P0P00PP 6  Q 860S @7@c(7PP\0 nR pR lR 0P0P00PP 5  Q H60S 66P} $0h&@ 0R P0 nR pR lR 0P0P00PP 45  Q 5&@5ZPH 0 nR pR lR 0000P 4  Q $5 55/PT`pP40Se @Tk40SgV`pT P0 nR pR lR 0P0P00PP x3  Q j30S? h3P( 0 nR pR lR 0000P 2  Q >d3 \3H3P 0 nR pR lR 0000P 2  Q 2 220S;P0 nR pR lR 0P0P00PP x1  Q 10S |1 Rt1 d110S  0 nR pR lR00P 0  Q L10S d10SqT\ P6q 0000 10S1  1 g@P" P0 nR pR lR:0P0P020P,<@..<T.P..,ȏ.+0|.-y/<.̏<$h.,(T H8cP 00  Q X00S- 0S0!S+B0S0S @0P 00P 0 @$q,Q`0gS  S &:00C S#pS rS` 0`0`0`0 1@sTP000`00V FwV 00 S 20S@ p02  1 0 S 0 Sp pRV000|2@  @P00CS0MB0y0E BRT P KO 3 @ #00CS0,C0[0VPP?PT3h#0$S0000W0#00#0#00# 00 0nS pS lS0 00 00 0 0\ 3PP0 nR pR lR 0P0P00PP X4  Q N40S# 444 ~g4PD{P40S(0pW50SH'P0 nR pR lR 0P0P00PP |5  Q 50S #50S,P0 nR pR lR 0P0P00PP $6  Q PTRpqW QWPd6 Pt60 r 6000}`P8 60S6 R6 6  68P&0 nR pR lR 0P0P00PP \7  Q 0S0!S+@0S0S`{7WT7 70QP7(0P00 0S 80SqWP<80S0 nR pR lR00P 8  Q D B8 8 P010C0S  I1@s qP00 0 nR pR lR 0000P |9  Q 9)00Q0 mP0 nR pR lR 0P0P00PQ (:  Q H:T 0S8:`:Ml:0Sx PCP0 nR pR lR 0P0P00PQ :  Q \;S;⾖ ;0S, I4; <; P T;  PPt P -LtM  V5 jWPڜ0000SrSh5hehhhhuhU@sP xP pP00 @ j0  5%Tp0 10 00b0 0S 000-S 0@S@ʜ000 00C0 TP@K P0: S  0040P  展@P >7*#000S 000S 04P 0oPX30S 000!S 0+L ?0S 8000S  20SsRcT0S S䒟䢟"P PB-"0S& <"0S"p820S  p2Rlh2 0)IP20SH"0`0089"0@09"000 S 10S!@0`00@00@P @P  @Pt t t$ @!00X,00S  1R 1 00 S 9h00Sc 0R0 0V$/,/TTďD/ȿL/P/\/.<0`/@x/,0^S0]S[S 0.R =R:R  S0Q]S0]S S]S -1L`@[S \S`P t0 S\`0S S,140 pcQ0A0 QP\00NP00CS0-P0/0% 0P0CS0@00\@DP T H0 0`S  0o ,//$(4 p- L P p P 000 S S@0S~ pk`Pp0P 00S M|0P@Cpcp\0P@P PYP 8 800JPpp,,,/ȏ( -L Mğs@, 0 40 0&S903` 0hQ0 QP\00M P{ 00CP|S 0l#0uX0, $3 0P0@ 0Sv\SC00S@9S>400CS:0 2`2 0hQ0 QP\00M P5 0l0CPdS 0T"0/@0,  2 0P0@ 0S0!`V&0 VP\00dM P00CS080t0CPlS 0 \!0H0]01 00@ 0 0c SC R/`p0 RP\00*M PGg00CS0@00 ,0P0CS 0PP00(0 00@(K -LM  @$" (2 P  Ld0S  0@_K  0 B JP$" b  ," (2S  S ;#rPU0 U@L00L P; 0ß0CS@ 0 h0KT#00ß0S 0B R K 0P 8"RpW$0 W@L00yL P00CS0U0pŸ0CS@ 0 X0D"0s Ÿ0S 0 RK`0S 2S ,\    ?K孍Pk  "向0pf 0 Q2 /hQ`0 Q@L00"L P?<_00CS0AA009 $60@0CS 0@00W "1 $ 4p00S 0T@ /R H)RQ"(K40 -L M0P䑟0C0 4 , 0Q000 400pP^A QPX|0`00pPY`P UDA  MPP!00CS0:A0*02 /V00CS0  00 P,00,0 p@0d 0b, RZPP  P(K H0. -L0  0%Su0 SqB 0Sp  Q.0 QP\00K P;[0@CT@xR00  0<0CSP 0000  Q@ 0S.@D/\Q)0 S0 @!!0S 0S0`00 tQP d!000S SPFq@a$@00 S R0 a䀟0 RP\00JpP00CS0#@0?0 0P0CSp0XP0,0$ H0@00,.0 -@p@@0LP` U0@ P0 R00R00 10B0S 1@s @@ gR0000,<. -`吀L p Q0@P @FT00Cs0,0 (0000 080<<@ -2LM0s22080  20s.xB0Sl2  +`"0X0 @0A0 S6 000  0' 0 00 0 00L000 000 000 0000 0 00   00#0\L 1   @Bp4`K07# @D0 0C0n##0 C0?^NPnʬ00S:t0x@C d0 \0T800@ \P00 j(K<<@0800 -PpL0` Sd 0 1I@P 0 P 0 5$m 0 5$g0 % 006(VE@@480k -/L@TP  0 ST @T 0/S 0/S @T  -LxM  $P  - PP3 40CS0SB <0Se 0$ p0/S0`c<4@ 0T/S/00$0h0 S" 媵  PP0S (K@ 唵00 厵  #00`Kp4 4ST H0 Sp * R2 0: S  R, T R{  RV QP  0S. O@dp 7P$  $ p4Sj H00* Rd2 RX2 Rd 0Sk  PS("$ 0 pf0: SF1 Rg0S? H0卮: R9  R/  R1 R q3,P) 0S 0S h@H 0: S  00 1 R q3/P-@  ܴq3DPrд  00 0: S /00tP +H l庴 HMPP@ DL80ԅen\\000 e -LM@PԓH01 p0#p5 H0@*S*T @ ,   "[p2`@fT"0Sa 0S!001p2`D9x2xB5Q+y6 P*NPDd 0 0!K pPw0SkVu8  '!00}1 y 1 1 q1 1j00g0p1 b p! ] p! X0S 1SX0 0S0S 10 KO1: S0S K. 0 . B0 )kp 0S pthq \ Pi0: S@0TL 01\`1 0-,@,PL( ! T4kt11 -0 L8P۶0S CL1 p-0L:#:0 0P( `/C#b ,0 0@4 /C#b KP@[V  ?PP0V* PP*0V0. XPP.p PP0 0S @0V<0~PP l0V@0dX崜PP _0-SX0S 8(@p$@MbL1221 Q-L@ hԥPT ?PD0P4(hXL,2 2 Q-L@ d宥PPPD0P4(xh3pL82 2 -LMMpA^K PE0PE`@ 0 儐p% 0K T04B P0P 0RK`gP XL;H6H,.0kL 2T2D2,0 -LM0S  @T  pp H Q! GD0S>4 R, D$0S PD00CS0 0`0 Pp@@ 8$0S0($0CS00 Pp0@@yVYV 㺐`vH{0S 1 ,㥐`v K⽲PP$1:( SPP@P0?8 0 % :. 偛p  0T00(d@PU 2 KP/0p8 t  00 dPm0?PX Y@,>0( L>l> -l`lLpPP@ 2PE 0S@`VP>2 -Lp`P@Pp  10e0@@1Pr00a00  1Pr0000D>> p-0@0LS0 P.  00S 00CS00@Ӥ0ꎲ@d`dP0S 00CS00Ӥ0ᗲy PpyTp蠶T`2 -LMpP`PP D10SL810SH,10S  0@9 000 P w0S0;0ۋPXQ P( 040 0@ ,G,0, 4(0 $@ $G4K P(K@\X >>>> - Lͮ> -LMK xP[ [4 0 S0S (0Sp2 -MLM8%pQ |cPP50S o`640S P 40S  K P$ 40S yѕJNK`@DdK@@DK 0X P (40S 8ᷕ`40S 4[S /P `+0+03 3`V KJ3@T )Kd!K-P0D#:  SK RP Pq`)KD ӌX20S K  0$`x P p20Sh`[K(PEPE9K) 4@P `?V00S 10S ?0S : ɭ30S`` K DK0$P Vt10S d屭``d0S X1 R D0S0 @,00@ 0$@4 ( V ^ x P V-00S)_%V00S D0)KS,0D0 D K d00S<0@K08K0 9K4VS ``(KX<\L> ?lP@\@?ԅ8 -ML M99 , 0igS0,0 xY,@ 0P P( 00L/P 0L( 0 0uS0nS0 0, 0,@/P }/P0L8 8 0@KT8 O/~FP, 3 P 0@K \P`@p@T k?PPR,01, B, ,0SU 0 0 !0@S07CK 7A 0@pK0g帗D8 A 0\ H( `8 dTL STu 1T9T-LT NTYaT- VT}bT* cTnTI gT4 fT.hTz lTz2rTp oT? qTrHtTY vTm_L lT .0@DPH ezbF,K ,00SX l000>\&G T. P( I< 0 00(00 >%P;0075\+. P 3H( 5.:0E,p 00.S.0@0K`8,0 , g b{.0,0 0x 0 0E000 ?H%000!P P D(5P p@P5@Xj>P 4@0H8S 40TS4T 0HST 00 R|š$0s400s030 P CK.KI B BI`X( L(00 @0-S 0SH8SCC000S40C S;`A(B(BB(BXDB(B(BAl30S|墫 }0S.P,  @K-P @KX$#0E P *XHPH00: S  JH00: S S0S2P" 8XH0S d"0SP d(H8S)0S @+-!0S  +P10SP9 @pK !0pD P: +V`<H!0S t0S<10S  H0t\0l10  P8 P P`0S00S 0S P |0SV`PPX00S r4kPTDL?T?0X?p2p?t<x??L8\?H2T?@@X,$@ԅ@@@L@d@@@T@H54@ 0-D0LS@ 0PUPHP)UPP0D00 0C0 0 -L`pP@@PHpD@ R-LP` q@0@P T@T ˭O0 0VX1Xq 00 @0D00 00 0@T:p VOp@@0P00 V4vpV00 0P00 d@ep _]8 000DP  sO00 2H@L@ -鈁LMPpH,  F@T Z@ )PD p` pG 00;P'  gIp:0P 4 010P 000 <@PD`  (PD0S0S(@  g0, cP@L@ -PPL`p/ (0S 00wSp rS"ppV 000x000p000 0 0@00@ 2W忐p廐9T@H@P@L@ -`QL MH p0rSwS ?R@@T Wڪ00};Pw 1,@@0@0@4@@@@@@D@ 1嬑0 PwS 0 !@0q`P 8TH0090x` 0HwS:XW@ W@@0 #020Kt0"̠10K"$}000K- K0 ` )0KX20K/K,K+K*@KD0 . K@  < B 08 0X  DKp  05P  KP  0(P(KX@H@P@T@$AL@ -RHL`p$H X 0P @@ R,B BQRQ0Q@P`Fvd2TLDX@D@00 0 0 0 0 0 0 0  0  0  0  0  0 0 0 @^Plm@d@i@V}VmFP0p0`F@@ VV1E0\\0\ 0 \ 0 \ 0 \ 0 \ 0 \ 0\ 0\ 0\ 0\ 0\ 0\ 0\ 0\ 0 @`FPV 0 0R@P`Fv  @@@P[ -PpL 0눀H`$H?%XL\8@#8P@'XPfTPLD@DTLD@D(0U[E>^E0PEU\EPE@- 0S  00 0 0cRÌ`@0  0"0Q1 P0 0SPL28 -0L0SL8 -`QLp@00SP(0^ ^0 01^ 4# # !^#$""1^"4##!^#$""1^"4##^#! ! !@D!$""1"#T T $0@T0 01 #L8 0 "Q p-L`P@@Tp -pLAM0`, . 0J/K(1 |00R0@KJ_K   Pf@0    pd`0,1((K 0@-@P $^ 0 SΎ809P  L0  ( , 0 8 < lPP0P@-@ $P Q < ^ 018 0C0,0<8 0 Rp-PL@4 0@Q1S``.Pp(0 `S00`(0,0S0 ,00(PpUE20Pe$00E`S0,0$0p040$Pphpqq0%0  -@PL $Q ,0S 4Q00$,0$0P $P 00  00 0@-@P \00^ ^l\P:0 -LMpPL $`VI 0S<0S0S < 80 0(K08< 80080< #4 B80< <0 S0 h0 hh0  `h0S @ 0 0P 0@P0P $P 0 S<0s3 -P00@Q0SLT$PUQ (\N ,0SK 0(! `P 4P $ 0(P0,p >LS.Q :%<,0Q P0b0bS.00 L P0l0S.0b0S>0Wl0 $0 #4>4p$`0% -$@L40pS` $P0 (P47 (Q$ 02,(000( PcU4:b > (0,00 0e0`U`1`!  q>PU 4e j>(0,00P00( 0S00, (00PR:0,0 -pPL`P4 $@T1 0S 0 S+0 S  > ;0P P 00( 4Ub&>(0,0e >,P0 0 -L0MPP  $PU 0S 0S0S0 S00D < , 0H0 8p<`@ 0S񟗗^kkkkkkkk^<___p``^bdefghhliik^]]< y< !  ;< 0S  0  Z  0RJv`V0'<P0S'r0$ 0SH͟`F 30 `  0 0p8Z  0RJv`V'4<'<,4<0`80 00p 0S < H  D00<`8p k 080P\ 0S  07s`0Z  0RJv`V 0 S` `L`T` 0 0T0 0+X0 00LP 0; 000!q`F<07s` Z } 0RJv`V@˟("('8,Rc`0@ 0p@0Sg DQ01 S@1 @!T`  H=@0D H0d d dD H @0Z M 0RJv` V"'5t  0 0Q\0`d 'w`FR0 0h Z + 0RJv`Vʟ00 0'hq`Fh\0Q* h00h0S S.0L T0l T/p l0PZP< 00<0h0T03L@ C 01QZ  0RJv`P Z  0RJv`V:7q 0`ah UP  Z  0RJv`V:^`a7q< 6 0n00'q`F(P   Z  0RJv`V:71a q`AZ  0RJv`V:71a  s`AL 0S \7 000 h0 0h P*d `0h ^L x:0S! S>/΅T 0 l@L0T l0p` 0P< Kl0`P00X0X 0  p0d P0< 0 h6 05T030CL01 P0 Z . 0QJv`S4  03 @C403<1 R0 Z  0RJv`7|`lS``@ 7p0  0@ L% 0H000HQ Z 0RJv`V:1H0C07q@ `a @ 00X030CP01 P0 Z 0QJv`8 03 @C803<1 R0 Z 0RJv`7|`l@``7p'0H00D 0HQ Z 0RJv`V: 1H0C07qD `a D @,0DD 00`R00< jD Rr @D0 bSH @c 0 bR a(00b@40bRD@0 Q10l@0D0H0lD0 0 R0@0HS 0L H DQC @0H AD 0H 010S4  Z 3 0RJv`V@0Dl00@0@0Q00 H0 a8'4<,'<4 <S D@  00D`@ p0 0< H00D(08pS<`0S 0@P @P0< 09,0@ pc`b0 00@ 0@0 0RV0 f q8 QS@00<`P  \ 00R40 <P<  < <(KD?332G-|M⠀P00\ 0 S |@0 2R02BQ0`\ @00S@T@ \0@ @@@'@\ 00S@T 0 sJ QR0Q0P0S< # 000 Q | 0S4Q 0$A\0P P 3ß(0,  (,0 3ß(0,00S0!Tp!p1' PP#0 \00LS`$P08 8  8 800@0i^040@(,Ŏ0@`@0ià0%3l l 041 R @0@# R@0B00|0 02S0C8#(@  P P@@a800@|0T"C$ \ YPi0 \00cSPR :  0<Q00SA 0P0 0pa 0bC1 0wY $ 0S0`4 @8914 @00Q  0A0000S@010p|Ѝ;;Z::$A 0`<?/A2z -0L R0 R P0 |P0 |@||0SX@` @PQT0D0L 0S 4h`4kdTA^AAB -L M0@SK+1P K0 R 0LB 0-L M0@SPK02P K0 R U0̑\B -L4MP@2'唧0匇oS000 `gR   0P` mS000 HfR  pT` H` $'p= H0@0S0vtututuvtututuvtuvtututututuutututututututututututututuuuxututututututuututuuuuutuuu H ,&p 0P0 0S 10 -R% 0bST0SL  H0SOWppV00Lp L0 `QV< (  8 000C0Sԡ004K 8DŽ@̡0S540 R- @ D 0@  T q`pnp`kp`hpW0S `: P p @ ` D < Lq`Pp GPP+ 40C S ywwww(yxwwxw4x4x@? p0S Z 0P PPpe0S a0SH 0!R0S0S Z@Xw VP P R 0S0SH0S[ D@ <PP PQ@ pT RJ 0S0S@000C0SU4K` RPPl0S40 R| @ XP D c8K0K, KPl0@0 ,00D ,0 TH0 X00X0H, X00X0H X5PL sD@ o{P KH0\塁0P0S0L00@ D0 #P\ 1 0@0 D0 .pP@  p D @  @ `ꢠ"00|t8 d8 X8  H 8@4kdlh`lBTԅ\ e|BBBpp@-@P0S@ 4 p0S\ /+0;;0b @ fu0S V,0S -P 0 R-POu0S 00f0hH 0Sl0 0 PHh o4"xh.l.8|...T`.. -LFMM <t;6*D0T0C0 :!6+P( 衟00 PuTuM 0000 *0 00pg!$r2 $Xds)000@0S SBKJJ`+4KjQt p$  00C0tp \0@ 0R գ4s~R 0kh..8xT.T`/@/`/Xl//.p/.//n//B -LAM p`@PBK( H .H 㕣 0)W   ( 0R $KV 0S: @x*P 0T: SD0P 8 0S: 0kD0ph.0B -LM0  -X2LM 040p  4 ;;S  0SSYEPPV 0SJ4 Y, P` ,40+@+PU`RP ` YV4 "P4,/+0;;0b\c/00S@\40 @ + @,0 T0000 00S0SU,0S x* @f40 TP0PPP4@ 040P<  40~x$0 -LM⸑<0Qp,0 [8P 00 4P* /00S@0 @P, 0R(K0Q`0@0 P`0OO 4D;$+4 04P  K.?K0P  40@ hK.0 0 0<+ 0SP0SP0kxB80 0   p-d`L0S TPT 0@1@P$0S$$000p( -@LP$00| M0-LM0@0P0f '00CS ܛ'00K0''000Fp0 0-|0L @?P}od0 P 0S P 0S0S00S0 ,0 -LR(M00Qp h0b43X^u  0LQ OTUi H 8\J0@O /00@@D @ /T<9 H 0Po 050O<0 8@ H, 0H< 00 8<  5ɯ @0O 0 @T40 0@ 30 ,0O$!D@K0@P U`] S1 R(K  0@OP`0 @pP SWSH@DPK`0PO` 0 @VU1 R 0 40kp<0Op  0$7px @FlFFFF 0-PL@T0FPT0 0S $( 00S:p -$ 0LR (0S  - -00!0@S0L1! ! 85H:pp\0Q 0'TP@+Ġ``+ 40P0Pp0;&P|<d0SP@+L``+88 30|t xT0 -LRL@2\pPs 0 0BO?m PZ14,%`Ps 1 ?m1 0W0`  P 0@0@0@ 0$@p@d1\%R00 Z P1 P#U 0(  $1\%R(0 ?p  ^, 00 Z  0\%RX0 ?  ^ 0@嘀0Qp 0 aX0@0@DpdP%PP$ xT,($ GF -2L0M`0p`pT  0TpiUD"0S: 4bQT P | "P@PP0TKpǏ 0Lp H m1D @ *dP0 p< x118 `@4@ /T0K 0 O, DKDǏ/@ .DQ7 <@pǏ pL K p`TKPl8@ ?l44@< l0< T$>Q 0p07 g20@ W,L4 Rw0S04 R# pyğ0 ?k404\ 1> A0 10408 j  B V V  V p(KI#0S:B# 4 00083@ @U(ß4#0P\Q (pt"0#\Q t0p  0S80Ÿ00"\Q "0"\Q ^xŸ"00K\Q00d0X0˓L"0T"\Q00000K 0$@ Ÿ,"0\Q00"0D00"\Q00000K(0,@!0\Q00!0@00!\Q00 000K004@!0\Q00d!$0H0d1\%RB 40O0@41<1\%R404h0 404O0@ 0@n"F60N"00Zq"p00=(00s03ix'(Y0Sz Spg40O0 @tg,p<pxU GTdXG 0-PLM@ |kU K0T\!0S:N i@Q@<k04!\Qp"P# k k1 R(0 \Q, k0 \Q0O(0K  k0 \Qpxkhukd0 R \mk04 \Q0S:2px 2TD,2882D2(28! -MLMDEH <\, 0X P( L8 D > L(RH80 )P D, 0R (KX(HH0 B8( 0 ]'48HT00tpǏ Po t Po8"5XHpQ0K@0@ 0T aQTʑ 4 H8 4R 4(R3^z  10 8H^ fHD(g4(Zk >K0S@P8 LH pCt#0\^K  1   RHHL<0S00^3 0 nKH(`F`F@0 00!"PH8B\0"\Q 0K0S@0@j|2@@000QPQ0 ! R H8.K ' 000<0 !?0003Pk4 j4H\la@ 0@  r 3 H"P 0\Q <8! 0@0 00 #0K0S@0 @q0<AHD 0kĘx|T222|28\4C -LUM,0S 0, ,00806 6\Q 00 @xF0P: S S\ ST6^n 0(ŕ /R \ 6^i  0 RKAAh ,h&($R>Kp l 0 \5 XE 0BOhE?DE gpU\ed ` 8U 4e @E Kp l lBnK`F`F@0 0\0 PL!P,C3\%R 0 L5O0@Ui3 R @U(0/08 20 \P 0 \UXe21COPU`p2TU Pe P`hpǏHe 3 D 0  R/ $2PX0OD%0T%P5 H]aHDH D Pt0r OS(!\1pTP%Q PT P% X0 S R<0PES00T1 0 BnK`F`F@0 00z  P( 0\Q) 0TUPe0S@0@h0 (0TUUh0S*W.K \% X5 m0 L5O0 @MD?0TP%0S@0 @0kxT222 C -L@M\@KP`@ % 0 0KL @P <` p(t0 p0\Q `,%pH  0@K %xTdX -LpP@T% @0S Dh 0`@P``0 0\Q ,$c00i*P 0: S`0P\ \ @ $0S 82dxT2h.LX -`LMXH RS, @4ȟ (0S 0Sp P ǟ'0S0@0 G0S ǟ0S7 R ng|0@S K 0S 0S 0S XX 80   O  $ Q ?KP``F0`,_K`P`P`B2 MP`K 0u2/R 0O? 0@l& @Ācp 0b 0xB K2@fşu0S %`PU`0P@`P`%`M5 R 50,PO/Q o 5 p@PELş@_@P004@"%8Po% "2"_K`PU`P@`P`D0`ğ0S f|4@T f@T 0T0S8 tf@T `f@T *#0S84Dp q00Dp q00, 0R(K`" (?K sPS3T@@@@0S3 R2 ,ß 0S. p, R*D0 O  & _? d0 0< l21 \>Q,ʠ0p, @RʰrH"0TBS8000, Rb xb@ 10qŸ@ ,0SHR@g@d@0L_\2Y!0S tA0S 0Sh0S6fPx &KPf 0S8 qXc/9xfpf 0S^\f 0S\HfY@ fJ @ 04@0 0T eP e eee e80k 84X4xd(GGpD5(HTt5534Ld5<< 35444|434G54HC p-L@M P`K0S 0S  x3 -Lb@P{p00"p~ N0@+S+D(((((((((($(((((((((((((((LD(8(((((((($1w!0001m 0>0!Sdd00!000|1 c 0|t1PdK@1 T 0bqD1  8d0!000 1!0000z0pIP`g C0 R<V 1P@@ 0T0Pl$\H4kdH8X3 0HDH\0\3`lTK `: |< 3 -LM`0 HP0pW-"1> R.#` 0@ 0. 80pW080 0@P`Z  P 80pW080 0!`!0@0@Q ڠ1 R= pd / P1 ``Q 00L1 R R 0S0S R0S 0S0 0S P OPPH0| `Wt 0@0@QTY PW(:H8(6\646\@K 6 -\LM,0SPڼ0@Px@ tP D x 0, xPK`@P`RxP t` 8ڼ0t/x@ 00T 0 PoPpǏ`pT 0/ XP`1> 0P@`UVW4HTLd@;pǏpXʠ @ hK =@P-m͟00,0KX 0-0=0, R|ڀ@ |P @0 @ PoP ` 4m|0倠O *Q0   0OP`Ǐ`L 0T<\%R0ɯ \0Sg < Rc l< R\0/ X 0 0@ @1>0P  1  |00@@P$ `h̟0 P,@0[0  0, 0PK`@P`QP |` ʄk00*(K0@0 @ pPK`0@0 0P@`P`ȀgpYZt˟0   P 夐 U 8;`  p l JQ K GD Ka0pK@p l K P l  R@ T DR @ӕt0 BR @P  0@!K000S00S  R K00KP!%601@P00 K hKL H0 $,10 404 10 \Ph0O0 /S x1APh00LK 0S 0U`KP,!0\Q00h0 00O0@FQ pp RPm0Ws0 0@#1?@rx(|dL<T8U XI H6726p66IX(I6xTHT4746\@pIW\D1> 0P@`UVI K60`0\%RF 40O0@0P0\u Z=0PV=@Pa V0 8Q`0@0@TAT!0\Q  0  0S2 K00K 0 40O0 @=P 3 U0  a  P K4"00K00Th0S1 Gx |Pw  A -D0 ML8 , 0N$ 0p)PKxI -L@M@ hKR0 00, KX0 0 ,0S+ڸ P`Rp Vp`Ui@P LP H` C0hKS 0 P@`R,0 S 00(KxL -D0 ML8 , 0N$ 0pPKxI -L M0 0Z , :0쐟쀟,0  KP, P U, 0U PU 0S\0 | 0U R 0R Z 0@`p0,0 ,(K:@-0,0,0S@TTS -UMLMP'0,0 00CS񟗎,|Ph,  PP 0:0090J|F>K0C 0C t5 66*@ tS|0 1p6 bB! dd6 `4 X6X&Z4K0d0`00 0SZ S;;SV~KpGpG,(5)5(K \%5R 0@`5 \E ( R01 0#SP %0\Q,0(0,0p0t@(  R01 0# SP R P(%0(%\Q0X000@\0T4 PD t0L4 HD kZ4$p0Z0 "0`00@0 0S T r  Pğ  @$P%DPpZ#0P1`0U0:0@0PV @ 0S0SPV@, 0R(K`#A< 0 PF $#0\Q: 0@0 @L7 0@h5 dE GB~KpGpG@0 002 RSB 0̠  0SS 0?044 0 R|P p4"04"\Q 0@0@U{ rjsw  h Ÿ Pj /0p00(0!0C0@0 @$P0PsZ1SpA 0̠ xd 0S `\H Dr {P( 3 0Pr  ^ gP  Y0p0CZ0NPQ40k7`/8(|xxT t8488JT/.8nI.87777\@46$C -LM$$ @0 @KP(J -LM44 0, @8PhDJ -ML M8 `R0,0 (@TR8(04 KK ,.1K-K0-A[S00@`VʆT7(K MK@P 8 RP0S, 0R(KQ0.S 8 0`80 R`p `(00CSSP0@S &P 0S &00xP8  8 R 0,-1K`0KKL.1K4 T-1[8 00Rp 000 P8#8E c(K 08  8 0 0C0(K (K@@@T0W .80 8 Pk 00C0e0Sz*<ş 0$`Y4(K` MK80@f 8 00C0 n@P68 58 RFQ 0.SA$PP'TP`& 80S< 00@@[0S ğ0N00PE00C0V 0 080S ß080S-0S`ß \3 RP3 RDß 0t P` S0@ 0: S00S000&<  0 80Sڒ~KpGpG@0 0l0RnKL@`FP `F 0@0B04"092 Re Z 0`PPb .8 q)8 lPl?P<0@ 0$@ Ra !QPV` H@0 0$@0!Tw $ 0(K MKlPLP  @0 0$@0k8`8p88n999`:9:8:x,: :dJp:89@9t899,CX9 -!̑01@!1PL0B-0SC 0HS8000PP4  0 0S 0` @$1 R@ 3P ` 0S  P_0HS 00Q | 0@ 0$@00C000P@00(t, -LM$$ @0 @dP(pJ -LM0p`W0,0 C0,0  P0,0 "1> R*A R P) R 0S0S@00V T pW 0@P`0:0 @   0@pW,Q( -L@M@ hK8|"0t",0KX l2l"0, RڸX 剁0S\ڑ pPoV0U.LP H` /00CSQd8 !QW R P^ R 0S0S00 hKp x p0S0@P`!0,!\Q0  000S hKX p0Sʸ0 ,0 S$ڸ 0hK ?hK :AhK 00 0S Q 00(Kx T`.T:p:: -80 ML0, 00p0FPKJ -MLMXXXO0 KPK(JX!J,0 HK TQ`? R KH!8KX1Lqp Q[ PhKXaXQxKHŵXKXQ$ETnTTʠnxKXqQQ$PPpxKXq`0\3  BqB00B"1K1X0 000SXN0S  KX$@QPPӼhKXa`0^3  BQxKXq0@%0 B 00B!!L0   KH @ 8KX1 LqHKXAt0XK  Ba?0\a/PŔbL8KXQ`AKKT K0dhl!P5K(@KA/@8KD`@KXKpxKp!xxa pKp0Kx@ 0<0|0XKXQ808t< Po 0c O`VP' (K0X!0,;+HK;XA ,0SxKP`}G4K`tKDKX0XK @OxKDhKXa,HKXA 4 X 0`OPǏ`XKXQ 0 hK5TaH+0S 3S K DKXK0@O8T 0p@W(K4!R7  R\0?00 10  B\ HK8QLAUʠ KX$5S.pPl h0U`0&p@ @ T 8KX1$%T  1@01pP0SUT XKXQ$%T  101$0hKxaO0@0@0KOx0@0 @P`(KD!  8K/x1  0hKO0xa@xKXqPL#@ iPKH^ 8KX1KT Ea0 0XKXQhKDaK,L0 p@R HKXPPL5hKsKd!8KP%X1x?N 7P`, 0RP(KXK 0R# 4  R`0?00 108KX1p80P@`PW7 W"$0#0$0QK`0X800cPK0ϊ/.Q00b\Kt!0KKX80O(K8! R8K<1SHK0APHK0Q0HK00XA$%RhK80l 0 0 08WKA`KX8XKhK Tl!P 2 RQKT2xKQ\01h!\XKTQHKTA\0yP Kp@! P KT1 DARKT \0|1R\08Kh!g0 0KTx0 R0R0 )Kp P0 0K`Q8KT1 `0Q\0?0@0RxKTqXK\0TQ0?00SH qP#0kx<$KJX.K GTp:KKKlK<TU HK8JxJJJ8CPU 05 D0RKTK\0T0?0S5KX(K04q!8KT1PU HK`A`VXK\QUA`0RKTxK`0Tq0?@1P`0?000S' qPPU 05 X1RKTK\0T0?0S5KXK04q!KTPU 8K\1`V xKpq2 P KKT l!00 0(b@"0\Q\ 0T0xKXqXP 0\KX\ K00B` `0XK  Ba\ad$5SAh$501l `R 00Bdd0(PlHKphKKhQlqdxKp\ P KxKX0PP 0(KT! BKX$5S0C0S$ PKH KX0$54 KH! HKXAXQ,0$EUH P 0SS Od0Sxۼ -LM$$ @0 @PK00 ᰘ0ᰘ0ᤘ -LSP ״; Q-L@ a P Tƴ; P-L  P 年< 0-/LP@P 00+8/00,+ +00< p-LlM/Pw@P K!P0: S Kp0`rS@ ^ P0-L@P0 R 0 R 0=R0hUOROt0 R0h0l-R ɂH0 R <0<"R808Rk0Rꨘ<8!4k$< --LM0 0 R --LM0 0 K --LM0 0 K -L@ y˽ h -LQMH0@K0卑PP`pK<ᅑP0: S V@@ S00S F`PoP$K2P T P`0 R000 ZK@VP h1: S 8Q((QQꤘdp<P<`< --LM0 0 PT -T L@HSP4TxGW edA<< -L0MpPg@P"  Ta0B0S0 T00@ S0 00a>C"0, ,0 ,0 R Rt3tt#!2(K0 00B SH' 0#,@ P 00C 4, Q0 0C#4 4 4p48@ 0, 40 0C< 80 0@( D |,0P@@`0D@ ?)O8<00夐,@@8嬀 ? 84 <P%0<,D 4@< 0B$%pH /T P @DL@ X 夐 Y 00S  0I 000DL 4 0B 40D0< ,0P@@`0 ?NT K <@ ?ND0 S,d 0S d H\`0H P3  B  B00B11X@00@0 SY0  0040(  , L AHCK<d P-L@ 00 R$hEz8P8=8! - 6LM , RvfFXS$3S Pu  0ȟʠ 0 Pş5 \5 SS SU us :0,\ڴP\%85R h0 S0 0B RR40NRR00^td0OS),`  ?#t$0ttS} \%h4R& 0O044D $0O84 R P 0Sl> 4OpKN0S `p ϟX.p 0P`@`` pp pp .N 0^St Pr mP(0--<0000P@o = RD0  TJ$N0S ^hm84P :H08<%0OQ |J 0hZH/8<%P $P 8:L]`0OU  0L/@D%)PH P 9L]`$堀Q@Pu`0\3  B‘B0"0B11 00 0@0/@P`PoU i$QPU@``0^3  Ba@5 B0  B11L 0000ȟ RP l\7xP0 0 "DCQ Q ,h\`P &RT3<Pb F0 6 00`pWU p0OO  Q^Pa `0O?0@@ c@P5P e0,x5P 0h%?>T 0 H5HU  ,5PE 5P <ş 5  44  O+4 E4r嚷 K, 0R(K40Sğ@T" 0(ßP=HD0SF ,|CK+P) K% SV 3-K B BP P S@Td 000P c\54 S0 `5S@Q@=4ZEur5 HKD2[V ß0>K+DLMPbR  0<0 iVfV$:RFTS8*06pKl2 Rb `BdR0 0 0a<rK82 R ,0"0 0 0eK2 R AQ0 0 0XK Rf a0 0 0eLK1 RD !0 0 0Cp?Kl1 Ri hA\Q0 0 0k@3K RF 480 0 0\0 E%K1 R @0 0 00k4P>46l>$ pXM@MM8MN@NNT$OPOtOOTOO0@,($T >p>>H>C?><>LMMM8x4@,@P@POdP@Cl??,M>?(?D?\@8@?dNNNxJ|0 Rf @P0 0 0L]`eJ R< `0 0 0;J0 R  0 0 0J 1 R ,A(Q0 0 0HD!h /\1\l Jo0,JJ JJd5S/x5tp d0 pP!tx5/ W.O/0,@`0@L l3B \AQ<0P d5Ww"2I?2 2R -BMLMp0 0 p0P0S ANK @D@DPpP 0R K L`Pt0@ /h0 < 84 4$ 0D 'CKH0 A, A (4 $ FpTl0k@!C - L0S* | t0 @_ 0GT0 `q0 G0pP 1$0S*pPx -LYp@_mmOp@ 0-LMMpPANK@D0@D\ 0 ^ V80 m 0RK0 0kA C -L@MRP`@ # W0 0  (K!0S y0S s0S  X0S l1@@ @hKE0 U,@K<0 # DP @` ,1D@K0X0 L@ HP Dp @ P fhK& 0W01 ?00i+   iVW 0 X0 P Lp H HhKp0 XX 00 + @` D0/ Y D:LpKX d`n -L@ML H LK J K -0L: S  S  S  S <0P ,IH S  S  S A - ! @0@@L0P; 0 ` @ @ ``0 Pp&p  @0@X ` P P $0P0@P00UQ rpXPqx<A -,2L `Rc@p@3 {xT1 RO1 RK࡟0SBT 1 R<qQG߿0ST00CS0SX0@X0FTR T00CS0.0 R0, 02P0 S n P 0S 5PP 0 GG0@n PyTYT nTNT xYTyT  `0 XEZn@XEqn@00846l4`$BB BA -,0L@S$D D D D <0S d3`0 R TG0,0 n,:P00,0,0DB\80B ,<K0K40Q5F@ R*0 4@T@ ` P0@_4 0K@P ɔ <0K0@ hF0@@ T (Ko4w(K4<Kt <KoBB(HB -LM 0@S `V 0n V up̐ pp d T 0`V0p8d HDLTL? 0<` @\ l2>4Q,h\pC00p`V@BPx4 -LM,00K, K00 `0S3\%RX` B2 R7Br @T T `U@ | PrpU`Q\"\0Y00/H2 RB0 !A `gPP@0A#O 1"1?0P HA`p-8PP`# P P 0 r3p1>0 R! "A@e0 0@A0#O 1#"1?0P01 FA`5 -LP`  PT  P P@  P8  P( $ 0 f ` i k k DX $0 000, R8g 0 < -@LP  P $h 0-L@%0PP HPEP@@jP9P04Q -\0LM@(0K( 0 @ K$ K0 P K$K@ -0L@T P  hn#@ --@0L M,K0,K  | K8Q -`0LM00 0@0 K P @h{ K@TQ -t0LM $0K 0  $  K K0P $0@hX K@dQ -0LM0S P h@X@0 @00P mh-@tQQ -LM  K K0K 4p@Lh  aKQ 0-LM 0PS    KK0p @(h0 ;K0Q -L@<@0VWQW R 0S00 -p-LM@0`P0 RgP0200  0S CKp -0-L$@KM0 0 :0P@$0 S000 @ 1' 00 0SK0 --LM0 0 gg K p-PLP`  0Ap rP@@p0S P P@ PpUP@$0  @ppLt  R@RXR - 0LP`p) 0S& 0S# 00 @00pll 0Ap\X PP@ V0,0(0(`@,@(`@贊\t 8 -T1L000,Q,p5@p 0`$P0 ,@T"0 0R0 0Hp 0 0S 000IP 6000B& ePPje@000/& ,@T 8xR Rg 0-|0L@0S,@TH0@?PP 40PP@aeP P7e08Tn g --LM0 0 ffU K -LM@?p`PK! 끍P4$0嚄$0 URRR -LM@f0pP0Kpt P>p`lP Uh ,SJ0!K 㪣P 0KJ`\0GJ!0[ 1S000SU% 0@2 : 0 @@00@0`:   0 S`l:   |(0@S`Ld <`KP h30 0 0 0@ 0 @@*0 @@0Y@P X 20Sl` 0PP|2|`0O?   4D;S##t`2^`V u2 (2 R P 00C  + R |*(0 S;30 R 0S1  0#R ʄ101 S90!0S`1010p10S xA0S d10sZ00!0S00S00#1ѣ10L@Kp:  x* `00S  P |*p8,00Sp A x A4kԙXXXY0YHY`YYYșY̙Y Z(ZЙ\ęؕ@Z|ZLTZZ<8Z@n<ԅZ\d<xZZ([L[x[[[80@Sh H 0 $ 000 10B 0# 0 10Z$\80@S , ؇ , , , ̇ 000 10B 0# 0 10Y<\ -L80LS$Ј 0S01S 00  00 #A10 #1 0S YT\ -0LPA@`|  `   0BOpcP VB?㖃! p     -LMp`Q pD4K iP00SDDT[0 PBP 0$ݗl\ -LMp|`Q D@X4 iTP8D0 P1P 0"\ -LMxe@D lUd  0 L5QD60S 0@p4 00 Y@040 0@ 70PS`08 `?4K P04K80Po4P 0` 0P0o ?S4 RlX 4 0 @4@84 `R`0_P 4K7 ß 0S0C0 ?0@3C  00C0 000 ?>0@3C 000t30SvL3 Q`0P0 20D080U00@ d 0 0G4K(KU \\\  - L0R  PJ] -2LM00 S8 4 h0ld0 P2R@ d c 0= 2P)eJ 00C 08P4`\\0`"1>\\0?0 80(R0! @ d :2 0; 0@4D1 00C04P ,0OT8`S8 K #J0O,0 (@ 8K 010 O Pop@P <` @S!.Ǐ@ 0@W< !@p`p, K 8K1x `?1` d 0 0@P0 0S 08Kx ?100 08Kx ?100,V$000 (00$Kkh꬙U \ 8] -LMK@P,0 K`0@ P A P @ P A  0!C p  0 K4 0@ 0 @ ^K`pL =0@0O$+41 ! d q004 0 KA -LM@PpGK,`b$1@ 0 A SA  9 K00` 0  0K  帇 ,K01B00@S  0K42P L=EK0@0O4;0 dH04 0GK DKA  -:L0MP0OH0 D@ P `HL` ȟH08d 10S70܀80P)0p@xpl@`x0W0HOH DpP,0 /0Od b00 0 080P0x `RU(K`] U ]T -LM  <<P ,;P4KW;0S ; 0t{WdV 00ϑ: @P0fo:p   㾄`;:Q: `: Sr\ mQ (:  S4Z@ ,0EttJ @P@PPjɟ 00T 0L59 0$: 049 0B90A  E`0UT T0PD R@: R08R0EY00 8 04 000cH0 400cL0 H00O85p``̙`, TTaT ht@,e,a$(H\ԙHaXa  ȐY kP400S40|  00 00 ,00p0$@QPU``0^3  Ba0B 5 =0 B110L 000@x0`Sp0 0OH4LD ,L=2 000`1Pg P=LV>00h0 h0 S:h0<2 0<0H2 0\ T2 0 0R0PT0XT0P0P0HU 00 400@0PP40@0, 0a84 0 =(0 H4LD0 ?>0 ?0 ;0 4 D0,40S0 ,d@8t<64P`r 4  4d U0O?`@P$+4 K ФPp }+@p4Pg`dE 5UP`8d, 0a+D @ , DK< K,0K]P<KQ  P  K < 80 5,00 `d6F8< ?Đ r)Q  P33 5 5  08q@ Rܠ #㑊(d&0  K@0@1K>P A0`@ @c0 0@` R pQ 0帐崠 J)F#Z **0PN70S@P'(*0\% 8R8\5*03G*0P$8l(t8Q0\5P80S+ d8PP 0 ?0 ;0 4 D0P  r@K*0`PTH4LDVlKd M00 f0 R P000`P pV`0 008P40  @@A@p; 008#80(K 0-LMPX0@K P0,L 0P< PE 7PPK0 $ha -0L ܋ӗ4kTa p-LP`@T 0@T *0P/S @0P/S00@T:/pP@0.S P@Tp0S .S0S`V (0  0S0L<a -1L MС`V( p1 R 0: S 0pP8( 0RX$K ddq\a\q60SB@F00CS0A0P0 Pp 0S0!0CS0 0 Pp0YUyUOOP0 S7K*. [0 R@@AjP j0d6 KHP(@FOPOP(Œ40k0aT@taa -RLM`p, $0 W @P L  ,%6P `VpW V@ PVQ -LMq0@QP(0  0: S ( 0R:$K0S 'LoKlP`% P}s3D1  ( *p` KLP  03S ,3S iO00@7 (3S43: SKفp T2 S!3 P D0`P uP*3 60kb\<aP 0S x0 RhKT0  P 0 Q(+(\<8,Hb -bL0Sp2 R p dPP tc@P# 0A S5` WZ 0Sj P @h 7K1 Pc@PN0Sch`0SH %P _0 00SB 0AS) d  d @ d d @ @4 0= 0S 'P 0S|0 0 R Q AH=P 0S KN0Sl0 RpyvH Pt 52(4ԅ<\80 e -L@Pa0p0!pp- P0@"S" l 8 pp0 bQ!@+60S 0W 00 0|0 t0h0 p0000ݔ(0 R@8\bT0<(4, -000 0LS    ň㼔4`dbT|b-0 CR 0R0 SLW00 -@RLP 0S DF& 4A&TH UF 0@SB 10S<p `(< W0C3@ R 0S, ,V0S|V@ l R @0 S0S400S(>h>hVQQ 0-PL@0S(0h%BQP x%t d\00SP e <V 0% (0h%8bb4bbb - L .(Pׇm @@ c "(m -LM@/娓"P0002Pp2 lR dr`XT2T"PPPfP tP  6op2 10 bSP PP P 0@SX :tP}10S Ya@a,@ pQl 4  PP `@a0<S 00K@P SL0S 1 0S0z+0S% 3KP ,K } 04 P,00S ;040 8K[P @00S d% 0X =B`Ԇ4d<cT c04c0\HcԅP -0L -$4kTc -LlMp`@ V,*U&/00U@0 PsP3U @R$P KKedP0: S K0 0 $KAP K d -Lp`7@&[[!>np mP2 pP X!2npL1 ApPE @`~ 0@S 0P/S @0P/S00 R:X  xPP 08`3S<  3SpN`[~ [~3S`@@<@TU EShhbESA3S||75S< 5S< `lVA3S83S83S8az C3SC@F93SC@F93SC@F9bF/A3SNw:3SNw:3S;c)HA3S;ESESdCmC3S;3S;3S;e_)7A3S;3S;4S* f_dESMS$}Y2MS$}Y2   ( 0 8 @ H Dg ]SfRSO(BL:UCPohOW z*8b?%bn;X3Q1bؗk2zwsZNbNl ˋ5&jmۃύ{c|J2KЧzcwg zHH S1 S@\U3J0M;VuƕnUv%fbKDis1rL;E:ֆB`'.ٚE WTn&fk<_cڦ2kP8Жbw)]dMܦ+Ŭz!Ζ lPKi~sA%6x#lq~.Z&=g{sJf&rNWJ,3U_K&* 9,g=o!f.Zr)mVKhM'I0 Fyh>T\ȃL |.rD..:O,MskJߪtM "} rXY]ҳ3"EΐAvDc"Jq&m/yQ~HL2W 0r~(Xm9}Ȣf=O8=7M`EgX . ..arch catdatechmodchgrp cp dd df edexprhostname ksh sh ln ls mtsha256sha512mkdireject mv pax tar rmsleepstty|sync ... ... .E.. . .. tmp dbF runemptyԧtzlist ... ...P,@P 3,P#P00 U030"S \APHy` 0:?P` @cT\p -`LV@pPq \V Vfb[RC[VS  0 ^S0 0]S0 $0[S0.P =P:P 0SE  0]S0\\S0nS  0S ]S00]S*@P"\R0[S  S nSP \SW0R0000P R @cd/ -`RLp00@P0@ s0@0S S ;S s0@0S S\ 4F0gPV@v @[蘶Ld -L`?0rS aS bS6tS {S1-000, XP & 0R0 S 0A 0Sp GP 0  @T0S04  ` V t`d p-L`@P @P 0S0  T X0 R 7P 4 0$ 0S5Lp xd$ 0-LM0 9SP0S*$S /S\S @PP 0@00 00 K,@@8dd -LBK@tCM @ P T L$ Lt TT1P@, L4S4nP?@/PLt ,0S , ,0 r p000,0 R#R ;R Pp0000Pt 00,0qPPL j,wP,  , ,0 r 000, 0,S0P0-0S,0  , ,0 r 80008,EP, , ,0 rP 000,00S ,0 M00,R @0 S0U,  P0 SK P 0 d $ ,00S,0  , ,0 r 000 0"0 00,00S,0  , ,0 r T 000L ,0P$ 0S0L0P0z L0pL4 ,00S,0  , ,0 r 000,0 ;R R  X,00S,0  , ,0 r 4 000,00\S <,00S,0  , ,0 r 000,00S, !0P`0K00 ) 0eS * e 0`S01:-`   \S0S S@000S0lQP 4K@P0w 00M,00S,0  , ,0 r ` 000,00S , M PU00B,(S#p;,@G嵌 0t1,00S,0  , ,0 r 000,  ,00S,0  , ,0 r 000,0S 0| , K w,00S,0  , ,0 r 000,<, K 0S$V `  0b0 S01@ 0S 0 P ~P 9 @Tj0 @, 2, 0,0 0\SSh% Y,3P, @ ,0@,0  P<$ R<H l 00  `84 @4 D4 8$ 0hS * h 0`S8 01:@@ @4 P<D$\SQ# RD `@T`FD + LP \  0 S0@B 0T0S@\T&T\00<Si@`Hd  S 00`0Sd`P0iH$0, P4 ` 0p40S 4 40 r 800040 gR 9R1R*Rj R;R_epR wRZVk`UpSVb44K ߈0@s@\X`@0S40 4 40 rT (000 R  A40 40 0RT0P0- TlT"@TT@@"!p _F$0T$40L40040 wS,0  , ,0 r 000, 0;S}0,0@,@ 0\SS ` @PiD PP`0 HP0s 0@T E 000 S 0 0Q645hddtddXe eTedeeeef ԅ ffv$f0fHfffffplf,g\ggggh(hPh|hh $PU,P  , ,0 r h000,0 ;R0,0 R P@ 0`S0 E @TP U0 0n1!00g1(K -"LM0S>̂r`P y @R"2 0  #PP@KE  0ld"0S 00CS00 Ӥ0EE r@ g900010S 00A,K1P0S00#3 [ PP h1@E0S E‰ 0H 0 , P4! 0qa00!0P 0 0S 0婄PP@D呉 0| 0S 00CS00 Ӥ0DD r@ Ygt,lԅ -@L 000@輠 0-PL @ 0P@000踠 -LM0S`p00S; :SiP 000S S,6"PP 0@\D 0l0 00T2 0DD"iP<< "$"0 00001,K坃@P# Q000 ,0S:y, , ,0  RO0#SL0nSt1 G0H00@$!0S 0#S0nS 1  0,0 ,0S ,0+;, a0 @\ \0 0 0^0^ d 0000H000 0 00,00C贠lԅx`h -鐁向吡L`Pp@)fP aP eP EPrP uP nP 41 @@p 1@'&1 fp0 00@pQ @0S@Pd0x@gP TC< t hT0iT D R000P RM 0S͟0SP) l0Q|M 0Sx͟%!%*ll000 R000 R$͟M 0Sl0 p3Pl  g l@0=0C>S񟗭|         T                        T d   D `   p   \ ( \     $  t [k0SK0000P 0 0 0l0 0 @l @ [Sl  l L00l@000S6 ˟0S= 10S? R  B Pd 002d 0` c : J0S 0 ʟ 0 0 l 4 0J`0s P n P KP4[S 0y䙟䉟PD9< 0U PVp )000 \P 0S JP" P 0S\ \tI@V 8P 0iS@0IP P`0VS80S$$I80S  IT80S`86#3 YPP~ @0S @„ q880S0S 8! }P 00] tPW70S0S7 0SH 7B0S? R  B Pd  00bh@ 0 ,7d\h& 70S0S 6 xhƟhf 0SXF 0 zP4 0 0 0l@0 0 @l @ PP6l 0p0 @T\@ X 50S  0S0xl 00 " \X0P< E0l0  @` `P\0 HX0T4   00 `Q{l D0p`Z&Up% \U 000C SS p0&S\SpPğ0@0S :K@ p0@` X$P0001 @D"0T 00tu& qr ßPd0@00S :K@ 0@` #T@0X `000PUl0@0S :K@ @#0@` `0PS@`@  ß0 X0 `A` "0XSX00X0 0S @X@0 SS S X0` X0X0 @`0 /Y00 \X 0P'`@TVYXX 0PK  @PK l 000S 1l @P- PU* 0s< 0 l0 $0P l0@%> 000p 00p@0S 00ll  \,eht@xiii@ 01p@Wk `PVk 0S0N K0S2 TPr 0S0PP 1S0S@T 10TyNtA ppq0_? P .U?0#K"0KR0(0Y0@ ;0-Q6  ݕK #Kؕ0@ RU t3AN=N0+0#0K"K!pK  0| , 0<t<MzdNܠvOOvw`Nvvv 0-PPL $0$@QoPP0`NO -LMPP 0-S- `pC#pp lP sP ?P`Kg`PhM`PCP#pppV OA0' #0@| 2  0 =`Px @T3 娺P @, 0T00S&R+PppT] 01P` KsP@ pKP=@T 0%S\TP`{tM`T; 01P `K0S OM@T' sPw !0LSLL 2Q0 d8MXKM`E; 8BM``%`T6M`O0 R @[$ R @MT M`GQ 9G6G02G0.G0S0D Dp$Gh!G040 xDyHyN\$zLyܠ`ylyyyyyMNyyyyyyzz -LM0P eRo v `F jp\ ?0@6S* ) ) ) ) ) ) ) ) ) ) ) ) ) ) ) ) ) ) + ) ) ) ) ) ) ) ) ) ) ) ) ) ) ) ) ) ) + ) ) ) ) ) ) ) ) + ) * ) * * ) * $K@P ( KEP( F``(K EP(F``0ht``4p RP 0-S R` nR eR ER RP 0-S `R`3 0 00 , 5P00U080 4 0 @T% 80  cR 8K~g\T000P fQn VaQn \0Qn \Q QPE\ \00@TPU 00PpU 00w24P0 @eSXj pT`T yP@`PVV40SHqV TpV? ;P Pp` `rQ  nQ bQ) cQ`tQ  vQkA 00C R 0B0S00C R10Pᰀ굀4Pp`P 0004=4,=0  1pP' p圲P 1p 000C1!pp0`~0zNDz@p@ xhp`0QU `Ep`0@ R V"T .SP4Ep}f@P `*E\0p63w44Epn@`NNPzN<OTz -L0M8dP0D($)hp LP PP ?P(KC#hp0S EAL H X PU 0S xDl3p0S\D@P X`UT @gT O3p"P  "0 @T0 D P 2 ; 80 4 n80 0x@0 < 坊0pK@`K,K0 < ,0@OP)00S "0 mZP<l<@OU ~DD0Sh !bp20w mD.t10S<<@0/S4ZBT0 MnL P  3D0S> !D7 A띍1P+ 0D0 P0 7PH厍0P DP P |.Dn<@H 㯋"DxDm@P<@XD`NNPzxzzzNzOzz$/ܠz|<z0fP p-PLU pCpd0 R O`ML@JLT (@(T CpMp`N{ -hAPL`!f`pp mP <1 8 C0C@ `P- {@p fp01 PR @@1ST TVp ! X c@V  XC@0 pR@D c@NN{{{ -`L0 R$ p@@ T P 0@P?0 s 3T R @0 0S  @ T 0 0O`N -LM@PKp@Dd0@0  6fp ?P pP :P8WC 0008OC@0S  ڄ`P@ PR1S0 01 0S00S 000@$KP|0||O -LMQp@  VL0ϠAl  0 Qq(Kt0V< 0 `< 0W 00B Ln 02qꭋh@T|d| -L^MPpLK`bKRKP p TT0@@@@ U/0S] XKaKlfKip PK`b0KPU`Q4P 0` , ,0 ß `40KP` R4P 0` ,  PK`b0KPU`Q@P <` 8 80 ` @0KP` R@P <` 8 PZPD XPK`bL0KPU`QXP T` P W^ BŸX K0@>C0XKPaK fK  0p@!0TRK0K \4 0 , 0@ =9L4 0 =C,0 4 O_K`0KP`Q@P <` 8 0P=)A@` -BP@P <` 8 W A4 K0@t@ K0@`LX K0@D4 K(0,@ K0k (K0P@=9B` =C4P 0` ,0 N0P@=9B` =C@P <` 80 _0P@=9` =WXP T` P0 e0P@=9` =@P <` 80 <0P@=9` =4P 0` ,0 pLM@@ ?dpp01@T `P0 [P`@T W,@TpAN|| p-LM 0S@P1  KgP/0S"  D 1`0P @g0P0fC10C0 0S0 ,0 R$0xmxxO`N,O(k 0-hALM`!Pc?PA 0AT00  KfP5 \51 R= 08S9 R 08S S\ 000 R\ 0 S Q0000 lp0*@0bPE\K0@h@ (0@NܠO|Q| 0-ALM P]c?P80AT KKfP%  0 0 rR P0S @[\dDP0@0d0 R R 00C8S@ 0  ?NܠMNO| -DLMKP`@0 0=00 0<00^L@D,00tP@T@B>FD>A0kN 0O}(}}}|Xj}}}<} p-AL!`a?P8 0Q@P `{P# PZ{P@ NzPp@B^ 0S > `l>T @pT>pP@U 0-S0S>@pNܠ0Q4}@} -`L @a?P@ hp4N0T 10 00PS<0< Z@ NܠO`N,OM -0L8MT0 0\0 0CPX0 XEP%rap2 rP ?P pP,K<PT ,Q>(KsP uP@PT  , KN=PT , 9>D0$X0 ?ap01 `Rl40&Tx=`$Tn?@PP 00T.P  v=X0STp 0 40 0 40P0<0 8 `0IVP0 8`u UD 0S C0 P0U u0  $0S1xP 0;0 0S ClP0\0 hX0S L0 cRLK^pPp<0  cR<K^`Z4 UJ uPu U0S8V  Vx 00S 0V0 R`FV00厃0`D2 R98 Pg0\0\U00Su U 0!0  80S 0SPr1$ RPkTx~P LP1L PE][  0圇qgP0E=igX0S@x@3u00#T uP0  D0 @ D0p0H L0 p` 000HG5H@T<NP}@xP4  <xGoNܠ\MOԅ p-0LM` P@_?P 0AT K0V4\0\  00 0l x4W<xO<ONܠX}| R4 5:0QB -0L` Q\p 0PS @0S 0SP00@S4kk - LR@:Q0AS Q 80p3P000 tl -LM0P@ @ P&0 pP#0:0S0: pP]  `PG00< !@@p@3{0@ `P4!@ \P `P  P. @ 0@@ @ P @ 0@L @|4 @u @n|~$~P~d~<~ p-L@PY0`PP p P P` `V`p p-LP@0`PP p P P``V`p 0-L@0P 0 P 0u30 ~ p-LlM`PH@PT0 RKpKsAP@ : S I@@8N -LM`PP@p1 0A#Sl^ @^ ] ] ] ] `] 4] ] \ \ \[ \ X\ 4[ _ _ _ `_ (_ ^ ^ ^ (` ` H` <\ \ \ \ \ \ \ [ h[ |^ KbP0#50#0# KK$APKAP|d 0Rh 0RKAPK AP 0R 0R $K 0S2P"000YPKP|@VTKP0: SKP0: SKP0: SK@T\J`@pK T; 4P` @TJ4PP*T 04PP<<00C<0 4P`<  @D1`P 8$K@pK 00 RsP @ 0, p3p3@pK 0 0  ,@0 U T a a t}~~`N~ 0-LM@P$KmC $Kp  ?S<8K0 Kpq8=~ -@LM`P@Q $K 0/P $P 0 08 K0C4pK%C4@ 0P ,@ (P ,aP%@T @%j (7 7~0O~, -LL0PS8H 0 S S0 0   0#  A0A0 S00p`B"Zp?@C "Pg f f f f f f f f Hh f f f f f f f f f f @h f f f f f f f f f f f f f g 0SV0SR 0RQQ  OP A!zZpp?@0!R a7``oXhA\!bZp . ?0B"Sg g g g g g g g g \h g g g g g g g g g g \h g g g g g g g g g g g g g \h 6W |Q @x7QQ@T  8P$(lN@htl0 L0@-@^ 0#S^ 08 S00S0 0#S 00 R00^P P0 SPR R^ J0Q S0 B00Q B\0AZ# 00000 -L@`>|T- p@PP 0`pc@W P`qP kP@W  -LM@R00?P`p@ 0pUWlŸ (0K P{ T0\\S@DLT\"0'P "P `P =P :P @DL^m0 g'Qe "Qc `Qa =Q_ :Q] PP^0 'Q "Q `Q =Q :Q \QP^TJ q7 1  01 0D@q* 0' \ZU-0/S '0/S PPpp0PdpU@{ Wl{y0Sp(  0 0 008客PpPq 0Ow , Q-L@' T# AT *0Q/S 0/S@T:0/S d 0R /S @T:0/S Qd p-`PLP@VP 0R  0RQ^p^p -PPL`@p 8p@@P ThO -@QL.0  V]00X p`@[T*T ?T $T P(U /TpU @\T0 SP` U~X 0* 0 P WO4 -RLxMJaApPD0pp0G P P4`$KP10Kt!( , 0 0(0Q*PP, 0` 00 @P/ ``QUV ;V& @`, @`DA xA@(@ , 0 K?P0 R7`T (0`0@ON8N  0-@ 0PL]P 0c0 -LM0K` m mPp   ZP P0xU*oZP omPp  (K @`DA AP@PO -L,MP L T @ᚸL 0 40 0 H 40T0<0 8 p P:P8@w  YD  0< 0 bR<KU@Y R   P /00D00D0 H<0  cR<KT@PH 峷T 80 T0b CAT00jC1T@0 $1`p@pW` 0,0 , K~P LPQD p@( ᇸ@`WT 1 00 R P80$(K,0S 0O -RLM<0 ; @,P`4`KH#-8#000 40 , ##0@T T@T"0 !>y|2P 0 0p400gCz @W `2  @Y8 @ ` P X`P @ 00kV 0P KP XP @  81+8 80 1 RW 1 !0 04 4,0Q8*00040 ` 40 <  (K !VIZ0 P`` VP @PA0L<x D0X0@` DA A@,@ 0 4  407 8+ONMN\MTܠt p -/L`ngHPDp`@P祟P@ T iY0mr -!LHMp0W,0 H PM dpK PLAXK@0[?[ 0H0[XL0D[1EP[C`[@b0X KX L 70K`:K9K8@K;0S0S 0S0 S0S0S  P H, 0R (K40$ ; ' b@0kLtUD(m -@TLPL x0S C x  Tp0@ p0TP`[]@L(x R p0 Bx p0`L]L -`RL@YPPT^ Tp ppTPW o U 00 S/R  0R B/S PUjW10@  `1`0V0 T@j DA  f1A` 0V@0T00  oP@j DA  AA O[ M 0-LMPK R@PP0SH0 R lm R@PT[8N -L M0S 0 0@Q@ K0 KvP1[S S|ࠁ ࠓl 0@d{P[,y1[S < 0W{P [yL O\NDht@,e 0-L@P}\ 0S0S @p00S@ ᷈@`Nd0 -@L! @@@ @@44okP, 303 0 h Li T0QL P@p 00 ᘶ 0-0LSP @P0PS0 0 )<0404 00, (0 L))\)T)X)`)-l 0S ^S 0000S$ >R@0̗?R!00E!0 0 T))0̠ -tLQhd0d @pT *T0`VPUzTP@00)`)\)X)t) - 0pL`P@0 ^000@S@0C@0000`ጴP  r 0  @蘶D 0p-Lp0s TT 0RHHr P@4bUᱲ0c00D0c "S00!000o!0PL 1pW)a0 S@10`PcU]0 0CSX@0 0CS@ TT 0R( 0R <qt Q!0@TtP0S:00 0R>*@DVt Q00 QP>d\@P d0 R} X0 >w/@d)\)L)p)l)t))X)`)T)N** -\0LT0L0L0@DP 0540 ,0 7ht)T)L)h)\)l)) P P p-P0P`0 0LR@ 0 R R00CRphp!0DS L ĉ L ĉ ĉ L 00C0000p)l)d) p-08`PLP @0U@Pph) -L - L p0   X) -LM`@p0Pd K"d@P `00`H0H T wL)X)P)T)\),0 (0$ 0c0ALNO)) P-L@ p D 00 hK^IT?@hv꘶@ -$0L x vL -Xp@LP P <`0T: 0S0UPh)`) 0-LPP @@ T0 0-0 L\+ 0P @ @T!:\$Q \ q 0_Qq 0_Q $Q\@T*@00T)X)x) 0-0L@Q 00P:|0@0hlP P: U T00B0R T*0B0R T:\)t)T) -1!L@P\j q``VE:\ 0$R \ r 0_RLUD r 0 R0@!0 ӑ  T q 00 _Q $QUU q 00  Q 00ӑ\`V* `yq 00  Q` 00r 0 R0, 0 &T)X)x)HDCL}U{ -4LP $0 A )T) -0@LQ 0 Q 0 R 0`S Q0S0S0S0 SS CCQ0y0Sv0S  CL)T)X)`N -0LL) -0LX) -H0H 0L S 40R T)X)x) -H0H 0L Q 40R `T)L)x) 0-0 L P- 0P  @^!: P$Q @ P@ Pq 0_QPq 0_Q $Q@ P@^*0H@T)L)x) -L -L.0 gT) -LD0<0< 800 00@@KL))\)X)T)`) -L> -0L `R0 PhP0@z|0 p d@`0@嘰TPT0T @@@Th XNOL))P)\)X))T) -T0L R D0404 00 0@|)XNx)NO - 0 0Lx)) -0 LA)x) -0LO -0L|XN< P00( 0S P0CB̠)0@ Q-L@!00@0@ QP =D0 @<0 40V 000x)|)) -LMpP` ȀȠ04 <0 8 0 00 , @@@@ݯ4 0 b00Z<08 040 00 ,0 0DȯJY Y (K\)L)P)X)T)u p-0L@`0 ^P :ϠQAQ 00S 0U^@*ppT)x)L)X) -|p|0LP R`*\@  `ܯ د0 0 0 X)P)T) -L@`P嬀`@P0 ㌠ 0 |pS030#0j0V 00@0Ttw0S:00T)h))`)d) 0-1L @Ts 1 RD0S S S "S 'S0S  B0S0S"S 'S 0S S S S S "S 'S0S B0S PU "U 'U PU U U00zP0ۮ D0T'* P P "P 'P 0CT: P P0_0 P P "P 'P 0CT:"P 'PO|)x) -l0l 0LS`\00000C0P 80 40 -$)))T))\ 0-PLM T@00Cs0 0K0KPK 00Cs088x) p-d0LX RT@T`0PP8f8 1?1c"10c QpT)H)))gfff -tpPlp@LX`d@D0 <0 40,0p pX)L)T)`))\)) -`PLP LPD < P0P0f 50%QA!V0Pfp p@@Tp e` PSP0 0 B cRW@@T P 1U@@+T00T0 0@Pt0S:\)T)X)d)l)p)) p-0L MP 0 K$KK a0a(@K @`PKp0 !$0 `xV P0AP፭H aPU$PX)T)L)$  p-P`L@T @00TPc@PdH@p)T) p-0 LQ 0Q` 0 pl`tP0P A`0@d0S00CP 0p) H ))p)T) -0 0Q tt0 `L X0R 0`@RJ@d|)L)X)x)T) -LB -L -H0H 0LQ 40Q,X)T)x)000 0Q 0 R X)L)|) -T0T 0L Q @@0R `9T)L)x) -1L Mxx 0,K n0nP(K4@K0K @`P3 U (4 ) ($K,00 (pcVW00S@ X (0  0R/S 0!U00SQ((4 0,-(0 vX)T)L)$ -L -L -L -Lx -Lp -Lh -L` 0-0L^S@P Pe0@ ᮔP0 -0QLp @aT`*@DT:PPX`0@Ϋ@0@^SDN(0P  )XNL)O - MLMKK I0 , -1KZ<p`P@1p@0T-9K.yK@ ^KPEPE@T9  P0V 3 p1R5 h1R; `1RK-0KS20Zp0'81 @nP 0i-![ ^R@Z /`P, 0R*(KV Z ^Y *00hY ND bZW0kĠ L)0,@0 0 0  0@ *0@0  C0@ f0@ g0@0 <0 \ ?0L@ ?08@ 0$@0 0 0  .0@| _0@v0 q 0@k0 f0 |a 0l@[0 XV0 HQ A04@K U0 @E u0@?0 :0 50 0 y0A@) [0B@! [0C@ [0@D [0@  O0@ O0@ O0@D O0,H`@ [0`FP@ [0,P@ O0`@ O0P@ 00@@ 10(@ 20@ 30@ 40@ 50@ 60@ 70@ 80@ 90hPE `F5p@ [0@ [0@ [0@{D [0H@s(K厐P )H))``NĠt  ̖ H  Ȧ ̣ <  p Р @  ĕ $ ( h P T  ؘ $ T t \  H <  -0L @ 0S (<5##,h/#0 h'#Ā̀ - @R0 000  0L Pt hĠH) -MLMŸ帢@^(@ `Pp: S B_ @T Q 0d @"T( 0R$KP" }낎KHH0" V^ 0S2@T@S ܏PP0"1@T r@TUpAp t1@T @S ṏP0}< 09P9U @8 P ᣏP0@T @S ᗏP0[21C 0@T @T PP"|TP L`"t@HS<p"m)0kdm<\ĠԀ Tm -3#ML M3#3#3 `3 S3#帓K@A A@`, 1P48#`0e0||#Pp@@0c00 F cDCD3  h10S$C\ 3" #0l0cCP00쒟002 `-(K CP40( Ks`(0K A2B"| R# @Z@Vm PF Pb PQT0, $2@ $0 -8KR000```P01@T p@T PVʂKAA LPVpW@Z@W00S 0`!Q P0 0c, 0R'(KW! R 0S  ]F=gN0b0 0C07P0J3RP)\)T)`)L)0kX)O)N))l)*p)d)*t)h))NXNx)))|))Ġ )\m -PLp&`P- @eT:  PR 0gXR@ @ 0gR00@  LP Z 0gX(00W  ٍ -LM` 1 pPM]V 0U/00ń/\@0@0cS AP@P/\ /ōPP 0 0hCPN 00`3T %P _ 8'PP 8 0.S0S .Si 0.SmFP $0 0cS ںA@ q 0H0Y 1!0@&PP $ f00 lRA@ d*1 `Y 10I(K@0S `0Vሁ5L* ` kH1`0S KM+PT U0U/S0: S SK&P1: S  0 SU0U/S 0: S SR 1: S/0 0 ႤP 1H@` DA A!`@`K&P`O -0LM<p00 , BP@0U @PP0 8K(K8 4@ P(@ 4,U `jcFa@f$KO -L`pP@PP0U*- kPX0@` DA xAP@Pd 0A0b CahCOp -L$MpD H0 0{S nPMP0UO*DH `0P(KPQ  z0C RS R {R0 }R0C ,RS  RS0S0Z0SP Z  Q8P ,  P U Q0P{S0P O }S ,,SQ 0 PD+(Koe1@` DA AP@P,Q, D0H0  @cj804 PBPc4 0`` D@@ آ0 8<0 Ң 4 <΢@00< 40 @pZ0 P8P ,00,0 O -tt`0@Lpw.@@PP0 P 0pQ0msONN -LMPHK @  /0/S000  0S0 S 0@00 0  00 , O00 (0`K ``@   80 4 L 80  cR8K?P0 D L  `  Z   0S PD0Q D0 D =ZHP  _ Q    00 ZPY 0 0 "" "Z  R Y ZV Y 0 -0  00C0 40S  00 Z !  0儠 0C0 p Z p l T D D@T QA  Q0 R00S 0S0 `,0 R `Q !0J]S񟗀 p \ @ p p P R0 B 0Z Ze  RnL  000 00 0 R 00   00 䨐 0 00  R0 S0    R0(  0  x0 t x00| 0 R  pz0P/S@s0P/S W :S 0 cR ڀK> @ 0S 0SS|p0S" +S2 -S  U V0P PL8U |tQU 0S 80 cR8K=0S00 00 STd X@ , <`` X> S`S0@P {Z @K 00 Ep N)p |0〠 p A00 p 0 p 0 A   00#0CS< < $  0@Te  #T  Q00  0 9 00  000 RQI@T*T000 #0CS #450S:00 R 0@T@@@  0 @PD0   0@ U5Q00ST 0-S=S ?S@ 0S 4P 0S0   S0S 0 400c0 P 0P0 0#0C S |  | | | | | | | | | | | | | | | | | | | | | | | | l p ' `p  !0P  $00(   0S @80 cR 8K<0Tp00S) 0  `p  0 $0( 0 0S @80 cR8Kv<0Tp00S)00 `p  p p Yp 004, ` `@TQ 0P0U*៟  PZK 1 ( 000 ``, 000  80 4 Yc  /0S  Q   0SzczJQr0 t 3 0@  0  0 a P0UM*` ZP(KpN@,OԅNtx`N@0OzTN$/hvzܠ $(\O 400c0 0+40S /pP 0P0Um*p0 P I@ 0@` DA SAP@P !P11 @`DA ?AP@P<@|  0S00 0R+00 %` 0` 40ᾞ!0@P ac R0 00    00@"00@040jcpP0%S! ڣS S `V0S   0S` p  } ?P;PEW0 P40@XC \  0<0 ` X#Sk)pp@`R3 J`P( 0S K& J`@|P  4| 2f=  0D`     |` ` 4 0 | dPK@K0 f b0S @80 cR8K:00 R `0`PV 0S|[AP 0@S*S0]S @V*Vo@ 0Q  0S00S T  .:&00 Z?  P  0  SD V` A\P?0 00 c[P 0@S*S v  =R e ^POb@ 0 :S 0  00S     0 R  #70SS P@V @` @0'Z`0 R 0@T 0S 00SGg 00PI`PP Xp3X@ 00s03S+P@ 0 ^Pa@ 0]S  #0BS 8@pE\r^PP@ `aPU 0 T @g DA :A`p@#SRW@N`UK:0` 0>P p`@0` 0>P`EW20` (  N2p/@ PP`F  U  Q22p 0@P 2U @ -;X  t2000Y @ @ 0"00P00 Z4^ 2P 0 P 1 P  0@D&10; 0 8 Z P5 0S0 l .NP@@ 0  Z PU00SP NPP 0 q"P 0 00 00010  -PP 0@poZ]h0P@@  0_ 8XN0P0y`NN\M*TNOTܠNN -LP`000iM  @0`|;X nR0 00P;000 #QXPMv30괄 -x0tp00lL @`0PPD0D05 @$>0000NLNNN 0-@LP M ,dM@P 0h  NԄ0PR000AS ܠ 0-PLM0( 0 , i AF/$ 0 0 R<   0S41  b/@PA, R  (>. CpB K041,Q/#( 0 0% P H0 0. >$0 P0R@@i)F0  0S UC h0  .A`8$0@FF 00ONN]D, -0LM  00  P,0 0P, K  0 .\? R>0 R@ 00 0;0  0S O@P 0 @ W0 R^ 0 RY `(X >$Q \KP00>X #,QT X 0HS񟗥 p 0-S 08 KpP<0S! WN= P @0SP  YQ  :P3X W 0S 08C80CS48   \ \    l , | | , 8  X \ ( < R  ,pWw 000 00 S<  0S0 00|,0-000S 0  P 0S!N< R0(Kxpy; R 0@H  (X[M @+\0KS C\K003Wr\+BmPh 0Se 8;Ra0 [0 R  0H0 R 0 RKzP0: S`0Sz M0 Rt: @@d:  A4 0 29# R& 40 R" W [P .@40 R @440 0\9 0@40 @Rt ;40 R| 40i x0 O0 0 R  C0  * (\0K GS@i)D 0X MXH (8XX@@SD 00  0 0 0 0 p30 0<P0 000\0  7X 'P0 L 7'\KH0 D 0 0 0 0 0S00Q0#S0<\0 000 0 080K 0Sx 0 64 006@P t6 ("( [0DSXT0 r00@ 0Sg 0 Rc0 4 40 R 40 qP  y6Pg40040 4 0S0 0SB0 R> 0 dP-0  [0 .,5 5@P 5 ("( 0DST0 00 0T00 0 @ 0 @ 0 R@@K <0@0  @I000 00 0S C0 A0 0  @{00 0 4 00 0 @Y4 !K++04 0Sx|@4`UYYPP 0S0SLS 0 0P0 @B0  8 Kp2 @P@"0S 0SH,R{0 @% 0 @ @`K1@PVTBP<0P0PT ?8K 㹎1 00 07 0 0g+4KR\0K ,!^Q 806*R+P+0 00 60 0  -0  @I@0 0< 0< 0 0 P0 0=PPH|PJNO`N MD$H M8 ,OMPx`]Dd X  < ąTЅ4N 0S. 00 0  0p0C 0 0S q q  p,{!p 0Jp 00s03 0 e0p$S {  00p, 4   q@4 gb40(([@ `NN(Ol ؎x\*OL<DNȈ 0      U4T P@T ,40#00 W  @ 00CS0<0V 0P T 0@   T  z(KU<0@  z0$0!4NLh*,$rԅ 0-0LQ2 0 @P ^ T\ Q  P 0S R pp0R`  0  H0H0 P 0S 0h* O`N\N@4<DL -LM`00Ȃ000pSp Q  Q2 R  5P 0@`00@ 00|70@00 00/ 00 R 2 R 0S QZ 1Q;P̑b 0SX 1P 0S3 ! 0S0;00< S 0S, h,0\ 0P@ 0S 0S $!%/% 0S 0S U 0S0  <PP 20 I7x0P0p;00D 00<P@- 00`NNN*D*tULM0@  ry(K ly@[@ 0S9PKW`A00 R ܑVQ=PY  Fy, 1@0 t- p"P0 -  (y0@ pPP,0  @  y,0!@"$k괐D 0S0n  x 0S T0P@, 0L4NܠL*p*D*$rԅtUԋ -LM$`K@p( xPTP  KP0 0S$ @ xT0d0K0P 0 P 0S 0S x@ x@ x R@ $0!o@4N O$h*$rԅ 0-LMPK mxx0P h  bx}@8008, @ Px84Nl*0H` p-8@LTP` `@T P k@P`Tp -LM$pK` P%x K@P'  R 0S P @ xKP+ \@UUӿ  w 0! @4Nԅ$r0800 R <0S0 * O -LM@K 8w40 R 000 w4Nl* -LM0  Pi@(K,K ,w(%`V00 0 0000S D0S $p0``0$00U:PP@s0#SuTs 4@ Rn۾PP@@T zd$0S Q  #44 R  4JZ0$(33 -T<Z @  Fw#pW00| 3P \5 0S0 R  + 0@ 0$@,00@D34(  , 0"0002@8`p`{   w,A. @嬨`T2   | @ 0p00% o(" 0S DD H&8@T $(A&@T  *#!@}1 ,ttp}!#@l :#Z E vX!0S = @!0S 1d`1@!@ 1@ @@:B3 0I$HR 0S 2 2_@P  M @` PD@D 1T4N*l*d*)N`N*D*h* OHMTN 0R, SK 0 , b  nR,,PL 0 R [Pq 2  0 <@@$00$0"<0Q0$ $ $Pa $00$0000<0@ 0  $0S `1 R, *,P`0S7 W@5 * RH  00S< 00S60 S6$00p p0S Y)0t |0,n<0   f@N`NXM N MܠON0ON p-1L R 0 0P0@0 p`0SP 0  0P0@0phyx@\T0 0R0 P 0 0R@0a P 00p*N* - 1LM  0(,0 ( ,00P40 0 p@`T`\T00S 0 R00 @``40 cRP4KP[T@p ]TpGW00S T000( `w3$KON* -LM0/K,0  " ?@ 0@ 2 ! >K*.KH! 0  B 凞101 ? @  p@`00`" <` `X/ P\PH @ϟ0S00B P P #PL f? $0 0$0.0S, 奟Kb  P\P Ο0S00 X V V00.01 cRKp V А < @ T  H Ȓ 0S0C0  P\P ͟0S00 )P \X[ `X $X  00p8= R X-!X  $01 P\P (͟0S0@0 @ TT T !Tc 00D-T S}t  l 00  " PK@K T T% T# @-0KU t  P\P \̟0S0@0 n@TPKhPU+1PUO 0 !RK 0(n0˟00; 0 0< 6}Xm |X (Xw @X*X ?X+X !X 'X \X= "Xm000 Y 0 p`0)X |Xt (X 0 0 0 Y p 00"X \XP* P\P ʟ0S00 $X> "X; X9  \00 p2\X 'X "X, 0 `0 p(X000 )X p}X1 IY 0`0p"X1 IY{ `00 p'X00p1 IYe ` V 8 00 p B `X0u \X  P\P ȟ0S00$P "P? P \00py)X (X000 'XI 50 V0S0T0 0  Y * 0 p`0Y0SȖ ` 'Xx @T~1 IY, `@ pB"Xr \X@00@0C0(X@@@ O"X 'Xd  000@X' P\P @ǟ0S00(P 000 Y] 0p`0(P Zt x00 }N[X`  .P [00 p` P\P HƟ0S00P00pP00p0 Y 0 0 0C%00 pS  `0S CCR 0S BR 0S0C`0L% P\P 4ş0S0P0 P(U| {U 000@ X0 0 1@ cRK @P P\P ğ0S0P0 yP00  0 X  pV $ P\P ğ0S0@0 Y@$T "T  1 cRK pT3 0\  p@) 0@0p 001 IY ` p00 p1 cRK p P$<XPP>X V`  Af V` 00 !`T0FXbSB(@T0"0PQA  `nT0S   x#@  #@Pz 0w 0S  0To   0Tj < 0S (  @lh0 <0$1 ⵚO 00 p0W S WV奚(X* ;X |X>0 P\PK 0S00EX^ |X&PF+ )000 p`0j\TA `T?  $ ;0kXNMMM0k0ONO`NN *MNPrON*X, 0R(K0 Y  0` 0  p`000CS0^0 P\P 0S00)P1 IYm `00 p P\P? 0S009(P:0 Y 0 1 0c0` p  1 cRK p X00p0P@0  $PJ p(P 0 Y 0@  ` p 0 0 0 Y  K0P0Pp @T\T 0S00 @Wd p @ #Tp9 D3 0p2p/ p+W)00Xp P\Pa t0S00[:P\ %P#Pn VVS0 Y 0`0X$0 1 cRK P@P`$0[TKP @0S @1 cRPK P00 R$54 P\P 0S00 ":P@00 P\P 40S00p%P#PK0 Y/ 0`0\P `Pf\X6 `X4 X2 )X@@D@ \X@00  &00C0@@00{ X &X|<<0008& P\P P0S00 P P00C00S0&0 0`00C06 P\Pe 0S00_X >P00S00 &P Z00 0|P0@00 000 0 傘7E`KPs 00p0S @1 cRKp00  0pSP(YA0S p:K@00E  KKf  K  K`$0 0 sp  K  K.!p0 Yc 0`0Y` Q@ dfl00( 0C p( B`0 ! 0S    0B)000: < 1 ! 10 1  `0P pa P\P 40S0@0 @T W T p0T 1 cRKL`@`P P\P0S TT @ UC 1 cRK+@P@8  P\P P0S0P0 P U 1` cRK @`P; R P\P+ 0S00%(P( D  K0pPC  K  K~  KM  KH;9  K?P  K7;XȀ |Xㆀ =&XK00  K#AH   PP1 " h=R }R(d= |0(00 00 < ^0`!8000C02 S " :2,,tx  KP  KWh.>X00`0  KF  K>X00) 00 P\P 0S00 -P0 00U000,0* -LlM℁P`U @Th P~H{080 `PG K:RpP000T\S/Wj j%R@PPD0 R ㊖00@`P PP0: S 0@ 0@0W0P `?R@P 00d0K 0@0W0P$K*TN`N 0-LlMP@PPpd 0T  KP 0@ 0@K00: ST0K 0@*TN p-LlM  | P@@PPR@ X1PUC P K`P0: S 0@ 0@PUKp@ <0 XK  0XKS `0S& * @,0SBa)XK0S0SD+P 00Pd0S***Ȏ<* 0-@PL 4P@T  0R|@T0 O -$0L@T @TO p-t`LPU R @0@8C8Sڱ @TO0 0PU 00pO -(@L0 01h\O -laLPp0S  0R:0 R @@ T 0Q A@+ T 0S 0S Ws 00h `V0 R 0 xP0@CTT WR}HP'@0 P42 ዑO M`NM\N0Q -P`LpGP@pP⿔ P00 Q @O P-@L 0 RP0S 02n T000e+PPh0 R \0 RH 000 <ܡ -pPLDM䀟00PQ0S$ @ $ 0R) K^`^T@P0e@@Td`K ѸGp3 0 0Š` 0kOr 0-LM@P K+ 0S  P00Q0Sp008 0-LP@P0| p-`PPLP F^@ᆊ PFp 0-L,MxP0>Kp0 @Q X0 R%\<000 0RK0m 0kr`NOr p-LMH@P4 `0T0 @ Kp`N@Б -aLMpP0Pp' PPR 0000p U0HS0 0Q$pP PSQ U00R0S00QR R. @K$ ,0 _`N O\N8N -LMT0Sp! j W4|1  DK+x t DK|!p@ 40AT00#`9 oT" ?T WsT0x1  @$PP%U 0T0  s%U (K<@T  PS0S 10   VV<00t1 VGpdS@0PS PQ@%T<4( E+]C* PE#]䂟Jψ0S 00 Q0W002|1 t0-S /i P 0-S`RLŸ | bd@aPpA `AT \1(K! 0 DAHQp1`Pp P%Up!>KD40D !R 0-S+S00S 0SQ h!0S#0D0 \ t1S P D0! R  t1S 0S w0S  7x\ D 1  Q 01 0Sl t1SD D  ! tD1S1 0D S D<**r`NhؑLp vp  0-@QLP╈0 00h0@-@Q$ /Q``V/Q P Q7 .Q \ /000S/S 0S/S/Q00/^^ 0 .^0p/SS0&\00S \/00 0 P0 \.00\ L U*0/S -`QLM`< /QpPy .Q8 | < X 80S40 00 ,0 , 0S:S00S,0   0S:S00S Q00,0 P00<R04 0 ,  0/S4  0  000 4 ,0 Y 0SR0,0  0c0@[ P0 bR,@ Z80S<0(K40@ cR4P@4 Z4 0 S/R/000@80 00< .S0S/S000#80 Xy8 4 0 , M[0@ cRP@ Z 0 S/R/00Pܠ -MLM0 c1\, @ TPA @/T@/T T9 /CP `eP V9 V:  @/00 0 0  cR@B^K pPEUZPEp P@'( K0tC,$[/R0  0a P PZ, 0 R(K.T.T0.S Y0y/SC0SZ`0ks -LM@Z0     00 K 0  fP 0Q/0000 `KO -`PL@$ ZP0Up YT t0T l0h耆LpP PĆ YT0@P@NNܠOTN 0- L @ 0  0 0S[ :Q0 a/ 00 0 P0  00h t $0 0ꔓ -`L p 0SL;z ( S , 0P@aT#T ةPP@`w0S[` k`n 0Q$ 0% ` 009 0~`j`0i `0` #Z000 0= S,  @0  d0d`0 0 `$00ꨓ -P L`pM WP@T 0P Wd@ X0 0 dX`0 WXDp X0Q@ W@`Td#T! )P`@`0S#0 ;0 00$ \WL ~X X 0 0h0 0꼓Г 0-@PLP Y 0h0 p-LM @`, v  0`KS' PK+ ҨP Pq0S  ;0h0`$0x R 0 B `0xT$H M$0`0p`   -LQ@M0\ ,0 H H X  P %P`  R 0 B 0HH P0 H00H0 @, 0HR(K0pT0 P0 L0 W 0GLSLx ` (  p 0 ~ @0G0 P 00D@SP 000L0 X EpUpUX `T P plWpL0L@0  `L0 L {L p `L uL0 ` LppL lL p,0 `L P0 dLp `L ^L0p0 `L0 X\ L \0 X   pX `\ P JL p `L DL p `L >X0Sp `\ T0 6 pL\ X  b `L T ) A0G0S 0LP pc0G\L S  ` ` ` ` ` ` ` ` ` ` ` p ` ` ` L p L L0;@L0 \\ `d0GS  t 4 V0X0 Pu`X ,Kh  0d d0l 0d  P`duWt XQ -00lh lL  XL T L T XPL0TPh p L Pe= S L0 p0pUX@0C0 0 @0T 0S @d TdHH US@0 B @Tp0  R @TH  H >L 3#,Kh %2> &BP0`lLT ^x0X00L L00B0Bh0l,Kh 1>A P0 0` lL: 0R 000lhlx,KuL  0\0\  P`P`\ \ &L\ 0 L \ CKC0KL!40#0X0S^ \CKCpK\0\0 02\ d Vdh lA-P+PR PP 0P 0pT0Sf 0C0 00 HHXH 0xS0SW 0C0 00 H  H0pH 0L05 +00lhl @`` 0 B p0` @0T  R d &` @0TdH00ePH0 0S 0C0 00 H00H0pH0 L E 00lhl d d d d d d0k0Osx( --LM0 0 4 K 0-@LP" 50u    P  &P0 : @0 P@ 00 00 0S P0 X0PS 0@0 0p  4 - L @ 0S# & -*  P 0S0 0S0:0x  $00Np 0+ 0 00$ 0L - L@ R 0 B 0,p R` -P L@3 T6 pD `Q!   P 00a0S@@ }TpW   0Xd0P0 `\p Q V`KT`x -P Lp! X `$R9p R V@@ :T 0`d d0Vp0 V f4X ` 0;茔 0-0L@P 0P  0000   ,嵀00 0- 0LS@P >P  0P 0P 0 0- 0LS@P'P PP0  0,倀0,{0 -L^\`pP@%T㼀& 0W, pE <  p0$ (P PPPB0BSU@P?ppE{k(}0lo@O --L4MD@K0B 0 0 SVK -p-`P00PQ0 L4MS P 0LL@K0 0 0 2P4Kp̔ -pl`LP@)# T P (0V0W< `0``0$     ʓd T 㼓P PPp P PPpPp  -l`LPp@% T9 V`+0 0,0$ (` p ` P   vPPP P PPH[P 0\00@0O, -@`L#0p00 0,0< (0P @P T00ӧ2 0 o3Q00 !ᄠX@,"O@- 004+N0  4+ -<0@L 4  @     O p-LP`@@P`p p-@L0`S 0 P p00P@0T * 00p00@[X0T0@` DA A000 0@@P<+@+NܠO -RL0pS@3Q0@A00T2 P- T<2P``V 0T0 XQ P@0T*00T+ T4 T- T: 0DSLQB`1 P1 R|1@` DA ~A000 0@@P41P``(P``Q 1:`p`3)P``0  0:`p`3TEP0  0BS Q` L M`P H040R@0@ `w<+@+MONttttt -PPLML H00@!@1  Q@ - EQ5 Q 1P AQ 0 S P0AS0KK0K@K0  /P 0  QP 0x  X\ 0KT  0p @|= @0@40 8 < |ԭ@0l S` 0P0=URʨMUq0KU t tt 0KlpP `p1@U@PBPUt  t 00K00Sb h7 7P_ {P0Cd0 N0 Sh \ i d0P 7@Tz`0pSr 6 (P0@@P0 &00P 6 |P  U:t@f DA @z&A0P@0`P||P T1@@ f %z)]%0S d0S  O\Q\ hp p0\p Sx5 J ED5@f DA yA`P 5 %h t0K 5t P<@40PT*$! <@ <@40T*4lp  `<@ S P0 ylpP`t E@P $y  0 0 4 3  PwU*00Pp3@f DA yAP`@@3  &0U0;0g0S7<80 0c0S783 RC0S!3 P<- `X :2@g DA LyA@p`@ 00Uap0PZ5P|t, <80 0c0SX2 R40\?*(00< f d P;PppT;p f yd OU8h1@` DA xA @4@ @8 < ,8(1@` DA xA @4@ @8 < 80 @` DA xA @4@ 8 < 0@f DA xA`P)P806`t w0U4P} 4Px |4PLrO<+@+ D T  N  NMt`N^ L`ȕ̕(y0yЏ -LP@Q 0  *=Q&0  "=Q QD1@P U0`0$ 岀00$Pp  000n{ 0 @+x0@$x P0P0 :00 0p0 p@ x 0p P0ONO<+ 0-0L0@  PP0S p0P0S 0 P 005,00MN4+N<+0+@+ 0-L| Gt0@T P@T 0S  ,0 00 0 0@T0NTNs R 20 R00 00 0BS 0 0P0 00BS 0 0-0@Lmw0 S@P0SL 0 0 R0S0eCA 000O + }3 -L\ P0L `01P@U 1pT@P4U 0S \3P0 -p@L wTP 01 R1 0d?A1cX0@ P. Z$` $ ` V AT 0 K 0B0S 1 P00S@0`0C V0mvvgfff -LMZ, 0 , 0 0J @01P`U ,  1pV`P6U 0S,2P(K0Szʊ xw,NJ@v000 @0 0P, I00C0PXR    T8 0S 0  0R 00QPUT0S R 0S 0  R 0P 0QPU 0- L @P 0Q0   Q Q 0 00  0< 2 0Q0    0000h p-L M@`!PPP4  "   0 R)00 `0`S 0` $K$` 0 0 rKpT$ K}r$ 0R    `NL7 D+P R -P@L1  !R 110Q 0-D@LB^T @ 0 ! T @00Q1 0) 1x0QD9 -0L 01!"Q0  !Q0 $4($B0TPt`q40000嘠@0P`0  B@phTPt`q4=  L9  @5<  o00QtD+L7 P+pQQSPQ 0-P LP@u0T̃ 0 0R0q03 00S  H0 R00 0h00Q00 0000TNL7 `N 0-t0p@l l0LB^T @ 0 0S 0S T @0N0QNN - pWL` % 0S !RRP, 0@@   p <00l0d@PPLt  @ 0  0  MMTN p- L@PT" P0@Bn0 0S T @0S UTp@80 000 0aN0QNN0 R N |0p-"L@Pᑱ`T0 @ H0  0S40,  Ry`p0QNNN -LM04!0`p Q 8kP GP0U) P@T WO0P GP 0P@0P| WP=P L0UP K5P R R0Ղ"P0O0QPU p-LL`P@T PpSP 0@0PpIN -pPLPH Ps0S P @sP0zs0S P @qsP0js X @T `P_s P[sPWsTs@TNsiDs -L0ML`K@ B 00P S < `; `; ; t; l; l; < d< D< 0< ; @$((P P))@$(P P)'K|@(@}P@$p{P PP @0TPS@@ `0-L@P^$?@0h0S 0h^$?0h p-L`P0@ S = = = = = = = <> = = > > VU@ PEP@p0P@SP T0TSU S 0P@SPĖ p-L`P@er phE -LMP`0  r0 00  S  00R  0Sb@er0@0P PP00 R00  0Sb@Fr0@0P PP00 pW7 @Tg@)rPU%  , r ,@0,0 00 R s 0S m 0S oPU0 0p0 pj0 e0000(KLp -LM`pPG %P?;0@:S:PD lB lB lB lB lB lB lB lB lB lB lB lB lB lB lB lB lB lB PD lB lB lB 8D C $C lB lB lB lB lB lB lB lB lB lB lB lB lB lB C B lB lB lB lB lB lB lB lB lB lB lB lB lB lB B lB B ?P(K0pP @2P p?dP00S b -00@@@0SppX @80CSDI ,I hH DH I I I J L F K tJ K K tJ `J I H H H H H 0@,0 0P ShE (F C E pE E D D D HE 4E tD ,0@S `T"T\P,@  pW@0  ;P  7)@}P@${P} PP @0TPS@@"@0,0 "@0,0 |@(@p$}(z(wP P)l)iP@v$c(`P P P@] 0S&$Tok @Y @ @@D 8TT 1@T,~)d0 %0 SG 0S x%  0S @ P%0S 8%4%0 % 0Su @T P  @T 0@TP  00S @TR[  W0S  d$0 P@ 0 <$HX:0 $? $08 #00P0#  $ #0#0 #|#0 R 0S @ #0S R 0Sv @ "0Sm ""P 0  "Z "00S @ "00@S x"C h">X"0@0Sb0"0 0S! 0!@ T! ! !0PU 000 !  0S @\)| t!}0S00T!uPU 0H 0< 0Q00S OܘܠDH0OИ -LM@pP` 0[S P 0㔐0 @ @᠛P k g  p0,KZ, R j场O -LM0 RH80  RX00  R(l0  R L0 R^FPfP ^@D@TY00S@ l+<0O (0 R00PP0`N P-L@ 0 p-D`L0@ PR  a5 e 00b 0p+ p-@QLP! R `0 Q 0Q 0  5 000pT`  0Spp0 a5 00 0+ 0-hPL@T\@D P0R  P 0,0 0S0C0000<<+3+ 0 0  g5+D< 0-4@4P0L Z50 0 0+<D `,0R- 0B5<+4P0 0ࢿl<h<N -pPLP@`0e R0@0Q~0U0C0P 00 0b@A~0U00P 8~8 0U00.~0U00P`<d< -PL@4M<$< 0,4<<0 pP@p WV0`@T3`VG3 Vb 4 у 0U{3# @<0S 4 _QQ„ V^00@0!0<0pWS0N 040  VP\ 0SYW00S4 0 Q 0 V0WP ژ 0?, PÐ @ 0 ` 0f S,0 0P0@  D `~@TD b$2`?ÐY 0@m 0` S PPT M0 V0 0C V00@p40 W0040  V080   0Q00l 0C 8 00@!V@8 0P 0 qS 0S  F}000PU@08 0S  +@R<@ P0S | 0 $}0@0004S  , 00c0(KP @>@<+p<<t<`Nd<`<< -`0` \0@L <3T | |$0$  0 <|<t<d<`<< -,@L0S V_0000T<TN -L|hT} 0- P@L?_0h;_TN -L0L @R TT^|@@$h| |@`N 0-@P Le2 0 00h p-X`@L;_P7_ L20 0 pTN -LM@Pa0SW P 00|q$K(K0 @,K @w`PJ (1 ($9 $0V0 P,0AP2 wP#U0( bQ P0P00Ť0 00 @@ K lP P4Q (0Ph@@6P`++ H<<<@<L<< -L MK0 K @KK @qw@P {|xK -L$M@PPb0S S P 00吢U0 ,K0K4K8@K @լ.Pը^0l0ŠnN cR0N 0NRtN lNh.0XP.X  ,  ,0  c> B > . >.@@LEvQ4  P 00 S 8v@t) R ] 0S 0S 0S# RP ( p ԧ Ȫ  8-0 0 @[00,QB T00^@  T  0 TPPU Qb Q < R B 0AL c0  ",P< 0S P"0S S S00j000S 00LPm D ح T00e ˟0  @0 000D S` `˟Q\;X;  H;  @ T " +0000010DS 00D 0 1:ʟ @ T  *0 00D Sp 0!0000C00 T T`` 0(*TT 0T 0T :'Q{  :@ 9 R 0  R)l9@ M0 0 0C0 TT70  R@9 ^0 0@0$0  00^u@t }t {tu R8 0 R0W $8PȟȟH yP0S cQsQ CQ d8P#P8 po8   0 B y T TPP& '10DSP00D P 0iǟ`@` P 0 S0@ @@* t t ttH0 SD Q *6D 0 0 (Kt&0SLƟ00*Ɵ0 ( 000ct P$Is\@T] P6 D 00`0 0Ɵ 00@m5@T5 R@0T 0T 00ST  R %PTd, L L L L ܱ ̱ L L < L L L L L L L L L L L L L L İ b,P% #@E! 00C0>0 R84 0@ L4 P 3ß P @ğ@$a00@yP P. pc00v3! R|S0 0CR4#@0#Q@3 $ß0 @0S 0P0 0ż/ 20P~ @ R B0 0P0 0 з0C 0 0QH2P0" @0S 0 ` a)1 0 f0b 00R0bP0`l"2`<0 @0K0` 0PFP @ `v}PE`X@ ڰ 00z P  ag) 1 0Pc 0/T PP  XPx\b,10cSsS8 CS6 2 rP aX )0  c/) 00 0;P<3D<L<H<@<33<<+LN++l<h<|<d<`<t<TNp<<D<<T<Lu`++++4+`N< <u<+d, -L"MŸQ p,  S P2 `R` P R* PP 2 RjKAdp{ X~8: S}BNK@D@D {Pw \(P 0@(K0$S RM 'BNK!@D@D0+>PP V$ ^K!PEPE0+1PZ 7(`4(VP +'+'H '( 0pYHP0+', 0R&(KACՀҀ ΀ˀȀnk忀|开tbp6h崀+'0孀0kVl,|d|,@H8 0-L MP@P Q 0SP R:00 0 0 K00u(r o ki먜М -LD0"3 00Q@0P 00:v耢U -LSM✀0YOKp $ :lp `IKPK@dK 0<@i$ 0R K0kptd@A,$H -L$M@0P0 , 0S ,S0 0,SS af\ n\ 4@K | XS 0R KS ]0k`LT -LGMđ0Pp,0 g 0S@`KS@' ,S0 0,SSBKHH j ; 0/FpP; IKAɍp: =t|41` V,0@SV1S   Q RQ\ ^00\0S l}`, 0R(KDr 8t $e0k̝pd p-L M`P 0(0P`0,P 4@0 0 0 m$400 PPKp9x p-0St0``QLP @3!   @h@Q0S pQ4kȼ -LMMMNnK`F0`F@/㸀K,0 p%[K %"K % % Kp!0,2 0 (2 $ jPP6NK@  0= 0 8ONK@D0@D ,2 ( $B t t j@ % %  %T NK@x(, 0R(KN"0kp(B x p-LM`0.^K@/0 %h0 ,K P0 HjPKH 0RKp0kVp'B0 -MLMD0PQ,0 p H  YP +Z% |CTPJ cT N~T0UCTUCKHH/>%2"2CT(K! W`` 0( K@V0@  1 吡 W00 S[K=00 j@ %tg  , 0Rb(K0[K PK`% $10 x1 pQ |a i@PJt1S* 0 |1 x! pq  0ZDp@8 JKAAp6 gr@4[K 1 $0 D1 0Ch! |A x1 @! lA pq 0  $}W|}tQp%h}`I TE0r @?0k|tVp&B̞@XܞĞ -LWM 0`(0 pxipP* OK/p$ ,` gi@P"YnKK`F./a$0$K0 ᳀ r RiPq( 0R $KD,  40A}($0kBVB$B -ML M/NK0 /`q(0 "$0 2 i@P0K00S$^^KPE PE2K P 00@S,$0x 5 @C hP V( 0R$K($h0kVp B"B,$ p-LM@a0_K@/0 # !0d0C SD 4 4 4 4 4 4 4 4 4 4 4  |0$0 0 hP-Kr0gS 0R||f 0RKp0$0 0$0 0$0 0$0 (3$0kV4p#Bw\PȚ -\LM0OK /,0 q#4&4Ɵ0 (3 eh@P 0Sw ş, 0Rv(K;K!0SjKA AI  I , K#%ş0e6 9u4 (K0P)|0P6h@PO)R K P9S (K06PK8C8sj@K 6K %"( K0S3S dQt $4QppA?KK $"3s s 4 R K Kj>C^ c^ KP6KjK 0K@K pae3S b'}KpGpG`/"#09 9 g 7 gP7S P p G 3CSL GW`3 Rt  K >L#(KH0( K<#(KFK(#_"6[SW V@K  6[SI PK  0KχKe2 RK3`S)0 S) "儢 7K p"/"3CS GWK@H"H2#"@<840,b=a;b9b7b5a3PK V@K 0K@!P!T  0PdOK0K0@!P!C^+p 0KKjKX!!PPPP!P1d 3S0C9 $  0KKK6KjKud3S9 b0kVp B(*"BìП @Vh!B РVğĠ؟ܠ tD$,Ԛ -L`M0xpKP `(0 ) := P @@.P5 P @|K< \|\ ( 0 R$K|K< G|\< <|0k4ܚ -MLM 0/KA A ,0 + POKℂ/P!;lr 3K; TK00 ?fP2Sd St ZNK@D@D/5!0 5 +f@PvZK@2SXڊKJ`J, !0 8 e f@PWK@Y - P95S6/]KPE5@S// 04 ; i I eP)1( K+Q0(K+\( K0+Q8[S  +S, 0R(K2`Stp.K`X=Pd0+@y8\0kVp$B B"B!B|\,L$ -L M0K@P`/$0 6K΢p 03KD300 0U ,P "  Qp(  0 xePKA$ 0R KKP2"3K2#K3K< 8 ,]y0 Xy0kVp%B¨L -0L 04kT -H&LM0@Pp,0 B VC P`C C B B B B B %ip> C0@3S3 d d d d d d d d d d ` T d 0 d d d d d d d d d d d d d d  p d d d ` L d <  d d d  d | l $*p$0cP1 @ P`T ?K P?tp0 Q"#U U U U0 @ 0@0 0@0 x4 {#0 @P`0# 2 q3 m1 K@["3R_ 0x Xl3x#SX#8 @P`# K8303 G0@P`B(3 >0@P`92@ P00@ S` . 0K@ 2S8#82 "0 @# P `" `"0@P`D" 0@P`02 02 " 0@ P`" ! 0@P` 112 1 /x, 0RB(KbV=  SV08Lcp= 8..K0@ c@P2K1" 0`V V"h 0@0 P #U@ww|wtwl0 D0w\4 U0kTTpV|x8VVtBVt$ -Luw -0L ]T4kT -L M@P㘅!ᳪp1` fRp0`S.S0C  " P5 A1!O @_@P 0*P (KQ0`S.Sp0C  .S W000 4K4` 0p , wP Ї00CV꘠@0@* ?Tᚐ)Ac 0TPS0C Px0T0Ct0PS0 C RY  þ@ TgfffE 0-,@,PL(  T4k -LM  y]P: K Gp* 0#4 j]P; K 8p 0#4 K巵p岵d@dd d0zTᢵqv @,8 ,0lꐤd(D80\ -L$Mp L mbPP= -gbPv 埮PD H 5b o`0S㨂 B@P *ڀ2MmT p Z vPYj j(KT000/P@E@L?ΆD H hjH0SS /`PK00X ٣P8(40!Ϡ @0`,`?AlN3c @K@@ Q !Q0 0l0 \0 0XPP <0 e 0,0 00 0 0 0W WW 0-\PL0S S0@ S 00@0) WW -LNM`0\(0 0P S:NKXT1*D1S8 @1Ho@RPr0P Sv` HqP V?KqTP 4P=@hF@( 0R$KP.@JOK <s r 0k W@\ -Lp` Q4 T P" @T TT#"PP P T0 P q00q_rZr WХ -Lp` T0 0 00b00@T TPP {P 1r W -LM넃`p@T T T TT T$KPPc (K P^ 0D S, , @ @ @ @ @ @ @ @ ` $ (0Rppfdo`$ (0RppYWb`$ (0RppLJU`$ (0pRp@>I`$ (0Rpp31<`$ (0Rpp&$/`0D S񟗯 X @ @ @ @ @ @ @ @ $ 9h `d,hPpp`VhpPp`IhPpp`;h`/gppp3`" K W p-L|`P0S @PP 0PS p W p-LT`@0S PkP 0@S pw W 0-@PL+TlPX0H0@ R0S(aZ:Z@W W! -0L 壼4kT-0 CR 0R0 S,00 -PTL8Mp`@MPP NP@"pp3&@pK0K`< , K00 @` @P,00,0 |PP~p , {0< ,0 0 @@P \XK pL0T PR0T0 T0@`5K,0T@X >\P <\00S \ 0   \PPe40[S  5[0Sl|告t Y`@L0VU D00S8 W ${(K(P\ -0L ޻4kTl -0LAM @Pp  8p sPp  .p0` fRAT  oPNKPP WY.fPPmj0k>T -@LM `P 00 Q03*,  0,, pW00P0 U 00 @ep 0  P02@0P5 :0P *0@@,0 PdW p脢 0-LXM@P% @\@0P00 lK-`00\0P0  :C K0W W -LXM@%\@0P00 hK-\00X0P0  :n KW W -Lp`,P3*@P04`0K*K0C8M4>K0C4A=K(0C4$QK 0B*K44(I C:K$$P0B*Kp(I4 0 S9 P  P P P P P P P P   0 40S0000 0 0*$(p 0%  (00?0bS fS)0S00 < 4<̠Č8#Č:K"̌,K$,4, ,*K 0$880S~0 0000 0 0哾:K P$ Z0`<`:KdK G(p~0`04Z@`B0  0K|P T d K磩P @T`P d "p@ d0Kp @T `  `v~*K@傽q~V@m~0SS h8+P 080(x0 0S$k $@`PO dK %,dK<K-.3[0C3K:K3[dKS3dK H. R)0S S S"Z  Z:Kp0S   p ,<4("4!< 03[0C3KA3[SS `$P V}0 0000'0S<0 00S 0S; 000 0T`0 000 00S0T0 0-0 000 000 0(Kl p-PPL}@00*`,(@P L00040)P0 ''@*p -L@M` P 0 \13000 55:W00000 0 S,0 ,, pW0000P U>*0  0 @ep 0 <P02@0P5 :*0 3P $*0 @@00 PdW p0@ TP3 : 0S 0 0@ 0@,0qU dP"(K舢 p-LXMP@`"0 |P0P00 pK*}d00 `0P0 @@ :f@ S T  00|@Kp g4g 0-LXMP@"u P|@lK*|`00\ \0P PP :1@ T (0 |@00SK0 g4g -L@"000  PhG-M T 0 $0@(@ P,P`0`p 4p@0Tp  <0P<` 0Ԣ($ 0,($0P00P4@ h ! @(`$, <@0g\ P. 0@!g.,P(@T<@`0$ 04@, p$0( 04$(0Dp4pHXLP @ @0 ! 0@!0@ Q18 P!@`!@08P! LPpHI$PDHpf.. 0 p 8D0#Hpj!E$ 0#j 0P%@@X@ 0H @^LP@D PpX  `DHL@PPT@00P0 00 pD0 00H000000000 L@000 PP`000ЍtG-M0@ Q0@0@0@0@0@0@0@0@0@0@0@|0@t0x@<0@@408@,00@aAq@P `(p08! AQaq ,0d481Q   0p^P0Qp nt ^Q nt /tP@ t ~ %tPp t t0P0L0#,0 #(8 , 4 #@ H0 < D H #",#,L P H .(#T X H "D0\ #<`0 D d "(h D0l #4p0 @Dp.\..40[8[T@[?  08^P0Q8 n< ?^Q@ n< y<P@ < n8 o<P8 < i<0P0D0#<00 , D04 #880 @0D#\#.pT.l0[#4<8[0@0 @P劐pP0(Ko: 0-PL@ 0#<00#800#400 R0 0h" -pRLPw D@A1>0O `cWP: @1@ T@D SH0 0@H0L@pf.x @1 0S@DBR@H0 0@H0L@@00 @TpG†@0D@ S H00 @H0L@`W W  P? @1 0S@D RH0 0@H0L@ \00-PLP @0@0D@H0L@04 -RL`? D@A1>?0( @PcXPp: @0!0@@0D@e` @0!0@@0D@T@00 @@0D@@H@?X X  P @0!0@@0D@ D00-PLP / @0@0D@0t -LXMP`@vp 0+Pv0 S 0v 0p xK_$d0 s000vl00d0 KQ`0 S0$00DS$0 0!$0D -MLM`p# PP' 0V0 BNK@D@D 0PP0 Z P4 W\  K  `p  P#$K '  -L0M`PpP) K.0 Pe 0S K0C*KK0C*K8K8R-K( B( C:KԨبpJ( A((0B8 8PC 0 Sd( + D+ - d+ d1 d1 d1 d1 d1 d1 / 1 01 00S0,040S l0SJt0SGp0SDx0SA\07"0"S000=`0SS S0004d0SS S S000)S4 PB`0S S d0S S R  h0S S R  r 000SS\ 4  <h0SS\ 4 88q < r qr h0S r q0000000S26ddgdGP\0  D' DK0#DK 0P0p0S,0S0 #p DK P0sDK0S,0S\0 000p0$0 00$0` R$01D0s{,0S000 0r0( 0?0bS@$@|`|@V0@ V0 0S  0P.S 00 000+ 00 .S0S00P 0K0 0%# P)K !0 P 0 0100:K(4y00|0 0K$ PK pn P000*K劚P 0|00 00(00?0bS fSU|P0 0 } `0S$01D0S 0 P 0s0 S 00P崳P3 ``KX0$ 1D K hp` @ 0K0՞P  )"p@TT \0"   P s0 S 000 0 0 ὲ/0@!P 00( r0 `@K$p!K"2$:[0C:K:[KS88@|`KP*K`K#:K8K :ZRDK!(K0 S< K^ 4 | Kx0  0{ K7K ^(KtK0|K{0KK\0 :K*K4P0P@ P740X~p~ -LM8 Y< pP rx4 2n EP!X20S002 9PP 20S00#30#9p3Ps r0m,`  tP00CS00 Ӥ0[r R r ,Kx80SW00S ^P<,Kי0,Kә@P 0K JU00S p00RQW00S < P,0S  ω R ,0,SP SS SP00P,00,0 00r04  0(K\~ p-LM@d`Pw3P@ 0  ;,0@0S f3TKpX~p~ rS-@L`P"@3:qp 0P@q@qp p-LM@d`P;3P@  0  ,0@0S *3TKpX~p~ rS-@L`P"@3:qp 0P@q@qp 0-@LP 003,@r.0 2 0hs`~X~8w4w 0-@LP 002,@r.0 2 0h`~X~8w4w p-LM 0`|20tr.