ELFa(4j4 ( 0P0P0j00Wۣe,j,,$$`p_D O!"&@00Q_: 0/0jh@/ dd@0 6QQO `0 @ @0 _-@p`P`D  B00 R mР -L] U0/0main() returnedD   ),@@(TQ 0/s -LM@$0x S|Pp @(`V d $0  6/@ $d0@0(0 $048 <c( 00-LM@4P 800 408 ,0 0p-LM@4` 8\4P08 00 p 0-LM@0P 4000  40,0 $-L$0 P0Pi 80-LP0 @ 4@0 00-LMP@ 4\0 4000 0 0-L@ 0+h0 0  9i9i/h0S0h0/ -L0MP PxH $L 0^D0 |pT  p)0yP0c0 -Lp`P@fT @0S @ p-L@ P`P(!"# 0P) 0P/ <P p0P Pp  0P ppdXpTDpD0p4p, PTP$( p-`@0PL$@  8@@ 0@0ph -LMP@(pP`' @@0 0  B0 `P@ (0K0 0 *,P @0ϰ`$K@0(  04P@ 0 P @0 8@0 0 0-L0@S74P0d0@0 0Sp (P$ \00080 0h0t 40CPR d0@ $ p0S 0 04 03 80h.$0p S0  0 `l* 0-@4LPPT d0@ Q00C0 p $0R_ 0SQ 0S0!1 0S2Q0 0S 04P0d0@0 Q000800t 010t 0h0"8U0000S00S  00S  0Q 0S 0S00C000hK0S044-@0 4 40 ( (0`lbweU{ -@LHh0S h0S h0S0Ch0 h0S h0S x0h 8t0h0Shdx@L -Lh0@S h0S 0h0dx@90h0 -LMpx`0P@pppp@(\ 0t " 0 A  -LM< p2<qP 0SR 0S0S4" 8 g0 L0S B70SIL0S 0<8 0`4` f 040 t 40V4 Y #@((PU@1"001@` t 0"0 05/@(PU t 0$0 ~?5/@(PU 0  < B5/t0 30  h0Sd0  @ ] @0`  2  0 R4(KP80S @B#(@"1001h R5d0 #30R0#S200@ 0S8 8 o0k 0S@,   0#WP L00CSP ,0Rs@@ p T&pP1 ,p h0S@0h0 08 S8 Q000 L0S0D   (@%U Ġ  10 01@hHp hp P p D 0 0L008 @ "(@"100 1 @0h0L 0R8 00 0 8 88 0 #0  X2X 0S} $ ,K,P"100( 1`o z80 ,  0S0 J"@, ,("100@1` \#pg-PA T_P8 4V000 t48 P P&A000 a "8 @ (  0s 0n 0ixx 0ddd 0_| 0 844` <0SidDd`lwX4m -PL⸐@xpt0`@D3h0S `TX 8/  X 8/ pn -LPp@`P# @0 p0h d@z!7'0@'Ƞ0'\?0Cp 0@ P p8 @"@>$ -L`pP@P) B? Pd0p hPC!0' 0 @y0CC B 0p` pP  0  840< P0VP>$ -L,M@P8< `PPk000 P pr>,̻  -LMP`px`,  1]0, 0!0S L1N"] ,]( 0@P (M@@ X"}P@060 l0  uP@@pn' D"-LM`x0x 64 s0, 00 "4@0 p 0|X 0-LL0@PpP  T]0L0P`P   OLpL`LP R P0BQ/l 2-LMP0, LL0E@P \@"pL,02(K +'0&0 \pP @  0Z`P @1!@ h}p@넀0 0'00E0 `` h0P @W T  t00*0h0'E0 0hP0  P@ @@L0@ D 0;pn@̻ l -@LxPd0@ph0 ``S7 h0Se h0S W84}t0!0I !h0 00P/0S WE 8s! R000800  t 0!h00 000SP dL0 00t0P 4Qpn 1-LM0 L`A20S, P 2P"  0P ,! 00 ,@p  ""  P  0P,@ 0  0"P+PPD P5 P0S@P0@Sz P4 0tGP  )i [P(tP P M| g@l 0\APP  @9h 04c4 0 8  8  d -Lp0@s`𨝈V @P10LP 05@  p-Lh0@SxP S S h ( R000800   h pt 0R `V  0Pt0 1h 000 R00C0pPPX X0iP    `lp  -q0LL@`P R     &HP >(0S @0|YP(Q  Q Q lP   0L0 -L(Mpp`P D @(K : Pl 1T04L`#08,00 @P  & @,04 008 <p,@4@Q k. 50S,'P 0 0 ,@ O K"" B@ H 2 ᢡP( HhHcP 0S 0,@ 0   0 H0Q40  0 z , 8 *, 倐t x` @ P0,̠$$,  D0 @ 0""Ġ"  0h0<@0@  ,JH8 Q, L8 (B100@ 1 <0 @|0 0  5  8 440  ,,08 4D0 P ,0` [  @3P 82Q4"4 0L @$ F  @ ,7 ;  @"100( 1 B H @QP00000H0 0 H"@H@HhPP@/ P P $  @  V (uT  @( P P  P| 0l @P  P  @ 8 0 4 0 8 d 8  d Q-L` Q h! @PL0SP U@ !h@PpLPP < U@ p-`LP 2PpP@L0S@ TPp p-LM`u@P%(c Q <#40H0IP@ T 04  P@PL0SP U@ BKp0PKD0H\0A ,0 ( $@  0` 0000  !"$+ C=-L  00C 0CR2 d ~0X$ C=-L  00C 0CR4 h ~0X$@ @0 -L,0\0  (@ 4/$9 ;@-)9 0 0@0@/0 0@0@ -L MAP0`` ,0Kp "[P1RC R $K2[m4`CX#X+p@ 1  0CR8 p (K"[p0 R2Ks 0X00@ C=    00  &0Kp p0 00@0@,[D u=$0  '$$$# 0-MLMP@90000& 1 R+ 1 x  0Sd1 KX!0KL1AKA AP(1K R000K003X000K, 0 KAK0 A A P K00C S񟗼OO8N8N8NO8N8N8N8NpO000000000000'D <0-L)0 0 '0 0  / C-p-LM@0P;-` p 00> `P0 0CR  (P01Łp0C1 0PP9 p+s 00b`=C0R2"@ 0@ 0hA0CRI T2Ry 0R @<2@00CR0 0R( 0? R2 0h#,0CR> 0R@1@00CR 0R@1@0@1@0 1 0@1@0@t1@0@d1@0X2@   0@1@00 0h@0@0 0 0 ?0h@0@0 0D 0 0h |0 00 0 ($ C$$ $,$ C=-MLM0  p 000CSp(KBKII 0 D K0T `0S` @ T !pP@VP)81#0 $1  pP pP90$(K0P @ (0KA  0  pP pP0)(K1(K0t00 T0  pP  pP9 0  ' d-LpdM℀K2 S108K(K9<ô99<$PP@`K*  TP U`0 @ TP000s08KT0  K40 d100' R-LIMX0@,0 , 0RJ(K<, 0R(Ki0 00',',$4$\ C=-LPM 0 6 -1S" k.pP% l`KD4K 0C@R- 0a KP&6 #[)1S 0q BW 0S*(Kj ( 1 0R!!  10C1 RI 3RF RD 3SA 14K3 R3 RL(@S 0(D 0 D B0000 . LP  J)6;63 0P tZK :20Sp0 { pQ2 R 0 RP TK% t >K 8K 0K<0C4KK t0 BSr 04"43K@BK0 5[0K9, 5K*K2 L (@ 0 B($[4[QD 04K 0 D B0000 < { L(@0 B' DPt 0 P0 0C 0 0]5[ TK

K R@0 $40Ba0#$ 'gfff 6S-L@` 8SA  7p0 0C0Q  XP v05/0 P0CQ0`X  x0`Cm*T  J>T N0CT X>T} >TB-p 0lX >Ti %0CT 0T  p0l0X 4X5 X0S x x\ C- 0:02`-(K`==T =Tu =T5 =ThㅜP 4XX l 6@ x xC4=T` '0CT 0ThdP< R  ͓p X ,4P4X 0 S <R  R 0CR =X p0X`,| @ 奓p04,X  P l 6@@ < R< XVP ahPpX Uh P yp X Xx+PX0 \U\;Q= P;Q 2 Q5  Q KX0PXPl 6 00p  $ *00004K?4K$; NK$K |:Q !0Q:Q L:Q P:Q H:Q @:Q (:Q\ :T :TG :T9T$ 9T 9Th㉛PpvX 9T:p X 9T  0Tl 6{ = S @S 9 l0&l9 pLX 8 Rp 010   廒,X X0/ 9X PX0 `8R p 101tl 6 \8 RC 啒,<8X X 0t(X0PoX 0 Sk !X0 x np x ! _xDhPs !hp0! x xP X / Q5H7 RᏭ@_ ]P x >@N`K@@&D @6@4KDK 0G $KHK ;  l x6 0xh㯚P)(6 R l 62 6 R  0X 0X 0060X0) P6X Pm5UM$@   5Ϡ!C-@l0  20C%l 606p0 0Se 5 pSX hNP4 R 㹑0T0 p X 0T 00bZp 0{SX P|0 \ d0 t UY t0 `:  |@h   hC Ct0 0$3 0S0R   m 05 %<0 S  S  7S  nS  0t B02 R B0 0C s0 B02 R0x0 h2 Px00x0p0\ | Pp0 T0 p0 X 0T 00b Sp 0d | Sd :|0B\0 pmX h㛙P  p X X!qPqXF ,0X ꏭ@ x xP X 00D"0X 0S00( 0XD "x2 RBX0u $ ,B0X 02X 0000 X 00200X0 T 4X +00$3Q' D0CQy >0QCuL3Q. 0Q<\3 R~X x3 eC= t ,C= o iC= @j aC= e YX0 GC=  X  4 R 4X 51>,0, 0-LVKKEK5K0X03K|4 M3K  n2K j 6K3 R 9 45K05K3K C= Q3|CP P0,pK0  Pn3,   p P_C=, 0C TH? `9 <@0;9 RY&  @0Ÿ00VK 5KKEK 0\2K05K?5K 0x"x25K 05K%K 0005K@20K5K 00Q1KPA5K05K !15K K%K01! #000 h1PL 0SI P H1H!5K0 5K0%K 905K0K5K0)0 Qʀ0KK5K0pn'  ###: -$$ $ ,$2$0$$*$! -pLP@@t`n@DEDtj ЁС 0 ( T]Au0 R   X PRv0   X `R   0X  y0XJ Dz' @`P0 R0 ` (  0R  ( R4 h 0X Z𯝨9  0D<9 (<<$( -LPM,0 60  qa,0P> R6 l n R6 l 0X @R6 l 0X 60 j@P R6 l (T0P R6 l ((0P(K$4xV -L0M`P? QC 03\ $3QX Fd0CQd  80.P/r R8 p 0X @R8 p 0X\ RL8 p 0l2 ` 0P (K0S02.`K0K2K02K2Q7 0Q0SU2K?2K.`K02K00C SH( ܛ 02K12K0.`K2K t10S5 d10S+ S[.`KK@!TK@0PK20p&W?D  5K@K0 PT0 R\ 0H2K.`K0"K2KH      $$'!'#((($,$ p-LM`80@VPPp404 ,0 0R8 p p$ 3-LMP @Rv"00 !P$ 80&P4 夢r0 R8 p (0P` 0R8 p (0S (Kv\`0 RL8 p 00? SD 1 R 1R 1R 0R d0CR< 0RP P 0AS@̟ܟԟ쟀䟀$1Q% 0Q0S? .PK2K"Kt0\ 0S40 00000 .PK2K"KVP dS bT0 0S Sk S2< @>h<@0 fPK=  WA$[P& >K 8K  *K  0 0D P 0 0@0@갤[>0P 6[T  lKU0 <0< P 9 w<00 0lK CM,@ 0Ep G|P 9 Z00 @0@< G0  K'' $($\8x C=-L  9Scs R2 d 0X @R4 h 2Xb堢r 0R2 d X 0R0 ` ( R4 h @2PXue 0R" D ( R4 h 0@X1 Rf 9&  1 0CR4 h :XX1X 0CR2 d H1XU2S00 0CR4 h 0X0 0CR4 h 0X R4 h 0X R4 h 0X|$p D8-L$M88H}/` `P, 8 $K4K JKpP H, 0R(K  FKj @K4h 70P9$ ! 0x1( =! \  L ?@7@@'0Cp ,'00 7  ' <0 7 p0pd &006 &6pp ?$K3K0P 66#[  6Q Q) Q +>3K06 $K P3[SC-000  ,} 4T 6:@K3K 03K5 P 5 [^ࠃ5v5 P BM@%5 0C 00 0P , =L?0C 3P00 0@ 0S0 0 0=-800 0`0 00 ~0 e(0 ~H&$$hπ' S-LM` 0 ʴ9b(K0 L0 @  V@K0KPK P0SK 0KPP 0 OpPQ $3¿Q> Qe 9 \(P2   M    0Y$ 2ᲂ $ ڨ KKy0& /ȽD,  0$#2 RC 9 1  =!Qʴ9<Q @pWx1 R0S( S Y@PU 0  Q9 A 0R  R1Ḑ0 1 @PU @@PrSD@T 9[  tPP@1A01:0@0'(0&pn` 0-]9L@0PM0 R0t0  h s?CPX0 qP +> x  , (0h d&$$р p-PLC`ID@DD@0 40  Rx0 0 00   R 0 0 0 @P  ƂÂ-00C0p&$ -LMş9`@5, Php 5MQ0@ 0CQ 0CQ pl, 0R&(K\5Q :P5Qpp<45 @T 0{S|㨐K 000@TI 0|SE:|pH|  K2 K 24 &K0 6K34K3U K#4V0Kf KK:00 e0Kf K:0 f0[( K0 = Af0K:0 f0[(K 0= Af0K:0 f0[( K0 = Af0K | H pP 3긠K  pP= 3 @T 0S`؀K@T 0`S:pF 6KK#,K3 0& 0\0 00 8R804PE 4 B)TP80180 X,\ , D<4 0<`px(K ` X 0@0<904 D0 ,p D( -LM`p$0 S0S 0S @Q60 00@50 @000$K&8P@ P 0@O00۲ 0(K,K0P@P@P@0,( S  @儠(p0S <2S 004/p@ ݳipnd -LMP@,080 032 qpP l`Px $800R@ 倠 40 ,` c80<, %*8 0v108 <0<D4 , 0 0,04,8_!1Z000㰅 4<D4 N0`Sp= H`40S@@60&0P0(K<2Sp@j W,K0K  0 P;P  A >l\084 004`00<Dspn 0-LMPFT D06D `0H0D0K0 0K~P à ,0 0 P K\ ^TX&@D 6 -LMP p@ `=2S ` R0 6SP`3,0(KP `2`,0 Q Q Q,   , P Z4  `0,0 4^= 8 ~8P0 ` 04, 0P4~ 0\4894 ^0010; 8;!  