@l2PX2\00SgP  0`P@2Kp`~X~8w4w\~ 0-K*K0C M8>K0C8a=K(0C8Q=K(0C8(P 0B*K88 C:K((40B*K88( C:K( 0 SM T 4N T T T T T T T T P S S 40P0 P 0000 SL0SRL0S 000 00S0  .V S:V` 00FV08 K*Pw40p@P  `p 8K pP@2k0 00kp 0x (00?0bS fS0S4 0R  0 :K(45<*K 0880S 0RPX傫:K P(t 0S<`:K(05`P0`0*K84pL*KpK )pk0`0>:K8S@ p K玖P@pH K!*P TpH K*PHK HP`P l p@p0Kp @ T HK 3p`Nk*K@ZIkV@P`Dk0S 8P 080(pw0 0S$~0P04 $`B@P  pKpKHKnK`F4[0C4K4[pKS:K"r_*KpK:K8"`VR0S SL- S SG6Z:K %<*KP8*K$"2Z0*KP**K Gp#:K ZY:K 6*K Z Y :K (*K p 4[0C4K4[S@$Tj0 000090S <L sp`j0 0+0S00 S0S0P@00 00 0P0S00 00S0P0 0 -0 000 000 0'`(Kl -L@`pP 0I@{ -`PL@048 oP@ 0Ii0 0Fi0(S 000,@P. @p0S( 0S%$ 00D0 0 0S00< S00<000D0s00 0  00($p-0 0 ?(K -L@`p6P 0@, -0-LPM@a?KC/_K@0 Q Q =06Kp@ `@ a,0 pK\ L0 ,P l  K0Y -L1M`0pPKA4 8 0 p 1S01 R rP 8 00000C00S^P0 r [000%R@QgQP'eQG*GQEQC*9Q0Qk*%QA *QP Q7 AQ6 DQd[Qq OQf XQj LQBcQLP aQ!pQ jQ3 hQ4 iQKnQ LlQ1tQ6 qQ1 sQ xQD zQ. uQ=PP0SP 0S0 0C rK@@0hS@@0lS@@L@@ 000C @0 w 0# t@K0lKl"K60^S  0J_C0 S RJ!- JK0P-S ]S S@Q00]Q0SJ_K0 RLP8"K @0 2  0p0p@  0p p @p p 0Oq '000 @ 003  P0S P0SKP  00CS0>P0 r T000U񟗶` ` a b Xe X  PT0*0PdP # 0hP P 0.P 4p4 X P0P0CU  SP U/0(K 01SSU$@P0X0C000  0SըP Ti (K001SSPTd 43p043 HX @ 0@ B0T0  RᬨP 0 r U000 'P@ 0C00X0  0SᎨP 0 r 000 4 0d p4 dT0HʏKS8SJS0 9R 8R%*0R +R+ -RH(XR+ A0BSAaR>:fRxR:0PI0 J"00003 J000S03 03 S  :J   60K0UI0 0 0CS0000PU  ?K0CUUUXPxPPE ;-0 80#<80#?   0p@  0p 0p @pp4# 4# 8 0`_ H?K8RPPJ,0 9R 0RJ#*-R .R +R!ER eR  J  J9S:J0 0CS0000ᢧPX   _K@PEt{T-xePEP qxn;0 87i0p@ 8Oi0p8:0p4# 4# 8S 0e4P4 4(K蘶V -DpL0`S@PK 0@SK蠶 -L M0`Ⴠp=X:0S 0@P0~p @ d0P0}p@  98@  b$K -Lpp p'  @0S1'*p7@ @0S1 8CX0 8CXp@  P 1 A P<70  c`<7 p, 0R<000`< & 0q40 0db4P`V U00D< 0DO/K<' D %2 <>&B aP`< <'O?KPbdU87L7 Z 0K⠡K)0KL7 < P)0[Lp'PS*0[H H SHH  t' ,h7H@lT`$H` \0 R0\0 ` xdK PK@DT 0@` \0 0R\0 ` xdKPpK)0[S )0K000`  \0R0\0 ` xdKPZK*0[S 00+0K+0K000` \0 R0\0 ` xdKPBKtP,hH'@bTT`$H` \0 R0\0 ` xdKP'K@DT 0@` \0 0R\0 ` xdKPKL7@eT`$H` \0 R0\0 ` xdKPK@DT 0@` \0 0R\0 ` xdKmPKp <!` \0 0dQ,7d `'R80S\:000`  \0R0\0 ` xdKDPK87Sp 00d`  \0R0\0 ` xdK+PK80@cTjP$(` \0 R0\0 ` xdKPK@DT0`@` \0 0R\0 ` xdKPxK8808 a<0<'XG0bT@T` \0 R0\0 ` xdKP[KX? @cTkP$(` \0 R0\0 ` xdKPCK@DT0`@` \0 0R\0 ` xdKP.K<8X'P< p7 00d`  \0R0\0 ` xdKPK<0<8G0`T@T` \0 R0\0 ` xdKPK8?@cTlmPʡ(` \0 R0\0 ` xdKhPK@DT0`@` \0 0R\0 ` ҂{8'Rp7U <d01K01K>K000` \0 R0\0 ` PxdK9PPK<T'0B0` \0 0R\0 ` PxdK$PPK87T@iTܮ`2H` \0 R0\0 ` PxdK PPK@DT 0@` \0 0R\0 ` P <00`  \0R0\0 ` PxdKPbPKXK\` \0 R0\0 ` xdKPOKp'* h7H@lTaP"(` \0 R0\0 ` xdKP4K@DT0`@` \0 0R\0 ` xdKP H'hl1R 0aR\0Sl  xdKP 0㤐K`0 \0S xdKP0`0 x'0@0l7 bZp 00lw PY O@P 0KP D:8 Ml(K谢 -DpL0`S@P?@ f0@S9@蠶QRP000S0 -LV`P @ 0S\00R001S @  T0p@ 0\ T0Wp@d 000XlT00S <0@@ \ 0 0i<Ă -LMGPPX 00z`10>CNKTa@D @D 0P3KHH k p* T0S \PT3 4`K Xp7K0D@K0@3[<3K03K\ Tl  (0!"(80S Y00 @3[P3<8P@<0X0P(Kt  0- L@?pP  /p  /p  .?p XY0$S TY@@=PYP@0 p-`PLU@`P`0h`  h0S0#*P0h``0p -AMLM8pK`d P(K,0SF"[3RB2[S?2[p< : 8 CNK"[ @D0@DD0H  ,0S+#[<0R'#[80R#@P2[  XW0 02["[[AmK0`F@`FT@D,Pd 00S  X00 K -L0MP`XKS-!@ T @!  8 8 d, X100,0 00`VZY`w 0S0%5,0 r<040R(0 0ZY (K$4 -LMkP"{`@p{xb"Kq 0Sn"[0hS*1 0Q Q Q QD1Q Q6 Q=  O4!Y;   !O! J&" 00S   0S   [`0 $000 0S 0"[0hS,0 0 0Sk L 0-< LP@ P0 -0L.S@P#P*QR00)0P00X0`dS F>R`V@1@! WP P0@0S.pJU000U -h3LM008 ,0 0s ,0 S P R P u@0+S  -S00  ` Pp4 0 !R ZZZ Z5< I$`VN"0I405<A$  4 0  0L.\  0 S00S< P 4 0O0S "4S 4P 0` `0` \8@4 K  V d1d0@0\ 0 R \Ap ,P0 vN00<110 0ᠽ`pꜽJ W  0Vd9#Zp ꇽ`p X 00045# 80 @T8N00 (K蘶DX -?@p##pWL MX8 0O?   BE!5;t l@ N"0 01`V#U!42T1,0  4 0   0Bt4 0  0"T 14K1 4 0 @T0 4 00 0,0 4 20|A$p0OT?@ 00@@#U[ UDe VZ00@@P` @ 8 3, 0r03Z cY 0zdyVUZ00@@l ,@ 08X  D , 084 ` (KX p-H8`LP@Pp0Sp -LP@ R@00 00 -@L,1p- 000s00 (p-"XL`  p@pp -LM   PM@"00S0  @0  !K00 @P K p@K$ -LMP p@ 0^ Ƞ,Ƞ0@P` ("(p V`00 p-LM ` Ƞ,H@PP  p 00nxx -1L`PV@7 s0pA("S*L"0 0(Q% 00P  000 `0 PP*@` N$0@0    ? - 2L L0S L0#S 50 !S0S0` 0C# @U  000PP P/@` T0L 00P00 R p LX0 Q dp  PpWU% ,0 dS(K0k Ȣ Э 0-@LP0 (0P0CP:0@000 $0 R00c 0 0 00000000 -@Lh 0- R00 0P0Lp@f/00C00h -L@0S - L`@p 0QP@150` !!@c + RT -LM0MJK1@D00@D`* 0 LK P Q  0000 0b00@sPU:K0C00CUD0 @ 0s 00K<0 0 ,0 00 (0 8 0$0 LpK  *p@ K0S K07SJ#00PJ@ U p .00 0 SK0kܭ -LJKM@DP*)`  V@  0`000 0b0QzKpG eJp@ J0S J07S J#0 0 PJ @7 K 0- 0PQL@J 0 0P0 0 0 0 0-0 0SL@Pp00  0 p-0P 0SL@`p 0 6000p p- L`E0PP PP@P0 `0`p Q-L@*P T@ -L M`p<0 J 1! /8 P +e%@,WP@& +V%p@ 4PK  N,0 0,0 Z,00,0 ,1040 0@ ;%pP-I@Yt2I0S. a8 0p P*%@I?00tI0S8`l d0p P*8%@I?00< R00(K@l̂wd \ -LpM`10@W,0   @K}@PK cp@K@  {`P060#0P@U@Ky}   ރ B  {P0\0#0P@U@K\} Ń   %0, 0R (K0k -L\M` @ V^PP, p t x a 0Cs^0l0 oPX   hKTpK| :(< 0|0(((  lp t0@iD0@00 hKp t0\X0D0 @0A 0@A0#Q 0@ T:V@1@# x@Kx `d x V@@PKl , ,hK,@K, ,0 S (K0k -L@oP $p !!!T,at -0LMM0 ,0 #PPWoKJ%T1[S   @P UK,MK H0 deo ..㯅Pp O, ,0 S1(K0k4, -LAM0 , 4$ 84 `@ PBH?0004A7pP 0=>P 0H0Sdd!0UH48$"PD "H0S@ 40B^KPE@DPE (0K@tD^P?p%0 1H%@P P 0+4J PGhpl 0H04$84c`PF^ ,0 S0(K0kTlp``nD -LM8 < ᓇPg `,pKV4 D0 S `PT 4 40@#P0S> 4 lPP8 $ P@ l@P8 00S0 KP 0 R ;;S wl@P"0 G8rP 0l alQ<  0 4Kdž@PV j$@(K`lT\RA Q:0S  -LŸMS 00 8 `0 40 < @ Y0,K00<勆PPU ,00SQ@00 S  P80eS\,0 @,00T:, R 00S S0B,0 ,4 QR 0E 40R P,00C,0 ,8pqp3\pW  q@P8'8@ Q , ,08@  pX00V00S< 8 R9 P4 08pP@"0B 0S S 0S 0S4  S0 S S 4S S R`00 0S 008 @ R8(K® -aMLM20$0 pP" !p` ]KPE[NK@D +? 0K 0 E 5 U\e !pT?*cK^PXGk06: S  S [NK@D+ K@@P[NK@Dp1l!G 0K@@X@9@UTSaD[NK@Dl!`PF0S  K0UC^!`PX% lt!n/KN!PX[KA`t)) K2SPX [KhAwB\00S $0 S4 K0kwd \08\edAPlԮȮ -LM  K K0K P K 0-L@P,PP0.S 0a C00C0  SRQ00 -LM  K K0K `P K -0LM0`p  $0 PPKBPUOK /e SK+e,KK'eJE.+P_K\;9) $0 S K0k -@PLp@ 000C S 00 B00C S 0.S 0  00B S00EP@000C S0*S@0@SU T0 0B8 S8< 74`@T@D -PLMb2 pP@, %Sp{0BS| 2S- +SI .SI %Sm3S >S7iSb DSp dS nS rS , &`*`( UcU V*dd000eP V* y0 V* X0,00c,0 , RPE PC0 U0ppP;0PUU U,0S!0S ,0S Q0 u PP U V{*PP Vs*0 / BP>10CB>A#>A0BPE0Sj8@@f $PW*įֆ̆h p-LM`0`@K KKK`KPP +0 000Kp -0L: P -$0LM K4P p-ML Mh20@0 \2`)PPDPPAK@0@$0/S PAK@@ P 0S AK@0@! P :AK@@AK@@+A.KI>K B0C B0C$ :S S S:S0S QA"*0S0U0 0S /S P+AKIK@A @`A d PPT00S +]:bP 0S` T00S <0Pu 0 S(;Kp0kԯܯ$/̯ ,"-L Ÿ  RP`@ 0 0Թ Q 10m Q 0᷹ 0P`bN Aʠ^   0b< 0BcA4H6&? `? 0S_ c`\  pQ @^00P00S PpW00Q n B2`@? T P  |0 ` 0:5 6!ƠP `5* -LDM \p, 0 \P0QF0XSxSB >r< 000D6 W @`  Q#00ӑ iPhh#h3e00T02@0 pW: @QP q "000DTpG- u00A SrТ` @ Sj Pv"2$TaQ 00A SpWa:/QQ@ .QQN00A SKP/Q!D00A S00V0S< @ j P$ T9Q *00A SP&Q@"V t0S SS0h1P@@0h!0Q  0T2A@0(^PK2 1PA@(0/@P00 |PT@ dK0 fd0S@ A@00A/00@ ,0 S,(K0kTDh4H$ -LM 0|븰T -LM0 |wT -0L⼐MP`,pK,0KyP i 0 ##SVPU`0.T00S` U @ TU ,K A, -h2L M0P,0 PD  PD<@K 0:S0:Sr ` p@ H >(PP1!P 1@ RY0cr1WT @ %:TXZ I0SF H 0SB'$0 p`p@ .T5`,0KV1 iP,@TX  ,0KR!0'$ p`Z<K 0Vj  0\0 l^A0VD<K @/00 ,0 S(K0kL8 %%%* 0Z --LM0 0 K..* -L M` @P4K0px $@ PPP00P0#S @00 Z $0 SL K0kx` -L`M\,  0  \ |K ! BB/A?/A0(K B 0bT 1#QT ` |K1Sr @@r v T` Qr v T`v Z`ZK p. ;v W 0WW10SG*:*W @T>*: W VZ Zh0L S   dNP@ m@|KPd!1PPpW00P0#Sv 0S ,0KR*:00ZK .0R:?0a @S@?00 叾?/00 ,0 S|(K0k)l -0LM@P 0  0S 0 S =S00SR ?0 0 0!0S0(pPd `K VP P -0LM(0 0= S S00SR W?0 0<Pj(@K  1P (0 `@(  (0!0S0  P  00pW0bXP@P  4`0S @@0 0pP -0LM`P@,0 8  0S 0 S =S00SR >0 0]8fs 4 , KP T,0M HQ00@K00  00!0S0  P0 00Q< 0bCpQW@P* 0S @< 0@,  40p ,P@P ,0! 0S0 =S=0080S8 0 (KP  p-LM@P`iP0fC @\000C S 0 cKp -4L(M PK<KP0 L@ Ple/d4<@0 @ @ R*0S0 |S :S00$  $<: <P#X0<0X0D KUpD0C<DPK (0<KD0 00<ED0 ,0<?D0<@ K40P@l  <P.pD0 8#(3 D K0<#p2B, 00D0 800D K7<p8 40D 2KKN0CBK 0CL|8 LN B;` Tx ( X8 d\  |P U%XPD%0S@ d  0P7 h< 8 ( 0 p P D8 R@ <8 @80C88 RppSPR`P1  P.`(\8`%TzPd p P |xHx PPH(W:|+d87Plğ0Sd02@ d @P(RdyT+|8H p0 SU!0U@E\S 0X@ U:;Pf?PVP^ dy0fP@`XX d @T0#SS hPl(R PP0:S@l{P@T80T8 T0S*.K B0 B0CL p( t8 x = FpPn @0S :S@DxptT(d8PPP uP(RdUypvU u0:DL8 DLX 4 0S :S08 i b0( 4 00SPG:S:08008 0(0ecX(0hZX;0f pPVZP^dy )f0f fpPXx `0H a@40( @ DP(RdxX8f`S0A0 vP`V )9p 00 L\(p^p`Ypp ,0 S,|(K0kбhlر -MLM,30(ß,0 $3$C0 <8 3R048 0@ S0nyP 2X "0S00f  P BnK`F`F⌢{8h PP8Q(: +0P`8 P"0S00#3@ @P@Tetx1 @00P@Z *yPS8(0 S8( U0U E\S 0U:;@hP= 0hpP000S#S 8(81f/0y1 h 1 NK@D@D Pࠟ(K0pxC0`KA PA@0pt@T 0^y@8l 40PS H0<( @T 8 P,0 S,{(K0kȈlܱı 0-L@P0h -LM 0  K0 K 0-0@L0PS0@S0蠶 0-0@L0PS0@S$0蠶 -LP@ : 00S0 R r 1S010pS0 `0a000;?C0C,  0K2 J0 , 0#2>;3Sa SC S- Sy'S- St4So S Sj Sj:SL Sb Sa^S\ S\: SW "SVH&S SQ 0 L!L1WWIXF0!W(1W? W< W8>32 0 00 0->400 2&0aPC E 00>  >3 0>3 S0 >01 >3 S00P@ Us -LMp4 Q00 Q@, 0Aό  F0Zl` X00 X00LR,@P@ V00  V 00"U00P@T T 0  @Dʰ1U  XD x 00 000s03_X0S  V vd 0  0 _V00R08!SP X" x 0  0 _X00R0S U  V v 00  000s03_V0S PA?E0CS 0  ,<00 40 Z\, 00  @\,(K -LMPp, 0A>#R R R >3>3>3 SR8  R R R R RR RWp, 0@,  0,0 DPP`I 0`P 0 `pw, 0`,  0,0 FP@IpP 0P  P00S0@P R@ 0rpE, 0,  0,0 JP0 E0`0>3@ 0` 1>3@1>3"S@D0 @~ PP0 @<p 0 >0c"O 0 >0c"O0 @ P U/(KG-M(,@H`pIP>3Sg SD S. S'S. S5S S S} S=SW Su SvqSo Sq@ Sj "SkV&S Sf0X !1XX]YZX!XSXP XL>32 00 C 0 > 0>0 0 `0 S004S0``C/ 0>0 0 0 00$ P >3 0>3 S 000 0>0 0 01>3 S 0     0 0 0` V]Ѝ -LM4  0p 1>#R# R/ RR4 R R~ R&R8 RT |4WW 0RS4 WO 4WJ >32 0 0A pa0W0[ 0W6*0W0W0P -,*0 S)0H% W0 0W*0W S0 W Wr 0_R  0W * 0W0 * R0r 0_R 0W Wr 0 _R  !>3 !>3 S .Z00S\R 4W 0J0,0 Q>3S9 SF SM SS Sd S0>S0P "0st `@S dR 4 0dW  P,00 !0S   4  0P>3 $0 1p 1WA  >3 q 0c 4 P\ @>30 @C1>3@1 >3"S@D0 4 @P<0 1>3 S5 @>3@d_4 0 0 P0 0 @>3@d_4 `@ P 0 ~P0 0` p(K蘶 -LM4  0p 1>#R# R/ RR4 R R~ R&R8 RT |4WW 0RS4 WO 4WJ >32 0 0A pa0W0[ 0W6*0W0W0P -,*0 S)0H% W0 0W*0W S0 W Wr 0_R  0W * 0W0 * R0r 0_R 0W Wr 0 _R  !>3 !>3 S .Z00S\R 4W 0J0,0 Q>3S9 SF SM SS Sd S0>S0P "0st `@S dR 4 0dW  -P,00 !0S   4  0P>3 $0 1p 1WA  >3 q 0c 4 P\ @>30 @C1>3@1 >3"S@D0 4 @P<0 1>3 S5 @>3@d_4 0 0 P0 0 @>3@d_4 `@ P 0 ~P0 0` p(K蘶 -LMP8 <0 Q`40(@04 0  V< 00, 0Aό< @0Y|p Z00 Z00b,@`@ W00  W 008"88V00`@T @T0< @D1V  ZD z 00 000s03_Z0S  W w 0  0 _W00R0S` Z" zP! 0  0 _Z00R0S 1V  W w 00 000s03_W0S `A?F0CS0< @0@\,0 04 ,0 8 YP  00 4< 00aO,(K -LMPp, 0A>#R R R >3>3>3 SR8  R R R R RR RWp, 0@,  0,0 DPP`I 0`P 0 `pw, 0`,  0,0 FP@IpP 0P  P00S0@P R@ 0rpE, 0,  0,0 JP0 E0`0>3@ 0` 1>3@1>3"S@D0 @h PP0 @<p 0 >0c"O 0 >0c"O0 @ P U/(K -LxMp 0 \  >R(00  l S$0 0    0 MY:<`V Ph@ 0R0@ UP @PE Tʠl0 \ Tp 00 ` X0 D0 P L <0 80 40 P0AϠX0`  `Xl0h p L0pXph|\ Vh `00 V\0`0],@P@ W`00  W \0<U, `0P00@T ` T 0  @Dh U  VD v\ 00 000s03_V0S  W w, 0  0 _W00R0SP V" v  0  0 _V00R0S U  W w+00  000s03_W0S X[A?E0CS 0`   8<>  X00S  0p`  (`ZhRH  xX-DPH0S `PKH 0@PH00H0  ^H0Sf X0S`0D X X0S  X02  `0D0RH0S \0 `KH 0>LPD0SD L0SD0SX `KH 0>P``PKH D T 0 0J@P 0 ( H``%PP" TH0`0`O/\ @P` `0D0TX02P`P`@TXPヹDP      0  | | | ^*<`V| @Pi 0R0@ UP @PE| Tl|@\ Tp ` X@ D@ P L BP< P `0@0 8 0 0@ 40 0 0@ 00 0 0@0 ,  /P00Y408@t0 `0x  |pY!00AϠ0 `@=`0 td L0``Yt dP  Wd 0 W\0,@UP@ Z0  Z \0``ş`%U00 P@T ` T0 @D U  WD w 00 000s03_W0S  Z z$ 0  0ğ _Z00R0S P W" wx 0  0 _W00R0S <U  Z z( 00 000s03_Z0S SA?E0CS0`  0| Y00R0S`0 x`0 t` x0 pNdH 0S yXHDF<DQ H0S `KH| 03@PH00H0  ^H0Sj X0S`0D%X X0S0  X02  `0D0RH0S \0 `KH 0!LPD0SD L0SD0SX< a`KH 0PPH D T0`K H@P0 `K@ HPPPP" TH0`0`O/\ @P` `0D0TX02P`P`@TXP㗷DP㔷<咷 H0 SH0|S(KeE* M0-LM0 0 0@ POhK0 P*{* 0-L M0KK p0PSQQRRRQQR@ 0$0%K@*"00@@ AK0l1 xB 02 #4xB 024=> 0&롻@-/@d4xB 02d @-M)Ѝ@4=> 0|  -L 0KM#(C -LMK  K㓻P K -LMK  KㆻP K -QL M@ 0K00#0  0p03T0S00#0K p- 1LMP4K8 K70! K, S:p` P  K H$ KC0 4K2 i'P'$K@ I ` K+''v$KpPT  BBp*A 0- L0@PP d0߈P0p0 (0姄P00C - L0P`ˆPp h0勄P X0|@ <0v 0DpC=P4M<P81#8181:P02410!0 < 8#" Ѝ- 0-Y+ ̌!00@  0*\\* -02LM0< @  p@t 0-T@  +T000 @ 0  z 3Z00S 0T0XSxS@p R 0T  ȟ 0X 8 4 0YP, `00D S t1 !000+ W070c P%\!40V8 U 80U04 V0, P00S )P"0`0 6#P o@00\00S Pu`@ R \pGKJK\1 0Q ,Q @ 0K 0 KP |  0 cKx1 1 4 p@ 1P|P |P ѱ0|1 00~% 00@ 0 SLhKp0kB*<<*::*: Sb0  Sc0  Sd0  S  Sl0  Ss0  S-0p0?0 0r0-00w0-0 00!=@S S-0  S ! Sx0S0s00 r0-00w0-0 00 \ \-0  \ 0\x0S0s00r0-00w0-0 00p \ \-0  \ <0\x0T0t0000 00 0-L@PGp P Kp TlA U` p@ T000dl66***R0@-@P \4, 0L 0lRQ@P03P3hlxlllllllllllllllllllllllllllllllllllllllllllmmm(m8mHm`lXm 10000000001001 0014001|001Hl0d0 `00P00@00 000$00L 0P@tdX 0-@LP8P(000P000\dQRP000S P0-PL@   01S S  R 0^0#T0 0 ^  RR11:000-P S30S10P P10:00 P-L Q#T0 0 P0s3 -0LS # 0P ( 0 $ >0S@ !88S@ ::S e# T00@ 0lA?0 B<R<00  -L@\pE#0+Qpp RU \` P%WPH P ` 0S 0S Pk 0S Ph #T00/ P`|3U 1 !0S?0\:\0lIPL06+@P00 R ! 3R(0P WP @ -PLP`&RZ 0S00S)0 R  d 0ppD pB P@ @@pT:6SR 0S00Sp@""T00#  00S d 0=p00 p00 P @pT X1:00 -L M`P0 40  i"P00LXP=@Pp,K0QQ=  pP6 P@0 T/00SS0&Y p@  ,K@t,K 0P0 T P400 q ZU1e@:0 10(K 0-L@PP[YU@0//s* -(L"x H!X` P  h᩶ HU -LM(KS2 2R $0 Sa (0S]:|2t" 890h2 \ (084"#H<208#Xe@ 2@ r X`iV@ T S XZ!A 0S1h1 " ڰP"4KP4Kd0@0   S9001Q1 0@ !0.00 !@R0 \ ( <@ 30B320 0 R0#@$@T0@@K܉/uy P0x -0LM @ R R R0ᓗ0 Pexh h0 R@0@0@ 4( 0000K xȼ -Lh}pT 0-LM0@ K R10t!p PLH1 PL`R5{{{{{{{8{{{{{{{{{{{ee 0 庶p P# @`R01S 0 ᦶ | 0嚶pP,T,yPD@ 卶K0xԅܳX\ DT3 -LhoTP0 !  |[x<T* 0LS\\ 񟗕|}h~~~~~\Q0000aQ@ 7Q 0Q'*$QH -Q00 QK@MQ EQE7\Q =rQ fQ, nQ bQ8tQ" 3 03:vQ0G00A00000 0 00600 0 0 00"-Q0 ^Q0 0000?Q0000 0A0S010000A0S0001000  -LM `K00&p@ 0FP@@00PU$ K0/P@hP -0LRM p`C@)K0K0  C  0P ꠀ`tT)0[505@ T)0[505@T00ĕPU)K0 K0PT)0[505@T00ĕg(K@-A@0gS -S0 XS1 +S50oS uS0=#80  0 30100  0301000T 0I@@-gQ@ =Q +Q -QXQ1 oQ uQ, 0R0- 0+\ 00\00  00  00000+T00 -T00 =T000 -L$M@T j4@K00K 00 奯&`$ 㝯ჭPz 0`00C S8` P0`< ( ,K p,0`0S>0S Ẫk "00\ U@1:`@PP 80H%=k0 0Gp0gS aSoS uS ~p'}C~pp +RH -R=R 0 0H@0=\0@0 D |0sS gS# XS~oS rSyuS :wS xSqIW  W 0 |ꒀIX U:<⌡ < 傭@P 0f0 D P`80H PHD +Q00R0@=QS@  U:<⁡< [@P\ 0f0 D P`8XD0 PD U:<  ₡ < @@PA 0f0 D P`8 H0PGXH@ =QRH@0=\0 U@0 :<⁡< @P 0f0 D P`8H0 PDQ! U:<  ₁< @Pᴩ Y0f0 DP`8D0X lPID -0S ,SpX+-0S2 `0+S -SXS@0-S0 @ +S0 @XS0 0`T@p\p^p (K -1LM0`p,  P@t 0-T@ +T@ v 3V00S 0T0XSxS@`P R 0T ``㚱ㆱ00D S t 000 W070 cR\ Q00 R00S!! "00@\00, SaR \,0pEp蘶G-1M0 p `00B Sn0R  XRxR   P00B@@ S<, Е^ Q r 0D A0a00c ƒ.R` VC  R Q;r9 06 0mC10S%8 Ќ\)*0Š$\"*0S R<8\0SP R<84 X ,< $8 #$,, Ѝ蘶 -LMKyP|*x*Q -LP`pPp`p00 㸓{@ᛒW1AX* -LM= K$$J* 0 0Q0  {\Q@-@  @Q*Q?Q [Q#Q p 3000#"10# Q00S10# Q00S"20# Q00S  0A QSp 2000 \Q@S Q Q# Q> JQ QF& Q*  Q Q>*0\  n00\  r00m0\  b00\  a00\  v00\  t00\  f00\  s0\00 L0 R00000Ε< P   ?Q*Q #Q[Q \0010"#0 000 0@\00M00| \0000  0^  Q?0@00-  00蘶 p-LP`@00 S  e0p -@LpP`T0PEU0 @U 00g0 -LM4 `4#1!0#  "@0 -K @p80 < @ V\Q  @Q*Q?Q [Q#Q q |000 80 Q00S<0 Q00S&20# Q00S   0A QSq 000 \Q@ T4@D"p#*p0-K @0pcP U-K 2@ HX HQ T:4\000 SP-pK0lg@0S i(K蘶*bb** M0-LM0 0 0@ PJWK0}* -LM K[Pwt@ -LM K"Ivt -0-LMP0U0 @0 0 0Q a0`0 |P@T$ (K K 0K @( @夯P000(   K04k8!\""*==*aa** *pP0000 P8000ӑP000ӑᘶDH0 S000 -@L $$ R*00 C R00T0SQ00T0S  @-0P`p @ 00000l0P20C^  00C 00S 1>3 01 -L` R*P*0S0]S`pPhQP0Sp@T U}< 0- LR@#r+ R!*0S*0[S.Q00 PR *0S*0.S0]S00 N0 0 p-0LS@Pp P`P 7pP `p p-0LS@`P 0S0?0 P  0 1 p -@ 0SLP*  ȗP &  㿗P 000 `0 00Vp&@@P= 0!0P0/\ 0 1#"0 "\00g ឮ0Q  R V001@B#"A2A` B 0V 0000@q0@0l0 @o R*0^S00 R*0]S 00 ]00]00]0 -S00 -00-00-00-S [SR: {0:S =Sw 0S0!#Z+00-S]SS R*q Ɵ000ujP0S p@ T 10 000000P#p -@P@ Pߣ @   @  ge00S R!#+ R*0S*0:S0]S. ] 0S0!#+00-S]S =) 0000 R!#+ R *0S*0=S0]S00/; pR*0-SQ*0]S -P00W@ @ 0000000SQ*0]S  R*-S0]S  -00-00-00 R*0]S  i0Sb 0 0h@Cp0 t 000 4P 000000@DT Y 00C  0N@@000`00^00  00 00 0C0p 0 0P\ 0 0PVo* 0@0S00T0S 0 0 00Q\ \ @T:`0  bB"oM$жض p-L KM0P0^00K 00KS0`0K 0@0KP`x -LM0` @8P pw 0000 zP 0KP 0]0@ 0K0pK0Kq@P N0S04  4蘶 -`RLP@p "P 0!ī000 -LP\`@# 0 q$0S0$0L0S0L0 Q   fA! B⡬ 0p -LP`@p0 ST TW0 W000Stꐧ$ `  f00   f  f9"  B a0  .@0 f~  f  f"  B a   KpG`@  f0Y  fi8@DpG2@D`vi -LM00  \@, :P0^S00 W (00(0 ,00,0\Qp0P!#u+0 0|4W_ .W *W|w[W JWwlğ W >G0CSnNL$WjF00  e a2^ 70D  D 0DP U 1   R *0S*0\S0)S \) U 1H   R *0S*0\S0)S00%  !<0`CQH0S   H  0HU  ; R*0*Q 0 0 hx  h   h0l  hPSw*\Qu0{Sr00 `R*0,S0S0 *000C SVP \P 0a R *0S *0\S0}S0 0  R*Q*0\S0}S x u  P R *P*0 S00 SQ 0 0C0+ (00(0 000000, S(KoL$W (K){} - L M@, 4 G ?U pe +U*U`*$UM (U.U~\^U7 [Ud \Uvd{Uk |UqHR!#+0D  D 0DP U 1  R*0)S ) U 1H   R*0)S I    (00(0 ,00,09  (00(0 00000+ #00P   R!#+00 R*000C S  R*P*0E0?US{U0S*000C S0Q0 +U *U?U' {UzB 0  g  gB   g0   g    g0  g*T 0  g  g  g " B a  E `R*0,S00000C S\ 5VP %P 0 R*0}S00  R*0}S   Q* *0B0?RS{R 0S*000C S 0S*P|U 4 U0 S R/*0|S,0, 0R    j 0o 0 ,   i00 aC 0" 00 0  a  i (Ko|, R (K -0LtMS` 倀/  PPa *(ᙨPf@P $ 000 P  O 0K0 |@ `   P(0 PHPP0|P40 pPP P(P,P0P3S S SS S SP`B B>3!>3S S "S (00(0@0P@P >3S@P ⃠P<@@  >3S BR000S   0>3S SPASQ(00(0d0L0D 0 L0 @0(0Ku0S p(KEe -t0 LR @T T0R000P!PP<PheE0* -PLM 0@0 @ K0(K0 RP0@(0 $@ (K --LM0 0 -D0@L`P4 0KT A @ W4kT8! - LM0 K  Yp K33* * * -Lp`@ P@D`@0c%T -L8M\$ p`<@ 7P @ PU@V@K 02R R @ RV@K 2 ` 25ᖦWP  $0 S R K0k<H&ܻi* -L M@000@00 0 R10K' -LhM Q 0 000?/0 S @?P046S d  X  0㈀ 儐 mP0   D [K0 K,0KoPP Q ):**R K46oB`FT 0 ,00C Q@0a3 A 0a8CnA✰`FAT h>d.d>>`.`>@P\L.L>4 0@Pևh 0\nP hG 0PhAh h R0d0 h=K1 CnPhࠣA d h d ,0h0fS0SaBC\ Ux0 Ux E\ E^\ \ X t x0h0llx0 t X  R @R0@0CŒ0 Ō@\ |p l ` # ` 0  `p  l ` 0`0 \ ` p l ` h 0`V0Fp` l0 `p` 2PD  p\00S2 h^+; NB1`p;K z@@ 聆P`tT p  0a"h @bT ; 1 KcDbP@p` W@PV pd0S :  zmpP00\00S@ P l^  P:1hl A8 4 p0h40 8 G 0 :4`^ p@ UA 9 ф 0p`OlP4 H p 17mP`4Qd)1A 0 d 0᱄D@ ᒆ@ 0ᢄ0@ 0@`Pm@P@  08 h  0mP 8 @4\S p8幅`p0 0᱅ | DT@̀ 0d 0`P4P 4 40@ Z 7@ 7K^ 0kPlʀ K @ 0lP 0x0S 8h Op`pꈀK0 h0?Q0Sl p R00Ӭ61 R 6R 0WhPhpH 8 @D P 0-` 08 0000 0@P!P ,6 p Y' 0 0@P^kP8h  0P DXh 00 h 00x9S 000@P`0SxPH0  T\,0CN@6@cnPH  \x\ Px \0RS`\0x\ S 0c\ Pc `ctQ` R Hn0PH0  P n@P PlP@ PtnPP  NnpP X\ npP `@^00S X 46S 40 S \P\ X R0 01Hl 0`\ 00 0cS0C\ S\0\ P`UPmPP ^ \QxmpPW d R P6lPP  nPP H T H  mPH ? h0l0Ch0 p p^&ʌQQ" mpP- p R P lPh080 H pDh L D100800h0 T VH(mPH  ZHHD< L H H Il@P H0  ! $ mPPLPkH`l@P 0SPPkPl0@ \ U00S Y9T* V1@ V00S YP0S0SUPlPP kP @:T @U9T0{900t'?aCoc?`(?yPD?0?$@@@?< p0@RC P  1mPP w LH\  &mPH l L L  mPL c H  mPH \ << nDPP_0@P@P0  \0SL ,p UPlPP = L PVlPP 4 kP  D X100h00h0 0x9S 000x0S IkH\ L^ ^AkH?kP=k 0hS00 D D(K -L⊄p3 -LM< 0 S<B !0 0<0  4 P8 <, 0 / pP`08 R0@ 0@s 40Q PP`0 @p ! 00S0  I00 BR0S < jP58p08 , 0P, ` 0@0s@4 ,0Q @S0 p ! 00S0  I00 BR0S 8(K 02@ j - L@@ 0SjP@ 0-L@PP  0S0U 0 -QLM@8 P<0 R 0 0љP4 8 e yꕘ$*`< P@&<0P  0Q0p 8净XJZ p8 e║!, 0 0 040 R0  0 R08`A8 ꕗ$*< Pp@! 0 R0`80pWV㕖' `ᕖ$4< P 400 R  0 R00 8,0Q 0 4K (K;;e*a*( -LM0 G K p-0LDM0PQ`0 *P P\@Kbh 0#200 00@R0 0 SLKp0kl -LMT0@K`P$0 p\ ב$ 0R qL K0kx -MLM@lK, l p`=P@ VKAp g;$U eXW 0a0Q U)K ᖑV U PUo0 ONK@D@DV  U FpPD @ 0@ W@lKV ,0 S  L(K0k 0-@MPL 00K0jj**0(0 -0LP000@-Q@ Q QP0P0P0P0 0-@L0PST00SP,0h) -LHM` h p$P \\B\pX 0000hPP B`X 0000x0S h 0dP@Pk04,"400S0 aUP bP0 TA 0000pD "00@0@@4K9뺜P`\ hd 04 T X `@ TdKuSP0S! MT0T0L0Stl0\0(RP 4@ 00@00ኔሔ (KT X -LTMP\ p  t0 Q40` pP`h0 p   R0` R0d0 4 L0Kx |0 P ( h 00C,̠Čh 0("Č# (K FP6(0 R% 0SMR GR KR R kR mR gR`PA`VK 5` @ `[F`Q@Pڌ% TpLX`0XX `堙P0P00(@$K.@( (H --LM00  K 0-<0@LP ,,>T   0h4kT8!-`00S 0 CR 0R0 S  00䠶 -2LIM0TK(0 `@NVP:KPP50z WeV?  0P{@P 0lp h0 l0Kd0 0`0 dK0\ K PPX 0FR\Θ/@P*1 0R& 0R" R;"" ᭘ _PP @1R <1R  81R" pFQK`4P (0 SE$K0k\dX 0-PL@A/D0PP PA/d@P P@055* 0-LMP@ KӘ E0R @ 0 0 r004003200  K, KP,K088*[[*Q  ; -RLMP` ?R0Spf10S<R00P @0Pႎ0 000 R r0 11@pppqNZ@ (K, KSV@(` X fPp(0Vp `\pX@00000C 00 0S (0VKZ@0@`0  f00 ` 00SS$K蠶 iiB*99>*R0S0S0  R00EE(*&"R!" Q\R0"S0Q0 #Rp0 00 R R R H0 000 S S S  R00L -,@LP@00 -4@LP AP  r 000 00 0] ,P  r 000 00 P  r 000 00 P  r 000 00\ P  r 000 00  P  r 000 0 0 P =Q P@pWyx00#S #W0 S SHP@0 S0nP0  0  @ 0-LPZP @P0yy*800 S00CS0+00ᠶ00CS 000 0-X0L0@S)00CS00PӤ0P00S0蠶 -0 LR@ r 1S01AP0 0C0 0P0CD0HCD -LM0  \CD p-LM @K`Pn0 ~Kp蠿 --LM0 0 K 0P0D 0-L MP K1PU 0K KK00@-@0@000 00000#EgvT2ܺ -L@M@ hKs ph( 0 @ 00# d ,0*0 0#`a0"00# \@dȟ0! 00#X@Dlŀ0 0 0#T@$(0, 00# P@ b* 0.0 0#L@0"00# H@ǟ`0! 00#D@̀0 0 0#@0n)+C0,0O B0#  <`G' 0.@0 0#@8@@dE0"00# 4 0$00#0`ǟ` 0! 00#, ǀ0 0 0#nd@& 0. 0 0#  -P@0" 00#<@|0!00# ` h@\Ɵ0 00#lƀT@<0,00#@@& 0. 0 0#  +,@0" 00#aX@0!00# `D@ş0 00#̀0,00#\@% 0. 0 0#  b)H`E0"@ 00#@@dF4@0$00# ` ş0! 00#ˁL0,00#n$ P.0 0#  T0b&P%H@`0"0# ğ<0 0 0#lȁ0! 0#d@d$0, 0#  HX0b. 0.0#L@, 0"0# ğ@0a 0 0#4@ā0! 0##h0n 0,0#\@  * 0.0#P0`0"0#D@ ß0 0#ll΁0! 0#P#,0 0,0#`@ 4 b( 0.0#h@000# L@Ÿa0 00#lˁ000#T@"0 0 0#  % 000#\@|` 000# @@\Ÿa0 00#d@<ȁ000#H@"0 0 0#  ,Ab- 0@00#@@PQdK0P00# PP4aX0`00#``Xe000#<|` 0 00#` \lˀ000#D@<1  0p0  "0u 0 0(KxjVp $ν|*ƇGF0FؘiD\"kqCy!Ib%@@QZ^&Ƕ]/SD!7Ç ZEogL*B9q"am 8D꾤K`Kp~('09|eVD")*C#9Y[e }]O~o,CN~S5:*ӆ -P`1>?0@@N10@j@RLp0@P:Z @  aphP\@P@pG?W W   oʒ -L(M< 1>?0@0c@ S80 D ,0@D0 @@ 4p 4 0 S S*S? +S -S S t 0t0 040 0S,040 @t@ 4 00Sx 00XS xS!t@80K4K< K@V0S@ Ss SV t 8 R =LKX8[0DKLK< QC4 040 00S S; x 4 P  p Qp@Ւ4$p@ 00@Q:*040 4/P00@9P0P M0SI RQ 040   @@ 64 @040 0P 10@S 24 P @0P@ 0 PPp0p R  \BSp  0ӓ"p R 0ӓ*@4 040 00@ S00 တ @EPeP:x0 y 4p 4 0+S -S```040 00@ S4 040 0P 10@S4P0@ <,404 /P00@9Pڨ*0e\S 00V0c04p 0XCx R9NP IP4iP nP/4@K$WP( 400C 40 WP40040 H:@0 04@KWP 400(S L KYPH046@0 L0D0 L0D0 @0 H0t0 4p DX``Q0ip| T0 VD @ 891H C r@ P 0gqD @ X,ʋUP)T@T T8DK؄1 PhT0\ʤHDK1 wrT 0eA rrD @ T0s`(T@0##DK SqT0f @TW  8DK1 VrD @ 0 MSh l d ` (8@0 0D0 hQ 8`Zl^Zd\ZhZZ`XZ꘧CbpD@K0p` -r@PV!D@ @P @056C@0 87DK1 rD @ @\'7 R6CR7 @0 560@ D0 @ @0 RO@d  6DK1 pD @ DbB V60␦j0p0 D@K0` q@PV pʄD@ @P \ @h60#:kcQQ04QD0 A0276@0 D0 1D0 DK 0P h l d ` 0@D0 @@ m `5P| p00WPh Y ` d h0YPl S h@  ! ⸏DK, K00KZP8 D %[Pd ? T,0\T `0 ࠣSc00CD0aS6b \ $ cRb0 B"00\0 \ @0` @T00 S 0S p pc@c`c^ d#[Pd  8ZPP 8eY8P T8KZP8 Xl [Pl Vl;ZPl Wd3ZPd l8YP` 0 0dXPZD0S@ 46S830kS` 0S0Sx` Z0P`0 dXP*mfZ@ 4"6S5@DT 20jS#:k0c&B# P&\2Qp l206@0 046SD0S\ ,"@0 kR7R9 @ 206C#::@0 0D0 .\P @0D0% ZDKD@K0 c 0xoD @ Y 0\o @P0D@ @P P `dU 1@PWPHZp`ZD0S@046S S@0S p吐`G t0WP t0`pA`p3 N ܿ0|?|A?55?5?P9 (09pZ@P@Q-SP`p l0n`p@0p QX (56CDKDK@0   0p 0DKnD @ @ 0A0S56P@0 <$\q 0VS+검VX7 0 pSY@0U 0@ S 1Pp0 SU0Sp#@UpPd0U W 0VS ` TPF:0Vs3?*!:ܵ-]0PP000P R* p- LR@ 0`Q0PS☁`V*唁000SP 01PS∁0U僁00p -LMPq@ |   t00  t%`pDAP P_ 0  0S 0S0T@V`P L00P F0 0!, ჄP  pR 0S '0SpZ 0p < ,lP  `R 0S &0S`ZX`0 0 0l 0  R:0 0F@0l@AP<  00l ㄊ 001  0S0 i@00`P  'P ׀0 0a0 @0A 0  0, 0St @V   -MLMğ  ` ,  P8 @T g@ 0  (0 S00:Gp/0@@0BNK@D@D+P 0K@A (BP 0* 0U/S' 8: S S!BNK@D@D+P 0K@A , P 8: S0 S/ 000>K(0Cp   R0B0S/S@@Q P PU0E0/S |(U@@K0@S@L+r+ZP  0K@@@ $ P0Sm B^KPEPE+APb@0PY 0VW 0p@ ! ( = 0  d0S00p0/ 00 10.S0.S%@ 8T*0 S0 T:p @0|P  D8` pP (P 0@  ppp ,0 S6(K0k`_? -LM:KM,0 K~S0 D 0 A KK@,^@`P*K0A@ Q p 0S /S000S P P K@JP 0FV 0`SR*0S0>K0C K,0傎KPH?VPv [V *V00u@!TP0S p]RP!T`PEr!T||#@ @[X:0:S7P:;P1 0]S.0e,c 0^^  R*0S `PU  Ÿ0l10 0᳀[X@p0 0 ]X 000-S 0]S \Ÿ 00p@0]S 00< 0P 0< 0 0.K B<X 0 X1R ! `Vo1`(K0S KLK*KA KKA(@0 0 PO 0 P < SEK:K0 ,0 > P;Ipi - @ `P0 AP 000000P  0$  00 00@QP7~ 0 D0 (K$/[!ܵ:-]?**@:L: -LM0@{S0}S0Su {KP>K0Cj@@C@Tp0 @P` [S   0]SSSP {S` }SVゞKIC `FP0SK @@0[S ,S2{S }S-   0]SSS@ `V`FV0 CQ 0:0S0 P  00 @T (K -ML M`(KPp@ PQ 0 000 <Q 0pA R>q< r: 10aR6K @  @ 0\`*KS   0R\S0L0Q09 B0@\*0S @K @00 @( K Koop 0 00ᘶp 0 00ᘶ P Pp 0 00 ᘶp 0 00ᘶp 0 00ᘶp 0 00ᘶp 0 00ᘶp 0 00ᘶp 0 00ᘶp 0 00ᘶp 0 00DᘶP @  QA 0SbG-Mp(0`SPP0`00b@070 S:!^ ^5*.000S0*.\ \\00S$*\00Q*0`0SZ0Y0? 04030#Q0#S 0Z RYh Ѝ  R P*0SPl0p, 0 00P000ӑᘶD -SL(M @ D0 4 80 <0  D\D D < 8 < <00<0 <0S8 p @` BL \e D0H,0 =,P00 / QN&0C0H0 .S+ \SP P@P PPH 0aS0S0S00l.SP 00? 40 R0S0 l 80Z:Q4 PL*8!A4 =R#= B0,@",0 a = R <0LS 3`5 5<0 5 .Wp \WpW 40R*ppW0fSW`B 0A>S\ 8 00`Ws40V:\ 80000@ b(K. ".Q  .RA Aa0A \.\A Aa0ARS 00A S  RS 00A-Q S _Q  Q0*S0.S S -0S ]S.R00 S Q\R !R!0B.R]R0S! C00 <8 < 0 <0 Ġ 80 R-$L 0 0 -L@@zT p- LRP @T@z <0Sz$0``PPzzzvP PM@9I@p -$0P@@L`Pp}0P@  @ጄ0(P004$0L0000H0 L 0- L<Q@ *Pcz00?0 0 }PPP PRz P0 -LlM$0@0`KH`  P p PP 0PAp P 00l / 010  P%L 4,00.R80M0S L040. S  ,0S00S40\0   <0S0 P 0  P000K -LlM$@pP(R` `PP KPP4 0R, 0R0 |0R yP00PqW@\l@K -0LR@`p (|PPPPyPP0P0 0pp 0^10 -L0MX P P X Rl04$0, 0pX R0<0  $ 0S 0< 80  8 00 c<  8 <0X @S@R  0T D0 H0  0 XP0H D0  T  00404H LD $000S/S$0L 0/  0 <0s@0 @ 0 @ Z, L  piL , P 4 $0  0.S0S 040. S  h@P Q&: pP T`x, 04$0 :, $0` W $0 00  40 4 0pi@0<00000 S$0*x,  $$0 :, $0l?00H0S < R 04 0H 40 0,< R 80S P P $0 0L00$$0L 0( 0 0# 8<0S0@8PS<  B< ,0  SP0,@ @L P@  L `P]fQ00c00 RL0,  Q00c000S0 <0LS$0 0L RY000C00 0 00D0S# X L0SR<0S $0vP 0:PP  $$0 :, $0L0ST R,0 04 0L SR,(KoQ0,0  4 R ,(Kn -pQ00 W@@TLP 00;`@$0 4D T1 T.P  W$0p:$0<0pS00/S $0` B\ @P6P TP` 0-L@PׁUP10@S0 -`LVp $0*0Q4: Q4 0C8S .P$0 P4֡ 04ơ0 $04SFQ $@ 4 0R 4 P 0004P   :$0z000S  0OP 4 04  000 R P$0  `00P0`V\ w<0S($0@SP$0`( L$  坁/1P P0S @-P ⋁(P04 00 94S S P$0  P4֡ 04ơ0 $0040$  0R/S@/00(  LU Pv<0sve``60$ `<0S$0$4 $0  P K@ 7G@ 2   L0P $0P:$00`S004P``n -0LM@p  00 0{(yPP0P u 0P p00$@0 0$0  P @P^ PV 0`<0'uP00E @P? L000<0$  P $W``Vp,0`@,` ,@  ATWY Y` vP `0 $$0d P$00$0Y u %uuu000 0(K@` p-\PL0@SŁ0` 0u0S0Suphk꠶ p-LlMK@`P%0: S kP00 xP P"<00@000xP uP @0@`0@``PKp 0-L@ɿpP  00R00S 4P 00PP 0 㪿0 0-Lsp@P PP 0S- " 0\0  0\0  -L`Pp@P PP@@ PP@@ -L`,M D0 0f@ P T0 P R0V040  4 @0S'# ff<0 H 40S 00  40H @pH0 TPD P<0X*@ p@ 0R㖣' (R0B▣( @  1D0P  D0d|d pD0ev  D0pp40S 00   40O@ p0B▣)0@ P80  4 R 00  409p@T4 D0P f0  40S 00   40 fp0 T0 00 T TP D0P_ 00  40Pf@W'8 ff, L 40S 00  40L @pL0 TPD P,0X.*@ pjph\\  l400i PefQ!Q 40aW| D0 U |e@ 4 R (K 0-L`P0p Rp0S   P   @!R  000lRڏ0 0  0  00@ 0-LM4P0@SK0S8蠶&&֨*LLҨ*ooͨ* 0-LM 0@0 @P$K0G-HM@pP0 #2b P"3 UpG1?7 (1 L0LLLWW& 0 00000 R0 S` h.22 1 W00&#!0=00=00P U03107:Ѝ -`L@pPUq ("000L=QN eP| UClbbb@cT P< Vp*1 P0c104T Vf*!0 bB2 Q05:PX` PT VQ*P!0 bB1 Q05:PC`P T V<*0 0c  `PQ/ U-DdDdcc0000r 0  PR=R  r 0  PRTV*0SU `蘶 p-L`QPPp@H0S@ z~PT  0Rppdd* 0-@PL PU0. @ |@P0/S P /U l0@P  Q0r/S0Pa U:@?00@ {000P c* ?0$ -L0@S`0Slp0S s00EtPZ 040 {$@ dd`PT ?0$ -L0@S`0Slp0St00ouPZ 040 {$@ wdxtdT*))*0 ! -LM@R$  ,  `y0A XK00C 1 儠K─K0 h!0!S @PpP P " [ ! 00P 8P L00L0 60[S0 60KQ Q , {L0 0, L0 {x00x0 00 0 \3 K0 } Ky Ku,K q Km Ki Ke Ka K]T{ VA p ! # T *!R00K [r d000 1S R@00 ӑ KW [R 00 ӑ K0[0K "P  0[ S S00L0   , {P  wp0ST!X0S K K K K K K K K ߣK ۣ1S j1S ṣT4P@!TU!R e10 qQ P@p ,0 S(,'(K0k@!gDHT 0xP 000ӑDP 000ӑH 0-0L0M0P0 @ DK<00<0 D KQ Q QT Lg@ 00 0 S&K00kt,t,t,hi*e* -`PL @0S /pP PUP "P -L 0P耬 0-PLP "00@ p@@ p @@0 -LM0`SPP{#P ,K0K#@P 0 R 0#S S 00S# S0B00 0 6P0d00 0sPPk 0 cy00%P@@0 S SPP h%pPP  %,0S ?R0Sp 0SOrP PW@Pp)+ S S@" 0@1UrP;@k7 @00000c0P@LY%P p@T 0S0 0 (Kl -LW0P 0-0LS@P$$"-# 00 00l Z*((V*GGR*N*##J*''F* B*$<*MM8* p-0LM0PSz0@0S @T00SzxQt0 `0 0STz!`K ipP0S nux蠶L p-LM, 0( rSwS@T }`00{ q 0S`t $K P`10Sz`p@ P :10Sz$H F`nUd1XQ@0S07@T, 0rS  @$-T   $$P $(0 jd00SXz, 0rS$` , `$0LP`0@0S8>z4 000 S 5zKp蠶LTg -0L P -BML M20PP ,0 T$ 0S /`PP0 L4 04 J\wX2@P@Px00 c]0   0| `BKJJLT `0SPa 8xP 5x0 Sp1KH4 0D4 1A84  0@d 0@S/ L$ P$1!S 0 c@] P40T$aBNK@D@D`PL$R N 0K0SG00 ,0 S,$(K0k U`$gT0 CP --0LM00  00  0  0S10 c] 00 00 0  0S0 0 S # K0k --0LM00  00  0  0S10 c] 0000 0  0S0 00  0 S # K0k --0LM00  00  0  0S10 c] 0000 0  0S000  0 S_# K0kP p- PLM@y 0K `P(  PP" R 00R d 00' P 8#0 <000@$0(0 ,0 0(00 0 xI|I,I$I 0-0@L0PS90@S7@0蠶07R0S0 0A R R!!*;*; -LaM ``, ptP@tP@T itA \,0 c 1   ^@P -LMDCDß`4 8 0 =< @0 ^PpfMvp0C 0C 000z 8,Kc0PD,@@ LUP0 S 00K$P00<<, , q ß000 GQ, +Q7 -Q4UQ ZQ  0 MS, ,0 TR,0  SB @0KL#0, @P 00K,(#@P 0 0, <,0L CA0C0  RS0,0 0 P0 ,00L Q , 0@ R:\ , 0 R@R RdPj;P0  U ~, ,0 r 0004Q1 r 11QDRd0 0v>C 0C0!000t1@R 0vn `djPjp3 0ST10 2) 00C0000 0!0 000 0R0 0% PF@{F@i@@eiP0000 c 0 S 1X0 0,(Klt $,8n'pt00@-DP@P 0 0S 0Q0c0)p@-`RP@ L 00S 0\0cpR ^p)2*P0x -$0L! 0-$@LP`P`$`P`0h` p-LM$`0PK@.05 P P8;,0,00S0KKpT -LK0C< >K,BK0C0CI B< I0F, < /mNP PP"@iT  Me( K0Z (Cpd  If,0 /S \2Xm/00  ,8[Sr (ONPm JN@P Xf<@/(0f@]+@N!PIKAG@P /0STZR)<0U<: SA, R>01L!屩PP>( K0LC,<[/S@ X<@/0@fZ ( KI,RA/P0 , 0K$ K0K bp1 $@K0 ?h;&@p K, /0K0K 0@ bpD &000 0 00,0  K0K0Kap   D  +!+ K0,  i0@-@0@$00 0000000 0#EgÉܺvT2 -/LM0 @ lK,0 a1Ahp PaA ad`lnDi4 i80/0%1  d0 ac 00#l1 p `0(p0 $nd-c Hc1@l ` 0(T` 0\,@1 P\0P Q\clD0%X0H@aqbacT`Οc< Ȑ X0' &@0 P01 T0Q T "aDc, 0% P0H͌@`lcTc< 0* (0X A1 L0 PL|  "d Qc,lDnad@͟H0% &@ H0  "aq@cTcL?1 0 @?Rp0@`P@Pl@  G[@@P?0S@@:  eo3[ -0L M0P@ 0 (`K  !tf@Tx ~op` 0 P Qn/B(K 0 SK0k 0-LP@!1 1 !320Q\ 0h][$PPm* --LM0 0 -L@PpT0` LLT  0j0$   4kT8!< --LM0 0 {j Khh0*,*  10BS)00 0 00S  0S0 0S  -0L)S`p-010CS)\& 00 0\:@PT0 P 00@ 0S@P @T:00 p-0L)S`&010CS"\ 00 0\:@PT0 P 00P:00pP pp PQ 10C0 -QLp' %R`@@PU@ UbP@ [ P 0Pg0 B T:00 -QLPp R`@@8 P 0S0B e0@T:00 0-PL @Y0 0-PL @Y0 -LR0L0@@P T@ lR0  0 R B0 0 Y -0LMS,0 P@0Y.0D0TST' T%0 `7XPpp``UVZ W@@ W G00 Y@, 0  00`QQ00 A00 Y -`BRVPL@0R,U*p Wp00jW d00`W`p P j0@0@@b00P0PjQ0PE0P -BRYpL@`0R6W4P UP00hW d00`W@0000 S0ppP X h0@@@b00zP0PhQ0PE0P4*-R 0R \!* -@L0Sp ZP.0Q 0 ZP"PN000QP0 0ZP 4`4P4协  @R00 ك*RRԃ*G-$1M0 ` p00S0 XSxS  R!! \s  D A0a00c0PP@S @0 C .S^ s 0 0m C Q171Q Ѝ蘶II*6*6 -`L P@0SV @P /pP @TP @ - L0 0P 0-PLP 00@N@@N @@0 -LM0`SpP ,K0K@P 0 R 0#S S 00S# S0B00 0 P0d00 0.QPPz 0 uW00P@@0 S SPP P P  ,0S ?R0S`1P8#8 $#$(@"( @0S VPP PPP/ 00@% S S@! 0@1UPP=@[9 @00000c0P@H[@P T 0S0 0 (Kl -LF0P( 0-0LS@P$$. 00 00l 0-0LS@P 00400Sަ0 R r0 110 0PS PP೼0M00P @0PM0 00DP M0D0000000S0蠶 0-H0LS@P:0D3PPDHP0 -1L0S@Ꮶ0 R r 1S010SBPF  P Pe0 :0 a100P`PP f+DAVP `P 0`cpPD )V0P0f00P@0P0DPS P 0PPP 2蠶 p-LMPK1`P@' z@P$  t0P00ı@ S00@000H0`$0@0@,080(040 00 0xI|I,I$I -0LrS wS aS   ̠߿00 Ϡ0+S bS0+S 00 - L@(00S0`0000蠶 0-8PL0@S㬥0`000S 0h覥0蠶 -LxM@T P ( R  0Nu0SZ ZG ZE :C0 PP` 0  pP`q0S  k 0 00 0PUoS <0PUo R 00cPo K  0 0 40SDA 00P`0S 30S 3\ 08CJK✼P0: S 0;00@ ;L 0ZpK K↼PPpK K pY0 P  0 pqz 00 0PPoS <0PUo000 S 80<0b q/ 00bU 0R60#0Q  P`VU0 ab00 0P @0PK0 000 00+L00cPo 0 pq# 00  P @0PJ000PW 00 KP R :0 e00 00S0 }-;P K 0 pq00S g00P @0PJ0 000 0P080$0S P  (K,I0/ 0-1L0@Sg 0 P0X- 000@0D PG0P00P00000P @0P_J00P<0S0 80000S 0 90088  R0  $0X P  0 0000@000000`0 0 S SB0SP -R00 H"R00LMS Q00~1`0 Pu 0-UP  +U0,0 P ,  x 3X00S 0U0XSxSP` R 0U ,0SAA2RpHR, @R Wph@pg 00E S u4 000. W070 cR(Q$,0S \ 00R00S b F"  \00R00S,, 5"00PZ QF 蘶 0- LPM0 dK P6@K R 0<K <0 N0 dKH@Kn \S0 D0 @0 H0 V|5>|50k -@Lܠ 0 0  -LpM 0 s`  0p  [0s Q@KjP  Sp`h PKpK; 叢p@p奠@ 0 SK0kd< P-RL@  ?  000 -- LM 0  8 K -ML MğPL,  P, pP, LP$\L4#0D$P[%[0 S2 iH 0NK@DP@D0#|R3L,PR@[` PEP`@ 0 D<0RD< 3000S p#YRPEP`@ 0 k0@#KRPEP`@0S UPEU:00 00PEBKJJ-%V'0mS@ L,R H "0 "H< RPH` %S00X0S 0`H`@X`H`VB.K` B BP<P 0žKEI I @i DK 0i0c8< 1A4< A0 0< < o0S  0   0lP$07S p 00`^K®KPEJPEJ=  0L`P07S p 0  ݖPPK@>@r:0i0cK8< At0A 4< < 0 [ ,0 S@>(K0kp@t4k\X$TL 0-LM@00 PUP8 -LMđ K -@L t8 -L@LPp? 0 /T #R 0 1 9 P@36:/0 9 P`$*?XQPdP0@ O0P@X P*0`@@ O0f OPP@D"@X-00@ : -LM0@!  0 Kd -LM`p@ṺP0PP@0  pw@᩺TPPK蜶d p-L@ 0 0P  xF  p-LP 0 0^p@,<4("4!<C `J,<4("4!<0cS= @ @,< (l<4",(.̀%"4$<PA `@,<4("4!< 0cS<,$ 80050SL`K`PK`T0KXL PU`QZ0=@P`  L2K P0= @@ @Q R@P00Y0X00Sz0<K@ K@  d 0LP0SPPf 08 40J`0h 0RYx@K h0`Kt P* 440S@0 @ 0P0400800S 0@0 !\ 0 0 P  B xP@x@ xP 4@4ꗵ0#S  ,0 Se(K0k?B  -40LQ< 0(  p-LM@PU@_DP" P<\00`Kx0 @ 0 0(,0<,00SKp0S S. R R@)) )()0)8)0 0 0 0 00 000 R0 R000000 00000S00 S S00000 00 0-00000LSP@[P 6P QP  LP 0hF0 0-LP@P 0S S 3P 0h-0h 0 0-LMP@ P P 0S 0#88  0-LP@P  >0h0 0-LP@P  P 0S S 00P 0h0-  @  0-0Sࠓ 0C0,<4("4!<0 00 00S0C0 ,<4("4!<0 00 00 c0 Q0a0  R %3 a 0 0% %  0-0LS@P*00b0 I 00 00 0-0@SLP*00b0 I 00 00 -LM0@S0C0K,<4("4 <0!  I 00 0 0-LM0@SP80C0 K I,<4("4!<0 00 08 -1LFM0PQ,0 p@ K_K<N/K81 pR 8!+A[IT081 4A `T041 081 `)x.005@81V0OK@  >KKsK?KU N/KkP?@ ,0 S (K0k< 0-L@PrP mP hP  0hb0 -0LM $0 $K K 0-LM@PT :T80K0!080KP 0088 0-LM@PT :T80K0!080KP 0088 - LR :R00 - LR :R00 0-LM@PT :T80K0!080KP 0088 0-LM@PT :T80K0!080KP 0088 0-LM@PT :T80K0!080KP 1[088 0-LM@PT :T80K0!080KP 1[088 0-LM@PT :T80K0!080KP 1[088 0-LM@PT :T80K0!080KP 1[088 -LM0@K0!P00 -LM0@K0!P00 0-LM@PT :T80K0S00!080KP 00S0088 0R0-L@& P0PeS 0P U  0h0S 0 P U  0, 0S000T -LP@p`P 0@S RV -LMP@U` :U) '0$PK$ 0 0P 0$pK0P 0P $0 @@00K -LMP@U` :U) '0$PK$ 0 0P 0$pK0P 0P $0 @@00K -LM0PS`p@ ST- PG  KP' 0S$ R :R T  @P@TTV 0   <00LT -LPp`@P( PU0S"0S :SU T ?P@PP iT <00hT ; 0-LM @Fx0 0 S0K(0 0$0 G0 R r 1S01(K 0P0S8K0蠶 -LM0S@ 0 0SSP  0 0 0p Wp  W 1+#,Pp`00`S0 000 ,0 dWp 0B<B S0S*0P`` 0PU:v?P 0 0b00P0P  UP! E0 0e P0 #0PW  E000{P o W:,PP e E0 0g 0 P00eS0[ pe0p00 W 00S   P00h0,0 000  ,`0V`!PP00V0S  RE0000P $V ,PP  =E0 0f 0 P,00S,0 P0 00eS0 pe0 @00 (K p-0L@ `V  00Pf`0 ,Pʼ0@00p`P` Up p-4`L0PS0@S p蠶 0-@PL\0hT00S0P 00P00S0LA -P`Lp@P0X@SpPUZ`V謷 0-0L0@S 0P,  00P @0P;00P0 $000 0000S0B< S @0  0 0c0 000000 p-LlM0@8CP`JKP00 ; 00  Q00R0 ;0  Q L ( 0R   Kp,I p-LM0@ C 00 !K K`=PP0C0  0D 0 SPP P RPP000Kp  -L MP`800SNFp@T 0S @ 0@P0p 0@0  FB00@ FP0 00 F00S KiF K蠶( -L M1 @ (` P0E% 0S Z 0Z E 4KC  0,pEP   E W 44 PE`VZ@TL Z00C0 S40@ @T  0@(K( -L MpRP`@H(10SE1@T 0 0S EP0P 0@0pP" 0@Q0 C00 F "Bp 00P0 B  pXEP@ @00SpE$K蠶( -X LM^   K0K  Cp 0 K -L@pq0:00PT:0 p-0L @`P 00: 0phT 0-LP<PP00OP0T@00:00 -L0M0@0@K0  0R K0k #t,@R 0S@ R0 100S 0C0R: 0-0 RRL@  P  100P:R0 b320 0 0-0@10 L0s00R: 0Rq PP@  ! LBH @0 1 0 -LM4 80 P0 K,0K@ `P? ,0 i00R000 ,  R5Y0S @TT T  BR \ 0210 32@@,Q&) ,Ppp T( `P 0@0y0@1 @d P p X0~ 00 p000 a `P 0@0[ p00Q8a Z00 0S 00 pP008PJU00X0S XQ4 21@0PC B 0T0 -`P`p 0@0XPp  Q 00000 娫 "00p 8K 0  @000@r (K -LMoPpU 0 K PB:P@ A S*PA8?0@P0 L@ 0D0 40 @p @ 0 S S*S +S -S S  00 0@0 0S 0@0 @ 00S0XS xS @KD0KP4  P  @ 0@0 00S S     @0  T0 QՒ<,Ѐ 00@Q9)0@0 @/P00@9P0P M0SI RQ 0@0  @@ 6@ @0@0 0P 10@Sࠃ 2@ T @0P@  0 PP0Ѐ R  \BS  0ӓ"Ѐ R 0ӓ)@@ 0@0 00@ S00 ᰀ @EPeP90 y @p @ 0+S -S```0@0 00@ S@ 0@0 0P 10@S@P0@ <,@0@ /P00@9P`+0e\SVl@p ZDQ:NP IP5iP nP0@@K8P) @00C@0 0P@0 0@0 0 40 @@K#P 0 @0 40 0(S  J 4 040 @p   h 0\  R040 00c0  R   r 3 Z ``Q  K VP L ڤ91H C !@ PK 0 P L 5^Z[\P 0PKF4\^ P  9RQH HK 5 5@`L06H0 / @`\ 8PK1 !P L 05\PK!Pj\0^(ʈHPK1 {!\ 0eA v! \~L8 2#PK Z P L 0PK4K<P 40S?Q\  0f@T=  7PK1 I!P L 0y GCb46 56,ʠL0 LLPK 2!P L `FVHǟLp4656L0 P@K0` !@PV >F@d  6PK1 P L 09 FCb46 56,ʠL0 LLPK P L `FVHƟLp4656L0 P@K0` @PV 5P@ LP 0#:?C0C PPPK< K80K9 PD  80@a<0T0<0 w<0 08 <0 <80 Pn0Ug U0 P 0 4@lT D P80D 080  R8 r D0  D0 P040 RD 080 00dD8 Q<  0S00 $4T 0Pp [ \`  p Pt L p0 ! l>D0Px ? D  ! _>8P<@ Pl 1 \i\ pp  0Pc@0 n0R0j0 0b`PU00S0ScPc`c\ l  0Pl0  xO @P x$x@ iQx Px axWt Pt  VtPt  XlPl  xtPh  0S0S? h ` l P00R00S4 0030 040 * V 00 P040 0\40 D@ 0 S @DTT50DP0@D <0 wV0!0PV00!  Z0S4 0\0ShPh q lFP040 AV9 R4 8D210 N ܿ0XAV瞯<??0 s R: 0 1S0 D0 B !08 < 40 0Z!04 PD!040 0SP<0 0b<0 8 PD 40 0,Z00SxD0t V PD  08@1@ @d@P80080 !0Z q040 ZhlR 1@PPV 0Z00SP  D 00 P0< P 00 P  p X J D2V l"l2PPp PX 2VX  0fQ Q Q  2P U U   0PX 0 00cX 0 Xp <8^d `  Q @aDxPD d 080 <00d<0 , K00KP| W ,Qa`P| L UD`5 01D|PD ? @^R0@DS A0@PUDڌP80 0C 80 :D1PD  00C0 <0X 0C <0 *|SPD  0 0CS A0@PU^ 800S80   D<0 0<0 0 X0 |  \R< 80`d0X Q00R0S3 %5 @P6  1`pP  0P40 0 0P 0q 0 P400PDxtlh< Q80 @cT DPD ~DdA<00d<0 <0x0tlph<0 S: 00S S SP" QDz 000020D0  040 R:0 0 b320 D0  040 y"00 000^ PD00P0  40R 004  @040 ["00Q@00 R40D <40 R =D&4(K -L00ሸ 0-@PL0 +@0 -LMhp8 W< @0 P;l4P@p ; #p700S @008 40  40040 0Q `70S 44 `@ &Q `@0 B0 R@60S`00 030 0R `60@s3040 @ 0S0SQ  0 SQ@H @00SQ0a10c00 0 0PS pS(0+S -S 00S SP C >"00SC S00X b000 4 80R80F0ZCP0f0CI X 0 S S R0S OPP000'S S SQ  R0pbPP@@0@0P 0P @T0U 0g R#1 0<00SPP  , 0CP0,@  q0Rh ^000Q@ @dDA@k`Q@hP D21 03pQPppQ00000 @aPP 0 d0 , p00Q뺣룠/0 RE00`cV) 0S S SVX HPQ  R 00,0@ bP0<0卣h뉣P"00`W@FpTp, 20 2p0f00 W? 0S S S70 2 ,00, 0bS( `PP* Z 00CX21 030S@ 1 0dP00Q0 p @ P0<0 (K,0  0@RZR R \000A10 00 R0: S:0 \ 1 21R  10 02SR -LM@(KPy,Kt0p, c(0`0b2SzG  0k$K -Lp` @7 00RʢP! 0 V0 0@ P @@ P 0 B PP@ U @ @0 BP U P 0"Rp@-"1@ 0`  00 3$ Pd05003$Q:R 00Q :0 0cC1S00p -LM0 10@ @R*0 S K0 @0S" 00          $  (  )  *  + , ! - " . # 00/ H0S <00 0000 00 X`\d0@-@P 00@ b@-@ l 3. P: -2LM008 S@ 0 2100 000 4 0 0080BP0 S SP00S p @ ,p W0 XSxS0 SP"`V< S$,0S T0#03P0S  T7`$,p P0 S0S+0 XSxS&0 SP")S00W0S8 00 )Q80B 0 S= PpT  $ 0200SW* T0#03P0S  bT  0 T000 R 40S 4 0 b 21000ASQ00(K,-  0S -4@L,    h,( -L ` -L` -0 PR0P`L`@PH 00010p 8!#800"( (!( 0( \"x:0 0b 0("( #8!80#x \:W  0RPP@  ! 6@0 1   0"108#8S"("$"""!   88S00000P 00-0 S10 0LRA 3#\ -0L100`p@PC 0` P0 `6>03U<U@@5 P 256 b42Uࠓ> 0S0 0-@PL 0 S0he,D0C05 `0 C>@0C01B@`@ K -LM@P`PxPC 00`0P@``kP6 p0!1  0 ``, @P0Q Q @ ^ P@:0t @  P@,  0V: pG02S p -0@0 LP` V pP 0!R 0010P n0>00R3:Q`0R0:0F0 -L M0 @R0@PP` pWP9 10040 0 4S:1 ! 00 `P,0 0 Z 0 @:0 0@^0:@P`,0U:4 pGW02S p(K -@L P00@ -LpPoȟ0@)"0@ \0P`0 0Zz@Pp  ! U4Qp 1P  -@L` 1 1`P@ Dq> APU0S6PUPP+ 000S|6 B@P `p @T0S\f6@T.P@ 0S X6P`8Dpq0 S0 Rp@-0SP`P` D4%LP`\p0S0 C,S R-S+S0SSP0@-P  00L S @#0C^00L S^00 0-LMPK@ 0P  >00:S 0P 0<##00:S  0 P0 008 0-0L-SP@ +S@P T00c00 -0LJS@000 #MS00  0P& 0.S" 0P 0.S 000C S00 [?qP 0/Sh00m  -LMPp@,  d1P0,0 1p3, 0S# S Sf 1,0 2" `0F00  1:C=C,0SO ;RMX1@H0@!B0ß00 QV@@Gd1dP1 @ 10 @1T  U0B0C@10P S,0 0 \@ B1Q \000 O0O(KTQ 0-PPL{1dEAw1`00 R10bQ1bQP00 -L$MRL0 H PP 09H0D LR L=Q:S0T.U50S4 ( 0 5  00S9P0 4 40040 U0L SPE 0S 0<0R 4 0"4 8 PUZ4 8 DğP 0, ] D` @ < !< 9$0 O Po0@0S@T SUQPRZ ,00K00 ^P,0pß0Os/< PL$ `GPU`<@H9@`Uį,p Z,@ d0P0p3`1 Qʭ P,C!r ,3V, `0D@ 0n00a8H lpz}HWzG}G2WPd0,@U0P0O00p031T,K`PX U 0 d;0P0500p03,KAPndؑ`,@P  d!0P0p31XL@PPLp,@`DP{D@0PfP/LP000L /<@0L0</4L ,@  d/P/p3 00 L00bL 0L0!0X0 00 0H$L L(KP@D@QnmL?QT R10bQ1bQP00 -PLU`p@//0c0h* 0R 0R 0R 0R 0R 0c -LM0 00  hK0S hK< PhPK`< P  PXPTpU R/ N/ 0(`Kp&0cX0 |PswP msPdhX ,0\`RPP/P /p3 10\0 XEp\0 SX ,0RPP.P.p3 10c\0 8P/DĔp,K\`dV ʨp` @,K,Pd .P . p 3X0\2"1Q c P\ X X` P ,K Ph,0;Q T0 v># 0Sh hK:EPh ;0 h0 0 0 ?S p 0O /?0@ @  `cP@a0P`ZP*Y`D -RLHM`@ +,6l@ P01d0 @0,0 0<S @>U0>Sv dl@ d ?l@ @d d@ 0Si ,K@Pd  RpP00PU& <U @>00 >SP dh@ ` h@ @d`@ 0S,S ;S 0KiP;,0>C00 0 s 3W4 R0;S,SDK hP& 0,S#XK_P PU|ğ @M00@H00 \ d,004 b 0a 0004}0Pp0(PPG,\ D0K g0P@ \ X0K^U T  G0  G0@ P 0G G0\00 \d=)P\7)p3"1p QʍP\  \ 00KSځSB0`"0Sh20c Q0TBD  0c#0S ,rR( R0 0h!00 0S, 0 n0O0@0 Sb0 \| @M00@0, 0d081 b 0a 0 0 00C00͆@0, 00 bhP  000P0PhP` d0` R `00 0 0 S l`Q d `0 h (KHH*L*LQ%X* -L@ P  hO p-L@P`U 0S00l"h0PLUP0@0 V40T(0(0p=0(0pxpBh| | - @L -3L$M\0p , D H 0S 0S0S 0S~ 0!0Sx0Su*8p 4 Q@ < P@KP010P0@"0L Y00.㓒tR@@*<5Q`E$L@ R0@80 4@ pW8p 4 08KS{0Sw00Sr0Sn:D8KH L H0PLe0, S 00R  Q  0OHSITGG^  0S0S 0 R 0S0S0S 0R0  0M@ H00K@L H L 08 010H0((KdY`X%t -1!P1UL00 `@0000" 010 \p@_JP 0`T@pm` 0@(PH=P0-0 Wpdt|%H>@ -hL0SX@0 0R@!P (@ @PYhldB -@LyShvSt p-0L (@PphQ0S P< n(PP,P0S P% PQ0  B B,p P` 0:S  ^P ph2p~lldBP* p-<`L@S  @PSpt  P0 0 p-8`LP@R @Rpt -@LRuhRt -LM8 4 8@K08K@_(`K0&8KpTR0@ Qp`0@K0@P0@ ,P r8KT R 0 @ QQR* 0KP'T"S `p0K0@K0@P0@ ,P N8KTZ 0 @YQR 00K@0K(K 0-LM  K00* T?K0 -L,M@<Ke K -,L@, 0_RP hp|\ -,L@, 0NRP hB|` -Lh p-QLM@P`p`S@rP`& 0V pxp@-`@Pb0 <250^@ 0<0p -LLM@P`p 4M%`^0p(S RP 0p#83K`#[ &8R! X.(,Ƞ3K0#KKKsK3KẂKSKXLT 9X0t @h `@ P P0\P l0 p h0` L0 RᴠX H`$`P{$`!PPE\ 8Rl0p@Xt 0  c a"88c !^@NLh00a#0X0 000#Q@DAJhPE000P d0 RP P\ T^ Xh 0Bn0T 3><A0 Q@h0"[[[2[x h[$[[3[xh(K耸Q -L`p`ppZ0 <0@PS00 X0AAQ Q0!0a0PR- \1,0l00 ?\0 00R- 0bR12<0 RQ ?R0̑030S@-@ 0l\4<0̠ \ ?\ 0 0@\ P R  0 00-R ,0l0>àS-0c02Ì.1 0 000 S 200 0 3# R02 R02  0 bQ B2c00 @- @0cR#3n P0C2Q0C2 d  l 00@- H. !Q, H@ ,P2\Ƞ3# 0 -LM@(pK` ,0K$PK 00K$0 (00, ($ 0 K -L$M4pK0`K@D0  80K@K 0,PK<@K0@ 40o  0,< 00`d D 0<@ 40Y,0 <0`S08 40, 000(K -RLM@`P&"xZ᐀"0 K40Kh(@K,PK0 400Bh,H0 ( Q02[Zz"$KP1#3P1 <2tPQP3100QP3100Q#2QP ;; ;Sp@-9`T@L0 QP R p(@00@0000#p p-L`P@@@`@p -LMPP`p P0`B53A0Q B"A0E0U00` EU0 @@ 0po@d@0@-@_Z@@P  @P0 p-PL M 0 o@a@[ PP5Q0 U0S 0 UZ K e0KAe  0Kp 00"ꌸ -LM( T"`@pt3Z,0 P T  W TTV1("SU*0U(!,0QsKPI T 0W0T0SWT  !0Vt0RU/u P (,8!0P(K,K 0e(,X 0SZ0P W T T0SP0S 000P (K 0(,K,00,0  0,0 ,0( 0P( ,0%$K舸 -(1LM0$ s3Xp@` S P SS``$8?S@!Q vZ-?45VCQqP0P_a$ K$0@Q T8 000$0@T  030? 舸 p-`LP@?@!aph -LMP`pf0, `, G  0sRq0P0, 0G  -L8MT P0 PtP0K :! vおJTTV  ,0K⨊J4P 8 0 ,p `Pd40K8K48 U2M&X , 0004 08 0HX4 ,0@RQ:S(:8 00RK:S":2 P0T8 40 %&00hX,0P1,0 0K,0K e,0A40140 :X X X  P g0S@@t-[p@Z0S XP@ O0SZI00@(K -L @P  - L@p -@L ,0( P00 -(0 :1LXP(0  XaAUpP+   dRE q`AP 1!0 1!( 0  P1D 1D , Z00  ,0o P-L@ 0At00 -L~M41Sp 5 000  @0 T ` `a pKKlq D @H `PLa 0P1 pX  0\! `d h 0 p!  p`,K+KDHa*KLqP)aK(qKTa `Xq\$qK`10dahq aKpl !p1@! 00a`0|a pq 嘑  01! 00at1 `xa pq 儑   @A  p! P Q 0(@2 `0a a4 `p4q$taxqaKp|,P1a1K`qp向!K 10a堑4qaK!( 1 1K`a pq Б  ! 嬁 01 `a  $pq ,pȁ @崁A ( P4Q , 8@" 0$ 1 ` 08q a ā0p8 P; pa6 W}p 0-PL@ P TA  P }@}0@0!311Q00 0-@PLP P 0 -`LCMV@, P}0 04w P. ,0P 1A  ,0 Xp0}@ 0 TKzP0T P0 V 88@0: 0 0000840, 8  8@0 1 D0 0@ ,0Q AKP0d 0 0Y" P 0 000S 00S400S 10SQ '7QQ $}0084@0 P0@ 1D 0$0D @ 00 WP0P0&2#5 0C@,0< 0(0 00 Q0 P0@? |@vY 0S50 1 A/0 !0( 0,0 )0[ 0*0[0+0[ 0,0[ 00,0 )0[@0*0[P0+0[ `0,0[$p00(,0 )0[, 41 001 410*0[41 401 410+0[41 801 410,0[41 <0 1 410 0 ,0 )0[@ 0*0[ 0+0[41 0$1 410,0[00,0 )0[0*0[0+0[0,0[00,0 )0[0*0[0+0[0,0[00,0 )0[0*0[0+0[0,0[00,0 )0[0*0[0+0[0,0[0 0,0 )0[ 0*0[0+0[0,0[0$0,0 )0[$0*0[0+0[0,0[0(0,0 )0[(0*0[0+0[0,0[0,0,0 )0[,0*0[0+0[0,0[000,0 )0[00*0[!0+0[0,0[040,0 )0[40*0[0+0[0,0[080,0 )0[80*0[0+0[0,0[0<0,0 )0[<0*0[ !0+0[0,0[0@0,0 )0[@0*0[0+0[0,0[01$D 1, ) [D0 * [0 +[ ,[   $ K+0[ ^0,0[ 0 !  ! (1s0 {0@h(A^d 1R`00CS\0   0@0PS(00 @P0P 0 1D 0!0 BR#N!!0 0Y Q  0 ,0P10A00#,0#04$1$0 PP0{0@ a{ 0 0000 0|0 0x00t00p0000 O@\_ j{ @ (Ka,hxX -pS00LMW00S@ W D{00,1$!W00/L 0(1 !$! aV$Q `Pp a0S 0P(1( U 0(0$QU0$1ZW(10(1 S$10$10 (1P` B 0(1(1 00Q R$1 !0$1^ 0S (1 8#0PS  0P  1S 000P Q 00c0 1 0000 0b0 -L M@  @4 < 0 D0 ~ 0 8`P 0 00P@8 7pW 4 0b\0 `P: P$W 0  4 00P'xS ,K,@ P,@ , 0 @PE 0 8 P8 X<0LSD0 @ 0P0<:<Q3P0/ 0S  D0FD00 00b0 gP @ D0^P 0  WP  000(K -RL@z01y00,1 0h; 0-LS00\00SP@ y01y00,10\ 00h -SL0@ h y00,1 0 0C0S2-S0!1!0 001 00 00  -LMAPTpm&' R0 W 0 0P X@ P   00 AT -L MR` X 0SR @ < 0 13 B1 40 0@0 < 010s03<0 8 XQ 1U   01 0Q0PQ!0Z0,0 R00S 0S S0101S 1Ua0P  Pa YPO V1S0C1\0   P0R 0S00S00 0 0WPs 00<3 Q B  1 001% p # 00S0S00S00  0p'PC p00 p 10!00@0@@T,0Q00001P0Q =U0 P < 0 Z00 PZ@8 041  01 0ā0P(K &("(30b  -L 0  -0@L0 S+ 000  -0LHM0P@ 0 7x0p4`Kd 0` \ 0X T0 0P0 L@ UH D` @P  0x :@ d0dK <0 080 wxD0p0S 0 S$ۺK0k4k؉48 -H LQ080 000 0 BS w 00 -LM0PC@ 0 0 b 00刡 0@ 0 `0D @1p0W,0  T P # 3TX0#03,0 0 p  p-0LP0  0%R@`@80\ lLN@#1A.S R00SRPp -LM 0`^, 0 F~[rP \1@0鎐pPIK 8 000 p 1@T  0A !0S0@0pW:P  01C0 0 P0 00,@C0  BP,!000  00C 0(K  -4LPM0,0 t4 @  ,@pPlKX X X`0 ? ~QP( K0 `DC\P `3`<0C>S{#`$l#`$`$#`$`$`$`$###`$#`$`$`$p$`$#`$#$`$8$`$`$H$`$X$`$`$`$`$`$`$#`$`$`$`$###`$#`$`$`$p$`$#`$#$`$0$`$`$@$`$P$,00 S,,0, 9,00P4p2P p (P,(*P(p&P$p"P pPpP P(P@0,0p p(,P P p P p$P$p1 \`V 0SuXV!$0@S00 P0 pP` x1p`֎P@<  9  5t :B< 00 1p`龎P 000 R@00 0 Z $%Z:U0 @   t00SD0 0S\u 00 ,0 S4(K0k, P D -L M2p0 0'P`80\ l{>0>0V LrPp0&ZP 2@0GpP"000uH@F1,L#tPU x0t S 0S  0S xtp0Y0jp0 *0S 0,H00! Q@X' A0 0jRV g 0S X0Y0j0p00jp0   0S 0S  h0P@0׍pD P000 p0, S (K  ->0>0L MRP`4 v1", Y 4P4!00f0ip00cYp pc@, t0S x0ԲP`txtp0Wpap00ap0!0(x000h0, W 0, 0BZ0 A:0, BtpW0S4  0S 4 4xtp0 0p0,Z00A@@,0ZD\ p ,0R,(KoS(K$ 4Ld -83PLPf `*"*R@ R B0B@ Tr@( 0b S:VoR T53$;2 PU (a e Pxt`"0( 0b0L0S 0S. (0.  c . B. iS0`ST  0S01t(tXPUd zP`@ 0St00CT :#:30#" 12 (i2!Q 1(1"(@0@R!0S00@@1S$ R00 1Sl0 0S  *1S1100S00@@| -L`sVp# P0S 0 @|0T 0S dhUX@00S0 h0 0CR0 sp蠶  - PLM`0 4 Dv^(0 0:CR*004 >0N@pP`sP 00u0 `P  2PsP(Q a S P5(  de0S ( 0b S*0S b (04 c:b0PPA 0S> :$0S9 40S(0( c h b-`0 0&R80Q 00@S00 R 000C10 1@PU p Z:3*, 1 ""  0 X, p# 3@P0tp' # 0,00 @ 00S0@@p,0@P 1P R000,  0U 0 *^Z# ᰡ01 R1J438#811  P  d0S00PP`8:3: *8#8!1Ს1 !2R0 B101!2 Q   @0@S0@0P@00@P0  0PN 0R|1Sl1@@T0@@$20!0Rp@ >8#Ƞ@T@ 00001!0C8#8 ,S!1 R00 00x 00c0!2QB !RL0P4 RU 00S  ?(K 8 -LM`P4 q0F80 0000 @V@T, P20S "0S2 P"00S0  V$ U!1 &@l(0:CU:q5>0~ Vp:00S Lx0Vu p@o 80 0fPU `dP6d@a[P-!U0@0f0gq@ 00,La 0PP  8Vq@(Q a Y P1(  0S Y(0(  c j b0 0 BS X T p0 0S $q 00 q,0P040@qPq,00@(K蠶D\  -LP`p(1p0S" 1!@1T PP9VU3:U P *00S 0 0SpP@0Q P L\ 0 0CRP0U 80 0S 4xp 00pp蠶 -LPp0p0S0 @0T PP#@00S0 Pp` $ X 0 0CRP0U  0S 87xp 00tpp蠶 -L$Mpdp40< S4$@4T QP'$0@T@ S@Z  @dT P4  T4@(0:CW:1p@ 0040:#:S@ S@ 0CC T8@ T53;3(00c80  W38 (0,p 0,0  W R40ZtY,>.0 ^nP`VZ(0S@`eP 0@ @ tP:@0Px0˭Ptt0x0p  cp  x 00h0@",0Y:@ 2@P t2@]@TP02 0 S  40 @pct4 ይP/ \+*(Q a P O(a P Fx1 fd 80W0S (  b g, 4 @ ,80WW !0S 0SW 8 g8 W00S  @P 80WS  R ! ( @t`0 0 BS fT @0 0S \2o 00.o<(K蠶|  -LM K 00!0 @"00ST 0S@0S QD0  rlK .^(100U0*2'Q-0 84 0<00 84 0<0 0 84 0<00 84 0<0 084 0< 0084 0<$0 0 84  0<(00  8 4 0<,0x0 0p04 0h00 0`0 00 84 0<8008 4 0<<0expand 32-byte k -h9LmM0 <@T ! A xP @ P` p $`(p娀 尠 ,4)80 @ P ` p  1 , @ D $ 8 < <?P  8A00 0A?@P$P`(`p,p04 8<  @0A Q4@0 ( 8v(0, 0R 0/ (K0kHH -1L@M0@ 0 ?[` R 00S 00S0d0* HPK` L0K%p(@TKP Tp L@  0Spg( HK-P0+ @&< $0  0 S$K0kLHHj p-LM|`0SpP0S9T@ aKKD ` 0 0CR0x蠶HH P0-L@0`;PP:50 -0L0@SPg똀p`H0S U@1@!c F `  0`0dPd0P U00S m}蠶HH@-M Ѝ@-MЍ! !P: ZŒŒ#! !P: `B!,aB 0>ZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0  -L@hj)++*+@-a@-pP`P 0@T00 S R B \0dC10P  =\P -0LM0 0S=S` K --0 L^M0`QP 0 paM_KPE`@M?KC/KKd1 4A 0A l0F`KppX0 peKQ Q < 1@0 0RK0k-R0 0c BSR48 R p-@P`x BRpR0 BRRR 0SbQ@  0R:XX X(X0X8X@XHXPX(" 2 02 02 02 02 02 02 02 0Q  00S:R B 0\R! B@-Q:@- R (2 R R -PPPP RrPP B PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R@- RP1P P1P RrP1P  B P1P B@  R010 1  B R0q0`0q0`0q0`\0q0`0q0`0q0` R 0\6 R B0@-81, Ġ%̌T$\D#L0P  R0@ Ġ01#̌  R R B0@-81, Ƞ%ȌX$XH#H0P  R0@ Ƞ01#Ȍ  R R B0@-81, ̠%Č\$TL#D0P  R0@ ̠01#Č  RJJ_)*OO[)* 0-LM 0@0 @PK0Π0<)*cc8)*``1)*22-)*11))*%)*>>!)* -L` pP@H1B@A01  P d 0200 0 0崜8q -AMLMŸP, p p8$ 2KMPlP`BNK@D@D0H" P:bg?0|BnK`FBK `FA0A 04 fp V = W1sa 1 <4 1R& Y 0CA 004 -4[.$[/[0[0L LLL^0H 0Q( K0/4[0$[0A A PZ<` W @00%BT  @ F : : @8$P0@<PLp 8$P fO00 ,0 S (K0kX\ -L M`pyQ 0P00 00 0 ? Q< R @00%BT v@ H : : 0 P0@ Pg;p G P 00P fO0 0<Z 0S 0 0C0pp/ 0R* Z 0CA 0,0 )0[* [+[,[0L LLL^02K+0[, [0 002K+0[, [0  P (K p-LM1@QP aP8 0,0ZP8 8sKp p- 0P8-`#1@::0CL0$ 0\\1 8!$ BP@  T00~AB2AA 0B 1 0phA -LM400  SP, 00S400400 000 `0$0!QD AQ! 1 BN?p @%PP T 01C T 0 ! 0$ 10C0S  "0|X 0S@p T!D0V$0@00@c TD `Vu F!D1DD0 `0CD0@ 010CX$0Sc pPi!D0@0 TD0"`V1 KmeR F!D1DD0@0CD0 ` 0 B Q~AB"AA 0B 1 05:    RQ00~LB2A0AB <0 0$ 10Q0A $0PD0 QP1@0c0Q51 vKe008#8#H! 00 00P 0,P00 00000P0C0@P, 00(K -P0@0P@cH$HX`pL %X0@@bH$HPX%X0 0C@0P0@ -LM`P@ OXX 0S0?pQD NR7 08 00Q4 -:<0@0F@bH$H, @u0D @cH$H0 @k00,80D0< 00 0c40b0C 08 00< 0@G0 S@0PU `尀X 0R<0 00S0S 00 0S a0 @QP1 0S 0 0 0S I 0  0@ P000 0000@ Q808(@40P0@(Ko(K -LpM@ 0|  PP\ > |0Pd 6 \(0P 00d"0  0@ `px 00S\@` 0d 0C 8tp dp#X`l 00C8Sh   0XK|PTX Xp0W P`V @l `` (^#t0`0C8#8 I 00h0ἐ 0|)`P~ `|PP @|c8 @#`` t | 0P8#8p0 Up0@  b< 0|0H0 00 0lD p ;P0S D <00 0S @K|; 0@KH K]000l 0S <0D 0 0Sl@K|=pP 0@Kl0 H K?00008#X0S0S UH:`P |`DB0 00c ,0  0f P0K8 K8x#8  08# l  0 0b00屐 0080 00l40 08#x`0|X0g8#8 I! 000ഐ\000d 000(K -@0pL\Po0R 0080S#80l G8U#h 0  b000 R C CCC0^(1U0E(10 00G000 000B800C80000 -PLp Q0`@\ Q QVPP P0S -LM@pQ 0  P n, %`PP> Z) 0(10S$1 0 ! 0S 0P * 0P$1 0$10 0S0P  0 `P, 8#R a`00 0 0 `(K -LP@`QtPPq  Q0 Q000a0`P^ 0 8ᲀ#xP`=0 R  0S0 ` pHP(E000Y0n0@ 0S$10 (!$1 50S 0,P ) 0(10P%$10$1  0h8(#h"x 0 0p 0S sa00  P10 -L M@pAQ 0  n`, PPP- 0 QP #0 0S0P  0PP, 8#R "aP00 0 0 P(K 0-LMP @p108 -LM<0 @ 80K0 K `@P^0, <KPwP 0< wPJ 0@ pUpW 000ᴠ08#8 P(@"(0ᱠ00 @0@0< @0@00Q<0A 8#8 P0 00<PP W000(K -LM`D0 00C8 D4 D 8 0 @ g8 S0<8@#8@cH$H ,0 L   8#8 @@0 0< 0@00 @\P 8,P8 0+p@0T # TD0X < T@PH$HPdX%X 0PC0 0 0d0d00< 0P00B0`004,04 000C88 < P#84 00;R008R#XD 0X0E8#X0 0@@eH$HX 8#8 B @0 00@ 00 @P `00 0 0 00000C8X#(p0(K -LP `  a("Hpd~0P pP5`PP  0 0b8#H0T ʲ0S T0 [P P -pLP`@LQ\QQW@p6T0X  Q00SP ô 0@00!0 0 0C2#00 0 0T00 WW800C80 -L@P/ 0`p( 0A 0P-L 0- L@0@P¹P $0t\0W0A -@LT 0tA -OL@POyKGR0@-@P l^0,00n1C3\NP0 0-L@ -LUsage: %s ..., where is one of: instbin%s: %s not compiled in mount_cd9660md5sha256sha512dfmountmount_ext2fsarchsyncnewfs_msdossttylndisklabelpaxtarfsck_ext2fscatifconfigsysctlrtsolping6datelessmoremount_nfsfdiskgrepfgrepegrepumountmount_msdosfscksignifymknodreboothaltmount_ffsdhclientcpgzipgunzipgzcatchmodchgrpchownfsck_ffsnewfsrmmtejectmkdirksh-shbioctlsleepmvexprdmesghostnameԉt؉TcH(@@x 0D@@ ܉ unknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs cannot be zerocbs meaningless if not doing record operationsbuffer sizes cannot be zerobuffer sizes cannot be greater than %zdseek offsets cannot be larger than %qdnonenoxferunknown status %s%s: illegal numeric valueunknown conversion %s%s: illegal conversion combinationcbsconvfilesibsifobsofskipstatusnoerrornotrunc%s: end of device%s: short write on character device%s: short write on tape devicefiles is not supported for non-tape devicesstdoutinput bufferoutput buffercase conv and -DNO_CONV%zu+%zu records in %zu+%zu records out blockblocks%zu odd length swab %s %zu truncated %s %qd bytes transferred in %lld.%03ld secs (%0.0f bytes/sec) skip reached end of inputmain  ^(08@usage: mount_cd9660 [-egjR] [-o options] [-s offset] special node session number is %s: %segjo:Rs:realpath %scd9660%s: Filesystem not supported by kernel%s on %suserquotagroupquotarwautoaccesstimeatimeexecsuidrdonlyupdateneedsdoes not need-o %s: option %s a value-o %s: option not supported%s: illegal value '%s'%s ("%s") = %s %s (%s) = %s usage: %s [-bcpqrtx] [-C checklist] [-h hashfile] [-s string] [file ...] error encoding base64cannot open %sstdout: write error%s: read errorbC:ch:pqrs:txbase64hex%s doesn't support %s ,unknown algorithm "%s"SHA256SHA512usage: %s [-hiklnP] [-t type] [[file | file_system] ...] df: %qd: %s 1024-blocks 512-blocks%-*.*s %s Used Available Capacity Mounted on Filesystem%-*.*s %*lld %10lld %11lld %5.0f%% %s %7s%-*.*s %*llu %9llu %9lld %5.0f%% %7llu %7llu %5.0f%% %s %-*.*s %s Used Avail Capacity Size1K-blocks%-*.*s %s Used Avail Capacity iused ifree %%iused Mounted onempty type listonly one -t option may be specified.hiklnPt:-h and -i are incompatible with -Pretrieving information on mounted file systems%s is not a local file system%s mounted as a %s file systemffsext2fsprmountmountfsmainnfs:@ufs%s: fstab uses outdated type 'ufs' -- fix pleasemfs%s: fstab type %s != disklabel type %susage: mount [-Aadfruvw] [-t type] mount [-dfrsuvw] special | node mount [-dfruvw] [-o options] [-t type] special node -o%s,%s on %s type %.*s (%sunknown flag%s %#x, ctime=%sv3v2udptcpsofthardintrnoconnrdirplus%s%s=%dwsizersizerdirsizetimeoretransmaxgrouplistreadaheadacregmin, %s=%dacregmaxacdirminacdirmax%s%s=%lu %smsdos%s%s=%u, %s=%uuidgid%s%s=0%onowin95direxecnorripgensextattprocfsversion %dlinuxstatfs %s on %s type %.*s: %s already mountedexec: mount_%sfork%s/mount_%sexec %s for %sno mount helper program found for %sforceAadfo:rswt:uvrqnoautogetmntinfounknown special file or file system %s.root_devicecan't find fstab entry for %s.%s has unknown file system type./var/run/mountd.pidsignal mountdasynchronousasyncexported to the worldkerberos uid mappingNFS exportedanon uid mappingexported read-onlynoatimenoaccesstimenodevnoexecnosuidwith quotasread-onlyroot file systemsynchronoussoftdep/usr/sbinmain  ^(08@usage: mount_ext2fs [-o options] special node o:specified device does not match mounted devicefilesystem not supported by kernelmount table full%s on %s: %susage: machine [-a] usage: arch [-ks] machinearmisharmOpenBSDmain@@@h pp p ` @  $%s: no default %s%s: illegal %s%s: bad %susage: %s [-N] [-a FAT-size] [-B boot] [-b block-size] [-c cluster-size] [-e dirents] [-F FAT-type] [-f format] [-h heads] [-I volid] [-i info] [-k backup] [-L label] [-m media] [-n FATs] [-O OEM] [-o hidden] [-r reserved] [-S sector-size] [-s total] [-u track-size] special [disktype] %s: bad FAT typevolume ID"*+,./:;<=>?[\]|%s: bad volume label%s: bad OEM stringbytes/sectorsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsfile system sizesectors/track/dev/%s is mounted on %s%s: block devicewarning: %s is not a character device%s: unknown standard format%s: can't figure out partition infoioctl (GDINFO)%s: can't read disk label; disk type must be specified%s: unknown disk type%s: partition is unavailablebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %u-%c is not a legal FAT%s optionblock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectorstoo many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs=%#x bkbs=%s: can't read sector %uNO NAMEFAT%uBSD 4.4%s: can't write sector %u160180320360720120014402880  ԭ̒   $ , ؕ04<:īȫ̫Ыث  #3 #(30283@3H#P@X@-@`@hpxĬ̬Ԭܬ  @@ $,4<DLT\dlt|  xĭЭܭ  ,8@HPX@`@l@t@    Į̮Ԯܮ@@  C$ CC$C$0<HT\dlt|  į@̯@ԯܯprintmainoption requires an argument -- %sundefmaximum option value is %d -- %soption requires a numeric argument -- %sdiscarddsuspeofeol2lnextminquitreprintstartstopsuspflushrprntillegal gfmt1 option -- %sillegal gfmt1 option%lxcflagiflagispeedlflagoflagospeedgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d TIOCSTOPTIOCSTARTTIOCSETD%d %d rows %scols %sillegal option -- -%scbreakcolscookeddecekeverythingextproclcasenewoldostartostoprawrowssanespeedttycs5cs6cs7cs8cstopb-cstopbcread-creadparenb-parenbparodd-paroddparity-parityevenp-evenpoddp-oddppass8-pass8hupcl-hupcl-hupclocal-clocalcrtscts-crtsctsmdmbuf-mdmbufignbrk-ignbrkbrkint-brkintignpar-ignparparmrk-parmrkinpck-inpckistrip-istripinlcr-inlcrigncr-igncricrnl-icrnliuclc-iuclcixon-ixon-flowixoff-ixofftandem-tandemixany-ixanydecctlq-decctlqimaxbel-imaxbel-echoechoe-echoecrterase-crterasecrtbs-crtbsechok-echokechoke-echokecrtkill-crtkillaltwerase-altweraseiexten-iextenechonl-echonlechoctl-echoctlctlecho-ctlechoechoprt-echoprtprterase-prteraseisig-isigicanon-icanonnoflsh-noflshtostop-tostopflusho-flushopendin-pendin-crtnewcrt-newcrtnokerninfo-nokerninfokerninfo-kerninfoxcase-xcaseopost-opostlitout-litoutocrnl-ocrnlolcuc-olcuconlcr-onlcronlret-onlretonocr-onocrtabs-tabsoxtabs-oxtabsonoeot-onoeot tablet disc; slip disc; ppp disc; strip disc; nmea disc; #%d disc; ispeed %d baud; ospeed %d baud;speed %d baud; %d rows; %d columns;lflags-extprociflagsoflagscflagscchars%s = %s;%-8susage: %s [-a | -e | -g] [-f file] [operands] -aefgaef:gnot a terminalTIOCGETDTIOCGWINSZgfmt1illegal option -- %stcsetattrTIOCSWINSZlinkitusage: %s [-fhLnPs] source [target] %s [-fLPs] source ... [directory] %s/%s%s: disappeared%s and %s are identical (nothing done).FfhLnPscmplabelduid_parsegetasciilabeleditgmpsavehas_overlapgetuint64editor_allocspaceedit_parmsedit_parmseditor_resizeeditor d @\ d @l t@@  @(@ %(@d @ `Nl@_d@@dd̲ LP@XdpxHTP8H@@@@@@@L|@@@@@P@@ (08<@H\8<\s6㿂;{vc'9O8'm:="! 5Ei[HZqv8E>}N.{7{iXiz^T ]Z|ת"4.yw'篒W;}&167M*Qd *OUwit{Uvj_ɿEr>yϒ3y?'0,&in_2YfӫJʫ\%/)*y.LJ(}qUJt3[_5Ƈ?7(>S‹dDy|H>\SCf .gTSͼY#j{^g!a:x&Q?I-7nOt{UJ^N>-=;UQTw;?h+  8)Jf_ZtúV=LU*x\\%ޟ]%')JG?x$x > aO bC{d%rsV:[ ɚZkb {W%n$9l܀!dhIuj*{IZD2 11˵j]RR hgN jW20Ȁ pqf](#SYgW~gQAWO 9MH:_c(̠IfQV-M5pag5;m ?kMQJaqVJ!sӐq/fzwnE"ӳKw;8zuz[SW ZjrfryZ<`b" #o\4Ut+Nj2;,&}C0_¸aP}؝ȫ5J=n: a?8F5͈V̈U2f`HACڼ$w&P*)f•tu&=<9;#0 :MmA*&x"PTp'okm7 Q@*U=kQh%w(DVG٠HA_ㆁ}hSEaP3Ay:_rB"2Obbg%9A#) M6Es 4/[2NiJ Yҷj.dйmЭ/mP;rqt}%_0Jb蟄4Zy)bJ! (F!0"c "6<owًH? X4 [='jW$cKb<jC>j .)hTB=Ƀ|Q͝)kԈvN8a6X7 7B:=-Am$a'>ݔ0"D]4![ 8ź}\, pUoqqo>%yC F'.!ApekK"("bܣa6$uδPslU 9&AVْ7 psXjD*%# a^H֡]_w9/Uij-[~k+sd˥IP>8fqChB03N{r,M0"ksem,LdD5daYx#64pYJv0:[8Xm%Q"lX6`qW:_PcRf5l(ۮ~fRDxx2<hS y(֠Amdirm… Z9EFy!G *S vzPpsB:&LIV9nҍpiE+o]u×<|Rsyj L"~`0RQCDSbEɖZP7`F'~uMV74܉<:FͪZwNwS|UxC*`}!#,Cqm6nLTʩuӢAn|*yT:IJl<O,u{Ќz&t9<z^0! YV=ٷ5H3Vmd]N+}>|>_Pu0c_U\5U]ay|yZ8 qZQ#j7b;+ 1|DH-moM. T1 p16NG1fJY<ހ|+m8[e*Db>!93q@Aqh|j-ŞJZdܝcz4ʚ2rTxvR1*ח`vQ陁%)95'J9EOZ;/VT\xɥi4Q;YQ'v/cX؀Z'cdz6[UA6,ӾVȘp$ ``'0u_#GXUv%dێGׁ2덂K:w.~3=bxܻv\$f=`&vHIQRܱ49 .(V-n5½c*I5x@(Y BL wfX `O:/Pqa޹W YV69x)L? rx4UF d3jkr뼇Q ;X(g:D7wWv5ӈK`4+Ʈ "YP]-f`Jz߉-k t2ƻF? A F_*W*TͧBwW`4"*}<ka̬egﺮ0x ;BTzi_}Vo3WqQ^5S7\=CxD kQzD y{<*Mi@̂B8ɶn0, \B-_0żdmgQœP &CO C2u}|:B93MR6W$p9֙Q'P`roolT3sWNizr0*Ldܰ*21y6xi%ejsL[1%і8M1.ȴt\%KK'7>5{O,ȲE1oT)? J>E2gğ\w0')y'2E&3b6dܼW e\יoHiUWg<ܵB G 9'HF5Q&P.Uj\M{~ ƿ; SY43eJCX"nQ[&KA; iT~Q%]l$68"k<>5g.PCqsSYJy9E#e3f ͹ 7ӋKl@"MӰSOvο&v 㲅01\IB&b4* gka7^gI)JIZ##C-K8i)wG`l10E};]bc9C †6>9: -M~oրDh͞H 716yrIr$>}=6M?7eWb1yA/z bQת3pW$(GQ?~ty\>,+L%0\]5L6KyJ0ʕ02x#x]\}y6VOn`ǎ B\vNt4PL/ϻuqs͘Z~VMs=vP~#0Ư RM {mo\թ5^%J0-6dkprc]@aJxBU9F`ij$c_3-ȸ;$B[4O#a[a=%2hZH?(]/[rDA?>-)/>zV;(҇TҨqiﾭ\@T0||JXH>s6,?PAM+M%%&AajLWsb~H~*׋Kwx7-/ҕi `F_Mkf&uÿhwꆚUzyϟ<2ڽC-Rusage: disklabel [-Acdtv] [-h | -p unit] disk (read) disklabel -w [-Acdnv] disk disktype [packid] (write) disklabel -e [-Acdnv] disk (edit) disklabel -E [-Acdnv] [-F|-f file] disk (simple editor) disklabel -R [-nv] disk protofile (restore) `disk' may be of the form: sd0 or /dev/rsd0%c. `disktype' is an entry from %s, see disktab(5) for more info. /etc/disktab`packid' is an identification string for the device. `protofile' is the output from the read cmd form; -R is powerful. For procedures specific to this architecture see: %s fdisk(8)sector size %dsectors/track %dtracks/cylinder %dcylinders/unit %dboot block size %dwarning, boot block size %% sector-size != 0super block size %dwarning, super block size %% sector-size != 0warning, number of partitions (%d) > MAXPARTITIONS (%d)warning, partition %c: size 0, but offset %llupartition %c: offset past end of unitpartition %c: partition extends past end of unitwarning, unused partition %c: size %llu offset %llu # line %d: syntax errorunknownIDEESDIline %d: warning, unknown disk type: %sbadsectvendorline %d: bad flag: %sdrivedataline %d: bad drivedata %s%d partitionsline %d: bad # of partitionsduidline %d: bad %s: %ssectors/cylindertracks/cylindercylindersrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seektotal sectorsboundstartboundendline %d: bad partition name: %sline %d: too few fieldsline %d: bad partition size: %sline %d: bad partition offset: %sline %d: warning, unknown filesystem type: %sline %d: unknown field: %sVISUALEDITOR/usr/bin/vi%s %s/bin/sh%s: No disk label on disk%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of disk%.*s|Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:nc#%u:sc#%u:su#%llu:d%d#%u\ :p%c#%llu:o%c#%llu:t%c=%s:t%c=unknown%d:b%c#%u:f%c#%u:Bootstrap doesn't leave room for disk labelioctl DIOCRLDINFOioctl DIOCGPDINFOioctl DIOCGDINFO/dev/%s%c%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx.aioctl DIOCWDINFOunknown disk type: %s %c: %16llu %16llu %c: %15.*f%c %16llu %7.7s%7d %5u %5u %4hu %19.19s# %s# %s: type: %s type: %d disk: %.*s label: %.*s duid: %02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx flags: badsect vendorbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %llu # total bytes: %.*f%cboundstart: %llu boundend: %llu drivedata: %d %hu partitions: # %16.16s %16.16s fstype [fsize bsize cpg] offset # Notes: # Up to 16 partitions are valid, named from 'a' to 'p'. Partition 'a' is # your root filesystem, 'b' is your swap, and 'c' should cover your whole # disk. Any other partition is free for any use. 'size' and 'offset' are # in 512-byte blocks. fstype should be '4.2BSD', 'swap', or 'none' or some # other values. fsize/bsize/cpg should typically be '2048 16384 16' for a # 4.2BSD filesystem (or '512 4096 16' except on alpha, sun4, ...) No changes.re-edit the label? [y]: bckmgtBCKMGTValid units are bckmgt ABEf:F:hRb:cdenp:tvwSMDMSCPold DECSCSIST506HP-IBHP-FLtype 9floppyccdvndATAPIRAIDunusedVersion6Version7SystemV4.1BSDEighth-Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSHFSADFSNTFSUDF-cTreating sectors %llu-%llu as the OpenBSD portion of the disk. You can use the 'b' command to change this. OpenBSD area: ; size: ; free: # %16.16s %16.16s fstype [fsize bsize cpg] Can't stat deviceAvailable commands: ? | h - show help n [part] - set mount point A - auto partition all space p [unit] - print partitions a [part] - add partition q - quit & save changes b - set OpenBSD boundaries R [part] - resize auto allocated partition c [part] - change partition size r - display free space D - reset label to default s [path] - save label to file d [part] - delete partition U - undo all changes e - edit drive parameters u - undo last change g [d|u] - [d]isk or [u]ser geometry w - write label to disk i - modify disklabel UID X - toggle expert mode l [unit] - print disk label header x - exit & lose changes M - disklabel(8) man page z - delete all partitions m [part] - modify partition Suffixes can be used to indicate units other than sectors: 'b' (bytes), 'k' (kilobytes), 'm' (megabytes), 'g' (gigabytes) 't' (terabytes) 'c' (cylinders), '%' (% of total disk), '&' (% of free space). Values in non-sector units are truncated to the nearest cylinder boundary.%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx.%c%s%c none swap sw %s%c %s %s rw 1 %d failed to sort partition table%s: [%s] [d]isk or [u]ser geometryEnter 'd' to use the geometry based on what the disk itself thinks it is, or 'u' to use the geometry that was found in the label.Command aborted BIOS geometry not defined. Note: user geometry is the same as disk geometry. You must enter either 'd' or 'u'. Where to mount this filesystem (ie: / /var /usr)'%c' already being mounted at '%s' Mount points must start with '/' The disklabel UID is currently: %02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx The disklabel UID, given as a 16 character hexadecimal string.Invalid UID entered. partition to deleteThe letter of the partition to delete, a - p, or '*'.Partition must be between 'a' and '%c' (excluding 'c'). Partition '%c' is not in use. partition to nameThe letter of the partition to name, a - p.You cannot name a filesystem of type %s. can't get mem sizePossible values are:"IDE", "%s"Disk typeWhat kind of disk is this? Usually SCSI, IDE, ESDI, ST506, or floppy."%s" is not a valid disk type. Valid types are: Error, partitions %c and %c overlap: Disable which one? (^D to abort) [%c %c] %s: [%llu] %lldRounding size to cylinder (%d sectors): %llu FS typeFilesystem type (usually 4.2BSD or swap)FS type (decimal)Filesystem type as a decimal number; usually 7 (4.2BSD) or 1 (swap).Invalid entry Unrecognized filesystem type '%s', treating as 'unknown' Size of ffs blocks. A multiple of the ffs fragment size.Error: block size must be at least as big as page size (%d). Error: block size must be a multiple of the fragment size (%llu). Align partition to block sizeRound the partition offset and size to multiples of bsize?Rounding offset to bsize (%llu sectors): %llu Rounding size to bsize (%llu sectors): %llu fragment sizeSize of ffs block fragments. A multiple of the disk sector-size.Error: fragment size must be a multiple of the disk sector size (%d) Zero fragment size implies zero block sizeSize of the partition. You may also say +/- amount for a relative change.The size must be > 0 sectors The size can't be more than %llu sectors, or the partition would extend beyond the last sector (%llu) of the OpenBSD portion of the disk. The 'b' command can change this limit. Sorry, there are only %llu sectors left partition to change sizeThe letter of the partition to change size, a - p.Partition %c is currently %llu sectors in size, and can have a maximum size of %llu sectors. Starting sector for this partition.The offset must be >= %llu and < %llu, the limits of the OpenBSD portion of the disk. The 'b' command can change these limits. The offset must be in a free area. partition to modifyThe letter of the partition to modify, a - p.No space left, you need to shrink a partition The letter of the new partition, a - p.Partition '%c' exists. Delete it first. Starting sectorThe start of the OpenBSD portion of the disk.Size ('*' for entire disk)The size of the OpenBSD portion of the disk ('*' for the entire disk).Changing device parameters for %s: What kind of disk is this? Usually SCSI, ESDI, ST506, or floppy (use ESDI for IDE).label name15 char string that describes this label, usually the disk name.The Number of sectors per track.The number of tracks per cylinder.The number of sectors per cylinder (Usually sectors/track * tracks/cylinder).number of cylindersThe total number of cylinders on the disk.The total number of sectors on the disk.You may want to increase the size of the 'c' partition.Not enough free space to shrink by %llu sectors (only %llu sectors left) partition to resizeNo such partition Cannot resize spoofed partition [+|-]new size (with unit)new size or amount to grow (+) or shrink (-) partition including unitAmount too big Partition %c shrunk to make room No room left for all partitions You need to specify a type for this disk.can't run when there is partition overlap.No 'c' partition found, adding one that spans the disk.Label editor (enter '?' for help at any prompt) unable to get default partition tableThis option is not valid when run without the -f flag. PAGER/usr/bin/lessgunzip -qc|%sunable to execute %sIn no change mode, not writing label.No label changes.Write new label?Write the modified label to disk?unable to write labelResize only implemented for auto allocated labels Free sectors: %16llu - %16llu (%16llu) Total free sectors: %llu. FilenameName of the file to save label into.Original label and mount points restored.Last change undone.EnteringExiting%s expert mode Unknown option: %c ('?' for help) /tmp/var/usr/usr/X11R6/usr/local/usr/src/usr/obj/homelfsadosntfsudfsdrzwdFLOPPYxdhdCCDVNDsvndabcdfiklnoprstuvwxBDEGHLPTUXYZ0Cannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specForward positioning operation on archive failedCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Reverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %d pad blocksUnable to backspace tape %d blocks.Failed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDUnable to truncate archive file%s: Waiting for tape drive close to complete...done. %s: unknown format, %llu bytes skipped. %s: %s vol %d, %lu files, %llu bytes read, %llu bytes written. could not pipecould not fork-dccould not exec %sFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed chdir to %sFailed stat on %sCannot write an archive on top of a directory %sUnable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Ready for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sUnable to open %s to readCannot identify format. Searching...Sorry, unable to determine archive format.Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot mix current archive format %s with %s%s: Reading archive to position at the end...Cannot chdir to %sCan't fchdir to starting directoryUser specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUnable to append when there are archive read errors.Archive read error limit (%d) reachedCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Write block size %d too large, maximium is: %dWrite block size %d is not a %d byte multipleWrite block size of %d too large, maximium is: %dWrite block size of %d is not a %d byte multipleWrite block size of %d larger than POSIX max %d, archive may not be portableUnable to allocate memory for group name cache tableUnable to allocate memory for user name cache tableUnable to allocate memory for group id cache tableUnable to allocate memory for user id cache tableFile changed size %sFile %s was modified during readFile rewind failed on: %sFailed seek on file %sFailed write to file %sFile seek on %sWARNING! Major Internal Error! GNU hack Failing!Out of memoryCould not set permissions on %sUnable to set file uid/gid of %sAccess/modification time set failed on: %sUnable to close file descriptor on %sUnable to copy %s, file would overwrite itselfUnable to remove directory %sCould not unlink %scannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCould not create: %scpioCould not access %s (stat)Unable to link file %s to itselfUnable to remove %sCould not link to %s from %sUnable to link to %s from %sA hard link to the directory %s is not allowedUnable to create %sIgnoring unterminated pathname at EOFIgnoring too-long pathname: %sCan't chdir to %snext_fileFile system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %sWARNING! These file names were not selected:Invalid file name argumentUnable to allocate memory for filenameUnable to allocate memory for file name buffer%b %e %H:%M%b %e %Y%s%s %s %s%2u %-*.*s %-*.*s %4lu, %4lu %9llu == -> %s: unknown option %c %s: %c argument missing Invalid option nameUnable to allocate space for option listInvalid options formatusage: tar {crtux}[014578befHhjLmNOoPpqsvwXZz] [blocking-factor | archive | replstr] [-C directory] [-I file] [file ...] tar {-crtux} [-014578eHhjLmNOoPpqvwXZz] [-b blocking-factor] [-C directory] [-f archive] [-I file] [-s replstr] [file ...] usage: pax [-0cdjnOvz] [-E limit] [-f archive] [-G group] [-s replstr] [-T range] [-U user] [pattern ...] pax -r [-0cDdijknOuvYZz] [-E limit] [-f archive] [-G group] [-o options] [-p string] [-s replstr] [-T range] [-U user] [pattern ...] pax -w [-0adHijLOPtuvXz] [-B bytes] [-b blocksize] [-f archive] [-G group] [-o options] [-s replstr] [-T range] [-U user] [-x format] [file ...] pax -rw [-0DdHikLlnOPtuvXYZ] [-G group] [-p string] [-s replstr] [-T range] [-U user] [file ...] directory Invalid block size %sbzip2compress/dev/rst0/dev/rst1/dev/rst4/dev/rst5/dev/rst7/dev/rst8b:cef:hjmopqruts:vwxzBC:HI:LNOPXZ014578-IUnable to open file '%s' for readProblem with file '%s'-Cwrite_opt=nodirTAPEInvalid -p string: %cUnknown -x format: %spax: Known -x formats are: Invalid write limit %sWrite limit is not a %d byte multipleError count value must be positiveab:cdf:ijklno:p:rs:tuvwx:zB:DE:G:HLOPT:U:XYZ0%s: Invalid combination of options: -%cDestination directory was not suppliedThese format options are not supported %s = %s ustarFile name %s/%s, too longWARNING! These patterns were not matched:Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Removing leading / from absolute path names in the archive ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Pattern select out of memoryPattern list inconsistentEmpty pattern stringUnable to allocate memory for pattern stringEmpty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sCPU time limit reached, cleaning up. Signal caught, cleaning up. Can't open current working directory.TMPDIR/tmp/Cannot allocate memory for temp file name.Unable to set up signal handlercan not gzip while appendingEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [[[[[cc]yy]mm]dd]HH]MM[.SS][/[c][m]]Unable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryCannot canonicalize %sUnable to store mode and times for created directory: %sUnable to allocate memory for directory timesCannot allocate space for directory access time tableCannot allocate memory for device mapping tableCannot allocate memory for interactive rename tableCannot allocate memory for hard link tableDirectory access time reset table ran out of memoryDevice map table out of memoryUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedNo interactive rename table, links may failCannot update rename tableInteractive rename table out of memoryHard link table out of memoryFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sUstar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sFile is too long for ustar %snobodyUstar header field is too small for uid %lu, using nobodyUstar header field is too small for gid %lu, using nobodyUstar header field is too small for %sTar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sInvalid extended header lengthInvalid extended header recordInvalid extended header record lengthExtended header record length %lld is out of rangeMalformed extended header recordlinkpathwrite_optnodirUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.%s: /dev/ttyFatal error, cannot open %susage: ping [-DdEefLnqRrv] [-c count] [-I ifaddr] [-i wait] [-l preload] [-p pattern] [-s packetsize] [-t ttl] [-V rtable] [-w maxwait] host patterns must be specified as hex digits%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0x%02xVr HL TOS Len ID Flg off TTL Pro cks Src Dst Data %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %s TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Echo ReplyDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set (MTU %d) frag needed and DF setSource Route FailedNetwork UnknownHost UnknownSource IsolatedDest. Net Administratively ProhibitedDest. Host Administratively ProhibitedDestination Net Unreachable for TOSDestination Host Unreachable for TOSRoute administratively prohibitedHost Precedence ViolationPrecedence CutoffDest Unreachable, Unknown Code: %d Source QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect, Unknown Code: %d(New addr: %s) Echo RequestRouter Discovery Advertisement(%d entries, lifetime %d seconds) Router Discovery SolicitationTime to live exceededFrag reassembly time exceededTime exceeded, Unknown Code: %d Parameter problem, required option absent: pointer = 0x%02x Parameter problem: pointer = 0x%02x TimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask Reply (Mask 0x%08x) Unknown ICMP type: %d --- %s ping statistics --- %ld packets transmitted, %ld packets received, %ld duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/std-dev = %d.%03d/%d.%03d/%d.%03d/%d.%03d ms packet too short (%d bytes) from %s%d bytes from %s: icmp_seq=%u ttl=%d time=%d.%03d ms (DUP!) (TRUNC!) wrong data byte #%d should be 0x%x but was 0x%x%x %d bytes from %s: LSRR: 0.0.0.0 %s (truncated route) (same route) RR: NOP unknown option %xping: sendtoping: wrote %s %d chars, ret=%d setresuidnumber of packets to transmit is %s: %sbad interface address: %sbad timing interval: %s%s: only root may use interval < 1spreload value is %s: %spacket size is %s: %sttl value is %s: %srtable value is %s: %ssetsockopt SO_RTABLEmaxwait value is %s: %sDEI:LRS:c:defi:l:np:qrs:T:t:V:vw:unknown host: %s-f and -i options are incompatibleNo audible output for flood pingsbind-R option and -D or -T, or -t to unicast destinations are incompatiblerecord route not valid to multicast destinationsping: record routesetsockopt IP_MULTICAST_LOOPsetsockopt IP_MULTICAST_TTLsetsockopt IP_MULTICAST_IFgetsockoptsetsockoptCannot set the receive buffer sizeCould only allocate a receive buffer of %d bytes (default %d)PING %s (%s): %d data bytes PING %s: %d data bytes ping: recvfrommakeentrylinkupfileerroriblockckinodemainpass2pass2checkpass5setupP@XdpxHTP8HcatchquitNO SPACE LEFT IN %s (EXPANDED)EXPANDUNREFDIRLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTUNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORYlost+found IS NOT A DIRECTORYREALLOCATESORRY. CANNOT CREATE lost+found DIRECTORY SORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu NAME=%s %s=%s DIRECTORY CORRUPTEDwrong type to dirscan %d lost+found%d %s I=%lluBAD STATE %d TO BLKERR cannot find inode %llu bad inode number %llu to nextinode Cannot allocate space for inode buffer bad inode number %llu to ginode blk %d < cgdmin %d; blk + cnt %d > cgsbase %d blk %d >= cgdmin %d; blk + cnt %d > cgdmax %d LARGE FILES UNSUPPORTED ON REVISION 0 FILESYSTEMSSETTING LARGE FILE INDICATOR SET LARGE FILE INDICATORTRYING TO SET FILESIZE TO %llu ON MODE %x FILE I=%llu OWNER=%u MODE=%o SIZE=%llu MTIME=%12.12s %4.4s cannot increase directory list PARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDSCLEAR (CLEARED)-%c flag requires a %s usage: %s [-dfnpy] [-b block#] [-m mode] filesystem ... Alternate super block location: %d bad mode to -m: %o ** lost+found creation mode %o b:dfm:npystarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system** Phase 1 - Check Blocks and SizesINTERNAL ERROR: dups with -p** Phase 1b - Rescan For More DUPS** Phase 2 - Check Pathnames** Phase 3 - Check Connectivity** Phase 4 - Check Reference Counts** Phase 5 - Check Cyl groups%d files, %d used, %d free %d files missing %d blocks missing The following duplicate blocks remain: %d,The following zero link count inodes remain: %llu, ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW *****EXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEEXCESSIVE DUP BLKS I=%lluuDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%lluINODE I=%llu HAS DTIME=%12.12s %4.4s (CORRECTED)bad size %llu:HOLD BAD BLOCKbad size %llu ndb %d:bad direct addr: %d bad indirect addr: %d LINK COUNT TABLE OVERFLOWINCORRECT BLOCK COUNT I=%llu (%d should be %d)UNKNOWN FILE TYPE I=%lluROOT INODE UNALLOCATEDALLOCATECANNOT ALLOCATE ROOT INODE DUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYFIXBAD STATE %d FOR ROOT INODE DIRECTORY TOO SHORTDIRECTORY %s: LENGTH %lu NOT MULTIPLE OF %dMISSING '..'BAD INODE NUMBER FOR '..'BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' BAD TYPE VALUE FOR '..'CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '..' EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEUNALLOCATEDDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORY (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%llu ZERO LENGTHBAD/DUP%u: %2x summary info for cg %d is %d, %d, %d,should be %d, %d, %d SUMMARY INFORMATIONS WRONG FOR CG #%dblk_bitmap:bbmap:BLK(S) MISSING IN BIT MAPS #%dino_bitmap:ibmap:INODE(S) MISSING IN BIT MAPS #%dsummary info bad in superblock: %d, %d should be %d, %d SUPERBLK SUMMARY INFORMATION BADstrdup failedrealloc failedmalloc failed/r%s (%s): UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat rootCan't stat %s %s is not a character device ioctl (GCINFO): %s %s: can't read disk label %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A EXT2 FILE SYSTEM (%s) BAD SUPER BLOCK: %s MAGIC NUMBER WRONGBAD LOG_BSIZEcompat 0x%08x, incompat 0x%08x, compat_ro 0x%08x INCOMPATIBLE FEATURE BITS IN SUPER BLOCKsuperblock mismatchesoffset %ld, original %ld, alternate %ld VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATECan't stat %s: %s %s is not a character deviceCan't open %s: %s ** %sNO WRITE ACCESS (NO WRITE)cannot allocate space for superblock LOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO FSCK_FFS TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ext2fs(8).USING ALTERNATE SUPERBLOCK AT %d state = %d ** F%sile system is clean; not checking ** File system is already clean IMPOSSIBLE RESERVED BLOCK COUNT=%d IN SUPERBLOCKSET TO DEFAULTWRONG FPG=%d (BPG=%d) IN SUPERBLOCKBAD SUMMARY INFORMATIONcannot alloc %u bytes for blockmap cannot alloc %u bytes for statemap cannot alloc %u bytes for typemap cannot alloc %u bytes for lncntp cannot alloc %u bytes for inphead returning to single-user after filesystem check bad file type 0%o cannot allocate buffer pool INTERNAL ERROR: GOT TO reply()%s? no %s? yes %s? [Fyn?] (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %d CANNOT %s: BLK %dProgram terminated SEEKWRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN: %ld,PARTIALLY WRITING %sZERO'ED BLOCK %d TO DISK UPDATE STANDARD SUPERBLOCKSPanic: lost %d buffers MARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEANcache missed %ld of %ld (%d%%) READTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %ld (%ld),deadlocked buffer pool %6d usage: %s [-benstuv] [file ...] benstuvUhh]h]h]h^h^v^v^v ^b(^r,^Xu4^Xu<^ vD^ vL^\T^\\^\g`^\gh^p^|^^P^^xRn^nRm^,bRDc^X|^^{^^,^b^b^b_b0S(S_0_e,_e@_ddL_ddX_ddldd`_ddh_ddp_ddx_dd_dd_dd_dd_dd]h_h_h_ h_h_@h_h____q_q`eaTb `d pi i@#L#]Xwni i#p& ` ``(`0`<`@`H` T`X#\`#d`#l`#p`$x`$`$`$`%`%`%`%`&`&`'`'`(`(`)`)`*a* a+a+ a,(a,4a,8a-@a-La-Pa.Xa.da/la/xa0a0a0a0a1a1a2a2a2a3a3a3a4a4b4b5b5(b60b6randommalformed link-level addressSIOCSIFLLADDRSIOCGIFXFLAGSSIOCSIFXFLAGS[#%d]SIOCG80211WPAPARMSSIOCS80211WPAPARMSSIOCGIFFLAGSSIOCSIFFLAGSSIOCIFDESTROYmedia mode %smediaopt instance %d"%.*s"0xSIOCGIFGROUPgetifgroups groups:usage: ifconfig [-AaC] [interface] [address_family] [address [dest_address]] [parameters] invalid channel %s: %sSIOCS80211CHANNELprefix %s: %sSIOCGIFMEDIA%s: no link type?only one `instance' command may be issuedmust specify `media' before `instance'media instance %s: %smtu %s: %sSIOCSIFMTUbad hexadecimal digitshexadecimal digits too longstrings too longSIOCS80211NWIDmalformed BSSID: %sSIOCS80211BSSID%s: bad value%s=%o%s=%xSIOCGETVLANSIOCSETVLANvlan tag %s: %s vlan: %d parent interface: %s SIOCG80211ALLCHANS %4s %-8s %s chanfreqproperties %4d %4d MHz passive scan%d: bad prefixleninvalid vlan tag and device specificationinvalid %s %s: %s%s not allowed for the AFvltimepltimenwid chan %u bssid %s lladdr %s %u%% %udB powersave %uMESSIBSSCF_POLLABLECF_POLLREQPRIVACYSHORT_PREAMBLEPBCCCHNL_AGILITY SPECTRUM_MGMT QOS SHORT_SLOTTIME APSDDSSSOFDMDELAYED_B_ACKIMMEDIATE_B_ACKCACHEBSSAUTHASSOCCOLLECT no permission to scanSIOCG80211ALLNODES none restoreunknown %s media mode: %sonly one `mode' command may be issuedinvalid media mode: %sunknown %s media subtype: %sonly one `media' command may be issuedmay not issue `media' after `mode' commandsmay not issue `media' after `mediaopt' commandswpagroupcipher: unknown cipher: %sstrdupunknown %s media option: %sonly one `-mediaopt' command may be issuedmay not issue both `media' and `-mediaopt'only one `mediaopt' command may be issuedmay not issue `mediaopt' after `instance'wpaciphers: unknown cipher: %spsk802.1xwpaakms: unknown akm: %swpa1wpa2wpaprotos: unknown protocol: %s ieee80211: nwid chan %u bssid %s %u%% %udB nwkey persist%d: wpakey wpaprotos %swpa2 wpaakms %s802.1x wpaciphers wpagroupcipher powersave on (%dms sleep) (auto) %ddBm%sHIDENWIDNOBRIDGEUPBROADCASTDEBUGLOOPBACKPOINTOPOINTNOTRAILERSRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTTXREADYNOINET6INET6_NOPRIVACYMPLSWOL rdomain %d metric %lu mtu %lu lladdr %s status: %s %s: no media types? media: supported media: tunnel: inet%s %s -> %s:%u vnetid %d ttl %dpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEYunsetifgroup: group names may not end in a digitunsetifgroup: group name too longSIOCDIFGROUPsetifgroup: group names may not end in a digitsetifgroup: group name too long SIOCAIFGROUPSIOCG80211NWIDwpakey: invalid pre-shared keywpakey: passphrase must be between 8 and 63 characterswpakey: nwid not setwpakey: passphrase hashing failedSIOCS80211WPAPSKinterface index is already filledgetifaddrscould not determine link local address inet6 %sSIOCGIFDSTADDR_IN6 -> %sSIOCGIFNETMASK_IN6 prefixlen %dSIOCGIFAFLAG_IN6 anycast tentative duplicated detached deprecated autoconf autoconfprivacy scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime inet %sSIOCGIFNETMASKSIOCGIFDSTADDR --> %s netmask 0x%xSIOCGIFBRDADDR broadcast %sSIOCIFCREATEinvalid carp demotion: %scarpdemoteSIOCSIFGATTRSIOCGIFGATTR carp demote count %d%s: no such interface SIOCGIFGMEMBprintgroupinterface name '%s' too longcreatedestroyinet6'%s' requires argument'%s' requires 2 argumentsSIOCDIFADDRSIOCAIFADDRarp-arpdebug-debugalias-aliasdeletenetmaskmtunwid-nwidbssid-bssidnwkey-nwkeywpa-wpawpaakmswpacipherswpagroupcipherwpaprotoswpakey-wpakey-chanbroadcastvlanvlandev-vlandevgroup-groupanycast-anycasttentative-tentativeeui64autoconfprivacy-autoconfprivacypowersavepriorityrtlabeltxpowernwflagrdomain-inet6descriptiondescrwol-wollink0-link0link1-link1link2-link2mediamediaopt-mediaoptinstanceinstlladdrinetEthernetetherFDDIIEEE802.11TDMCARPautoselectmanual10baseT10baseT/UTP10UTP10base210base2/BNC10BNC10base510base5/AUI10AUI100baseTX100TX100baseFX100FX100baseT4100T4100baseVG100VG100baseT2100T21000baseSX1000SX10baseSTPSTP10STP10baseFLFL10FL1000baseLX1000LX1000baseCX1000CX1000baseT1000T1000baseTX1000TXHomePNA1HPNA110GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10GbaseCX410GCX410GBASE-CX42500baseSX2500SX10GbaseT10GT10GBASE-T10GSFP+Cu10GCuSingle-modeSMFMulti-modeMMFCDDIFH1FH2DS2DS5DS11DS1DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72t1t1-amie1e1-g.704e1-amie1-ami-g.704t3t3-m13e3e3-g.751e3-g.832e1-g.704-crc411a11b11gfhmasterfull-duplexfdxhalf-duplexhdxflag0flag1flag2loopbackhw-loopbacklooprxpausetxpausedual-attachdasadhochostapibssibss-mastermonitorturbohdlc-crc16pppframerelay-ansiframerelay-ciscoframerelay-ituno carrierno networkbackupactivekeepalive downusegroupwep40tkipccmpwep104displayprinttimeprintlong %s: %s: %s: directory causes a cyclefts_readCOLUMNS1ACFHLRSTacdfghiklmnopqrstux%b %e %H:%M:%S %Y%*llu %*qd total %llu %s %*u %-*s %-*s %3d, %3d %*s%*qd %*s ls: %s: %s usage: %s [-1AaCcdFfgHhikLlmnopqRrSsTtux] [file ...] usage: sysctl [-n] name %s=kern.osreleasehw.machinehw.modelhw.producthw.disknameshw.ncpufoundwarnmsgrtsol_timer_updateifconfigmake_packetmainrtsol_check_timerrtsol_inputsendpacketrtsol_inputsendpacketsockopeninterface_statusinterface_upget_rdomainlladdropt_fillinterface_statusinterface_upget_llflagget_rdomaindefrouter_probedefrouter_probe:sendprobeprobe_initmultiple interfaces foundreallocprobing %s<%s> %sillegal interface state(%d) on %sstop timer for %sset timer for %s to %lld:%ldfailed to get link layer information for %sinterface %s was already configuredmemory allocation failedlink-layer address option has null length on %s. Treat as not included.memory allocation failed for %susage: rtsol [-DdF] [-O script-name] interface ... rtsol [-DdF] -a usage: rtsold [-1DdFfm] [-O script-name] interface ... rtsold [-1DdFfm] -a adDFO:adDfFm1O:kernel is configured not to accept RAskernel is configured not to accept redirectskernel is configured as a router, not a hostfailed to open a socketfailed to initialize interfacessetting rdomain %ufailed to initialize %sfailed to setup for probing routerstimer expiration on %s, state = %d%s status is changed from %d to %dNo answer after sending %d RSsthere is no timerNew timer is %lld:%08ldselect: %srecvmsg: %sfailed to get receiving interfacefailed to get receiving hop limitpacket size(%zd) is too shortinvalid icmp type(%d) from %s on %sinvalid icmp code(%d) from %s on %sinvalid RA with hop limit(%d) from %s on %sinvalid RA with non link-local source from %s on %sreceived RA from %s on an unexpected IF(%s)received RA from %s on %s, state is %dsend RS on %s, whose state is %dsendmsg on %s: %smalloc for receive msghdr failedmalloc for send msghdr failedff02::2inet_pton failed for %sIPV6_RECVPKTINFO: %sIPV6_RECVHOPLIMIT: %ssetsockopt(ICMP6_FILTER): %sunsupported link type(%d)ioctl(SIOCGIFFLAGS) on %s: %sioctl(SIOCGIFMEDIA) on %s: %sioctl(SIOCGIFFLAGS): %sioctl(SIOCSIFFLAGS): %schecking if %s is ready...socket(SOCK_DGRAM): %sgetifaddrs: %sioctl(SIOCGIFAFLAG_IN6): %sget_llflag() failed, anyway I'll try%s is ready%s is tentative%s is duplicatedget_rdomain socket: %ssysctl(ICMPV6CTL_ND6_DRLIST): %smalloc: %sdefault router list contains a non-link-local address(%s)probe a router %s on %sshutdown: %snigrouppr_iphdnsdecodesummarypr_rthdrpr_icmphpr_nodeaddrpr_packmain(~v8~H~P~0$usage: ping6 [-dEefHmNnqtvWw] [-a addrtype] [-b bufsiz] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-V rtable] [hops ...] host ff02::2:0000:0000-%uVr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->\%03o --- %s ping6 statistics --- +%ld duplicates, %.1lf%% packet lossround-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms path MTU for %s is notified. (ignored) NodeInfo Supported Qtypes, compressed bitmap, raw bitmap???nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu HbH Options: Dst Options: Routing: sendmsgping6: wrote %s %d chars, ret=%d IP6HBH DSTOPT FRAG RTHDR AH ICMP6: type = %d, code = %d ESPUnknown Header(%d) No Route to DestinationDestination Administratively UnreachableDestination Unreachable Beyond ScopeDestination Unreachable, Bad Code: %d Packet too big mtu = %d Time exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option Bad code(%d) pointer = 0x%02x Listener QueryListener ReportListener DoneRouter SolicitationRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sNode Information QueryNOOPSupported qtypesDNS namenodeaddrIPv4 nodeaddrunknown qtype, subject=%s(%s), oldfqdn, no subject, subject=%sDNS label(invalid), invalidNode Information Reply, %sBad ICMP type: %drefused truncated no address %s(TTL=infty)(TTL=%u)invalid peernamefailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!)extra (%d bytes %s)refused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luinvalid socket buffer sizeMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %stoo small interval, raised to 0.01Must be superuser to preloadillegal preload value -- %s-R is not supported in this configurationinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %da:b:c:dEefHg:h:I:i:l:mnNp:qRS:s:tvV:wWtoo many intermediate hopsgetaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface namecan't initialize rthdrbad addr family of an intermediate addrcan't add an intermediate nodeUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP setsockopt(IPV6_RTHDR)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> pollrecvmsgnew path MTU (%d) is notified IPv6 addressIPv4 addressSuccessRefusedusage: %s [-aju] [-d dst] [-r seconds] [-t minutes_west] [-z output_zone] %-*s[+format] [[[[[[cc]yy]mm]dd]HH]MM[.SS]] illegal time formatUTCcannot unsetenv TZad:jr:ut:z:settimeofday%a %b %e %H:%M:%S %Z %Yspecified date is outside allowed rangeCould not get local time of dayadjtimedate set by %stoo many argumentsconversion error?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for data?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?m(%T %i of %m) .?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%tCannot allocate memoryLESSSECURE-G-L-XLESS--WARNING: terminal is not fully functionalLESS_TERMCAP_DEBUG<%s>LESS_TERMCAP_krklkukdkPkNkh@7kDLINESlicoTERMhcxndadbsgpcticdcmsomdmbvbbc|^srNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketseek error to 0ch_ungetchar overrunseek errorESC^%c*s<%X>less %s(P)+Non-match First-file EOF-ignore Keep-pos Regex-off &/Pattern not found& [Press space to continue, 'q' to quit.]There is no %s optionCommand not available(N-th) No %snext fileNo %sprevious fileNo such filemark: goto mark: Brackets: [Press 'h' for instructions.]Warning: some edit commands disabledWarning: some commands disabled"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETAESCAPELESSMETACHARS; *? '"()<>[]|&^`#\$%=~%c%s%c%s %s %sLESSCLOSELESSOPEN...skipping... Cannot seek to that file positionDetermining length of fileDon't know length of fileCannot seek to end of fileCannot seek to beginning of fileCannot seek to line number %nLESSANSIENDCHARSLESSANSIMIDCHARS0123456789;[?!"'#%()*+ Line numbers turned offCalculating line numbersInvalid mark letterMark not setUse "h" for help-" must be followed by 1 or 2 charsquotes %sTab stops and then every %d spacesless Copyright (C) 1984-2009 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less #Invalid column fractionInvalid column numberHorizontal shift %d columns.%06dHorizontal shift %s of screen widthjInvalid line fractionInvalid line numberPosition target at screen line %dPosition target at screen position %sValue is required after %sNumber is required after %s--%s-%c (--%s)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric option-%sThere is no %s option ("less --help" for help)LESS_IS_MOREBe less helpful in promptsBe helpful in promptsSearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numbersprompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linesDisplay underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file namefakeInvalid patternNo previous regular expressionPlease re-enter search patternNothing to searchmain  ^(08|@(,4̒@ ܒ@HPT \@d8LXdusage: %s [-23bcdilsTU] [-a maxreadahead] [-g maxgroups] [-I readdirsize] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-w writesize] [-x retrans] rhost:path node hostname too longno : or @ speccan't resolve address for host %sNFS PortmapCannot MNT RPCbad MNT RPCcan't access %s: %s-2 and -3 are mutually exclusiveillegal -a value %s: %sillegal -g value %s: %sillegal -I value %s: %sconflicting version optionsillegal -R value %s: %sillegal -r value %s: %sillegal -t value %s: %sillegal -w value %s: %sillegal -x value %s: %s23a:bcdD:g:I:iL:lo:PR:r:sTt:w:x:Ubgconndumbtimernfsv3mntudpresvportnfsv2acmainUSER_print_diskUSER_modifygetuintask_pidask_numask_cmdMBR_pcopyunused DOS FAT-12 XENIX / XENIX /usr DOS FAT-16 Extended DOSDOS > 32MB NTFS AIX fs AIX/Coherent OS/2 Bootmgr Win95 FAT-32 Win95 FAT32LDOS FAT-16 Extended LBAOPUS OS/2 hidden Compaq Diag.OS/2 hidden OS/2 hidden OS/2 hidden AST swap Willowtech ThinkPad Rec Willowsoft $NEC DOS 'Win Recovery8Theos 9Plan 9 @VENIX 286 ALin/Minux DRBLinuxSwap DRCLinux DR MQNX 4.2 Pri NQNX 4.2 Sec OQNX 4.2 Ter PDM QDM RCP/M or SysVSDM TOntrack UEZ-Drive VGolden Bow \Priam aSpeedStor cISC, HURD, *dNetWare 2.xxeNetWare 3.xxfNetWare 386 gNovell hNovell iNovell pDiskSecure uPCIX Minix (old) Minix (new) Linux swap Linux files*OS/2 hidden Linux ext. NT FAT VS NTFS VS Linux LVM Amoeba FS Amoeba BBT Mylex BSDI NotebookSaveFreeBSD OpenBSD NEXTSTEP MacOS X NetBSD MacOS X bootMacOS X HFS+BSDI filesy*BSDI swap Solaris CTOS DRDOSs FAT12DRDOSs < 32MDRDOSs >=32MHPFS DisbledCPM/C.DOS/C*Dell Maint SpeedStor SpeedStor SpeedStor BeOS/i386 EFI GPT EFI Sys SpeedStor DOS 3.3+ SecSpeedStor Xenix BBT XwriteXreinit[[s۸~EWflO)Ŗ,aO9vr:I=gv*5%C$$qL&9ɤξb+Fw 7W׷:fWWvkrU:;0tU|.{xws1E  'VYQȕ\'* \g"SNV.~qQ|~_Zh<(D?I 9Tl"h*BOE6FR,d dž>c "SMC݊_ǜE;G&/*!:+qiavbw>`$2_jOR%LqI(A^dtUɾLRYjkTY(@b\6~ou-9R2R 4۝։[5WCbi)hOF{-5Sq3b*>Lŕy_r,85@2l]<~M/I%C#2J6(#ϬEtv2նa7a) kx舃Y+ ?P_L,CƉ ϖfti ֖;_z->p0ȟ2ic5.f) حqRG"ЭZWdvC-?5~O@K|މkq})./;NWxq#n~7 JHB,i]_oϦe&QNg[{'ߞp0zѨ7>gp4OQn|\z~W(:-Y}^#׈}%}.[y+_Hw#q|xp9{x~+{%~AHH~cs28;þC%g#SZQnv}ۯѸ5 p5t:狱@_G'vvnFOg'g!L‮5sqEó?_Nh(:t_Ɨmoiloߩ(9RL4b6>% h4UCwhdFp S"k+ _ _- )>&֎Bq;c>OVхR {]#!EYy.@d~N^Vo/j|㺐n |cx,Q%[",S*bdaU E2&ף-0̨/ڝbFbp=AəB2,UB1E{dvyڗR8J4"<[EtӦgwNV 7R^n rE-ٟx ?nܼ:oo}McD<`}NfedI|x=P_*k|=Jf&oK3*P]HX6(I҄rT|K0V#tQ+Qy[HR"x&[r}ZD4̃8kϼH]FYg*Nޛ)#8av @]0sy{y{ݩFA+ys%~W/ƣwOQOd<VǥHl*{.+{&dNgHXKqy#nދć+@AS{ #܆ yN(ٷiK*=_)b \8uyj46Se7/wi&ˆs}JjQcq:F4ӼC.dz TK R.GL=(gec^ណ]jiN01%.#rC[ңv6xfKzt[je _WTVGoSյ(uU!) _`",K,568SHj- 8X;M+b kEk߶U0:^3O6&sѮ7JPH Q<\9^SZk(d"g ߹ȩ5WAɍLer^!QNS [QK7vEQZmh=kXt`A5\QUS-$?.&(ocUħ{E@rAgH f>l7\դu-LI 0>|?C|@_./ܘzm:ٳD6ʇ(NJ/El.*2'2۝T3ZspjI2_'HTbjr[ExKY>[NرR 4i &Cqy!mFFJZӄQ}Getns]UT <"Xq* G(6-pTWW{u5K̿k+ xd߁oy`xt~|:0vw8=RG&[(4v9dg/eaԋ~:sƥVLR':IAyL+C߁fkK OjS݈ l\1-] {1jh"3/+y >s̀ !A<حD*`93j,ﲳA{BVo7ԊI<)j@Tf͙ƲHŶ(Uja?|@$m>Yq_/>Ն'gW*wЈuw&fHa9V4]􍇧̃<4 h1o;ΞsQXџ!~*=]R x,ɩZi[,byudLtJ<\=9g w⮜[ SneX.tjў!99)8$u rF\2g翍? ,`w3;\ p6ᧃd2`*6qC[%ˑyOG+5U2@30usage: %s [-eiuy] [-l blocks] [-c cylinders -h heads -s sectors] [-f mbrfile] disk -i: initialize disk with virgin MBR -u: update MBR code, preserve partition table -e: edit MBRs on disk interactively -f: specify non-standard MBR template -chs: specify disk geometry -l: specify LBA block count -y: do not ask questions `disk' may be of the forms: sd0 or /dev/rsd0c. Cylinder argument %s [1..262144].Head argument %s [1..256].Sector argument %s [1..63].Block argument %s [1..%u].ieuf:c:h:s:l:yPlease specify a full geometry with [-chs].Can't get disk geometry, please use [-chs] to specify.using builtin MBRUnable to read MBRerror initializing MBROffset: %lld Enter 'help' for informationfdisk:%c%d> Invalid command '%s'. Try 'help'. Aborting changes to current MBR.Do you wish to write new MBR?Do you wish to write new MBR and partition table?Command help listShow entire OpenBSD man page for fdiskreinitRe-initialize loaded MBR (to defaults)setpidSet the identifier of a given table entryEdit current drive statseditEdit given table entryflagFlag given table entry as bootableUpdate machine code in loaded MBRSelect extended partition table entry MBRSwap two partition entriesPrint loaded MBR partition tablewriteWrite loaded MBR to diskexitExit edit of current MBR, without saving changesQuit edit of current MBR, saving current changesabortAbort program without saving current changes%s: [%u] %s is out of range: %c%s%c %s is invalid: %c%s%c %s [n] Partition id ('0' to disable) [%X - %X]: [%X] (? for help) '%s' is not a valid number. '%x' is out of range. %s [%d - %d]: [%d] %s is %s: %s. BytesSectorsKilobytesMegabytesGigabytesDisk: %s geometry: %d/%d/%d [%.0f %d-byte %s] geometry: %s is not a character device or a regular fileDIOCGPDINFOdisk too large (%llu sectors). size truncated.Signature: 0x%X Start of partition #%d after end! Starting Ending LBA Info: #: id C H S - C H S [ start: size ]-------------------------------------------------------------------------------%c%1d: %.2X %6u %3u %3u - %6u %3u %3u [%12u:%12.0f%s] %s Warning CHS values out of bounds only saving LBA valuesChoose from the following Partition id values:%02X %s %02X %s %02X %s %02X %s partition number is %s: %s. flag value is %s: %s. Partition %d marked active. Partition %d flag value set to 0x%x. %s %s Machine code updated.partition number is invalid:partition number is %s: %s %d same partition as %d, doing nothing. MBR contains more than one OpenBSD partition!Write MBR anyway?Writing MBR at offset %d. error writing MBROffset: %d Partition %d is not an extended partition. Loop to offset 0! Not selected.Selected extended partition %d New MBR at offset %d. Change disk geometry?BIOS CylindersBIOS HeadsBIOS SectorsPartition %d is disabled. Do you wish to edit in CHS mode?BIOS Starting cylinderBIOS Starting headBIOS Starting sectorBIOS Ending cylinderBIOS Ending headBIOS Ending sectorPartition offsetPartition sizeIn memory copy is initialized to:Use 'write' to update disk.Linvalid file type(standard input)(fd %d)usage: %s [-abcEFGHhIiLlnoqRsUVvwx] [-A num] [-B num] [-C[num]] [-e pattern] [-f file] [--binary-files=value] [--context[=num]] [--line-buffered] [pattern] [file ...] ^\((%s[[:<:]]%s%.*s%s[[:>:]]%scontext out of rangegrep version %u.%u binarywithout-matchtextUnknown binary-files optionCan't use small fgrep with -wbinary-filesmmapline-bufferedafter-contextbefore-contextextended-regexpfixed-stringsbasic-regexpwith-filenamebyte-offsetregexpno-filenameignore-casefiles-without-matchfiles-with-matchesline-numberquietsilentrecursiveno-messagesrevert-matchword-regexpline-regexpunix-byte-offsets0123456789A:B:CEFGHILRUVabce:f:hilnoqrsuvwxyLine is too big to processBinary file %s matches usage: %s %s umount [-fv] special | nodeumount -a [-fv] [-h host] [-t type]%s: not currently mounted%s: not a directory or special device%s: unmount from %s afh:t:vmain  ^(08@X@usage: mount_msdos [-9lsx] [-g gid] [-m mask] [-o options] [-u uid] special node invalid file mode: %sunknown user id: %sunknown group id: %ssl9xu:g:m:o:stat %snot an MSDOS filesystemcheckfsfsck_%snostart %s %swait %s%s/fsck_%sexec %sCan't get resource limit to max data sizeCan't get resource limit for data size-b %sInvalid option stringusage: %s [-dfnpvy] [-b block#] [-l maxparallel] [-T fstype:fsoptions] [-t fstype] [special | node ...] dvpfnyb:l:T:t:%s: unknown special file or file system.Can't open checklist file: %s/etc/fstabpass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s: Unknown pid %lddone %s: %s (%s) = %x %s: %s (%s): EXITED WITH SIGNAL %d THE FOLLOWING FILE SYSTEM%s HAD AN %s UNEXPECTED INCONSISTENCY:%s: %s (%s)%s, )c]!!\cX%`-V%`,i\1Sn6i!XfffffffffffffffffffffffffffffffmRQw }dNfev_gY&V0V$xYMuAAM pywy@so+lRJ'x/C/=M+ O$+malloc %zuuntrusted comment: invalid comment in %s; must start with '%s'comment too longmissing new line after b64 in %sinvalid b64 encoding in %sEdunsupported file %sdup failedcan't open %s for %sread from %susage: %1$s -V [-eq] [-x sigfile] -p pubkey -m message CGISVc:em:np:qs:x:must specify sigfile with - message%s.sigpath too longneed message and pubkeyfstat on %s%s must be a regular filemsg too large in %sverification failed: checked against wrong keysignature verification failedwrite to %susage: %s [-m mode] fifo_name ... usage: %s [-m mode] name b|c major minor %s [-m mode] name p node must be type 'b' or 'c'.non-numeric major number.non-numeric minor number.major or minor number too largemkfifoinvalid file mode.m:sodumpinet6_makenetandmaskgetaddrprint_rtmsgmonitorldGxdlddtctctcddddnetname6routenamep_flagsp_rtentry0123456789abcdefUGHRBD M@dmCXLS1@2 3cPTdefaultconnectedstaticospfis-isbgpbad label: %s is %sinvalid table id: %slabel too longprefixlen is not supported with af %dprefixlen %s is %s%s: link %s; %s: inet %s; %s: inet6 %s; set_metric mtu: %s is %sset_metric expire: %s is %sking bula sez: set_metric with invalid key128internal error%s: resolved to multiple valuesmpls labels require -in or -out switch%s: not a network%s: bad address%d: bad address familybotched keyword: %susage: %s [-dnqtv] [-T tableid] command [[modifiers] args] commands: add, change, delete, exec, flush, get, monitor, show setrtable sockaddrs: locks: inits: route to: %s routing message version %d not understoodmessage length mismatch, in packet %d, returned %dRTM_GET: %s (errno %d)destination: %s mask: %s gateway: %s interface: %.*s if address: %s mpls label: %s %s priority: %u (%s) flags: label: %s use mtu expire%8llu %8u%c %8lld%c sockaddrs: [rtm_type %d out of range]: len %d, if# %d, name: %s, link: %s, flags:, metric %d, flags:, if# %d, name %s, what: arrivaldeparture, priority %d, table %u, pid: %ld, seq %d, errno %d flags: use: %8llu mtu: %8u%c expire: %8lld%cso_dstso_gateso_maskso_ifpso_ifaso_labelso_srcwriting to routing socketread from routing socketmust be root to alter routing table-mplslabel requires -inet or -inet6-in requires -mpls-out requires -mpls-out requires -push, -pop, -swap-pop requires -mpls-push requires -mpls-swap requires -mplspriority is %s: %snetmask missingnet: gateway %sentry in userouting table overflownot in tableroute-sysctl-estimateactual retrieval of interface tablesetsockopt(ROUTE_MSGFILTER)setsockopt(ROUTE_TABLEFILTER)got message of size %d on %sno such interface %sactual retrieval of routing tableExamining routing table from sysctl(address family %s) write to routing socketgot only %d for rlen %-20.20s donednqtT:vrouting table %d/dev/nulladdblackholechangecloningdstencapexpiregatewaygethopcountifaifpjumbolinkllinfolocklockrestmpathmplslabelnojumbonostaticpopproto1proto2pushrecvpiperejectrttrttvarsasendpipeshowssthreshxresolveRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics or flagsRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_RESOLVE: Route created by cloningRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_IFINFO: iface status changeRTM_IFANNOUNCE: iface arrival/departureRTM_DESYNC: route socket overflowPUSHLOCALPOPSWAPlink#%dillegal prefixlen%s/%d%u/%d%u.%u/%d%u.%u.%u/%d%u.%u.%u.%u/%daf %d: %s(%d) %s%-6s %-*.*s %-6u/esp/ah/ipcomp/ipip//use/require/acquire/deny/bypass/dontacq//in/out%-*s %-5u %-*.*s %-5u InternetInternet6Encap Protocol Family %d: MPLS%-18s %-5s %-18s %-5s %-5s %-22s SourcePortProtoSA(Address/Proto/Type/Direction)%-9s %-9s %-6s %-18s %-6.6s %5.5s %8.8s %5.5s %4.4s %s In labelOut labelOpGatewayFlagsRefsUseMtuPrioInterface%-*.*s %-*.*s %-6.6s %5.5s %8.8s %5.5s %4.4s %sIfaceLabel%-6.6s %5u %8llu %5u %5s %2d %-5.16ssysctl of routing tableRouting tablesspd-sysctl-estimatesysctl of spd Encap:Extra `@' characters in usernames and passwords should be encoded as %%40 KMGTPftp://http://file::/Can't allocate memory for URL decoding <>"#{}|\^~[]`receivedCan't allocate memory to parse URLurl_get: Invalid URL '%s'No `/' after host (use -o): %sNo filename after host (use -o): %sNo filename after directory (use -o): %sCan't allocate memory for proxy URL.Malformed proxy URL: %serror in base64 encodingCan't open file %sCan't open %sCan't allocate memory for transfer bufferWriting %sReading from file(unknown)Trying %s... r+Requesting %sCan't allocate memory for URL encoding%%%02x (via %s) GET %s HTTP/1.0 Proxy-Authorization: Basic %s%s %s User-Agent: OpenBSD ftpGET %s HTTP/1.0 %s%s GET /%s %s Host: HTTP/1.0Can't allocate memory.[%s]:%s %s%s Writing HTTP requestReceiving HTTP replyError retrieving file: %sToo many redirections requestedContent-Length: Location: Relative redirect not supportedCannot allocate memory for URLRedirected to %s Reading from socketRead short file. Auto-login using ftp URLs isn't supported when using $ftp_proxyImproper response from %sftp_proxyhttp_proxyCan't allocate memory for auto-fetch.Invalid URL: %sCan't connect or login to host `%s'*?[]{}NLSTRetrieving %s/%s mget file fetch aborted. http fetch aborted. Forced abort. The connection will be closed. local: %srunique: can't find unique file name. receive aborted waiting for remote to finish abort. acceptsetsockopt TOS (ignored)%c%c%c421 Service not available, remote server has closed connection. Lost control connection for abort.%cABOR No control connection for command.QUITRETRSTOUSTORPASVproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s use of scoped address can be troublesomeEPSVwrong server: return code must be 229 LPSVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u%c%c%c%d%cparse error! setsockopt (reuse address)setsockopt IP_PORTRANGE (ignored)setsockopt IPV6_PORTRANGE (ignored)listenEPRT |%d|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dlocal: %s remote: %s REST %lldnetin: %slocal: %s: %s%s: short writeWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sftpgatehttp%s: bad port number `%s'connect to address %sfdopen failed.Connected to %s. usage: %s [-o output] ftp://[user:password@]host[:port]/file[/] ... %s [-o output] http://host[:port]/file ... %s [-o output] file:file ... %s [-o output] host:/file[/] ... FTPSERVERPORTFTPMODEpassivegateunknown FTPMODE: %s. Using defaultsgate-ftpFTPSERVERNeither $FTPSERVER nor $GATE_SERVER is defined; disabling gate-ftpdumbemacssukeep alive amount is %s: %sretry amount is %s: %s46AaCc:dD:Eegik:mno:pP:r:S:s:tvVnmap: unbalanced brackets. CWD %sCWD command not recognized, trying XCWD. XCWD %scan't get cwdSkipping non-relative filename `%s' a+winternal error: unknown type %d.TYPE %s %sTYPE %susage: %s [ | Using %s mode to transfer files. %s: unknown mode. asciiimageebcdictenex%lld byte%s %s in %.2f seconds (%.2f %sB/s) ETA: %02d:%02d:%02d %-*.*s%s %-*.*s%s %3d%% %3d%% |%.*s%*s|************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************* %5lld %c%c %2d:%02d:%02d --:-- ETA - stalled -%02d:%02d ETAUnable to determine real path of `%s'%s: not foundunable to create temporary file: %sftpXXXXXXXXXXLISTcan't find list of remote files, oops. can't find list of remote files, oops.anonymous%s@Name (%s:%s): Name (%s): USER %sPassword:PASS %sAccount:ACCT %sLogin %s failed.Already connected to %s, use close first. gateserver not defined (shouldn't happen)PASSERVE %sConnected via pass-through server %s non-printstreamSYSTRemote system type is %s. 215 UNIX Type: L8215 TOPS20Remember to set tenex mode when transferring binary files from this machine. SIZE %sMDTM %s191Y2K warning! Fixed incorrect time-val received from server. %*s %04d%02d%02d%02d%02d%02dCan't convert %s to a time. mainusage: %s [-dn%sq] dlnpqhalted (with powerdown) by %shalted by %srebooted by %s~SIGTSTP init/etc/rc/dev/consolerevokesetsidopenSIGTERM processesWARNING: some process(es) wouldn't die(can't restart init): main  ^(08X@@|0usage: mount_ffs [-o options] special node filesystem must be mounted read-only; you may need to run fsckreload5^("0@$HP.