00 0T\ϠD 0>004 R񟗞<@0 l!, 00Cs0SN 0$0`<080400S `0F{ 80⻱`P0@,0P0f(`0v,0`@ 0PH`S|0p@,0`P0dD 0 4,Z   pn  -QLP@0 D6 p`@V`!:V@l•x"1@  p,/.00b* T0!,!@V 0 0 i 0-@PL l2x"p ,?p0=20P 6P00l”x"0 p\X2\"0 X2\" #+$X2U0CX2 l”x"006 p\ l0`X2 0CX2="0 ⣥ PmPၤP< -Llx"@p ,6h -@PL =2S <2S l2x"p ,?0hrl”x"p \ 00-Llpx"@\PdU' ,l2x"p ,P  l”px"0\Pl2px",P0dUL 0GlX 0p-LP`U0@PUJ=2Sl”x"p ,6?0  0SpPUZ00ph -LMD  0 S@ =2S D@0"8! B00CR(KH0@20S @D0  0r03R0SR0 0 R 00  R00 00 8@%P8 < ՍP@< , 4 @Uph0d04 < 4@0D40 ʠ040 , ,ʠ0:#:0d 0>0.S 0!C60P 4804 QO0 pWp@ 0\* D0 S,0 0@ `p> 0W$0@ D0$ P 0,,  08 Q4 0$0D( 0 $::5% 0 (0 ,0  , @ DRF1910d0D <0Sp8c @D 2P0C"  00C3 R PS0Q80S*<Q@<R\P @ @2 0S00@0h01@&0\0&\0xS`0`0@ d2Pc 80TDD <080<0<00圐@@60&@ Ƃ$@@<2S @l2x"p ,pn  -L@Ph -LMP0`="R @;H0N0 0p 08(K,K? P6@P+0,( S 3 @ܠ(O0S <2S 00& 6@P@<2S !$K@Ap@!0 嚰Q CpnxT -L@ᅧP0h -LMP0`="R @;H0N0 0p 08(K,K? P@P+0,( S 3 @ܠ(0S <2S 00& 6@P@<2S $K@ҧp@Ჯ0 ៮+ pn -L@P0h 0-@0L P=2S 0H080P0<2S0o0 -L@P0h p-PQL`@pU 000ESQp  0000ASQ0p l*-L0M0,0  p=2S 8H04 32/.0T10 D@0Dd ,0- $R9Ro 49R Kڣ R 9R 09R00Y@P, 0R9(KP9R R R RTӼF 0A?CR< "9R, RU0008R   E #!$4 -L@P0h> -LM=BT (Km. 0 0s0 , l2pBxR` \p, @07/x 0l ?0k@P Z,@ 0r4(Ko,00(KorpnLT -Lp` 0P=2Sj<0 XQ{0 X00@0!/0褑000@p T\T@ 0㸩\@00 ;0CⰩPU D<@ 0㦩D@00 ;0C➩4PU Y@FP ٝ 0 @00l0\@Pp⺫Trѣ00ʞ pnt 0S0 0eca p-L@(`PUppn-0 =\ E 0 d`0h lT  0-@LP\T0&HD0 D0D0 SHH 0\T0h -L00`@HpP0 ?00i&pn -LFT L0S6m>6`0( R Pd _0040 (0e n@PEERFYSUB 0A-LS( i脲ゲ`<20<2l2p ,2lB˜x",0 0p\l˜x"P0 0p\6S`@6Sl2x"Q@  p,@=Sl˜x"@0@  p\6`SVw 2㪫6Sq@6Sll2x"Q@  p,@=Sl˜x"@0@  p\<2&0R<2`@6Sl2x"Q@  p,$2@0Sl˜x"0@  p\6Sl2px",l˜px"@00\dTd Ol2x"p ,@ <20C<2P `0=2l2pBxR` \p, @ 08107/l˜x"p@ 0\dT& l2x"p ,@ l˜x"6p \2<20C<2i肱l˜p 0\1 -  0-@LPP -PPnKԪ0 0-L=2PS0X20QX2 @~T|2 6S nW6SX20CX200 6ϜX20CX20 -l2Lp$l™p x,l2p ,b0`2 HPZl2px", P <2奯 * 0קP@"0R02 2 !Ql™x",0 0p\e TlP  t3j. &00D 70 P @4 6@T ?P ͦl™p 0\` ;2<2@LATL`@D` @@@\ǦP@` TD 0*p :0P!=C 0D L`\TD ;0C⦦T"P@Ud:@TP!0 ᖦ @P P :0@00 ?0C 000LT\H@D@D 0~l™Fx"P00p \ n奧m.nl2pBxR` \p, 08107/l™x"0@ p\dZk ㉩l2x"p , l™x"6 p\Kt# "P001"Pl ހP/ -LX@ Ƞ Ƞ,Ā\ P 8\ \ 0, 0@< 07w&88&#Č, @   Č 0iM) $0WEV" -L Ƞ Ƞ`,DP$ ᝳpP@ 1UI t1U) *@᥮T1U* L1Ue/@,10S @ 0 ᤷ@P 4@P0U$ ᓷ02 0 @  ei0@ be/k 0U &$ 40( r(@ rdAhdsd edAk~gd" -L M|H0#88#!$P( > (  姲p* (H0P 0(20 0 , y 00P`|4Q!@04@aT@!0 '  L@00dD0P@ A ($Kk4 @+0804 DDP@ , $KL  pn 8 8-#TLH%pἲ`P0@ ᢷٶĭ 8 8-#L@(៲PPp 0`ƶpP ᫭0S  0㦷pᱶ0 pP -@L30ŷ$0L002 -p`0L hP$  h@P P00 `(Pp 0P,\0@P  0@: i 0 T <\ -L| -L| -L Q#-QLMK 0K 0SB$  p-LMQ@1@#PK` 7TCJ |4QZT00V0Sp 10C p 00/ 80 P/0S/0S/P/ @ P P 0S00 P -L@T00 ((0 R0@0 D p-L`P@P @phP , P @``00p ph r -L\@0S P@T<0 ,~@Thw , @ |$+ -@L 6hj 0-L@P0S040@T  $@T000 p-L`zPP @0 0` @0#p4 0-LTP0S0H0@T  #@T000 0@-\P@ 0R R R  0R RT@@\0@0@0 / -LM|0Q 1>4?>>>>>>>>>>H?>>\?>>|?>>?>> 0A^S6LJ 0R1K0 4K0@@8 d / |* 4K0 @ L <4,m,dI$+ |`#p#h#X#x#! -L0ML `P 0,0 P00SP0 ZJLp P@T@ )P I0DP1S4tC4A4A4A4A4A4A4A4A4A4A4A4A4A4A4A4A4A4A4A4A4A4A4A(AhC8CC4A4A4ABtC4A4AB4A4AB4A4AB@B4AB4A4AA4AA@PTIY iY`V`P \P00SP0 Z<,0 <S`(K qH@K0   _  z V  q|P LPPt 0@^S tb ?PPg 0@^SDU 1H@K0 p SpP !  <G   3>  0@^S(P2p/-t M lh0`*`l0P8g,#$+L###Ix###|T#H! 0-L0P@St  0hx  -L@P P P P P# P P3 P& 0 0 0  P 0 |0 lP  P Do P PDHL## -L@P P hP  ]4fP 00c0Z# p-LM`KP Kp @@E0 t PPP0@S00S@ P# K^P T 0S T U   T$T  0 4T  '00## p-LM`KPKp10@S@ PK T00  00b0 0 !0@S@P00# p-LM`KPKp0@S@ PK RT002320 0 0@S@ P4 R$ 00## 00Cs0/ -`@LpP 0 @r0 SR 0ӧ#P R @ 0a0CSa0Q-S # RD@T 0a@_S#Th{!"$$  -L$M0sS `PLKV=  # a0@S( K$ \R0S  0S0SQ+0@a$0Lv U TA0 001 :(KYJ 1 ,` t!0S PP\aBTU 10K0@ 8 r@600cP 1 0 ,,U`%0S@  @ 0a0Cs0S0@SV P000 R  a0B(Ks0S +00B R0:S 0:S_0PE$0L00C Y][`\$I 0-@QLP0H#@TZ0 Q-L`ሀp@00fT*P"00fS 0c00f000f0 p-L8@8`8P0c0`000p  0-@QLP0H"@TZ0 0@-L@~S~P8QdPlQQQdPRdP4RRdP4RSdPTTdP SdPXSSdPSdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPdPRxx6 Q 0@^S)\V Q0q0 R:@0 00"`P0aU 0R"0 0CR0:E%0S!00C0x5l%0Q*LU@0Q*!0 RE5 Q*!0004$0Qd帄0\ᔔ $0ST t吤T000pğ 0 SX400S0  00  @04#0S*cC3Q`3 be#C00 Sn \\ L0Cf!d!0Sa!0S^! S0R SU K 0RLRr 0Gb 0SQ P000B Q6br00CS0吢% G"8:|R0B0 S C R0!H"010Q? 0$RC 0 0R "p000 0 1R R1 1`1蠡 G0000R010 0QH L!<000 0 41R R0 0R0 0p Đ P* Q% 0Sp0PQ 0S|0\^0SRL0 @ ltpdh$c -LP@XpT`T0T @@D@PPPh P  00` 0 00/4 P00/ 0 Q#45/x0/x0/| -L 000x| -Lt T8 !0@]S@00@ SE0P03Pc0p0 QR`TWpD@T7pD0u" @/TA DaDU9070T0pDU A D00DR Sa0D_TS(oPOPP tPTP P xPXPP 2P@A @a0@SR2\T( 2@P2@U tA @a0@SR@0@_P Q:P\P00 \Tbp P@0^([0hSp P@O\P_P 0?SD[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[X\P\H\@\8\[[0\(\ \\\\[[[[[[[[[[[[[[[[[>P+@ <P*@.P@   $<$H$\$ P 00/| x-L$@0P 0@00/ p-LMPP`V Dphw@8@s0 ,$0j`pTl$${T$ S-LM@ 00S S h0Pd  0^0?l 0000 P  0 P $$$$$$0 0 `R/f$+ -L℠儀p`Wt0@B VW@@ T0g0C `pW` p1 -L `Rڬq B0R !0F]S' VU V2 VL VhidQ-@e@TTcP9 qP7 PP@0P0C0ASPU I@0 0 S 000P@ 00CR .t 0 00 0P0L 000$40 0 $% H-L4M<08S , 2PLKHpKPKTK ` 0L @@ L %TQ 0P PL0P P Rd P0Sl0HL, 0R (K0@,l$ě0<  ~ 0?0  ((hh(llP, , =00$ 0R  K,p"R p-@Q(Qh@`L Q $w sp/@81S=0 0S/0!0S/@81S=0=0 / 0 0Q/41S /t -L0`Sp 00S uO@0Po 0$dᆎ, 0-@LH@PD R0D0 0S00  0h 0-@LH@PP R0P0 0S00  0h p00-@ qL! qD0PP<00@ 40(0@00DP<0  S-LMp4P ã,T0@S0` 3/ L\ 000P ( -LP1`P10@p`PP KPFP0S0 0P 0-L3Mp@ PoK L3 K,P L30L3 400HP 0RKL冉," -L M4  P (KP0S8 S00 R( ,  Rp`"( pRچ21C,0@`PP A @4 @0P$0P0p4 00( R, 0S, 00 R( 0 - Rp`"( pRچ21C,0@᫿`PP A @4 @0P$0`P0p4 00( R0000 0S0 0 -gMLMȓ@p0,0 SW 0S 0S 0S 0S $0S (0S ,0S 00S 80S @0S D0S H0S \0S P`8@4p0\P 8@Ph06  8vPh0S 3/ C/h@@@hfoK01XC 6 6 6 <1DAHALA@11AAA1X30X3 HPY@3S g^K<3PE PE6 HPMK@D@MK@D͈ 0|@D@MKaψ 0X@D@D}qψ 08@u,,(O 0  0`0SS唲040, 0R(Kd0SI4P兲 u0)4@tvl@C__,$+8e(P((p8(P("x(l 00-LM@10vd.v`,v O10CS1 1r 0àLxP0 h0Q(ڴ 0SP!00S PU@ 0' 0" @0 00$P(@mY$ʁ( 2-LMa0Sp1S^0t"v1S X,1p0,18P=0=0 0 p0@0 @ Pd^.1.PadPw1dPSp\P 4!R 1UP!00@0 @`410e41 Rp帀 hS0nSPP R 0%0%0R00S0QS P~cpP1S  03/0Sz4<#pvp6pP m(( 80-8@L#T P)0AT% 1SP10P1 P(10CS1P 0P PP0CS1rt0PP 3-LMpQ0S`/1SN0"u1S 81SX 0S `^|.x2%\\ @i`@v1`@S`\P `P`^.1(!`x0 fQ0cQ@@ R0d0t0% 0%$1S 0 3/( b`P =0 0SE 0`@lT.1@4`@Yv1`@S`P ]`YV#`Q(aZ* 01001 `P00R00S3#`{`y()( 80-8@L#T P)0AT% 1SP10P1 P10CS1P 0P PP0CS1rs0PP 0p-LMP180S 0Sd`0S 0d0@0.@u0d@S0S 0S``0S 0`0@0.@u0`@SpM01{/v 0S0S 0400p400, )) Q-L Q Q 0-LP@U 0S `0S4000P0S0d0S4 0,000dZs0d0`Us`P c'8# -LM,ʟ4 `0R P,0  phK CO舀K 0s  h0 @0s0 0sd0    T0s0 0s`0  H0s0  0s\0  L0s|0 0sX0  P0sx0 0s   T0 D0st0 Yv0SzY㜐   ~^ Q 0 00 0 P0 L 0sw \w s0=00=0= L 0\  R = 0  0P(^Ql R  娀qlpl  l ,0r l s,r 0S00_  ,0s 0^0Q   Y l 0Bs'l0t |00S I^ , 0Bs L0T \00S 5l00Cs00ƕ,00Cs00ƕ r 0S P \ r ^ OP 0s MH KA0K< A0[PX0s \0S OOH KA0K)X A0[P;0S MH KA0KH ;0Pq{0S \0S R 0Pcq 1s @0  04K<0 8 @K400@PP0s =0 0S 03/P@0S r 0R01S0 r 00CS0! 0s 0 0bQ080S 080S 0S=0 ePx0Sb 0x0S^0S[=0X ß, 0R(K81S0=0P0S PY㜐     0 p0 l uQ 0s0=00=0=  42h ,2"2  2"\ 0 h0 d t0 T0 ` |0x \0 X  < ^h0d 0 T0` t0 \0X |0 x eOOH KA0K H {0P wPs0Sl0S = \00S 0S0S 0^0  0S0SP N5=0H0s#$zP== ,hMb" -`LMVP@ <0@ (K400 @P<0X@0<0<0`@d@0<0V@@@,A4A8AL 1S 0S 坬@4 0 081<0=0@K  剸0  ! E_@쀜    000l0 | l xP t` pp 嬠   , H0K0K@P40h0S 0  3/C/400h0Co@P)l -L ȠM a Ƞ@,\Pp60 AT2 1SP40S+ 1 0R1 R R P0CS1R 0p,10CS1Pro 0p1PP 4-LM`pQ14SN0$p1S x4V l4V `4VX T4V L4VU` 04V $4Vh 4V_ 4V4 ` K3V 3V 3V`3V< 3V 3V(`0lc0| t(0`\i3`P0S 03/`0@\ <0S 03/`PT8A`!