\lx' k &_ #\H$h  !@D$Đj040D0X0l0x0000d ddDdd(DTX p D(DDTTld00`000DXdh0x0DDd( @Thd```d0dd0 0 0$ 00 0< 0L 0X 0l 0 d ` ` ` ` ` ` `!0 !`!`(!`4!`@!`L!`X!`d!`p!`|!`!`!`!`!`!`!`!`!`!`!`"` "`"`$"`0"`<"`H"`T"``"`l"`x"`"`"`"`"`"""`"`"`"`#` #`#`$#`0#`<#`H#`T#``#`l#`x#`#`#`#`#`#`#`#`#d#`#`$`$`$`($0D$`P$`\$`h$`t$`$`$`$`$`$`$`$`$`$`$`$`%`%`%`(%`4%`@%`L%`X%`d%`p%`|%`%`%`%`%`%`%`%`%`%`%`&` &`&`$&`0&`<&`H&`T&``&`l&`x&`&`&`&`&`&`&`&`&`&`&`&`'`'` '`,'`8'`D'`P'`\'`h'`t'`'`'`'`'`'`'`'`'`'`'`'`(`(`(`((`4(`@(`L(`X(`d(`p(`|(`(`(`(`(`(`(`(`("(`)`)d$)`0)`<)d/etc/resolv.confCouldn't open '%s': %sCouldn't write contents to '%s': %sShort contents write to '%s' (%zd vs %zd)fchmod(fd, 0x%x) of '%s' failed (%s)fchown(fd, %d, %d) of '%s' failed (%s)warning: hostname %s contains an underscore which violates RFC 952write_file: path too long (%zu)write_file: imsg_composev: %swrite_fileInvalid option name: '%s'fcntl F_GETF: %sfcntl F_SETFL: %sUnable to clone leaseUnable to apply defaultssearch %s no memory for domainnamenameserver %s no memory for nameserver# Generated by %s dhclient no memory for courtesy lineno memory for resolv.conf contentsegresssocket errorno interface in group egress foundioctl SIOCGIFGMEMB: %sget_ifnametoo many interfaces in group egressInterface name too long: %sInterface name too longoption_as_string: bad code %udhcp option too largedaemoncannot forkchdir("/")%s [priv]no memory for priv_ibufpoll error: %simsg_read(priv_ibuf): %sCould not unlink '%s': %s%s; restarting.RESTART FAILED: '%s': %s%s; exiting bootp; %s { %s interface "%s"; fixed-address %s; next-server %s; filename server-name option %s %s; renew %w %Y/%m/%d %T UTC; rebind %w %Y/%m/%d %T UTC; expire %w %Y/%m/%d %T UTC; } offeredcannot fit offered lease into option dbcannot make offered lease into stringeffectivecannot fit effective lease into option dbcannot make effective lease into stringlease file not opencannot make lease into stringoptions do not fit in DHCPDECLINE packet.options do not fit in DHCPREQUEST packet.options do not fit in DHCPDISCOVER packet.DHCPDECLINE on %s to %s port %huNo acceptable DHCPOFFERS received.Trying recorded lease %sbound: renewal in %lld seconds.bound: immediate renewal.No working leases in persistent database - sleeping.DHCPDISCOVER on %s to %s port %hu interval %lldDHCPREQUEST on %s to %s port %hudhcpoffer: no memory to record lease.option-dhcpoffer: unknown option %dBogus data for option %sdhcpoffer: no memory for server name.Bogus server name %sdhcpoffer: no memory for filename.bound to %s -- renewal in %lld seconds.Unsatisfactory %susage: %s [-dqu] [-c file] [-i options] [-L file] [-l file] interface No memory for rtmmsg%s sa == NULL%s, not %s, added to %s%s added to %sActive address (%s) deleted; exiting%s, not %s, deleted from %s%s deleted from %s%s downLLADDR changed; restarting%s departuredno memory for errmsg'%s' is not a regular filec:di:l:L:quifi callocclient callocconfig calloc%s.%s/var/db/dhclient.leasesasprintfsetting routing table to %u: '%s'/etc/resolv.conf.tailCannot open /etc/resolv.conf.tail: %sCannot stat /etc/resolv.conf.tail: %sno memory for resolv.conf.tail contents: %sCouldn't read resolv.conf.tail: %sGot no data from resolv.conf.tailShort read of resolv.conf.tail%s: no link ... sleeping got link cannot open %s: %s_dhcpno such user: _dhcpsocketpair: %sno memory for unpriv_ibufcan't open and lock %s: %scan't open %s: %ssocket(PF_ROUTE, SOCK_RAW): %ssetsockopt(ROUTE_MSGFILTER): %ssetsockopt(ROUTE_TABLEFILTER): %s/var/empty/chrootsetresgidsetgroups/etc/dhclient.confno memory for reject address!expecting option name.too many options.expecting hex octet.string constant too long.expecting string or hexadecimal dataexpecting ':'.expecting identifier after option keyword.unknown option name.expecting string.option data buffer overflowexpecting signed 32-bit integer.expecting unsigned 32-bit integer.expecting unsigned 16-bit integer.expecting unsigned 8-bit integer.expecting identifier.truefalseexpecting boolean.Bad format %c in parse_option_param.out of memory allocating option data.expecting interface name (in quotes).wrong interface name.expecting lease declaration.expecting left brace.no memory for lease.unterminated lease declaration.Obsolete client identifier (%s) in recorded leaseexpecting a statement.unterminated interface declaration.Corrupt lease file - possible data loss!getifaddrs failedinterface %s already has the offered subnet!Can't create socketinterface_link_forceup: SIOCGIFFLAGS failed (%s)interface_link_forceup: SIOCSIFFLAGS DOWN failed (%s)interface_link_forceup: SIOCSIFFLAGS UP failed (%s)receive_packet failed on %s: %sInterface %s no longer appears valid.no space to remember ifpNo interfaces availableInterface %s: rdomain changed out from under usNo live interface to poll onpoll: %sdispatch%s; restartingsend_packet: %ssocket(SOCK_RAW): %ssetsockopt(IP_HDRINCL): %ssetsockopt(SO_RTABLE): %s/dev/bpf%dCan't find free bpf: %sCan't attach interface %s to bpf device %s: %sCan't get BPF version: %sKernel BPF version out of range - recompile dhcpd!Can't set immediate mode on bpf device: %sCan't set filter-drop mode on bpf device: %sCan't get bpf buffer length: %sCan't allocate %lu bytes for bpf input buffer.Can't install packet filter program: %sCan't install write filter program: %sCannot lock bpfcSc"'$`\\%cpretty_print_option: bad code %d%s: Excess information in format string: %s%s: no size indicator before A in format string: %s%s: garbage in format string: %s%s: expecting at least %d bytes; got %d%s: expecting only %d bytes: got %d%s: expecting %d bytes: got %d%s/%uUnexpected format code %coption %s (%d) larger than buffer.option %s has no length field.Can't allocate storage for option %s.Can't expand storage for option %s.DHCPACKDHCPOFFERDHCPNACKBOOTREPLY%s from %s (%s)no memory for info stringeof in string constantstring constant too longnumeric token larger than internal bufferappendbackoff-cutoffbootpdenyethernetfixed-addresshardwareignoreinitial-intervallink-timeoutmediumnext-serverprependrebindrenewrequireretryselect-timeoutsendserver-namesupersedetimeout%s line %d: %s%*c^ %s: msgbuf_write: %sRTM_DELETE write: %sshort RTM_DELETE write (%zd) DHCLIENT DHCLIENT %dcreating route label: %screating route label: label too long (%d vs %zd)default route socket: %sRTM_GET of default route: %sget default route read: %sno data from default route readdefault route read rtm: %ssendhup: imsg_compose: %ssendhupadd_address: imsg_compose: %sadd_addressdelete_address: imsg_compose: %sdelete_addressadd_route: imsg_compose: %sadd_routeflush_routes: imsg_compose: %sflush_routessocket open failed: %sSIOCAIFADDR failed (%s): %sSIOCDIFADDR failed (%s): %sdelete_addresses getifaddrs: %sRouting Socket open failed: %sfailed to add default route: %sroutes buf malloc:sysctl retrieval of routes:route cleanup failed - %s %s (msize=%zu)opening socket to flush routes: %ssysctl size of routes:%d bad IP checksums seen in %d packets%d udp packets in %d too long - dropped%d bad udp checksums in %d packetspadsubnet-masktime-offsetIAtime-serversien116-name-serversdomain-name-serverslog-serverscookie-serverslpr-serversimpress-serversresource-location-servershost-nameboot-sizemerit-dumpdomain-nameswap-serverroot-pathextensions-pathip-forwardingnon-local-source-routingpolicy-filterIIAmax-dgram-reassemblydefault-ip-ttlpath-mtu-aging-timeoutpath-mtu-plateau-tableSAinterface-mtuall-subnets-localbroadcast-addressperform-mask-discoverymask-supplierrouter-discoveryrouter-solicitation-addressstatic-routestrailer-encapsulationarp-cache-timeoutieee802-3-encapsulationdefault-tcp-ttltcp-keepalive-intervaltcp-keepalive-garbagenis-domainnis-serversntp-serversvendor-encapsulated-optionsnetbios-name-serversnetbios-dd-servernetbios-node-typenetbios-scopefont-serversx-display-managerdhcp-requested-addressdhcp-lease-timedhcp-option-overloaddhcp-message-typedhcp-server-identifierdhcp-parameter-request-listBAdhcp-messagedhcp-max-message-sizedhcp-renewal-timedhcp-rebinding-timedhcp-class-identifierdhcp-client-identifieroption-62option-63nisplus-domainnisplus-serverstftp-server-namebootfile-namemobile-ip-home-agentsmtp-serverpop-servernntp-serverwww-serverfinger-serverirc-serverstreettalk-serverstreettalk-directory-assistance-serveruser-classoption-78option-79option-80option-81relay-agent-informationoption-83option-84nds-serversnds-tree-namends-contextoption-88option-89option-90option-91option-92option-93option-94option-95option-96option-97option-98option-99option-100option-101option-102option-103option-104option-105option-106option-107option-108option-109option-110option-111option-112option-113option-114option-115option-116option-117option-118option-119option-120classless-static-routesCIAoption-122option-123option-124option-125option-126option-127option-128option-129option-130option-131option-132option-133option-134option-135option-136option-137option-138option-139option-140option-141option-142option-143tftp-config-fileoption-145option-146option-147option-148option-149voip-configuration-serveroption-151option-152option-153option-154option-155option-156option-157option-158option-159option-160option-161option-162option-163option-164option-165option-166option-167option-168option-169option-170option-171option-172option-173option-174option-175option-176option-177option-178option-179option-180option-181option-182option-183option-184option-185option-186option-187option-188option-189option-190option-191option-192option-193option-194option-195option-196option-197option-198option-199option-200option-201option-202option-203option-204option-205option-206option-207option-208option-209option-210option-211option-212option-213option-214option-215option-216option-217option-218option-219option-220option-221option-222option-223option-224option-225option-226option-227option-228option-229option-230option-231option-232option-233option-234option-235option-236option-237option-238option-239option-240option-241option-242option-243option-244option-245option-246option-247option-248classless-ms-static-routesoption-250option-251autoproxy-scriptoption-253option-254option-endexpecting semicolon.time string too longinvalid time string%w %Y/%m/%d %T UTC%w %Y/%m/%d %T%u %Y/%m/%d %Tunparseable time stringtime could not be representedexpecting unsigned 32-bit decimal value.expecting CIDR subnet.expecting '/'.Expecting CIDR prefix length.expecting 'ethernet'.expecting '.'.expecting decimal octet.filename must be a stringno memory for string %s.dispatch_imsg: imsg_get failure: %sbad IMSG_DELETE_ADDRESSbad IMSG_ADD_ADDRESSbad IMSG_FLUSH_ROUTESbad IMSG_ADD_ROUTEbad IMSG_HUPshort IMSG_WRITE_FILEbad IMSG_WRITE_FILE (%zu)received unknown message, code %ucannot close temp fileinvalid address/tmp/ed.XXXXXXXXXXw+cannot open temp fileline too longcannot seek temp filecannot write temp filecannot read temp fileunexpected end-of-file& no previous commandinvalid pattern delimiter\  \abfnrtv\cannot read stdincannot write filecannot open output filecannot close output filecannot read input filenewline inserted newline appended cannot open input filecannot close input fileshell access restrictedinvalid mark charactered.hup/ed.hupno current filenameinvalid filenamefilename too longno matchnumber out of rangeinvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioncrypt unavailableHOMEcrypt unavailable ? p:sx ? interrupt? warning: file modifiedscript, line %d: %s usage: %s [-] [-sx] [-p string] [file] unbalanced brackets ([])trailing backslash (\)no previous patterninfinite substitution loopnothing to undocopy_link%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).HLPRfiprthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too longusage: %s [-fip] [-R [-H | -L | -P]] source target %s [-fip] [-R [-H | -L | -P]] source ... directory lchown: %sutimes: %schown: %schmod: %schflags: %sunlink: %smknod: %smkfifo: %sreadlink: %ssymlink: %soverwrite %s? @@@@AAJH4EIAA A>>      A@!  @a`10  @`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O @@ !1Aa  0@` #+3;CScs,AT!6Se96Se97SL) ua6Se96Se97SL) 2f!6Se96Se97SL) Sa6Se96Se97SL).!6Se96Se97SL)ya6Se96Se97SL)EG!6Se96Se97SL),.a6Se96Se97SL)!&]!6SHH:6SHH:7SL)םLXa6SHH:6SHH:7SL)L .!6SHH:6SHH:7SL)j嘽a6SHH:6SHH:7SL)Ej !6SHH:6SHH:7SL)wOea6SHH:6SHH:7SL)8쁶!6SHH:6SHH:7SL)1a6SHH:6SHH:7SL)t;!6SHH:6SHH:7SL)M6@a6SHH:6SHH:7SL) &!6SHH:6SHH:7SL)XLa6SHH:6SHH:7SL)1X!6SHH:6SHH:7SL)a6SHH:6SHH:7SL)!6SHH:6SHH:7SL)a6S1:6S1:7SL)!6S1:6S1:7SL)(a6S1:6S1:7SL)CFS!6S1:6S1:7SL):a6S1:6S1:7SL)^H!6S1:6S1:7SL)3Bpa6S1:6S1:7SL)Ek8!6S1:6S1:7SL)Ma6S1:6S1:7SL)!6S1:6S1:7SL)Xya6S1:6S1:7SL)b !6S1:6S1:7SL)t6.a6S1:6S1:7SL)(!6S1:6S1:7SL)ja6Smy;6Smy;7SL)]Eh~!6Smy;6Smy;7SL)a6Smy;6Smy;7SL)/c!6Smy;6Smy;7SL)^a6Smy;6Smy;7SL)W!6Smy;6Smy;7SL)Pa6Smy;6Smy;7SL)F !6Smy;6Smy;7SL)Fa6Smy;6Smy;7SL)T!6Smy;6Smy;7SL)X̷a6Smy;6Smy;7SL)p!!6Smy;6Smy;7SL);a6Smy;6Smy;7SL)l ǭ!6Smy;6Smy;7SL) %;a7Sbw7Sbw7SL)!7Sbw7Sbw7SL)wya7Sbw7Sbw7SL)9$!7Sbw7Sbw7SL) a7Sbw7Sbw7SL)Ww!7Sbw7Sbw7SL)ᴀa7Sbw7Sbw7SL) ̄4!7Sbw7Sbw7SL) S{a7Sbw7Sbw7SL) C!7Sbw7Sbw7SL) 4a7Sbw7Sbw7SL) ~G!7Sbw7Sbw7SL) pca7Sbw7Sbw7SL) X:!7Sbw7Sbw7SL) 3P5a7S7S7SL) rC!7S7S7SL) y܊a7S7S7SL)+ !7S7S7SL)a7S7S7SL)G!7S7S7SL)G!7S7S7Sr _Bu!7S7S7S4Ζ DRBua7S7S7SL){On!7S7S7SL)xRa7S7S7SuL!7S7S7SC!7S7S7S?3!7S7S7S?}na7S7S7S"H!7SHC7SHC7S3a7SHC7SHC7S!7SHC7SHC7Sעa7SHC7SHC7Sil!7SHC7SHC7SBfa7SHC7SHC7S;b!7SRA7SRA7S!7SRA7SRA7SRA<!7SRA7SRA7SRA=\4!7SRA7SRA7SRA"!7SRA7SRA7SRA"!7SRA7SRA7SRA4Qoc!7SRA7SRA7Sf!7SRA7SRA7SRA(|%!7SRA7SRA7SRA(I0!7SRA7SRA7SRA(T!7SRA7SRA7SRA({, "†$mIw]JZ-,n-EvXa:#%cG>cX@ . ..GMAKEDEVHconsoleI ttyJ memKkmem6Lnull6Mzero6NstdinOstdoutPstderrQksymsRklog6Sbpf06Twd0a6Urwd0aVwd0b6Wrwd0bXwd0c6Yrwd0cZwd0d6[rwd0d\wd0e6]rwd0e^wd0f6_rwd0f`wd0g6arwd0gbwd0h6crwd0hdwd0i6erwd0iA ...B . ..chowndhclient disklabeldmesgfdiskfsck fsck_ext2fsfsck_ffsifconfiginitmknodmount mount_cd9660@ mount_ext2fs@ mount_ffs mount_msdos mount_nfsnewfs newfs_msdospingping6reboothaltroutertsolumountsysctlC . ..D binmdecsbinEshareD .C .. ftpgrepfgrepegrepgzipgunzipgzcatlessmore sedPsignifyE .C ..miscԣkeymapsF ...may not mix -o, -c, or -t options%s is a directory: ignored: unchanged%s not a regular file%s%s already has %s suffix -- unchanged%s: unknown suffix: ignored%s%s: name too long%s: input: %sdeflate.gz123456789ab:cdfhLlNnOo:qrS:tVvcfhLlNno:qrtVvfhqrZgzz1.2.3need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionusage: %s [-R [-H | -L | -P]] %s file ... owner[:group]usage: %s [-h] [-R [-H | -L | -P]] %s file ... %s [-h] [-R [-H | -L | -P]] :group file ... group is %s: %suser is %s: %sHLPRXfghorstuwxthe -R and -h options may not be specified together.invalid flags: %sinvalid flag: %smakeentrylinkupfileerrordirscaniblockckinodecheckfilesyspass2pass2checkpass5setupP@XdpxHTP8H @ catchinfocatchquit?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@%lld %s I=%llubad size: blk %lld, offset %lld, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock.fs_fpg %d cannot allocate memory for inode cache cannot increase directory listbad inode number %llu to nextinode %llu cannot alloc %lu bytes to extend inoinfo CG %d: BAD MAGIC NUMBER %lld files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %lld files missing %lld blocks missing %lld,conversion levelcannot do level %d conversion usage: %s [-fnpy] [-b block#] [-c level] [-m mode] filesystem ... dfpnNyYb:c:m:EXCESSIVE DUP BLKS I=%llucannot alloc %u bytes for inoinfobad direct addr: %ld bad indirect addr: %ld INCORRECT BLOCK COUNT I=%llu (%ld should be %d)too many inodes %llu cannot realloc %zu bytes to %zu for inoinfo phase 1, inode %llu/%lluphase 1b, inode %llu/%llu%s %s: LENGTH %ld NOT MULTIPLE of %d%s %s: LENGTH %ld NOT MULTIPLE OF %dphase 2, directory %d/%dphase 2, parent directory %d/%d (REMOVED)phase 3, directory %d/%ldphase 4, inode %llu/%lluDELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS UNKNOWN ROTATIONAL TABLE FORMAT %d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %ld MARKED FREE ALLOCATED FRAG %ld MARKED FREE BLK(S) MISSING IN BIT MAPSphase 5, cg %d/%d%s: NOT LABELED AS A BSD FILE SYSTEM (%s) NCG OUT OF RANGECPG OUT OF RANGENCYL LESS THAN NCG*CPGSBSIZE PREPOSTEROUSLY LARGEILLEGAL BLOCK SIZE IN SUPERBLOCKILLEGAL FRAGMENT SIZE IN SUPERBLOCKoffset %d, original %ld, alternate %ld VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN LAST ALTERNATEINFORMATION; SEE fsck_ffs(8).clean = %d UNDEFINED OPTIMIZATION IN SUPERBLOCKIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE NPSECT=%d IN SUPERBLOCK (FIXED)INCORRECT BMASK=%x IN SUPERBLOCKINCORRECT FMASK=%x IN SUPERBLOCKINCORRECT BSHIFT=%d IN SUPERBLOCKINCORRECT FSHIFT=%d IN SUPERBLOCKFormat of filesystem is too old. Must update to modern format using a version of fsck from before release 5.0 with the command ``fsck -c 2'' INCORRECT MAXFILESIZE=%llu IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%lx IN SUPERBLOCKINCORRECT QFMASK=%lx IN SUPERBLOCKINCONSISTENT CGSIZE=%d INCONSISTENT INOPB=%d INCONSISTENT NINDIR=%d cannot alloc %u bytes for cylinder group summary area cannot alloc %u bytes for inostathead cannot alloc %zu bytes for inpsort cannot alloc %zu bytes for inphead inoinfo: inumber %llu out of rangeCANNOT %s: BLK %lldWRITING %sZERO'ED BLOCK %lld TO DISK UPDATE STANDARD SUPERBLOCK %lld (%lld),   delete %d: %sinsert %d: %ssession database close: %ssession database open: %scannot get kernel security level: %scannot change kernel security level from %d to %d: %sfatal signal: %scan't parse getty for port %scan't allocate windowcan't parse window for port %sport %s changed utmp index from %d to %dcan't fork for window system on port %s: %msetsid failed (window) %mcan't exec window system '%s' for port %s: %mcan't fork for getty on port %s: %mgetty repeating too quickly on port %s, sleepingcan't exec getty '%s' for port %s: %msome processes would not die; ps axl advisedcan't open %s: %mcan't get %s for controlling terminal: %mcannot disable lid suspendcan't exec %s for %s %s: %mautobootcan't exec %s for %s: %mcan't fork for %s on %s: %mwait for %s on %s failed: %m; going to single user modeinit: %s on %s stopped, restarting %s on %s terminated abnormally, going to single user mode/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bincan't exec %s for single user: %mcan't fork single-user shell, trying againwait for single-user shell failed: %m; restartinginit: shell stopped, restarting single user shell terminated.single user shell terminated, restartinginit: %s init: already running initial setsid() failed: %mrootsetlogin() failed: %munrecognized flag '-%c'sfignoring excess argumentsusage: %s [-b block-size] [-c fragments-per-cylinder-group] [-e maxbpg] [-f frag-size] [-i bytes] [-m free-space] [-o options] [-P file] [-s size] special node usage: %s [-Nq] [-b block-size] [-c fragments-per-cylinder-group] [-e maxbpg] [-f frag-size] [-g avgfilesize] [-h avgfpdir] [-i bytes] [-m free-space] [-O filesystem-format] [-o optimization] [-S sector-size] [-s size] [-T disktype] [-t fstype] special ioctl (WDINFO)%s: can't rewrite disk labelinsane maxpartitions value %dP:T:b:c:e:f:i:m:o:s:NO:S:T:b:c:e:f:g:h:i:m:o:qs:t:%s: invalid ffs versionsector size invalid: %sblock size is %s: %sfragments per cylinder group is %s: %sblocks per file in a cylinder group is %s: %sfragment size is %s: %saverage file size is %s: %saverage files per dir is %s: %sbytes per inode is %s: %sfree space %% is %s: %s%s: unknown optimization preference: use `space' or `time'.file system size invalid: %snewfs_%s%s/newfs_%s%s not found%s: getmntinfo: %s%s: not a character-special device%s: can't figure out file system partition%s: `%c' partition is unavailable%s: `%c' partition overlaps boot program%s: no default sector size%s: maximum file system size on the `%c' partition is %llu sectorswarning: changing optimization to space because minfree is less than %d%% setblock bad fs_frag %dclrblock bad fs_frag %disblock bad fs_frag %dwtfs: write error on block %lldrdfs: read error on block %lldcg 0: bad magic numberfirst cylinder group ran out of spaceinternal error: can't find block in cyl 0ilog2: %d is not a power of 2 fsinit: inode value %llu out of rangeinode table does not fit in cylinder grouppanic: cylinder group too big: %d > %dpreposterous size %lld, max is %dpreposterous size %lld, max is %lldblock size must be a power of 2, not %dfragment size must be a power of 2, not %dfragment size %d is too small, minimum is %lldblock size %d is too small, minimum is %dblock size %d is too large, maximum is %dblock size (%d) cannot be smaller than fragment size (%d)fragment size %d is too small, minimum with block size %d is %ddensity reduced from %d to %d bytes per inodecan't honour -c: minimum is %dfile system size %jd < minimum size of %d fragmentsreduced number of fragments per cylinder group from %d to %d to enlarge last cylinder groupcalloc failed%s: %.1fMB in %jd sectors of %lld bytes %d cylinder groups of %.2fMB, %d blocks, %d inodes each can't get physmemwarning: fsck_ffs will need %lluMB; min(MAXDSIZ,physmem) is %lluMBsuper-block backups (for fsck -b #) at:cannot allocate I/O bufferfsinit1 failedfsinit2 failed%s: initializing cg %ld/%d checkrm_overwriteusage: %s [-dfiPRr] file ... "." and ".." may not be removedremove %s? override %s%s%s/%s for %s? %s (inode %llu): not overwritten due to multiple links%s: malloc%s: is a directorydfiPRrusage: %s [-t] device usage: %s [-f device] command [count] %d: unknown tape drive type %s tape drive, residual=%d erblocksize: %d (%d) density: %d (%d) ioctl MTIOCGETf:no remote support%s: unknown command%s: illegal countbsfbsrdensityeomfsffsrofflinerewindrewofflretensionweofWriteProtectMounted76543210usage: %s [-p] [-m mode] directory ... m:p\ can not be used as a string delimiternewline can not be used as a string delimiterwhitespace after %sundefined label '%s'RE error: %sunterminated regular expressionexpected context addressunexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandfilename expectedw commandread commandbranchempty labelduplicate label '%s'substitute pattern can not be delimited by newline or backslashunterminated substitute pattern123456789\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expressionmore than one number or 'g' in substitute flagsnumber in substitute flags out of rangeno wfile specifiedbad flag in substitute command: '%c'transform pattern can not be delimited by newline or backslashunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthextra text at the end of a transform commandunused label '%s' ..."usage: sed [-aEnru] command [file ...] sed [-aEnru] [-e command] [-f command_file] [file ...] Eae:f:nrustdout: %ssed: %lu: %s: first RE may not be empty\ %03o\%d not defined in the RE\abfrtv { {$1 {H) xL) ${l 0{l4 4{ @{ H{ P{ lL) T{/ X{l d{l p{$ |{% { { + {{c_umaskl}dR p}5 t}b x}B }5 }B }DK }8 }`D }5 }`D }A }S }? }J }Q }K }b }5 ~hf ~E ~@ T6 ~5 h-a-b-c-d -e-f-G-g-h -H -k-L -n-O-o-p -r-s-S -t-u-w-x-z===!=<>-eq-ne-gt-ge-lt -le!-ef"-nt#-ot$d~TX|tfcdslmnTpx_modex_search_histkb_addx_bindx_emacst ̖ $ < PH ` l  ̣  ā Ё ؁ ( p 4 D?ĕ   $  $h 0 @\ LH T ` p  @  P < ȂT ؂t t  $ ؘ , HT XЃ lH t ܗ (Y  hȦ Р  ă ԃ <  dbteste_isa܆++--==!== *= /= %= += -= <<= >>= &= ^= |= <<>><=>=<>&& || */%+-&^|? , ~!():hist_initj_printܠ ,doppromptyylexIFS= ${PS2=> } ${PS3=#? } ${PS4=+ }Џ܆̏ȅgmatchgetoptions(a4@cHTdeltiklXdmCnfĒb̒uԒprg,shv8,<xdo_phys_pathshf_vfprintf    ȕ L` ( 08Hhؕ<{(}T@DHLPT ttttu]]<>!let||&&()str_val,e X  8 0 șЙؙܠ@(#)PD KSH v5.2.14 99/07/13.2 AAA  Q AA A QBafree: %p not present in area %punable to allocate memorylmmissing options argumentmissing name argument%s: is not an identifierc_getopts: no argvarguments changed since last callOPTARGbad signal `%s'ls:usage: kill [-s signame | -signum | -signame] { job | pid | pgrp } ... kill -l [exit_status ...] %s: arguments must be jobs or process IDs%*d %*s %s%*d %*d %sjob control not enabled%%lpnzno argumentsadtdprtUxalias: -r flag can only be used with -t and without arguments alias %s alias not found L#R#UZ#fi#lprtuxonly -t, -u and -x options may be used with -ffunction %s %T %s() %T %s: not identifiertypeset -i -x -r -t -L%d -R%d -Z -l -u -U exportreadonly%s[%d]pvpvV is a reserved wordexported is an %salias for alias %s= is an exported traced undefined (autoload from %s) function special is a%s shell builtin is a tracked %salias for not found%s is *GOK*Rnprsu,-n-p: %s-u: %s: %sLPcan't get current directory - %srestricted shell - can't cdPWDOLDPWDno home directory (HOME not set)no OLDPWDdon't know current directoryCDPATH%s: bad directory+alias+cd+command*=export+fc+getopts+jobs+killletpwd*=readonly=typeset+unaliaswhence+bg+fgunalias-tacan't suspend a login shellinvalid file modeusage: mknod [-m mode] name b|c major minorusage: mknod [-m mode] name ptime: -%s unknown optiontime: -%s requires an argument:p%s%*lld.%02ld%s%s%*lldm%lld.%02lds%sreal real user sys user system fv%s is read only%s: cannot %s%s: can only %s %d level(s)%s: bad numberugorwx%#3.3o augo=+-rwxugoXsbad masktrap -- bad signal %sprsu,nothing to shift*=.*=:[*=break=builtin*=continue*=eval*=exec*=exit+false*=return*=set*=shift=times*=trap+=wait+readtest+trueulimit+umask*=unsetsuspendmissing closing parenmissing argumentexpression expectedmissing second argumentmissing expression operatorunexpected operator/operandinternal error: unknown opmissing ]-t-aunlimited unlimitedinvalid limit: %s-%c exceeds allowable limitbad -%c limit: %susage: ulimit [-acdfHlmnpSst] [value]ulimit: %c%-20s time(cpu-seconds)file(blocks)coredump(blocks)data(kbytes)stack(kbytes)lockedmem(kbytes)memory(kbytes)nofiles(descriptors)IFS"#$&'()*:;<=>?[\]`{|};|&()`+@!fileglob: substitute errorFPATH nothing to yank yank something first I-search: duplicate binding for %sPOSIX%s = %s %s = '%s' cannot bind, not a ttyauto-insert%s: no such functioninvalid return codebeginning-of-historycomplete-commandcomplete-filecompletedelete-char-backwarddelete-word-backwarddelete-char-forwarddelete-word-forwardkill-lineredrawend-of-historyeot-or-deletegoto-historymacro-stringkill-to-eolkill-regionlist-commandlist-filequoteyank-popbackward-charbeginning-of-linebackward-wordend-of-lineforward-charforward-wordnewlinedown-historynewline-and-nextno-opup-historyprev-hist-wordsearch-character-forwardsearch-character-backwardsearch-historyset-mark-commandstuffstuff-resettranspose-charsexchange-point-and-markcomplete-listexpand-filecapitalize-worddowncase-wordupcase-wordset-argcomment*+?@! substituteexpand(NULL)%Rfunny $() command: %s%s: cannot open $(<) input%s: parameter not set%S%s: bad substitutionparameter null or not set%*d) %sdbteste_error: %s (offset %d)shcomexec: %shere document missingcan't %s temporary file %s: %sherein: yylexerror writing %s: %sPS4%s%s %s: restricteddupcannot %s %s: %scould not finish (dup) redirection %s: %scoprocess already existsPS3EXECSHELL%s: %s: %sbuiltin: %s: not a builtincommand -p: restricted%s: can't find function definition file - %s%s: can't find function definition file%s: can't open function definition file %s - %s%s: function not defined by %sCFUNC %d%s: cannot execute - %s-rend of expression%s: unexpected `%s'%s: bad number `%s'%s: expression recurses on parameter `%s'%s: %s requires lvalue%s: %s applied to read only variablemissing )zero divisormissing :HISTFILE%s.%dno history (yet)%s: not in history%s: invalid rangehistory functions not available-%c%se:glnrs0,1,2,3,4,5,6,7,8,9,can't use -e, -l, -n, -r with -s (-e -)substitution failedcan't use -l, -n with -e-16%.*s cannot create temp file %s - %serror writing temporary file - %s${FCEDIT:-/bin/ed} $_cannot open temp file %serror reading temp file %s - %sno coprocess%s/shXXXXXXXXbad file descriptorfd not open for readingfd not open for writingillegal file descriptor name%s[%d]: internal error: shl_stdout not validtoo many files open in shellcan't create pipe - try again RunningDoneDone (%d)[%d] %c %5d (core dumped)%s%s %-20s %s%s%s%s%5d %-20s %s%s %s%sremove_job: job not found (%s)notifyj_async: job not startedj_async: bad nzombie (%d)zombiejobsstopped and runningYou have %s%s%s jobs j_waitj: tcsetpgrp(%d, %d) failed: %sjob not job-controlled[%d] | 1st tcsetpgrp(%d, %d) failed: %sfg: 2nd tcsetpgrp(%d, %d) failed: %scannot continue job %s: %sjw:resumejw:waitforwaitlast: no last jobwaitlast: not startedjw:waitlastexchild: XPIPEI and no last_job - pid %dfork failedcannot fork - try againchildexchild: execute() returned[%d]jw:last procj_init: getpgrp() failed: %sj_init: tcgetpgrp() failed: %sj_init: setpgid() failed: %sj_init: tcsetpgrp() failed: %swarning: won't have full job controlj_suspend: tcsetpgrp() failed: %sj_suspend: setpgid() failed: %scheck_job: job started (flags 0x%x)checkjobno such jobambiguousargument must be %job or process id%a %b %d%l:%M:%S%r~/%sPS1\$PS2missing ] no closing quote here document `%s' unclosed MAILyou have mail in $_shell: %dUse `exit' to leave ksh include: %drshrkshrpdkshpdrkshSH_VERSIONPPIDUSER$ -c requires an argumentCannot determine current working directory/etc/profile$HOME/.profile/etc/suid_profileENVtypesetKSH_VERSION-xOPTIND=1evaltypeset -i RANDOM MAILCHECK="${MAILCHECK-600}" SECONDS="${SECONDS-0}" TMOUT="${TMOUT-0}"hash=alias -ttype=whence -vstop=kill -STOPautoload=typeset -fufunctions=typeset -fhistory=fc -linteger=typeset -inohup=nohup local=typesetr=fc -e -login=exec login-tUccmailmakeprviwho |&;<>()*@#!$-? =-+?#% "#$&'()*;<>?[\`|0123456789ABCDEF%-*s%*s'\'%s%s-%c: unknown option%s%s-`%c' requires argument%-*s %sA:o;sCurrent option settings -o %s%s: bad optionparse_args: `%c'allexportbraceexpandbgnicecsh-historyemacs-usemetaerrexitgmacsignoreeofinteractivekeywordloginmarkdirsnoclobbernoglobnohupnolognounsetphysicalposixprivilegedtrackallverbosevirawvi-show8vi-tabcompletevi-esccompletextracealnumalphablankcntrldigitgraphlowerpunctupperxdigitshf_flush: no fdshf_emptybuf: no fdshf_write: flags %xshf_write: nbytes %dshf_putchar: flags %xshf_putchar: no fd0123456789abcdef(null %s)shf_ungetc: flags %xshf_fillbuf: no fdshf_getchar: flags %xshf_getse: flags %xshf_read: flags %xshf_read: bsize %dshf_sopen: flags 0x%xshf_snprintf: buf %lx, bsize %dshf_reopen: missing read/writeshf_reopen: bad shf/buf/bsizeshf_fdopen: missing read/writeunmatchedsyntax error: unexpected EOF ?%dsyntax error: `%s' %s unexpectedtoo many <<'s too many redirections for%s: bad identifier %s: invalid function name thenelseelifficaseesacwhileuntildo{[[&&||;;((|&too many varssetexecsig: unset signal %d(%s)ERRError handlerEXITtimed out waiting for inputSIGwdscan: unknown char 0x%x (carrying on)%S #no-vars# #no-args# ( %T) %T| %T%;%T%s %T %S ]] select %s for %s in %;do%N%T%;done case %S in%N(%S%c%;%T%N;;%Nesac if %Tthen%N%Telif %Telse%;%T%;fi %s %T%;do{%;%T%;} %T|& %T& function %s %T%s() %Ttime %T< <<- << >> >| <> <&>&No controlling tty (open /dev/tty: %s)Can't find tty file descriptorj_ttyinit: dup of tty fd failed: %sj_ttyinit: can't set close-on-exec flag: %s%0*s%.*s%*s%.*s%s: subscript %ld out of range%s: is read onlysetstr: %s=%s: assigning to self0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789abcdefghijklmnopqrstuvwxyzOPTINDPOSIXLY_CORRECTHISTSIZEMAILCHECKMAILPATHRANDOMSECONDSTMOUTLINENOM-grabhist: bad history arrayy$%s %dfc -e ${VISUAL:-${EDITOR:-vi}} --derive_key_pkcsbio_diskinqbio_createflagsbio_parse_devlistbio_changepassbio_deleteraidbio_createraidbio_blinkbio_getvolbynamebio_alarmbio_inqstr2locatorbio_setblinkbio_setstatemainInvalid keyInvalid saltToo few rounds: %dcan't specify passphrase file during initial creation of crypto volumeinvalid passphrase filecan't stat passphrase filepassphrase file must be owned by rootpassphrase file has the wrong permissionscan't read passphrase fileinvalid passphrase lengthunable to read passphraseRe-type passphrase: Passphrases did not matchpbkdf2 failedinvalid KDF infoinvalid KDF hintKDF hint has invalid sizeunknown KDF type %dnumber of KDF rounds too low: %dDIOCINQ%s: <%s, %s, %s>, serial %s invalid flags listinvalid flag %sinvalid device listcould not open %scould not stat %stoo many devices on device listduplicate device in listNew passphrase: unknown errorBIOCDISCIPLINEOld passphrase: BIOCDELETERAIDno devices specifiednot enough memory for dev_t listunsupported raid levelnot enough disksnot exactly one partitionioctlPassphrase: BIOCCREATERAID/dev/bioCan't locate %s device via %sBIOCBLINKBIOCINQBIOCVOLinvalid alarm function: %sBIOCALARMalarm is currently %s %-11s %-10s %14s %-8s VolumeStatusSizeDevice %d%% done %u secondsScrubbingInvalidOnlineOfflineDegradedBuildingRebuildWTWB%s %u%14llu%11s %-10s %14s %-7s CRYPTO%s%s %11s %-10s %14s %-7s CONCAT%s%s %11s %-10s %14s %-7s RAID%u%s%s %s BIOCDISKFailedHot spareUnused %3u%14skey disk%u:%u.%unoenclunknown serial%11s %-10s %14s %-7s %-6s <%s> %11s %-10s %14s %-7s %-6s '%s' target not specifiedTarget %s: %sDisk %s is not in an enclosureDisk %s does not existinvalid device %sBIOCSETSTATEusage: %s [-hiqv] [-a alarm-function] [-b channel:target[.lun]] [-H channel:target[.lun]] [-R device | channel:target[.lun]] [-u channel:target[.lun]] device %s [-dhiPqsv] [-C flag[,flag,...]] [-c raidlevel] [-k keydisk] [-l special[,special,...]] [-O device | channel:target[.lun]] [-p passfile] [-R device | channel:target[.lun]] [-r rounds] device Invalid RAID levelNumber of rounds is %s: %sa:b:C:c:dH:hik:l:O:Pp:qr:R:svu:need deviceneed -c parameterneed -l parametermust use bio deviceusage: %s seconds do_movemainusage: %s [-fi] source target %s [-fi] source ... directory /bin/cp-PRp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status/bin/rm-rf%s: remove%s: set owner/group; not setting setuid/setgid%s: set owner/group%s: set mode%s: set flags%s: set timesrename %s to %scannot resolve %scannot rename a mount pointcan't remove %s%s: destination pathname too longeval5syntax error|&=<>+-*/%:()non-numeric argumentdivision by zerousage: %s [-M core] [-N system] M:N:sysctl: KERN_MSGBUFSIZEcouldn't allocate space for buffer datasysctl: KERN_MSGBUFmainusage: %s [-s] [name-of-host] sethostnamegethostname/etc/networks"(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDlɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~[/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxqg jgrn<:ORQhك[0.0.0.0127.0.0.1::::1/etc/group/etc/spwd.db/etc/pwd.db/etc/ethers%02x:%02x:%02x:%02x:%02x:%02x  0123456789ABCDEF0123456789abcdefnanNANinfINF(null)bug in vfprintf: bad base HOSTALIASES/etc/hosts;#nameserverlookupypsearchinet4ndots:RES_OPTIONSoptions LOCALDOMAINsearch lookup bind filenameserver 127.0.0.1ASR_CONFIGlookup file %d.%d.%d.%d.in-addr.arpa.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.ip6.arpa.no spacebad domain namedomain name too longbad dlen@BKMGTPE0B%lld%c%lld.%1lld%cimsg_readmsgbuf_write/dev/diskmap%s%s%s%c%s%s%shmac_sha1pkcs5_pbkdf2logout/var/run/utmplogin_protect%s: %s: %m/etc/fbtab/*%s: chmod(%s): %m%s: chown(%s): %m%s: opendir(%s): %m%o%s: bad entry: %s\\#readlabelfs@@@@@@@L|@@@@@P@@%sr%s%s: not a device node%s: couldn't read disklabel%s: bad filesystem type in labellogwtmp/var/log/wtmp5MS7) OOPStgetentTERMCAP/usr/share/misc/termcapTERMPATH.termcap /usr/share/misc/termcapinet_net_ptoninet_net_pton_ipv401234567890123456789abcdef/usr/src/lib/libc/net/inet_net_pton.cn >= 0 && n <= 15n >= 0 && n <= 9assertion "%s" failed: file "%s", line %d, function "%s" assertion "%s" failed: file "%s", line %d inet_pton01234567890123456789ABCDEF0123456789abcdefinet_ntop4inet_ntop%u.%u.%u.%u0b0b1ncdtscsbpxbxfxoxtxdxgetentcgetnext%s.dbtc|:InfinityNaNlongjmp botch. gSHA256EndSHA256DataSHA256FileChunk0123456789abcdefPOSIX_V6_ILP32_OFFBIGPOSIX_V7_ILP32_OFFBIG-lpthreadasprintf^[Yy]^[Nn]yes646NONEUTF8 Xh̴ܴ8Xtȵ0LdRPC: (unknown error code)RPC: Port mapper failure%s: %s - %s RPC: Remote system error; errno = %s; low version = %u, high version = %u; why = (unknown authentication error - %d); s1 = %u, s2 = %uRPC: SuccessRPC: Can't encode argumentsRPC: Can't decode resultRPC: Unable to sendRPC: Unable to receiveRPC: Timed outRPC: Incompatible versions of RPCRPC: Authentication errorRPC: Program unavailableRPC: Program/version mismatchRPC: Procedure unavailableRPC: Server can't decode argumentsRPC: Unknown hostRPC: Program not registeredRPC: Failed (unspecified error)RPC: Unknown protocolAuthentication OKInvalid client credentialServer rejected credentialInvalid client verifierServer rejected verifierClient credential too weakInvalid server verifierFailed (unspecified error)[:<:]][:>:]]ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ !"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789ABCDEFabcdefNULSOHSTXETXEOTENQBELalertBSbackspaceHTtabLFVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBIS4IS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoponetwothreefourfivesixseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDELregerrorREG_0x%xREG_NOMATCHregexec() failed to matchREG_BADPATinvalid regular expressionREG_ECOLLATEinvalid collating elementREG_ECTYPEinvalid character classREG_EESCAPEREG_ESUBREGinvalid backreference numberREG_EBRACKbrackets ([ ]) not balancedREG_EPARENparentheses not balancedREG_EBRACEbraces not balancedREG_BADBRinvalid repetition count(s)REG_ERANGEinvalid character rangeREG_ESPACEREG_BADRPTrepetition-operator operand invalidREG_EMPTYempty (sub)expressionREG_ASSERT"can't happen" -- you found a bugREG_INVARGinvalid argument to regex routine*** unknown regexp error code ***SHA512EndSHA512DataSHA512FileChunk0123456789abcdefclnttcp_create: out of memory xdrrec_create: out of memory BLOCKSIZE%s: unknown blocksizemaximum blocksize is %dG%s: minimum blocksize is 512%ld%s-blocksttyname_r/var/run/dev.db/etc/ttyssecurertsctssoftcarwindow%h %e %T MD5PadؗҜ<3#I9=D2[%Cod(hinityan0123456789abcdefglob2ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/readpassphrase  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~tcsetattr|$4@LXp0H\p|$4@LXp0H\pSignal 0HangupInterruptQuitIllegal instructionTrace/BPT trapAbort trapEMT trapFloating point exceptionKilledBus errorSegmentation faultBad system callBroken pipeAlarm clockTerminatedUrgent I/O conditionSuspended (signal)SuspendedContinuedChild exitedStopped (tty input)Stopped (tty output)I/O possibleCputime limit exceededFilesize limit exceededVirtual timer expiredProfiling timer expiredWindow size changesInformation requestUser defined signal 1User defined signal 2Thread AST/etc/protocols|@DHLT\`dlpx|,PHUPINTILLTRAPABRTEMTFPEKILLBUSSEGVSYSPIPEALRMURGTSTPCONTCHLDTTINTTOUIOXCPUXFSZVTALRMPROFWINCHUSR1USR2THRexecvpeexeclpexecleexeclexecvp: : path too long unknown option -- %coption requires an argument -- %cambiguous option -- %.*soption doesn't take an argument -- %.*soption requires an argument -- %sunknown option -- %sfstabscanxxsw("h"too small  0<HP\lt ,nosappndnosappendnoarchnoarchivednoschgnoschangenosimmutablenouappndnouappendnouchgnouchangenouimmutablenodumpnoopaqueDHLPTX\`%m/%d/%y%Y-%m-%d%H:%M%I:%M:%S %p%H:%M:%SESTCSTMSTPSTEDTCDTMDTPDT $(,08@HT`htx|  8,SunMonTueWedThuFriSatSundayMondayTuesdayWednesdayThursdayFridaySaturdayJanFebMarAprMayJunJulAugSepOctNovDecJanuaryFebruaryMarchAprilJuneJulyAugustSeptemberOctoberNovemberDecemberAMPM%a %b %e %H:%M:%S %Y  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~authunix_createauthunix_create_defaultauth_none.c - Fatal marshalling problemauthunix_create: out of memory perrorxdr_array: out of memory argument buffer overflowunknown/invalid errorno errorinvalid value for ai_flagsname or service is not knowntemporary failure in name resolutionnon-recoverable failure in name resolutionno address associated with nameai_family not supportedai_socktype not supportedservice not supported for ai_socktypeaddress family for name not supportedmemory allocation failureinvalid value for hintsresolved protocol is unknownrealpath%u.%u.%u.%uinet6_rth_reverseSHA1TransformSHA1Pad/etc/services,/ ((((( AAAAAABBBBBB __stack_smash_handlerstack overflow in function %sconnectlog_r__vsyslog_r/dev/log_rsyslog%s: unknown facility/priority: %x<%d>[%ld]Error %dlibcUnknown signal: Unknown error: _catopenNLSPATH/usr/share/nls/%L/%N.cat:/usr/share/nls/%l.%c/%N.cat:/usr/share/nls/%l/%N.catLC_ALLLC_MESSAGESLANG,DXpd$0Dhx(8P4`8Ll 8Xh4X|(8Ld (Ldx$8TUndefined error: 0Operation not permittedNo such file or directoryNo such processInterrupted system callInput/output errorDevice not configuredArgument list too longExec format errorBad file descriptorNo child processesResource deadlock avoidedPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkOperation not supported by deviceNot a directoryIs a directoryInvalid argumentToo many open files in systemToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksNumerical argument out of domainResult too largeResource temporarily unavailableOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not availableProtocol not supportedSocket type not supportedOperation not supportedProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceOperation timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downNo route to hostDirectory not emptyToo many processesToo many usersDisk quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticatorIPsec processing failureAttribute not foundIllegal byte sequenceNo medium foundWrong medium typeValue too large to be stored in data typeOperation canceledIdentifier removedNo message of desired typeNot supported|$4@LXp0H\pvsnprintf<clntudp_callclntudp_create: out of memory bindresvport_saxdr_string: out of memory xdr_bytes: out of memory isatty !#&(*-/14@@@@@@@`@@ABCDEF7yACnF?O8M20HwZ> P30123456789.=:f/?/*?*n+n,N-N.&7m'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !+ Hh VqQ:q:QZZ    l h b  w  i x X      0  $  k  j  is not a regular file (use -f to see it) is a directoryyyay܊b@y $DBydcydAy (ey@\pfyFyČgy4`hyi|y ԍ j 4DJ!yTtKyLyԎmy ,n"y8PdpH P qxyr"y@s!yS!yȐu"yؐ V$ w"y8\x(lȑԑXAyyy(@zyd|"~!y̒?h#@ Ay y4Xy|... (interrupt to abort) (press RETURN)sh444 Ȏмظ11"t €u6Uu|agPtPS[X!Using drive X, partition YMBR on floppy or old BIOS Read error No O/S No active partition OxUT`$ ,T\p ĶX̶@L`@L@lX\ 0t8@(L.@X(A8B !CDHEXFhGxHU(YVabTcceTfhiLlnqqrsv w,x8u<8x|^( 4    `jTh `]kvdl(^ ! ^" #$% &R'L_($),*4+<,H-P.T/\0`1l2t384@56@$Px,\| priorityrttvarrttssthreshsendpiperecvpipeexpirehopcountmtuUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CLONING XRESOLVE LLINFO STATIC BLACKHOLEPROTO3PROTO2PROTO1CLONEDSOURCEMPATHMPLSUPBROADCASTDEBUGLOOPBACKPTPNOTRAILERSRUNNINGNOARP PPROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD SRC SRCMASK LABEL<NOOP d4D<DD+Ld@ ( 0(EHC P E(  0(EHDHCh/HL@T0 ... ...0D0D0D0ETn   ^(08X@@|@@@%s: can't read disk label; disk type must be specified......\c`cdclc ԭ pctcxccccccc{}abcdDgGhHilnNpPqrs tw xy !:#=Ġ PЏ܆؏Џȅ$/Џؐ8Џؐ^XhxȐܐ^ą $,4̆T~g8<DX:L:T:\:d:l ;t4;l\;|;\;;;D _ xx:xx:xx:xx:xx:xx0000000000000000  (08<@HP@XdpxHTP8HkhԲRuneCT10NONEBBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~\DLT\dltl| \@lm nn4o(ntpto4rosD@L @T@\X@d@l|@tܷ@l@|X@\|@@@@ĸȸ̸hиԸܸ          048<@DHLPTX\` dhlptx|\ !"#$%̹&ع'() *+$,,-4-D.L.//ܥ0X1\2`3h4p5x6|789:;<=>к?@[\\ ]8^D^X_d_p`{{|}}л~ػ(DTp|/̼ؼ ( <H dp  Ľн$@H@Xl X455DX:L:T:\:d:l ;t4;l\;|;\;;;df?@GMTdȬЫ\$II,I|I$II,I|I T$II,I|I!! '''''+*.0.-- -0--l,p,,-- -0-d-l,D|| WPTЃ.shstrtab.init.text.fini.rodata.openbsd.randomdata.data.eh_frame.jcr.gotpad0.got.ctors.dtors.gotpad1.bss.stack.arm.atpcs.note.openbsd.ident ppCЃJf%0k0k94k4khM?IN8W8$\8ȸc8иj8s`xTTB . ..chowndhclient disklabeldmesgfdiskfsck fsck_ext2fsfsck_ffsifconfiginitmknodmount mount_cd9660@ mount_ext2fs@ mount_ffs mount_msdos mount_nfsnewfs newfs_msdospingping6reboothaltroutertsolumountsysctlbioctlhid2 uhid3 urio0 usb0 R usb1 usb2 usb3 usb4 usb5 usb6 usb7 ;; ttyU[0-9a-zA-Z]) U=${i#ttyU*} o=$(alph2d $U) M ttyU$U c 68 $o 660 dialer uucp M cuaU$U c 68 $(($o+128)) 660 dialer uucp ;; wsmux|wsmouse|wskbd) M wsmouse c 63 0 600 M wskbd c 63 1 600 ;; wsmouse[0-9]*) M wsmouse$U c 62 $U 600 ;; wskbd[0-9]*) M wskbd$U c 61 $U 600 ;; wscons) R wsmouse0 wsmouse1 wsmouse2 wsmouse3 wskbd0 wskbd1 wskbd2 R wskbd3 wsmux ttyCcfg ttyC0 ttyC1 ttyC2 ttyC3 ttyC4 ttyC5 R ttyC6 ttyC7 ttyC8 ttyC9 ttyCa ttyCb ;; tty[C-J]*) U=${i##tty[C-J]} case $i in ttyC*) n=C m=0;; ttyD*) n=D m=256;; ttyE*) n=E m=512;; ttyF*) n=F m=768;; ttyG*) n=G m=1024;; ttyH*) n=H m=1280;; ttyI*) n=I m=1536;; ttyJ*) n=J m=1792;; esac case $U in [0-9a-f]) M tty$n$U c 60 $((16#$U+$m)) 600;; cfg) M tty${n}cfg c 60 $((255+$m)) 600;; *) echo bad unit $U for $i; exit 1;; esac ;; pty*) if [ $U -gt 15 ]; then echo bad unit for pty in: $i continue fi set -A letters p q r s t u v w x y z P Q R S T set -A suffixes 0 1 2 3 4 5 6 7 8 9 a b c d e f g h i j k l m n o p q \ r s t u v w x y z A B C D E F G H I J K L M N O P Q R S T U V W X \ Y Z name=${letters[$U]} n=0 while [ $n -lt 62 ] do nam=$name${suffixes[$n]} off=$(($U*62)) M tty$nam c 4 $(($off+$n)) M pty$nam c 5 $(($off+$n)) n=$(($n+1)) done ;; ptm) M ptm c 98 0 666 ;; tty[0-7][0-9a-f]) U=${i#tty*} o=$(h2d $U) M tty$U c 12 $o 660 dialer uucp M cua$U c 12 $(($o+128)) 660 dialer uucp ;; st*) n=$(($U*16)) for pre in " " n e en do M ${pre}st$U b 25 $n 660 operator M ${pre}rst$U c 25 $n 660 operator n=$(($n+1)) done ;; vnd*) dodisk vnd $U 19 19 $U 0 ;; rd*) dodisk2 rd $U 18 18 $U 0 ;; ch*) M ch$U c 27 $U 660 operator ;; cd*) dodisk2 cd $U 26 26 $U 0 ;; local) test -s $T.local && sh $T.local ;; all) R bthub0 bthub1 bthub2 vnd0 vnd1 vnd2 vnd3 sd0 sd1 sd2 sd3 R sd4 sd5 sd6 sd7 sd8 sd9 cd0 cd1 rd0 tun0 tun1 tun2 tun3 bio R bpf0 bpf1 bpf2 bpf3 bpf4 bpf5 bpf6 bpf7 bpf8 bpf9 pty0 R diskmap vscsi0 ch0 audio0 audio1 audio2 fuse pppx hotplug R ptm local wscons pci0 pci1 pci2 pci3 uall rmidi0 rmidi1 R rmidi2 rmidi3 rmidi4 rmidi5 rmidi6 rmidi7 tuner0 radio0 R video0 video1 uk0 random lkm tty00 tty01 tty02 tty03 tty04 R tty05 tty06 tty07 tty08 tty09 tty0a tty0b apm crypto pf R systrace wd0 wd1 wd2 wd3 std st0 st1 fd ;; wd*|sd*) case $i in wd*) dodisk wd $U 16 16 $U 0;; sd*) dodisk sd $U 24 24 $U 0;; esac ;; *) echo $i: unknown device ;; esac done } R "$@" { echo -n ${RMlist[*]} echo -n ${mklist[*]} echo -n ${MKlist[*]} echo -n ${whlist[*]} echo ${oplist[*]} } | if [ "$eo" = "echo" ]; then cat else sh fi #!/bin/sh - PATH=/sbin:/usr/sbin:/bin:/usr/bin T=$0 [ "$eo" ] || eo= hex() { case $1 in [0-9]) echo -n $1;; 10) echo -n a;; 11) echo -n b;; 12) echo -n c;; 13) echo -n d;; 14) echo -n e;; 15) echo -n f;; esac } alph2d() { local t="$1" local p="0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ" local sub=${p%${t}*} echo ${#sub} } h2d() { local s="$1" local f=${s%*[0-9a-f]} n=${s#[0-9a-f]*} echo $(($(_h2d $f)*16+ $(_h2d $n) )) } _h2d() { case $1 in [0-9]) echo -n $1;; a) echo -n 10;; b) echo -n 11;; c) echo -n 12;; d) echo -n 13;; e) echo -n 14;; f) echo -n 15;; esac } unt() { arg="$1" tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" while [ "$tmp" != "$arg" ] do arg=$tmp tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" done echo $arg } dodisk() { [ "$DEBUG" ] && set -x n=$(($((${5}*${7:-16}))+${6})) count=0 [ 0$7 -ne 8 ] && l="i j k l m n o p" for d in a b c d e f g h $l do M $1$2$d b $3 $(($n+$count)) 640 operator M r$1$2$d c $4 $(($n+$count)) 640 operator let count=count+1 done } dodisk2() { n=$(($(($5*${7:-16}))+$6)) M $1$2a b $3 $n 640 operator M r$1$2a c $4 $n 640 operator n=$(($n+2)) M $1$2c b $3 $n 640 operator M r$1$2c c $4 $n 640 operator } RMlist[0]="rm -f" mkl() { mklist[${#mklist[*]}]=";mknod -m $1 $2 $3 $4 $5" } M() { RMlist[${#RMlist[*]}]=$1 mkl ${5-666} $1 $2 $3 $4 G=${6:-wheel} [ "$7" ] && { MKlist[${#MKlist[*]}]="&& chown $7:$G $1" } || { case $G in wheel) [ ${#whlist[*]} = 0 ] && whlist[0]="&& chgrp wheel" whlist[${#whlist[*]}]="$1" ;; operator) [ ${#oplist[*]} = 0 ] && oplist[0]="&& chgrp operator" oplist[${#oplist[*]}]="$1" ;; *) MKlist[${#MKlist[*]}]="&& chgrp $G $1"; esac } return 0 } R() { [ "$DEBUG" ] && set -x for i in "$@" do U=`unt $i` [ "$U" ] || U=0 case $i in ramdisk) R std bpf0 wd0 wd1 sd0 tty00 rd0 wsmouse R st0 ttyC0 wskbd0 apm bio diskmap random ;; std) M console c 0 0 600 M tty c 1 0 M mem c 2 0 640 kmem M kmem c 2 1 640 kmem M null c 2 2 M zero c 2 12 M stdin c 7 0 M stdout c 7 1 M stderr c 7 2 M ksyms c 8 0 640 kmem M klog c 6 0 600 ;; vscsi*) M vscsi$U c 100 $U 600 ;; video*) M video$U c 38 $U MKlist[${#MKlist[*]}]=";[ -e video ] || ln -s video$U video" ;; tuner*) M tuner$U c 75 $(($(($U*2))+16)) 644 ;; systrace) M systrace c 50 0 644 ;; uk*) M uk$U c 28 $U 640 operator ;; tun*) M tun$U c 33 $U 600 ;; rmidi*) M rmidi$U c 57 $U 666 ;; *random) n=0 for pre in " " s u a do M ${pre}random c 40 $n 644 n=$(($n+1)) done ;; radio*) M radio$U c 97 $U MKlist[${#MKlist[*]}]=";[ -e radio ] || ln -s radio$U radio" ;; pppx*) M pppx$U c 103 $U 600 ;; pf*) M pf c 46 0 600 ;; pci*) M pci$U c 88 $U 600 MKlist[${#MKlist[*]}]=";[ -h pci ] || ln -sf pci0 pci" ;; lkm) M lkm c 35 0 640 _lkm ;; hotplug) M hotplug c 37 $U 400 ;; fuse) M fuse$U c 77 $U 600 ;; fd) RMlist[${#RMlist[*]}]=";mkdir -p fd;rm -f" n=0 while [ $n -lt 64 ];do M fd/$n c 7 $n;n=$(($n+1));done MKlist[${#MKlist[*]}]=";chmod 555 fd" ;; diskmap) M diskmap c 102 0 640 operator ;; crypto) M crypto c 47 0 ;; bthub*) M bthub$U c 101 $U ;; bpf*) M bpf$U c 22 $U 600 ;; bktr*) M bktr$U c 75 $U 644 ;; bio) M bio c 52 0 600 ;; audio*) M sound$U c 36 $U M mixer$U c 36 $(($U+16)) M audio$U c 36 $(($U+128)) M audioctl$U c 36 $(($U+192)) MKlist[${#MKlist[*]}]=";[ -e audio ] || ln -s audio$U audio" MKlist[${#MKlist[*]}]=";[ -e mixer ] || ln -s mixer$U mixer" MKlist[${#MKlist[*]}]=";[ -e sound ] || ln -s sound$U sound" MKlist[${#MKlist[*]}]=";[ -e audioctl ] || ln -s audioctl$U audioctl" ;; apm*) M apm c 34 0 644 M apmctl c 34 8 644 ;; usb*) [ "$i" = "usb" ] && u= || u=$U M usb$u c 64 $U 660 ;; urio*) M urio$U c 67 $U 660 ;; ulpt*) M ulpt$U c 66 $U 660 ;; uhid*) M uhid$U c 65 $U 660 ;; ugen*) n=$(($U*16)) for j in 0{0,1,2,3,4,5,6,7,8,9} 1{0,1,2,3,4,5} do M ugen$U.$j c 70 $(($n+10#$j)) 660 done ;; uall) R ttyU0 ttyU1 ttyU2 ttyU3 ugen0 ugen1 ugen2 ugen3 ugen4 ugen5 R ugen6 ugen7 ulpt0 ulpt1 uhid0 uhid1 u@ . ..GMAKEDEVHconsoleI ttyJ memKkmem6Lnull6Mzero6NstdinOstdoutPstderrQksymsRklog6Sbpf06Twd0a6Urwd0aVwd0b6Wrwd0bXwd0c6Yrwd0cZwd0d6[rwd0d\wd0e6]rwd0e^wd0f6_rwd0f`wd0g6arwd0gbwd0h6crwd0hdwd0i6erwd0ifwd0j6grwd0jhwd0k6irwd0kjwd0l6krwd0llwd0m6mrwd0mnwd0n6orwd0npwd0o6qrwd0orwd0p6srwd0ptwd1a6urwd1avwd1b6wrwd1bxwd1c6yrwd1czwd1d6{rwd1d|wd1e6}rwd1e~wd1f6rwd1fۀwd1g6ہrwd1gۂwd1h6ۃrwd1hۄwd1i6ۅrwd1iۆwd1j6ۇrwd1jۈwd1k6ۉrwd1kۊwd1l6ۋrwd1lیwd1m6ۍrwd1mێwd1n6ۏrwd1nېwd1o6ۑrwd1oےwd1p6ۓrwd1p۔