`s~`p@`P=`` 0 s 3T R| 0 s 3W R `|Q`Xw XP`0`X0p `j !( @0@@c 0S@#%`0c00(HF0CVB81`0?$1V;`:0CV6 `1T.`-@K ٶ=00$0 h` <0$00 `08`0\` rP=|8)!A @}fAA(AA@A A@A $A@A0@A@A@"A@ A @~f -L ȠMp Ƞ@,d^P2AT. \P\ \ 0 0NS1P >P0NS1rKn\ \ PP Qp-d@`@@`0L`SLPXPpph|Y*n00XPp 0-LM@04PS_ <0S0 0S0h |0lx 0S|0t0% |0%0R 00&0S + 0 R 00t0%l 0%d0S, Q0| t0R0`0S0 `m0`00d0S00| @t0(00Q 0 R 00t0% 0%0l00| @0( Ȫҁ@)# -LMP04S <0S 0S (Kp 0`0S00% 0%0R00@@gW@jڰ 帀b, 0S004!` 0 0 004!PX !, 50b0 0Q R 0|:R:0aS0%51S  , @0{ 0`@ X 尀% 0SḀ'PuX0!050c000Q S * RQS:0aS0%51Sc s @0G 0`0SB =0 0S 8Q`0S&Qj 0Rfd0Sb dm0d0]`0SZ0 P0$R 0R SQ~1S䠅, 0`@0 PD0$88 1Sp 0Ӂ@)#X0 -LP<00S0(@#40àLY\0 -LPp<0P 40 àL  Y/l0 -LPp 40D#"B ,0S 3/0P Y(0 -L0S 0-LDP@0S0P0 T00  0x0 0-L @R0PXPTP00C00S T0000T0000/D0 0-L0@SP0\0 0( KpP ( R 00CS 0 >( 0h0 0c @0 (0l p`  pK.pP(0\ $@<0<00C<0S+ (0 @ (0 P (0 $(@ P(0,@0P(4@8P(0<@@P(D@HP(0L@PP+(  00CS 0 [><} k, 0( 0 **(7 wd ,4 <2-LM@(2P ! haH -PE   :PP @ !0ቦqP?@Y<(Kc Kp l 吐 P h` AP0CK0 *@P00S @08!\Pc0Kp l 吐 0 P h` @P@ <0K T*S' ?:pP @ 0@ 0KP H0 D@ @ , < 0p L 8 4` 0PK0)@P!0p!0@<))p0-p@0SL0^ 0^ R lP0l0l }f -LMp0P0AT @0S80Sl04488<0P0L0400D0( @P080tR/0S/ p-LH0 \P@0S 0 400)0/ 0-L M  K  彁 K Q-L ¥) 0-LP `R@0L0S0S Pxxp@00@S 0PS 00CP0PyiL0S 0L0Lri@mYT 0-LM@P@PK004 pH 8P /u vK0)-\  0S 0S 0S 0S 04 W) p-L(P@`VH7 T@#@3p 0-@LH@PFd R0d0 0S00  0h p-L$P@`-D@T@p 0-@LH@PX R0X0 0S00  0h p00-@ pqL! qD0XP<00@ 40(0@00dP<00 p-@LpQ@0S` A  P`@ 8 S`1VR T4``lTh L1-LMppPAD0`L^.0@\-/Llj`P u R& ሀ $0e;#;4 R Q R !;`RP1P! V`P ,O`K#` G`* -LP0@S< `lPhxSP P%h`lP -L(@R 80 04P 8(0 B;R#;8(00 0S 43/hH08S pht<0S/0<0 0p-LMp A@0SPP` 0 2 ?L4ch4008p8SPPp`<\h d0 PiP@0S (`PP** h1-LMppAD0P @0S`0S ȔP \.1:V5P`~iPP3@0S P8 S:0S#PP0l Q! ;`Q1!I. UPP808c0]0SWPS* -L@@\80SD0 P(4 0R;$#;0L0STlPhqRLLg` -L0S 80S@0S8S<0Shh @)t# 0-LP@0hR/A P00Z/%R-D0\  " Z%R-D000Q\  @0q00  `Z%R-D040Q\  @0q00  @@Z%@-RH08@\0^  " @0|00  `Z%R-D1<0P\ " A A0p00  A aZ%@-RH0<@\0^  " @0|00  @@Z%R-D1@0Q\ " @ @0q00  @ @@Z%R-D 0\0#  Z#R/A P00Z/#R/A0P0#  Z/#R/A P00Z/'R-D0\  " Z'R-D000Q\  @0q00  `Z'R-D040Q\  @0q00  @@Z'@-RH08@\0^  " @0|00  `Z'@-RH0<@\0^  " @0|00  @@Z'R/A P00Z/$R/A0P0#  Z/$R-D 0\0#  Z$R-D0\0#  Z$R-D180Q\  @ @0q00  @ `Z%R-D1<0P\  A A0p00  A AAZ%R-D1<0Q\ " @ @0q00  @ `Z'R-D1@0Q\ " @ @0q00  @ @@Z'R@-H@0\ Z#'R@-H@0\ Z$%R-D 0\0#  Z$R-D0\0#  Z$R-D 0\0#  Z#R-D0\0#  Z#G-0@840 <00  0  840 <0 0 M   R    0Pp ` |   0Pp `  0 840< 0 0($ ,$ 0 840<(0 0($ ,, 0 840<0 0($ , 0  840<0  0($ , Ѝ)) 4 0 0 -84 0<80 0( $ ,<  S-LM8 @1 < 0,0 A 88!818A$  8Q ! 08a1 @8qA P8Q `8a p8 q 8 8 $P ( , 88!8108A 4 800 <@P @ @a?VVlK lK0A?@P$P`(`p,pԀ0ؠ48<@q@@pG@q @?P 8AP4P`0``, 0R(KP p  00@1Qp 8AP4P`0`s,)G-MQ= 0p`0GPz @jzf. 3*fχ*1 ʠu4# Q!ʠA0# 0#0#!0#0#\W!!"0 `V!0p0Ѝl,)//1s s0<0/ 0<0//@-;@ 0$@/@-:@ 0$@/P/კ$0 -Lqhn,T -LMd00p`̠(00 @\(0,@堀0,0 ( @-,KX\D P@P\0 0S05<0% 0%\$Km P-LMp"0Ÿ @40 , :BU 0 0c bo"oFS0c aR bV00S0 "Q08 C4C2 C10Y_ 0   0 0bC2S0c0SX `0!PU[B"UaY UPV 4, : "1Ax1  0<0 8@ }b  0@p  ("0"0`E2ŸP /A!b10bc@!<2n10!0\#3n20!0\ 1STt!<2n10!0\J3n20!0\B ,1`c 1ST!<2n10!0\/3n20!0\' P0S `c0 Sr0 `4p 2Cca0/"b 31Cc K$00L0 *Q$IQmnųL0-\<< 0S 0R 1 P  8p$ P0R 0D 4S1(S0S /2 S//ELF0P/000/E-P`0f 0@0 @  f0`p 0 -L@P 0`pPCP0 00GCP 0h?C @1-LMpK0@(1pP@!, @ɤ00B`@ dFW, K 4P , 0R'(KD| K0x t |@ PIK Pd| K0|@ x t Pp P000 m,`*X*0* -LMQ8p0|,0   PK|Ah $@dp0h 0  1LK|0 !x 00 t 0 0p 1 l 1 0Sh0 00 h @ 0d 0` 0\ 0 X 0T 0P  h  K1 P0`P , 0Rn(K81 @ P0K0 =10 @ Q0`K PK` ` ؀ Ȁ 0 P C`P0S` 8!00 K 0 SB`P000 JB`P 0!  0?B`P 8! 0100 嘀K  P`P@0 0TP T   P0P@T0P`l,`*D* `#-LdM Pd0K, d &PPd0h Kd PP B ,, 0Ro(K`@K4  0\K[KZK(K[4 0D K@ RKYPKXPKHP @P A0d  0NS @?d,"|h*\*** -LM80 0psP \, 8l .0a 0 cA ., 0#10    00000 n00 4 g n`V @^*21C@\"Z @ 0   00V @^*"!B@1f Z0  0 000  80 .> 00 , 0^nP`U @^E*"@!BH1f0`  0040, 0 (K@^,*>A0@> 0Z  {0 008 0iS0c80a, PNJFfB{<:x: p-L M@P`  0  0K`=P0SKp -LMPBpB ) @`0@P/22 V/*@ @T**0S 0 PP: ( P0@P  R0S  ⺠P @**P 0-L4MP p3R,0 `,P10Cs0S(K!<0S 40 @ԕB B( @ 0cP e*E01 1\$ @L 0 SJ*娌  0AP=\ @0SZ SLQL L 1S0D0 i 4 41, 0 S%  3@@6P 3\ @,K0 0>0 1!@D0Z0$1  x'HD 00" D000, 8D! 7)40!16P aPK*L>@`*<ۣe : -LsMD, LPK  ! 1 P 儀 `P @0pW `P(d00(, 0Rg(K0!0 `PL0$ 00 `P P 0 x`@K 40`PfP5[S `C[ B&D @P0`PC[Ta !a ^  0Sq0(K. !p0>00b>0q 1 ! thz q0G 0gP p@ DqpP( K10    h !t.  . a0 S1Q>2=12>303h0 5T( 0! 1 1 hKTP Z p@Dh0Q q.0C 0b 0pp@Dq  ! !@Rʴ#[Rm0ˠ@1 1 1Q8  @ R ]h l QlKP 0c!d d hK d0KA PH\3:h0\d% * d b0 0b$1#[0d0 Z!0Q$*1"!B001 0j1 000 #[hd ` /| 1,l*ۣe : -LHM@@aD1Vp$0  8Q$K 0uP P 'Ԉ K'ˈ`0d0  0\0 ` 0T0 X  0P L0 *0D0 H  0@ 4 8 <0 0<dK7 ( , 00 vL> -L@P@1S<@ -L$M` (1@8 @  0St $P 0PSU *0 S   0 S  R:p(K00@ T T@ T T TH@ L@ D@  0T0S* T L  0L0  T LL L @T TT D H 0;00 0 40  8 0 0   (1@,(,K.@p,(W<@ v(1, 0(100,0, $,0, (00(0, 00CS 0  c00L ?P @(1 0(1$? < $<++ 0-PLPP  PP  #@ ۬P%0 p-LMP 0.> 0` Ȍ.@P0qΌ  00 `Kp -LMpP`$K0.> `0.@P0 0 `0 `P0@ `  0``P0S   . . 0`$ -LMP`P@" 0:#:S%0:#:S z'zW .%P @ @ ȌP qΌ00p @P K0@ 0-L@Q P21C 0 P 4 QP P0\0 ?$00P0 -LP`@! pP2 1C@  U 0 000 P p@P00 R00S&p+ p-L@0PS:T 00? @""!B` 0P ?$`pZ 0K+`++ 1!p-@!10 PL00>0>0 1/*"!B` ` 1 0a0`0PP PPP0P:21C  `0 ! ! ` P PPpx:m0h<0h< 0-LHM,0 0@ L0 T0$ ( TK BP T0 1P P $囎 K嗎@U+,+ 0-L8MA <0 R0 !\S0S $0`(K a1@P *0!00 `YPX p,0x0PUM +ؚp0@c 00 0`C0K 8@ 0p X/@F 8K80 PKD KP0 L@ Hp P& P 7PU 0- ,04 Kj 4K1@K@``ds0 30K2K0@ Ѫ<` `F<K ɪ(K,($p<, p,,,H, |6-LtvMphq0]e\\\Vujۜ빰\)HG X`0Q00`pP 0  R0pdP $a 0 Ep A 0şS40 40800嘅p0(80 R 0t%@0@ PP`m0-005(( 81hT O] SK]50 @*0 张>4$04 0A R4@ h4@@ P [`@P0@0PoXP @P`FPptX@\Ph@lP0T@@*@@1`d3 PT!(_0nPl2@p{abC\D#0S @P3/0S`STc@rc뇯O0S, 5@d c ß 0@@ `$P"B000S 0 "Q0SB>20S 3/P ݍ,K,00ŸR$09$0 0 @Pc H 0!0 @ 0 0 0 @U`V =PU @ S0 !1APU`V 1P5p!pp1P, \\1~P# HH1wP 441pP(= !00XP !0@MQca_][YW<|* َ2@`v_  V1@J0 SSBB c!03P; 2@pH,!$0!`0\ 1!Z 1!X0R  U0 Z(K@020Tp 10 p@T @Tp 10 p@T ڸ`2 ^   1@2 1 1s 121 0$ ^0 000R$40 0$ -L@MX pPj`PJ  0 S"$rrrs0 `Ha@[@P @0R 0` P @ (K ᶪ@P@B>0X0X,K@0 0` P 4,0, %|D -LMp@P 8K4 8 ` pP*48@0 10A0!0Q,0 P@8 ,K ,埕P8 0,0 B0R,0 P8  I@'00KP (K4K  ;P`@Z`J,K ,wP0 ,0@T0P,0 J $`'00KP  P "-L M0p(0, `PP 0@Tw T P8,nv(K0 0 PPL0$0!@0;00 0 zPP1 I 0 0 KPP  0@@ P ,KPP:, 0h0b 0 RP/PA 3/P41<  Y Y (1#209P @0S00S 0S Y P P  0S* PE  0 8`mxPY$1 !SP#P3R0! $0S Ud PbDL>8  -LMh 0l" d2 0 0\2 pP (Kd8p Rh"Jc0? 0 P lp hp p d E ʟH" 0K @2 <" #>KB/K%K(q Dr q q 8r 42 L!  L pPH`:凸P` - (1Xr `BFh"`V `2`,K,Pg 0 00K*pP00X`@X Pd  0P ppP K(1BQ mP  \" 0PS` \mP)`'L? p  ~$ RXr `B `BPXr 0S 00S00?  XRX $? (10(1 0,(1 n r,E h"`V Tr ,P 0 00K⹓P00`@T2Pd0T2   0P P p?W8pGTr W0S ! 0X"00T"000!100`00`00S00 pl 01 !  `H!p D1>0#6`0@0t0#6l08!x 41|08"R! %KP00X"cT2L@KH @0 %K `2$P = PP5 `&WQ D@lP  (\8l\" 0P}6`'L?  0pp?Ppp  B000 s%vdN @ 0& 4Q"T0S0# X00 dO<5 0@00Pd"P1T00 p͞d80@0 Q0Q p 㽞1  XPpž0 00 0  d"80 c0@ 0@0@0@0@4 `'⚷\k\"P 0d"4 ,0S %K3/Pm l2%K ( Pad80  #L?; 81S! L R  S 2/(1 /  1S/0D 0R %K 2/181pW upR d2@S9E2d"1C0 \ ~\Rup@.d" 8)d2 48Lp00\@c1  0 001 P0 00, 040 ,P4  PU, 8 0Q'0Q$p # 4K< KU@@P4<0S>U8KP&08 0 1P'8 <00<040@4 40408 $ 4(00(04  00CS 04 6<4 ,9 s<4 8,tpDML>'/pn(/,4;L0  7@  8@8H0 H0 $Y O81H0S  3/\t54R  < D0T   g8    d0l 00080  8 R000 ğ R0 0000P  p1S40!40800 0Yq00 010800S0 0@0, 0R0$0(080$  , ( ,@ 0  0 QP  8\ 0XX 0 X0 X000 X000HQ 00(K=9 =0 H :PY ,5O? 000C 0-0P 00U0\ *Y4 0"@<0^00000Q000 Rp@0SL\ 80 f ^ 00D"Y  0 x "0 380   <@zG8 GGT =80 1L  80  8ї@ 8̗ $00  0p< Rc @0(0@0㶗\    d0l 000 U   * 0   t 000`  d0l 000 (','@k$'D|Dxv 0DHXpn$u@B0 -ML 0  K -LM@00T $ 0@ @K p-LMP`0L S@Kp0 $K0 $0 0 墉@P($  0 @P`@蹂 X0p- P`L @Tp04PS0P@Tp8'h0 p-L@`TP 6/p  P $ `P@0pn8'0 @P-L8Ph P0h0 m<<0 p-M@LK`P 0T-@ @P (⾖ SyV00Kp 0S-L `0`S   000@0@0h44Q 00 n S 0n U 0n`l000 1 -L P P 0-LP@Q x0h 7 0m`l0d1-X0SLL L0S900S0C1S0! S0%5D'L'sH' 0-L3/p1 -L`M@0 K  !6P( K @Z$(@0@t lp嫮\0CAD.0@P@$U< 0ÃɃQN ` PP0*0 Rr 3#!8 8 \9Q B0 .,0 ,0 A"4 ݴ40Si ,@K n[  00Kx[P00<PŸ0U0qm@2 RC w K[Ÿ!>0 C6 H @@0 6RL0  0P @@@劮PD 4 !DP Y0!0cC61 `@ŲL 0@i@i [0000S00#0D! Tn,@K j,8B!0 _k" <0D6 Rk0x 0l  0P l Q0d@KP 1@< v v0 Ã/ 0Rl PR 0/0S00 /00/0/0S/ 0-PL@u0h -L0Sj6 -L0  0j6 -L0 , h10Qpjmj<66 p-L0P` @ P V@ 0D Ppph8-@0D \0 -Lh  R h0S 0CS0 R/ 0yj<`7<7 -L2M! ph1 0  `< @0<0 SPP0S (K,X* $iX!X0<  h1 0S2@.8K 0Pd, &p38K-  # h1 0Spi8K0-  p38Kr-8K,P ii+<7P77t7T0 -L h  R@ 000qP00< 0-L@P  0h P0 0-L@P 0h DP080 -Lh!@  Ph9< -L@ h- P@0S8@0/ -LM8CP`<0 (38 Ph (K)0  @(`2"00H408P0P`0Sw4P 4 1p0S 40<404 00*  4, 4 |00S8@0@0<1/@PUwUw0 R00,K  弥PC,0SL0V 803/40 @0!,40  40040T!,P4 0  Y40  8X@ D0R=J U5 0l  0O l\X  0S@ Q0x^W˩,0L040S4 f0~h,|h(zh$xh<pn(> 0-PML|@T p0@ P@PL()L8@0( Z000K0J[ <>0> 0-LP1`00@ Qd0`@ T@dA0h p-LP@` ^  000@0ph0 R 00aS0 @00p 0@0$pn) -PL q @l0S` 0 R0@p00p@81@ 0S00l00l0p8 8R P8  R P@ @0@0 @80S@@00nSpn 0-@L`P TT 0Q0C0000S0 0 0pn)$ p-PL` @p l0R0Cl00p0 0S00 8 @!00CQ ppnX0 R 0S P 0S  R/ //) p-LM@KP`Pp0p R R 80S@0S pp 0-h>,D>0@-@PU P S! 80 0Q Q U U00 R0^0D > R00  ! 0 P 80 f$ $10$1$/ 0 /-$8!0Q0A""0! !!Q0 1) -@1L0`p P@T T8<@1 T8!<@@ !1 01@pn10/,0hD!/<1@!0cS#3/<, h1 018 4004/<84 R040/ 0S00  /@-  3R $0  / 0 0@ 0$@ -L@<`V-0<08с@T@T T (0 (tp -0SP @T(0P0S0-0. 0Ypn`x>> 0-L@0@S0@P02 @0S0> p-@1P`1L($`r08<1J 0P p> 0-P A$@rL1 01 !0000 8<X0G 0`1100110`@1100110 1 100 1 10110011Q 1! 101 R101 0QEX1011 0100n`0 $Q 0  0S npn) -LP`<0S$ P!80  0-0@}-<0S Xhp@00CS@0@80   80   pn -L`pPPV^L!8㎀@0T@0

-L`p @PRbT`@00 V𨝈06p0 0 -LM0hlpE_0! E_U a0@@@(KP 4K NrPH!,0A<,104P/1,@QQ- P0FO@0J0 Q P XH <XH@0S 0P @K a@0 0 rpQ,,, ,0 W 0W>`x>>> -L MPT1@ 8c@^p O?W(K 00 0 SrPT (`K qPW  0 D1$0 SO?"( 3( K -L MP@E\$`@V U U; T* !1 ,0 0$0 ( ,1$  1$00$0 1$00$0 1$0@0$0 U ,K$00$0 00 (0 q@PV@ ,pK pq@P @ K 1$00$0  1$0 0$0 0 u -L4M4 <0 8 0 , 0K0 , 1.c, @00 K Z p1x#@P08@0 00` 04@@0@ `0O`PZ 0<  0@ 0@(K`4 \< @040.8$0 0@ P`T?>? -LXM 0`(0 @ P TK`@ pad1l!8@ < X@ @0 `0`@K640 d 0 l0 Ơ, %P ( 0R$K 0gP P@5[ 0` `*,d, -LMR @0`,0 8 0+8  80d0l D Q&* NpKΆ0""T!P p , 0R(K pJ0@4 0-K00 0cp 0 @ @ |` pP @0S K$!   0wpPX$A00S  $$0 5 p1S16 1S 7 0 $ bO$0 00X T $d` ` \ $»$ 0pP81dK0p$ P| 80d d0S` 0Spt DZ $w$0 J),TH?`*R8k'8e)pn?l? -L MAQP 8 0Yq X00%l4h!R 0 S  R (0 11P R4 1$@as80 $ 1c10,0 1,   (1S0(1ʅ 1 RM 0,0 E{ 4 Z000 ]$00Y00S @T T  @T,PU -0S` Sy S@T T (Ko80L Xw 40S0P{P0S (0 (KY14"@a FO@V{b, 4 E3L{000 EF{(C{<PE(Ko+{40S -0SE!{,@ (0 8  @0,p34P00S*0P00S@ @@E{]?᳀(0 (0 11P$(z 12S20 1ŅZ'oEzR(@zz,P ,0S@ P0S@ 0-0VEz<)pn? - LN0 -L@T@T 80  8z $ 1  @T  -L(0@@ 608  10 P 3Q(0  !1 1s D (uz`1Q1Q 08  10 P(0([z(Tz(0 -LM @80P $`0A s lphdQ Ki+!00008 10! !1 1 0U1 0!10101 K) Pp-L`Pp@TpU  80 @Tp P-L@P h S-`0Lp( H1PU" PU @00S(040T0S  0P W PUXR  PPU PU @h 00S(0 R  0P W -00Cs0S -LPp`PRPU 0 R Q 00S U U U h\lOP@T0P \ 00S U U U @TU :@T -@P0 UL p𩝈R&0R = B @`P  0S  `P (0 0iP Ur R0i 0i b0i@B$$10CS$1/0$0E( 0-LP F$J/@50$10( 0-L$0P$!R0@$@0 -`L$P\ p Z0@@ 1E T101x0\1O< 1P 0R 10P0) H-L M< w4@0 ,J 0@HKD7h.?( p-L`P 0Sp@ T0p2@T  Q00000  @Tp0S/SQ 0S/\0000 000 -pL@` P#PW` P 00  00S00@ P0-LPP@@@T:P0T 01 R0D00O? 0-LMP0S6 Q1@ R 0A@S0@& R 0S S0 0 B00 0@ 0@ 0K `jP0 NN?? -p0LSPa0SV WZ\U0 0CW .\, @ R W`1`!P$1 70S( bj^ 0 f0 00@ pf fW P0S  j i j$ 0h!R lNhN< @? -LM5 K `-LhM0 @P@, H0 D@ "P` $$0S @T0X0 P `PP YP@PTPXP ßP P 3@ 3 @3@@tß  X@Yy \@ T@ O 03R\,30X  l=K#L\0 d {YŸT T0P\P`0 T0 p\ RYd, d 00< l h 0@8`XH` p@T$( H0,00@P48 h0l0d崐Y @=K XT @HK gXP A @0=K B!CD EFG@@gL\\h00CP!00@4, `0RF(KU 1Z `0P0 P PpP 0L0 XL儐, d 00<t p 0@8XH P @`` P $`(pH0T,00@P48 p0t0L>Z(!,*4@**PTH@@,-P  0S 34\^ hQ/0S :P/0 (00< QQ-L MpP1Q1 $0KPP) D$ `&$0 $00$ 0@0,@0P$84$<8$@<$DD@Pr K(KgPP l(0 @('X(T (0 lh0lwPL -@LPp`$XT  0R 𨝈UT hJh MP-L0 0S R K P 3h P-LM0  0S RP Kh Q-LM@NQO `PM Z: @0C -00Cs0SA(0L> 0  0R>802P U;P00 U"@#0 @@0p ( KP0E0"@E0`0~@P ָ(K@@,  ` g@S@P Q-LTM| Q0JS-@P |P -00Cs0S(0  800JS @ l@ P00P0 @HK=1`8 P`0 \@  80KhKX TP 4 h0 dP P` L plnPZ Z Z|0D<x x x@ t0 Htp  1 p 00!\,0 A eZ,Kt CgPfp@P00KX 4  80 l80KhKP `@ \P T h0 d L 2PN0 RA :#:jc0@PT0 d0 08K lhK`@ \P 8p 4` h X` P L0 P2V6 0S@10S @T000Z8, fP ,0 0T ,0 50 0 00 (K Z(K00 t fl @ 0 0R@ eP;  | D0, fP ,0x 0\x ,0 tt Zpp U | <0eZZ0|700 -LMD0  1P`/ UDP   0@ 0$@ 04 0@80<@$ @D  0@H0L@\ X\ 0@ d (0,@(0@ h08, 1x00000000 04…08…0⩏V0 - 11=H + 00,5 B/A#b 00=9 =\2 01A !L D p0P0H0@1AD0]1! !1$1$0S1(1$0S1,1-001(!M?3!O/ 0  8U NU U0S`00`00 S`00`0- 0Bs0RS) 0S X01 `01 h01 l01T1@0@- 0!t00x 01 111!!2!P0S lQ  RUDQ1SP0D2HB-00Cs0SS 0!1=1A2H!B/A#b!0O1A/!0O1A/!0O1A/!0O1A/!0O1A/"0O2B/ "0O2B/ "0` `1pQb$b(0@L2PB$!`"00 l 0S00 p 0S00 t 80 Q p00|0D@S0C0T|00@P0T@0|00- 0Bs0SR 0 0@ K4Ky,80/4@?L#bN3c1!(K`00h 0\2/C#b l00@t!|01 A =A0`p AP0@X1\A3Mb?B R-L$MH0 HD Q`V pWV (K03hA1!< ,0 4 Pp30 DP  2DP @ 8 U< !R6 @-0S2 ,0Sn[(]]\\\l\[(0 #ZWj4 R @T@T ZW00@ @ ld fpGPD@TPU80Sa18 P0 <0Q P0 < 0S P80 0 0S p0<S P 00S 00 <0R P0< S P00<S P@0Sa L L[@ 004P Q Q@p 000Q@ dP fpGvD R 0bH S 301H 000< -LxMP `/p (SU|  X0@00( 00  00"0  ( 0 , _P. 0 0 R& 0@80<@00CSn_aaxa`ha0 @ 0$@ 0(0 ,0@004@$ @D 0P080<@,HL 40P0T@<X\ D0`0d@Lhl U$pX x0@p0t@0 x 0|04 0@0@L  LQ ` S  0K P0Kh#0@0|@K0D @P  R 0 00x1000@A00=9 =1R R0 !(K$04 t!$0 l! pX$H0@`1dAL0h1$X01 !W 0@1A 0 ! 0 $0@1A !L0Sq X@1AT01AP $1SS S6 SX 0@X1\A !0@1A pt 0@1AQ 0y  B1yW 0y000000x0 | 400G0@1AD0@(1,A#0!,0410 8!40<18 @!3D1 H! 0L1$ P!(0T1 !IXD0@(1,A3018 4!3D1( H!019P0S0@1A2 Q-L8MP0 Q PU RH PH  0@U< (KD0 8hU01?# @0 p34 WTL r TP T8  LX8Y0!0  P0S 3#P<^s7@T  `8 8  8 @T 0S HDP030#Q0S 04L L@ aPHDeA`H D 07@T , 8 p(0 80 -0S S <\-0 0 S' @T<0s6@T 0 8 p(0  80 -0S S <\r00 So @TsLQ\ HD^030#Q0S80080 \ HD^030#P0S80080 H\ HD^030#P0S80080  R`80080 `R0Q (0HD^030#P0S 40L Pm@ L,SaP ,HD  Be, H D  L( 0\ HD^030#P0S80080 \ HD^030#P0S80080 \ HD^030#P0S80080 H\ HD^030#P0S80080  RO`80080 `RG0Q (0HD^030#P0S 40L P@ L0`P 0HD  Be0 H D  4 0LPL,@ `PD,HD e B, H D 74 0LPL,@ `P,HD e B, H D 4 0LPL,@ `P,HD e B, H D 4 0LPL0@ v`Pp0HD e B0 H D c4 0LPxL0@ ^`P+0HD e B0 H D 4 0LP_L0@ E`P!0HD e B0 H D 4 0LPFL0@ ,`P0HD e B0 H D < P-L`p @ 0S 38PVPR00SP0 @ `P00 hx_ -LMP p, OU`$,0 SR00 SU0 0S @V  _P00` ,  H_000V R S  D_`P @A _P00T -L MP K -L MP K Pp-LP`  0S p@U@R00SpP 0 r_P00p ph^ Pp-LP`  0S p@U@R00SpP 0 L_P00p ph^ p-LM`\Q Q0 \\ 2 1C0PU P 0KpP H0 <@K $@00<08 R@- @Q\ 0@- R0-LMP@@ KxP0T30%K00 -L M@` \QP20LS5stvTv8vvuuu@u uttsttttxs,tsTtss0S s p>PP 0dSd00SP0S  K830S,-P 3$P 3 Rß 0KPŸ 0CP2@FP 0PP20S  Pp2p"@ 0@c\20S-PH20S-P420S-P 20S $K3/PP $0PA0cP 0P PP1!0à L Px PPsL10S 41Ph :Pa 0 0b 6PU 0 6PL 0PE 0P= x0kP6, `P.