sd0a6ەrsd0aۖsd0b6ۗrsd0bۘsd0c6ۙrsd0cۚsd0d6ۛrsd0dۜsd0e6۝rsd0e۞sd0f6۟rsd0f۠sd0g6ۡrsd0gۢsd0h6ۣrsd0hۤsd0i6ۥrsd0iۦsd0j6ۧrsd0jۨsd0k6۩rsd0k۪sd0l6۫rsd0l۬sd0m6ۭrsd0mۮsd0n6ۯrsd0n۰sd0o6۱rsd0o۲sd0p6۳rsd0p۴tty00۵cua00۶rd0a6۷rrd0a۸rd0c6۹rrd0cۺwsmousewskbdۼ st0rst06۾nst06ۿnrst0est06erst0enst0enrst0ttyC0wskbd0 apmapmctl biodiskmaprandomsrandomurandomarandomAfrica/ Africa/Abidjan Africa/Accra Africa/Addis_Ababa Africa/Algiers Africa/Asmara Africa/Asmera Africa/Bamako Africa/Bangui Africa/Banjul Africa/Bissau Africa/Blantyre Africa/Brazzaville Africa/Bujumbura Africa/Cairo Africa/Casablanca Africa/Ceuta Africa/Conakry Africa/Dakar Africa/Dar_es_Salaam Africa/Djibouti Africa/Douala Africa/El_Aaiun Africa/Freetown Africa/Gaborone Africa/Harare Africa/Johannesburg Africa/Juba Africa/Kampala Africa/Khartoum Africa/Kigali Africa/Kinshasa Africa/Lagos Africa/Libreville Africa/Lome Africa/Luanda Africa/Lubumbashi Africa/Lusaka Africa/Malabo Africa/Maputo Africa/Maseru Africa/Mbabane Africa/Mogadishu Africa/Monrovia Africa/Nairobi Africa/Ndjamena Africa/Niamey Africa/Nouakchott Africa/Ouagadougou Africa/Porto-Novo Africa/Sao_Tome Africa/Timbuktu Africa/Tripoli Africa/Tunis Africa/Windhoek America/ America/Adak America/Anchorage America/Anguilla America/Antigua America/Araguaina America/Argentina/ America/Argentina/Buenos_Aires America/Argentina/Catamarca America/Argentina/ComodRivadavia America/Argentina/Cordoba America/Argentina/Jujuy America/Argentina/La_Rioja America/Argentina/Mendoza America/Argentina/Rio_Gallegos America/Argentina/Salta America/Argentina/San_Juan America/Argentina/San_Luis America/Argentina/Tucuman America/Argentina/Ushuaia America/Aruba America/Asuncion America/Atikokan America/Atka America/Bahia America/Bahia_Banderas America/Barbados America/Belem America/Belize America/Blanc-Sablon America/Boa_Vista America/Bogota America/Boise America/Buenos_Aires America/Cambridge_Bay America/Campo_Grande America/Cancun America/Caracas America/Catamarca America/Cayenne America/Cayman America/Chicago America/Chihuahua America/Coral_Harbour America/Cordoba America/Costa_Rica America/Creston America/Cuiaba America/Curacao America/Danmarkshavn America/Dawson America/Dawson_Creek America/Denver America/Detroit America/Dominica America/Edmonton America/Eirunepe America/El_Salvador America/Ensenada America/Fort_Wayne America/Fortaleza America/Glace_Bay America/Godthab America/Goose_Bay America/Grand_Turk America/Grenada America/Guadeloupe America/Guatemala America/Guayaquil America/Guyana America/Halifax America/Havana America/Hermosillo America/Indiana/ America/Indiana/Indianapolis America/Indiana/Knox America/Indiana/Marengo America/Indiana/Petersburg America/Indiana/Tell_City America/Indiana/Vevay America/Indiana/Vincennes America/Indiana/Winamac America/Indianapolis America/Inuvik America/Iqaluit America/Jamaica America/Jujuy America/Juneau America/Kentucky/ America/Kentucky/Louisville America/Kentucky/Monticello America/Knox_IN America/Kralendijk America/La_Paz America/Lima America/Los_Angeles America/Louisville America/Lower_Princes America/Maceio America/Managua America/Manaus America/Marigot America/Martinique America/Matamoros America/Mazatlan America/Mendoza America/Menominee America/Merida America/Metlakatla America/Mexico_City America/Miquelon America/Moncton America/Monterrey America/Montevideo America/Montreal America/Montserrat America/Nassau America/New_York America/Nipigon America/Nome America/Noronha America/North_Dakota/ America/North_Dakota/Beulah America/North_Dakota/Center America/North_Dakota/New_Salem America/Ojinaga America/Panama America/Pangnirtung America/Paramaribo America/Phoenix America/Port-au-Prince America/Port_of_Spain America/Porto_Acre America/Porto_Velho America/Puerto_Rico America/Rainy_River America/Rankin_Inlet America/Recife America/Regina America/Resolute America/Rio_Branco America/Rosario America/Santa_Isabel America/Santarem America/Santiago America/Santo_Domingo America/Sao_Paulo America/Scoresbysund America/Shiprock America/Sitka America/St_Barthelemy America/St_Johns America/St_Kitts America/St_Lucia America/St_Thomas America/St_Vincent America/Swift_Current America/Tegucigalpa America/Thule America/Thunder_Bay America/Tijuana America/Toronto America/Tortola America/Vancouver America/Virgin America/Whitehorse America/Winnipeg America/Yakutat America/Yellowknife Antarctica/ Antarctica/Casey Antarctica/Davis Antarctica/DumontDUrville Antarctica/Macquarie Antarctica/Mawson Antarctica/McMurdo Antarctica/Palmer Antarctica/Rothera Antarctica/South_Pole Antarctica/Syowa Antarctica/Vostok Arctic/ Arctic/Longyearbyen Asia/ Asia/Aden Asia/Almaty Asia/Amman Asia/Anadyr Asia/Aqtau Asia/Aqtobe Asia/Ashgabat Asia/Ashkhabad Asia/Baghdad Asia/Bahrain Asia/Baku Asia/Bangkok Asia/Beirut Asia/Bishkek Asia/Brunei Asia/Calcutta Asia/Choibalsan Asia/Chongqing Asia/Chungking Asia/Colombo Asia/Dacca Asia/Damascus Asia/Dhaka Asia/Dili Asia/Dubai Asia/Dushanbe Asia/Gaza Asia/Harbin Asia/Hebron Asia/Ho_Chi_Minh Asia/Hong_Kong Asia/Hovd Asia/Irkutsk Asia/Istanbul Asia/Jakarta Asia/Jayapura Asia/Jerusalem Asia/Kabul Asia/Kamchatka Asia/Karachi Asia/Kashgar Asia/Kathmandu Asia/Katmandu Asia/Khandyga Asia/Kolkata Asia/Krasnoyarsk Asia/Kuala_Lumpur Asia/Kuching Asia/Kuwait Asia/Macao Asia/Macau Asia/Magadan Asia/Makassar Asia/Manila Asia/Muscat Asia/Nicosia Asia/Novokuznetsk Asia/Novosibirsk Asia/Omsk Asia/Oral Asia/Phnom_Penh Asia/Pontianak Asia/Pyongyang Asia/Qatar Asia/Qyzylorda Asia/Rangoon Asia/Riyadh Asia/Riyadh87 Asia/Riyadh88 Asia/Riyadh89 Asia/Saigon Asia/Sakhalin Asia/Samarkand Asia/Seoul Asia/Shanghai Asia/Singapore Asia/Taipei Asia/Tashkent Asia/Tbilisi Asia/Tehran Asia/Tel_Aviv Asia/Thimbu Asia/Thimphu Asia/Tokyo Asia/Ujung_Pandang Asia/Ulaanbaatar Asia/Ulan_Bator Asia/Urumqi Asia/Ust-Nera Asia/Vientiane Asia/Vladivostok Asia/Yakutsk Asia/Yekaterinburg Asia/Yerevan Atlantic/ Atlantic/Azores Atlantic/Bermuda Atlantic/Canary Atlantic/Cape_Verde Atlantic/Faeroe Atlantic/Faroe Atlantic/Jan_Mayen Atlantic/Madeira Atlantic/Reykjavik Atlantic/South_Georgia Atlantic/St_Helena Atlantic/Stanley Australia/ Australia/ACT Australia/Adelaide Australia/Brisbane Australia/Broken_Hill Australia/Canberra Australia/Currie Australia/Darwin Australia/Eucla Australia/Hobart Australia/LHI Australia/Lindeman Australia/Lord_Howe Australia/Melbourne Australia/NSW Australia/North Australia/Perth Australia/Queensland Australia/South Australia/Sydney Australia/Tasmania Australia/Victoria Australia/West Australia/Yancowinna Brazil/ Brazil/Acre Brazil/DeNoronha Brazil/East Brazil/West CET CST6CDT Canada/ Canada/Atlantic Canada/Central Canada/East-Saskatchewan Canada/Eastern Canada/Mountain Canada/Newfoundland Canada/Pacific Canada/Saskatchewan Canada/Yukon Chile/ Chile/Continental Chile/EasterIsland Cuba EET EST EST5EDT Egypt Eire Etc/ Etc/GMT Etc/GMT+0 Etc/GMT+1 Etc/GMT+10 Etc/GMT+11 Etc/GMT+12 Etc/GMT+2 Etc/GMT+3 Etc/GMT+4 Etc/GMT+5 Etc/GMT+6 Etc/GMT+7 Etc/GMT+8 Etc/GMT+9 Etc/GMT-0 Etc/GMT-1 Etc/GMT-10 Etc/GMT-11 Etc/GMT-12 Etc/GMT-13 Etc/GMT-14 Etc/GMT-2 Etc/GMT-3 Etc/GMT-4 Etc/GMT-5 Etc/GMT-6 Etc/GMT-7 Etc/GMT-8 Etc/GMT-9 Etc/GMT0 Etc/Greenwich Etc/UCT Etc/UTC Etc/Universal Etc/Zulu Europe/ Europe/Amsterdam Europe/Andorra Europe/Athens Europe/Belfast Europe/Belgrade Europe/Berlin Europe/Bratislava Europe/Brussels Europe/Bucharest Europe/Budapest Europe/Busingen Europe/Chisinau Europe/Copenhagen Europe/Dublin Europe/Gibraltar Europe/Guernsey Europe/Helsinki Europe/Isle_of_Man Europe/Istanbul Europe/Jersey Europe/Kaliningrad Europe/Kiev Europe/Lisbon Europe/Ljubljana Europe/London Europe/Luxembourg Europe/Madrid Europe/Malta Europe/Mariehamn Europe/Minsk Europe/Monaco Europe/Moscow Europe/Nicosia Europe/Oslo Europe/Paris Europe/Podgorica Europe/Prague Europe/Riga Europe/Rome Europe/Samara Europe/San_Marino Europe/Sarajevo Europe/Simferopol Europe/Skopje Europe/Sofia Europe/Stockholm Europe/Tallinn Europe/Tirane Europe/Tiraspol Europe/Uzhgorod Europe/Vaduz Europe/Vatican Europe/Vienna Europe/Vilnius Europe/Volgograd Europe/Warsaw Europe/Zagreb Europe/Zaporozhye Europe/Zurich Factory GB GB-Eire GMT GMT+0 GMT-0 GMT0 Greenwich HST Hongkong Iceland Indian/ Indian/Antananarivo Indian/Chagos Indian/Christmas Indian/Cocos Indian/Comoro Indian/Kerguelen Indian/Mahe Indian/Maldives Indian/Mauritius Indian/Mayotte Indian/Reunion Iran Israel Jamaica Japan Kwajalein Libya MET MST MST7MDT Mexico/ Mexico/BajaNorte Mexico/BajaSur Mexico/General Mideast/ Mideast/Riyadh87 Mideast/Riyadh88 Mideast/Riyadh89 NZ NZ-CHAT Navajo PRC PST8PDT Pacific/ Pacific/Apia Pacific/Auckland Pacific/Chatham Pacific/Chuuk Pacific/Easter Pacific/Efate Pacific/Enderbury Pacific/Fakaofo Pacific/Fiji Pacific/Funafuti Pacific/Galapagos Pacific/Gambier Pacific/Guadalcanal Pacific/Guam Pacific/Honolulu Pacific/Johnston Pacific/Kiritimati Pacific/Kosrae Pacific/Kwajalein Pacific/Majuro Pacific/Marquesas Pacific/Midway Pacific/Nauru Pacific/Niue Pacific/Norfolk Pacific/Noumea Pacific/Pago_Pago Pacific/Palau Pacific/Pitcairn Pacific/Pohnpei Pacific/Ponape Pacific/Port_Moresby Pacific/Rarotonga Pacific/Saipan Pacific/Samoa Pacific/Tahiti Pacific/Tarawa Pacific/Tongatapu Pacific/Truk Pacific/Wake Pacific/Wallis Pacific/Yap Poland Portugal ROC ROK Singapore Turkey UCT US/ US/Alaska US/Aleutian US/Arizona US/Central US/East-Indiana US/Eastern US/Hawaii US/Indiana-Starke US/Michigan US/Mountain US/Pacific US/Pacific-New US/Samoa UTC Universal W-SU WET Zulu posix/ posix/Africa/ posix/Africa/Abidjan posix/Africa/Accra posix/Africa/Addis_Ababa posix/Africa/Algiers posix/Africa/Asmara posix/Africa/Asmera posix/Africa/Bamako posix/Africa/Bangui posix/Africa/Banjul posix/Africa/Bissau posix/Africa/Blantyre posix/Africa/Brazzaville posix/Africa/Bujumbura posix/Africa/Cairo posix/Africa/Casablanca posix/Africa/Ceuta posix/Africa/Conakry posix/Africa/Dakar posix/Africa/Dar_es_Salaam posix/Africa/Djibouti posix/Africa/Douala posix/Africa/El_Aaiun posix/Africa/Freetown posix/Africa/Gaborone posix/Africa/Harare posix/Africa/Johannesburg posix/Africa/Juba posix/Africa/Kampala posix/Africa/Khartoum posix/Africa/Kigali posix/Africa/Kinshasa posix/Africa/Lagos posix/Africa/Libreville posix/Africa/Lome posix/Africa/Luanda posix/Africa/Lubumbashi posix/Africa/Lusaka posix/Africa/Malabo posix/Africa/Maputo posix/Africa/Maseru posix/Africa/Mbabane posix/Africa/Mogadishu posix/Africa/Monrovia posix/Africa/Nairobi posix/Africa/Ndjamena posix/Africa/Niamey posix/Africa/Nouakchott posix/Africa/Ouagadougou posix/Africa/Porto-Novo posix/Africa/Sao_Tome posix/Africa/Timbuktu posix/Africa/Tripoli posix/Africa/Tunis posix/Africa/Windhoek posix/America/ posix/America/Adak posix/America/Anchorage posix/America/Anguilla posix/America/Antigua posix/America/Araguaina posix/America/Argentina/ posix/America/Argentina/Buenos_Aires posix/America/Argentina/Catamarca posix/America/Argentina/ComodRivadavia posix/America/Argentina/Cordoba posix/America/Argentina/Jujuy posix/America/Argentina/La_Rioja posix/America/Argentina/Mendoza posix/America/Argentina/Rio_Gallegos posix/America/Argentina/Salta posix/America/Argentina/San_Juan posix/America/Argentina/San_Luis posix/America/Argentina/Tucuman posix/America/Argentina/Ushuaia posix/America/Aruba posix/America/Asuncion posix/America/Atikokan posix/America/Atka posix/America/Bahia posix/America/Bahia_Banderas posix/America/Barbados posix/America/Belem posix/America/Belize posix/America/Blanc-Sablon posix/America/Boa_Vista posix/America/Bogota posix/America/Boise posix/America/Buenos_Aires posix/America/Cambridge_Bay posix/America/Campo_Grande posix/America/Cancun posix/America/Caracas posix/America/Catamarca posix/America/Cayenne posix/America/Cayman posix/America/Chicago posix/America/Chihuahua posix/America/Coral_Harbour posix/America/Cordoba posix/America/Costa_Rica posix/America/Creston posix/America/Cuiaba posix/America/Curacao posix/America/Danmarkshavn posix/America/Dawson posix/America/Dawson_Creek posix/America/Denver posix/America/Detroit posix/America/Dominica posix/America/Edmonton posix/America/Eirunepe posix/America/El_Salvador posix/America/Ensenada posix/America/Fort_Wayne posix/America/Fortaleza posix/America/Glace_Bay posix/America/Godthab posix/America/Goose_Bay posix/America/Grand_Turk posix/America/Grenada posix/America/Guadeloupe posix/America/Guatemala posix/America/Guayaquil posix/America/Guyana posix/America/Halifax posix/America/Havana posix/America/Hermosillo posix/America/Indiana/ posix/America/Indiana/Indianapolis posix/America/Indiana/Knox posix/America/Indiana/Marengo posix/America/Indiana/Petersburg posix/America/Indiana/Tell_City posix/America/Indiana/Vevay posix/America/Indiana/Vincennes posix/America/Indiana/Winamac posix/America/Indianapolis posix/America/Inuvik posix/America/Iqaluit posix/America/Jamaica posix/America/Jujuy posix/America/Juneau posix/America/Kentucky/ posix/America/Kentucky/Louisville posix/America/Kentucky/Monticello posix/America/Knox_IN posix/America/Kralendijk posix/America/La_Paz posix/America/Lima posix/America/Los_Angeles posix/America/Louisville posix/America/Lower_Princes posix/America/Maceio posix/America/Managua posix/America/Manaus posix/America/Marigot posix/America/Martinique posix/America/Matamoros posix/America/Mazatlan posix/America/Mendoza posix/America/Menominee posix/America/Merida posix/America/Metlakatla posix/America/Mexico_City posix/America/Miquelon posix/America/Moncton posix/America/Monterrey posix/America/Montevideo posix/America/Montreal posix/America/Montserrat posix/America/Nassau posix/America/New_York posix/America/Nipigon posix/America/Nome posix/America/Noronha posix/America/North_Dakota/ posix/America/North_Dakota/Beulah posix/America/North_Dakota/Center posix/America/North_Dakota/New_Salem posix/America/Ojinaga posix/America/Panama posix/America/Pangnirtung posix/America/Paramaribo posix/America/Phoenix posix/America/Port-au-Prince posix/America/Port_of_Spain posix/America/Porto_Acre posix/America/Porto_Velho posix/America/Puerto_Rico posix/America/Rainy_River posix/America/Rankin_Inlet posix/America/Recife posix/America/Regina posix/America/Resolute posix/America/Rio_Branco posix/America/Rosario posix/America/Santa_Isabel posix/America/Santarem posix/America/Santiago posix/America/Santo_Domingo posix/America/Sao_Paulo posix/America/Scoresbysund posix/America/Shiprock posix/America/Sitka posix/America/St_Barthelemy posix/America/St_Johns posix/America/St_Kitts posix/America/St_Lucia posix/America/St_Thomas posix/America/St_Vincent posix/America/Swift_Current posix/America/Tegucigalpa posix/America/Thule posix/America/Thunder_Bay posix/America/Tijuana posix/America/Toronto posix/America/Tortola posix/America/Vancouver posix/America/Virgin posix/America/Whitehorse posix/America/Winnipeg posix/America/Yakutat posix/America/Yellowknife posix/Antarctica/ posix/Antarctica/Casey posix/Antarctica/Davis posix/Antarctica/DumontDUrville posix/Antarctica/Macquarie posix/Antarctica/Mawson posix/Antarctica/McMurdo posix/Antarctica/Palmer posix/Antarctica/Rothera posix/Antarctica/South_Pole posix/Antarctica/Syowa posix/Antarctica/Vostok posix/Arctic/ posix/Arctic/Longyearbyen posix/Asia/ posix/Asia/Aden posix/Asia/Almaty posix/Asia/Amman posix/Asia/Anadyr posix/Asia/Aqtau posix/Asia/Aqtobe posix/Asia/Ashgabat posix/Asia/Ashkhabad posix/Asia/Baghdad posix/Asia/Bahrain posix/Asia/Baku posix/Asia/Bangkok posix/Asia/Beirut posix/Asia/Bishkek posix/Asia/Brunei posix/Asia/Calcutta posix/Asia/Choibalsan posix/Asia/Chongqing posix/Asia/Chungking posix/Asia/Colombo posix/Asia/Dacca posix/Asia/Damascus posix/Asia/Dhaka posix/Asia/Dili posix/Asia/Dubai posix/Asia/Dushanbe posix/Asia/Gaza posix/Asia/Harbin posix/Asia/Hebron posix/Asia/Ho_Chi_Minh posix/Asia/Hong_Kong posix/Asia/Hovd posix/Asia/Irkutsk posix/Asia/Istanbul posix/Asia/Jakarta posix/Asia/Jayapura posix/Asia/Jerusalem posix/Asia/Kabul posix/Asia/Kamchatka posix/Asia/Karachi posix/Asia/Kashgar posix/Asia/Kathmandu posix/Asia/Katmandu posix/Asia/Khandyga posix/Asia/Kolkata posix/Asia/Krasnoyarsk posix/Asia/Kuala_Lumpur posix/Asia/Kuching posix/Asia/Kuwait posix/Asia/Macao posix/Asia/Macau posix/Asia/Magadan posix/Asia/Makassar posix/Asia/Manila posix/Asia/Muscat posix/Asia/Nicosia posix/Asia/Novokuznetsk posix/Asia/Novosibirsk posix/Asia/Omsk posix/Asia/Oral posix/Asia/Phnom_Penh posix/Asia/Pontianak posix/Asia/Pyongyang posix/Asia/Qatar posix/Asia/Qyzylorda posix/Asia/Rangoon posix/Asia/Riyadh posix/Asia/Riyadh87 posix/Asia/Riyadh88 posix/Asia/Riyadh89 posix/Asia/Saigon posix/Asia/Sakhalin posix/Asia/Samarkand posix/Asia/Seoul posix/Asia/Shanghai posix/Asia/Singapore posix/Asia/Taipei posix/Asia/Tashkent posix/Asia/Tbilisi posix/Asia/Tehran posix/Asia/Tel_Aviv posix/Asia/Thimbu posix/Asia/Thimphu posix/Asia/Tokyo posix/Asia/Ujung_Pandang posix/Asia/Ulaanbaatar posix/Asia/Ulan_Bator posix/Asia/Urumqi posix/Asia/Ust-Nera posix/Asia/Vientiane posix/Asia/Vladivostok posix/Asia/Yakutsk posix/Asia/Yekaterinburg posix/Asia/Yerevan posix/Atlantic/ posix/Atlantic/Azores posix/Atlantic/Bermuda posix/Atlantic/Canary posix/Atlantic/Cape_Verde posix/Atlantic/Faeroe posix/Atlantic/Faroe posix/Atlantic/Jan_Mayen posix/Atlantic/Madeira posix/Atlantic/Reykjavik posix/Atlantic/South_Georgia posix/Atlantic/St_Helena posix/Atlantic/Stanley posix/Australia/ posix/Australia/ACT posix/Australia/Adelaide posix/Australia/Brisbane posix/Australia/Broken_Hill posix/Australia/Canberra posix/Australia/Currie posix/Australia/Darwin posix/Australia/Eucla posix/Australia/Hobart posix/Australia/LHI posix/Australia/Lindeman posix/Australia/Lord_Howe posix/Australia/Melbourne posix/Australia/NSW posix/Australia/North posix/Australia/Perth posix/Australia/Queensland posix/Australia/South posix/Australia/Sydney posix/Australia/Tasmania posix/Australia/Victoria posix/Australia/West posix/Australia/Yancowinna posix/Brazil/ posix/Brazil/Acre posix/Brazil/DeNoronha posix/Brazil/East posix/Brazil/West posix/CET posix/CST6CDT posix/Canada/ posix/Canada/Atlantic posix/Canada/Central posix/Canada/East-Saskatchewan posix/Canada/Eastern posix/Canada/Mountain posix/Canada/Newfoundland posix/Canada/Pacific posix/Canada/Saskatchewan posix/Canada/Yukon posix/Chile/ posix/Chile/Continental posix/Chile/EasterIsland posix/Cuba posix/EET posix/EST posix/EST5EDT posix/Egypt posix/Eire posix/Etc/ posix/Etc/GMT posix/Etc/GMT+0 posix/Etc/GMT+1 posix/Etc/GMT+10 posix/Etc/GMT+11 posix/Etc/GMT+12 posix/Etc/GMT+2 posix/Etc/GMT+3 posix/Etc/GMT+4 posix/Etc/GMT+5 posix/Etc/GMT+6 posix/Etc/GMT+7 posix/Etc/GMT+8 posix/Etc/GMT+9 posix/Etc/GMT-0 posix/Etc/GMT-1 posix/Etc/GMT-10 posix/Etc/GMT-11 posix/Etc/GMT-12 posix/Etc/GMT-13 posix/Etc/GMT-14 posix/Etc/GMT-2 posix/Etc/GMT-3 posix/Etc/GMT-4 posix/Etc/GMT-5 posix/Etc/GMT-6 posix/Etc/GMT-7 posix/Etc/GMT-8 posix/Etc/GMT-9 posix/Etc/GMT0 posix/Etc/Greenwich posix/Etc/UCT posix/Etc/UTC posix/Etc/Universal posix/Etc/Zulu posix/Europe/ posix/Europe/Amsterdam posix/Europe/Andorra posix/Europe/Athens posix/Europe/Belfast posix/Europe/Belgrade posix/Europe/Berlin posix/Europe/Bratislava posix/Europe/Brussels posix/Europe/Bucharest posix/Europe/Budapest posix/Europe/Busingen posix/Europe/Chisinau posix/Europe/Copenhagen posix/Europe/Dublin posix/Europe/Gibraltar posix/Europe/Guernsey posix/Europe/Helsinki posix/Europe/Isle_of_Man posix/Europe/Istanbul posix/Europe/Jersey posix/Europe/Kaliningrad posix/Europe/Kiev posix/Europe/Lisbon posix/Europe/Ljubljana posix/Europe/London posix/Europe/Luxembourg posix/Europe/Madrid posix/Europe/Malta posix/Europe/Mariehamn posix/Europe/Minsk posix/Europe/Monaco posix/Europe/Moscow posix/Europe/Nicosia posix/Europe/Oslo posix/Europe/Paris posix/Europe/Podgorica posix/Europe/Prague posix/Europe/Riga posix/Europe/Rome posix/Europe/Samara posix/Europe/San_Marino posix/Europe/Sarajevo posix/Europe/Simferopol posix/Europe/Skopje posix/Europe/Sofia posix/Europe/Stockholm posix/Europe/Tallinn posix/Europe/Tirane posix/Europe/Tiraspol posix/Europe/Uzhgorod posix/Europe/Vaduz posix/Europe/Vatican posix/Europe/Vienna posix/Europe/Vilnius posix/Europe/Volgograd posix/Europe/Warsaw posix/Europe/Zagreb posix/Europe/Zaporozhye posix/Europe/Zurich posix/Factory posix/GB posix/GB-Eire posix/GMT posix/GMT+0 posix/GMT-0 posix/GMT0 posix/Greenwich posix/HST posix/Hongkong posix/Iceland posix/Indian/ posix/Indian/Antananarivo posix/Indian/Chagos posix/Indian/Christmas posix/Indian/Cocos posix/Indian/Comoro posix/Indian/Kerguelen posix/Indian/Mahe posix/Indian/Maldives posix/Indian/Mauritius posix/Indian/Mayotte posix/Indian/Reunion posix/Iran posix/Israel posix/Jamaica posix/Japan posix/Kwajalein posix/Libya posix/MET posix/MST posix/MST7MDT posix/Mexico/ posix/Mexico/BajaNorte posix/Mexico/BajaSur posix/Mexico/General posix/Mideast/ posix/Mideast/Riyadh87 posix/Mideast/Riyadh88 posix/Mideast/Riyadh89 posix/NZ posix/NZ-CHAT posix/Navajo posix/PRC posix/PST8PDT posix/Pacific/ posix/Pacific/Apia posix/Pacific/Auckland posix/Pacific/Chatham posix/Pacific/Chuuk posix/Pacific/Easter posix/Pacific/Efate posix/Pacific/Enderbury posix/Pacific/Fakaofo posix/Pacific/Fiji posix/Pacific/Funafuti posix/Pacific/Galapagos posix/Pacific/Gambier posix/Pacific/Guadalcanal posix/Pacific/Guam posix/Pacific/Honolulu posix/Pacific/Johnston posix/Pacific/Kiritimati posix/Pacific/Kosrae posix/Pacific/Kwajalein posix/Pacific/Majuro posix/Pacific/Marquesas posix/Pacific/Midway posix/Pacific/Nauru posix/Pacific/Niue posix/Pacific/Norfolk posix/Pacific/Noumea posix/Pacific/Pago_Pago posix/Pacific/Palau posix/Pacific/Pitcairn posix/Pacific/Pohnpei posix/Pacific/Ponape posix/Pacific/Port_Moresby posix/Pacific/Rarotonga posix/Pacific/Saipan posix/Pacific/Samoa posix/Pacific/Tahiti posix/Pacific/Tarawa posix/Pacific/Tongatapu posix/Pacific/Truk posix/Pacific/Wake posix/Pacific/Wallis posix/Pacific/Yap posix/Poland posix/Portugal posix/ROC posix/ROK posix/Singapore posix/Turkey posix/UCT posix/US/ posix/US/Alaska posix/US/Aleutian posix/US/Arizona posix/US/Central posix/US/East-Indiana posix/US/Eastern posix/US/Hawaii posix/US/Indiana-Starke posix/US/Michigan posix/US/Mountain posix/US/Pacific posix/US/Pacific-New posix/US/Samoa posix/UTC posix/Universal posix/W-SU posix/WET posix/Zulu posixrules right/ right/Africa/ right/Africa/Abidjan right/Africa/Accra right/Africa/Addis_Ababa right/Africa/Algiers right/Africa/Asmara right/Africa/Asmera right/Africa/Bamako right/Africa/Bangui right/Africa/Banjul right/Africa/Bissau right/Africa/Blantyre right/Africa/Brazzaville right/Africa/Bujumbura right/Africa/Cairo right/Africa/Casablanca right/Africa/Ceuta right/Africa/Conakry right/Africa/Dakar right/Africa/Dar_es_Salaam right/Africa/Djibouti right/Africa/Douala right/Africa/El_Aaiun right/Africa/Freetown right/Africa/Gaborone right/Africa/Harare right/Africa/Johannesburg right/Africa/Juba right/Africa/Kampala right/Africa/Khartoum right/Africa/Kigali right/Africa/Kinshasa right/Africa/Lagos right/Africa/Libreville right/Africa/Lome right/Africa/Luanda right/Africa/Lubumbashi right/Africa/Lusaka right/Africa/Malabo right/Africa/Maputo right/Africa/Maseru right/Africa/Mbabane right/Africa/Mogadishu right/Africa/Monrovia right/Africa/Nairobi right/Africa/Ndjamena right/Africa/Niamey right/Africa/Nouakchott right/Africa/Ouagadougou right/Africa/Porto-Novo right/Africa/Sao_Tome right/Africa/Timbuktu right/Africa/Tripoli right/Africa/Tunis right/Africa/Windhoek right/America/ right/America/Adak right/America/Anchorage right/America/Anguilla right/America/Antigua right/America/Araguaina right/America/Argentina/ right/America/Argentina/Buenos_Aires right/America/Argentina/Catamarca right/America/Argentina/ComodRivadavia right/America/Argentina/Cordoba right/America/Argentina/Jujuy right/America/Argentina/La_Rioja right/America/Argentina/Mendoza right/America/Argentina/Rio_Gallegos right/America/Argentina/Salta right/America/Argentina/San_Juan right/America/Argentina/San_Luis right/America/Argentina/Tucuman right/America/Argentina/Ushuaia right/America/Aruba right/America/Asuncion right/America/Atikokan right/America/Atka right/America/Bahia right/America/Bahia_Banderas right/America/Barbados right/America/Belem right/America/Belize right/America/Blanc-Sablon right/America/Boa_Vista right/America/Bogota right/America/Boise right/America/Buenos_Aires right/America/Cambridge_Bay right/America/Campo_Grande right/America/Cancun right/America/Caracas right/America/Catamarca right/America/Cayenne right/America/Cayman right/America/Chicago right/America/Chihuahua right/America/Coral_Harbour right/America/Cordoba right/America/Costa_Rica right/America/Creston right/America/Cuiaba right/America/Curacao right/America/Danmarkshavn right/America/Dawson right/America/Dawson_Creek right/America/Denver right/America/Detroit right/America/Dominica right/America/Edmonton right/America/Eirunepe right/America/El_Salvador right/America/Ensenada right/America/Fort_Wayne right/America/Fortaleza right/America/Glace_Bay right/America/Godthab right/America/Goose_Bay right/America/Grand_Turk right/America/Grenada right/America/Guadeloupe right/America/Guatemala right/America/Guayaquil right/America/Guyana right/America/Halifax right/America/Havana right/America/Hermosillo right/America/Indiana/ right/America/Indiana/Indianapolis right/America/Indiana/Knox right/America/Indiana/Marengo right/America/Indiana/Petersburg right/America/Indiana/Tell_City right/America/Indiana/Vevay right/America/Indiana/Vincennes right/America/Indiana/Winamac right/America/Indianapolis right/America/Inuvik right/America/Iqaluit right/America/Jamaica right/America/Jujuy right/America/Juneau right/America/Kentucky/ right/America/Kentucky/Louisville right/America/Kentucky/Monticello right/America/Knox_IN right/America/Kralendijk right/America/La_Paz right/America/Lima right/America/Los_Angeles right/America/Louisville right/America/Lower_Princes right/America/Maceio right/America/Managua right/America/Manaus right/America/Marigot right/America/Martinique right/America/Matamoros right/America/Mazatlan right/America/Mendoza right/America/Menominee right/America/Merida right/America/Metlakatla right/America/Mexico_City right/America/Miquelon right/America/Moncton right/America/Monterrey right/America/Montevideo right/America/Montreal right/America/Montserrat right/America/Nassau right/America/New_York right/America/Nipigon right/America/Nome right/America/Noronha right/America/North_Dakota/ right/America/North_Dakota/Beulah right/America/North_Dakota/Center right/America/North_Dakota/New_Salem right/America/Ojinaga right/America/Panama right/America/Pangnirtung right/America/Paramaribo right/America/Phoenix right/America/Port-au-Prince right/America/Port_of_Spain right/America/Porto_Acre right/America/Porto_Velho right/America/Puerto_Rico right/America/Rainy_River right/America/Rankin_Inlet right/America/Recife right/America/Regina right/America/Resolute right/America/Rio_Branco right/America/Rosario right/America/Santa_Isabel right/America/Santarem right/America/Santiago right/America/Santo_Domingo right/America/Sao_Paulo right/America/Scoresbysund right/America/Shiprock right/America/Sitka right/America/St_Barthelemy right/America/St_Johns right/America/St_Kitts right/America/St_Lucia right/America/St_Thomas right/America/St_Vincent right/America/Swift_Current right/America/Tegucigalpa right/America/Thule right/America/Thunder_Bay right/America/Tijuana right/America/Toronto right/America/Tortola right/America/Vancouver right/America/Virgin right/America/Whitehorse right/America/Winnipeg right/America/Yakutat right/America/Yellowknife right/Antarctica/ right/Antarctica/Casey right/Antarctica/Davis right/Antarctica/DumontDUrville right/Antarctica/Macquarie right/Antarctica/Mawson right/Antarctica/McMurdo right/Antarctica/Palmer right/Antarctica/Rothera right/Antarctica/South_Pole right/Antarctica/Syowa right/Antarctica/Vostok right/Arctic/ right/Arctic/Longyearbyen right/Asia/ right/Asia/Aden right/Asia/Almaty right/Asia/Amman right/Asia/Anadyr right/Asia/Aqtau right/Asia/Aqtobe right/Asia/Ashgabat right/Asia/Ashkhabad right/Asia/Baghdad right/Asia/Bahrain right/Asia/Baku right/Asia/Bangkok right/Asia/Beirut right/Asia/Bishkek right/Asia/Brunei right/Asia/Calcutta right/Asia/Choibalsan right/Asia/Chongqing right/Asia/Chungking right/Asia/Colombo right/Asia/Dacca right/Asia/Damascus right/Asia/Dhaka right/Asia/Dili right/Asia/Dubai right/Asia/Dushanbe right/Asia/Gaza right/Asia/Harbin right/Asia/Hebron right/Asia/Ho_Chi_Minh right/Asia/Hong_Kong right/Asia/Hovd right/Asia/Irkutsk right/Asia/Istanbul right/Asia/Jakarta right/Asia/Jayapura right/Asia/Jerusalem right/Asia/Kabul right/Asia/Kamchatka right/Asia/Karachi right/Asia/Kashgar right/Asia/Kathmandu right/Asia/Katmandu right/Asia/Khandyga right/Asia/Kolkata right/Asia/Krasnoyarsk right/Asia/Kuala_Lumpur right/Asia/Kuching right/Asia/Kuwait right/Asia/Macao right/Asia/Macau right/Asia/Magadan right/Asia/Makassar right/Asia/Manila right/Asia/Muscat right/Asia/Nicosia right/Asia/Novokuznetsk right/Asia/Novosibirsk right/Asia/Omsk right/Asia/Oral right/Asia/Phnom_Penh right/Asia/Pontianak right/Asia/Pyongyang right/Asia/Qatar right/Asia/Qyzylorda right/Asia/Rangoon right/Asia/Riyadh right/Asia/Riyadh87 right/Asia/Riyadh88 right/Asia/Riyadh89 right/Asia/Saigon right/Asia/Sakhalin right/Asia/Samarkand right/Asia/Seoul right/Asia/Shanghai right/Asia/Singapore right/Asia/Taipei right/Asia/Tashkent right/Asia/Tbilisi right/Asia/Tehran right/Asia/Tel_Aviv right/Asia/Thimbu right/Asia/Thimphu right/Asia/Tokyo right/Asia/Ujung_Pandang right/Asia/Ulaanbaatar right/Asia/Ulan_Bator right/Asia/Urumqi right/Asia/Ust-Nera right/Asia/Vientiane right/Asia/Vladivostok right/Asia/Yakutsk right/Asia/Yekaterinburg right/Asia/Yerevan right/Atlantic/ right/Atlantic/Azores right/Atlantic/Bermuda right/Atlantic/Canary right/Atlantic/Cape_Verde right/Atlantic/Faeroe right/Atlantic/Faroe right/Atlantic/Jan_Mayen right/Atlantic/Madeira right/Atlantic/Reykjavik right/Atlantic/South_Georgia right/Atlantic/St_Helena right/Atlantic/Stanley right/Australia/ right/Australia/ACT right/Australia/Adelaide right/Australia/Brisbane right/Australia/Broken_Hill right/Australia/Canberra right/Australia/Currie right/Australia/Darwin right/Australia/Eucla right/Australia/Hobart right/Australia/LHI right/Australia/Lindeman right/Australia/Lord_Howe right/Australia/Melbourne right/Australia/NSW right/Australia/North right/Australia/Perth right/Australia/Queensland right/Australia/South right/Australia/Sydney right/Australia/Tasmania right/Australia/Victoria right/Australia/West right/Australia/Yancowinna right/Brazil/ right/Brazil/Acre right/Brazil/DeNoronha right/Brazil/East right/Brazil/West right/CET right/CST6CDT right/Canada/ right/Canada/Atlantic right/Canada/Central right/Canada/East-Saskatchewan right/Canada/Eastern right/Canada/Mountain right/Canada/Newfoundland right/Canada/Pacific right/Canada/Saskatchewan right/Canada/Yukon right/Chile/ right/Chile/Continental right/Chile/EasterIsland right/Cuba right/EET right/EST right/EST5EDT right/Egypt right/Eire right/Etc/ right/Etc/GMT right/Etc/GMT+0 right/Etc/GMT+1 right/Etc/GMT+10 right/Etc/GMT+11 right/Etc/GMT+12 right/Etc/GMT+2 right/Etc/GMT+3 right/Etc/GMT+4 right/Etc/GMT+5 right/Etc/GMT+6 right/Etc/GMT+7 right/Etc/GMT+8 right/Etc/GMT+9 right/Etc/GMT-0 right/Etc/GMT-1 right/Etc/GMT-10 right/Etc/GMT-11 right/Etc/GMT-12 right/Etc/GMT-13 right/Etc/GMT-14 right/Etc/GMT-2 right/Etc/GMT-3 right/Etc/GMT-4 right/Etc/GMT-5 right/Etc/GMT-6 right/Etc/GMT-7 right/Etc/GMT-8 right/Etc/GMT-9 right/Etc/GMT0 right/Etc/Greenwich right/Etc/UCT right/Etc/UTC right/Etc/Universal right/Etc/Zulu right/Europe/ right/Europe/Amsterdam right/Europe/Andorra right/Europe/Athens right/Europe/Belfast right/Europe/Belgrade right/Europe/Berlin right/Europe/Bratislava right/Europe/Brussels right/Europe/Bucharest right/Europe/Budapest right/Europe/Busingen right/Europe/Chisinau right/Europe/Copenhagen right/Europe/Dublin right/Europe/Gibraltar right/Europe/Guernsey right/Europe/Helsinki right/Europe/Isle_of_Man right/Europe/Istanbul right/Europe/Jersey right/Europe/Kaliningrad right/Europe/Kiev right/Europe/Lisbon right/Europe/Ljubljana right/Europe/London right/Europe/Luxembourg right/Europe/Madrid right/Europe/Malta right/Europe/Mariehamn right/Europe/Minsk right/Europe/Monaco right/Europe/Moscow right/Europe/Nicosia right/Europe/Oslo right/Europe/Paris right/Europe/Podgorica right/Europe/Prague right/Europe/Riga right/Europe/Rome right/Europe/Samara right/Europe/San_Marino right/Europe/Sarajevo right/Europe/Simferopol right/Europe/Skopje right/Europe/Sofia right/Europe/Stockholm right/Europe/Tallinn right/Europe/Tirane right/Europe/Tiraspol right/Europe/Uzhgorod right/Europe/Vaduz right/Europe/Vatican right/Europe/Vienna right/Europe/Vilnius right/Europe/Volgograd right/Europe/Warsaw right/Europe/Zagreb right/Europe/Zaporozhye right/Europe/Zurich right/Factory right/GB right/GB-Eire right/GMT right/GMT+0 right/GMT-0 right/GMT0 right/Greenwich right/HST right/Hongkong right/Iceland right/Indian/ right/Indian/Antananarivo right/Indian/Chagos right/Indian/Christmas right/Indian/Cocos right/Indian/Comoro right/Indian/Kerguelen right/Indian/Mahe right/Indian/Maldives right/Indian/Mauritius right/Indian/Mayotte right/Indian/Reunion right/Iran right/Israel right/Jamaica right/Japan right/Kwajalein right/Libya right/MET right/MST right/MST7MDT right/Mexico/ right/Mexico/BajaNorte right/Mexico/BajaSur right/Mexico/General right/Mideast/ right/Mideast/Riyadh87 right/Mideast/Riyadh88 right/Mideast/Riyadh89 right/NZ right/NZ-CHAT right/Navajo right/PRC right/PST8PDT right/Pacific/ right/Pacific/Apia right/Pacific/Auckland right/Pacific/Chatham right/Pacific/Chuuk right/Pacific/Easter right/Pacific/Efate right/Pacific/Enderbury right/Pacific/Fakaofo right/Pacific/Fiji right/Pacific/Funafuti right/Pacific/Galapagos right/Pacific/Gambier right/Pacific/Guadalcanal right/Pacific/Guam right/Pacific/Honolulu right/Pacific/Johnston right/Pacific/Kiritimati right/Pacific/Kosrae right/Pacific/Kwajalein right/Pacific/Majuro right/Pacific/Marquesas right/Pacific/Midway right/Pacific/Nauru right/Pacific/Niue right/Pacific/Norfolk right/Pacific/Noumea right/Pacific/Pago_Pago right/Pacific/Palau right/Pacific/Pitcairn right/Pacific/Pohnpei right/Pacific/Ponape right/Pacific/Port_Moresby right/Pacific/Rarotonga right/Pacific/Saipan right/Pacific/Samoa right/Pacific/Tahiti right/Pacific/Tarawa right/Pacific/Tongatapu right/Pacific/Truk right/Pacific/Wake right/Pacific/Wallis right/Pacific/Yap right/Poland right/Portugal right/ROC right/ROK right/Singapore right/Turkey right/UCT right/US/ right/US/Alaska right/US/Aleutian right/US/Arizona right/US/Central right/US/East-Indiana right/US/Eastern right/US/Hawaii right/US/Indiana-Starke right/US/Michigan right/US/Mountain right/US/Pacific right/US/Pacific-New right/US/Samoa right/UTC right/Universal right/W-SU right/WET right/Zulu 08`3S<  3SpN`[~ [~3S`@@<@TU DSu  bDSuuA3S>I87S(7S(`IƟA3S>I83S>I83S8a4E:A3S87SZ 7SZ bJ~A3S93S93S9czhA3S93S93SNw:dgA3SNw:7S"*7S"*e]yA4S* 4S* 4S* f\5z7SL#7S$+T7S$+Thh7SZ 7SZ 7SZ g 7SBy7S47SspxPtA7S:7Ss7SsP(07Sg7Ss7Ssjzyb)7S!7Sg"7Sg"k17S1$7Sݬ$7Sݬ$lH7Ss%7Ss%7Ss%/tmp/fstab.shadow437S'7S'7S'/tmp/resolv.conf.shadow9I4 7S(7S(7S(/tmp/hostsX7]7S"*DS/=DS/=gFX5q9cY aw < . .. pppfirmwaresignifygroup protocols2dApasswdtmpspwd.db services2asswd.origpwd.db fstab resolv.conf hosts ... . ..openbsd-55-base.pub .C.. .C.. .E ..termcap ...untrusted comment: openbsd 5.5 base public key RWRGy8gxk9N9314J0gh9U02lA7s8i6ITajJiNgxQOndvXvM5ZPX+nQ9h wheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root bin:*:7: news:*:8: wsrc:*:9: users:*:10: auth:*:11: games:*:13: staff:*:20:root smmsp:*:25: sshd:*:27: _portmap:*:28: _identd:*:29: _rstatd:*:30: guest:*:31:root _rusersd:*:32: _fingerd:*:33: _sshagnt:*:34: _x11:*:35: utmp:*:45: _lkm:*:61: _spamd:*:62: _radius:*:63: _token:*:64: _shadow:*:65: crontab:*:66: www:*:67: _isakmpd:*:68: network:*:69: named:*:70: proxy:*:71: authpf:*:72: _syslogd:*:73: _pflogd:*:74: _bgpd:*:75: _tcpdump:*:76: _dhcp:*:77: _mopd:*:78: _tftpd:*:79: _rbootd:*:80: _ppp:*:82: _ntp:*:83: _ftp:*:84: _ospfd:*:85: _hostapd:*:86: _dvmrpd:*:87: _ripd:*:88: _relayd:*:89: _ospf6d:*:90: _snmpd:*:91: _rtadvd:*:92: _ypldap:*:93: _smtpd:*:95: _rwalld:*:96: _nsd:*:97: _ldpd:*:98: _sndio:*:99: _ldapd:*:100: _iked:*:101: _iscsid:*:102: dialer:*:117: nogroup:*:32766: nobody:*:32767: root:*:0:0:Charlie &:/root:/bin/ksh daemon:*:1:1:The devil himself:/root:/sbin/nologin operator:*:2:5:System &:/operator:/sbin/nologin bin:*:3:7:Binaries Commands and Source:/:/sbin/nologin uucp:*:66:1:UNIX-to-UNIX Copy:/var/spool/uucppublic:/usr/libexec/uucp/uucico _dhcp:*:77:77:DHCP programs:/var/empty:/sbin/nologin nobody:*:32767:32767:Unprivileged user for NFS:/nonexistent:/sbin/nologin ip 0 IP icmp 1 ICMP tcp 6 TCP udp 17 UDP ftp-data 20/tcp ftp 21/tcp domain 53/tcp nameserver domain 53/udp nameserver www 80/tcp http nfsd 2049/udp nfs nfsd 2049/tcp nfs ed_keys fi if [[ -n "$_rootpass" ]]; then _encr=$(encr_pwd "$_rootpass") echo "1,s@^root::@root:${_encr}:@ w q" | ed /mnt/etc/master.passwd 2>/dev/null fi /mnt/usr/sbin/pwd_mkdb -p -d /mnt/etc /etc/master.passwd [[ -n "$rootkey" ]] && ( umask 077 mkdir /mnt/root/.ssh print -r -- "$rootkey" >> /mnt/root/.ssh/authorized_keys ) if grep -qs '^rtsol' /mnt/etc/hostname.*; then sed -e "/^#\(net\.inet6\.ip6\.accept_rtadv\)/s//\1/" \ -e "/^#\(net\.inet6\.icmp6\.rediraccept\)/s//\1/" \ /mnt/etc/sysctl.conf >/tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf fi finish_up bin*Binaries Commands and Source//sbin/nologin1binrdrrootdaemonCharlie &/root/bin/ksh2rootdaemonCharlie &/root/bin/ksh3MHdaemon*The devil himself/root/sbin/nologin2daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user for NFS/nonexistent/sbin/nologin1nobody f]\W operator*System &/operator/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Boperator*System &/operator/sbin/nologin3operator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/ksh1rootA<bin*Binaries Commands and Source//sbin/nologin2bin*Binaries Commands and Source//sbin/nologin3uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucpD6Duucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2_dhcp*MMDHCP programs/var/empty/sbin/nologin1_dhcp^P^_dhcp*MMDHCP programs/var/empty/sbin/nologin2_dhcp*MMDHCP programs/var/empty/sbin/nologin3M@2@nobody*Unprivileged user for NFS/nonexistent/sbin/nologin2nobody*Unprivileged user for NFS/nonexistent/sbin/nologin3a  n}bin*Binaries Commands and Source//sbin/nologin1binpbprootdaemonCharlie &/root/bin/kshs2rootdaemonCharlie &/root/bin/kshs3MHdaemon*The devil himself/root/sbin/nologin2daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user for NFS/nonexistent/sbin/nologin1nobody e\[V  operator*System &/operator/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Boperator*System &/operator/sbin/nologin3operator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/ksh1rootA<bin*Binaries Commands and Source//sbin/nologin2bin*Binaries Commands and Source//sbin/nologin3uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucpD6Duucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2_dhcp*MMDHCP programs/var/empty/sbin/nologin1_dhcp^P^_dhcp*MMDHCP programs/var/empty/sbin/nologin2_dhcp*MMDHCP programs/var/empty/sbin/nologin3M@2@nobody*Unprivileged user for NFS/nonexistent/sbin/nologin2nobody*Unprivileged user for NFS/nonexistent/sbin/nologin3a  n} dumb|80-column dumb tty:\ :am:\ :co#80:\ :bl=^G:cr=^M:do=^J:sf=^J: vt100|vt100-am|dec vt100 (w/advanced video):\ :5i:am:bs:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :@8=\EOM:DO=\E[%dB:K1=\EOq:K2=\EOr:K3=\EOs:K4=\EOp:K5=\EOn:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:as=^N:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:do=^J:\ :eA=\E(B\E)0:ho=\E[H:k0=\EOy:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\EOt:k6=\EOu:k7=\EOv:k8=\EOl:k9=\EOw:k;=\EOx:\ :kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:l1=pf1:l2=pf2:l3=pf3:l4=pf4:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[0m:mr=\E[7m:nd=\E[C:pf=\E[4i:po=\E[5i:\ :ps=\E[0i:rc=\E8:rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :..sa=\E[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t\016%e\017%;$<2>:\ :sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: vt220|vt200|dec vt220:\ :5i:am:bs:mi:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :%0=\E[29~:%1=\E[28~:*6=\E[4~:@0=\E[1~:AL=\E[%dL:\ :DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:F1=\E[23~:F2=\E[24~:\ :F3=\E[25~:F4=\E[26~:F7=\E[31~:F8=\E[32~:F9=\E[33~:\ :FA=\E[34~:IC=\E[%d@:LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:\ :SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:eA=\E)0:ec=\E[%dX:ei=\E[4l:\ :ho=\E[H:if=/usr/share/tabset/vt100:im=\E[4h:\ :is=\E[?7h\E[>\E[?1h\E F\E[?4l:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k6=\E[17~:k7=\E[18~:k8=\E[19~:k9=\E[20~:\ :k;=\E[21~:kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=^H:kd=\E[B:\ :kl=\E[D:kr=\E[C:ku=\E[A:l1=pf1:l2=pf2:l3=pf3:l4=pf4:le=^H:\ :mb=\E[5m:md=\E[1m:me=\E[0m:mr=\E[7m:nd=\E[C:nw=\EE:\ :pf=\E[4i:po=\E[5i:ps=\E[i:r1=\E[?3l:rc=\E8:sc=\E7:\ :se=\E[27m:sf=\ED:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[24m:\ :up=\E[A:us=\E[4m:vb=\E[?5h\E[?5l: #!/bin/ksh MODE=install . install.sub DISK= DISKS_DONE= _DKDEVS=$(get_dkdevs) _fsent= rm -f /tmp/fstab* ask_yn "Use DUIDs rather than device names in fstab?" yes [[ $resp == y ]] && FSTABFLAG=-F while :; do DISKS_DONE=$(addel "$DISK" $DISKS_DONE) _DKDEVS=$(rmel "$DISK" $_DKDEVS) if isin $ROOTDISK $_DKDEVS; then resp=$ROOTDISK rm -f /tmp/fstab else ask_which "disk" "do you wish to initialize" \ '$(l=$(get_dkdevs); for a in $DISKS_DONE; do l=$(rmel $a $l); done; bsort $l)' \ done [[ $resp == done ]] && break fi DISK=$resp makedev $DISK || continue rm -f /tmp/*.$DISK md_prep_disklabel $DISK || { DISK= ; continue ; } grep -qs " / ffs " /tmp/fstab.$ROOTDISK || { DISK= ; echo "'/' must be configured!" ; continue ; } if [[ -f /tmp/fstab.$DISK ]]; then while read _pp _mp _rest; do if [[ $_mp == none ]]; then echo "$_pp $_mp $_rest" >>/tmp/fstab continue fi [[ /tmp/fstab.$DISK == $(grep -l " $_mp " /tmp/fstab.*) ]] || { _rest=$DISK ; DISK= ; break ; } done /etc/fstab rm /tmp/fstab.$_rest set -- $(grep -h " $_mp " /tmp/fstab.*[0-9]) echo "$_pp and $1 can't both be mounted at $_mp." continue fi while read _pp _mp _fstype _rest; do [[ $_fstype == ffs ]] || continue _OPT= [[ $_mp == / ]] && _OPT=$MDROOTFSOPT newfs -q $_OPT ${_pp##/dev/} _fsent="$_fsent $_mp!$_pp" done >/tmp/fstab munge_fstab mount_fs "-o async" feed_random install_sets if [[ -z $TZ ]]; then (cd /mnt/usr/share/zoneinfo ls -1dF $(tar cvf /dev/null [A-Za-y]*) >/mnt/tmp/tzlist ) echo set_timezone /mnt/tmp/tzlist rm -f /mnt/tmp/tzlist fi if _time=$(ftp_time) && _now=$(date +%s) && (( _now - _time > 120 || _time - _now > 120 )); then _tz=/mnt/usr/share/zoneinfo/$TZ ask_yn "Time appears wrong. Set to '$(TZ=$_tz date -r "$(ftp_time)")'?" yes if [[ $resp == y ]]; then date $(date -r "$(ftp_time)" "+%Y%m%d%H%M.%S") >/dev/null fi fi if [[ -s $SERVERLISTALL ]]; then _i= [[ -n $installedfrom ]] && _i="install=$installedfrom" [[ -n $TZ ]] && _i="$_i&TZ=$TZ" [[ -n $method ]] && _i="$_i&method=$method" [[ -n $_i ]] && ftp -Vao - \ "http://129.128.5.191/cgi-bin/ftpinstall.cgi?$_i" >/dev/null 2>&1 & fi sed "/^console.*on.*secure.*$/s/std\.[0-9]*/std.$(stty speed /tmp/ttys mv /tmp/ttys /mnt/etc/ttys echo -n "Saving configuration files..." (cd /var/db; [[ -f dhclient.leases ]] && mv dhclient.leases /mnt/var/db/. ) hostname >/tmp/myname if [[ -f /tmp/hosts ]]; then _dn=$(get_fqdn) while read _addr _hn _aliases; do if [[ -n $_aliases || $_hn != ${_hn%%.*} || -z $_dn ]]; then echo "$_addr\t$_hn $_aliases" else echo "$_addr\t$_hn.$_dn $_hn" fi done >/mnt/etc/hosts rm /tmp/hosts fi _f=dhclient.conf [[ -f /tmp/$_f ]] && { cat /tmp/$_f >>/mnt/etc/$_f ; rm /tmp/$_f ; } (cd /tmp; for _f in fstab hostname* kbdtype my* ttys *.conf *.tail; do [[ -f $_f && -s $_f ]] && mv $_f /mnt/etc/. done) apply if [[ -n $user ]]; then _encr=$(encr_pwd "$userpass") _home=/home/$user uline="${user}:${_encr}:1000:1000:staff:0:0:${username}:$_home:/bin/ksh" echo "$uline" >> /mnt/etc/master.passwd echo "${user}:*:1000:" >> /mnt/etc/group echo ${user} > /mnt/root/.forward _home=/mnt$_home mkdir -p $_home (cd /mnt/etc/skel; cp -pR . $_home) (umask 077 && sed "s,^To: root\$,To: ${username} <${user}>," \ /mnt/var/mail/root > /mnt/var/mail/$user ) chown -R 1000:1000 $_home /mnt/var/mail/$user echo "1,s@wheel:.:0:root\$@wheel:\*:0:root,${user}@ w q" | ed /mnt/etc/group 2>/dev/null [[ -n "$userkey" ]] && print -r -- "$userkey" >> $_home/.ssh/authoriz usage() { echo "usage: ${0##*/} [-a] [-f filename]" >&2 exit 1 } auto=false respfile= while getopts "af:" opt; do case $opt in a) auto=true;; f) respfile=$OPTARG;; *) usage;; esac done shift $((OPTIND-1)) [ $# = 0 ] || usage . install.md set_term() { local _layouts export TERM=${TERM:-${MDTERM:-vt220}} if [[ -n $CONSOLE ]]; then ask "Terminal type?" $TERM export TERM=$resp else [[ -x /sbin/kbd ]] || return _layouts=$(bsort $(kbd -l | egrep -v "^(user|tables|encoding)")) while :; do ask "Choose your keyboard layout ('?' or 'L' for list)" "default" case $resp in "?"|L|l) echo "Available layouts: $_layouts";; default) return;; *) kbd $resp && { echo $resp >/tmp/kbdtype; return; };; esac done fi } stripcom () { local _l [[ -f $1 ]] || return set -o noglob while read _l; do [[ -n ${_l%%#*} ]] && echo $_l done <$1 set +o noglob } quote() ( for a; do alias Q=$a; a=$(alias Q); print -rn -- " ${a#Q=}" done | sed '1s/ //' echo ) tmpdir() { local _i=1 _dir until _dir="${1?}.$_i.$RANDOM" && mkdir -- "$_dir" 2>/dev/null; do ((++_i < 10000)) || return 1 done echo "$_dir" } scan_dmesg() { bsort $(sed -n "$1" /var/run/dmesg.boot) } scan_disknames() { local IFS=, bsort $(for _n in $(sysctl -n hw.disknames); do echo "${_n%%:*} "; done | sed -n "$1") } get_dkdevs () { echo $(scan_disknames "${MDDKDEVS:-/^[sw]d[0-9][0-9]* /s/ .*//p}") } get_cddevs () { echo $(scan_disknames "${MDCDDEVS:-/^cd[0-9][0-9]* /s/ .*//p}") } get_ifdevs() { ifconfig "$@" 2>/dev/null | egrep -v '^[[:space:]]|(bridge|enc|gif|gre|lo|pflog|pfsync|ppp|sl|tun)[[:digit:]]+:' | sed -n 's/^\(.*\):.*/\1/p' } get_drive() { ask_which "$1" "contains the $MODE media" "$2" "$3" [[ $resp == done ]] && return 1 makedev $resp || return 1 return 0 } mount_mnt2() { local _dev=$1 _opts _file=/tmp/parts.$1 _parts disklabel $_dev 2>/dev/null | sed -En '/swap|unused/d;/^ [a-p]: /p' >$_file _parts=$(sed 's/^ \(.\): .*/\1/' $_file) set -- $_parts (($# == 0)) && { echo "No filesystems found on $_dev."; return 1; } if isin "c" $_parts; then resp=c elif (($# == 1)); then resp=$1 else cat $_file ask_which "$_dev partition" "has the $MODE sets" \ '$(disklabel '$_dev' 2>/dev/null | sed -En '\''/swap|unused/d;/^ ([a-p]): .*/s//\1/p'\'')' [[ $resp == done ]] && return 1 fi grep -q "^ $resp: .*MSDOS" $_file && _opts="-s" mount -o ro,$_opts /dev/$_dev$resp /mnt2 } askpass() { stty -echo IFS= read -r resp?"$1 " stty echo echo } rm -df /tmp/lock lock() { while ! mkdir /tmp/lock 2>/dev/null && sleep .1; do done } unlock() { rm -d /tmp/lock 2>/dev/null } retrap() { trap 'kill -KILL $cppid 2>/dev/null; echo; stty echo; exit 0' \ INT EXIT TERM } rm -f /tmp/update if ! $auto; then ( while :; do lock if test -e /tmp/update && [[ "`dmesg`" != "`cat /tmp/update`" ]]; then dmesg >/tmp/update kill -TERM 2>/dev/null $$ || exit 1 fi unlock sleep .5 done ) |& cppid=$! retrap fi _ask() { local _q=$1 _def=$2 _int _redo=0 _pid lock; dmesg >/tmp/update; unlock echo -n "${_q:+$_q }${_def:+[$_def] }" _autorespond "$_q" "$_def" && echo "$resp" && return trap "_int=1" INT trap "_redo=1" TERM read resp lock; rm /tmp/update; unlock if ((_redo)); then stty raw stty -raw else case $resp in !) echo "Type 'exit' to return to install." sh _redo=1 ;; !*) eval "${resp#?}" _redo=1 ;; esac fi retrap ((_int)) && kill -INT $$ : ${resp:=$_def} return $_redo } _autorespond() { typeset -l _q=$1 _key local _def=$2 _l _val [[ -f $respfile ]] || return mv /ai.conf /ai.conf.tmp while IFS=' ' read -r _l; do [[ $_l == [!#=]*=?* ]] || continue _key=${_l%%*([[:blank:]])=*} _val=${_l##*([!=])=*([[:blank:]])} [[ $_q == @(|*[[:blank:]])"$_key"@([[:blank:]?]*|) ]] && resp=$_val && cat && return print -r " $_l" done /ai.conf [[ -n $_def ]] && resp=$_def && return echo "\nQuestion has no answer in response file." exit 1 } ask() { while ! _ask "$1" "$2"; do done } askpassword() { local _q=$1 if $auto; then echo -n "$_q " _autorespond "$_q" echo '' _password=$resp return fi while :; do askpass "$_q (will not echo)" _password=$resp askpass "$_q (again)" [[ $resp == "$_password" ]] && break echo "Passwords do not match, try again." done } encr_pwd() { local _p=$1 if [[ -z $_p ]]; then echo '*' elif [[ $_p == \$2?\$[0-9][0-9]\$* && ${#_p} > 40 || $_p == '*************' ]]; then echo "$_p" else /mnt/usr/bin/encrypt -b 8 -- "$_p" fi } user_setup() { local _q="Setup a user? (enter a lower-case loginname, or 'no')" while :; do ask "$_q" no case $resp in n|no) return;; y|yes) _q="No really, what is the lower-case loginname, or 'no'?" continue;; root|daemon|operator|bin|smmsp|popa3d) ;; sshd|uucp|www|named|proxy|nobody|ftp) ;; [a-z]*([a-z0-9_])) ((${#resp} <= 31)) && break;; esac echo "$resp is not a useable loginname." done user=$resp while :; do ask "Full name for user $user?" $user case $resp in *[:\&,]*) echo "':', '&' or ',' are not allowed.";; *) ((${#resp} <= 100)) && break echo "Too long.";; esac done username=$resp askpassword "Password for user $user?" userpass=$_password userkey= $auto && ask "Public ssh key for user $user" none && [[ $resp != none ]] && userkey=$resp if [[ $sshd == y ]]; then ask_yn "Since you set up a user, disable sshd(8) logins to root?" yes sshd_disableroot=$resp fi } function ask_until { resp= while true; do ask "$1" "$2" [[ -n $resp ]] && break echo "A response is required." $auto && exit 1 done } ask_yn() { local _q=$1 _a=${2:-no} typeset -l _resp while :; do ask "$_q" "$_a" _resp=$resp case $_resp in y|yes) resp=y; return 0;; n|no) resp=n; return 1;; esac echo "'$resp' is not a valid choice." $auto && exit 1 done } ask_which() { local _name=$1 _query=$2 _list=$3 _def=$4 _dynlist _dyndef _key _q _key=$(echo "$_name" | sed 's/[^[:alnum:]]/_/g') while :; do eval "_dynlist=\"$_list\"" eval "_dyndef=\"$_def\"" set -o noglob set -- $_dyndef; _dyndef="$1" set -- $_dynlist; _dynlist="$*" set +o noglob (($# < 1)) && resp=done && return : ${_dyndef:=$1} echo "Available ${_name}s are: $_dynlist." _q="Which $_name $_query?" echo -n "$_q (or 'done') ${_dyndef:+[$_dyndef] }" _autorespond "$_q" "${_dyndef-done}" && echo "$resp" \ || _ask || continue [[ -z $resp ]] && resp="$_dyndef" isin "$resp" $_dynlist done && break echo "'$resp' is not a valid choice." $auto && [[ -n $respfile ]] && exit 1 done } isin() { local _a=$1 _b shift for _b; do [[ $_a == $_b ]] && return 0 done return 1 } addel() { local _a=$1 shift echo -n "$*" isin "$_a" $* || echo -n " $_a" } rmel() { local _a=$1 _b shift for _b; do [[ $_a != $_b ]] && echo -n "$_b " done } bsort() { local _l _a=$1 _b (($# > 0)) || return shift for _b; do if [[ $_a != $_b ]]; then if [[ $_a > $_b ]]; then _l="$_a $_l"; _a=$_b else _l="$_b $_l" fi fi done echo -n "$_a " bsort $_l } showcols() { local _l _cdir=/tmp/cdir set -A _clist mkdir -p $_cdir rm -rf -- $_cdir/* while read _l; do [ "$_l" ] || continue mkdir -p /tmp/cdir/"$_l" _clist[${#_clist[*]}]="$_l" done (cd $_cdir; ls -Cdf "${_clist[@]}") rm -rf -- $_cdir } makedev() { [[ -z $(cd /dev && sh MAKEDEV "$@" 2>&1) ]] } addhostent() { local _addr=$1 _name=$2 _delim="." [[ -z $_addr || -z $_name ]] && return [[ $_addr == *:* ]] && _delim=":" sed "/^[0-9a-fA-F]*[$_delim].*[ ]$_name\$/d" /tmp/hosts \ >/tmp/hosts.new 2>/dev/null mv /tmp/hosts.new /tmp/hosts echo "$_addr $_name" >>/tmp/hosts } select_sets() { local _avail=$1 _selected=$2 _f _action _col=$COLUMNS local _comp=comp${VERSION}.tgz _xbase=xbase${VERSION}.tgz let COLUMNS=_col-8 cat <<__EOT Select sets by entering a set name, a file name pattern or 'all'. De-select sets by prepending a '-' to the set name, file name pattern or 'all'. Selected sets are labelled '[X]'. __EOT while :; do for _f in $_avail; do isin $_f $_selected && echo "[X] $_f" || echo "[ ] $_f" done | showcols | sed 's/^/ /' ask "Set name(s)? (or 'abort' or 'done')" done set -o noglob for resp in $resp; do case $resp in abort) _selected=; break 2;; done) break 2;; -*) _action=rmel;; *) _action=addel;; esac resp=${resp#[+-]} [[ $resp = all ]] && resp=* for _f in $_avail; do [[ $_f = $resp ]] && _selected=$($_action $_f $_selected) done done if isin $_xbase $_selected && ! isin $_comp $_selected && isin $_comp $_avail; then _selected=$(addel $_comp $_selected) echo "The xbase set requires the comp set, so adding it back in." fi done set +o noglob COLUMNS=$_col resp=$_selected } configure_ifs() { local _first _ifdevs _ifs _name _hn _vl=0 _vd _vi _p _tags while :; do _vd=$(ifconfig vlan$_vl 2>&1) [[ $_vd == @(*no such interface*) ]] && break [[ $_vd == @(vlan$_vl: flags=0<>*) ]] && break ((_vl++)) done _vd= ifconfig lo0 inet 127.0.0.1/8 while :; do ifconfig vlan$_vl create >/dev/null 2>&1 ask_which "network interface" "do you wish to configure" \ '$(get_ifdevs)' \ ${_p:-'$( (get_ifdevs netboot; get_ifdevs) | sed q )'} [[ $resp == done ]] && break _ifs=$resp _hn=/tmp/hostname.