|*\M*s$u P**T Q-LKM\`, p @ C 0B>S񟗐PxyyyyyyyyyyyyyyyyyyyyyyPxyyyyPxyyyyPxyPxyyyPxyyyyyPxPxPxPxPxPxyPxPxyPxyPxyyyyPx0BMSfԃ\@؂P8 yyy zyhD$pLȀyyyyDzz|z\z ||{|d|{h{D{~~~~x~\~8~~}}}}`}<}|D|쀃,܁, 0 R(K 0 0 0lʟ0 L@@P00X00S0:$ʟ 0  9` 9ȩ  L  00 0QY@ ( @T \9@Tɟ 024INK 08 &P81 CRS0wuL 02nȟ 0Bfȟ 0:^L 0NUL 0@MD8^ 48R C$ȟ 0;H 0@P100CUS+0S& @_`pd 0!7'L 0>dǟ 0L 0L 0'Ɵ 0P-hL 0L 0L 0L 0Ϡ D64Ɵ 0Ɵ 0ş 0L 0@L 0@d5\K T5RG 0b\50L5HA DQ Bn  R?K@ sE 0@PPi0Sf W6d 4]ğ 01Uğ 0L 0!E0 S<0V> KOKy C[4,ğ 0+ 40S00<1 <1  O?K7ß 0͠ 3& ß 0tß 0Tß 0L 0@- 3 S B0MK 4 l410Ÿ0 L@!P00X00ST2  HR00  KJPX 0S0Q S00S 7k 0, 1( 1Tx l1q T1jH 0a( 0X  0jNA0|G,1=<.'< .a0$'4LM8<2( 2@1XMbd.4(' `*9(411a $0(@, -L@MP0`S,  0B S@(K!\KY@P\00C S ̆؆@P -@X0q S P ,K iY@PP( P@PX 81, H  a R<*} @qqqpppp,0 ,K0 A `XK 07/Q@ X dPT Q  Y@ fz 0z@P 9{w*$utrd{$ 00  R/ P0S/ RC408 10000  P / 0-@PLM0 Q PK XP000 0 JY0 EY0* -L -0pQL`hQ -0S@0 00@`0 G$ L0! l @Ppx@00PPW=U=<pn h@|@ -`LԠ PF40 1pPU -@0As0SP0S PUT0P000000 -PE Q ^=pn @ -LU00 u 0@T `@T D0S`D0VD0V0 00( p-@LT` P0SP -0S (eppn 0p-@LPhQ`p`P PQ 08  10 P $ @0 0``p `p<0 Q0-LhAP0([e <0S P0S 0 -0 0Q 80 10 P PP0<< -Lh(0K (;e#T( <Q/0hT; < Q0-  0LS  0RPhA  0- x 000S `-0S0!!D @0(0heQd<<.,pn@ -o`LMVPp30 R0 R @ 0PK,@K 0 oQ}PP00U00Sn 0 <XM1pns`@@ -LMD X`p@ @ V0<0 B 8 K@P08KTd Q LPIr R @<@P#@(K00@TP c ZPt!t0 O S.AJ`Z?D D@<@PP ,K VP,0S@ D 0D0 D D0S xD0D 08@D t0@D0U 00R  0@ k y2(A -L Mp@P` (PK `VP KPI -LM\`P.Q1 4@Kg묠 }p' @ t3WP$K}$$ 0$; 0;pn`@AHA 0/0 -LM @0,0 @ P`0 pc5F$0@X0 @  , R @0SW0@ * -LMp,K,P ,0K `500@Kʚ; 0-LPd 0Q 0 P0@  04 -LMp,K,P ,0K `500@K@B0@-(P40@@T @0S0*0@-(P(0@@T @0S0*0 /*`0 -L0P@S}?H H0 Ӓ< ?A3c0 0 *MbHp@-RRP` ڔP`Q 0@0$0@p rP`<0Q*0P`Q 0Q0*x@-P,0$\ $0(@* -L,M@0P,0 p Pp {00@PT 0L`K   e8 D @`0T 0 @+$, 0R(K#*,TTA(7, -L,M쐟LKP, p@` D 0PP , 0R(KDP h0@T @T zDP0@P *,*,Q-P00CSPh- L0 80i0 0 HHD 0-@0LS  0 21C0`ÂQU! 0 0@ R0P0R0 Ț@0 0R0 0R0000 $77̴**0`AA -LMp,K,P ,0K `500@K@B@-HpDP 0@`$^500@ @0S*ʚ; -LMp,K ,P ,0K `500@Kʚ;@-HpDP 0@`$^500@ @0S*@B 2-LMPp@ D @< @P/C@"0 Y@P n @   1 P`A$0 @V 0$@ 8`K@00 K @PS0@ ,P  8KU0 0@0@R8K0@ 8 4  8 4 (0@cT@PTP@DT8K(, ,P5P0@80K408@,5<@0Y@ !K P@P$ EL \%`q߀< (`@P0H 0 @P@04 00(K**4@Bʚ;**$$ 00S0/008,H -L4ML 8KLQ00KOH D L u!%!H0K0W@T@0 <@ JG 8HK8PK`0 p pW0@R00 ,@ 1. <쐟P`@0K 0 @9L00@8P 4` C0 R , L0I@Ph8 K @ 7(KQ0@P`S0@ K4ʚ;XDA -L(M\ŸL  (KoL 8RP L@L P0Op蓕H D !%! pY XZHK0@ H D !HKY P` p$PW`@ <0 0P ,` ,0SHD @KTY 8 4 0 K 0Z 0,) !840, OP8 s,,80K `0?@QQ(Ko WY 0@0@T0@pP(K4 K* @B0S P(0P// 0R/ɚ;-R \D0\\ ,00\00Q?B  / R/ 00R0/@-\ 0 l 0@=Ɍ ͌   0 `  \    0 l\ 0=Ɍ@ ͌  0S0 -Lp M4K <4PK`,0PU`0`S!X0  V 00(K X࠳00X\P 0@P`U -Lp M0K@`0K(0Q SJS T 0$KSP\ 0T0SP 0= @ -LM` 0 \XK(pK0 X1 R 0@=)B -B (@K0P Q  r RP Q 0R  R 04K 04K, P cR4 0 ,  Ც80@QS(pK0@=) -4 0 , ?B -L$MP@`T$KHK @` 2 1C0T@0H D <@ 8P 4 p@    P0Kk<K040S 0@K0P% U T r R 0@ 4 <0 8@  4 (0P cR< 8 4 0@=) -< 8 4 Q4 (0R  pn -L,M`pWTPU TK O@PHX  0K, 0p w@P>U@; HPKTKP8P4W4SOQ<KH D0 @0S _H0KN gOPV   _OKp 0-LHKT0K@L Sl\H D @ 0PK`(0PU`lQP00=:#:S  = @ @P  0R Kp< 0@0$0 @ +w Q  Nʚ; -LMpQ괳p̳Ĵ:#:S!= @ @pP  0S 2$K+3`PU` `\` `0P``0h \0P1Ì@`eȌ6̌`<!P`\`k0P1Ì@`eȌ6̌`2`PU` `\`_0 P`\`0P1Ì@`eȌ6̌`<!P`\`/0Pl!@`  `Pq4K0,K 0 P0S, (0 ; 4 K < 80 (Q 50@<K`Q 04 0 a_4K0@ < 8 4 0 0O0PŌ@`kɌ ̌`0PŌ@`kɌ ̌`MR40K<0 8@ <ɚ;6e ʚ; p-L M`$PK@< P MKp p-L M0@`R0Kp" $K60 R0$KT Q  r R  Q h0{P 80QU 0R  0AB 0-L MPpP$T 0K LPV $K LPT (00@K0<K#<@ 8P !B !4 PV$0K Kp 0-L M@P K0 PK LP0Sl$ $000   R/8800 / -LM`@P" 0匐0c,KQU  0KBt k k0L0\ 0  b0 0[0@V(K84LBPBD0 @0-LK00I0,(@Z@T04hBxB88 -pPLؘ`sP0^ |@ 00bW0000 ^ 0@P U ms4-88 0-LsŸ00 0!0 SQ Q 0!010 P01  0]C401 0R 00C40!0C4010 P0C401    B4:B80 1 0R 00C80!0C8010 P0C801   B8"< 1 0R 00!010 P01  @.s@T@0-4888 0-@LT;s P P0 00 0  00 s0- 0-L0@P4 Q4s 000 0 c0cSP0000  0@@TrP0H 00P0 @@r0//-48BB8 -@0LAsh(0 -@Lsh T0p-LϠ \?@@v Rphp00@- 2Txs -p 0LQ|0Psl @0`OP, 0O0@T1@iOs@B0 p-@ `LAs\ 0O, 0O0@T1@ph's x0p-@L`cs\ 0O, 0O0@T1@phs @p-Lr4b\L $0 00000cSoSb SA400!!Ń1у10000 0bSG SA400 !ՠ!Ń1у100000cS- SA400d!d!Ń1у1000 0 bR RC400 ! !Ń1у100\phqRC80#< Ń1у100SA80!< մ Ń1у100SA80!< Ո Ń1у100SA80!<\ \ Ń1у1000 P000@zq4/qr-848888 -LD@0S8?40$0 0 -@--- -LMhQ R-@ P P@ K0q p@P0S7 aQ @0S`K ,~@P0Sp 0 p0S |`Qp0d0P ,`0S , 0--Xl*@--ăL0 -L R4@402/(0$ h---@ 0-LH@T04044 0 g0--@ ǃl*ăX p-LM@`pPU  p0PU0S 00CS0 Hpp0S00 0ppB p-L`PP @A T f#PPX\ p-LPPT@P` up00 0@ 0Qpph- p-P`Lap@T00;p 0;@OpT Qph+pT  T/-#pph 41, CRQȃBC -LM@P8`p$P  !0K\ p-LM@Pp R00phoR `,0 S ` <0 0SophtB(C -L`p$ ᗿPP @P `@@o0@ 0 yɃ p-L`` MPX0 P@ Px% s% lo0D @P @KphX\4C-Ƀ 0/ p-@`PLo0P 0Q0000$0 P000aop p-@PL`so0 00 $  $0@$@JopCop -LMP`pTo ^  0 ^0S %o@Q 000$00   @ oT B -LM`4@K($,pPP o@@D@nT ս p-P`Ln@T00n 0ѽ@nT Q:phnT  T+nphb4* CRQa΃DC`C p-LM@Pn R00phnR `+0 S ` ~<0 s0S{nph$CC -L`p( GPP @P`@@ @9n 0 @$0 ((σ"(σ- -LT+C -L@P ||0 -L @R \vH0(! 0 0S0#Ps (!!D0S0 00.,<8 p-@LH` H00$S$0#H0P 11S!1ԅ 1ąppn0 -Lp0@SHP` u1x 0R0H00BUx0 0CSx0 {x00CSx0  oPPHPh(.-h0 -@ L@ h1S 0 SP0S0  00S80 -L @R tu-0S S *08   ]?0S 0CEkS0-0x0S0 Sx , !D0R03 550505.,C<8 -L M⤢hq+-0S 0S |+u4K4PK`U^ Q0W0s0S",0PU` c \4 0 , l4K\`1P`! QQa0P!@` Qa!9Q`0SG 0S2.  `tRXW0-0 X!000S0 S41  t0 S9o(KP0V ,0S000S. 0S0@ 0S0S0Ō@ kɌ ̌4 0 , @@Y/<0*,,o/,0*<.,ɚ;6eP$u8`CCDt0 Pp-Lha\@ !!0-0 !P000+p)<pn(D T0p- LH`hA0!!-0 !P~000p<pn 1-LM!, `Vだ1`VV t1@T@ hq@T; -0t 0C s0St x0p 0x0x0S5p0 dVpPL L"1lmH0 p L dmH 1Q-0S!! !@T'h,o!!"1!S !1 1(( $0a)( .pn`CTD @-L8@ ,0 $0 0/A!b hv؃Pgfff0 0/(  0-P (@L 0S-0000(0P(@0 000/,00,0/ Q-L@0Q0P (0@ ,00CS,0/Q -L@`TPp& p@T! $0SU U)pW  'U U U $0S 0 @TVp ' z'XDDD p-L 0P`@0S 3/@p@p< -L0S 00C0 Rh.?(D -Lp`@TU@ 0P$ RU 00000   㽼U@( p-L$0@S` |P R 0S R кP 0@ `0  0ph'' '(ED8E -LrMPj0S ڐ2 0S0C`0j 00Cs0SP0S P j00S0j 0S* 3/P@T $0ST @TR[!0S@ @ @0S V0SE S00q R0A0-Q 10 0  000 01 Q0S  Q00001S RlX& `S& 0R004='0;' $7'(.hE  FEEtEE p-LP`@P0 0 P $0S1P pp  -LMp0@`/P` ׹PP_ 0 0( @0S* 000h!%PI$p @RTR 㰹pP= T*p 0!R20,00Q0S Q0!R 0S S0 R 0Sʵ!1K8&4&0&(&$0T  &|F0FFDFFFFF -PQL 0 Qp0S`0S 0Cs0S 0S@0S 2 0RZ 8/0S `0SE -L0@S`p60S'0S  3/0SP+0U 0S P ׺Pp0Siͺ00S0h"&0\)%0S D#%p0 $%%$.GGvDGG Q-LM0P0 4 ,0 (  0 Qp0$  0 R `0S 0Cs0S  0S@2 0R 0S `0S`0 R , R $0DS0 00$,K4Ke$$.`GtG -LxrMp@h0S T2DD 0S0$0hXd 0 Q P^ H,0 Rj 0Qp0Sg@0S00Q PP00 @XK  x$Y  9/d!0S  0S V p0S0S00 S00 0S sv,0 Ph00CS0$+h(KP@ q0R00X-$PPP P0h%<<D D0c%((8 80^%(.hE (H`GeGgGfG -@PL` pP  0h;V6/ 0#4. -LM0`, SpP4 ( 0 $ 0S"@00Cs0S0/P4Ke0S,K  p-`@L PP  0ph#pH820P#/! 0Q "/@-(0 S<3(057<@ @00@09780<S"p* ;@ @0@0< 7P`@ p0@ 7 :$T0P7<P`@ + -LMP80SH`= |pX9@Y (@Ġ 00 ,0 k 40 ;8 40D(K 2hPP`00 @$"X W Y 4POT @SD4K@0XW0 /@P4< P/0S/ 0 S/P/s -LP<0 R 0P 0P R@ -LMa/p, P@.P , 0R[(K /P>< c080 4K  . 00Bs0 S?/(K0 QP2 0A1@T (0 P @  (.P- @TZ \ 080 (".P0.S a0B8 s0Sa0Bs0SW0Bs0$Z,@DTTH - -L MPp`4$,K (0( "4#220$ 04DˑP 0 @!(K, h1BPh ,0谥P 0t !` ,h1 <,+0< ! h1,-, p`H<edAHH -LM`0PK0 0 :.P 0RK00[S  00Cs0 S00•0SLpQ @@Q -P10K,s- 0p-LM`@K Kd0 ]PP 0 K0 @@0@0  K0\SQ QL0 H!D03/ 0RKp( o"m",ՌHd(- H -PQL`. 00S`S%p0@T@T 0S -0P0SfP020$ 0440apCWPE@  -L@P T,!P0@T @T 0S$!@T!$I 8I$+ -LM`x0P ,0 @T $0s (0s @TU 4@K , ,P RT `X,X00P(L(0000Q,Z 0#4@P0 (PK0@#88#Da'$B0~ 5- 0KE@P VPPpT00S 0S V 0Si 0SN T ,, 0R(K R 0S(0 @ T,&P0&^0T0U0Sv긦0s0Sj @pPP0೼0  " 40 $ 020$ 04 <<6  0Ɵ$0a6 0G W 0S% |" 0#(#4(@"!| ,40T,8 8#$"Q r  h0R`5  Lp p+45 ,Ƞ Ƞ,$0a0"" p p4 ,Ƞ Ƞ,$0a0""TȤpKV 0S|  @}w*Pww\+P 0u03V0SVU@E( K0^*SB K0 PP 0S& 3\#   @Cw*=wt+P X,0S] S7 @#0TPPp0㸀K 0N?PP ++Pag~ 0K*P 0S  P @ lO@T@T $0s (00?@T:AeP H0 ,(,("4#220$ 04 P j K0`@P 0P@ P` p + *P pW (0 P @ *P @VPPz@ YHD@ 0`@P P@ P`,@H8(IIDIIL8JHJ$+pndIpI60IITcIILI(IJ8-IXJ *q 0-@PLb,00S,0 0hbd 0-LM80 < b,00Cs,0c 4pK4PK`d0,l PU`QOJpx X1 Rptx 0@=)B -Bptx d0<\+X< PP`8p0OP` pPPT`8p<82b<0)#(KHP`0p 0OP` pHPL`0p4@0 0@@0D@0=@P` ?BJ -L⬀`0S Pp@0@S 0PSp0SP`p@00@S 0PS  0  0Tg0ppP  P @0T6 TUA B:P3 T U-:TU\00 000W 0 009 0p  U*00( 0l 0R 00 pp @( 0ph-4L`LLLKL p-LSP@3 0  0S0`` 0P  0S VP0A0 00@@pV 0^ 000 000 ph0\  0S 0A0 00S00@@Ppph -L(M`P@pPE P? QB ^ TX:^S  CD D dZD @X<0J 0$N  0I ;\1 P Q # 2R@ 0D0l0`0, ^Q  R# @!< %:0 S* RQ< 0 S:0,0a 0@R  W3 #8 50 54 58 %0 %4 %T:* P:@0S2  0@  n0 0H cH0N  R 1:0LS@0*P* 0,0l0 @R0S% < W#: D0RX!: d R000Sv04 R0#03\0S<08  4 0 8 < D0% "=*W9:@ R 0 @  n 00 jN0 0S01 :QD@ P*W % 0 ::SX!: e 00 R0S304 R0#03Z0S8< 4 0 8  00 q 3S R 5 0000H!1P  @= 4@8<  <0l@(K @< 0 8 4 $!# \0|tD 4`X P8 0 4 \-lMMM4MXM,LLKLM(NMMM -L@p@p @ P`pigHNt- -LMpP`@PPP K  0 @dN- -LM`P@pc RY 0APQ`0Sf 0Qv: U  0P \\  UY: T 0  U: T 0P  0008!0AP = T: 0S6@0pd 0RDA 0pF85U\00 000 0U0SPB20d2p0: #-NLNdN,LlMMK4LLN 0-PPL) ^ 00 @k@T0 @  _ R000  00hzK- P-LM, 00 ` R:U+V00SpXK B^W We  @,0FS0$P(` 0@ F,@ ,0 0S B0 0R 0 0 ,00 000 0000 0 M R  Rq R0QSO 0S 00 UV i00  @(Kd0 \- D( 0W0 0   0P! ,0p 00@0 0000 0  |PP  0S00P0P0$@ |d0, Th#`@X4X0尧@ hlpO-OTO-\O OLO O0-p0 R0  0R  Q R0S0S0000 00Sa0 P00/ 0 /  0-L1Ps0< <0<@<00 @0$ 00P0L.pn 0-@LPP D R00 0S00  0pn@-@ 00bO 0$@P/,1 Q-L`7 1Q 1Q  1Q 0Q0  0 00  0  p@  0PaU0 PPP4 0 0000 00}f~fvtwt@pnx0 -L R`@0 D@00000 e0  -Ldp@`A@P H0 S  @pn 1- L@P`p\ 0-`P  000^  S 0El@Q@1@!T `P0Q 0Q`#`pnO Q0-L@00PA0 R   x0 P0R0 R {P P0000 0S0SU RUa0 0/᭾ﾭ @Q@#0-!ALP000S0 @Q@#-!QLp`@ Q   1S R 0@-P@\' 0S$ ^) ^ R  RA 0 0 R0 00 S0  0S\ 0 000@ 0 0  R \-  R / 0^ 00 S 0  0S0S0P@ 0 S@@0  @0@ 0 0 0S00S0@ 0^@@  @0@- R 0S^ 0Sk 0 0R 0SI0SD \  R0 0 \0S0  0S R( ^ 0Sm R 0S 0R 00 S00 S0 0S    R00 000 0 \0S0  0SR 0S@0T 00 S @0  0 S 0R 00 S00 S0 0S    R0 R 0S@0T 00 S @0P  0 SP y -LpX5 PU?P0S`X`V  0S@W `RP 0WPP 0RPPV 00SZ  `X `V 0S` -@LP& ( 00 S\  R (0c\0 0lS0P 0 \00 0&-P( 00 S00SP (0c\0 0lS00@-P(@ 00 S00S@P (0c\0 0lS00 P 0S/0S/P/0S/0S/0S / P 0S/0S/P/0S/0S/0S /P/Q00S/Q00S/0S000/ Q0-PL <@DRR400@-HQ@P /x@0@PL| 0@0/ -LM, pX $`,@V P, :/P 0U@XPU  0,@02$` 002 TV 0@ 002T , `F:/V 0PU -LT0 T0 L} -PL8p@T 0 `qLpn}0 fL} p-LM@P`@(KT@ 0@K `  LKp.} -LMh`P,@KPp K$P T0 P$L@K(.pn} p-LM<P`@(K@ 0  @K ` LKp8.} p-LP@` P T0PPpT0Pp -LMRp0  S`, 1 S* S YQP(1@T ,  , P0S , P0S @0T 0S  ,KJ)YQP0y03Q0SPP P P X0 R 𯝉 X&)  !)pn\. -L`pV$ `(7/ 02 P@T0 7/0 03P`VOO -LMP0`Sp ppS0pS(`@ $0X@6/T6/,6/L<D H06/6/6/W 0S 6/0S t6/0S X6/P (86/K,6/PD0< ,0bS`K"*8 00R$0S.D0< ,0bS: @ T|L@Tp@T Q00 000(`0 (Z@Tp 0 8'`pT!U p-L<`40@TP  @Tppn\. -L @R" R$ 0S T 0S 0 00HQ  &Q0S0SHHH H0g 0S00 $ $0[ \.`pT Q000 0S00`0`0 @A$ K(0KP $( X100Ptx hIX`FXXN<A0( X0048X(5|Vd.VVW0>0S%  !J0P11""00pp@TO\Fp0p p0p @0 0 ?XOTMLJHHH H0\.48'~Xh.$$ F|ElFE$XlX@X`pTuX \/ 0Q|/ 2 1C c ' -L MtptP`@F ` 0 04c`V pPKt'X8~ 0P \/| 2 1Cc'T1 -`D1PP81 p U00SL@% 1 Q X00S@Pp PVP$1 VV!W 0X0Q0S Ui= U   xPW H 0U0040 R v011. R-LhM ! @  |@ , pPP@ P t l T t@%PP00mPx d0 t@ @h0 ` \0 t p  t p 0LZSCrrrrrrrrrrsormPoroooooooooorrrrrrrrrrmrrrrrrrrrr`mrrrrrtkrrprrrrrrrrrtqomrrrpmrr4prdplm4q(rrppmkrr@rrrtZt  P W00 S} 0 zP, 0R`(K> mhh h   `@@ \  `@T`00P0hs0S,@Kh l@  RX , K2l 51:R[ 6``|A P`0l@0  dl@ h d 0R00l l0b a bl ``P`h(h %h@" P@@ `h0 h h@ P@@ `!p00Lt!0000@ Qt p d0 t*P 0@ \ p ` t0P!0p 00A 0 \?`0 t nt h00h0 dt+\ _0@PCKl XP C0K`@ \` th @ h Nt0lPhh t0 h h B@@ .0`l0 l8^Q@l ` 6P l `0PbU`PX h  T Y `@@ h 000h   h  \ \0 0h'P`h0@T 0@ x@ h0 p@ \ h M L H  ` 0S S S`HL0CK& @C0D RV ZH PW00 S   G @th  h h \ T h0h h@ P@@ `t0ȟh p\  PCKl XP CKP\Q t t0\ thh 0Rd t@@`PX 40@Po@ 0@P`@ 0@P`@   @DHP W00 S 0  l@@l@ PU):lZ dX@aTAZ P W00 S000 0  @D0 @D,0 @Dh dX@`TZ PW00 S 00   @DTP  @Dh Z] PW00 SH   \ }V U-K,Kl ',Kl %T0&"P`l bl  b4,K @ 0 ]K 00dNKQP` @Dl@ l@00 d0 P0@P`@ 000P0S  Rp @ ,  0*p %h h  h@ L  L@0@L0 H@ 0 L H  @|0S@pL@H @t `Pq  P@ l@ \2A@QLK<@00` !0@s0^S!0@s0^S^<,Z@ PW00 S   !0@s0^SP@W00 S   !0@s0^SZ ,XXXXXT.Xl PX 4"H@L0CKH @B4 HL0CKt 6(^ Z PW00 S>00  qt00@?t `0 Q-L@M  K 0"( K 0 K(0 -0- L M0CQ0  0( K  K0 K( 0 0-LM@TPD 0P|40 R@ C0C0|.1 --LMPC 0 ],0 R@ CK|.1 -@LI -L< ,0-LM Q0/d --LM00 K - -LM0  K -`0-LMh!80 1 Q  1 0 K< - -LMp@p 0` ` `P40 R0` ` 2Kpn  p-LM`@0< 3PK0 f0\ 3[P @ ZP >S 0RKp,6\. --LM@xP p` 0@ @ @00 R0@ @ Kpn  Y p- -LMP0P Sx0`A  hP TP0 R Pg70@ 0@1.$Y$+. 0-@L @<00S S SB7h h>7,Y.LY -ML  0hY -LM`RP80#40#00S4!R𨝉8 b01#88Q$H),1pK@ P1[0 1K9P $v -L0K? R  b1#880S$H(P1L0P1(,(0  -L @pT`𨝈TuH@  4! 081 ,!001P vpn///N/-// 21C/ O 32C/Yh0 $P/H0 P<0p,0 !4$ 04/@mlnLm0- $ Rl0\`0S  Q 1S0Ġ 8 8#$ $ ,0d Uc\@ < 8 C<0SL1!p A (0@p l 0SC  ᗐ` K  t txPh oxU0R,0dP00S @&h#P [p5 PWx th Q0@ @ < <0 S8 @ 0R@KTsp @d&p0F gh h0Sk 10e@P6 `d Px tPh h $ɚ;1Qpnʚ;Y1 -LM`@Pp 0PK P KP P $PK |P0p -LMPu Uh ?\poA3cO40 0@ $"4KPU`7G$,0  0(KMb@B -LhM Qp@P  Tㄑ  Te 00CS 0 Hu (KT PK00 P< 0TpHP D@ 0 4 ,0 8 p8p 0S3W00p8p 0S*W( RP0  H KP80,DP`c0pǏ@ P`,0 DPH`00S =80W pP  ]P #P -LM@`PptP 0 K 0 0 0P p] -LMPp`_t@P 0 K $0 ( 0 0 0@(0KP@ 8 0-L0P@P0PP0ѓP P 0R00001 p-@L }Pp00@Pp` P 0RP (0@p|0p  噓00@Pp-0S 4(@$p+pn11 -L M< D @ H 0 , 0 DH00Z8 40 782a070`0PpC @@# Z!ڽs PP. 0,0 0   P <040 !<0 0! ! 00CS 0s Z,0  ^, 0 0< (Kt. Q-LhM| 0 PY0| P0| R!Rp PX@K oT`Kl@ @ P@KL KH0KDK` d0 h P lp PP RL p PPF ( @%$uP #U U0S `p PP \ d p PPP hp PP l0R 㿏(KAd p 0 0 l `@XK`0 h d 0S p ;PP\\ `p 4KF, 40Kh"`pQ\ 01#@`e(p6,\ 0S( 1(`1 # 08<1t ! @ x #p l` |0PPq0Sc R! 4K4KQ0 W0) 0s0SR,0\ Vc\@ < 8 -<0S! 1 !t A (0@ x 0S" PJV0R,0\ S00@ 0R@K8pt 0x @ @ < 8 @>#FL t0HAPU @/#ɚ;1Qpnʚ;(1 -L M`@Pp 0PK wP KPP $PK fPA p -L(M`@Pp 4PK MP KP,04K(K#( $ !B !  