$_ifs rm -f $_hn if [[ $_ifs == vlan[0-9]* ]]; then _vi=$(ifconfig $_ifs 2>/dev/null | sed -n 's/vlan: \([0-9]*\).*/\1/p') _tags=$(ifconfig vlan 2>/dev/null | sed -n 's/vlan: \([0-9]*\).*/\1/p') [[ -n $_tags ]] && _tags=$(rmel "$_vi" $_tags) if [[ -z $_vi ]]; then _vi=0 while ((++_vi < 4096)); do ! isin "$_vi" $_tags && break done fi _ifdevs=$(get_ifdevs) set -- $_ifdevs while [[ $1 == vlan[0-9]* ]]; do shift done ask "Which interface:tag should $_ifs be on?" "${_vd:=$1}:$_vi" _vd=${resp%%:*} _vi=${resp##*:} if ! (isin "$_vd" $_ifdevs && [[ $_vd != vlan[0-9]* ]]); then echo "Invalid interface choice '$_vd'" _vd= continue fi if ((_vi < 1 || _vi > 4095)) || isin "$_vi" $_tags; then echo "Invalid or in-use vlan tag '$_vi'" continue fi grep -qs "^up" /tmp/hostname.$_vd || echo "up" >>/tmp/hostname.$_vd chmod 640 /tmp/hostname.$_vd ifconfig $_vd up ifconfig $_ifs destroy >/dev/null 2>&1 ifconfig $_ifs vlan $_vi vlandev $_vd echo "vlan $_vi vlandev $_vd" >>$_hn [[ ${_ifs##vlan} == $_vl ]] && ((_vl++)) fi ifconfig $_ifs 2>/dev/null | grep -q "^[[:space:]]*ieee80211:" && ieee80211_config $_ifs $_hn resp=$(hostname -s) [[ -n $_first && $_first != $_ifs ]] && ask "Symbolic (host) name for $_ifs?" $resp _name=$resp v4_config $_ifs $_name $_hn v6_config $_ifs $_name $_hn if [[ -f $_hn ]]; then chmod 640 $_hn ((nifs++)) : ${_first:=$_ifs} _p=done fi done } v4_info() { ifconfig $1 inet | sed -n ' 1s/.*/dev/null /sbin/dhclient "$@" } dhcp_request() { local _ifs=$1 _hn=$2 echo "lookup file bind" >/etc/resolv.conf.tail if [[ -n $_hn ]]; then _hn="send host-name \"$_hn\";" echo "Issuing hostname-associated DHCP request for $_ifs." else echo "Issuing free-roaming DHCP request for $_ifs." fi cat >/etc/dhclient.conf <<__EOT initial-interval 1; $_hn request subnet-mask, broadcast-address, routers, domain-name, domain-name-servers, host-name; __EOT ifconfig $_ifs group dhcp >/dev/null 2>&1 dhclient $_ifs set -- $(v4_info $_ifs) if [[ $1 == UP && -n $2 ]]; then mv /etc/dhclient.conf /tmp/dhclient.conf mv /etc/resolv.conf.tail /tmp/resolv.conf.tail return 0 fi ifconfig $_ifs delete down -group dhcp 2>/dev/null rm /etc/dhclient.conf /etc/resolv.conf.tail return 1 } hextodec() { local _d _b for _b in $(echo ${1#0x} | sed 's/\(..\)/\1 /g'); do _d=$_d.$((0x$_b)) done echo ${_d#.} } ieee80211_scan() { [[ -f $WLANLIST ]] || ifconfig $1 scan | sed -n 's/^ nwid \([^"]\)/\1/p' >$WLANLIST cat $WLANLIST } ieee80211_config() { local _ifs=$1 _hn=$2 _prompt _nwid _haswpa=0 _err ifconfig $_ifs -nwid -nwkey ifconfig $_ifs -wpa 2>/dev/null && _haswpa=1 rm -f $WLANLIST while [[ -z $_nwid ]]; do ask_until "Access point? (ESSID, 'any', list# or '?')" "any" case "$resp" in +([0-9])) _nwid=$(ieee80211_scan $_ifs | sed -n "${resp}s/ .*//p") [[ -z $_nwid ]] && echo "There is no line $resp." ;; \?) ieee80211_scan $_ifs | sed -n 's/^\([^ ]*\) chan .* bssid \([^ ]*\) .*$/ \1 (\2)/p' | less -XEN ;; *) _nwid=$resp;; esac done if [[ $_nwid != any ]]; then ifconfig $_ifs nwid "$_nwid" quote nwid "$_nwid" >>$_hn _prompt="Security protocol? (O)pen, (W)EP" ((_haswpa == 1)) && _prompt="$_prompt, WPA-(P)SK" while :; do ask_until "$_prompt" "O" case "$_haswpa-$resp" in ?-[Oo]) break ;; ?-[Ww]) ask_until "WEP key? (will echo)" if _err=$(ifconfig $_ifs nwkey "$resp" 2>&1) && [[ -z $_err ]]; then quote nwkey "$resp" >>$_hn break fi echo "$_err" ;; 1-[Pp]) ask_until "WPA passphrase? (will echo)" if ifconfig $_ifs wpakey "$resp"; then quote wpakey "$resp" >>$_hn break fi ;; *) echo "'$resp' is not a valid choice." ;; esac done fi } v4_config() { local _ifs=$1 _name=$2 _hn=$3 _prompt _addr _mask if ifconfig $_ifs | grep -q 'groups:.* dhcp'; then _addr=dhcp else set -- $(v4_info $_ifs) if [[ -n $2 ]]; then _addr=$2; _mask=$(hextodec $3) ifconfig $_ifs inet $_addr delete fi fi if [[ -x /sbin/dhclient ]]; then _prompt="or 'dhcp' " ifconfig dhcp >/dev/null 2>&1 || _addr=dhcp fi _prompt="IPv4 address for $_ifs? (${_prompt}or 'none')" ask_until "$_prompt" "$_addr" case $resp in none) ;; dhcp) if [[ ! -x /sbin/dhclient ]]; then echo "DHCP not possible - no /sbin/dhclient." elif dhcp_request $_ifs "$_name" || dhcp_request $_ifs; then echo "dhcp" >>$_hn fi ;; *) _addr=$resp ask_until "Netmask?" "${_mask:=255.255.255.0}" ifconfig $_ifs -group dhcp >/dev/null 2>&1 if ifconfig $_ifs inet $_addr netmask $resp up; then addhostent "$_addr" "$_name" echo "inet $_addr $resp" >>$_hn fi ;; esac } v6_config() { local _ifs=$1 _name=$2 _hn=$3 _addr _prefixlen _prompt ifconfig lo0 inet6 >/dev/null 2>&1 || return set -- $(v6_info $_ifs) [[ -n $2 ]] && { _addr=$2; _prefixlen=$3; } [[ -x /sbin/rtsol ]] && _prompt="or 'rtsol' " _prompt="IPv6 address for $_ifs? (${_prompt}or 'none')" ask_until "$_prompt" "${_addr:-none}" case $resp in none) return ;; rtsol) [[ ! -x /sbin/rtsol ]] && { echo "No /sbin/rtsol."; return; } ifconfig $_ifs up if rtsol -F $_ifs; then echo "up\nrtsol" >>$_hn fi return ;; esac _addr=$resp ask_until "IPv6 prefix length for $_ifs?" "${_prefixlen:=64}" ifconfig $_ifs inet6 $_addr prefixlen $resp up || return echo "inet6 $_addr $resp" >>$_hn addhostent "$_addr" "$_name" v6_defroute $_ifs } v4_defroute() { local _dr _prompt=" or 'none'" [[ -n $(ifconfig | sed -n '/[ ]inet .* broadcast /p') ]] || return [[ -f /tmp/dhclient.conf && $nifs == 1 ]] && return [[ -x /sbin/dhclient ]] && _prompt=", 'dhcp'$_prompt" _prompt="Default IPv4 route? (IPv4 address$_prompt)" _dr=$(route -n show -inet | sed -n '/^default */{s///; s/ .*//; p;}') [[ -f /tmp/dhclient.conf ]] && _dr=dhcp while :; do ask_until "$_prompt" "$_dr" [[ $resp == @(none|dhcp) ]] && break route delete -inet default >/dev/null 2>&1 route -n add -inet -host default "$resp" && { echo "$resp" >/tmp/mygate; break; } route -n add -inet -host default $_dr >/dev/null 2>&1 done } v6_defroute() { local _if=$1 _resp _routers route -n show -inet6 | egrep -q '^default[[:space:]]' && return _routers=$(bsort $(ping6 -n -c 2 ff02::2%$_if 2>/dev/null | sed -n '/bytes from/{s/^.*from //;s/,.*$//;p;}' | sed -n 'G;s/\n/&&/;/^\(.*\n\).*\n\1/d;h;P')) local PS3="IPv6 default router? (${_routers:+list #, }IPv6 address or 'none'): " select _resp in $_routers; do [[ ${_resp:=$REPLY} == *:* ]] && break [[ $_resp == none ]] && return done route -n add -inet6 -host default "$_resp" && echo "$_resp" >>/tmp/mygate } enable_network() { local _f _gw for _f in dhclient.conf resolv.conf resolv.conf.tail; do if [ -f /mnt/etc/$_f ]; then cp /mnt/etc/$_f /etc/$_f fi done ifconfig lo0 inet 127.0.0.1/8 for hn in /mnt/etc/hostname.*; do ((nifs++)) if=${hn#/mnt/etc/hostname.} (ifconfig $if||ifconfig $if create) >/dev/null 2>&1 || continue while :; do if [ "$cmd2" ]; then set -- $cmd2 af=$1 name=$2 mask=$3 bcaddr=$4 ext1=$5 cmd2= i=1 while [ i -lt 6 -a -n "$1" ]; do shift; let i=i+1; done ext2="$@" else read af name mask bcaddr ext1 ext2 || break fi case "$af" in "#"*|"!"*|"bridge"|"") continue ;; "dhcp") [ "$name" = "NONE" ] && name= [ "$mask" = "NONE" ] && mask= [ "$bcaddr" = "NONE" ] && bcaddr= dhcpif="$dhcpif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 down" if [[ -x /sbin/dhclient ]]; then cmd="$cmd; dhclient $if" else cmd="$cmd; echo /sbin/dhclient missing - skipping dhcp request." fi ;; "rtsol") rtsolif="$rtsolif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" ;; *) read dt dtaddr if [ "$name" = "alias" ]; then alias=$name name=$mask mask=$bcaddr bcaddr=$ext1 ext1=$ext2 ext2= else alias= fi cmd="ifconfig $if $af $alias $name" case "$dt" in dest) cmd="$cmd $dtaddr" ;; *) cmd2="$dt $dtaddr" ;; esac case $af in inet) if [ ! -n "$name" ]; then echo "/etc/hostname.$if: inet alone is invalid" return fi [ "$mask" ] && cmd="$cmd netmask $mask" if [ "$bcaddr" -a X"$bcaddr" != "XNONE" ]; then cmd="$cmd broadcast $bcaddr" fi [ "$alias" ] && rtcmd=";route -qn add -host $name 127.0.0.1" ;; inet6) if [ ! -n "$name" ]; then echo "/etc/hostname.$if: inet6 alone is invalid" return fi [ "$mask" ] && cmd="$cmd prefixlen $mask" cmd="$cmd $bcaddr" ;; *) cmd="$cmd $mask $bcaddr" ;; esac cmd="$cmd $ext1 $ext2$rtcmd" rtcmd= ;; esac eval "$cmd" done /dev/null 2>&1 route -qn add -host default $_gw && break done [[ -z $rtsolif ]] && stripcom /mnt/etc/mygate | while read _gw; do [[ $_gw == !(*:*) ]] && continue route -qn delete -inet6 default >/dev/null 2>&1 route -qn add -host -inet6 default $_gw && break done route -qn add -net 127 127.0.0.1 -reject >/dev/null } install_files() { local _src=$1 _files=$2 _f _sets _get_sets _n _col=$COLUMNS \ _tmpfs _tmpsrc _cfile _fsrc _unver _t _issue _srclocal _size for _f in $THESETS; do isin $_f $_files || continue; _sets=$(addel $_f $_sets) if [[ -z $DISPLAY && ! -d /mnt/etc/X11 ]]; then isin ${_f%${VERSION}.tgz} xbase xetc xshare xfont xserv && continue fi isin $_f $DEFAULTSETS "site$VERSION-$(hostname -s).tgz" && _get_sets=$(addel $_f $_get_sets) done if [[ -z $_sets ]]; then echo -n "Looked at " echo $_src | sed 's/\(^ftp:\/\/[^/]*\)\(:[^/]*\)\(@.*\)/\1\3/' echo "and found no $OBSD sets. The set names looked for were:" let COLUMNS=_col-8 for _n in $THESETS; do echo $_n; done | showcols | sed 's/^/ /' COLUMNS=$_col $auto && exit 1 echo return fi isin INSTALL.$ARCH $_files || ask_yn "INSTALL.$ARCH not found. Use sets found here anyway?" || return select_sets "$_sets" "$_get_sets" [[ -n $resp ]] || return _get_sets=$resp _get_sets=$(for s in $THESETS; do isin $s $_get_sets && echo $s; done) _size=$( ( [[ $_src == file://* ]] && ls -lT "${_src#file://}" || ftp -V -o - "$_src/index.txt" 2>/dev/null ) | ( sum=0 while read x x x x s x x x f2 f && : ${f:=$f2}; do isin $f $_get_sets && let sum+=s done; echo $sum ) ) _size=$((${_size:-536870912} / 1024)) _unver=$_get_sets for _issue in ''; do ! isin SHA256.sig $_files && _issue="Directory does not contain SHA256.sig" && break _tmpfs=$( ( for fs in /mnt/{{,var/}tmp,home,usr{/local,}}; do df -k $fs 2>/dev/null | grep " $fs\$" done df -k ) | ( while read a a a a m m; do [[ $m == /mnt/@(@(|var/)tmp|home|usr/@(src,obj,xobj))@(|/*) ]] && ((a > _size + 10240)) && echo $m && exit [[ $m == /mnt@(|/*) ]] && ((a > _size * 4)) && echo $m && exit done ) ) if [[ -d $_tmpfs ]]; then ! _tmpsrc=$(tmpdir "$_tmpfs/sets") && _issue="Cannot create prefetch area" && break else _issue="Cannot determine prefetch area" && break fi _cfile=$_tmpsrc/SHA256 _srclocal=false _t=Get/Verify [[ $_src == file://* ]] && _srclocal=true _t='Verifying ' ! ftp -D "$_t" -Vmo "$_cfile.sig" "$_src/SHA256.sig" && _issue="Cannot fetch SHA256.sig" && break ! signify -Vep /etc/signify/openbsd-${VERSION}-base.pub \ -x "$_cfile.sig" -m "$_cfile" && _issue="Signature check of SHA256.sig failed" && break for _f in $_get_sets; do rm -f "$_tmpsrc/h" "$_tmpsrc/fail" ( ftp -D "$_t" -Vmo - "$_src/$_f" || >"$_tmpsrc/fail" ) | ( $_srclocal && sha256 >$_tmpsrc/h || sha256 -ph "$_tmpsrc/h" >"$_tmpsrc/$_f" ) if [[ -f $_tmpsrc/fail ]]; then rm -f "$_tmpsrc/$_f" if ! ask_yn "Fetching of $_f failed. Continue anyway?"; then [[ -d $_tmpsrc ]] && rm -rf "$_tmpsrc" $auto && exit 1 return fi continue fi if fgrep -qx "SHA256 ($_f) = $(<$_tmpsrc/h)" "$_cfile"; then _unver=$(rmel $_f $_unver) else if ! ask_yn "Checksum test for $_f failed. Continue anyway?"; then [[ -d $_tmpsrc ]] && rm -rf "$_tmpsrc" $auto && exit 1 return fi fi done done [[ -n $_unver ]] && : ${_issue:="Unverified sets:" ${_unver% }} if [[ -n $_issue ]] && ! ask_yn "$_issue. Continue without verification?"; then [[ -d $_tmpsrc ]] && rm -rf "$_tmpsrc" $auto && exit 1 return fi for _f in $_get_sets; do _fsrc="$_src/$_f" [[ -f $_tmpsrc/$_f ]] && _fsrc="file://$_tmpsrc/$_f" case $_fsrc in *.tgz) ftp -D Installing -Vmo - "$_fsrc" | tar -zxphf - -C /mnt;; *) ftp -D Installing -Vmo "/mnt/$_f" "$_fsrc";; esac if (($?)); then if ! ask_yn "Installation of $_f failed. Continue anyway?"; then [[ -d $_tmpsrc ]] && rm -rf "$_tmpsrc" $auto && exit 1 return fi else DEFAULTSETS=$(rmel $_f $DEFAULTSETS) GOTSETS="$GOTSETS $_f" fi [[ -d $_tmpsrc ]] && rm -f "$_tmpsrc/$_f" done [[ -d $_tmpsrc ]] && rm -rf "$_tmpsrc" } encode_for_url() { echo "$1" | sed " s/%/%25/g s/ /%20/g s/!/%21/g s/\"/%22/g s/#/%23/g s/\\\$/%24/g s/&/%26/g s/'/%27/g s/(/%28/g s/)/%29/g s/\*/%2a/g s/+/%2b/g s/,/%2c/g s/-/%2d/g s/\./%2e/g s/\//%2f/g s/:/%3a/g s/;/%3b/g s//%3e/g s/?/%3f/g s/@/%40/g s/\[/%5b/g s/\\\\/%5c/g s/]/%5d/g s/\^/%5e/g s/_/%5f/g s/\`/%60/g s/{/%7b/g s/|/%7c/g s/}/%7d/g s/~/%7e/g " } ftp_error() { if [[ -n $(echo "$2" | grep "$1") ]]; then echo $1 return 0 fi return 1 } startftplist() { ((nifs < 1)) && return set -m ( ftp -Vao - "http://129.128.5.191/cgi-bin/ftplist.cgi?path=$FTPSETDIR" \ 2>/tmp/ftplisterr >$SERVERLISTALL echo -n $SECONDS >$SERVERLISTSEC feed_random ) & ftppid=$! set +m (sleep 12; kill -INT -$ftppid >/dev/null 2>&1) & } waitftplist() { wait "$ftppid" 2>/dev/null } ftp_time() { local _ftplist_sec=$(cat $SERVERLISTSEC 2>/dev/null) local _time=$(sed '/^TIME=\([0-9]*\)$/!d;s//\1/;q' $SERVERLISTALL 2>/dev/null) [[ -n $_ftplist_sec && -n $_time ]] && echo $((_time + SECONDS - _ftplist_sec)) } install_url() { local _url_type=$1 _file_list _url_base _prompt _passwd _mirror eval local _server_ip=\$_${_url_type}_server_ip \ _server_dir=\$_${_url_type}_server_dir waitftplist ask "HTTP/FTP proxy URL? (e.g. 'http://proxy:8080', or 'none')" \ "${ftp_proxy:-none}" unset ftp_proxy http_proxy [[ $resp == none ]] || export ftp_proxy=$resp http_proxy=$resp if [[ -s $SERVERLISTALL ]]; then _prompt="Server? (hostname, list#, 'done' or '?')" sed -n "s,^${_url_type}://"'\([[A-Za-z0-9\:_][]A-Za-z0-9:._-]*\),\1,p' \ $SERVERLISTALL >$SERVERLIST set -- $(sed q $SERVERLIST) _server_ip=${1%%/*} else echo "(Was not able to get ftplist from ftp.openbsd.org, but that is OK)" _prompt="Server? (hostname or 'done')" fi while :; do ask_until "$_prompt" "$_server_ip" case $resp in done) return;; "?") [[ -s $SERVERLIST ]] || continue less -XEN < $SERVERLIST ;; +([0-9])) [[ -s $SERVERLIST ]] || continue set -- $(sed -n "${resp}p" $SERVERLIST) (($# < 1)) && { echo "There is no line $resp."; continue; } _server_ip=${1%%/*} ;; +([A-Za-z0-9\:.\[\]_-])) _server_ip=$resp break ;; *) echo "'$resp' is not a valid hostname." ;; esac done eval _${_url_type}_server_ip=$_server_ip set -- $(sed "/^$_server_ip/x;\$!d;x" $SERVERLIST 2>/dev/null) resp=${1#*/} [[ $resp == "$1" ]] && resp= if (($# > 1)); then resp=$resp/$FTPSETDIR _mirror=yes fi ask_until "Server directory?" "${resp:-pub/OpenBSD/$FTPSETDIR}" _server_dir=$resp eval _${_url_type}_server_dir=$_server_dir if [[ $_url_type == ftp ]]; then IFS= ask_until "Login?" "${_ftp_server_login:=anonymous}" _ftp_server_login=$resp if [[ $_ftp_server_login == @(anonymous|ftp) ]]; then _passwd=root@`hostname` else resp= while [[ -z $resp ]]; do askpass "Password? (will not echo)" done _passwd=$resp fi fi _url_base=$_url_type:// if [[ $_url_type == ftp && $_ftp_server_login != anonymous ]]; then _url_base=$_url_base$(encode_for_url "$_ftp_server_login"):$(encode_for_url "$_passwd")@ fi _url_base=$_url_base$_server_ip/$_server_dir if [[ $_url_type == ftp && -z $ftp_proxy ]]; then _file_list=$(ftp -V "$_url_base/") ftp_error "Login failed." "$_file_list" && return ftp_error "No such file or directory." "$_file_list" && return else _file_list=$(ftp -Vo - "$_url_base/index.txt" | sed 's/^.* //' | sed 's/ //') fi install_files "$_url_base" "$_file_list" installedfrom=$_url_type://$_server_ip/$_server_dir if [[ -n $_mirror ]]; then PACKAGE_PATH=$(print -r -- "$installedfrom" | sed -E "/\/(snapshots|[0-9]\.[0-9])\/($ARCH)\/*$/!d s!!/\1/packages/$(arch -s)/!;q") else PACKAGE_PATH= fi } install_mounted_fs() { local _dir while :; do ask_until "Pathname to the sets? (or 'done')" "$SETDIR" [[ $resp == done ]] && return [[ -d /mnt2/$resp ]] && { _dir=/mnt2/$resp; break; } [[ -d /mnt/$resp ]] && { _dir=/mnt/$resp; break; } [[ -d /$resp ]] && { _dir=/$resp; break; } echo "The directory '$resp' does not exist." done install_files "file://$_dir" "$(ls $_dir/)" } install_cdrom() { get_drive "CD-ROM" '$(get_cddevs)' || return mount_mnt2 $resp || return install_mounted_fs } install_disk() { ask_yn "Is the disk partition already mounted?" if [[ $resp == n ]]; then get_drive "disk" '$(bsort $(get_dkdevs))' \ '$(bsort $(rmel $ROOTDISK $(get_dkdevs)))' || return mount_mnt2 $resp || return fi install_mounted_fs } install_nfs() { local _tcp ask_until "Server IP address or hostname?" "$NFS_ADDR" NFS_ADDR=$resp ask_until "Filesystem on server to mount?" "$NFS_PATH" NFS_PATH=$resp ask_yn "Use TCP transport? (requires TCP-capable NFS server)" [[ $resp == y ]] && _tcp=-T mount_nfs $_tcp -o ro -R 5 $NFS_ADDR:$NFS_PATH /mnt2 || return install_mounted_fs } install_tape() { local _z _bs get_drive "tape drive" '$MTDEVS' || return export TAPE=/dev/nr$resp if [[ ! -c $TAPE ]]; then echo "$TAPE is not a character special file." return fi echo -n "Rewinding $TAPE (mt rewind)..." mt rewind || return echo "done." while :; do ask_until "Skip how many files? (or 'done')" 0 [[ $resp == done ]] && return [[ $resp == +([0-9]) ]] || continue if (($resp > 0)); then echo -n "Skipping $resp file(s)..." mt fsf $resp || return echo "done." elif [[ -n $_bs ]]; then mt bsf; mt fsf fi unset _z ask_yn "Is the file gzipped?" yes [[ $resp == y ]] && _z=z [[ $_z == z ]] || _bs=10240 ask_until "Blocksize for this file?" "${_bs:-8k}" [[ $resp == done ]] && return _bs=$resp dd if=$TAPE bs=$_bs | tar ${_z}xvphf - -C /mnt || return done } set_timezone() { local _zonefile=$1 _zonepath _zsed _tz _zoneroot=/usr/share/zoneinfo [[ ! -f $_zonefile ]] && return [[ -n $TZ ]] && return if [[ -h /mnt/etc/localtime ]]; then TZ=$(ls -l /mnt/etc/localtime 2>/dev/null) TZ=${TZ#*${_zoneroot#/mnt}/} fi waitftplist if [[ -s $SERVERLISTALL ]]; then _tz=$(sed -n '/^TZ=/s/TZ=//p' <$SERVERLISTALL) [[ -n $_tz ]] && isin "$_tz" `cat $_zonefile` && TZ=$_tz fi [[ $_zonefile = /var/tzlist && -z $TZ ]] && return while :; do ask "What timezone are you in? ('?' for list)" "$TZ" _zonepath=${resp%%*(/)} case $_zonepath in "") continue;; "?") grep -v /. $_zonefile | showcols continue;; esac while isin "$_zonepath/" $(cat $_zonefile); do ask "What sub-timezone of '$_zonepath' are you in? ('?' for list)" _zsed=$(echo $_zonepath/ | sed 's,/,\\/,g') resp=${resp%%*(/)} case $resp in "") ;; "?") sed -n "/^$_zsed/{s/$_zsed//;/\/./!p;}" $_zonefile | showcols;; *) _zonepath=$_zonepath/$resp;; esac done if isin "$_zonepath" $(cat $_zonefile); then TZ=${_zonepath#$_zoneroot} return fi echo -n "'${_zonepath}'" echo " is not a valid timezone on this system." done } sane_install() { local _q=$1 _s for _s in $SANESETS; do isin $_s $DEFAULTSETS || continue [[ -z $_q ]] && ask_yn "Are you *SURE* your $MODE is complete without '$_s'?" || return done } install_sets() { local _d _locs="disk ftp http" echo [[ -s $SERVERLISTALL ]] && _d=$(sed -n '/^method=/s/method=//p' $SERVERLISTALL) ifconfig netboot >/dev/null 2>&1 && : ${_d:=http} [[ -n $(get_cddevs) ]] && { _locs="cd $_locs"; : ${_d:=cd}; } [[ -x /sbin/mount_nfs ]] && _locs="$_locs nfs" [[ -n $MTDEVS && -x /bin/mt ]] && _locs="$_locs tape" : ${_d:=http} if ! isin "$_d" $_locs; then for a in http ftp cd nfs tape disk; do isin $a $_locs && _d=$a && break done fi echo "Let's $MODE the sets!" while :; do umount -f /mnt2 >/dev/null 2>&1 [[ -n $method ]] && _d=$method sane_install quiet && _d=done ask "Location of sets? ($_locs or 'done')" "$_d" case $resp in done) sane_install && return;; c*|C*) isin cd $_locs && install_cdrom && method=cd;; d*|D*) install_disk && method=disk;; f*|F*) isin ftp $_locs && install_url ftp && method=ftp;; h*|H*) isin http $_locs && install_url http && method=http;; n*|N*) isin nfs $_locs && install_nfs && method=nfs;; t*|T*) isin tape $_locs && install_tape && method=tape;; esac $auto && break done } update_firmware() { echo "/usr/sbin/fw_update -v" >>/mnt/etc/rc.firsttime } munge_fstab() { local _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do [[ $_dev == @(/dev/vnd*|\#*) || $_fstype == nfs || ! -f /sbin/mount_$_fstype || $_opt == *noauto* || $_opt == *xx* ]] && continue _opt=$(echo $_opt | sed 's/softdep//') [[ $_fstype == ffs ]] && _opt=$(echo $_opt | sed 's/ro/rw/') [[ $_fstype == ffs ]] || _opt=$(echo $_opt | sed 's/rw/ro/') echo $_dev /mnt${_mp%/} $_fstype $_opt $_rest done /etc/fstab if [ ! -s /etc/fstab ]; then echo "Unable to create valid /etc/fstab." exit fi } mount_fs() { local _async=$1 _dev _mp _fstype _opt _rest _msg _fail while read _dev _mp _fstype _opt _rest; do [ "$_mp" = "/mnt" ] || mkdir -p $_mp _msg=$(mount -v -t $_fstype $_async -o $_opt $_dev $_mp) || _fail="$_fail\n$_mp ($_dev)" echo $_msg | sed 's/, ctime=[^,)]*//' done 0)) || continue echo -n "fsck -${_f}p $_dev..." if ! fsck -${_f}p $_dev >/dev/null 2>&1; then echo "FAILED. You must fsck $_dev manually." _fail=y else echo "OK." fi done /tmp/resolv.conf for _ns in $resp; do echo "nameserver $_ns" >>/tmp/resolv.conf done cp /tmp/resolv.conf /tmp/resolv.conf.shadow fi } populateusrlocal() { if [ -f /mnt/etc/mtree/BSD.local.dist ]; then /mnt/usr/sbin/chroot /mnt /usr/sbin/mtree -Uedqn -p /usr/local -f /etc/mtree/BSD.local.dist >/dev/null fi } apply() { if [[ $sshd == n ]]; then echo "sshd_flags=NO # disabled during install" \ >>/mnt/etc/rc.conf.local fi if [[ $sshd_disableroot == y ]]; then sed "/^#\(PermitRootLogin\) yes/s//\1 no/" \ < /mnt/etc/ssh/sshd_config >/tmp/sshd_config cp /tmp/sshd_config /mnt/etc/ssh/sshd_config fi if [[ $ntpd == y ]]; then echo "ntpd_flags= # enabled during install" \ >>/mnt/etc/rc.conf.local if [[ $ntpd_server != default ]]; then set -- $ntpd_server sed "s/^servers /#&/;/#server /a\\ servers $1 " /mnt/etc/ntpd.conf >/tmp/ntpd.conf cp /tmp/ntpd.conf /mnt/etc/ntpd.conf fi fi if [[ $x11 == y ]]; then sed "/^#\(machdep\.allowaperture=${MDXAPERTURE}\)/s//\1 /" \ /mnt/etc/sysctl.conf >/tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf fi if [[ $xdm == y && -x /mnt/usr/X11R6/bin/xdm ]]; then echo "xdm_flags= # enabled during install" \ >>/mnt/etc/rc.conf.local fi if [[ $defcons == y ]]; then cp /mnt/etc/ttys /tmp/ttys sed -e "/^$CTTY/s/std.9600/std.${CSPEED}/" \ -e "/^$CTTY/s/unknown/vt220 /" \ -e "/$CTTY/s/off.*/on secure/" /tmp/ttys >/mnt/etc/ttys [[ -n $CPROM ]] && echo "stty $CPROM $CSPEED\nset tty $CPROM" >>/mnt/etc/boot.conf fi ln -sf /usr/share/zoneinfo/$TZ /mnt/etc/localtime } questions() { local _d _xdmask=y _def ask_yn "Start sshd(8) by default?" yes sshd=$resp ask_yn "Start ntpd(8) by default?" ntpd=$resp if [[ $resp == y ]]; then ask "NTP server? (hostname or 'default')" default ntpd_server=$resp fi def=no [[ -n $DISPLAY ]] && def=yes if [[ -n $MDXAPERTURE ]]; then ask_yn "Do you expect to run the X Window System?" $def x11=$resp _xdmask=$resp fi if [[ -n $MDXDM && $_xdmask == y ]]; then ask_yn "Do you want the X Window System to be started by xdm(1)?" xdm=$resp fi if [[ -n $CDEV ]]; then _d=${CPROM:-$CDEV} ask_yn "Change the default console to $_d?" defcons=$resp if [[ $resp == y ]]; then ask_which "speed" "should $_d use" \ "9600 19200 38400 57600 115200" $CSPEED case $resp in done) defcons=n;; *) CSPEED=$resp;; esac fi fi } upgrade_to64time_t() { /mnt/usr/sbin/pwd_mkdb -d /mnt/etc master.passwd >/mnt/var/log/lastlog >/mnt/var/run/utmp } feed_random() { { (dmesg; cat $SERVERLISTALL /*.conf; sysctl; route -n show; df; ifconfig -A; hostname) >/dev/random 2>&1 dd if=/mnt/var/db/host.random of=/dev/random bs=65536 count=1 } >/dev/null 2>&1 } store_random() { { dd if=/dev/random of=/mnt/var/db/host.random bs=65536 count=1 dd if=/dev/random of=/mnt/etc/random.seed bs=512 count=1 chmod 600 /mnt/var/db/host.random /mnt/etc/random.seed } >/dev/null 2>&1 } finish_up() { local _dev _mp _fstype _rest if [[ -x /mnt/sbin/swapctl ]]; then /mnt/sbin/swapctl -a /dev/$SWAPDEV >/dev/null 2>&1 while read _dev _mp _fstype _rest; do [[ $_fstype == swap ]] && /mnt/sbin/swapctl -a $_dev >/dev/null 2>&1 done $/\1/p') md_installboot $ROOTDISK if [[ -f /mnt/bsd.mp ]] && ((NCPU > 1)); then echo "Multiprocessor machine; using bsd.mp instead of bsd." mv /mnt/bsd /mnt/bsd.sp 2>/dev/null mv /mnt/bsd.mp /mnt/bsd fi update_firmware upgrade_to64time_t store_random cat <<__EOT CONGRATULATIONS! Your OpenBSD $MODE has been successfully completed! To boot the new system, enter 'reboot' at the command prompt. __EOT [[ $MODE == install ]] && cat <<__EOT When you login to your new system the first time, please read your mail using the 'mail' command. __EOT md_congrats [[ "$MODE" == upgrade ]] && \ echo "After rebooting, run sysmerge(8) to update your system configuration." $auto && >/ai.done } ROOTDISK= ROOTDEV= PACKAGE_PATH= SM_ARGS= SM_ARGSX= SETDIR="$VNAME/$ARCH" FTPDIR="pub/OpenBSD/$VNAME" SERVERLISTALL=/tmp/serverlistall SERVERLISTSEC=/tmp/serverlistsec SERVERLIST=/tmp/serverlist WLANLIST=/tmp/wlanlist FSTABFLAG=-f for _opt in d f l m n p s; do ulimit -$_opt unlimited done dmesg | sed -n '/^OpenBSD /h;/^OpenBSD /!H;${g;p;}' >/var/run/dmesg.boot FTPSETDIR=$SETDIR set -- $(scan_dmesg "/^OpenBSD $VNAME\([^ ]*\).*$/s//\1/p") [[ $1 == -!(stable) ]] && FTPSETDIR=snapshots/$ARCH MTDEVS=$(scan_dmesg "${MDMTDEVS:-/^[cms]t[0-9][0-9]* /s/ .*//p}") nifs=0 DISPLAY=$(scan_dmesg '/^wsdisplay[0-9]* /s/ .*//p') CONSOLE=$(scan_dmesg '/^\([^ ]*\).*: console$/s//\1/p') CONSOLE=${CONSOLE% } [[ -n $CONSOLE ]] && CSPEED=$(stty speed /dev/null 2>&1 for _ifs in $(get_ifdevs dhcp); do set -- $(v4_info $_ifs) [[ $1 == UP && -n $2 ]] && continue ifconfig $_ifs delete down -group dhcp 2>/dev/null done get_responsefile() { local _f _ifdev _mac _mode _server _lf [[ -x /sbin/dhclient ]] || return _ifdev=$(get_ifdevs netboot) if [[ -z $_ifdev ]]; then set -- $(get_ifdevs) (($#)) || return if (($# == 1)); then _ifdev=$1 else while :; do ask_which "network interface" \ "should be used for the initial DHCP request" \ "$*" isin "$resp" $* && _ifdev=$resp && break done fi fi [[ -n $_ifdev ]] || return dhclient $_ifdev _lf=/var/db/dhclient.leases.$_ifdev _server=$(sed "/^ *next-server /!d;s///;s/;$//;q" $_lf) _mode=$(sed -E '/^ *filename "auto_(install|upgrade)";$/!d;s//\1/;q' \ $_lf) _mac=$(ifconfig $_ifdev | sed 's/.*lladdr \(.*\)/\1/p;d') hostname "$(sed -E '/^ *option host-name "(.*)";$/!d;s//\1/;q' $_lf)" if [[ -z $_server ]]; then echo "Could not determine next-server." elif [[ -z $_mode ]]; then echo "Could not determine auto mode." else for _f in {$_mac-,}$_mode; do ftp -o "/$_mode.conf" "http://$_server/$_f.conf" && action=$_mode && return 0 done fi return 1 } if ! $auto; then cat <<__EOT At any prompt except password prompts you can escape to a shell by typing '!'. Default answers are shown in []'s and are selected by pressing RETURN. You can exit this program at any time by pressing Control-C, but this can leave your system in an inconsistent state. __EOT elif [[ -z $respfile ]]; then if ! get_responsefile; then echo "No response file found; non-interactive mode aborted." exit 1 fi rm -f /ai.done echo "Performing non-interactive $action..." /$action -af /$action.conf 2>&1 >$_lf chmod 600 $_lf _lf=${_lf#/mnt} cat <<__EOT >>/mnt/etc/rc.firsttime ( /usr/bin/mail -s '$(hostname) $action log' root < $_lf && rm $_lf ) >/dev/null 2>&1 & __EOT exec reboot else echo "failed; check /ai.log" exit 1 fi else cp $respfile /ai.conf || exit fi set_term if [[ $MODE == install ]]; then ask_until "System hostname? (short form, e.g. 'foo')" "$(hostname -s)" [[ ${resp%%.*} != $(hostname -s) ]] && hostname $resp THESETS="$THESETS site$VERSION-$(hostname -s).tgz" echo donetconfig ((nifs != 0)) && startftplist echo while :; do askpassword "Password for root account?" _rootpass="$_password" [[ -n "$_password" ]] && break echo "The root password must be set." done rootkey= $auto && ask "Public ssh key for root account?" none && [[ $resp != none ]] && rootkey=$resp questions user_setup set_timezone /var/tzlist echo fi diskinfo() { local _d for _d; do makedev $_d echo -n "$_d: " disklabel -dpg $_d 2>/dev/null | sed -e '/^label: /{s,,,;s/ *$//;s/^$//;H;d;}' \ -e '/.*# total bytes: \(.*\)/{s//(\1)/;H;}' \ -e '$!d;x;s/\n/ /' rm -f /dev/{r,}$_d? done } while :; do echo "Available disks are: $(get_dkdevs | sed 's/^$/none/')." _ask "Which disk is the root disk? ('?' for details)" \ $(get_dkdevs | sed 's/ .*//') || continue case $resp in "?") diskinfo $(get_dkdevs);; '') ;; *) isin "$resp" $(get_dkdevs) && break echo "no such disk";; esac done makedev $resp || exit ROOTDISK=$resp ROOTDEV=${ROOTDISK}a SWAPDEV=${ROOTDISK}b u% |%{%BȂ%%8od@ 'l@'t@m(|@%@%@%@Xk@%@ %9A%@8%@%@%@t% @X%@t%@X%ȃ@`%Ѓ@(%؃@%TA%@%@<%@%A%@%@%@|%@d%@L%$@,@%4@%A%<@`% A%@%d@%D@%%A%L@%T@0%\@H%d@%n@%l@%xB%x@%@D%@D%@<%@%@ 'l@'@k@k@%@%Ą@%@%%%<%l%t%P%xxooPLk&rx@k%@k%@k%@ k%@k%@k%ko (o(o%%%% ER&CE#&ST&SL&`(h(C&&X>&A&&`(H>&|>&`>&`?&$K&F&ffs>ext2fsP!>cd9660X)>msdos2lockf@` P@X@`@h@p@x@@@@@@@@@@@@ļ@̼@Լ@ܼ@@@@@ ***h(i*0i*Ph*h(*x***4*p*****P** *|**d*P**0*l*h*P**P****L**P*P*h(P*P**P*P***P*P*<****t*** *h(h(t*h(*h(4*t**t********h(t*t*t*t**p*t**. .. X?+,@X8,@k@kd,4Ck0E.7.7.@%.4CkC( //S.|//x.4Ckl.@...\...4Ckp.(l.(j.m.4Ck.(l.(j.m.8.l.4Ck!/(l.(j.m./4Ck)!/(l.(j.m.4Ck-(l.(j.m.--P--4Ckp.(l.(j.m.p.L@`Ak4Ckh , dXhCklCktCkxCkpCk<8Q @X,CkCkCkCkLAkPAkTAkXAkDkCkCkCkCkCkCkCkCkCkCkCkCkCkCk;p(@AAA==(A* dd%(i @@@@@@@@@@HEk Ekxaqhaq@Ek$EkLEk`EkdEkPEk$ FkFkFk@//l////P/@D0400@00X0@8HP0H0(0@ 000 @ 000@$L0L000@$L0L000@$@ @00X00 @ @l0p0d0 @ X@@6/0A/,@ \@b/0|}/8@ \@$C/80,a/H@ @/0(/X@00/0ȓ/h@@@ ؕ/0Д/x@4T*0)0p(0X)0'0@4T*0)0p(0X)0'0@$4T*0)0p(0X)0'0 @X@6/0A/ @\b/0|}/ @X@6/0A/@\b/0|}/@Z00@Zt0t0>>>>|0L0i0O000X&1<&1,&1T*H1H$1\0*T1+10 R1<11(41 18*11111P0'1p&1w0P0,161*01-1L1$1\+1<01X&1<&1,&1P*H1 *|**K1P*0 R1<1h*P**P****1$1P*P*P0P*P**P*P*L1*P*$1<*111x111 ... ...X&1<&1,&1T*,11i1*T1 11<1Tz11l11110111 11X11̺11111$1̹11*X&1<&1,&1P*,1 *|**K1P*1<1Tz1h*P**P****1$1P*P*1P*P**P*P*1*P*$1<*22D 22 2 "20 2 2 4Nk|NkNkAd3,m3{3s3Lp3,p3Ts32\Qk)_43h3x>4\QkC// 4|/x.\Qkl.....\Qk$@5@55>545D535\Qk:'4@55>545D5:4 43\Qk<3\Qk+ج4\Qk,3\Qk)L!/@5545D5/\QkL!/@5545D5\Qk$@5@5545D5@5A Ok\Qkh ,@3\3@  XdXQkQkSkSkSkSkSkQkQkSk`RkdRkSk@ E8(@AAA==(A*QkQkQkQkQkQkQkQkQkQkQkQkQkQkQkQkQkQkQkQkQ SkSk  >><>>>"A4r"A8r"A<r#A@r#ADr#AHr #ALr#APr#ATr#AXr#A\r #A`r$#Adr(#Ahr,#Alr4#Apr<#AtrD#AxrL#A|rP#AD|o5X#AD|ox5`#AD|oL5Ukh#A05055$A055%Ax6$6,66P666666666 66666@66666t6t6t6t6t66666armish|rF64G6H6p6o6ʏ@(@(@(@(@(@(@(T3@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@( 8@ 8l8 888@(@(@(@(@(<{%z%py%w%u%u%H(H(H(H(H(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(7`u7Lt7k7<_77H(H(H(H(H(tN7 M7L7Q7+7+7@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(%D%d%%x%H%<%@(P%|>)h(=)l=)<)h(<)@(\<)Q6Q6\R6\R6Q6@((Q6&@(@(@(@(@(@((@(H(H(H(H(H(H(H(<%)@(D(H(H(H(H(H(h(H(H(@(H(4U(TU(X(@(U(@(0X(@(@W(&@(@(@(@(@((@(H(H(H(@(@(@((@(&H(H(@(H(@(@((@(&@(@(@(@(@(@((@(@(@(@(@(@(@((@(j!i!0H!tH!f![!H!<%)@(D(H(H(@(@(H(@((@(@(@(@(@(@(@((@(@(@(@(@(@(@((@( 8@ 8\8(8 8@((@(&@(@(@(@(@(@((@(<{%z%8v%v%w%@((@(&H(H(H(H(H(@((@(&@(@(@(@(@(@((@(@(@(@(@(@(@((@( q+$+++x+@(t+@(`n+@(@(@(@(@(@((@(7`u7o7Xo7k7@((@(&H(H(H(H(H(@((@(&tN7 M7G7G7Q7@((@(&H(H(@(@(H(@((@(H(H(@(@(H(@((@(@(@(@(@(@(@((@(@(@(@(@(@(@((@(@(@(@(@(@(@((@(@(@(@(@(@(@((@(H(H(H(H(H(@(H(@(H(H(H(@(@(H(@((@(H(H(H(@(@(H(@((@(H(H(H(H(H(@(H(H(H(<%%Ą%@(%@(|%@( %H(H(H(@(H(@(H(H(@(@(@(@(@(@((@(T%\%&$%%@((@(d%@(@(@(@(@(@((@(@(@(@(@(@(@((@(@(@(@(@(@(@((@(@(@(@(@(@(@((@(@(@(@(@(@(@((@(H(H(@(@(H(@((@(/$/@(@(x/@((@(@(@(@(@(@(@((@(@(@(@(@(@(@((@(H(H(@(@(H(@((@(@(@(@(@(@(@((@(}%}%@(@(%@((@(@(@(@(@(@(@((@(@(@(@(@(@(@((@(@(@(@(@(@(@((@(@(@(@(@(@(@((@(H(H(H(H(H(@(H(@(H(@(@(@(@(@(@((@(@(@(@(@(@(@((@(H(H(H(H(H(H(H(H(H(H(|F8E8,E8@(E8@(>8@(HZ8X8dX8@(8X8@(W8@(l8f8f8@(l8@(lf8@(Pm8m8@(@( u8@((@(9L9999@(\9@(\9H(H(@(H(@(@((@(H(H(H(H(H(@(H(@((8888<8X848<%)@(D(@(@(@(@(@(@((@(L88888@( 8@(8@(@(@(@(@(@((@(@(@(@(@(@(@((@(@(@(@(@(@(@((@(@(@(@(@(@(@((@(@(@(@(@(@(@((@(@(@(@(@(@(@((@(H(H(H(H(H(@(H(@(H(@(@(@(@(@(@((@(@(@(@(@(@(@((@(@(@(@(@(@(@((@(@(@(@(@(@(@((@(@(@(@(@(@(@((@(@(@(@(@(@(@((@(@(@(@(@(@(@((@(@(@(@(@(@(@((@(@(@(@(@(@(@((@(@(@(@(@(@(@((@(@(@(@(@(@(@((@(@(@(@(@(@(@((@(@(@(@(@(@(@((@(@(@(@(@(@(@((@(@(@(@(@(@(@((@(@(@(@(@(@(@((@(@(@(@(@(@(@((@(@(@(@(@(@(@((@(@(@(@(@(@(@((@(H(H(@(@(H(@((@(H(H(@(@(H(@((@(H(H(@(H(H(@((@(&H(H(@(@(H(@(H(@(H(@(@(@(@(@(@((@(%%%%%@((@(&H(H(H(H(H(@(H(@(H(ahGH@z@z@;AB|@GA<7*7)7*7tADdQ7P7LP7N7;A\w77Lw7v7z@4747lA /HNPWTܱ77tAX7ػ7ԢA$77A047T7A$7ФAl77AL7|7ApAxkiAxkvAxk2!xkykyk077XA(87d777x7 67 6 6 60 6( 6P 6 6 6 6 6 66 6 6 6` 6 6 6 6 6,6<6L6\6l6|6666666666688TAx8888z@t3A4APA`AxAAAAȯAAPA`AxAAAAA48J80H858d2dL58t58D8>8++#aa@(([//\))](-{/-|)-}!!c/l-y-soxoco<<>>?? ' ` ~ ^ "' ,AAA AA'CEEEEIIIINOOOOOUUUUYaaaa aa'ceeeeiiiinooooouuuuyy"A"E"I"O"U"a"e"i"o"u"yA^A`A*A~ACE^E`EI^I`I~NO^O`O~OU^U`UYa^a`a*a~ace^e`ei^i`i~no^o`o~ou^u`uyܱA,U8Y8 b84U8V8 W8W8c88d8h8Pe8`Q@4A8A :&4"%05Lj*'t=.T-9@uk EP3U<2b@ -Xz((:L%2Px!6 84?,#09(~2:Ck/k$#@:6Dt}9Wd-8qp'|ԛ,d(0:Xi:Wkp,\) )8,(8Cl' Z,\& 95dJ`AkQp"$bأ:(q,4k}9\8. t,>*D8xr= >4p(`k @<0r-\q:HkFkOX9(\=k^;Pxh?-|U;Ck5,2$L:X&\8 #4!d3,<i0-H/:D('EXs#4aP-q46L{w*S R",c !"q P8p =k 'X 8C N)D c8 k @1l &  d6L ,( xF! 9t *h -* \k5 6F h?3X Cg 0v :P T 7 @k F' R&` 0$T 3l <1 -\ zk *L9 S58> 6M X-c %pv 4 ,o D# |% ؕ/P j,t Q6h \-D "   w74 Vk?  $P 00_ 8%8h 7| ,! ; X?` U?  |Nk$ X1 4k !0 q |r& .X< 06G J?N -Xn t8D W;  dRDGkeؼ9yhq)/@p(<L58(Q52#+(h'6= h1,J'#<12dP(d # l'xP9L!4/k9xV2I8V8`t+\sr+$}t&lhX:X C5kW'@6L1pd!4>`"<-6Xjq,.P84*@CI%WD$dȆ;tp4%~r6 +poH%@(P;`8 <-|PkPx9 ),H85!G7HRk[/j"}"Xd8r/#xq9t78oq$|1 0-T$,'T0$?0O0p[$Toox''0 koX)0$$t'$ *o xkPa&p8(&D16'LC6KXkqU%`]Qko,-,xkPEk,#'0;,`/X+z7p6@ :k m". ز h: :I TpX 7pPf P3po _(< 8k T: 3: 6 : Ck Ck h" 7<!56$!`3:!oD!-[!X4k(e!|: s!t&r!o7!9-x!1X!|0!:!T7!l.P!t*`!04";p"9+ "H;@4"$X+C"(O"`57\"Ȗ;j"8o2~" 480"drx "4k"n:"09 "e8 "T2d"p"0; #'h#7H,#"?#+N#Z<d#:w#ps9#8k#aq0#o#:?#4k#tO:`#4Ak#LE6#%x#;9$#8r$'$.''$l '3$49,@$2P$l3:a$>8@k$Dk2}$<(p$:$9 $,/T$8=@$:$L5,$4-$%o,%^9.%B%G%d%<V%8C_%:l%~kw%7T%t7%'% k%&D% &t%&%%8%$%C &!&8$&$'X.&|/&<&xt'K&$DZ&X'a&0'm&6#T&Sk&.&*(& c;(& 6&h[)p&o&ܘ&&-l&B6<'q$d'"p(*' $4'H9D'ĝ%<Z'l$q';,'`!,';h' ,'؍:' 94'!'8 (`q('(#(#1():(x.DE(X#\( g' d(6r(Pn2(%(8t(<r( 6( Pq(\:(Vk(8o` )\kq)"r")038)M8E)\.W)&. =l. ,...`2...g( .7$0/(3p /2 /q2//)d6/k@/CC/tl;\V/!58f/&v/`^#L/"/!/N l/$;'0/x^*/x9 /)/0k/d"0 !0@r&0,3$:0gqK09V0,l0D$*Pt0<:\0B6T0"0 0+;`0T!d0:05 0`u7$0*( 1@)t14M'l$1'/1%:1oF10>0M1x&(^1x7l12w1k1XA'1"1+1)1|;D1r91>610>3M.M3:Z36d3Dr~3+l3(;h3@:`3*H373,63԰43pGk4m+4%&4$h54@`$D4$<2xS48dc4r o4Rk4/4q=4;4Nk4+X4n4 42,4p/k4`&< 5T %5ԁ/ 55&B5&<L56]5|vkh52pw5r5*5<"\5\075z-5}% 5;[1 K;VkZ;HGke;HG8y;Uk;K!; -0;d);T&t;<0#;pk4,;4);:<M5<'0<\9),%<h*3<<-|H<d-6\c<=<r<p<$<-:4<7<~k<Fk<2l<=k<f*<|/<dn$,=9l"=65=D+==H>&I='Q= 7`=p(0p=#<=$@=<"$ =a2=9*L=Dk=k=&r=T1=(%>K#L> $>4`;1>ĭ%\@>D*7`N>\9[>*<h>&s>T*0@>-8>2>3>)X>&x>%p>j,X>pb9> 6?*#?9k0?:\A?-<U? -n?,8y?0uk?|# ?D<4?;4?9? 6?%?h)< ?W5P?,'@=@@l:@*? +@)d3@:,A@%tS@X4dd@L$0s@:|@ش9@Nk@`1@C@p94@Dt9@Lk@\+1H@J)@"< A!%A01 (A*|A)lA /.A\[#0A6A\(8AN,A*TAt!A"rA1. B<*tBt;\,B 9:BD'IB#XB>5LfB : tB46B5?B/PB@9hB)B8$BrB<1Bd8C pC8C0|p*C$2$l4C?C(>CCHC$9]CX1oCd/4wC'Ct.6XC C8C+<C@&,C4kC"D3dD)!D$2$0D+2x:D#HD%TDpiDLy)P sD, P|D8w(xDCDl7LD-D :DD~-D$$DB0D$8P E@55 E5p E!H5Evk@E34RE4)ZEL8(jE,,E+\E*dE+`E &<E%$Exr9@EDg8ECkE1pE(F*(F^%0F",F@=h>F/6PFtd) [F-tcFX+PmF4%F:?F7F,)xFK)Fh%$Fd2F,*F("`Fp:lP#&PV87PT7IP-RPlI*aP,#0{P 8@P\1P7<P<`P4k PY,hP&>P<4PM:Q&6QH'Q]x)<] 9]$4]4 T]?]p:]!P]e8]Nk^1x^T-d0^;9H;^vkI^*S^kZ^h:%j^!^<^9^ 3^43t ^33^&>^`'H^PH'd^t0&_ ;h_$*_0;_t*XW_c'b_:kj_Hf6_+_%`_8_r_/L_&x_PZ2_D(p_-'_,),`8 `h7h$`28`.H`9:d[`7lq`Hg:~`k`,`Sk`8%`<1H`lg,`($`9l`r8`\r4aNq a<%<avka\*'ax!60a̙;>a rMa0'Ya6kaX :ya $a,!ao=a -la06' aH7\a8$ aoa9 b)b&tbE7-bdo;b1<Nb(0XbN$nb9pwb3b+1Xbx4b4bt>&bl"b4b$b,+b[& c%,c0f:T(c,D6c*<Sc'gc#0c rc%tc(#co:(cd)c/$ce+cx9c< 6dH!`!dn&6dM$Nd7(Xd`-ld(|d 0&TdLod%d(;,d`G;d+(d(`d0td"d[!<d:eD9T e01e(l.( f\*pfP&)fX0\8f`.8If4f;(TfEkbfX8,mfq{f+f'fhr0f| fqf$"@fTM5 f$(|fd*g;<gyk&g4 1g .l?g*HHg@H\gW?Htg*|g#g+xg&gT$ gt9hgȓ/g2g6g'tg1 hIk(%h<5h-(ChD!Vh&`dh0$wh# h=h:h(6h9iwl7l9'llH Ll.pl8$lj)4l.lpxkl!<m;mr#mr$ 8m% JmD!Vm'@dm '(vm6mq$0m2mN, m-Lm8&Pm4'mkm,+=nhCknP-$n8B+L2n)unk)0n(tn4"PnXrn-n2n+nk nN3nH6ol$o+l-o7,Do<[o8|so02,ox)oȜ(Doko(oP',o4&\ohkoJ.po" pH8pp&pL 1p-FprTOpĄ9lZp&rfp05sp)7\pm q8)9\q@W(h*qm+9ql3Fq8%Zq_4Ddq(tlq%PqtC'q=4qHy2XqUkq7qHY&q!8qؿ0 qP'  rH&r\#,&rl>&2rx+8*Ks %Ysl7Pisrqsh,H{s*sks+s5)sȰ*DsXCs-sP<#sdU <sRktH !h t,h3t:`@tR&dSt!ctont8outk~tlkth(Xt|g"Lt;t-t,t6tDkt Ok u`2tu-#u!04uo>u$UuIk(kup{uG1(uh&XuP7u|(u"uH-pup=utO'u\xku;LvFkv<;'vL)<9vJk(LvD/$_vH6'pvp vp0vNqv9pvrvЇkv8;v 8\v4,tv{2Lv<%8w7Dw-'wTk/w%=w+3LwH)UwXoawK$Dow70ywP3?wpowg*wP9*w6'`wd=Xwd"4w8w)0`wt'(xh6,x32x$*<Bx#SxPC@cx$7 vx8x 'xx.%xL@34x,xh++x(txrxH( y9| yG2 y,h'( yl ,0yX($@y0kJyoUy`6jy =lvy@(3Xy$9,,y'y8%y02Ly@O3y49y.=hz/<0ztX9 1z3Ez1SzY=ozLkvzX+Lz@O;4z/(z(z(*@z;dz :Dz 6z833xz;z 1{D~3{'D.{|<0>{(L{\;Y{H+<j{bqw{$0k{\$4{09{&r{r {.,,{@${C{(wk{2@{$.|TAk|,,4|&>|xL=xM|I1X|Gk$g|;t| (|\r|(1|o|$k:|B9|a08|03p|PGk|9t }&r} 6$}>,}4'D<}kpH}[?0\}o'8l}%d}C} Q2 }W-}9|}<}`{; }6~l,~p7~(*+~$H@~:4K~:,X~vk_~kl~8|:`x~3d~X*,~%@<~bq~X)h~\c#P~"d~p4~c#`~18D;d6'`(:#;d:|Kx%x_|%kp xxM;(46t+t7""9 4(3̺1@7L+$\"D%#l4 ?@t&lOu+ X$#pi kw4;\l2%,L"$(pȀ&rҀح1߀_6Ģ/#-9ddm2l3Lk D Q<,dh 6t(6&4 %X#r45t".΁;ln9d+,0k%$h; 1+78`%dF6J8[|.tjH2xl#XP:le82||C<64Ԃ0/1po- (t@OQ? Q0=a==y8: l7Ti1xmqT&rGk$ȇ&Ƀ%ڃ$P?'d1*0 p&L`!$'8};DGl2(Ug; c?;4ox9`y0 v(W(0k)9ÄCkԄ-8k0=4],D#p$ ,p( :pFX'#|Tv:`a|1TnDKk|* W<=k)D\2$΅P=*Dnql40r @k,8h+:k5o=,t1(M,!!0W(?70ft7y;3Qk%D<C K6Ȇ|K2Dֆؤ$x<pC$(7H(S5H)X%Ԣ&3lf8@=0AkHCa=`{>m)l$o%V LF<Ň7`ڇ`:ܶ7(C:8k(T$$" 6# OC[|3`h@O$Č.,(4+0*t<: KDt+lU<Ca0Ik(xH1H&UkQ*,;98ƌ*0ь1;*T,) (p 5$ "DX1@,|.7&EoO!|_Ё*(i8r5h2X 2`0!,Љ9xɍHoҍoލ84(6,1px;@ r!n258<?!"HSQkdl0qo 4 0:()7T2,=2tɎ%4׎C8.p-T8k4}%$0:`:6Nğ3p ] h/u90!0W$(:,@'(_78ukƏa1׏82p=T:p #0!$7T=$>Tu6h80 y-0h=k'\Nk#̐ hאĎkߐ8X8,@&~82>@!8o(j#6,8TCkUH)];,q(<38=*x&4'4Y%ёH ޑ9XqX5/k: 2,Hs!<C@5$ZLv.f0 wpt4T*+pP04N)8b(t.#Ւ-0| ;C-P$4,$0,7>oI <Vxh(XfCp<-$}d)H(x`>& D75:TD6ГT5֓\96@P3 T1$l 5T$',`3<CXkpT\?Hf7q3~8+L0k6 k3<(0 d8@k˔0y,0ߔ4k7p<8`'2$x'L)H1drC&3X_ȷ>h+u8XP* 2M'̙&Ǖ[)TΕ4$@וQqX8 zk?&̖-H?$1J*@S0*oA/x484o09d*&`!D–X%Ԗp \ܖ' ]*X |%ܵ> 8 4%-<~;1HZ8=$*4G&@T}(H/V1Tc'|npH6{2LZ'|X @%x9T38ƙtc-c*!6<#$X"/07t<P;+hM@-\m'|d$z:8)+(*xC6hoЇ hʚX<`m+, =\ 4%%8@5@AkAx|5<R3[kb"y+pl7,-L6)ś "՛+ݛ<'8\64v,@|!*{:(4&rDq6S<6fا/v2$r&pT#88Ŝ(380p7,6( l13Dt+,)3LQ? @kG\)TB2|`l%xh*4q`8P~l1pt$D%)34ȝ1<>5k"r @!609p:pM,CkV],j:s(8'$p*H="8*vkȞ:Ԟ|74܅:<d?:x84 cq'$" %`)L97 C4lCX $Z~kg8r.L}&r(d(D"t $;:ȟhk ֟@ 8'T (3 !( &3<:pG'ȫ%ӫX!83t\(xxHk$)%%r!:Ժ2Cr8P6a1n* z^2>$h3D+4Q? Ǭ8&rR50db*xP)D ;4T#5)141B+PO'4U1d/rl&<|%h| CW8@(xH7$S l(έ8 '֭09L 9:8\*4D4,L4k  +$,h:;HākP0<[9*fЦ+Pmr vl)~);00H8~6d/`d(Dծ0H!0 <{*dr;, k $T<9 1y5>0 O%aJ*\l4;y$172`lT5< +T+'4,į@3pϯ(tܯCC0`+ % :|&"#6$,DTȗ)$^kn3{,?+0p<|R9/o$ΰ0:ٰ6<>,L*T(#("*& 9b; G (LY*8h;y702<<1,HDZ)Աa9 h3n=#r8()<5;4Bx>4M'<S\6\;i:}ph*8( 6Ų((p̲/kزh<+% $@ ($<!.-PJkRhi$id)uL=0dQ7<8z6@8X5 ųp=$60pCk+M7ɽ9kٽLo2D3$@L69H6#25,|?L&TNR"Z9dV(Xt'T49k*((,&LǾȿ0վ`@+"pP+Hp!C` P58"$T5H&ب:5p8N(1p\P=r(g6h05x%%l$d)P7ʿLY5@ҿ/LڿV*l߿x9$hr64XEk44k$*|=&9Ȃ%XM"pf8Tv-|hq 1@&|`/kQ'|;D8P6 PG-hHw+ĕ.P|(,+pL(P4:3t,l48"0816p<!O+\T0i5 p-lD;(4:8Kk%$! +P$4,95k)ho2;pA*R7w"p,=#=H$ $L<#h1<@k#/$5"0E$:RH:k]X )@eL(t:} =t8*XT2p$!o(!lk 0,t,*D)1L6o@d%Sx$X`d"<t4){"&r[;t*D7'/\9TԠ+,": ,Tk r1-h; $0R f<h-@y*(<$<>,!XH:t8P*<d$XS'4",<}*h#$h7#hB:YD<j)XuqT20 ,x"T\ =7hq(Ek&,@(,lY-94e00zx+'h*!g7@w'#t L X78[?l%_260k FH#8\ĵ;h-r<*L)0#"@!8#=7_5/*, |#xh:,$19'`I!_hkf(ppz3$;xQk@# /%`e#kd'\,.T-&#(8NqH1<_ 7-<tr0:2 8 9@.th+y&O0&!$L#)8e6Rk",40ko!H+?. Wk5@`/B5+$P\U? \^0m"${: %W22"XL"@<60`x.*8E) 6# > ,q89H:P5ka%u8{"|;"/k*? m8PK<4:`r/kh'o'";6TM(U$Z8$e2s\EkDC|24-HL=DBظ+PhS50($=;Hc;lr&$Kk4|,G$t'TVL6$khvku(X~]9oho:8 m9/$(!@x%<:L@ 6 8kD8 &A706ԣ$PD&rPd4bH%iE(@zeq$-<& =lo%D@|8$)*4p"p|!)m1D56P? 6R5Y7$,c6zl]5 Qk <E?wk7*,D`*@p'<C8<6Ek"T&t;9|H&rZ6s1|.tĥ+`# N!d;H 77D!tO;45 [9\G74(!\&~!=l*$Kn$Hb69<nԃk0zh8)htCk$9k&|a:9l3ko ^!o8v.(u&$90%4o82(0kt6 k77p!5k+;$:l(7I`%4ZSkg\2zf0paqp*|Tk4)D;/X.$~kx686k"2<*Ĉ7D4d1@ x;T7bh,@p((K$17D%( k6hľ" %7xaq4G,t( =7 :Q7 #,8< & H9pQ8:`_+lk:{lqP? $8(4U( $Z;:-4z!s%p! G7 78&X)-v.47X7G|aqPv-i7d|T6h328+PP-p+!||4`&0)& %8+pwk7:C8LU(x5db9pnN3|pr1<. *Dh9Y6i'@4k60<*Tl8rm&@%8K,83*DoO(2`kh#s:L$X;k}1D60*;HP9pCkQ*@<_=l4,Uk;<9`E[6To_r9`ix8{"<2a)X'6/%T(L)&: C7 F-/P79PF'\ETi',QX!xe( p(&:8<9 4,86;`89dQ61dg3D2o:Q9FoS6[Ctt+ <C;90c*d1k184&`T*\%8n)x<S80*4|;,27t@Я7 ItrU(3xdD=+q(j.pKkX+ȸ,44k(P&tvk<&Qk 1T,(0l?*8:(*9H"-]lvkg,l)lv@&b'|- (dz8L#1` Jk(-,x+3T):,62pDP0P`kZ<8js8`vĖ+8&Vk+4x`6$>-tw, 8 P'6*$3-@t+H+3dX'b4D$Hp;p|#$v; ='#0k58D ',"!\#`r<l;.$ \6j)Bԇ6@R7,T]Xj"r,r{p|;LX0D8#7p-3(L!/x C@x6 .3!DkT/t'd=!QP(Z "j:~T5<[#o$7i'D($"rD4l2*8'H 9D7+1 <9%Jt3<ax5,r(54X20D>D2<)_34@;(448t-0hV5h14%(,7:CSU:(^P8Hvĩ91L0& 8$\$<$=+05kx9I u8\R*6Xcн&dqI41.*\1P-,|@k0[!  0 X$/H 6" 4,49,6!5\G03LVkaP4TrT3|}8T:`0Ck ;9T3:<w5S58 O8d71)8T{:]hqm^,B+x)&k"p"Ha!0ܟ%$ CL%0 T# C&w(,=&rMn4Zt\2@o> ~8Rq<,X)d#6<[*,b=P :`E( $-D /('L |o-;x;@ 8C<r@Vr*a;Tsh'0H',l2Mk\2p&p 0>06t6E'81' h8$-pE0(pM 8 T<@24_>!g5dt0%280&r)tD%45?DR5&zkTV;4_:k ܣ)P,/L9S:PG$8' Vd#TkP*Dt#1M0t3x7p("'788z&  J  ؁k 8`5 hy8K t1b 0!Dj l)0q <*% L.0 І& 4<$ H*4 k [% 0%9 2 K$ t.X <%L) 83 |3D ;;LR j98[  xki 'x C} ;X 7k wk 6H T%\ \7x Q6 pG- F&P Ŀ$l D08 $7'd, t//X=  |F kO Fk] G2f &xl $ y L7H ]%p L. 5k h.'0 " &r 3H 0m+ wk 3" ,; X6' H \;4] x1k {:(t T;< \7-H + \( (D)< P$ Ĵ2P / -, )D ,]) @74( e35 lCkD #0S XE(a %Hq ! $X 9k t (   > ^%4 r Ek o` X=98$,:<7kD%Utod@ $tp+{5d P>9j'hH4DL04k!f8X *t  *@k!LKk$)@k7E??: Lh(S/! ]_:q 0`!@C'T|*@8`60%4tP? :P47$P0P6'$,+D.2'\@x=pP=p`: n7080kL"4H;8̹1ԍ%E4X6;\(r%A4Sd7)Z؎kd4.tL%(#8 9kpG60E.,+86$P$:&1H/+v'`8,;<O37b-Xn(#{P;63p$=|v: P+*D'@'!D ,o+`1:<5HIز+XXN&mN z4#0xZ##%pD+<k: *8$  q+`L7 9p* #=C;|R5T_ksrP2pHk$kD40&$tC6"XtH!D: H3p('%*T0Ik(G M7Op*0Z%LiD+t0oh}-0pho`zkK:(p!;p9p86$ *C, Ok<4@k4<2@<8p8t(0 *,(4%;46X*6C289`n,d4(>|j2\T(+Paoh#zX8-8p+|5X::4L#l 6 6\2D(d(1M pB9DP-H_@;hm+xxk=qo:d298E613!L   pD4p/pT7.'8=$G@E%U~kg7.su% z<"/["P: @42,k$:9pLk"@98 %09l*<F4Q? R2\0 m,E8|wМ)HC(0wkd"pt<Կ0Y(p$HY8@`:#T5*/8(lG0 SB-h-pL '($ $34%,:8t%H-; L8<3|$/X5.pH$!XX.3hl0m)y 7$ w:pt'|&|r9 P? 48 ,$H+L\;('T "<$A%05Dl:xAX;tU1@j:0~6.d~,94`B!td 2W6$a< 7`d.H%~k#l66#:GJ3(X/dD/kn",9| <*h&$d<|$:10 % ,t $6  L&0 H ?% 4x!5 X.!lD ;U 0:`a hF)8g $$r ȱ4 2  % ;\ h6 O(@ ' o 7*l !܅!!#%!Y#8!2B!&XM!rZ!,#k!{#`!}%!\9!o!Z%`!4Y,!-d!(7p!1"*"$$""4<+H4""?"x*\K"> R"%,a"9`p"6y"$0," "=p"k"4 <"1"t*"|5#L"`;"h(`#Ԩ/#+'%#t*0#%@<#5I#",T#LEkd#԰6t#10#`D1\#*#<'# :l#(2#X&#r#d3$#U5#'X$ 6$82%$090$7B$'(N$H @ f$00$s$'$Px-4$l=)$86$/H$d.$%p$K: $7 %w7<%8| %x:(+%k(|9%ox?%p9I%61 T%4?[%eqi%x$v%H"%:%Z2L%<$`%8%J,% (8%h#& (&J2&&%@5&;XH&1Q&*`&V68o&47&O)&X3#$&7t&"&=&/,&c;0&8 *&T>&W ':%'l[98'e3 F'TEkN'4~9@a'D%\}''t';'0')D'4'\'Qk'/T'w('9' '6(3(0  (N*x1()3XG(7x\(*!xn(u2D('(8v%4(6,(X5(T((`#H(76(L%(^7|(@B7)1 ) $l)r))؍19)*G)';TT)k])X 8l)'Xt)X=)> )@&8)h7)(200)`"<)+h!S+T:"te+7tu+L3|+:+XM6H+"T+ 6+:p+H9+k+$ +4 9,0-,X)>4,ȏ&&,f9`6,+7>,(K,![,;m,94,D%<,,:,ln2,43?,&r,(o,%,860-9,L-8t2-3 ?-%P-$rW-`K38g-`9u-@(.-o-$R(l-z%t-o+-p-3-(*-0=:(-4?-6-0|70Dq00\0|:1I:1r8$"1I301l1H1@8pW1E'8f1!8o1,~kz1<7D1*D1#101XAk1& 222l 3)|+37;3s'PK3h6T3Xk^3dX8|j3;%4x3Vk3L(3x7l3Q#3X0"3;3)3,9l4 !4lN h(4#@?4(kU40h45,y4A.48[)044k4l8,4%4wk4Ck4T%843$H49-h 5,8 5375~.xH5"\5D:kf5L8lr5 1565J45885ij+P5d$)5&'5`#t5\Z!5J3l 6*`6w%6#d*6;<6&/P6%b6"p6|26\'6N:6 66Y9|6(6/676,6 e#L7: 7$9*7Wk37`w)=7ܺ;XK7?@[7$k709d~7G(7` 377t74(7k*7l8X7Mk7-8X%8i! 8xk18DM;>8H'H8P |Y8DG:`a8)m87898*8Pwk8{;D8U508r*898d$8,X8x1 9.l!9PS5 '9:0193@97pG9HkP9kW9D'3t9k'09O? 9+h9`09% 98 95`989L_3:lq:%h:051:x'=:|kD:%TS:4N? _:<:(j:4 x:9'x:"2L:':9x:8$:,r:,:ܳ>: 18:/8;T1;t;`.);9p0;P%\E;, ),L;-<_;*t;N";(<\9<>@7*l%>h#83>hC:>(41dC><6' S>m*^>ܱ7m>1<>5>%>;(>3,>30>,d>k>=><_7>S5>4*(?lyk?d3?D&$$?07<*?;d@?`q7H?Uk a?\M4Xs?4rL|?(?d`,l?7d?6?$ ?M!L?0'6?*D?ē8T@t 3<@D?)\%@ C/@Z?$A@̓:M@1S@g$^@ ,j@Ts3v@+<@4(!@)&$@ ( @@?@,-;@82t@p,@4&d@*? @ FkAEkA,E:X$Ak.A 38QAx04aA0?-8sA//\A# XA9kA8TA3pA2AX:8ACAz!$B)7(B,(@B>8.B7D8B4r4IBHkOBo`BD-iB,:`uB8@B-`B)tBq!B,B`9pB:BH 6B* BdI;PCC; CM?x&C$9C"dPCl8([C9"nCH(<xC7CoCd!6C%CT<C/Cܥ5C-|C%\ DH!D4)D8'0,DX$:DkRD8TbD6vD4(D\1dD4kD=DT6DoD!XD4ET&E!EU-E3E-3 Fw2DFr'F!>FVkZFD+hF&F#F ,Fp9HF^5F&F7 FoF\#!0Ft-pG*7G4(G4J!3GH:d=G}%EG"[G?; iG3|G?dG60G03%Gj7Gp6G&3LG,HG6(Gc6, H:H,6-Ho;Hf$HEH;,OHDAk\H8dwH,d7HHp..H&H!H=dH =HX9:`H;8H:<H9 I\*I PIPe8/I`$>I!=PI<fI6tIHKkIz&I,1DI 4Q2QTz1(Q *PRo R +8Rm(H0Rl)=R(6IRl1RRPq$0lR #HR%R <R;R!,RȠ& RtS&R$pRoR S(;SHA+#S{%0-Sy(9SĄ%ES1@TSd&eS* mS $p}SX4XS_4S(g: S"lS6pS( pS2 S;S<&1T.TDP"<$T!$7T6;DT x,$[T@/eT((nT +zTp'T< Tp%TTإ6T82PTP%8T5T,10T.L[,6|][Vkl[u2[=k[ī-[T<[d:*[@o9D[ k[(8[Д/\/p\'0\P'60\3lE\'lS\6`d\48$x\Q6D\O0\5$0\0C\;`\Ĕ;\l-9L\+\ ,\9t\6<]T8p] >&]-E]oO] ]]N4Tg])v]ܵ']k]8:T],%]P 6]@k]p](=L]Hk*^l-0^+D'^<8|8^>k|V^4k]^H$ l^"l~^G)|^*?^Lk^",^`(2H^(`^o^8#0^; _'_h8'_2'._ 7_6<E_$K_=d_p4Xu_P? _'9_xm,,_t{8x_(-_T9\_3p_Ȃ6@`n;`iq`,+ %`x 65`<>F`)O`?<a`x!9dn`T*@`p%`6p`!:`3,`o)d`t&|`%H`*`_9|`:?`:XaD% a`oaHEk(aDk1a =a5;Na3\a>ga9pnaouam(~ad:a8 a2@at,a6%ah+a1a1(bvk8 b'$bHt%(bS&Db5TbDk`b(kbd,bX ?bX-<bH,0b`fqb0 -b3,Lb2b|#b+> c8%ciPP? Ji`oPi,Ldi&0ui@-$0iRkiج4 i` 6i6i)<id%piL;diykix7i*|jM3jo*j&r=j0EkVjl%hj4ryj|$(j|(8jD< j@&j3-jt7&j4kjL<jh9k3%k/k 2k@+<|FkX;(Rk 7,akl$xukC}kLqkH.k58kĊ k8:kl4hkP%,kxaqk+Pk 3)l %l 4&lx835l6@?lCIlTkRlXIk(olIJ,l+?l<lP 6l*8lؖ*l)lD$HlT lhJ#mlwkm +|'m'5m@kCmP#XmXm, qm.(ym Tmwkm,%m2>mq*mP<8m6\mP$Lmc6`n/k n)&H n@*98/n($CnA;OnH90Ynx,0tnh)`~n0knL<9n9nt/n( / n`vknd=Lneqn+PnD7tn8,o7o'1oX&<%o 3oCj6o<:NoP*Yo,"xko?+,xoD&Hoe3uX$u8vH)v(2vl%d0v,-Ev%dNv=7@^v@V*gvx:<qvX5wvt=4v:(v,'v(ovH&vؤ*v -TvT!vܷ!|v-| w@(w7 w\;%d9w0EwG.Vw0p`w,7qw7w9pw)w:xw̵>wr wHR5Hw6pw)wxC6w?w*<xc8@xrxa2\/xRq =x'6$BxT @<Vxk_xXkhx4 D{xq+>x8(txX;9txrx%'x%Px$C/Xx@*(xH:x%Ty9yT#3ytH)dCyloLy0Vyd8Hfyl4pry<)0{yt$y;yl>yt@'yZ3 yh7hy6y3py| 6yz4y@-z4k  zp6zr4,#z'd0zp"\>zLp3Fz`h8Tzo+ ez\)pzP3$PzdEkz\y*(z]%z&rzxqzQkz*@zH;TzA;P{ ,P{(<!{65{|)7lJ{5( Q{1<_{1pi{P2 |{6{Lc#{)8{o$0{6l{Ck{|<'TH|\8"\|Dke| 6v|r|a6|Nk |2|$|&r|\$$|dK$|< x }4<}0+}Q? ?}6lL}@!]}x *z}7}}8p}+L}:}|.8}-}*%4 ~# ~M2)~9p6~\5F~x-_~,%(q~|w!~l;L~H) ~'~0'`~%3l~+@~P-d~l2l~$hk<+,#T+ 5:A,S  pc~k~,a/%0!ȹ;7@`+86L#Ԋkn8(`*5@:\JH)PU+_'xo$h4%@`9p9(Ā& π<`߀&<@x& 'd"h!<(6$289"C*PM'W|'4c"rX!c(<,%L0#kÁw6$؁`Ek6pl/0H!D 428V$0Y1C0L OL&_lkxq$3}i(x .,-&"Dɂ-߂T'$\&@k$'` (4#,*a2Gd+` O*Ztkh|80x4Lp.)(7t8rǃl' ΃:Lhi9@L10 ,Ak("'l3r;LkI 0W&$`Pe<(p(>vb9`H-4_)h0/8:@ʄH9ׄT>m*D!` pNk  4/k&k9 A27IL%0Y'j9u.L0/ (;;ȅ<,L};D,8Sk$%k;1`7HrY4teSkoQk\2d:?(c/LCQH,b/p=z@:87dȵ*<`&7 ?%̇d4ڇ)ĩ"k$. |P%0"6+96`qA oG$5`UX>:b `9xn<!|(4kH(\\$`H$1l8.4ˈ<<܈rf3t/.4=*d t-0"C== Ld< eH6: pB,xC+(@;-.tk͉%߉58h ,`o Xe#:#&(4$'xECkX Ph[,|},W*#h,F; X@74k'Ίė*ي1%$*77`!:p.H&;\X2T1|d5|0%5*4: x2,ȋO$ԋ$:݋@ ?{kl(,(tB*'d}%2 8H-MpY|8f9 tH=@?*(̴#5Ю#6͌*/`5>X($#k+,<*LF'V-Po"T}`aq rD8p`'(&O:͍(Tk׍t9lE*+; `9H(%(/w:A0Lxe<_%rX<x}'%t !@>9̎/.׎(Tߎ`%,M$$)(4 k8[*E4U8V4G#4l*0{d =,D5>Vk%X)ď)я8/k ۏ=k%,&1D8P0T%Kk.*|9Do*D(oO !X^2Tm-y&  27``5 ll'X($C9L;ΐ(84֐Ckh<|20; dy:d-D,E"U7 \hs.Xf1;tK.C(ط>,6 p&C 6<͑*ב $7<$9\d%l(L"` D30w;(?<30Ud;p^*lk'xk@+8'06HW;T1pʒ.`ג+>X!ĉkl27U6#.0)>\Y3HD?0Vܕ*cx9 qݕ8$Dpo8$l'|*`f:t :(@95LkD8T~8 d<0n,4()k)l4Qk-'$*xƖ%|Ӗ#ޖ "R245p$ $+2(B:TO6]t6l&|8E?T-;0:Hd:\T>8`ɗ6җkڗ|k ?9: CkT%*>EkN|)<V:pa r l? 5k8o,;(Vk(+јC<d+oW%5%5831@:k$K%YH*x`oj%}9|]7`8tp3|oʙ@66@[.X0` 4#8'/_=?Q? R*4^)mo8zrd) N7lT?2,l+`&0˝,7`՝1ޝ,#T&\N*x0+$#9J"M98Waq`| j@$ t1~'= 1< + 0Þ68k C880SS$g!rv,k;4'300!pʣ$kԣ3%HJk(@Gk!9k@,<'\=lEk4IpYH*d2C oXkw-|U:J$#Ȥ"֤Qk|Gk$T)d&,Z?`,$ 7HT$J4Nk$UvCk)Th8:`$24.'49`ʪT"ߪ7H+v7;+8-|%t%8@!;0D5`Ol+9@\ȋ*i|47{ r `(C4d0,ī(v*Ϋ<\hf'r$$868,;p1400h̴*Dȭ8(pЭ'|ݭ\7@T965 XO(|# %.X!L@,p]3ph8~3X B-5: Oq Įkή 6T~k0$xkQk)Ā8D,&@PhW9<cD78lCk}0P'pkP8($t +L ʯ*د0kk'= 0;H& Ek6؅*p@%P|1`5km8kv@C k V1t%6ʰVkL3pQk2 "<8!4805)@7DWDX6d4oP/xz( p8'@@//4$б$ݱ(8`f8@H1* 858b78)/:x4pD68S ;Xb7Lr2d+X 8T93$*x^2̲ -p0,ܒk  ;h-'E,4l*=x;kG0=le,{\% 'tƳ!׳.}ppHzkFkH3ȣ)Y) )C5@98@x5N|>&^`-Dkf( u:k'! !-t:4L$0H1ɴX3Pش+p*D('L}% 0;#$G*0/C : F GPK.`W$@b=9lp)0{%X-hP <864tҵ@+6-h4*+@ rL616p;+J F [`5Pj8-4}dvkP 'X :7Dp&röOq ۶@%`/ #0.@`!/x".%,@,=(@E1aSkmЈ,<E:H.xp. dH4 \9LϷ$8k(;l8\,5%/2$:Dld(XVV?$o`6.xh&*Tk0 TXQ;TVk0Fk͸,4`8k'4h`5($0P0`9C(GT2\V4okx%s!#10&\$\K$\#x(ɹ7pչo(>" P+X `]5 &p"* /q9 <В!J:[;7m'H|$'p(:0 e)@P$(5dϺ;;4%@L"LT]6'D,0=F6N49[P9,eU+u%DQk4`)xL6P-L<+λrdT=,430&$l,<;(7h%:AH6]'k|'<t1l:4\+l *J(ʼ\;hؼ$8rDyk8L (U3D  .6lo ?X=M|9a7vZ-_; d0(:-ɽ>ӽdol$: d'` )!-$-'$568hE0HW ,4mPk;H0Ȏk (( #X"׾&HĞ),І%d1D > j=D;68HH5R$@fм!{Xo743$(Vk@~ktU(4Ϳv'`ۿ#$z3hdx&d |$J?