pq -LM@qPPA 0> `f/gfff0 0/11R  Rx0x0'' Q Qx0x088 R/A⋷0 -@L 2ౄ0Qp00  (00H >1>1>1t00  |0S 00 0l0$0(Q11 Q0-LM@P@00CS0- L@)0 T;:|@Ph0h0hH(h DHh @00 8 ,P0 00P011 0-LP 0N P0.t0R0 -LM@pP`H0St0t0# 0  0S 3/H0St t  0  0S 0t0H( (0PP pn$/ -@LȠ`^VH ph10RUV tp t0l0t00壴H0U uh@ 1HX  pn<XZ -LPMP P(K3P@"A@1@K3E$  1   000cP0S P|0S \` \6 V/ -- A0@r QRs0  PS000S S S 0A @s0S00r R  R Ru R x x0R:(0 (0h`\- p04KL0 0Bs0RSD 0 0$D @ K`V,"K@^, S84KnjǨ@\8 ]@pK01Ìp@eȌ6̌@p < 8 -00SH Q SQ lPx1UPp1L lO D+T0 %>H p P`0O0@`d  d >V J0>y  0@d 0 d  H P 0>cJ` 0s ,!0 Q0As ~|A0J\ZSP pP`\H0@d  d Pk =^p!p(p'p)Z)p2 l 0@d 0 d  MH PI>SC ?1.pn -LP`@t0 p  U 0  pn 0-Lt0P   % "20#0 P0S0 0@@T 0h@T00 P0S P ^T @^? -LMPP  봠(`(pK @P ( @P` @P ( @Pt0:t00>0>pn p-`QL@pP\ YPUUp 2-LM@P0 S50 ^ B?@0CS+1 ? Rl  t0 ! T0N>K2n @ :t0\ ~0S萟t0 :t0>%`,pKⰎ >f PP , 6 PP0t 5*0t .xr0c Q.PPQJPUZ. [pn -LM<" P$`P0p0 8b 4b ,0 ,4t @0  <"#34 4Q  I##0h  R  VR8 0H0XDVa V(ڠ0@ <#?0g@V' .H >` 0> 0O p0@Pd `l d Mʨ0H0X9 VR  gNBP70p`FH0X!4H0$BX'<"\t0"0t0H24 4"Re  R`1l#OK gP4 =8Vpp8b ŌH0CM8 w |0Pt 0q @o$0!k1Fh0S@  $! 1@P4 , I  82S K, 40R(K  82 S 0R#  4" 4  #042 iT8K  042 ],pn /<.1$//. . -L@ qP` (Q/Q)t0 >;.t0.O p0t #40,àt x LHQHPzc- (* Q HP# pnY Q-L@ t00t0t0 0t0 0) P P 5  -Lt@ 0R'0 t0! 0)P P qQ  p ̌t"$ L32C 00t0hX11H[ -@0LS00> 0Q>|  00CS0 tt -`ppLmL0 Y㨀@  0@D  D 9@P 蜠% ,t 00S r PWP|@$  20P; t zRxW  a @h0(PTgʣ/0S\(0Sڜ0  P H Pt0@t0 0S 3/Pt@tt  p [ |t  0S, 0S  0S 0SH 0SW~ X | 㱘t t 0@$  $ i0 t@0  th0@t t    0R20,50t oh pG0 #Y!   A0GS p0S P 0S 0SL @T T   t@(0 h0S&  .H0SBtq  0S 0SWt W W@ p p(0 S|PPPY T 0S 0S 0S >0s0S>>>t  ^-0SqSo m >u 0bS@1@#Te@DT^0p  y t  (Wt{pq !W|pm 'W`pj qW X60|S W 050<#(0 0S050-| 㫗tW tW   ^tt { Ty 0>(mxW 0S  'tWW: tl 0WtW  > Rt lQf0>t>tW  |@ P0 P p p P P 0 @Pp0 P P W 0@0S tt/ W   jt~\Wty.op0t#40#"B )W}p ^W~p  R @q0S5%| Ֆzpn111.Y 0-LMp Rx2@@<0S9  㴕,$!(1@pP 0\Gx#W  cp 0'B0Sj8P0 y 8 x8ᠶ8 0R,0 !V8嗶0p0 #pp0p<pngfff ///|0 -L @R\I10  (0 P0Sy0(  ./ -p@Lp' 40#`"B P0O 0$@0  $0St0191191 0S𩝘Ypn 40 -Là` L@Ap(0P  UWt0P.H0SP   aPʤ0  Pt0PYpn -LXMP|0 U`' Jt;U# h;U J0U T;Ur FH;U z<;U ;Ux 0UL ;U: p(K;0S  0 S8 |0^ @$01F0S g *:@^pP p:U+0CU*0CUL:Uf T0CUN 0:U 0U:t  @0 5,0t 9p9U 9UIA?p |9U? 09U :890SD9@90Sx $0Sx9pq9U }8UB 8U9 8UcH0p0`Xt@ pSP X0S Z t0(0(SpE  @0h X(D0 @0CpKl0 p H@ @ DpP6 \ii 0\ ;g p\h\QW!Q0CU\ 0UGt0p;t07U d7U 0 0S |03 1 Rz80w l08' 20p7U 7Ul0p06U 0Ua| 1 Q80 Pp 0Qp| px&0Zp pp0Ft0p;t0@6@p` Tp#*l0S ܕU| t l0 20  pP   l0tpP x@  P  f)| pt pp , pjTp@ ] 1 QA80> 0p 0OhDx0p8x0 @8x0  x07x00@x08x00 x07x01 Bp-  )p' 1 R 2P|pPp|30St0t000t0t0\ 1 @T40S0 R.R 00CS0 18 p000 ! 00 !| 1 j (0Sh0S  3/pPt  0    00CsQ 00000!30 !0l0 10C<0  0@-0S| x 00 QRT0 BR 0P@@ R00c!R!<0-L0P R 00c!R!<0 -@Lp RP`$ 0  BQ0A0 00C 0 0 Q  00b \20 200 00SPP0 0pn -PL`V@-Q@)pQ$ 0S`0`Q@@  P 0a0 0S00`dd0Vp@hQ  pn -@LP >uP 0SB>u000 p-@`LP >sV`0 0 0P  pUB> s -pQLP@p4 Q( Q+ `0Q! 0Q a a0RPP `P  0a 0 0S 00pe 0W R 0 $  pn`[ -LP a@ Rp7 R0S* 0 0 0P \  0a 0 10  0P000  00 10  ,\ J0pn|[ -LMpḠ0S# 0S 0R Up(KPDKD@K pn00h! 80 1 P b/<80 1 0S b7 p-LM`P8  @T \Q Q 0 S 8Kp`|bat -pPL` 80 1 @T  9d 0Qb `xc` -pPL` 80 1 @T  d 0b `Vc` p-P L`80 1 @T  c0 a `5cp`p80 P/0S/0S/P/2 -L@P P*0Ss0 S4P: P0-LP@0P QT 4Q R0S0T0SR\ 0l0 -LPpU`@T * \4@0 t t5/p?@ 5/10[[[D\`\x\___ `4`\\\]]X^^^^_^p_ -L1p` Q PQA @@A00 P1D00  0`d`+` -L1  `0S 8% Dhh~PDhz` Q-LM`  pR KPP VU 0 @@cV@1`d 0V 0 pP a``` D0- 00@ 1L00@0 -L`@Q d0d0d `1 P 011 H0S L DP3/1 P 01$\ D21C c4a 0-L1@00! B!1P  8v01NU1:11 2(4 p-@PLp0`PP@ppn p-L@,`P@ppn 0-L@P@0SU 00  00 0PP 1  `0SE 0 SP00 -@L`pTP@P t0  101D0 001q 00@0pn(4 2 -L@Ppp`Q H1W P5T' 21CX" cPPD) W 70 1D  0 1 LP \`XpHd@`@P @ T0 @0@Z % 0@pn4@a -`LP@1N \pP7 R'0d00 0!00*1! $ DD1D d` 01 ``1 @ 0 ,@1 0 [17D }4P@m 7pnha -@L`pTPh!@P \0  1010 q 100pn(4 2 -LM@PP pQ` ` R*`pbV1g3Z P !0j0= DD@LQ00`!1``` 01d`d0 0 p0 P  PP&0!0e00,0 PZ 0j0 p0 PP&,00 pn -LϠ MϜ4 0 Q44  10 K0PpP X0,0 ,@K0sDD@0PQ00`!1```` 0dp1d`00X  n000 SR0p00 XFWB @ P`? Y& 00 0bX1! ' 0S  ;$ .X1! 0  00b^! 0 >4 Pt0X00 ,X,(K,t pnʚ;aaaa -LMS -LQӻRQ`pP PP 0 \@ @ 0S*@cTS5X V ʲ! 0P0 000000f0ePP" 1 `000 0X0j 0    0S 0S00P 0PX  -LM Q-Lp@`8`W 0 0g 0 1000P% 1 A @AQ PPQA@AA00D00 0g0` ` p&`b0 0 4:: -L@P   -LL@L`N^Hp P <0E@0T0h)4(0(4 -L M0SB@  0@90pL< 0@뼐张`0@ @P#5  0@PPT`&VpLL i(Ko40Lb(48~,4Tb940\b:Tb P-LMp,  ,  0Q`%,` P`U0@Tpc>P 0@PV Us1V 8 P P@U`0X/@gT@!  )0X# PU X`p0S P P0gX@cRTPP PpP X XPp , 1 0Y0 &17, 717 -L`RPp*Q+U! 0Q*U 0ScPPVU 0@`T@! 7/P`dVP bbdbxb R-LMp`@0,0 PP V@`;,K⼠,0S {PP3 젠 jR",0S W gpZ @1@! @`d VPx0Z0 c; 1,, 1:1,9 -L1`Qu 0,0Sp* 0Xcp`!Q@@T P 0D P0 S`:X4`X  `V00S 0 X@1@!  d 00dS 0000 X  V00SR`` pP T)1  A @AQ PPQA@AAD00X@@X 0Xpc`0 1002 02/2/RP/0S/0S/P/00/// -L@Q 00Q029 -L @R00 0S00 4 R0 0 Rq029 0-@QLP 4T R$sPP@00o9b  0-@LPP 50 -@Lp`@T PU00002 P02@T P7 -LMPp, 00 , K @P P P `0PTP0 ,RX \ 0`h 0%`hW00S Z0 ,00(KW#VgXg0PUSUY  0 `Q ,0 0P@, R  0 R0W8\fEW3PP00W00SU& `0,  0 0f 0 00 00 0;00P0@,0 0 14 @jPP  -P0 XU( ,0S 00S |VU 0S:0f 0,0 @ 00f 0@,P V0 g1e 00 = 00 0? @H$c -LM`XP@@ 0 p@ Kpn -LM@0`P-P  Kp0P h 0PP 0S000VT 0V`H 0V003 `pn<11 -LMP\`@L0h0p  @Kpn< p-LM@p`09@P 0%@ 0 <0h0 @Kppn< -LM@0`P-@  K耀0p 0  8@P00Ph 0 @pn<0S R$  /0S$ / p-P!80Lr$ rp0`P0P0<0<0H@,  3,P03p0`<011pn1 p-@80Ld`$P R00 0S00  0S<0<ppn0-80$ @P @$P0  191# 0/#R 00 40Q 0 ?SRP p-@80Ld`$P R00 0S00  0S?0?ppn@-8 $3O 0$@P/ -@L<@ D0h -LM^P` 0S \  0<!Z -@LT 1S 3/ -L 0Pb0c0 UP[R<  W0@ 5(@/0:0 0? ~ 0 Q P:0O0@/Tʭ t$hD0S, K8  ,@T 젠PW0f0 X00Sh ; 1` 00S ,0S  V@KdD {D  @80P, 000@P`pVY4 R000T3WPD3 h<0 S@0  , 09h8 -@L060800*h) 2-LM R, ,L H32C0bP (K#0a R , ,P 0 0 CO@00 0<0<00D D03  A Qaq@3, ,@P,00< `Z`  <  , 0 P@h!   0,PZ , ,6␈0 00 8劻 傻./4Q:< 0-L0P@; 00U0 P6g0h A{60h -RLpP` 10^ V@ @@ 0R 0 `0aR \^ P 0 0 T`V`0   0 1SS 0001P00S 0 00!RR 0001P000$0S $ 4e$10/ -LM @S 1 !@ PK  0-P0@L$1S0S T P 0$A00$`P 0 -L@<P  0S 0&  0 0 S-P;0SpL`p3*jV@ ; 1.7p ` pP U@0S0#S0` -LMp`$ K@P$0$P 0S  00CS 0$<9@ K(K @P $  00CS 0 1  0@P(0B@$< -LMp`$ KbPP  K(K ]PP $  00CS 0 X $0$@ 0PP(0P$Q< 0p-L M`@ K 0 #PP* 0S* $K PP0$ 0K"PP Q $ R 0S R $ PP   00CS 0 P UKp$P <$K kP -LMp@ KPP%0 SP 0S` _0S`V  PP!0 0  0$P  00CS 0  ;7P; u1V 7P  00CS 0 p-LM`@ KPP p0$  00CS 0P;p -L@M\ `, K4 0 nPp0@  P0 L@ \0\X T D @ <0 H  0SH0 ~Q{H00SH0 v\  ,0R@$ @4K00KX KHPP@pPH0t 0c0Qp 0Pp8  08 R !pPJ80X0 8K pP@Q& X" 4PU  0X!05  0305 P0U @@X00 P0SpU0 cW, ,00@,00@ ,0DO DH p,  00CS 0 0P 4P (K\,:H0S wW #W -L(M`0pS @K P02(K `D < D K8 (@ $P 4 ,`  K@0 -L`MDKPp @P8 P(@P`K0P,0  000 0 0000008 $ <048@0 PP$0S DK PPP, (00(0, 00CS 0& 0 (00(00 00CS 0 V84PP @80B9080 D8,:9040 08,8. 0-LMp@$ K(0 PP$ $`0A?AS  00CS 0$8%P K (K0PP 000$  00CS 0 (P uP({PP0A?AS$  00CS 0 ($P$j8$f8`@06F@ 0\PP U0S3pnDe -LMp0`S@   0KPP,K PP (K,,08 $@ .  