&t@ ; 00ZQkml${Db:(O(*$#_6D1(w&# 9" (8*12%@ I؛)UT-Xf&tlD"*w?)DJ;hc8D'H77Dw*d |CL;00T3(X $h|R#(7050)lPCg'sr:` a:pt,9t7)5, 1|!x:9t 6 ?) zk%:324AOq<M (X 0k4uks3 @$6t=3Tk x"*@$t;p%)Q'  <h22<C0kswap_onwi_set_nwkeyucom_unlockpfslowtimonanouptimebuf_rb_bufs_RB_REMOVErandomreadehci_device_ctrl_closeem_set_mac_typeaxe_tickre_disable_hw_imuaddr_bestfit_functionslongjmpwi_usb_rx_list_initproc_freesr_crypto_discipline_initkdb_trapvfs_allocate_syncvnodetc_setclockuhci_pci_attacharpresolvechrtoblktblsw_reg_strategysys_minheritieee80211_tree_RB_NFINDputcharural_update_promiscuvmfault_unlockmapschild_returnsmsc_cartlabel_unrefHMAC_SHA1_Updatesmsc_startuvm_map_inituvscom_attachipsec_soft_first_usenkmempagesuhci_device_isoc_donecopyinstraue_miibus_readregieee80211_send_group_msg1sys_getgidieee80211_tkip_micdofilewritevwi_inquire_usbuftdi_matchdumpmagieee80211_derive_ptkttyflushsys_setsockoptsys_ppollcomdefaultrateclock_gettimeieee80211_watchdogwihap_sta_disassocdefrouter_lookupinetswbwi_rate2modtypewi_get_fid_usbwdog_periodcdce_rxeofip_reassrt_maskedcopyin6addr_anyVOP_ACCESSusbd_get_quirksem_k1_gig_workaround_hvip6_get_prevhdrscheduler_startdb_logpciide_triones_productspmap_alias_bitsuvm_maxkaddrehci_pci_cansphy_cdumass_io_putral_pci_detachicsphy_resetieee80211_getmgmtrlphyattachipmforwardingmainbusprintohci_waitintrumsm_attachsys_closeusbd_do_request_flagsbwi_mac_attachrt2560_set_rxantennartflushclone1ffs_inode_allocdes_encrypt2sys_setsidbwi_rf_calc_nrssi_slope_11gieee80211_encap__ashldi3artisea_chip_mapvn_statunp_detachsiop_scriptnd6_nud_hintether_ip6multicast_minumodem_breakusbd_submatchtcp_secretrti_find__mainbwi_rf_lo_writeaue_stopufs_quota_deletehardclocksd_vpd_thinenc_xform_aes_ctrieee80211_eapol_timeoutsr_raid5_discipline_initsr_rebuild_threadrt2560_wakeup_expirewi_read_data_iowdc_reset_channelrt2661_get_rssiumodem_set_comm_featurein6_domifdetachieee80211_get_authvtagssiop_pci_attachmtx_enter_trysmsc_sethwcsumwskbd_cndetachdb_get_variablecd9660_vgethotplug_get_eventpcaled_caieee80211_inputcrypto_dispatchsr_discipline_shutdowngeneric_armv4_bs_wm_2if_group_routechangesys_fstatatnd6_timer_workohci_device_intr_closebrgphy_disable_early_dacurl_csr_read_2dest6_inputgsignalacphy_cart2560_suspendehci_pci_matchipport_firstautoehci_strbwi_mac_set_tpctl_11bgmii_mediachgwi_txeofaue_devsipsendredirectsbpf_setifem_encapunp_internalizetk_rawcc__wdstartscsi_xs_sync_donefc_lfcemptyvfs_export_lookuprt2860_set_ledsrt2661_wakeupif_cloners_countifnetyieldohci_endpdm_freemwsmuxattachuhid_seltrue_filtopsuaddr_free_rbtree_RB_NEXTfilt_seltruesc_print_addrlogcomspeedsmsc_tick_taskvn_writechkin_ifscrubral_pci_caarmv4_tlb_flushIuvm_pmr_freepageqpdevnames_sizemichael_updateumsm_umass_changemodescsi_mode_select_bigroute_dstsingle_thread_clearinit_execsr_schedule_wuuvm_pmr_size_RB_NEXTuvm_addr_alignieee80211_send_4way_msg4wskbd_cdnamecache_rb_cache_RB_FINDbcmpgeneric_bs_r_1ieee80211_node_detachdb_set_breakpointsnd6_dad_startexec_maxhdrszuhci_device_ctrl_donedb_force_whitespaceSHA512Initieee80211_ifattachmmmmapieee80211_clean_nodesbwi_memobj_write_2setjmpsd_read_cap_16prefetch_abort_handler_addresswdc_disable_intraes_ctr_reinitbio_inforicohrtc_clock_readrt2560_get_rfpdc203xx_dma_finishpci_subclass_communicationsurlphy_funcsuvm_deviceopsuvm_addr_align_backlogread_filtopsre_ifmedia_stsvndxfer_poolcpu_info_primarytcp6_mtudisc_callbackcopyoutstratu_caieee80211_countrycode2regdomainusb_transfer_completelxtphy_servicepciide_unmapregs_compatuaddr_stack_brk_selectswcr_newsessiontcp_attachla_hold_totalwskbd_cngetcbuf_dirtysoo_writesystempageieee80211_align_mbufm_zeropdc20262_dma_startural_alloc_tx_listnd6_llinfo_timervn_fsizechkunp_gcingreaddoslabelbwi_rf_init_hw_nrssi_tablebdevswcalctsruumodem_matchbaddynamicportsworkq_initohci_root_ctrl_closeX_db_line_at_pcural_ack_rateuvm_mk_pclusterbswap16domainnameehci_endpduvm_pmr_addr_RB_REMOVElockinitwsmouse_detachttywrite_filtopswi_usb_devsnd6_ns_outputbpfkqfiltersorwakeupre_ifmedia_updinflateCopyttyunblocksr_meta_opt_loadbioclosehidms_disableremovedeudav_miibus_statchgigmp_timers_are_runninguvm_deallocatefilt_procattachufs_quota_free_inode2filt_procdetachsys___thrwakeup__divdi3pciaddr_resource_reserve_disabledi80321_io_bs_allocallowpowerdownsys_clock_settimesiop_led_offural_txeofwdc_floating_busuvisor_calocnameshidkbd_bell_fndisk_busydb_breakpoint_allochidkbd_belltcp_pulloutofbandevcount_sysctlsqphy_statussddetacharprequesttfork_child_returnsiginituipaq_cdpci_mapreg_mapsr_wu_enqueue_ccbuhci_device_isoc_abortpool_set_constraintsusb_task_thread_procip_sysctluhidev_closemsdosfs_vptofhscsi_mode_sense_bigusbd_clear_endpoint_stalldb_vnode_print_cmdums_casetdisklabelbio_registerdeflateknote_removesii3112_drv_probepmap_bootstrap_pv_page_allocbufq_nscan_createsr_hotspare_rebuilduvm_mapent_addr_insertroutedomainhid_locateicmp6_errorVOP_MKDIRpool_large_freeip_protoxsys_settimeofdayi80321_sdram_boundssdstrategyaddlogehci_sync_hcuvm_page_physgetrt2560_bbp_readmsdosfs_synccheckdisklabelscsi_mode_senseip_savecontrolstackgap_randomvm_map_unlock_lnffs_clrblockusbd_set_hub_featurepdc202xx_chip_mapuvm_addr_linsearchbpf_filterchgproccntip_drainieee80211_tree_RB_PREVdb_map_print_cmdumass_init_shuttlesoqremquepci_class__adddi3uvm_map_inheritsys_getthridcd9660_syncem_enable_hw_vlansbrgphy_reset_bnxin6_ifawithscopebuf_page_offsetumodem_set_line_stateuvm_pmemrange_addr_cmpkm_freeusbd_is_dyingsync_printvnopsem_lv_phy_workarounds_ich8lanieee80211_rssadapt_inputsys_lchownmsdosfs_removecd9660_readdb_read_tokenem_attach_miibusieee80211_regdomain_compare_rnfilt_timerdetachwi_get_idzeroin_addrbmtphy_cdehci_device_bulk_closewdc_set_driveuvm_map_protectusbd_get_xfer_statusuvm_map_setup_mdre_encapprintfehci_alloc_sqtd_chaincdce_devsrandomwriteuhci_device_intr_methodsprelist_updatehmac_ipad_buffercrypto_drivers_numsmsc_miibus_readregip6_protoxsys_recvfromswcr_freesessionttrstrtwskbd_mux_openrandombwi_txeof_statusif_getsysctl_doprockcopysiop_modechangeext2fs_initrtfreesingle_thread_checkre_pci_detachrt2661_node_freecuio_getptrcd9660_linkhostnamelenupl_cdusb_needs_reattachdeflateTuneuaddr_hint_selectem_flowstatusxscale_cache_purgeID_rngttyopenuplcom_rtsraw_ctlinputwi_usb_ctl_unlockbwi_rxeof32nd6_ioctlsched_chooseprocphyslockspec_setattraxe_miibus_statchgpte_l1_s_protousbd_get_stringfill_prlistipsec_exp_allocationsHMAC_SHA256_Finalbpfcloseusbd_probe_and_attachsys_writevsys_setpriorityumodem_set_line_codingm_tag_prependE_abs_script_sched_slot0_Usedaxe_cmdurl_unlock_miiumass_detachusbd_free_iface_dataip_defttlwi_usb_attachurl_rx_list_initusb_schedsoftintrarpintrkqueue_registerpciaddr_resource_managecred0in_delmultirt3090_rf_setupuvm_forkdisk_lookupuhci_device_intr_abortuid_findumass_activatend6_rtrequestuplcom_cduvm_km_suballocusb_delay_msucomparamif_getgroupattribsbpfdetachsys_closefromumodem_closeehci_devdttydefcharssigexitscsi_link_openhidirtypagesrt2560_reset_tx_ringin6mask128rt3090_rf_wakeupbus_space_read_raw_multi_4uvm_amap_poolin_pcballocVOP_LOOKUPsr_raid5_regeneratesr_meta_readbrgphy_loopdb_shift_exprphysical_startbs_notimpl_bs_c_8ifa_delpcred_poolenqueue_randomnessexphyattachusbd_set_idleserverworks_pci_intrieee80211_find_node_for_beaconemul_nativeaxe_txeofwskbd_inputre_miibus_statchgobio_matchacphy_cdcrypto_getfeatbwi_memobj_write_4bwi_phy_config_agcwsmux_attach_sccpu_do_powersavebwi_free_rx_ring32aue_rx_list_initi80321_bs_vaddruvm_km_pagesufs_quota_alloc_inode2ieee80211_name2countrycodemicrouptimesr_validate_ioaes_xts_decryptsocket_poolsr_raid_recreate_wupgrphashsys_setpgidpciide_jmb_caprofhzAES_GMAC_Updatesr_meta_init_completentp_update_secondcache_enterdb_watch_tablei80321intc_attachedexec_elf32_makecmdsusb_rem_wait_taskext2fs_bufatoffsys_setlogininitarmamap_listdb_trapip6_maxifprefixesieee80211_node_cache_timeoutthecustcp_do_rfc3390ieee80211_req2nodesys_setresuidsvwsata_dmactl_readcrypto_kinvokern_deletesd_get_parmsiskmemdevstat_rush_requestsrt3090_filter_calibwi_watchdogatu_start_scanipsec_def_compfc_lmdistancench_poolphtree_RB_REMOVEsomaxconnural_readugl_initscsi_xs_get_doneatu_external_firmwareipsec_exp_timeoutip_directedbcastbwi_free_rx_ring64i80321_pci_decompose_tag_bus_dmamap_loaduvm_pmr_pg_to_memtypeuihashtblieee80211_node_getrssitaskq_sysumct_activateticks_per_secondsd_buf_doneieee80211_get_rtsamap_initffs_flushfilesubsa_baudrateiq80321_pci_intr_establishicmp_sysctlsys_lseekdes3_decryptllinfo_arpmsdosfs_pollpci_lookup_quirkdatamsdosfs_accessaddupc_intrdvd_read_bcaamphy_servicevm_map_lock_read_lnwsevent_finiip6stathotplugread_filtopsuplcom_set_line_statehidms_enablewsmux_set_layoutuvm_pageboot_allocconfig_pendingmii_phy_updatesys___thrsleepi80321_i2c_matchbwi_mac_dummy_xmitether_crc32_lepiix3_4_setup_channeluvscom_set_crtsctsaue_csr_write_1ugenread_isoc_filtopsipipstatsecureleveluftdi_cadb_consoleurl_matcharpt_keepsavectxdb_printsymums_disablepte_l2_l_cache_mode_ptbinuptimedogetrusagesys_seteuidhidms_attachuao_shrink_hashugl_rx_list_initwskbdpolluvm_map_checkprotmax_protohdratu_tx_list_initcdce_activatedes_is_weak_keyohci_pci_matchural_rf_writedb_access_irq_spieee80211_add_qos_capabilityieee80211_cipher_keylenumass_scsi_attachsr_raid1_discipline_initrandomkqfilterbufpagesuipaq_attachusbrev_strpciaddr_resource_allocateiic_execsleep_setup_signalrlphy_cdprocess_newsys_keventcopyargsarc4_reinitsr_chunk_in_useuhci_device_bulk_methodsrt2560_attachwd_standbymi_switchcd9660_statfssysctl_sensorssr_scsi_wu_puttsleepkern_sysctlbwi_dma_mbuf_creatend6_delayin_pcbinitsys_fchmodatsqphymatchbs_notimpl_bs_rm_4nmbclust_updatehw_prodfdremoveigmp_fasttimoatomic_setbits_intehci_device_ctrl_startuserconf_cmdbufwi_get_pmumass_bbb_statedb_print_loc_and_instohci_device_ctrl_abortsvwsata_dmacmd_readrt2560_updateslotpiix_setup_idetim_timingsrt_mpath_matchgateubsa_stopbitscdce_startrt2661_reset_rx_ringusbd_port_disown_to_1_1uvm_map_entry_poolcrgetuhci_activateunp_bindtcp_delackuhci_device_isoc_closecsignalreaddisklabelvm_map_unbusy_lndb_print_cmdusbd_clear_endpoint_stall_asyncvirtual_availbs_notimpl_bs_rr_2tcpstatuvscom_readstatdma_constraintdb_break_tableuvm_anon_pooli80321_softcicmp6_mtudisc_timeoutfillmapentrytcp_timer_persistsata_chip_mapugl_intrcpufunc_ifarudav_newbufsys_umaskuhci_pci_attach_deferredpci_subclass_i2o_tr_flush_blockpow2dividesyn_cache_reaperfilt_fileattachsysentieee80211_find_rxnodecpuset_addpmap_alloc_specialsbs_notimpl_bs_r_8tcp_setpersistrt2860_drain_stats_fifoufs_ihashlookupubsa_intrscsi_inquire_vpdsii3114_mapchanicmp_rediracceptmemmoveugen_set_interfaceusbd_get_hub_statusworkq_create_threaddb_boot_halt_cmdural_attachip_outputbwi_init_rx_ring64bwi_bbp_attachbpf_mtapnkmempages_maxfindblknamekue_rx_list_initpool_inituvn_referencebwi_pci_detachuvm_pmr_addr_RB_PREVbpfreadbio_errorpool_putm_copym2sr_raid5_addiobuf_alloc_pagessysctl_structbufqs_stopuhci_poll_hubaxe_ifmedia_stssysctl_rdstringuvn_attachlasttimesr_wu_putehci_freexcryptoclosesysctl_disklockcnkqfilterrt2860_alloc_tx_pooldesiredvnodesbs_notimpl_bs_r_2ufs_pollsr_raid5_writepmap_map_sectionmsdosfs_readlinkpmap_devmap_bootstrapdes1_encryptieee80211_decryptusbd_get_device_statusbwi_rf_init_sw_nrssi_tablenchinitexec_mapdb_qualifysnprintfcomcngetciicbus_printext2fs_readlinkether_ioctlumass_bbb_transfertqphy_servicebwi_free_txstats32ip6_forwardingsr_shutdownural_cdkue_resetarp_allocated_bus_dmamap_load_mbufbwi_plcp_headerwdc_print_capswi_watchdog_usbifindex2ifnetcd9660_ioctlem_initrt_mpath_conflictin_pcbnotifyalluvm_pglistallocsyn_cache_addpool_large_free_niohci_device_ctrl_transferbuf_kva_enduvm_map_splitentryvm_map_lock_lnincoreurlphy_cdhzdcphy_mii_phy_autodefrouter_resetcd9660_ihashinsbwi_dma_allocrt2860_newassocrt2560_bbp_initsiop_script_writesched_exitcheckaliascue_activatettyretypestartuphook_listrt2860_detachre_tx_list_initpte_l1_s_cache_modeuvm_pmr_remove_addruaddr_pivot_poolkue_detachrt_timer_queue_changelf_initwi_ioctl_usbcpu_attachbwi_set_addr_filterwdc_preata_drivemii_phy_matchrt2560_eeprom_readural_amrr_timeoutzlibVersionsdclosevop_generic_kqfilterpffasttimoinitsiginfosys_getuiddb_set_cmdcomconsunitcpuidsexec_setup_stackobio_bs_vaddruao_createdb_free_watchpointssensor_detachbwi_led_blink_endifaddr_items_RB_INSERT_COLORbuf_mapbrgphy_adc_bugaue_lock_miiidentify_arm_cpuffs_realloccguplcom_set_crtsctsrt2860_initwskbd_load_keymapxscale_cache_cleanD_rngm_clpoolcd9660_bufatoffugenintrgroupmemberuvmspace_initrt2661_ioctlscsi_plug_detachether_sprintfatu_calculate_paddingfintek_refreshmsdosfs_unlockselwaitpmap_init_l1icmp6_mtudisc_callbacksnd6_slowtimosys_forkbufq_implsip_setmoptionsuvscom_reset__qdivrempmap_deadproc_cache_stateifaddr_items_RB_PREVpiix_setup_sidetim_timingsumct_matchspec_openi80321_io_bs_vaddrpmap_vac_me_kpmapmld6_checktimerswcr_sessionsfilt_bpfreaddb_watchpoint_freesr_disk_attachehci_alloc_sqhuvm_fault_wireusbd_abort_pipekernelstackicmp6_mtudisc_timeout_qcrypto_initem_k1_workaround_lvpci_resumevm_nphyssegifaddr_items_RB_NFINDip6_randomiduvm_pseg_initproc_filtopself32_os_pt_notewdc_print_current_modesSHA512Transformfiledescopensys_vforkpmap_vac_me_usercomcnspeeduvm_pager_initcpufuncswinChkNamebwi_regwin_is_enableddvd_read_copyrightieee80211_recv_4way_msg1bio_delegate_ioctlrt3090_set_rx_antennauvm_pmr_addr_RB_MINMAXdb_history_prevem_read_pcie_cap_regbwi_rf_clear_stateem_setup_receive_structuressys_mkdiruao_reference_lockedcom_resumepmap_devmap_tableufs_fhtovpcrypto_donewskbd_translatedumppcbbwi_rf_set_nrssi_ofs_11grttrashtargetpagesohci_root_ctrl_abortmblowatgetnewvnodert2661_amrr_node_free_allufs_inactivepciide_natsemi_productskue_load_fwnd6_mmaxtriessingle_thread_waitsiop_intrsys_socketuhci_detachuhci_abort_xferbwi_mac_fw_loadugenopeni80321intc_imaskffs_cgreadwi_init_usbugenioctlvm_map_lock_try_lnspec_close_clonevop_generic_bwritenanotimere_cdufsspec_writelxtphy_casd_read_cap_10iso_disklabelspooffdfreeuvn_detachieee80211_ccmp_set_keyfintek_capci_set_powerstateuvm_km_valloc_trytty_countugl_cdhidkbd_detachbwi_phy_init_11gdeflate_globaluftdi_detachraw_disconnectsensor_task_registersis_south_matchip6_neighborgcthreshbufkvmKERNEL_BASE_virtremove_coproc_handleratomic_clearbits_intumass_polled_transferucom_to_tiocmdeflateSetHeaderuvm_pmr_extract_rangebrelvpsensor_attachre_intrmsdosfs_mountfsvfs_relookupem_oem_bits_config_pchlanpcibr_flagsuvm_map_addr_augment_getem_82547_update_fifo_headsys_utracencpusfoundehci_root_intr_startwi_stopsync_fsyncumsm_activatesetstatclockratecd9660_strategyem_iffuserconf_parserrw_initural_tx_bcntiocm_to_ucomext2fs_allocpmap_cachevivtusercryptowskbd_deliver_eventdb_eregscom_fifo_probeieee80211_delba_requestbread_cluster_callbackfdcopy_bwi_txeofin6_proto_cksum_outbuf_acquire_nomapatu_send_mibemul_findAES_GMAC_Finalb_to_quvm_pmr_size_RB_INSERTin_len2maskbus_space_read_raw_multi_2uhci_pci_matchcmd0643_9_chip_mapugl_startobio_bs_allocusb_blk_freelistudp_sendspaceuvm_objtree_RB_PREVifg_headvfs_rootmountallocSHA1Updateehci_device_isoc_transfercue_tx_list_initbs_notimpl_bs_sr_2netintrcd9660_openrw_initi80321_bs_mmapAES_GMAC_Reinitixp_setup_channelsr_uuid_generateohci_root_ctrl_startvm_map_busy_lnbuf_rb_bufs_RB_FINDcmaskbrgphy_cd_bss_end__ext2fs_blkprefdb_pool_print_cmdbwi_encapwi_alloc_nicmem_ioicsphyattachdb_delete_linescsi_activateuhidkqfilterVOP_ISLOCKEDsys_kqueueAES_GMAC_Initieee80211_tree_RB_REMOVE_COLORuao_referencein6_addrscopebuf_getsys___threxitdb_searchieee80211_ifdetachuvisor_attachbs_notimpl_bs_wm_4vfs_getcwd_scandirmaxlockdepthwi_usb_tx_unlockieee80211_free_nodeieee80211_node_leave_11graw_usrreqnblkdevuhci_find_prev_qhpciide_detachinitiduhidev_detachbs_notimpl_bs_wm_2sr_crypto_hotplugttyinputscanc__stack_smash_handlerbwi_pci_conf_writeumsm_matchukbd_consopsbiodoneural_activatedb_set_breakpointicmp6_rip6_inputehci_free_sqtdwi_usb_txfrmsmsc_encapmaxslpext2fs_makeinodeehci_device_intr_methodscue_startaue_csr_read_2ufsread_filtopsufs_symlinkm_dup_pkthdrbwi_bitswap4sr_crypto_assembleufs_mkdirvfs_getcwd_getcachepci_subclass_satcomusbd_get_no_altsural_newassoc_length_codenamecache_rb_cache_RB_PREVin_iawithaddrbwi_mac_fw_free__anddi3phtree_RB_REMOVE_COLORrt_missmsgVOP_BMAPre_txeofignore_addrsip_dooptionsvn_locksvwsata_lba48_write_regcue_tick_tasktimeout_add_tsbwi_phy_attachrip6_ctlinputubsa_activatescsi_link_shutdowncdce_caSHA384Initumass_cbi_adscsbdropsr_meta_native_attachmsgbufphysuaddr_free_rbtree_RB_INSERT_COLORusbd_desc_iter_nexttcp_debugusbd_transferinpcb_poolohci_pollohci_hubdnextralocsmsc_miibus_writereguvm_addr_fitspaceblf_keysys_setegidbus_space_write_raw_multi_4wdc_wait_for_statusucom_status_changern_matchcd9660_symlinkautoconf_verbosebwi_memobj_read_4in6_setpeeraddrunp_externalizesys_munlockalluvm_faultuhci_waitintrrandomioctlsoftraid_disk_attachsoreceivesiop_iwrpool_getuextralocscsibus_printlinkdb_show_radix_nodeudav_csr_read1ieee80211_eapol_key_inputohci_root_intr_startffs_dirprefucom_shutdownrip6_outputinflatert2661_setup_tx_descscsibus_cdin6_get_rand_ifidndflushcompose_tab_cmpieee80211_parse_wmm_paramsrn_insertspec_pollbpf_wakeupfilt_kqdetachdb_flush_lineaue_unlock_miiwsmux_getmuxipsec_exp_bytesbufqueuesconfig_defersys_faccessatgf_mulbwi_mac_setup_tpctlem_check_for_link_bus_dmamem_allocm_tag_initbsearchif_attachsr_crypto_free_resourcesugl_capciaddr_ioaddrsys_setrtablem_reclaimsr_raid_read_capuvm_map_addr_RB_REMOVE_COLORnameibwi_disable_intrsem_read_pci_cfgbs_notimpl_bs_sr_4uvm_map_setup_entriesext2fs_readdirip6_ctloutputdead_pollpte_l2_l_coherenttqphy_funcswihap_initversionbwi_mac_opmode_init_bus_dmamap_syncuvm_pmr_remove_sizelzs_dummybuf_needvakqueue_initieee80211_wep_delete_keyrt2661_read_eepromuplcom_set_line_codingaxe_rx_list_initata_dmaerrieee80211_bip_set_keybwi_mac_set_retry_limuvm_pagezeroin6_setsockaddrigmp_leavegroupcom_common_getciic_probe_sensorre_pci_cabs_notimpl_bs_rr_8mountlistuserconf_histbufsys_getdentscomsoftwihap_mgmt_inputpdc203xx_read_regudav_initVOP_REVOKEconfig_deactivatebwi_txeof_status64SHA256Finalclallocbiowaitbwi_led_blink_nextpdc268_config_readpci_subclass_inputprobe_addrs_sensorfilt_ufsreadrt2560_rx_intrunixswuvm_objtree_RB_INSERT_COLORdb_stop_at_pcsccstqphy_caehci_check_intrral_pci_activateccpupmap_updateehci_device_setintrobio_cdem_setup_linkpci_vpd_readgeneric_bs_sr_1re_pci_activateacard_chip_maphidkbd_inputprocess_zapsr_raid6_wu_donenexttickeventfdinitboothowtoarc4randomnsphy_funcstcp_delack_ticksbwi_get_rf_loupl_stoprt2860_intr_coherentttopenata_get_paramsukbd_apple_iso_mungeip6_randomid_initieee80211_tx_ba_timeoutether_ipmulticast_minconfig_rootsearchrt2860_bbp_initrip6_sendspaceieee80211_countrycode2nameuao_dropswapin_addprefixenxiosys___getcwdcd9660_specvopsusb_cdrnd_event_headin6_maxmtupmap_enterrt2560_iter_funcamphy_funcsundefined_handler_addressRMD160Transformsys_setreuidSHA1Initusbd_ratecheckbwi_phy_init_11b_rev6wi_usb_open_pipesudav_tick_taskuvm_map_findspacepdc203xx_pci_intrwsevent_initcryptoopencomcnattachuserasymcryptodb_var_rw_intwdc_xfer_putrt2560_set_bssidsdsizeuao_dropswap_rangesys_pwritevudav_lock_miikqueue_scanieee80211_pmksa_findbwi_rf_off_11g_rev5uplcom_breakusbd_iface_claimedtcp_closeohci_free_stdsd_patternsX_db_search_symbolscsi_initmsdosfs_advlockswcr_idwdog_registerkue_attachpdcsata_chip_mapusbd_free_xferdb_varssys_utimensatfalloclxtphy_cdatu_joindeadproc_mutexdb_breakpoint_freeumsm_methodspfctlinputcomcnprobephys_mapext2fs_pathconfumass_bbb_methodssoft_intrqdeflateSetDictionaryufs_lockcomintrboot_eaddr_validsys_accessem_read_mac_addrnsphy_statusuvm_swap_iouserconf_initbwi_phy_init_11art2560_ioctlkillpg1url_tx_list_inituhci_strwsmouse_mux_openi80321intc_attacharpproxyvputonfreelistuhci_device_ctrl_transferwdioctlext2fs_mountrootobio_printpciide_mapregs_compatumodem_methodsieee80211_findrateregyearem_update_stats_countersurl_ioctlpage0setrunnablepool_do_putuvm_pmr_getpageswi_set_ssidcue_ioctlnd6_prefix_onlinkugen_seltrue_filtopsffs_specvopsumct_intrcue_attachelf32_read_fromosversionticks_per_intrem_free_receive_structuresatu_get_mibhid_is_collectionwi_usb_tx_list_initfind_pfxlist_reachable_routerip6_pcboptstvtohzieee80211_get_eapol_keyphtree_RB_NFINDratecheckin_rtchangevfs_syncwaitrt2860_tbtt_intrudav_ifmedia_statusaue_crcffs1_reallocblksieee80211_node_lateattachcansignalhotplugpollem_link_stall_workaround_hvrt2860_suspendmsdosfs_check_exportbwi_fwimage_is_validieee80211_up_to_aclf_setlocknbigpipecue_devsin_controlieee80211_get_addba_respbwi_regwin_inforlphy_funcswsmux_srcopslmaxuvm_pagecopyphtree_RB_NEXTsysctl_quadsys_readexec_process_vmcmdskue_tx_list_initrt2560_update_promisccmd_chip_mapieee80211_tree_RB_FINDi80321_bs_tag_templateucomioctlm_cldropmbstatuhci_remove_ls_ctrldcphy_statusuhidev_intrttyinfodb_flush_lexttyinohci_root_ctrl_donegetnulldevispidtakendb_dmesg_cmdpciide_dma_initsr_meta_save_callbackextent_destroydb_lpenc_xform_rijndael128if_group_egress_buildloop_clonerttsetwatergetcieee80211_addba_requestrt2860_gp_intrsr_raid6_intrifaddr_items_RB_INSERTdb_last_addrural_update_slotuvm_pseg_lcksr_ioctl_volem_clear_hw_cntrscom_obio_matchpmap_enter_pvmsgbufenableduvm_mapent_mkfreeunp_disconnectsys_listensys_mounthotplug_put_eventehci_root_ctrl_donepgsignalehci_waitintrbpf_mtap_etherfirstcdb_read_bytesuhub_detachrt2560_media_changeieee80211_ccmp_delete_keysr_failioffs_fsyncwsmux_mux_openfintek_attachucom_do_openinetdomainehci_abort_xferscsi_devid_wwnmemcpywdc_enable_intrkthread_exitaxe_activatescsi_req_detachbwi_nrssi_writecue_newbufdisk_constructvfs_unbusyrip_usrrequhci_setup_isocvm_map_upgrade_lnspec_writesiop_wdtr_msgpciide_unmapregs_nativecom_obio_cdkq_timeoutmaxin_broadcastfd_getfilesr_sensors_deletehidkbd_set_ledsmsgbufaddrucomclosesdioctlutsnameip6_setmoptionsexit2aue_resetkue_open_pipesacer_setup_channelip6_mloopbackext2fs_cgupdateuhci_add_hs_ctrlrt2860_ampdu_rx_startsiop_scsifreeieee80211_send_4way_msg2tcp_update_rcvspacerddumpem_enable_intrcpu_setperfuaddr_rnd_poolufs_lookupsiop_pci_resetugen_attachufs_bmapdoasyncfreeudav_miibus_readregcpufunc_dfarip6_randomflowlabelttpolldegetlogpollkthread_createbwi_mac_set_promiscugen_set_configdb_elf_sym_initwdc_default_read_raw_multi_2current_ipl_levellogclosesd_vpd_block_limitsieee80211_kdfgeneric_bs_wr_4install_coproc_handlernd6_dad_findohci_rhscudav_detachufs_strategysr_crypto_create_key_diskohci_device_requestkue_watchdogphysical_freeendcopy_statfs_infobounds_check_with_labelarc4_timeoutsr_raid1_assembleumct_opensd_ioctl_cachepci_subclass_networkext2fs_checkpathns_scx200_chip_mapsocantrcvmorepci_vpd_writeuipaq_rtsprocess_poolrt2560_update_ledip6_setpktoptfile_filtopssr_raid6_rwbuf_unmapmsdosfs_renamesysctl_proc_argssiop_adapterpipe_wfiltops__lshldi3purge_detachedpfxrtr_addcd_load_unloadipq_pooluaddr_kbootstrap_destroypmap_activatebuf_dealloc_membmtphy_resetconfig_make_softcpte_l2_s_prot_kruaddr_stack_brk_functionsunp_discardcue_csr_write_1ip6_outputwi_read_record_iouhid_caudav_rxeofrt2661_bbp_readwsmux_get_layoutswap_syscall_lockufs_kqfilterieee80211_newstateums_enablescsi_autoconfcheckdirsexecswsr_raid0_creatert2560_set_txantennaumass_atapi_attachin6_are_prefix_equalin6_controluvm_pmr_rootupdateleapyearsleep_finish_timeoutsys_sigsuspendcd9660_unmountpciide_dma_startehci_device_bulk_abortswcr_authcomputenamecache_rb_cache_RB_NFINDtrapsignalrushjobpmap_devmap_registerrn_inithead0db_single_step_cmdwd_flushcachend_defrouterblf_decfdcloseexecuvm_map_sel_limitsevcount_attachlimcopybio_doreadwi_do_hostencryptscsi_req_probeuvm_mapent_forkcopytcp_timer_rexmturl_ifmedia_changei80321_gpio_pin_writeuftdi_attachsiop_pci_cart_timer_initnd6_useloopbacksr_crypto_rwuaddr_rnd_createieee80211_next_modeputsaxe_tx_list_initrip6statip6_id_ctxtcp_debxcnpollcd_casys_truncateesigcodeacphy_servicescsi_xfer_poolsysctl_wdogarmv4_tlb_flushIDudav_csr_readohci_add_donert2661_ack_rateem_read_phy_regieee80211_tree_RB_NEXTsched_choosecpu_forki80321_pci_initohci_add_edwdc_xfer_poolcdce_newbufsoacceptkqueue_pollcdgetdisklabeldb_call_depthuaddr_pivot_randomdb_printfehci_device_isoc_doneuhidreadin6_ifaddloopufs_creatend6_freend6_optionscd9660_seekbwi_free_tx_ring64nd6_llinfo_settimersr_roam_chunksmsdosfs_unmountelf32_load_psectiondb_show_all_bufsuftdi_writern_mpath_nextnamecache_rb_cache_RB_MINMAXtaskq_create_threaduhci_device_bulk_transferarm_pcache_unifieddb_add_symbol_tableuhci_remove_intruplcom_setm_tag_nextohci_intr1msdosfs_writecue_resetbs_notimpl_bs_w_1rt2661_amrr_node_free_unusedexec_script_makecmdsehci_rem_free_itd_chainiic_matchieee80211_reset_erpfilt_pipedetachcd9660_rootentropy_add_ptrdb_unaryrgephy_statusiophyattachdisk_attach_callbackselrecordffs_validatert2860_intrcomstopatu_wait_completionaxe_ax88772_initffs1_compat_readrip_outputrrw_exitext2fs_accessbwi_ofdm_plcp_headerrt2560_read_eeprommld6_fasttimeouaddr_rnd_insertkthread_qimaxwsmouse_matchohci_free_seduserconf_pdevuvm_object_printitsr_detachinflate_fastiq80321_devmapmbpoolclock_secs_to_ymdhmsaes_xts_setkeytcp_canceltimerstqphymatchrip_recvspaceroute_initswap_prioritylink_rtrequesttc_setrealtimeclockffs2_reallocblkswdc_get_xferuvm_vmspace_poolbwi_setup_rx_desc32stackgap_initpipe_createsysctl_vnodepdc202xx_setup_channeliodatand6_sysctlsyn_cache_putdoopenatpciide_amd_productspci_subclass_multimediavn_openuhci_freexif_clone_createbufq_fifo_requeuesr_boot_assemblycdce_tx_list_initSHA384Finaluao_detachcpufunc_controlmallocamap_pp_adjrefauth_hash_hmac_sha2_384_192apollo_chip_mapin_pcbrtentryrt2560_get_macaddrknote_dequeuesr_discipline_inituhci_root_ctrl_startuhci_pci_activatewi_cmd_usb__udivsi3re_ifftcp_outflagskqueue_statcdce_ioctlcd9660_rrip_analyzeohci_hash_find_tdexphymatchbuf_fix_mappingbio_unregisterip6_v6onlysys_preadvdb_tok_stringuserretsys_recvmsgpipe_statHMAC_MD5_Finalvn_writesr_hotplug_unregistermtdphy_servicehidkbd_hookup_bellVOP_LINKubsa_devsicmp_inputumass_cdvcountvm_page_zero_enableieee80211_get_sa_queryuvm_vsunlock_devicerd_root_sizein6_delmultistathzenc_xform_cast5route_ctloutputwdog_ctl_cbbwi_nrssi_readsched_idlebio_warnuftdi_get_statuswskbd_cnattachwdc_ata_bio_intrvirtual_enduhidev_get_reportsys_getloginifaddr_items_RB_NEXTbuckstring_inituhci_free_std_chainiq80321_pci_init2icmp6_rediracceptbwi_set_gainsdetruncdb_elf_symbol_valuescopyoutpfindbufq_peekcomconsaddrip_ctloutputuhidev_set_report_asyncwsevent_readenc_xform_arc4bwi_stopbrgphy_5704_a0_bugarp_ifinitdb_write_variableufs_dirbadcd9660_readdirvfs_unmountallrgephy_loopsys_renameatohci_allocxcopyrightsdattachsched_peg_curprocwdc_default_lba48_write_regtcp_timer_keepusbd_devinfo_vpsbsynctcp_mss_updateiopiic_cdphison_setup_channelpciide_lookup_productfree_pagesehci_root_ctrl_startdb_proc_print_cmdrt2560_initrw_enter_readdb_show_all_procsvunmapbufehci_device_ctrl_transferuvm_map_pageable_wireroute_outputrti_deletefreepidsys_geteuiddb_output_positionem_clear_vfta_i350icmpmaskreplin6_pcblookup_listenmsdosfs_mknodttkqfluship6_defmcasthlimsys_munmapsii3114_dmactl_writekp_nonefilt_solistenvsnprintfrt2860_node_leavepte_l2_s_prot_urarplookupuvm_map_pageablechainallocuplcom_methodssw_reg_startpmap_copy_page_xscalesr_ioctl_deleteraidifmedia_baudratei80321_calibrate_delayem_82547_tx_fifo_resetusbd_setup_default_xferuvm_pagelookupsoshutdownuserconf_hist_cmduftdi_cduserconf_listproc_cansugidcd9660_rrip_getsymnamedb_command_tableip_mloopbackbwi_rf_get_tp_ctrl2bpf_iflistKQREFwdc_downgrade_modeieee80211_node_leaveip6intrqaxe_newbuftodr_handlend6_rs_inputscsi_activate_buspciide_mapreg_dmasoabortm_free_unlockedem_82547_move_tail_lockedem_get_bufcast_encryptunp_inotaskq_threadbwi_default_led_acthidkbd_attach_wskbdlogkqfilterbpf_mtap_pflogni6_dnsmatchdb_extent_print_cmdip6_init2uprintfdb_clear_single_stepsensordev_installrandomiduvm_page_printitmainbus_cai80321_local_dma_initcoredump_elf32rt2560_intrsoftdep_flushworklistsys_issetugidinitclocksbwi_rf_attachcd9660_mmapif_detachaue_watchdogwsmuxopenwdc_ata_bio_startnd6_cache_lladdrcatqsession_poolugl_txeofunp_connectuvm_pagermapiniic_smbus_read_byteif_detached_startpool_serialuplcom_activateugl_ioctlxscale_cache_flushD_SEscsi_probe_lunaue_ioctlirq_entryni6_inputvfs_mountedondb_expressionboard_powerdowncputypert_lookupfc_lookup__bss_start__if_downndqbVOP_GETATTRuhci_root_ctrl_methodsieee80211_fix_ratebwi_get_pwron_delaysiop_add_reselswip6_mtudisc_timeoutwihap_deauth_reqieee80211_node2reqwi_usb_matchelf32_check_headerrt2661_bbp_initdb_historygf_logeephy_cdinphy_cdttytstamprt2860_mcu_bbp_readural_set_txantennaieee80211_node_allocieee80211_crypto_detachpmap_unwireipaddrip6_auto_linklocaluvm_pageunwirerti_fillHMAC_SHA256_Inithw_serialehci_device_intr_abortauth_hash_hmac_md5_96autoconf_attdetufs_chmodbufq_nscan_resortcdattachuserconf_devicebwi_rf_off_11ain_localaddrbwi_pci_wakeupsys_sigaltstacki80321_i2c_casii3114_dmatbl_writeDES_versionbrgphy_resetsoisdisconnectingauth_hash_key_sha1Blowfish_initstatesched_steal_procwi_media_changenull_decryptsyn_hash2rttimer_queue_headarm_pdcache_sizeexphy_capcidetachucom_dtrrtredirectuvm_map_printitdb_read_variablesoftintr_initieee80211_setkeysdonedb_regsdb_stack_dumpuvm_pmr_pnaddrttymodemdb_lbuf_endehci_free_itdmtx_enteraxe_devskqueue_poolvntblinitbuf_rb_bufs_RB_INSERTcpuset_intersectionem_lookup_gcubwi_rf_tssi2dbmuhub_activateAES_GMAC_Setkeysleep_queue_initpmap_preferin6_ifattach_linklocalVOP_REALLOCBLKSuhci_globalresetE_abs_tag0_Usedtcr1_get_timecountugenwritesys_setresgidsr_crypto_encryptuvm_pmr_freepagesieee80211_input_bamsdosfs_sync_vnodesplassert_failarm_picache_waystty_initaxe_ioctluvm_km_freesys_killrn_mpath_repriouserconf_numberperflevelcomconsiohpmap_set_pcb_pagedirem_watchdoguvm_pmr_addr_RB_NFINDrt_setmetricssys_getegiddb_set_single_stepuvm_objtree_RB_FINDsw_reg_iodone_internalhidms_detachem_check_mng_modeserverworks_setup_channelumass_init_insystemfrag6_deletefraghdruaddr_destroyem_validate_eeprom_checksumdirchkifaddr_items_RB_FINDexphy_resetipip_outputpipecloseVOP_REMOVEpci_mapreg_typewi_usb_activateconsinituvm_pmr_isfreeurlphy_statusext2fs_dirremoveuvm_vnp_uncachesysctl__stringffs_clusteracctconfig_detachmtdphyattachifaof_ifpforaddrcryptop_poolsensordev_listsr_checksum_printhidms_ioctlsc_pld_shminidatacleanrt_timer_queue_destroysr_meta_probewi_cdsd_cduvm_pseg_geticmp_mtudiscipport_hifirstautoieee80211_tkip_delete_keysys_fstatem_read_eepromufs_itimesenc_xform_3desrgephyattachuserconf_enablepte_l2_s_prot_uwext2fs_vinitdb_endlpuplcom_intrumass_bbb_resetffs_alloccgbuf_object_storecryptodevallowsoftsmsc_wait_for_bitsobio_foundgeneric_bs_w_1sa6_anysys_getpriorityatu_radfirmpci_subclass_cryptosysctl_diskinitsr_concat_discipline_initE_ldsa_abs_reselect_Useduvm_km_vallocieee80211_send_mgmtcue_getmacnatsemi_chip_mapbrgphy_bcm5421_dspcodescsi_xsh_delrt_mpath_nextscsi_plug_probesys_unmountsr_meta_native_probeuvscom_dtruipaq_detachbootdvelf32_probesumct_detachin6ifa_ifpwithaddrvgonelpciide_jmicron_productscrypto_taskqsofreebwi_amrr_timeoutbwi_rf_lo_findnd6_dad_timerbwi_led_newstateuaddr_rnd_destroyinphyattachcpuset_unionbwi_init_tx_ring32uvscom_shutdowndb_del_symbol_tabledb_add_exprsiop_timeouteephy_matchpmap_removebpf_mtap_afrt2860_set_basicrateshidkbd_parse_descicmp6_fasttimouvm_pmr_addr_RB_INSERText2fs_removemtx_initif_clone_destroyehci_close_pipebwi_regwin_enablewdccommandvmcmd_randomizebpf_setfuserconf_historypciide_pci_capci_disable_legacy_vgauvm_page_unbusyfilt_hotplugreadbwi_rf_lo_isusedtk_noutusbpalockext2fs_mountpmap_collectBlowfish_expand0stateuhci_check_intrukbd_enableuvm_map_addr_RB_PREVdb_symformat_elfwdc_xfer_getpciide_compat_intrgeneric_bs_rr_4cpu_sysctlcd9660_deftstamphotplugkqfilteri80321intc_smaskzlibCompileFlagsip_randomidbrgphy_eth_wirespeedaue_tx_list_initnettxintrieee80211_recv_disassocnosuidcoredumpukphyattachcddumpdb_search_cmdastusbd_claim_ifacetcp_disconnectuvmspace_execuhci_timeoutwi_usb_detachwsmux_createsys_mmapehci_bus_methodsbootnd6_is_addr_neighborblf_ecb_encryptunp_rightshostnamedb_print_llinfodisk_closepartcmd680_setup_channelpci_enumerate_busbrgphy_fiber_funcsem_set_eee_i350em_disable_pciex_masterupl_outputi80321_intrext2fs_bmapuvmexpnextstateventenc_xform_blfbufq_donesr_crypto_dev_rwehci_detachsensordev_getufs_diremptyreinsertfinishduprt2661_newassocsleep_setup_timeoutbrgphy_crc_buguao_grow_hashukphy_serviceqsphy_resetsmsc_stopdeflate_decompresspool_destroylogwakeupshutdownhook_listhidkbd_attachip_dosourcerouteieee80211_node_join_rsnsoread_filtopsgcu_miibus_readregieee80211_media2ratedmapoolsbdevsw_lookupdisk_changebwi_mac_resetuplcom_matchamap_lookupsdoreallocblkscache_revlookupamd756_setup_channelbpfread_filtopssoinituvm_mapent_isjoinableem_get_speed_and_duplexVOP_MKNODuvmnd6_ifdetachin6_ifaddrroute_protofilt_ugenread_isocsync_vopshw_uuidext2fs_truncatere_newbufcd_play_tracksscsi_do_mode_senseuvm_pmr_allocpmrip6_maxfragpacketsdb_errorehci_confdprefetch_abort_handleruvm_km_threadsr_checksumem_rxeofuhci_root_intr_methodsscsi_probe_buslminm_leadingspacesys_fpathconfwsmuxpollarpt_pruneohci_device_bulk_methodsem_copper_link_postconfigkp_zerosoconnect2knote_poolcnopensiop_scsiprobenatsemi_setup_channelscsi_test_unit_readyural_set_bssidricohrtc_reg_writenmbclustural_get_rfsominconndma_freert2661_mcu_wakeupuhci_device_clear_togglesoftraid_cduvm_vnp_syncem_transmit_checksum_setuppool_allocator_large_niieee80211_get_disassociopxs_cdwihap_assoc_reqarpt_downrdgetdisklabelarm_pdcache_line_sizebpf_tapnthreadsdb_lookupuvm_pmr_addr_RB_NEXTrt2860_tx_intrnumnegpciactivatemii_phy_autouvm_pmr_addr_RB_FINDuvm_mapent_free_removemsdosfs_initohci_device_ctrl_startwi_write_record_ioext2fs_writelf_clearlockbwi_rf_set_ant_modegeneric_armv4_bs_wr_2uvmpd_scan_inactivedb_lastsymsiop_resetbusurl_memip_srcrouteuhidioctlip6_accept_rtadvieee80211_recv_4way_msg4pte_l1_s_cache_masksys_setregidusbd_device2interface_handleurl_csr_read_1cpuset_infosusbd_dopollvinvalbufsys_ftruncateuhci_device_isoc_startbwi_rf_map_txpowerubsa_dtraes_ctr_cryptm_splituhci_remove_hs_ctrlsoftintr_disestablishentropylockumodem_ioctlurl_stoptcp_timer_initdb_tab_stop_widthdb_putncharstuagg_unlockedsii3114_dmactl_readnd6_maxnudhinttcp6_inputsosetoptkp_dirtyehci_set_qh_qtdtcp_mssrt_sendmsgifa_addcache_purgeudav_stop_taskbpf_mcopycomconsrateauth_hash_hmac_sha1_96uaddr_pivot_insertfork1db_activevfs_hang_addrlistpci_primary_vgacue_tickdead_writeufs_dirrewriteinsmntquettreadtk_canccdb_write_bytesrt2860_media_changeext2fs_blkfreeudp_outputfind_last_setsoftraid0rt2661_set_chansys_chmoducomreadprelist_removeuvm_objtree_RB_NFINDuao_shrink_arrayffs_vgetrt2661_tx_intraxe_encapinitprocsr_bootuuidip6_getpmtu__umoddi3bcstatsbrgphy_fiber_statusarm_dcache_alignvm_map_downgrade_lnugenclosert2661_media_changeip6_log_intervalnull_encryptsched_idle_cpuswihap_auth_requgl_newbufscsi_activate_lunuvm_page_physdumpuvm_atopgX_db_sym_initmaxprocesssyn_cache_timerieee80211_auth_opensolisten_filtopshfsc_dequeueatu_internal_firmwareprocess_kernel_argsin6_update_ifa__wdcerrorSHA384Updatecdce_detachrt2560_tx_intrehci_alloc_itdrt_msg2suser_ucredsd_shutdownmem_noext2fs_buf_allocbufbackpagesral_pci_matchatu_xfer_list_freeuhci_free_stdwihap_sta_deletepciaddr_resource_reserveuaddr_kernel_functionspmap_free_l2_bucketRMD160Update_intrevarprequestmsdosfsreadwrite_filtopsrrw_enterkernel_mapuhci_device_isoc_enterwi_init_iodumpdevwsmouseioctlcd9660_lockusbd_ref_incrieee80211_mgt_subtype_namegf_powbwi_led_eventugen_do_readdb_not_taken_bkptm_printpciide_unmapreg_dmauvm_pmr_splitvfs_mount_foreach_vnodekqueue_kqfiltertimeout_add_usecsr_raid5_set_chunk_statewi_mgmt_xmituhid_do_ioctlzeroin6_addrstrncasecmptimer_filtopsatu_tx_startuvm_objwirert2560_encryption_introhci_device_bulk_starttcp_mss_advSHA512Update_intin_ifaddrnd6_optionwin2unixfnmax_hdrffs_readm_freephtree_RB_FINDbwi_mac_hostflags_initaes_key_wrapurlphy_attachieee80211_get_assoc_reqsr_meta_attachsr_meta_native_bootprobescsi_inqmatchfdesc_poolcmd_pci_intrpool_page_allocsr_switchin_pcblookupm_tag_delete_chainfilt_pipewritecd9660_polliicprobencugl_detachbadaddr_read_4bzeroumass_scsi_probearmv4_drain_writebufswapdrum_addufs_closedefrouter_delreqfixjobcuvm_pmr_size_RB_REMOVEdb_show_all_cmdspci_subclass_daspscsi_devidin6_addmultirn_newpairbios__udivdi3sys_obreakblf_setkeyusbd_set_config_norgephy_cdieee80211_pmksa_addpciide_cdlastddateucom_do_ioctluvmfault_unlockallsr_meta_getdevnamem_inithdrpmap_curmaxkvaddruvm_pmemrange_addr_RB_NFINDin6mask0bpf_validateusbd_get_string_descvaccessuao_set_swslotsys___thrsigdivertsys_getdtablecountmbinitsr_errortcp_secret_ctxusbd_get_reportabortwskbd_default_bell_datascsi_readsafe_cmdieee80211_set_link_stateamap_allocVOP_LOCKbuf_rb_bufs_RB_INSERT_COLORMD5Finalwskbd_matchcp_timeaxe_rxeofcd9660_vget_internalrt2560_decryption_intrdb_page_print_cmdwi_intrrw_casvgetrd_attachkd_nowaitugenpollieee80211_create_ibssbrgphy_jumbo_settingswsmouseopenwinChksumbufq_requeueserverworks_chip_mapfreeclusterchainmld6_initswapmapscsi_get_linkdisk_initrt2560_wakeupSHA256Updateohci_bus_methodsohci_hash_rem_itdatu_cdrip6_ctloutputdisk_readlabelpciide_pci_writeaue_sendusbd_getnewaddrnd6_na_outputext2fs_fhtovpsr_validate_stripsizeumass_cbi_transferext2fs_createieee80211_gtk_rekey_timeoutem_local_timerwi_sync_mediauvm_map_teardownpipe_pollpool_reclaim_allnsphy_cabmtphyattachucomopensysctl_dopooluhub_matchuvm_mapent_clonetcp_respondsys_readvcrypto_getreqamap_cow_nowroundrobinbadaddr_readuvm_map_createissignalwdprintsr_attachfilt_uhidrdetachin6_selectrouteieee80211_recv_rsn_group_msg1cdevvprt2560_bbp_writescsi_pending_startuhci_intrbwi_mac_balance_atten_setsoftintrmsdosfs_kqfilterigmp_joingroupuiomoveohci_device_isoc_donewi_usb_wridrespmsdosfs_startlf_alloccpu_idle_leavedb_loop_countwi_intr_ackpciide_dma_table_setupbpf_reset_dem_hv_phy_workarounds_ich8lannd6_dad_stopdiskmapioctlhid_start_parseuseloopbackinflateSyncPointuvm_waitnexecsbwi_init_rxdesc_ring32mclpoolsi80321_mem_bs_mapieee80211_regdomain2namepmap_referencesys_bindrt2661_watchdogloioctlrw_exit_writebs_notimpl_bs_wr_8ieee80211_eapol_key_micrt2560_free_tx_ringumct_initusb_abort_taskspmap_bootstrapbs_notimpl_bs_wr_2blf_cbc_encryptsys_mqueryarm_picache_line_sizekmeminit_nkmempagesbwi_rxeofusbd_new_deviceuvm_pmr_size_RB_REMOVE_COLORmcllivelocksscsi_iopool_initscsi_io_putuvm_pmemrange_findfillinusemaprecvitbmtphy_funcsums_cdfilt_sowriteuvm_kernacccnpollcsys_linkucomsubmatchuvm_addr_initlog_opensr_rebuild_initfilt_randomdetachuvm_pmr_size_cmpuaddr_free_rbtree_RB_MINMAXfragtbl124userconf_totdevi80321_bs_tagrt2661_tx_cmdxscale_cache_flushIDrt_tablesrt_ifmsgrandomread_filtopsieee80211_plcp2rateumsm_setobio_bs_maprealitexpireipstatunix2dostimert2860_delete_keydounlinkatscsibus_caubsa_attachiic_probe_eepromuvscom_openurl_newbufusbd_delay_msffs_dinode2_poolcrfreecnputcuhid_do_writeip6_lasthdrohci_device_isoc_abortuhub_uhub_caugen_matchtcp_reaperlastnowpool_sethiwatrt2661_tx_datasvwsata_mapreg_dmawi_read_record_usbuftdi_methodswdgetdefaultlabelmicrotimeuvm_pmr_addr_cmprt2560_tx_datapipeunlockuvm_pmemrange_addr_RB_MINMAXuvm_swap_getpciide_serverworks_productsext2fs_reloadrt3090_rf_initurlphy_matchcsefindelf32_copyargsisochariophymatchuvm_km_alloc1siop_cdcdopentcp_usrclosedaue_ifmedia_stsboard_resetphysmemuvn_flushurl_cduvmfault_relockinferiorbwi_rf_calc_rssi_bcm2050ukbd_attachxscale_cache_purgeD_Eclusteralloccryptof_readsr_raid_syncuplcom_capci_dopmrt_if_remove_rtdeletewskbd_attachin_pcbbindumass_cbi_statexscale_cache_flushImtdphy_caudp_notifyuhci_timeout_taskuhci_root_ctrl_closeendtsleepwihap_check_txstrnlensigactsshareuvm_map_freelist_update_refilldb_set_watchpointuvm_map_addr_RB_NEXTbpfattachuftdi_openugl_openpipesif_detach_queuesitimerdecrem_valid_nvm_bank_detect_ich8lanieee80211_get_delbaether_outputpci_cdem_phy_setup_autonegpmap_bootstrap_pv_page_freeuvm_addr_printauth_hash_md5crypto_kdoneinflateGetHeaderbpfilter_lookupm_copym0bwi_led_onoffaxe_miibus_readregvm_physmemiso_shipdirrdwritebwi_txeof_status32ieee80211_node_join_htrnd_timeoutieee80211_parse_edca_paramspipe_ioctlfilt_timerexpireural_set_chanwskbd_enablepmap_devmap_find_vacd9660_mountrootbpf_allocbufsbwi_init_txstats32set_stackptrrt_gettablemsgbufmappedohci_device_setintrrt3090_set_chancomprobe1cdsizedb_symbol_valuesuhci_device_ctrl_startumass_lookupdb_evarsupl_activatesmsc_attachiic_smbus_write_bytebwi_rf_get_latest_tssiwsmouse_mux_closewakeupuao_growgetnanotimeatu_devspciide_matchrt2860_rf_writei80321_mem_bs_mmaptcprexmtthreshkprintf_mutexrt_getifadb_malloc_print_cmdwi_get_fid_ioenosyslockmgrbwi_bus_attachrtlabel_name2idbwi_node_allochidkbd_is_consoleuvm_vnodeopsdb_bcstats_print_cmdvfsconfrt2860_free_tx_ringVOP_OPENcompwroffbuckstringuhci_device_bulk_startrt2860_enable_tsf_syncsiop_scsicmd_endusbd_fill_deviceinfoscsi_interpret_sensesqphy_cdugen_do_ioctlext2fs_flushfilesdes_ecb3_encryptieee80211_send_eapol_keycomconsattachedbrgphy_probelxtphyattachwi_usb_txeof_frmufs_readlinkrdopenin6_ifadddoscheckpathpcbmapatu_newstate_tr_stored_blocknd6_option_initbufq_quiescebrgphy_servicepiix_setup_channelext2fs_setsizeffs2_balloc__guard_localin6_init_prefix_ltimesnchstatscd9660_fhtovpmsgbufpE_ldsa_abs_selected_Usediq80321_pci_intr_stringsys_setgidrt2860_set_keyuserconf_common_attrfilt_ufswritert6_flushehci_timeout_taskgeneric_bs_r_4E_ldsa_abs_slot_Usedmmrwffs_bufatoffieee80211_add_ds_paramsem_init_hwiq80321_pci_intr_disestablishwi_usb_rridrespdohooksgf_invem_pci_set_mwiieee80211_rssadapt_choosenprocessesehci_free_sqtd_chainem_disable_intrukbd_activatesiop_sdpif_detached_ioctllocnamppsegswi_usb_casch_chip_mapuserconf_showbwi_next_scanip_mtudisc_timeout_qsr_raid5_assemblesr_scsi_cmdaddress_exception_entryffs_fhtovpgetvnodefilt_ufsvnodecrypto_get_driveridbwi_mac_updateslotpool_setlowatkmembaseswi_entryrip6_inituvm_aiobuf_poolisofncmpsysctl_emulseltrue_filtopssys_sigprocmaskdb_commandrt2661_select_bandin6_if_upfilt_pipereadenc_xform_aes_gmacsoreservedb_formatrt2560_reset_rx_ringuvm_mmapusb_activatescsi_report_lunsufs_quotactldosymlinkatuvm_map_uaddraroundin6_pcbnotifyifaddr_items_RB_REMOVEbrgphy_5708s_funcsusbd_clear_endpoint_toggleexplore_pendingstrrchrgetdevvpm_clgetpci_mem_finddefrouter_selectamap_unrefext2fs_statfsbpf_mtap_hdrcrdupamap_wiperangecuio_copybackisodirinodb_strlcpycfrootswsmousepollchrtoblkscsiprintsiop_get_lunswuserconf_pdevnamminphysukbd_matchurl_ticksys_fchownatrtalloc_noclonetimeout_mutexether_addmultiieee80211_recv_actionpci_powerdowncdce_cdffs_vptofhvfs_isbusyifunitirqstackbawritetputcharsvwsata_dmatbl_writewskbd_detachpmap_postinitcsedeletepool_print_pagelistffs_fragacctrt2661_rx_tuneffs1_ballocsys_fchowndcphy_attachuvisor_methodsums_activateinflateInit_SHA384Update_intdb_breakpoint_cmdvwaitforiomii_phy_tickcd_read_subchanneluao_shrink_flushflsextendfilelortrequesticmp6_inputbuf_valistuserconf_addohci_device_intr_methodswi_func_iocreatedefilt_randomreaduvscom_closebwi_regwin_nameieee80211_michael_mic_failuresbreleasedb_history_sizein6_selectifmsdosfs_islockedmax_linkhdrem_dma_freeumass_attachcryptof_statwdc_xfer_iopooludav_resetget_stackptrsysctl_rtablemsdosfs_reclaimbwi_set_chanbwi_rf_calc_rssi_bcm2060wdc_free_queuesqphy_serviceuserconf_hist_eocsys_readlinkatbrgphy_reset_bgei80321_intr_disestablishuvm_objtree_RB_REMOVEext2fs_getattrrtlabel_id2namesbdroprecorduvisor_activateuvm_coredumpem_write_phy_regi80321_handlerwdsizenamecache_rb_cache_RB_REMOVEacphy_statusip6_sysctlsuserdiskconfural_tx_dataatu_get_card_configvn_syncer_add_to_worklistusbd_get_interface_descriptorgeneric_bs_rm_1tk_ninsysfilt_opspciide_mapchanclusterfreefilt_randomwritesr_warnsr_raid_intrrt2560_beacon_expireieee80211_alloc_node_helperrootdevehci_device_isoc_startm_tag_firstem_82547_move_tailcdmatchpmap_map_entryusbd_get_config_descriptorpfxrtr_delpciide_machdep_compat_intr_establishdumpsysicmptstampreplif_detached_watchdogcy693_setup_channelrip6_sysctlext2fs_fsyncdoforceuhci_root_intr_startsys_fsyncwi_usb_stopuserconf_add_readsr_crypto_writere_pci_probeusbd_reset_portrt2661_set_macaddrifconfsiop_led_onpciide_pci_intramap_wipeoutuser_configcast_setkeytcp_outputnsphyattach_bus_dmamem_mmapi80321_attachupdate_ledsext2fs_updatetcp_timer_2mslaue_openpipesi80321_gpio_initffs_reload_vnodebuf_putmsdosfs_setattrVOP_RMDIRwdog_tickledb_delete_breakpointsr_ioctl_installbootif_addgroupciphy_cdieee80211_setmodeuhid_matchieee80211_add_ibss_paramspool_allocator_freefilt_proceopnotsuppumodem_paramem_rxfillffs_reallocblksphtree_RB_INSERT_COLORrandomcloserootvpaxe_miibus_writereguvm_pmemrange_addr_RB_NEXTugen_do_writeieee80211_eapol_key_decryptuserconf_maxlocnamespool_reclaiminitdisklabelpci_subclass_serialbususb_quirksbpf_sysctlvflushehci_openieee80211_bip_encapcddetachpmap_clear_modifytcpctl_varsarptimerbufq_dequeuetcp_reass_limitruaddsys___set_tcbrdstrategym_copymsystemsbcopy_pageip6_freepcboptsdb_free_breakpointsif_upcoredump_notes_elf32piixsata_chip_mapumsm_catimeout_add_nsecehci_intr1rt2860_enable_mrruvmfault_lookupm_extfreergephy_resetupl_intrucomprintural_matchdeflateBoundVOP_BWRITEbufq_fifo_peekrt_timer_queue_createm_cluncountwddonemsdosfs_ioctlpciide_dmatbl_writeupl_matchrt2560_stopno_constraintsys_opensr_crypto_change_maskkeywdc_alloc_queuergephy_funcsusbd_match_deviceinet6domainural_enable_tsf_sync_bus_dmamem_alloc_rangeether_crc32_be_updatepgdeletert2560_next_scanuvm_pageidlezerobwi_enable_intrswskbd_do_ioctl_scdead_vopsdb_symtabsi80321_irq_handlerieee80211_media_changeucom_detachuaddr_hint_createraw_attachural_set_rxantennahidkbd_cngetcscsi_ioc_cmddb_boot_sync_cmdastpendingifnewlladdruhci_noopphison_chip_mapether_ip6multicast_maxpipe_pooluao_initudav_iffifa_ifwithroutem_clinitifpspec_kqfiltertcp_notifyieee80211_match_bsscd9660_tstamp_conv7ural_free_tx_listffs_dinode1_poolieee80211_set_keyieee80211_bip_delete_keyem_smartspeeddb_print_positionrtflushclonedb_radixgetblksr_raid_turem_tbi_adjust_statsxscale_cache_flushD_rngmaxsmapwdc_ata_bioip6_mcast_pmtusoconnectrt2860_txural_initvtypesuvm_map_fix_spacenobuffers__lshrdi3data_abort_handler_addressin6_delayed_cksumrtrequest1usbd_errstrSHA256Update_intsr_scsi_ioctltcp_identtcp_rst_ppslimuhci_openbwi_pci_activateem_realignifinitsd_cmd_rw10cd_load_tocunpst_recvspaceuvm_map_mqueryget_ifidsr_infoscsi_io_getkue_initxscale_cache_purgeIDuvm_map_kmem_growraw_inputcd9660_reclaimrt2860_stopkue_ioctlfilt_logrdetachtimeout_add_btnd6_ifattachunpdg_recvspacedofaccessatpipe_closecd9660_inactivesoftdep_mountmsdosfs_rmdirdb_is_activemsdosfs_fsyncre_setup_sim_imcfdatadeflateInit_ffswi_usb_tx_lockusbd_do_request_async_cbufs_checkpathem_init_eeprom_paramspmap_pte_init_xscalepfxlist_onlink_checkdiskmapreaddb_elf_lookupm_tag_findinittodradler32blf_encvputaue_iffpte_l1_s_cache_mode_ptvector_page_setprottcbhashsizeworkq_syswqcd9660_setattrfilt_hotplugrdetachbwi_rf_set_nrssi_thr_11busbd_get_configieee80211_node_leave_rsnuaddr_kbootstrapufs_quota_initallocpidkqread_filtopscoredump_writebrgphy_bcm54k2_dspcodeusbd_setup_pipexscale_setttbem_read_part_numaue_csr_read_1xscale_cache_cleanIDbuf_acquireieee80211_beacon_allocatu_attachubsa_get_statusdolinkatbioopscpu_classesieee80211_add_htopbpf_setdlttcp_flush_queuepool_setiplmsdosfs_statfslboltpipe_inituvm_wait_plarn_mpath_priousbd_open_pipe_intraes_gcm_reinitsyncerprocrt2560_set_macaddrifa_print_rbufs_ihashinszcfreein_setpeeraddrinphymatchatu_taskwindow_inflatedb_readlinert2661_enable_tsf_syncether_ifdetachsr_meta_native_readieee80211_recv_probe_requhidev_get_report_descuserconf_histcurrndstatscy82c693_writemsdosfs_inactivepciaddr_do_resource_reserve_disabledpanicstrbwi_set_clock_delaypdc20265_pci_intrupl_newbufumass_scsi_cbscsi_delayext2fs_sync_vnodeif_startunpdg_sendspacesession0bwi_power_offviscpywsmouse_do_ioctlE_abs_lunsw_return_Usedehci_abort_isoc_xferhw_ver__umodsi3copyincomparamsiop_common_resetural_stopudav_sendcd9660_defattrohci_device_bulk_closeehci_reverse_bitsrtalloc1bs_notimpl_bs_sm_8uao_swhash_elt_poolufs_ihashgetdes_set_odd_parityuaddr_pivot_selectsigacts0uaddr_free_rbtree_RB_REMOVE_COLORfindblkmajormsdosfsvnode_filtopsntohlsorflushugen_caiophy_funcsuvm_mapent_tryjoinbwi_phy_config_11gttioctlarpintrqvprintfslpquesr_raid1_wu_doneohci_root_ctrl_methodsttycharssyncdelayuvm_vslock_devicewi_usb_infofrmugenreaduvm_pagealloc_multihidkbd_enableffs_mountwsmux_mux_closeicmp6errppslimbadaddr_read_2msdosfs_vopsuhci_add_intrconfig_process_deferred_childrenbufq_waitohci_ifcdieee80211_add_htcapsluphymatchxscale_cache_purgeID_Ebs_notimpl_bs_sm_2in6_setmaxmtuem_camsdosfs_roottqphyattachbpf_getdltlistrt2860_startm_tag_getuvm_map_freelist_updateuaddr_bestfit_insertsb_lockem_enable_tx_pkt_filteringohci_root_intr_abortuhci_polluaddr_bestfit_removert_labelscrypto_unregisterHMAC_SHA1_Finalupl_watchdogsuid_clearttwritedma_alloc_initatu_initem_activatebuf_rb_bufs_RB_NFINDbuflowpagesehci_activatert2661_set_basicratesswapdev_vpre_miibus_writereguipaq_methodsaes_xts_cryptieee80211_deliver_datadead_readufs_pathconffile_pooldb_boot_reboot_cmdohci_timeoutbwi_setup_tx_desc32unputcbwi_rf_lo_measure_11gendluphyattachVOP_CREATEcpuset_firstSHA512Updatecdce_stopifai_cmpbwi_rf_set_nrssi_thr_11guvscom_get_statusnd6_recalc_reachtm_intervalpagetables_startin_ifinitohci_device_ctrl_closepciide_mapregs_nativein_pcbhashlookupsys_mknodatem_setup_transmit_structureskp_dmare_eeprom_putbyteural_writeucom_cleanupVOP_ABORTOPehci_pcdcoredump_tradbwi_power_onem_identify_hardwaredofchownatsr_wu_done_callbackuhci_idoneuvscom_set_line_codingdefault_chip_mapsys_acceptuvm_map_entry_kmem_pooluvm_pagerealloc_multiieee80211_wep_decryptbwi_rf_calibvalwi_inquireehci_pci_takecontrolleradm1032cloneprobeuaddr_bestfit_pooltcp_rst_ppslim_countieee80211_recv_assoc_respieee80211_parse_rsn_bodyukbd_detachaes_key_wrap_set_keyif_clone_listtc_windupsys_futimesrt2661_update_promiscsdgetdisklabelsysctl_proc_cwdbwi_intrwi_do_hostdecryptsiop_table_syncinternal_commandpci_subclass_wirelessuvm_map_boundarymalloc_errintvlbwi_phy_init_11b_rev5ciphyattachin_losingsis_chip_mapVOP_SYMLINKgeteblkrt2661_suspendrt2661_detachusbd_set_interfaceem_force_mac_fcscsibusmatchinflateBackInit_crypto_kregistervn_ioctluhci_remove_bulkwi_usb_ctl_lockufsspec_readdb_show_calloutrt2661_set_txpreambleaxe_cdpipespacefiqvectorget_last_resort_ifidohci_alloc_stdcmd646_9_irqackip6_sendredirectsbwi_initcast_decryptddb_sysctlbwi_startukphy_caitimerfixip_stripoptionsieee80211_node_join_11gbwi_init_statechgsyn_cache_countuaddr_stack_brk_createieee80211_add_xratesnd6_timer_chugl_rxeofuvm_pseg_releasecpu_resetudav_ticktcp_ctlinputether_multiaddrstart_cleanerffs_blkfreeexit1ohci_detachbwi_mac_adjust_tpctlwsmouse_add_muxbdevvpifa_ifwithdstaddrehci_cdi80321_bs_mapuaddr_bestfit_selectuvmspace_duseddb_watchpoint_allocudav_ifmedia_changeselectroutein6_nigroupscsi_mode_sense_big_pageauth_hash_sha1sys_mkfifoatuihashrijndaelEncryptscsi_ioh_deltcp_keepintvluvisor_detachcdwriteufswrite_filtopsttybgconfig_searchphtree_RB_PREVwihap_sta_findusbd_printuvm_km_valloc_prefer_waitsyn_cache_poolpci_subclass_mass_storageffs_allocaue_tick_taskdb_preveephy_funcsinphy_funcsucom_hwiflowrgephymatchbswap32ipsec_exp_first_userlphy_serviceplimit_poolip6_defhlimumass_setup_ctrl_transferunp_connect2usbd_set_pollingrn_walktreepool_prime_pagepciide_ite_productssys_chownuvm_pagewirebwi_calibrateem_stoppci_vga_pciin6_joingroupsys_munlockhotplugattachinflateBackuvm_anfreeuhci_bus_methodsdofilereadvipip_sysctlbs_notimpl_bs_sr_1vn_statfilerw_exit_readieee80211_iterate_nodeswi_intr_enabletablefullumct_set_line_stateuhub_exploreupl_txeoftcp_maxidlevfs_getcwd_commonset_cpufuncscttyioctlsys_lstatieee80211_recv_wpa_group_msg1ieee80211_recv_addba_respohci_timeout_taskohci_hash_add_tdieee80211_tkip_set_keyiso_uiodircttykqfilterurl_activatecttyopenpmap_link_l2ptinet6ctlerrmapbwi_bbp_power_onicmp6_redirect_diagdisknamessched_queued_cpusumass_quirksdumploRMD160Updatemsdosfs_mountacphy_funcsffs_clusterallocbwi_calc_rssiuvscom_activatenullcnpollcuvm_km_inituvm_objinitbwi_hostflags_readpciide_acard_productsbzero_pageffs_sbupdateudp_sysctlsys_openatm_clcountbs_notimpl_bs_wm_1vmmapbsyusb_add_taskurl_int_miibus_readreguserconf_histlendb_list_breakpointsusbd_set_protocolrt2860_alloc_tx_ringrt2860_updateedcankmempages_minukbd_accessopsusbclosesis96x_setup_channeludav_matchvector_pagekq_ntimeoutssys_sched_yieldvmspace0bwi_phy_clear_statescsi_decode_sensettywaitwsmousedevprintuvm_map_setuptcp_syn_cache_sizewdc_default_vtbluao_grow_arrayieee80211_add_tieem_defer_attachetextifa_ifwithnetmemchrohci_device_ctrl_doneqsphy_statussqphyattachpte_l2_s_cache_maskcomp_algo_lzsieee80211_recv_barsysctl_cptime2scsi_mode_sense_pageboot_argspipelockumass_scsi_setupproc_pooluplcom_dtraue_intrudp6_inputsys_writert2661_next_scandb_get_valueural_set_txpreamblegeneric_armv4_bs_rr_2sb_maxusbd_fill_iface_datacd_set_pa_immedsr_uuid_print__bss_end__ip6_insertfraghdrcnstopextent_print_allihashtblieee80211_set_shortslottimesys_dup2em_phy_resetdb_inst_countdb_read_linesiop_productswd_get_paramsbread_clustersys_readlinkbwi_rf_writert2560_setup_tx_descext2fs_size__ashrdi3bs_notimpl_bs_mmapzErrorohci_intrxscale_cache_flushI_SEcrc32ip6_auto_flowlabelsvwsata_mapchanuipaq_cafintek_worklistdevid_copylf_splitifafreeVOP_STRATEGYtimeout_add_sectzucom_rtsxscale_cache_syncIrip_sendspacecoredump_writenote_elf32uhidev_writeusb_generic_tasksxscale_cache_cleanID_rngamap_addtcp_freeqif_setgroupattribsuhci_device_requestcom_attach_subrsii3114_dmacmd_readdvd_authrt2560_node_allocexphy_servicesiop_maumass_scsi_cmdcdreadrt2661_get_rfrt2560_enable_tsf_syncspec_inactiveehci_device_intr_starthidms_setupwi_func_usbwsmux_do_ioctlsys_sendtoicmperrppslimgeneric_filtopsknote_dropuftdi_setcue_watchdogin6_selectsrcrd_casoftclock_siem_82547_fifo_workaroundwi_usb_threadugl_watchdogsr_ccb_putin6_pcbsetportalldevsbwi_vendor_led_actrt2661_iter_funcwddumpicmp_do_errorvmcmd_map_readvnsmsc_initrandom_startcomconsfrequsbd_get_interface_altindexamap_extendsigpropvmapbufumass_scsi_switchi80321intc_intr_initdehashtblsocketopssiop_pci_matchscsibus_bioctlX_db_sym_numargsnd6_maxndoptuvm_map_clip_startffs_fragextendtcp_always_keepaliverawcbtablespec_readumodem_cdunp_markacphyattachdes_key_schedicmp_mtudisc_timeoutnwsmuxpmap_zero_page_xscalettyread_filtopsuvm_mapiic_printgetinoquotabrgphy_5708s_statusscsi_do_ioctlrtable_existsdisk_lock_nointrehci_free_sqhcd_resetX_db_foralluhci_pci_cascsi_ioh_addbwi_mac_reset_hwkeysscsi_detach_busudpstatroute_inputsetrootcd_read_tocural_amrr_updatecdioctlieee80211_defrag_timeoutbufq_switchcue_stopuvscom_detachifmedia_addatu_usb_requestfrag6_queuelxtphy_funcssr_matchusbd_set_config_indexlogopenluphy_serviceieee80211_add_rsn_bodyrt2560_txtimesr_raid6_initrt2661_rxratecd_buf_donescsi_devid_pg80breadntcp_hdrszscsi_devid_pg83tcbtableieee80211_recv_4way_msg2i80321_mem_bs_init__xordi3frag6_drainuvm_objtree_RB_REMOVE_COLORdosdiremptyigmp_slowtimoifpromiscre_disable_sim_imip6_setpktoptsfork_returnsys_getsocknamecd9660_lookupsr_concat_initricohrtc_cawi_usb_intrusbd_alloc_bufferinflatePrimemask_rnheadsw_reg_iodonepte_l2_s_protoufs_roottcp_sysctlVOP_SETATTRsmsc_chip_initpmap_kremovesigactsinitohci_pci_caffs2_blkprefdomknodatusbd_set_reportcpu_kcore_hdrexec_elf32_fixuprt_newaddrmsgvop_generic_lockcomconsiotuvmfault_anongetconsttybwi_detachural_bbp_readsr_ioctl_diskusermountext2fs_dirrewrite__ucmpdi2vn_closefilepci_findvendorumass_discoip_mtudiscvfs_free_netcredem_power_up_serdes_link_82575mld6_start_listeningcpu_mainbus_cakue_matchpmap_kenter_papidhashtblaue_matchusbd_get_protocol_nrssi_thresholduvm_mapent_forksharedm_pullupenterpgrpxscale_tlb_flushID_SEcrypto_freesessioncnbellm_copydatabufq_nscan_requeueatu_stopcd_setchanieee80211_get_probe_reqmtx_leavefilt_signalsigactsfreert2560_free_rx_ringwdc_default_write_raw_multi_4ttymallocupl_attachums_intricmp6_notify_errorieee80211_recv_probe_respbs_notimpl_bs_sm_4pcisubmatchkue_setmultimmioctluaddr_free_rbtree_RB_NFINDuvm_coredump_walkmapdb_nextumass_matchsched_choosesendsigohci_device_ctrl_methodsbpf_ifnameohci_cdural_ioctlsmsc_iffvfs_busytimecounterfilt_ufsdetachbufq_initlf_getlocksr_raid6_xorpsolistenpdc205xx_drv_probewskbd_compose_valuespec_getattrpciide_dmactl_readobio_bs_unmapiic_scanl1_lru_lockip_ecn_ingressmsdosfs_bmaprip_ctloutputffs_vtblif_getgroupieee80211_parse_rsnpool_debuguserconf_morekqueue_ioctlmax_processesem_free_pci_resourcessys_wait4rip6_recvspaceamap_share_protectieee80211_bar_tidfs_sysctlukbd_cnattachieee80211_ibss_mergeboot_filefilt_sordetachknote_activatepsignalieee80211_regdomain_compare_cnconfig_pending_incrusb_task_threadbwi_mac_unlockamap_pp_establishauth_hash_gmac_aes_192ieee80211_setkeysuvm_pmr_nextszatu_activateuvm_anon_initffs_reclaimbmtphy_causb_free_deviceusb_exploreifaddr_items_RB_REMOVE_COLORbufq_nscan_queuexscale_cpufuncsif_link_state_changepmap_virtual_spaceieee80211_add_wpaieee80211_eapol_key_check_micusb_disconnect_portpage0_endieee80211_add_capinfobpfpolluvm_pmr_nfindszupdatepriohci_activateciphy_fixupbwi_mac_lockbmtphy_servicesched_kthreads_createuhci_device_bulk_closeuhid_cdwskbd_cnbellbintimebwi_set_clock_modere_woluhci_intr1jmicron_chip_mappciide_print_channelswi_seekfilt_soreadpmap_remove_allrtable_addrt2860_mcu_bbp_writezeropageipsec_def_encbrgphy_bcm5401_dspcodeffs_nodealloccgbwi_mac_calibrate_txpowersoftintr_establishuvm_pmr_removeip4_input6pdevinit__iordi3uvm_pmr_findnextsegmentinetctlerrmapresetpriorityrt2560_set_slottimeenoioctlrt2860_watchdogwi_usb_start_threadflslbwi_dma_txstats_allocsigacts_poolpcaled_matchexecsigsconfig_initskip_fcicmp6_redirect_inputbuf_rb_bufs_RB_REMOVE_COLORrw_enteraue_read_macpciaddr_print_deviduvm_addr_destroysr_raid0_inituvm_pmr_size_RB_MINMAXdb_access_abt_spnd6_ra_inputffs1_blkprefin6addr_loopbackuvm_objtree_RB_MINMAXttypenduvm_swap_freepagesqsphymatchnd6_dad_starttimerin_revarpinputstrlcpyuaddr_bestfit_destroyX_db_symbol_valuesiopiic_attachehci_device_isoc_methodsumodem_setusbd_reload_device_descsmsc_read_regext2fs_advlockknote_fdcloseusbd_get_devcntehci_device_intr_doneem_get_pcs_speed_and_duplex_82575if_clone_detachpipe_rfiltopssiop_dmamem_allocubsa_openin6_cksumcomcninitpciide_print_modesstrncmpcsrc_ptedes1_decryptvfs_shutdowngetsockieee80211_get_deauthbwi_newassocbs_notimpl_bs_c_4upl_startsyn_cache_respondif_creategroupllinfo_nd6sbcheckreservepreemptuvm_iobioattachieee80211_begin_scanunixdomaindb_next_free_breakpointbwi_led_attachbwi_tbl_write_2smdscsibusattachugl_devsumct_rtssyn_hash1ulminwihap_data_inputi80321intc_do_pendingdb_last_symtabproc0paddrrn_addmaskifaddr_itemspciaddr_do_resource_reserveusb_attachbpf_bufsizeselscanpciide_promise_productssoo_pollumodem_activateuvm_map_uaddr_ertafidx_maxsig_filtopsknote_processexitohci_device_bulk_transferukbd_cdricohrtc_getcalwskbdopenrt2860_reset_rx_ringrt2661_eeprom_readem_startttclosurl_rxeofipsec_soft_allocationssleep_setup_bus_dmamem_mapip6_fragmentnet_sysctlcom_cdbwi_mac_init_tpctl_11bgtimeout_adjust_tickswskbd_do_ioctlxscale_cache_cleanD_Euvm_pmr_size_RB_FINDudv_listdead_ioctlaue_initusb_matchbwi_txeof__wdccommand_startsysctl_iflistvwakeupcmd680_channel_mappci_subclass_bridgeif_clonersrt2860_set_txpreamblewdcbit_bucketvgonewdc_probe_capspmap_initializedtcp6_ctlinputsched_init_runqueuesdb_stack_trace_cmdusb_allocmemsd_sizeufsspec_closend6_prefix_offlinkuvm_anon_dropswapwi_detachucom_lockigmp_inputkmemusageswcr_sesnumlf_getblockpciide_irqackautoconf_attdet_mtxumodem_attachtcp_rttdfltcleanerprocpdc202xx_pci_intrieee80211_parse_edca_params_bodysbappendstreamm_tag_copy_chainrt2661_bbp_writeohci_handoversowrite_filtopssr_chunks_unwindstrncpycseadddb_disasmsdreadsys_pselectupdatefatscue_memata_perrorvfs_getvfssr_alloc_resourcesaue_txeofffs_sync_vnodedeflateInit2_sr_raid6_discipline_initproc_stopvfs_vnode_printdb_history_lastrrticks_initbio_status_initusbd_set_port_featurebpfilter_createsysctl_locklockfpoolwihap_disassoc_reqieee80211_find_nodecpu_switchtoucom_cahtonlsched_all_cpusin6_mask2lentcp_dooptionsdos2unixtimesys_sigactionsr_scsi_donedeupdatusb_fill_di_taskehci_ifcdSHA256Transformrndlock__negdi2in6_purgeaddrcpu_modeluhci_softintrsii3114_read_regarm_dcache_align_maskcttyreadcd9660_unlockpciide_dmactl_writeuserconf_cmdsural_taskbwi_set_bssidiophy_statusschedclockbpfioctlconfig_attachsr_sensors_createohci_alloc_sitdcue_rx_list_initbwi_hostflags_writert2661_attachhookbmtphy_statusdisk_unbusysysctl_fileusb_syncmemugen_detachi80321_io_bs_freesoisconnectedurlphydebugamap_clean_worksuhci_alloc_std_chainusb_block_freememVOP_PATHCONFumass_fixup_sonydk_mountrootassertwaitokdb_run_modescsi_minphysauth_hash_key_md5siop_script_syncxscale_cpwaitvattr_nullsys_getsockoptrt2661_tx_mgtre_rxeofumct_paramuhidev_attachdb_vprintffrag6_nfragpacketsdb_linesr_raid0_assemblert2860_wakeupbwi_cdpool_allocator_largeuvm_anon_lockloanpgvfs_sysctlite_chip_mapcpu_get_controlVOP_READLINKbuf_mem_initumass_cbi_methodsdb_ed_stylemii_submatchuvmexp_printohci_root_intr_transfermsdosfs_pathconfoldpidstimeout_wheelbwi_pci_conf_readbpf_m_xhalfumass_io_getaverunnablecd9660_getattrttyfreettysleepehci_root_intr_donert2860_rx_intratu_get_opmodeunp_disposescsi_inquireufs_getattrBlowfish_encipherieee80211_mhz2ieeevfs_exportuplcom_closesr_hotspareuvm_km_pgremoveex_region_plfscalesmsc_matchffs_alloccgblkip_optcopyvfs_registerieee80211_proto_attachm_livelocksys_dupmcllowatmii_printieee80211_setup_ratesbpfilterattachproc_stop_topci_find_devicetimeout_todoswcr_initdb_lcbwi_updateslotumsm_truinstall_changemodecpu_read_cache_configumsm_detachwdc_sii3114_vtblsr_ioctl_createraidpanicget_pc_str_offsetciphy_resetural_rxeofcue_rxeofL_cksumdatamsdosfs_lockseltruepci_subclass_systembpf_m_xwordscsi_xs_syncieee80211_recv_group_msg2softdep_initializestackgap_allocunp_shutdownieee80211_tkip_encryptwi_resetdovutimensdummy_get_timecountext2fs_sysctlgeneric_bs_wm_4kthread_run_deferred_queuearc4_initwdreadlastdaycheck_execdb_max_linewi_usb_cdtcp_initpte_l2_s_cache_mode_ptdeferred_config_queueciphy_funcsucomreadcbbuf_rb_bufs_RB_MINMAXnetisr_initipport_lastautouhci_endpdsis_setup_channelwsmux_detach_sccom_raisedtrdb_last_commandicsphy_statusip6_pcboptwinSlotCntvn_kqfilterext2fs_syncsched_stoleni80321_io_bs_unmappte_l2_s_prot_maskpciide_intr_flagudav_ioctlcrypto_registercache_purgevfspostsigsys_pathconfcue_open_pipesin_addmultigetmicrotimebs_notimpl_bs_rm_8maxthrsleepumass_clear_endpoint_stallohci_setup_isocaue_newbufscsi_probedevaxe_ax88178_initi80321_i2c_attachtcp_templatemsdosfs_readdb_object_print_cmdieee80211_notify_dtimrt2860_select_chan_groupfintek_write_regohci_initcomopensata_setup_channelusbd_setup_xferauth_hash_hmac_sha2_512_256ieee80211_tree_RB_MINMAXmtagpoolpiix_chip_mapbcopyiic_attachwsmouseclosewdog_autourl_tick_taskcue_detachusbioctl_bus_dma_inrangekqueue_wakeupip6_unknown_optuaddr_rnd_removetcp_reasssys_getfhext2fs_vgetrt_timer_timerrtbl_id_maxcomcnputcKERNEL_BASE_physSHA1Update_intehci_alloc_sqtdcuio_applygeneric_bs_rr_1ni6_addrsaxe_resetdefrouter_addreqin6_clearscopebwi_pci_cand6_dad_ns_inputuvmpd_tuneusbd_set_addressudav_openpipesffs_setblockipsec_expire_acquirepci_suspendkue_stopicmp6_mtudisc_cloneatu_send_commandinflateResetmemcmpwskbd_init_keymapobio_bs_subregionnamecache_rb_cache_RB_REMOVE_COLORumct_dtrip6_dad_pendingieee80211_rate2plcpmsdosfs_createcd9660_startdb_output_linebwi_get_card_flagsbwi_rf_get_gainscomstartaes_xts_reinitdb_examinecfroots_sizedb_end_linebwi_mac_gpio_finitickadjpool_alloc_item_headeriq80321_irq_mapip6_splithdruvm_map_addr_augmentsiop_clearfifotcp_secret_initieee80211_recv_sa_query_reqsbreserveundefined_initvrecycleem_phy_hw_resetubsa_matchextent_printieee80211_alloc_nodeblf_ecb_decryptcrcopydb_symformatural_newstatewdcloseundefined_handlerssys_revokeural_free_rx_listsysctl_stringsys_rebootuvm_unmap_kill_entryext2fs_specvopsbufpoolproc_finish_waitwdccommandext_dist_code_bus_dmamap_load_buffercpu_forksigonstackuaddr_kbootstrap_selectwi_write_data_iodb_print_ifattylistwdopenuvm_vslockre_initdeflateResetuvmfault_update_statscast5_setkeypci_ndomainsttyoutputsr_raid5_wu_donekue_caexplicit_bzerocd9660_tstamp_conv17wskbd_calxtphy_statusuftdi_8u232am_getratetqphy_cdcopyaddroutcryptodev_cbumodem_detachcpuset_add_alluhci_root_intr_abortVOP_READbwi_phy_calibrateufs_ioctlffs_freefilein6ifa_ifpforlinklocallastdtimegetdisksys_setuidiq80321_pci_init_wdc_ata_bio_startstart_updatesiop_common_attachudav_cdusbd_clear_port_featureusb_abort_task_threadufs_quota_free_blocks2re_stopsenditsr_crypto_decryptudp_detachbufq_fifo_destroyacer_dma_initcluster_writernd_event_tailsr_raid5_createhidkbd_decodeuvm_setpagesizeehci_root_intr_closetcp_xmit_timersr_raid1_rwucomwritein6_recoverscopensphy_serviceaue_ticki80321intc_cdtimeout_add_tvticksvwsata_write_regmclpool_warnmsgi80321intc_cascsi_pending_finishdb_termscsi_preventmmcloseieee80211_get_assoc_respcd9660_accesssr_wu_getffs_statfscpuset_complementrijndael_set_keywdcprobeiophy_cdudp_recvspacekm_allocfdropsr_block_puti80321_mainbus_matchgf_initsyn_cache_unreachuserconf_histszsys_getrlimitrt2860_attachhooki80321_mainbus_foundicmp6_errcountbpf_attachdfintek_cdicmp6_ctloutputieee80211_ba_move_windowcpuset_issetsvwsata_dmactl_writeufs_dirremoveumct_setrgephy_serviceieee80211_add_timif_attachsetuppipe_writem_clsetwmssr_set_chunk_stateuvm_map_addr_RB_FINDcryptof_pollin_pcblookup_listensbappendm_copybackscsi_remove_linkuvm_swap_puticmpbmcastechoHMAC_SHA1_Initextent_print1db_continue_cmdrt2661_mcu_beacon_expireehci_timeoutbufheadconfig_scanwi_get_nwkeykp_pageablesr_raid6_addiopmap_copy_page_funcripsrciso_nchstatsem_update_eeprom_checksumkue_txeofugenkqfilterural_amrr_startnlineswdb_restart_at_pcdb_sstep_printohci_rem_edether_ifattachinflateSync__wdccommand_doneumass_adjust_transfersignal_initfill_drlistffs_updatedb_print_formatrt2560_tx_bcnwsmuxcloseunix2dosfnspec_advlockmtdphy_cdfragtblraw_sendspaceubsa_cauvscom_breaknullopre_attachuftdi_2232h_getrateAES_CMAC_SetKeycomdiagextralocunsleepvop_generic_bmapwdprobescsi_xs_getX_db_lookupmtdphy_funcsuipaq_seti80321intc_matchblf_encryptsched_proc_to_cpu_costohci_alloc_std_chainipintrgetnanouptimeohci_pci_detachuhci_pci_detachudav_activatei80321_pci_attach_hookdes3_encryptmaxdmaprt2661_tx_dma_intrural_alloc_rx_listusb_block_allocmemext2fs_symlinkdb_skip_to_eolip6_savecontroldevice_registerpciide_chan_candisablesr_raid6_set_chunk_statend6_dad_stoptimerq_to_bmountrootsyn_cache_resetdb_inputcharuhci_device_intr_doneuhidev_opendb_boot_cmdsundefined_entryip_initreaddeprocess_read_fpregsohci_freexural_txtimecd9660_rrip_getnameufs_check_exportdes_encryptsysctl_rdintpdc20268_setup_channelcd_interpret_sensein_mask2lenbwi_ack_rateural_eeprom_readscsi_iopool_destroylodirtypagessr_ioctl_disciplineem_probeumct_get_statusfindwin95VOP_WRITEsys_nanosleepre_rx_list_initstart_init_execifa_update_broadaddratu_detachnd6_addr_addifa_ifwithaddrclock_ymdhms_to_secssiop_add_devuhci_root_intr_transferbwi_dma_freebwi_phy_init_11b_rev2db_write_cmdrootduidif_clone_attachuplcom_get_statussys_getfsstatohci_abort_xferbpfopencdstrategynetisr_intrem_config_collision_distnatsemi_irqackdeflatePrimerandomwrite_filtopsnd6_slowtimo_chuvm_km_valloc_alignenc_xform_nulldb_max_widthip6_pullexthdrmalloc_printitcpu_idle_enterbwi_regwin_disable_bitscomwriteuvscom_intrbuf_kva_starttuagg_subVOP_RENAMEauth_hash_gmac_aes_128cdclosesys_fchdirsr_crypto_readsysctl_ifqprocess0ieee80211_send_eapol_key_reqm_cltick_tmorandompidwd_cdurl_initfilt_ttyrdetachrt2560_update_plcparp_inuseuhidwrite_bus_dmamap_destroyvn_polluhci_device_isoc_methodsinet6swrouteswdosdirtemplatemainbus_cddb_uvmexp_print_cmdre_ioctlsys_mincorepdc203xx_setup_channelieee80211_tree_RB_REMOVElastsecondswdog_timeoutpci_probe_devicewsmousedoopenwi_get_txpowerural_plcp_signaludav_stopusbd_error_strslun_switchamphymatchtcp_maxpersistidleudav_tx_list_initspec_ioctlufs_initproc_reparentrt2661_select_antennauvm_exitfc_bmapcallspr_rmpageffs_initcluster_wbuildsr_crypto_createsvwsata_dmacmd_writescsi_ioh_setbootsyncuvm_initaue_attachieee80211_crypto_attachsys_ioctluvm_map_addr_RB_NFINDif_free_sadldb_dotbwi_mac_gpio_initucomstopieee80211_node_joinfilt_bpfrdetachcompress2umodem_openicmp6_initbwi_mac_shutdownbs_notimpl_bs_rm_1disassembleuvm_mapent_free_insertfilt_ttywritepool_update_curpagesiop_script_readhid_end_parsein_setsockaddrcy82c693_readbpf_moveiniq80321_hdlg_irq_mapostypevndbuf_pooluplcom_resetuvm_page_physloadaxe_iffucomstartreset_entryuvm_pmr_remove_1strangere_setup_hw_imwdcresetwdc_exec_xferip6_insert_jumbooptipintrqtuaggohci_noopsr_raid5_intrusb_frag_freelistip_slowtimordsizerijndaelKeySetupEncrt2860_load_microcodeubsa_rtsip6_nexthdrrtdeletemsg__bss_startumsm_openrt_tab2domdcphy_cdbwi_rf_readpciide_via_productskue_rxeofsiop_attachrijndael128_encryptVOP_KQFILTERukphy_funcssys_msyncdeflate_compresswskbdreadsbappendrecordevcount_detachsd_cabwi_free_txstats64ixp_chip_mapsoftdep_fsync_mountdevinitmsgbufehci_device_bulk_startwsmouse_attachpciide_intel_productsuipaq_dtrmemsetcuio_copydatapipe_free_kmemufs_getlbnsieee80211_get_actionieee80211_sa_query_requestphysiosr_ccb_doneohci_strin6_selecthlimdb_show_all_vnodesupl_sendwdattachdb_symbol_is_ambiguousmii_phy_delete_mediausbd_set_report_asyncin6_unlink_ifacrypto_kdispatchicmp_mtudisc_clonert2661_rf_writeuvm_pmr_insert_sizesodisconnect_spllowerumct_closesys_setgroupsmainaue_csr_write_2lxtphy971_funcsucomttyohci_device_bulk_doneether_crc32_le_updatemtdphymatchtimespecfixbwi_read_spromsr_raid1_set_chunk_stateuplcom_opensiop_lookup_productuaddr_bestfit_createural_set_basicratesip_flushieee80211_delete_keykue_startre_watchdogsiop_scsicmduvm_unmap_removepmap_alloc_l1svwsata_chip_mapi80321_mem_bs_unmapicmp_errordb_hangmanwsmuxdevsbs_notimpl_bs_sm_1upl_rx_list_inituvm_swap_markbaddes_set_keykqueueopsrt2860_iter_funcsmsc_miibus_statchgvholdbufq_fifo_dequeuepciide_map_compat_intrubsa_parityidgen32db_help_cmdrt_if_removesr_minphysscsi_default_getghash_gfmulusbd_no_quirkrt2560_ack_ratere_read_eepromsis_hostbr_matchuipaq_matchm_adjsr_wu_donemld6_stop_listeninguao_shrinkhotplugioctlsvwsata_read_regpmap_map_chunkextent_alloc_subregion_with_descrppsratecheckkmemlimitbuf_rb_bufs_RB_PREVrt2560_rf_writebwi_ioctlbwi_init_rx_ring32amap_copybufq_drainphysical_endbwi_phy812_valuebwi_rf_calc_nrssi_slope_11bbio_statusuhidpollsched_wasidlesr_raid5_initieee80211_ieee2mhzieee80211_dup_bssi80321_io_bs_mapuaddr_hint_destroylf_findoverlapsr_raid_start_stopfilt_msdosfsvnodebwi_txtimelf_wakelockkv_anydb_sym_numargskue_attachhookdumpconfAES_CMAC_Initwi_rxeofehci_pci_detachbrgphy_cahpt_pci_intruaddr_lin_selectdead_badopbwi_dma_mbuf_destroypciide_dma_finishpool_large_alloc_niblf_cbc_decryptcalcrusys_unlinkdb_cmd_listmainbusmatchrt_setgatetcp_ack_on_pushpmap_growkernelext2fs_rmdirufs_chowndofchmodatsysctl_intupl_tx_list_inituvm_shutdownkqueue_closepte_l2_s_cache_modeuvn_initstrlcatsysctl_int_arrbs_notimpl_bs_wm_8uvm_map_set_uaddrcdce_matchsoftintr_dispatchdisk_unlockpciide_cypress_productsufs_ihashremtaskq_destroyieee80211_recv_4way_msg2or4cttywrite_bus_dmamap_createSHA256Inittcp_update_sndspacesr_crypto_doneurl_stop_taskpciaddr_device_is_agpsdmatchusb_freememudav_txeofpool_chk_pageproc0cdce_initufs_renameaxe_caext2gennumbersr_bio_ioctlbwi_rf_calc_txpowerudav_attachuvm_map_entrybyaddrsr_already_assembledusbd_get_hid_descriptorrt_ifannouncemsgsoo_readbwi_rf_lo_update_11gwdc_scrub_xferuvm_km_doputpagepciide_vendorspci_get_powerstateufs_opencopyout_statfspmap_modify_pvi80321_intr_establishm_catbwi_free_tx_ring32splxbwi_regwin_switchohci_pci_attachrtinittqphy_statuscluster_collectbufskp_dma_contigsiop_handle_qtag_rejectwi_write_data_usbumass_scsi_minphysuvm_swap_inittcp_nowaue_miibus_statchgdb_trace_until_matching_cmdproc_printitural_bbp_initdes1_setkeyunp_gcsys_clock_gettimeip6_hdrnestlimitcsefreepool_catchupcpuset_clearxscale_cache_syncI_rngfrag6_initsiop_sdtr_negbuf_replacevnodeuvm_pmr_size_RB_NFINDiq80321_pci_intr_mapre_miibus_readreguvm_mapent_addr_removetimeout_setrdread__subdi3ntohsmsgbuf_putcharbwi_media_change_bus_dmamem_freedb_boot_poweroff_cmdsd_flushcd_setvolext2fs_mkdirohci_openpte_l2_s_coherentext2fs_direntersys_symlinkatmii_pollstatrlphy_cawdgetdisklabelrw_exitpciide_machdep_compat_intr_disestablishkv_pagedupfdopeni80321intc_calc_maskidgen32_initbwi_dma_ring_allocrt2661_amrr_node_freeifmedia_list_addpidhashrt2661_updatestatsrtprefxscale_context_switchuvm_totalencdebugugl_sendicmp6_ratelimitdb_unread_charsr_raid1_createsys_mkdiratiic_searchdofstatatstart_inituhub_attachieee80211_recv_assoc_reqether_fakeaddrsysctl_tc_hardwarert2661_prepare_beaconsmsc_rxeofscsi_ioc_ata_cmdtcp_mssdfltrt2661_alloc_rx_ringrt2860_updatesloti80321_bs_unmapuvm_swap_freeatu_newbufdata_abort_handlerbwi_tbl_write_4bs_notimpl_bs_r_1umsm_closeaxe_initdb_look_charsr_block_getuhidev_set_reportin_pcbdetachmsdosfs_vfsopststohzaue_ifmedia_updcd_sizettycheckoutqrt2560_watchdogpiix_timing_debugicmp6_mtudisc_callback_registerdb_set_variableuvscom_set_linevm_map_unlock_read_lnaue_causb_explore_tasksrnd_event_spacesr_concat_rwpmap_clear_referencert_getmetricswdc_ata_bio_kill_xferin6_ifdetachdb_search_symbolcn_tabswaplist_insertsmsc_lock_miiip_forwardsensors_taskqextent_createrdclosebpf_freeddisklistin6_lifaddr_ioctlsys_fstatfsurl_txeofkue_devsbs_notimpl_bs_sr_8m_injectem_mta_setip6_mforwardingffs_isfreeblocki80321_mem_bs_freeseltrue_kqfilteruvm_map_lookup_entryhztoicsphymatchBlowfish_expandstatebs_notimpl_bs_w_4ieee80211_get_probe_respdead_strategypciide_dmacmd_readswi_handlergcu_miibus_writeregni6_store_addrsspec_fsync__wdcwait_resetuvm_map_deallocateicmp_reflectieee80211_parse_wpascsi_xsh_iohext2fs_reclaimpciide_acer_productsffs_ballocsys_getgroupssr_raid5_xorieee80211_node_attachsys_linkatuhub_cdwi_start_usbgeneric_bs_wm_1ip6_raw_ctloutputkernel_textumodem_get_capsufs_startsigstkinitbrgphy_mii_phy_autoohci_devd__end__kinfo_vdebugbwi_start_tx32rt2860_ampdu_rx_stopnsphy_reseturl_sendcdce_encapufs_bmaparrayfragtbl8i80321_mainbus_attachuvn_sync_lockaes_ctr_setkeyumct_attachurl_resetusb_needs_exploreswaplist_findufs_quota_alloc_blocks2fc_fileextendsfilt_sigattachre_startwsmouse_cdricohrtc_settimeVOP_FSYNCbwi_mac_get_propertyffs_sysctlipport_hilastautoarpinit_doneusb_wait_taskuvm_anon_pageinspec_closecd9660_closeuvm_map_mkentryem_initialize_receive_unituvm_map_addr_RB_REMOVEsys_shutdowncngetcehci_rem_qhsii_fixup_cachelinetc_adjfreqrnd_statesuaddr_pivot_createm_gethdrem_dma_mallocugen_activateconfig_rootfoundcue_cdputcsiop_resetsii3114_mapreg_dmaieee80211_phymode_namebufbackoffricohrtc_attachsysctl_rdstruct__divsi3uhidev_cdwsmousereadsr_raid1_initxscale_minidata_clean_sizeschedcpui80321_gpio_pin_readbwi_mac_bss_param_initrt2661_attachurlphy_servicesbappendcontrolukbd_set_ledswihap_sta_timeoutsiop_update_scntl3pciide_nvidia_productsugenread_intr_filtopssoftdep_flushfilesdb_access_und_spipv4_inputm_getclrpool_headwsmuxioctlsr_crypto_read_key_diskpcaled_cdipforwardingdb_lexohci_device_isoc_transferieee80211_get_cts_to_selfusbd_open_pipe_ivalicmp6_redirect_timeoutsyn_cache_lookupbwi_setup_tx_desc64prtactiveksym_upcaseufs_makeinodescsi_xs_ioip6_process_hopoptsusbd_find_edescif_link_state_change_taskfilt_ttyreadsys_getpgiduhci_runcom_common_putcswaplist_trimcache_lookuprdioctluhci_allocxobsd_pci_mem_findrijndaelKeySetupDecdb_boot_crash_cmdbwi_rf_on_11auvm_objtree_RB_INSERTsysctl_tcurl_detachbs_notimpl_bs_rr_1umass_scsi_sense_cbrijndael_encryptricohrtc_clock_writeieee80211_recv_mgmtbwi_newstate_beginumsm_get_statusaxe_detachdumpsizesowwakeuppci_matchbyidukbd_keydesctabsr_raid_inquirysmsc_setmacaddressextent_freeuvm_aiodone_daemoni80321_gpio_pin_ctladdupc_tasksched_syncusbd_clear_hub_featureext2fs_vopsieee80211_send_4way_msg3db_mount_print_cmdcomcloseiopxs_mainbus_caeephy_attachsetsigvecsiop_dmamem_freeurl_iffsys_sendmsgi80321_bs_barrieruhidopenvn_marktextiic_cdbrgphy_bcm5411_dspcodestrcmpsys_quotactluhidev_matchsr_raid_startwuieee80211_get_hdrlenuaddr_pivot_destroytcp_mtudisc_increaseulmaxatu_txeofin6_pcbconnectdehashluphy_cakue_cduvm_pmemrange_addr_RB_INSERThook_disestablishexphy_funcsbpf_catchpacketffs_isblocksr_concat_createucomwritecbdb_stack_trace_printusbd_find_quirkuvm_swap_allocpagesuvm_aobj_poolhotplugclosedb_show_frame_cmdsys_adjfreqpci_cadb_examine_cmdqsphy_funcsuvscom_seticmp6_reflectsetrunqueueudv_attachsettimecdce_rx_list_inituhub_intrarm_pcache_typertable_inituaddr_lin_functionsuvm_addr_entrybyspaceata_set_modemii_phy_auto_timeoutsyn_cache_getnetisrdb_clear_breakpointsttyrubieee80211_get_ratevop_generic_islockedrt2860_reset_tx_ringuaddr_hint_poolm_pulldownbufcachepercentbwi_mac_detachacer_pci_intrpmap_initufs_rmdircryptodevkey_cbrlphymatchieee80211_next_scanpmap_zero_page_funcarmv4_tlb_flushD_SEminsr_meta_native_writeuhci_device_ctrl_abortip6_initconfig_detach_childrenrawcbpdc203xx_write_regsmsc_detachukbd_cngetcz_errmsgtcpcb_poolsr_shutdownhookrt2860_updateproti80321_pci_make_taguvm_map_addr_RB_INSERTBlowfish_stream2worduhidclosetimeout_add_msecipip_allowsys_polluvm_map_clip_endufs_makedirentryusbd_set_configuvm_mapent_mergeieee80211_recv_addba_reqm_defragem_write_pci_cfgrtable_l2setvnode_hold_listlastdosdateudav_unlock_miibuf_rb_bufs_RB_NEXTuhci_add_bulkral_cdufs_linksched_choosecpusys_mkfiforicohrtc_matchuaddr_free_rbtree_RB_REMOVEzcallocdb_cmd_searchural_read_eepromin6_ifinitin6_leavegrouprtlabel_id2sasqphy_caem_reset_hwsddumpiminsys_chflagsobio_bs_tagget_hw_ifidKQRELEdelaypci_reserve_resourcessdstartdb_machine_command_tableip6_hopopts_inputddb_regsselfalseieee80211_media_initricohrtc_gettimescsi_default_putsr_free_resourcescom_enable_debugportpage0_datavn_isunderusbd_get_port_statusuvm_pageoutpffindtypepdevnamespci_subclass_dockuipaq_breakqsyncehci_resetwi_setmultiuvn_clusterifaddr_items_RB_MINMAXre_gmii_writeregcd9660_vptofhwi_attachusb_camii_phy_downuvmspace_forkraw_initknote_enqueueums_accessopsudpcksumtcp_sendspaceurl_csr_write_4db_maxoffuvm_pmemrange_addr_RB_REMOVE_COLORffs_oldfscompatieee80211_add_rsnrijndael_decryptwdcdetachmaxlocksperuidfilt_ugenrdetachin6_matchlensys_madviseupl_openpipesehci_device_ctrl_methodsrt2560_plcp_signalscsibusdetachdisk_attachwskbd_displayioctllm75probeip6_clearpktoptsncpusdb_cmd_loop_donearptfreeubsa_detachfilt_ugenread_intrdb_show_arptabbufadjustcom_detachieee80211_ccmp_encryptaxe_stopural_set_macaddrbs_notimpl_bs_w_2dead_printeephy_serviceinphy_servicemii_media_tablesr_discipline_freebwi_rf_lo_devi_measurewdstrategyrt2860_set_macaddrttyprintfi80321_pci_bus_maxdevsreaperprocsigcodedb_elf_search_symbolhpt_chip_mapipip_inputdeflateCopyieee80211_send_group_msg2db_delete_watchpointcomttybuf_undirtysysctl_tstringsr_meta_cleardb_watchpoints_insertedusbd_start_nextxscale_cache_cleanDfilt_ttywdetachamap_swap_offpool_allocator_nointrbwi_pci_attachsys_sysarchallprocessrt2560_disable_rf_tuneBlowfish_decipherbio_validateigmp_initmii_phy_add_mediafilt_msdosfsreadwritecpu_reset_needs_v4_MMU_disablecache_zapMD5Initem_txeofpcaled_gpio_pin_writecryptodesc_poolbus_space_write_raw_multi_2ffs_vfsopssysctl_mallocwihap_ioctlieee80211_outputfrag6_slowtimouvm_pmr_insert_addruvm_map_hintwant_reschedrt2661_amrr_node_allocpmap_bootstrap_pv_allocatormsdosfs_mkdirkthread_create_deferreduhci_free_sqhieee80211_ioctluhidevsubmatchcrc32_combinebufq_simple_nscandevid_freeboot_eaddrre_rx_list_fillieee80211_sa_query_timeoutscsibusactivatend6_timercomcnpollcatu_matchbioopenbwi_phy_set_bbp_attenqsphy_servicein6_ifloop_requestcd_patterns__cmpdi2sr_crypto_create_keyssd_ioctl_inquiryscsi_xsh_adduvm_pmemrange_addr_RB_FINDraw_detachscsi_xsh_runqueuepmap_get_pdeural_read_multibs_notimpl_bs_wr_1domainnamelenehci_pollpciattachigmpctl_varsusbd_get_report_descriptorsd_thin_paramsip_rtaddrfiledesc_initrt2661_enable_mrrload_dsatag_switchurl_ifmedia_statuspciide_pci_readatu_get_cmd_statuscue_csr_read_1vrelewi_set_pmwsmux_do_displayioctlohci_alloc_sedem_set_media_typeem_update_link_statusscsi_xs_errorprtrealloccheck_consoleamap_freeem_detachin6_domifattachugen_get_alt_indexusb_blk_nfreend6_prefix_lookuptc_getfrequencyrt2661_mcu_cmd_intruhci_device_ctrl_methodsbwi_rf_lo_adjustsync_inactivespec_printext2fs_lookupmsdosfs_openehci_hubdext2fs_linkvop_generic_revokeohci_hash_add_itdieee80211_add_erpieee80211_decapfilt_sigdetachfilt_seltruedetachext2fs_renameipsec_def_authuhci_add_loopusbd_setup_isoc_xferttywflushcd9660_rrip_offseturl_startwskbd_default_keyrepeat_datacomcnmodeclosefcomioctlumass_cbi_resetscsi_ioh_deqsoftdep_sync_metadataif_clone_lookupgetmicrouptimedisk_openpartmii_tickip6_dad_countem_pci_clear_mwiatu_complete_attachumct_breakuvm_pager_dropclusterfilt_generic_detachuvscom_rtsip6_getmoptionssensor_task_unregisterehci_intrlist_timeoutbwi_rf_calc_rssi_bcm2053pool_print1wdc_ioc_ata_cmddb_breakpoint_listcd_get_parmspmap_extractrt2860_set_chanin_purgeaddrnd6_ifptomacwsmousedoioctlamap_unaddural_watchdoguvm_pmr_insertcd9660_printsr_meta_saveohci_rhsc_enableif_congestionnfilescd9660_islockedin6if_do_daduhci_root_ctrl_transferrt2560_amrr_timeoutcue_txeofrt2661_amrr_node_findatu_rxeofaue_detachcryptodev_keyieee80211_iserp_stapipe_kqfilterdowait4em_configure_k1_ich8lannforce_pci_intrext2fs_openpmap_devmap_find_papmap_kenter_cacheusb_insert_transferaxe_matchukbd_keymapdatasr_meta_validatestopprofclockbufq_nscan_destroydb_hangbwi_rf_on_11bgnullioctlcertance_irq_mapuaddr_pivot_printcryptof_closepte_l2_l_cache_modeisohashrt2860_rssi2dbmmclsizesparsediskre_eeprom_getwordrt2860_calibwi_set_debugbcstats_printbwi_regwin_selectbreadem_intrieee80211_node_copyamap_lookupipctl_varsbwi_init_tx_ring64apollo_setup_channelpmap_page_removert_timer_remove_allwskbddevprintuhid_intrpcaled_gpio_pin_readrt2860_free_tx_poolwdc_output_bytesatu_ioctlieee80211_classifyproc_stop_sweepieee80211_media_statusiophy_capmap_set_pt_cache_modescsi_xs_exectcp_usrreqmichael_keydb_playsieee80211_setbasicratessd_interpret_senseuvm_map_pageable_pgonuvm_addr_invokeudp_usrreqifmedia_initrtable_l2ext2fs_vfsopsuvm_mapent_freeext2fs_inactivedead_bmapdb_guessesif_getgroupmembersdb_show_all_poolssoo_kqfiltercpu_startupamap_refehci_device_bulk_transferuhci_device_isoc_transferdb_command_loopwdc_ioctlamphyattachrt2661_updateslotfdexpandcoredump_countsegs_elf32sr_wu_inittickswdc_ata_presentpdc20262_dma_finishmsdosfs_closerd_detachpool_do_gethotplugreadext2fs_setattrsysctl_clockratevn_rdwrohci_close_pipend6_need_cacheip6intruftdi_activatebwi_phy_writesyncer_maskwdc_default_write_raw_multi_2uvm_pagedeactivatecy82c693_initufs_unlocktcp_ctloutputrt2860_mcu_cmdrt2661_plcp_signalukphy_statusieee80211_derive_pmkidMD5Updateblktochrifmedia_settask_setem_setup_interfacebio_lookuppmap_createuvm_map_extractsr_crypto_meta_opt_handlernd6_prelist_addufs_removepciide_activatesysctl_tc_choiceptsignalboottimecd9660_readlinkxscale_cpu_sleepVOP_ADVLOCKdb_watchpoint_cmdaxe_watchdogwskbd_mux_closefrag6_inputuhci_device_intr_closecompressBoundpmap_alias_distunpst_sendspaceffs_indirtruncsmsc_cdieee80211_add_ratessr_raid5_rebuildtcp_rscalettwakeupuvmspace_freeext2fs_inode_poolffs_ino_poolpci_detach_devicespmap_pageidlezerouaddr_rnd_printmii_phy_statusmsgpdc203xx_irqackcpufunc_domainsswapdrum_getsdpVOP_PRINTfdsharepci_subclass_memoryuipc_setaddrugl_tx_list_initicmpv6ctl_varsbwi_rf_lo_measure_11bfintek_matchcdstartgf_premulfilt_generic_readwriteuserconf_disableumct_methodsvrefin_scrubprefixusb_detachipforward_rtuhci_device_intr_startbwi_rf_lo_update_11bem_access_phy_reg_hvdb_elf_forallohci_device_isoc_closeuplcom_attachurl_int_miibus_writereguhidev_activateAES_CMAC_Finalsr_uuid_formatnd6_dad_na_inputuvisor_cdsd_cmd_rw16ghash_updatedb_set_temp_breakpointsiop_cmd_putdb_buf_print_cmdbwi_rf_set_chaninpcb_pool_initializedsys_nosysbwi_regwin_disableat_pollallproccdevswsr_rebuildxscale_cache_flushDumodem_get_statussys_mlockalluaddr_free_rbtree_RB_FINDwskbdcloseuvm_sysctlmalloc_lasterrucom_do_closegetsndiskmapopen_bus_dmamem_unmapsys_fchflagsnamei_poolrt_timer_countvfs_buf_printuhci_device_intr_transfercryptodev_opworkq_destroysmsc_ifmedia_stsukphymatchuvm_pager_putdiskmapcloseohci_device_bulk_abortbwi_newstateem_access_phy_debug_regs_hvudav_cabwi_get_clock_freqin_canforwardsmsc_unlock_miiifa_item_removeohci_device_intr_abortieee80211_tree_RB_INSERTpmap_destroyip_oursscsi_mode_selectkernel_pt_listuvm_map_freelist_update_clearetherbroadcastaddrieee80211_rssadapt_updatestatssii3114_chip_mapvfs_getnewfsidaue_rxeofem_cducom_attachSHA512Finaludp6_ctlinputitimerroundarm32_vector_inituvm_pmr_size_RB_PREVwdog_shutdownscsi_print_sensewskbd_update_layoutmmopenffs_inode_freeohci_device_intr_transferwdc_cdpci_findproductamphy_statusukbd_intrifa_item_insertrtioctlkue_ctlscsi_xs_putifaddr_item_pluaddr_hint_functionsieee80211_tree_RB_INSERT_COLORprofprocswdc_free_xferip6_inputbuf_free_pagessleep_finish_signalicsphy_cdwi_usb_cmdrespsr_crypto_alloc_resourcesgeneric_armv4_bs_rm_2route_srcbootduidehci_pci_activatespeedup_syncerigmp_sendpktloop_clone_destroywdc_ata_bio_doneifmedia_baudrate_descriptionsv_putcsr_scsi_wu_getbwi_rf_clear_tssim_getptrukbd_caufsvnode_filtops_bwi_adjust_devideuvm_fault_unwireuserconf_common_attr_valsched_noidleuhci_add_ls_ctrlobsd_pci_io_findsys_getitimerhid_get_datadonicewdcstartcpu_configuresr_rwohci_pci_attach_deferredip6_freemoptionssqphy_funcshidkbd_delayed_decodeieee80211_amrr_chooseusb_create_task_threadsieee80211_end_scancdce_txeofbufhighpagespmap_fault_fixupdcphy_serviceuaddr_poolrn_refinesgeneric_bs_rm_4hmac_opad_buffersockargshpt_setup_channelhidkbd_ioctlvop_generic_abortopsr_raid6_set_vol_statesetregsupl_rxeofni6_nametodnssobindvmcmd_map_zerodb_read_charvfsinituvisor_closeupl_caubsa_paramcnclosedb_tok_numbertcp_do_rfc1323ip_fragswdc_dmawaitmii_phy_setmediain6_ifpprefixkd_trylocklo0ifphostidpool_chkwi_alloc_nicmem_usbusbd_free_bufferuvm_pagermapoutrt_if_linkstate_changesr_raid0_rwif_downalluaddr_pivot_newpivotext2fs_vptofhnam2blkrw_statussr_raid6_assemblecoredump_writeseghdrs_elf32rt6_deleterouteip_maxqueuesysctl_ttyieee80211_chan2ieeeuhub_cain_socktrimieee80211_recv_delbaext2fs_dinode_poolieee80211_node_cmprtallocsys_mprotectuhci_alloc_sqhieee80211_std_rateset_11gdequeue_randomnessuvm_km_kmemalloc_plart2560_alloc_tx_ringcue_casyncer_maxdelaydeadprocstart_reaperehci_root_ctrl_methodssys_fcntlnforce_setup_channelvfs_free_addrlistsys_setrlimitsys_sigpendingbwi_led_blink_startrt3090_efuse_read_2loop_clone_creatediskmapwriteem_hash_mc_addri80321_timer_initeduvm_map_cleanuvm_pmr_get1pageicmp_redirtimeoutworkq_add_taskttyclosewdrestartugen_isoc_rintricmp6_nodeinfocomp_algo_deflatemaxvfsconftimeout_addcpu_cdip6_forwarddb_fncallnumcacheobio_bs_freesr_bootkeycmd0643_9_setup_channelural_write_multiuvm_pagecountcpu_initclocksbwi_mac_fw_alloccue_sendwskbdioctlmii_downrn_mpath_hashbrelseext2fs_unmountpsratiosdminphysohci_device_isoc_methodswi_usb_tx_lock_tryaxe_unlock_miicpuset_delttyoutdevice_lookupehci_device_requestDebuggerwi_usb_txeofsr_crypto_preparecdminphysschedhzurlphy_caem_allocate_pci_resourcesi80321intc_write_steerrip6_inputtcp_totbackoffvdropuserconf_basesr_raid5_rwpci_subclass_displaylooutputrt3090_rf_readcue_setmultisoisdisconnectedcpu_coredumpxscale_cache_clean_addrrevbitssvwsata_drv_probedvd_read_disckeypmap_clean_pageuvm_aio_aiodonesr_ccb_rwpmap_clearbitieee80211_mgmt_outputcrypto_freereqbwi_rxeof64syn_cache_rmclrbitsdb_boot_dump_cmduvn_putigmp_checktimerscsi_add_linkpci_vga_tagxscale_cache_clean_minidataieee80211_proto_detachmii_phy_statusuvscom_matchcommajorcrypto_newsessiongeneric_armv4_bs_r_2enc_xform_aes_xtssoclosesr_ccb_freescsi_detach_targetinstall_coproc_handler_staticwakeup_nsys_connectbuf_daemonskpcluphy_funcsdb_leieee80211_bip_decapbufq_fifo_createohci_root_ctrl_transferipv6ctl_varsroute6_inputbs_notimpl_bs_w_8board_startupsys_socketpaircnreadpcimatchcertancepci_addr_fixupdounmountuvm_swap_allockthread_create_nowhidkbd_bell_fn_argtcp_ackdrop_ppslim_countdb_elf_line_at_pcarm_picache_sizesr_map_rootttspeedtabns_scx200_setup_channelkqueue_readieee80211_add_edca_paramscd9660_mountuserconf_maxdevre_pci_attachcue_inituvm_pmemrange_addr_RB_INSERT_COLORfork_tfmrateacard_setup_channellxtphymatchi80321_bs_initsr_hotplug_registerpv_sizeuvn_sync_qin_proto_cksum_outwskbd_activatewi_media_statusurl_miibus_statchgnd6_purgedb_mult_exprtcp_keepidleif_attachheadnextcdb_listbreak_cmdwi_scan_timeoutuvm_wakeup_plaiszerodevuhci_devdciphy_caauth_hash_hmac_ripemd_160_96ieee80211_recv_pspollumass_caem_hardware_initgeneric_bs_sr_4lf_freesys_fhstatnullmodemohci_hash_find_itdwihap_sta_deauthbwi_ds_plcp_headerprobe_addrs_eepromif_attachdomain1sys___get_tcbraw_recvspacebwi_mac_set_ackratesieee80211_amrr_node_initdiskerrwi_startcd_cddb_machine_commands_installieee80211_state_namesys_preadem_media_statusscsi_moveehci_root_intr_abortkernel_pt_lookupkmem_mapcd9660_check_exportukbd_translateconfig_pending_decrqsphyattachaxe_startieee80211_input_print_tasksoqinsquediskstatsums_detachcdce_attachdes_ecb_encryptudp_inputnchrtoblktblehci_sb700_matchihashrn_search_mresettodrusbd_ref_decrpcaled_attachufs_readdirsys_flockiq80321_startpvwi_usb_do_transmit_syncspec_badopbwi_memobj_read_2msdosfs_linkbufq_nscan_dequeuepciide_unmap_chanbs_notimpl_bs_c_1ohci_root_intr_methodsicmpctl_varsigmpstatmichael_finalvn_initialize_syncerdpipeselwakeuprt2860_get_rfxscale_controlcd9660_quotactlsr_rebuild_starticmp_sendadjtimedeltauhci_root_ctrl_donesiop_morecbdcy693_chip_mapcdce_watchdogsmsc_newbufdb_mbuf_print_cmdsiop_ppr_negwdc_ata_errieee80211_choose_rsnparamstime_uptimeuvm_pagealloc_pgfill_filecdce_intrsmsc_rx_list_initfilt_uhidreaduvn_wlistuvm_pmemrange_addr_RB_REMOVEsowakeupinsidetcp_autorcvbuf_incbufq_queuebs_notimpl_bs_r_4db_putstringprefetch_abort_entrysigactsunsharetimeout_hardclock_updaterdattach_edatagcu_miibus_statchgupl_detachrijndael128_decryptbwi_setup_rx_desc64ttkqfilteri80321_pci_conf_writem_tag_deletecd9660_ihashrembwi_phy_readsensor_findip_fragmentfilt_timerusbd_endpoint_countsys_statfsSHA1Finalsched_nomigrationsinittimecountersensordev_deinstallrawin6pcbtablepmap_protectkprintfdevice_unrefrc4_keysetupdcphy_matchscsi_startuvm_pmr_addr_RB_REMOVE_COLORin_cksumzombprocessvnode_poolrt2661_rx_intruao_shrink_convertvnode_free_listtcp_savetiuvm_pagereallocbwi_setup_desc32iicprobeinitsensordev_countrt2661_stopiic_ignore_addruvm_fault_unwire_lockedklist_invalidateuvm_km_createthreadpool_printitubsa_flow_endpciide_attachdes_check_keyrt_senddesyncsogetopthid_report_sizeuvm_unmaprd_matchricohrtc_cddb_deletewatch_cmdusbd_ref_waitsr_crypto_calculate_check_hmac_sha1pollscandomaininitsii3112_setup_channelvflushbuftime_secondbwi_pci_matchacer_chip_mapip6_forward_rtwskbd_get_mapentryuvm_pmr_initsr_hotspare_rebuild_callbackusbd_read_report_descsbcreatecontrolsys_mlockhotplug_device_detachieee80211_setup_nodebioioctldvd_read_structvdevgoneumsm_intrhtonsehci_pci_attachubsa_setdb_show_callout_bucketbucketkqueue_writesys_syncieee80211_reset_scancominitrt2560_newassocieee80211_add_pmkid_kdeenodevobio_bs_barriersr_raid0_discipline_initffs_mountfsin_delayed_cksumm_clticksfintek_fullspeedi80321_mem_bs_allocrtstatttvtimeoutatu_startkd_waitokabtstacktimingsafe_bcmpspeclisthbdwritecpu_idle_cycleversion_to_spcVOP_INACTIVEwsmux_do_closepte_l1_c_protouvm_mapent_biastcp_syn_cachehaltpciide_sis_productseephy_cainphy_cawihap_sta_is_associeee80211_std_rateset_11akputcharums_ioctlbootargssys_getsiddb_trace_until_call_cmdRMD160Initdisk_gonewi_write_record_usbdb_show_all_mountscue_csr_read_2uhci_device_setintrm_trailingspacefileheadrc4_cryptusbd_alloc_xfernextvnodeidcttypollsr_meta_initural_startkp_dma_zerosensor_task_ticksys_swapctliic_dumpcpufunc_dfsrbd_reqbs_notimpl_bs_rm_2copypktoptsin_selectsrcmsgscpu_exitip6_initpktoptsworkq_threadbwi_get_eaddruvn_getwsmux_add_muxbpfilter_destroyunp_attachohci_device_isoc_starttcp_syn_bucket_limitsys_renamesr_raid6_xorqpci_vga_procfrag6_nfragsip6_log_timeem_deviceseephy_statusinphy_statusrtalloc_mpathsii3114_chansetupxscale_cache_purgeDscsi_activate_targetdisasmufs_ihashinitunp_deferuvm_km_valloc_waitsys_sigreturnbwi_iter_funcsbflushehci_device_intr_transferscsi_link_closeipsec_require_pfsswapdevwd_cakue_sendsr_raid5_openingssysctl_intrcntaxe_tick_taskvn_readnclrunegheadbwriteleavepgrprt2860_set_gp_timerqsphy_cdarmv4_tlb_flushDkernel_pt_tablepmap_get_pde_pteuvmpageropsuvm_page_initohci_root_intr_closestatminsr_copy_internal_dataehci_root_ctrl_closewihap_sta_allocem_fill_descriptorscast5_decryptbrgphy_copper_funcsxscale_setuprt2661_set_bssidnamecache_rb_cache_RB_INSERTpcaled_gpio_pin_ctltcp_timer_funcsipqent_poolif_attachdomainubsa_requesticmp_ratelimitieee80211_rssadapt_raise_ratesr_crypto_decrypt_keyuhci_rem_loopuvm_km_page_initrttimer_pooladler32_combineieee80211_regdomain2flagadd_entropy_wordsrt2560_rxratergephy_load_dspcodesosendtaskq_initdosetrlimituvm_pmemrange_addr_RB_PREVrn_initieee80211_set_timuvm_objtree_RB_NEXTsr_scsi_probecmd_channel_maploopattachsiop_update_residural_rxrateieee80211_save_iewdc_input_bytesusb_abort_task_thread_procRMD160Finaldb_listwatch_cmdrt2661_set_slottimepci_get_ht_capabilityscsi_cmd_rw_decodechainlengthprocess_read_regsbwi_mac_startwdc_pdc203xx_vtblusb_fill_udc_tasksys_unlinkatural_disable_rf_tunettwakeupwrrn_lookupthrsleep_unlocksr_wu_release_ccbspciide_ati_productsrtmask_poolsmsc_write_reguserconf_show_attrsys_execveamd756_chip_mapite_setup_channelfdallocprfindrt2860_updatestatsrt2661_alloc_tx_ringscsi_donert2860_set_bssidchkvnlockhw_sysctltc_ticktockbwi_start_tx64rt2560_newstatephtree_RB_MINMAXdb_siftinguhci_device_bulk_abortdb_look_tokenpmap_alloc_l2_buckettcp_syn_cache_limitnumvnodescryptof_ioctlcomreaduvm_pagefreeehci_device_isoc_abortext2fs_inode_allocswcr_encdecbufq_fifo_queuedb_examine_formatin6_pcbbindpool_large_allocicmp_do_exthdrieee80211_inact_timeoutreaperbwi_bus_initieee80211_add_gtk_kdecoredumpfilt_kqueueugen_cdmalloc_rounduppipe_readuhci_root_intr_closeuvm_map_addr_RB_INSERT_COLORifioctlsys_utimesdb_symformatsusbd_do_requestnd6_storelladdrrip_initsocreateobio_searchusbd_find_idescpmap_cache_stateureadcatu_get_dfu_stateaue_startufs_setattrrijndael128_setkeyieee80211com_headlogpriworkq_queue_taskmemhookdoclusterreadcast5_encryptsys_exitpciide_chanfreesbtryuvisor_matchieee80211_send_4way_msg1m_applyswcr_processcryptof_writeudav_startaxe_lock_miiuaddr_pivot_functionsdomkfifoatrt2560_detachwdc_exec_commandudv_lockbufqsdb_watchpoint_listwdcintrcd_playHMAC_MD5_Updatesys_clock_getresaxe_attachsyn_cache_insertrc4_getbytesswcr_authencttystats_initpciprintpci_mapreg_probeem_allocate_receive_structuresbrgphy_ber_bugucom_matchnd6_umaxtriesohci_device_intr_donedcphy_reseti80321intc_read_intsrcpte_l2_s_prot_kwnd6_setmtu0nd6_debugip6_maxdynroutesuvm_map_pieumodem_cawindow_deflatedb_delete_temp_breakpointehci_root_ctrl_transfercpu_cpuspeedpciide_cmd_productscpufunc_iddefrtrlist_updatert3090_rf_writeurl_csr_write_1_tr_initSHA1Transformesymieee80211_defragcrypto_invokeosreleaseubsa_breaki80321_io_bs_initVOP_RECLAIMscsi_probe_targetsr_raid1_set_vol_stateip6_getpcboptbuf_releasert2860_newstateucom_cdsiop_update_xfer_modeHMAC_MD5_Init__modsi3smsc_txeoftcpqe_poolpgrp0mainbussearchurl_watchdoguvisor_initwihap_timeoutuserconf_changedb_panicuserconf_helpsr_ioctl_setstateufs_advlockicmp_initsii3112_chip_mapcdst_pteuvm_growcsecreateinet_ntopvfinddevieee80211_node_cleanupE_ldsa_abs_reselected_Usedral_pci_attachpciide_unmap_compat_intrugl_attachrt_msg1ehci_device_bulk_methodsether_delmultibrgphy_5709s_statussave_rtedb_history_currsr_crypto_get_kdfmainbusattachrn_mpath_initheadarc4_taskbwi_watchdoguvscom_paramexec_sigcode_mapsys_gettimeofdayipsec_soft_timeoutwdccommandshortieee80211_rate2mediavcleanuhci_device_bulk_doneiophy_servicecd_getvolsplassert_ctlsys_getresuidsys_fhopensr_crypto_ioctldos2unixfnpciaddr_do_resource_allocatescsibussubmatchrtentry_poolbufq_restartuvm_km_pgremove_intrsafeext2fs_sbupdatein6_init_address_ltimesdefrtrlist_delsys_fchmodatu_watchdoguvm_unmap_detachieee80211_recv_authehci_add_qhupl_initusb_dev_quirkswskbd_srcopsdopselectuserconf_common_devvfs_mount_printhfsc_purgestartieee80211_needs_authwdog_cookieusbd_devinfosiop_wdtr_negral_pci_wakeupvn_isdisksys_selectbwi_attachdeflateParamsbwi_mac_initbadaddr_read_1vop_generic_lookupcryptoattachdb_branch_takenin6addr_intfacelocal_allnodeslogreadumsm_cdrn_mpath_capabledead_lockworkq_next_taskieee80211_name2regdomainbwi_nrssi_11gtcp_issphysical_freestartfc_largedistancesys_setitimerisofntransurl_attachnd_prefixsmsc_tx_list_initvfs_unregistermii_phy_flowstatussmsc_ifmedia_upddisk_mapselwakeupumct_set_baudrateffs_reloaddefault_chip_unmapdb_set_watchpointsem_initialize_transmit_unitfill_kproccnwritert2661_reset_tx_ringumass_bbb_get_max_lunin_ouraddrpolloutdb_show_panic_cmdehci_device_bulk_doneuipc_usrreqnd6_na_inputdb_next_free_watchpointvflush_vnodewsmouse_activate_bwi_rf_lo_update_11gaes_key_unwrapem_media_changerip6_usrreqin6mask96colddb_clear_watchpointsunp_scansbappendaddrbufqs_mtxbpf_maxbufsizeextract_entropyufs_islockedusb_detach_wakeupffs_unmountffs_vopsdofutimenssys_pwriteisohashtblwihap_shutdownuvmspace_allocrevarpinputbufq_nscan_peekcd_pausecompresshashinitttstartumass_setup_transferciphy_statuswdwriteipsec_keep_invalidpciide_channel_dma_setupuao_detach_lockedpci_devinfoumct_set_lcrieee80211_parse_rsn_akmrt2661_newstatesdopentcp_tracemii_phy_resetip_getmoptionsuhci_hubd_piixin6mask32__moddi3disk_countohci_confdpmap_page_protectdead_openscsi_detach_lunsr_ioctl_inqkue_setworddb_list_watchpointsuserconf_attrwdc_kill_pendingbmtphymatchicmp6_redirect_outputroute_cbsys_futimenstaskq_createexphy_cdreadepcpuset_init_cpuscsi_init_inquirylxtphy_resetuaddr_pivot_removetcp_slowtimoieee80211_std_rateset_11bre_setup_intramphy_cdcd_play_msfpmap_remove_pvtcp_newtcpcbsbchecklowmemswapmountffs_mapsearchsys_fhstatfssmsc_activateelf32_load_filesys_getpeernamert2860_alloc_rx_ringrt2560_prio_intri80321_bs_subregionehci_device_intr_closeehci_intrieee80211_get_txkeydb_taken_bkptdb_eqnamescsi_strvistcp_set_iss_tsmbpfwritedoingcachesys_getrusagepdc205xx_do_resetauth_hash_hmac_sha2_256_128aue_reset_pegasus_IIuvm_map_addr_RB_MINMAXcryptoioctlbufq_destroyusbd_get_cdescnd6_prunert2560_set_chancomconscflagm_getbwi_bbp_power_offffs_truncateuhidevprintmii_attachuvscom_cabwi_rf_workaroundttylclosecmd680_chip_mapwdc_svwsata_vtblpool_allocator_allocsiop_cmd_getwdc_default_read_reghidms_inputin6_ifremloopchar_typeohci_free_sitdusbctlprintworkq_createvn_closeuftdi_readudav_csr_writeuhid_do_readdoclusterwriteusbd_close_pipeusbd_deactivateffs_writeieee80211_wep_set_keybremfreefilt_sowdetachnd6_initip6_maxfragslimfreedoutimensatdb_show_regsuhci_reset__wdccommand_intrrt2661_startuvm_km_free_wakeuprootvnodeehci_initifmedia_ioctluserconf_modifywi_usb_rxeof__one_cmpldi2cpufunc_nullopcd9660_ihashgetumct_camii_phy_detachatu_media_changeumsm_huawei_changemodewskbd_add_mux__muldi3umct_cddb_qualify_ambiguous_namesuhidev_caurl_lock_miiip_mtudisc_timeoutrandomopenin6addr_linklocal_allnodesamphy_cabufinitubsa_closebootconfigscsi_quirk_patternsuserconf_lineslimit0rt_if_trackciphymatchuvm_md_constraintsif_attach_commonE_abs_targ0_Useduniqdosnamedb_recoversr_raid5_set_vol_stateinflateSetDictionarypfxrtr_lookupext2fs_mknodvttoif_tabdb_delete_cmdbgetvppgrp_poolsr_concat_assemblesmsc_ioctlsd_cmd_rw12ucomstartreaduvm_pmr_addr_RB_INSERT_COLORucred_poolxscale_cache_purgeD_rngcpufunc_ifsrip_insertoptionsdes3_setkeyarp_maxtriespmap_uareacd9660_bmapaue_eeprom_getwordukbd_cnbellphtree_RB_INSERTrt2661_initnaptimedcphy_funcscom_obio_attachufs_dirbadentrybwi_rf_init_bcm2050bwi_get_firmwarelogioctlicsphy_funcsubsa_databits_bus_dmamap_load_uiogeneric_bs_wr_1strlenrt2661_intrdb_machine_initsensor_task_workuhci_cdconfig_suspendieee80211_parse_rsn_cipherkue_activatepool_page_freewsmouse_inputwdactivatecopystrsched_nmigrationswdc_do_resetiftxlistwdog_ctl_cb_argsys_pipert2661_free_tx_ringural_setup_tx_descusb_detach_waitarm_pdcache_waysarp_rtrequesthw_vendorbwi_mac_testieee80211_encryptxscale_setup_minidataext2fs_reload_vnodeelf32_check_brandwi_cor_resetudp_initieee80211_recv_4way_msg3i80321_pci_conf_sizeproc_trampolinesys_rmdirem_attachcd9660_vfsopscpuset_copyem_get_bus_infobrgphy_5709s_funcsspec_accesssocantsendmoreusb_rem_taskpte_l2_l_cache_masksiop_sdtr_msgcdactivateuvm_vsunlockether_inputlockstatus_splraisequotaoffbwi_phy_init_11b_rev4coredump_note_elf32fs_posix_sysctlif_slowtimouhci_root_ctrl_abortrt2860_setup_beaconsmsc_tickudbtablewi_setdefwdcattachufs_printem_rar_setuaddr_lin_createfatentrywi_update_statsAES_CMAC_Updatesiop_startbwi_pci_devicesusbd_printBCDsys_statrt2661_txtimeukbd_apple_mungein_baddynamicieee80211_keyrunhotplugopenlineswmsdosfs_symlinksys_symlinkicmp6_sysctlclfreeconfig_found_smem_check_phy_reset_blockuhidread_filtopsusbd_interface2endpoint_descriptorfdreleasedb_line_at_pcehci_disownuvm_swapout_threadsural_bbp_writetask_addknote_attachmax_keylenrt2860_ioctlieee80211_tkip_decrypt__assertif_congestion_cleardb_put_valuend6_dad_ns_outputin6_prefixlen2maskuvm_pmemrange_use_insertudp6_outputieee80211_prfcn_devvpcom_activatewi_get_debugmaxfilesupl_devsuvm_pagecmpuvm_pageactivatein6_addr2scopeidgf_mapdma_alloc_bus_dmamap_load_rawffs_mountrootrd_cduplcom_paramrrw_statusuvm_map_pageable_allsleep_finishehci_device_isoc_closeipqtaskq_next_workmsdosfs_strategycd9660_vopstimeout_delem_ioctlural_media_changem_cltickuhci_alloc_stdrt2661_load_microcodeieee80211_chan2modeif_delgroupspec_strategybwi_rf_initiic_cauvm_pglistfreebwi_tmplt_write_4usbopenums_attachext2fs_readsoo_statwskbd_cnpollckue_newbufuvm_map_isavailrusage_pooldisk_detachstrchrtask_delsystqubsa_methodshid_clear_localehci_check_itd_intrscsi_plug_poolrgephy_capci_mapreg_infouvm_pmemrange_use_cmpaes_xts_encryptrt2661_free_rx_ringuvscom_cduvm_pmr_size_RB_INSERT_COLORdb_deleteauth_hash_gmac_aes_256crypto_driversiftovt_tabsysctl_int_lowertcp_backoffworkq_task_poolsys_chrootehci_odevdubsa_cdieee80211_rssadapt_lower_rateumodem_dtrehci_device_clear_toggleuhci_portresetrt2860_attachicmp6_redirtimeoutenc_xform_dessoisconnectingarc4random_bufpci_subclass_processorsr_wu_freeehci_check_qh_intraobj_pageruvn_iogeneric_armv4_bs_w_2MD5Transformmld6_inputgeneric_armv4_bs_sr_2em_set_eee_pchlanrgephy_mii_phy_autouvm_objunwireieee80211_rx_ba_timeoutbpf_d_listsr_wu_allocuhci_root_intr_donesyn_cache_cleanupip_pcboptsfc_purge__data_startieee80211_eapol_key_encryptifmedia_delete_instancefilt_timerattachE_ldsa_abs_data_Usedurl_caenc_xform_aes_gcmbwi_mac_stoprt2860_txrx_enableucom_breakpdc205xx_pci_intruvm_mapent_allocudav_miibus_writeregacphymatchicmp6statdb_single_stepgeneric_bs_w_4inflateEndsr_set_vol_statewsevent_pollieee80211_pwrsavesys_profilvmcmd_map_pagedvnciphy_serviceugl_stopin6_pcbhashlookupbpf_detachdVOP_UNLOCKpmap_uncache_pagesingle_thread_setehci_root_ctrl_abortsyn_cache_initcd9660_wchar2charieee80211_find_txnodeip_ecn_egressether_ipmulticast_maxsr_raid6_createohci_checkrevbwi_dma_txstats_freeuvm_init_limitsukphy_cdentropy_input_rotatesii3114_dmacmd_writein_pcbconnectem_free_transmit_structurespciide_dmacmd_writeieee80211_add_igtk_kdeVOP_POLLVOP_IOCTLrt2860_node_allocstatvarsafepriluphy_cduhidev_ioctlwdc_default_read_raw_multi_4ip6_copyexthdruao_swap_offmachinebwi_newbufwi_cmd_ioVOP_CLOSEbwi_reset_rx_ring32uvm_anallocin_pcbdisconnectuvm_vnp_terminatewi_usb_rxfrmbwi_init_txstats64sys_getpiduaddr_rnd_functionsipmultipathunp_dropugl_matchuvm_map_advicetcp_mtudisctimeout_startupcue_matchrt2860_eeprom_read_2fintek_read_regrn_addroutesdactivatefilt_msdosfsdetachdb_print_sadb_elf_sym_numargsural_detachdb_trapperukbd_cnpollcdoreadlinkatdvd_read_manufactundstackconfig_activate_childrenip6_check_rh0hdrieee80211_input_printdomkdiratem_allocate_transmit_structuresnforce_chip_mapem_mc_addr_list_updateremrunqueueatu_initial_configusb_fill_udf_tasksoo_closesiop_handle_resetumodem_rtstcp_recvspaceuvm_meterumodem_intruhidev_maxrepidpmap_needs_pte_synctcp_ackdrop_ppslimuhci_ifcdsii3114_write_regehci_device_ctrl_donemaxthreadnd6_lookupieee80211_cache_sizescsi_iopool_runurl_openpipesukbd_countrylayoutbwi_led_durationsys_getppidsr_raid_request_sensescsi_ioh_pendingmii_anaruaddr_rnd_selectrc4_skipVOP_READDIRdomainssys___sysctlsd_cmd_rw6arm32_dma_range_intersectin4_cksumextent_alloc_subregiondb_putcharrt2661_node_allocieee80211_recv_sa_query_respneedbufferusbd_do_request_asyncin6_ifattachieee80211_get_addba_requgl_activatetcp_rst_ppslim_lasticsphy_cabs_notimpl_bs_rr_4wsmouse_srcopsohci_root_intr_doneiq80321_thecus_irq_mapip6_multipathusbd_get_device_descriptorcd9660_initumass_fixup_yedataiicprobeipsec_soft_bytesmichael_initnselcollemul_elf32usbd_open_pipeohci_softintrmsdosfs_lookupspec_pathconfmountroothook_listhook_establishem_copper_link_autonegbrgphy_copper_statustcptv_keep_initsys_chdirdb_unread_tokenext2fs_diremptyuserconf_cntdcphy_caE_abs_msgin_Useduvscom_methodsext2fs_inode_freedb_find_variablescsi_io_get_donexscale_cache_clean_sizebuf_objectip6_rr_pruneuao_grow_convertjmicron_setup_channelusbd_desc_iter_initsbcompressiic_smbus_receive_bytepmap_free_l1nd6_outputSHA512Lastcdevsw_lookuplogsoftcsys_adjtimerijndael_set_key_enc_onlyohci_device_clear_togglesr_ccb_allocwdstartwsmuxreadamap_splitrefspec_open_clonewskbd_do_opensd_thin_pagescryptof_kqfilternclruheadscsi_move_doneural_next_scani80321intc_inituvm_aio_biodonern_initheadusbd_get_descuvm_pmr_printvop_generic_unlockuvmspace_shareieee80211_node_leave_htrt_timer_addentropy_poolpci_get_capabilityieee80211_print_essidroute_usrreqdeextendspec_vopsem_gate_hw_phy_config_ich8lanieee80211_wep_encryptsr_raid6_openingsem_receive_checksumieee80211_recv_deauthsched_init_cpure_config_imtypetcp_dropicmpstatcom_irq_overrideudpctl_varsuvmpd_scansys_getrtablem_prependsoftraid_casmsc_resetinflateInit2_cd9660_pathconfin_pcbrehashpool_walksyncer_delaynore_resetre_tickin_arpinputpmodehci_root_intr_transferufs_accessin6_embedscopeif_alloc_sadlphpoolunix2winfnmsleephfsc_enqueuepiix_setup_idetim_drvsreassignbufuhci_confdsiop_minphysip_freemoptionssr_meta_rwums_matchsohasoutofbandddb_initieee80211_release_nodesch_setup_channelbs_notimpl_bs_c_2nd6_dad_duplicated_bus_dmamap_unloadieee80211_free_allnodesmsdosfs_fhtovppte_l1_s_coherentbs_notimpl_bs_wr_4maxvnodesether_crc32_besiop_setuptablesinflateBackEndieee80211_add_ssidcpu_reset_addresspgfindatu_rx_list_initobio_attachsoftint_pendingtcp_ackdrop_ppslim_lastloadfirmwareswcr_compdecbwi_mac_lateattachral_pci_devicesip4_inputtcp_inputsysctl_dumpentrydkcksumuaddr_free_rbtree_RB_INSERTnd6_gctimerieee80211_ccmp_decrypturl_csr_write_2iptimerip_inputwi_set_txpowernd6_setmtuaxe_ifmedia_updwdc_ata_ctrl_intrdb_last_non_spacemii_detachusbd_get_endpoint_descriptor_tr_tallyudp_ctlinputudav_rx_list_initpool_sethardlimitpci_subclass_prehistoricip_freefvfs_lookupdb_show_cmdswdc_default_write_regrlphy_statuscpu_info_listudbhashsizeicmp6_mtudisc_updatesun_nonamekmeminitnd6_ns_inputdeflateEnddevice_refehci_device_ctrl_abortffs_syncrd_root_imageuvm_map_submapsr_hotplug_callbackscnioctlrt2560_startufs_vinitsys___tforksr_ccb_getehci_noopbwi_mac_fw_load_ivpool_primedevid_allocpgrphashtbldoppollrt2860_read_eepromifmedia_matchget_crc_tablestatclocksiop_ppr_msgaue_activatert2560_tx_mgtwi_read_data_usbdvd_read_physicalrw_enter_writeuserconf_argbufatu_media_statusMD5Update_intm_tag_copyehci_idoneinflate_tablesiop_pci_attach_commonpci_io_finddb_value_of_namert2860_free_rx_ringpmap_l2ptp_ctorrn_mpath_active_countdata_abort_entryhid_get_itemrt_xaddrsmsdosfs_getattrdb_find_breakpointip6_maxifdefroutersm_devgetwritedisklabelin_ifdetachmsdosfs_printkernel_pmap_storeem_write_eepromin6_ifattach_loopbackstartprofclockohci_device_isoc_enternsphymatchupl_ioctlundefinedinstruction_bouncesys_getresgidprocinituaddr_free_rbtree_RB_PREVatu_switch_radiomsdosfs_readdirdead_ebadfextent_do_allocbrgphy_attachusbd_interface_countnd6_timer_taskobio_cawddetachsoo_ioctlswap_officmp_redirect_timeoutforkstatwi_card_identaue_miibus_writeregi80321_pci_conf_readieee80211_recv_eapol_key_reqicsphy_servicenull_setkeywi_send_packetigmp_sysctlin6mask64db_lbuf_startohci_rhsc_ableuipaq_activatesoftclockre_gmii_readregieee80211_node_freetc_initupdate_modifierffs1_compat_writeieee80211_amsdu_decapdb_breakpoints_insertedpdc203xx_dma_startblf_decryptswdevtdisk_lockuhci_initbwi_rf_gain_max_reachedarc4random_uniformsbwaithotplug_device_attachufs_reclaimkv_intrsafeem_access_phy_wakeup_reg_bmscsi_xsh_set_tr_alignsr_meta_opt_handlerrt2560_alloc_rx_ringsdwriteohci_device_intr_startxscale_minidata_clean_addrwsmouse_cafilt_logreadsysctl_rdquadbwi_mac_fw_inituvm_vnp_setsizevmcmdset_extendsr_sensors_refreshural_cadefault_product_descaes_key_wrap_set_key_wrap_onlyip6_use_deprecatedehci_softintruftdi_paramuserconf_hist_intextent_alloc_regionsys_mknodbwi_mac_config_pspmap_proc_iflushext2fs_mountfskill_vmcmdsuhci_device_ctrl_closeuhid_attachbwi_rf_off_11bgufs_mknodpciide_phison_productssbinsertoobin_lifaddr_ioctlknotelf_advlockpffinddomaineephy_resetwsmux_do_openfreepci_device_foreachricohrtc_setcaldorenameatwi_ioctlrt3090_freqsffs_hashallocswstrategyuserconf_pnumehci_allocxbwi_plcp2ratescsibusprintnamecache_rb_cache_RB_NEXTehci_root_intr_methodssys_getpgrpuplcom_detachuftdi_breakukbd_ioctliicprobewsonewconndb_fetch_regufs_direnterrt2560_set_basicratesudav_csr_write1uhid_detachgeneric_armv4_bs_c_2pffindprotocom_obio_caudav_watchdoguvm_pagealloctcp_saveti6wdctimeoutHMAC_SHA256_Updatenchrdevfrag6_freefundefinedinstructionuvm_pmr_use_incaue_cdrt2860_switch_chanre_pci_devicesaf2rtafidxnamecache_rb_cache_RB_INSERT_COLORcoredump_unmapnatsemi_pci_intruvm_map_vmspace_updatepciide_chansetupqsphy_ca