9 3S PG0,FV 4 K>P,VU<w< 3S9.,1V47,r8,V0P18 00CS 073SP 0 0F6l!dPP 55 #0P36  PC  0A,0 ,0 ,0<, $PP  R 00<VPP ,U4i7,8,U< #P5P, (00(0, 00CS 0 @ 400,7 #pnLe.Te p-LM`@ KPPP p0$  00CS 0P_7p p-LM`@ K2PP Kp K0:PP   00CS 0>70  $P _ -@PLQ 1S 0 Sh0 R0S0 0C#qW P`Z0 ` 08/WP@TP/ ꔄP/( /0S00(0   (/l;P/ 0  0C0 00C0V7h; -L R r R0@0T  (0 (@T@T (e (00C0( 0(0RI @T@T1 &"Q R`3 P  Q 0Q(0  00 0P pLW@P@T J P0S$P >@TZ@WP6@TPZ&R00$Q d0 R0 D*@ R 0R@\;l;1PP 0S  0 1 -L MP4 `0S t2R P(K \ 00^<2< L 42,B/@!bQP0p1`k P @; 1^ ` 0hP -@0 LR )  0S S S 4}00wle -LLMpP0S/@ (K iQ0@0jQ@h P 0D H0 D 0 BpKp@ h0 l @P r@P\`00S&@  '@00 >@PxX 0R)@ 0 2 0=@P  t P  000 0 $ 0 0(0 00 0,$0t  $0  Z@ʚ; -L @R 0x00>(0S 6/P) 0040 R tOhhOh; -LM0S@80Cq hR3PU/`,hP`* j0 p 0d 0lK00@0 l0CdP h0 l DP < `PX@T TDK>TP O&'0`$K`'@KJ 00 0T XKˠD Kˠ =`PX0px00 P P0$00(00@ P,@> -L0@S 0S0S S S pƺl0l PD MP7@8i$0$ P |e222 2 Q-LM@p`6 PXP Q00S0v03Q0SQ=ȕX8 L l8d 0S -X Z s- 0Sp fJ D V8[TPC PA 00 0 3@P  80@ 0$@( 80<@,00@@ 4 00 @5U6 Rg R7 R5 t0S( S S Tyw R 00T0P 4 0 a00400 0l 0[̹PV00,0 0"PJ UpJRO   40 0c c 0PXP0 40 b0b0 0 0Y0( %W 0S80 P@Q 0P7W  PXP0Y0P90 P, }n e`;eee1 -L` M:/Hp`@000p:/p@0h\0P:/@0@0P:/ @0($0P:/$K;eeef 0OP`V0S` 2pW% P`0OV 00U@/R w,d0UQt0S<0p RP`P` <|;pnt;8;p;< S-L M40 0 I $ , `P 4T@ PK? H(, 圀4p@0P  +P|倠tx0&00`Pp@P R00X3 `4 P,#(K2#P`0PU`/R, /t0S22 R/4>0Ÿ#6Po ?Q$! t0ShŸ0 ?Q[XBP"0Pw, "pa $Mv22 RPq@T (P `H!0OQP@T1!h0\ p1 \ dALvP!0 w,0pt40P;400W )^], pXQjP `0p RcH0p Rv,0p?0 Lpn(<*!Ce2;p;<8t;<h<|;<@$<<h(h -L@ 0P  -LMp` 40 , 0 0PP KTp P ` ]PP 40 40 8400 {vt0@T P(KP @00@@0D@4 4 Ta pnHh; -LMp40  Z00Sx0LP Z p0 0@p0t@$K0 0@0@4 \) 4 (08P0`@ (0,@8< }6 h000;< -LMP @Pp, Z `@p`P P U (Ko2,1 -LM@h -L0Z (K  004KP L0 T0PK,@K@5PI,04 @r,@ T>  P< DPH <PP3J`H1pPUpG*JPK0OT U00P< @T H1P @40;40G<TH,FP0H0< H@0TD0 R01@P BH 8 P`(080@ (0,@8< DP/40l@090\@ XP 40D0 Poh40K  | \K0P`8  8 <@<0R0@@L0 h0lPp`DPPt0 S !1t00s]@@x0LSDT 0S)D0DP4 40K)D |0@4 H0P0(P`80P `0@D80<@(P,`H5P h000  06;`xfPhĬ<lh `0p-LX` T0@PT0 Q00cR0bcr00cUpp <8<0 -L PR}L 40R040TxQ@p0X0X X0 X T0T0X0pP`Hp0P` ppPt`HpL.L0; = -LMLPhUPYS \1 RLB<0hPl@0C6 ?S0@ ,P lp*p0K6@  P" 00S$000:0pP`@ P`P `<0C6 ?S (KRRTTT T0冰@@H H0偰,,< <0|J/,0w./;`|h1h2h'hh >0-LMX4h0S6L0S80 R0  RڼP 0O(6@0@0 @<>h.i -p LP \ (`VV , H0R \0@PH HL 00#0R 80 4S t0@P@ P@D 8 0@bP0#"#0%(9@`tr2=...ii 0-L00@SJ hPd10 0 0  000(P |(P|0S P0Q 4 H0R ,U00hQ 00S8 R R:0.SR 90.S P$0$0$00$0  $ HPD0 0  0  0  0004>D>==<> 0-@PLP (0S L0S PLPP0(0S L0S P0vsD><> -L00@S 0S c|PH 00S0H000H0UP 08>`ij8 80R c/99b p-L@PT `P`@@T@p 0-L@PT P@@T0 t4-L`Mh``4@@, Q` 0Ss0 KKL0KK|P   0pWm 4 H0R 3@P  , 0R(KPP  x 0  @00 0pHPX 0J^  -060 *P0"0 RW .P 060M F -0602@P   x.P 0 6 00S` (2@P  ^   0 0 0 0p 00 0 P0!0 R'H0U> h1@P X 0@!0 R [00 (0 0@(0,@ ) L ^-0600 9 0>  0@P  .t0 @P p'X~\40 @P $ <,2=D><>l0 p-L@`TP@P  R0T 0@ PPPv@p0@0@@P1 -pLQ`P0Sȸ帡 0R1P W0pH0@40H0 9,0(`8ܳ|0S: |P 0m(1PW, W  @0@00 00S 0Rؼ0Pml8 RR:0.S 0  $0@E TpT  @000R 90.S24>D>=<>Dj= -L M0 0@0a0 +,0 k;Z 000 P`,0  p @0 00Pp@`Z !0,0 0(K M-LM0L00 , 400S 0P`p <0@P`pG P Y W 004  ZW,\ (KoW(K, 00f4 (Ko(Ko 0Pj -L\MP T tp\ X0  L 0@ 0@0 @0@T \ P` 0P`Ud `0 P0@0h0 P @ h LPL04l l\@, 1h\ 0OS"U`U P ,K|L 0+PPP@|0sI ,T\ :PrT0p PPT|00@(KT h0O4 0 T@S*!0`4D0 @@ \D 00bUH0 N h D0L@PH@@p PP@h TpPMXV0sP,TP P|0p 0@VP@@@h@ uP0P@0h0 0|h$ɯ QfP0 SbT  0O 0 @U? PX0V4@K0@PT<@ 8P UH\TP L 00C!`LPg+P6 @UU+;TP0H@t p @ @<@K0Lt0@ PpP|V 0Lh PP `d0K0@d0 `@ T@0 0dKT 0@U:U*+;<KT  PP|00@$@- R00 RP00//// 10S0<0/2 00//@Q@- 0@ 0$@/!001 -L 0; S 兜L> D!-L0hqI @00S5 40 $  \k4P$V x 0P P x 0S00 T00Q0S4PkV<40)<40X 09jxP PU  0P ;& ><jxj tp-P MLdd 0 P PH0H `VPP@P U$@KpL>h.j(2,2 -@ LP( Q,0,0,0,0$00( 0, h P P-LM,  @0=   0R 00P0 ^,0  0R q0 Y t/ W> X. WFʁ qp tq U<9 Xt0   0 0Su0000rtuXYTU0SVt0 TY t6 q: R Q W0 t 0gR XY V0 qrruuXuVzrQj p-L MPK0@0% `K0S 0S  0`%PKp  -LpP01 0101 P`u 0P@`PU`P `400v0@0 @ -@L0%?0 0C0hԚ? 0-L@P?UT004ћ0P0T 00   R0?2 -0LS 0R& 0 8 `pP 0 0@P Q $  (0S 0 0@ 0R0 @  -L MP0@T$pK `K$0   0`w@P Y0DS l@ 0 0 @K 0 @ 0@ 0$0 @ 0$  0@Q  0S v 0  0$  ? 0R 0 0@ -L MP0SIJ@PQ g @ 0@ 3 cPQ l0S\  0@  0S ` K  `V" $(0(,@<#P$00g0S` ( P,0,,0,$0( 0, V 00C` pK@'`(K 0P (`P 8XX|#``T $0`P(  0Sa 0`0T$0 `P 0(0@(r0SO P ( R,0,0,0,0$0 $0 ,0( P((0$0 PT) $ 0P( $0  m@ 0R=  0R) (=`X`0P@(0   ($ -@~(0$ (0S (0S 0R$0@P 0( '`!22 -LM0 40 1Ph1,0 080 GPC`VB p pppV4X 0 P; ,Y0 = @PMP$ 8 ` p4@00 00$ 8 0C ,0 00Y40' Y Y PP P(K`P`(KoY0P1, 0  P PU< 8-L M((@ 8 0@_K?jh. -LM@P0p,0 80, `&0 Rd 0 c o$P00S 0P0CS,0 &U! 0 , &0SEx 000@ ?YL0$   YL0$  0  R 0  U L0$  , % kjjj -LM`,( 0 080 R0 0(40 S P< 00  , c&<@0/S D 0S/S 0S/S0dS@0 c0/S ,,0SɌ,80SɌ,,Ɍ,@0S , ! 0U D0U 40,P L0P  &0Sy 0Sv 40 ,  00,P #@PD R,Z ,0 jb, D@0,SɌ,P00S x@T%  # P, #%,K0 pW^,P,P00S SJh30 S ( @<@<@ D 0S/SY0c@ 0/S^0/S ,`jnj ,WPP,  (00CSP  }40S,u @Q p!0.SM0.Sʌ,HIS,hR 8 @0 "  RQ T+ 00(K0/S 0 db<00@S@ p0S4 0p03R0S@,PɌ,p@ ?@p y$p0S=t,@0 R1L0$ ,  0p ]$[ , x~00S L0$ 4 Rp L0$ l p@0 0 jȌp,0 @pj?@ j -L(Mp0(0 Q4 Z (0 ,0 P 0S 8+00`V R ,0 80CQ0S/SL Q0/S l0` 0 80$0 R 3  0/S dq Pt8 `^ P8L0S < P`Py,0r 0"| Rb $0S0$0s0S8D0`0K0@4 PP PK4` H0 D@ 8 `8|gC  00 RHZ `?`4d0b00PSJ8R?L>0kpkHkp@-`@\( 0S% ^P) ^ R R@ 0 0 R0 00 S0  0S\ 0 0p0@ 0 0  R \,  R/ 0^ 00 S 0  0S0S0P@ 0 S@@ 0 @0@ 0 0 0S00S0@ 0^@@ P@0@- R 0S^ 0Sk 0 0R 0SI0SD \  R0 0 \0S0  0S R( ^ 0Sm R 0S 0R 00 S00 S0 0S    R00 000 0 \0S0  0SR 0S@0T 00 S @0  0 S 0R 00 S00 S0 0S    R0 R 0S@0T 00 S @0P  0 SP y -L`@V3 ^=0S`PVPU p` 0S`` T PR 0T 0RU 00SW `PV p PU` 0S``P p P 0S/0S/P/0S/0S/0S / P 0S/0S/P/0S/0S/0S /P/Q00S/Q00S/0-t@0t S0/ UTR p-L@PT `P`@@T@p 0-L@PT P@@T0 p-L@`TP@P  R0T 0 PPP@p0@ 0@@P0 /L0P/P 0S 0R/P/? -LM` 0p00Ġ R 00@4h 04 0Q$0 $PK @$00$0 0s0P@$00KC40 GX0[SK0SN X 0RIK0@ XK, 4  @ XK4  @ XK4   @ XK4   XK@ @0 XK@ @0 XK@ @0 XK@ ڠ40  XKp@ ӠX0[S \WK☔0SH哔@*j,pQ0poqq q,q4q -LM @x -LMc0n p-LMP K`P p0 $@0 b `5  00CS 0p -LxM@( KPP$(` 0W 00#00P$  00SP PP  ( 00CS 0 $K(@Km(0|` xp  0 P 0-LxM@( KpPP $K(0 $`L0$ P  00 S&P0 R 0圠K 0 S PP  (  00CS 0(5꜠KP  P 吀 p 0  0F P0[S3 -LMPc0lKd h0 l D @ 0 0c  -LHM`@-0hpK@0<0 ` d h @ 8` @P TP 00`@ S0@0 0 < d h0 8` @P T0S P@KPT0P FT@ KP@ K@ -LM@ @K -LM@c0 K p-LMP8 L`K4 X \ ` `0P jP L0S H8KUHL0P LKp@K 00 0H LK ʠ8 K,ʠ 0 c -LMp`P@P0 R@ $K0lKd@ D0 hp l` @ @K  Q2 0 :#:00   Q  Q@00 0TXKD K}@ 00 -LM @ -LMc@ -L$Mp0P$0 P $ 0R* K@@K _P0PF 08KD K PD0L@H,` 0P$048,0/废X,0 -LM̀p0`$0 J@P $ 0R$ K@PK @P0PF@ 08KD K @PPK D@DTl 〟@dX,0 -LM0P ,   p PP  00 ` L P0, 0R(K0,00  LKT KPPL@  T 000H@K 㼞PP L0S T LEPP g0P 0@KP K PPP P00S-P  SP{20S P00SP  0PPP PP  @KP@P 0@ P PP P 0cPPP <00<0L0 0 L08!L0 L0P$% 0@ d0 `@ l0 h@  0%K5K P @0@UKl0KPL @)P0PP0 | PuL (00(0 PLT  (00(0L  00CS 0p L8lFP](|W 0-PPU|,,41 -LhMp`0@$0 PP $ 0R* K0D cKP `P \  0 X@ GPPt@@K ᯍL8K0 <0 @ L0 $PU NP2W,1 p-LMP@P `K ᅍ\ 4P Kp/,\ 'Pdd.! -LMPp$ K@P $ $0L`V  00CS 0$@,0 $  00CS 0@ T$048,0 @$ @0-LHMp P80 dK0C\ `0 d < 4P P KP0L@,`0 P$048,0 r -LMp, @|,K0 K`P*00 P0 000@0" d0 A0C` 匐 吠 <0h` `p K0"0 K`P V v`0,&(K, <`| ,00,0, $/ 0@ @0 <@ H0 D@  0#K3K @0@cKb , H0K@@P 0,]`0[ , (00(0Y$ ,0  ` L0$ `00S< `PAOK, 0 0 0 `P   ,00  (00(0,  00CS 0,< Rv00`Pn, 000o` ,4 -LM  @#K -LM c K -LMpP  0$S00PS   y0@0 KP x@ T P(K0 `V(P x@T P ` $1-LM, 0 p宣@T1$048,0, "`P+[@U PWPW X*Y,`, 0P C@UW X00`(K00`0k:?0 -L PU  PW  0pP$`@0$0w0@0 @$0@0$0? -LM`80S x K0 P00PUp p@0S 0S PU@0S W @@T W  0p 0  0p0  0p0?lu -P$0L@0$0p`P T00$0 0@0 @P7 0@TT  $00#X00S'Q00 0 0  P  0x0 00C0@T eR <?u D0-LHM p<0 hK0C` d0 h @ 8p +@P0TP L`0P @P$0  @ K40  "P@ 0_@ H5-LM45Qp , `PPK Z 07PP , 0RV(KD00  0CKP 0 p PP̠ 40C gP0 UK0 PP10 H1S uPP%pP  0L `$0`0 0 PP 00S 3P0x` (|SL@ X $\  -P P0 P -PP(P  \!``uPP$8$$$"2 0$0K px@ UX 000P  0@@+  =$0 !, 0 0PP *P 00<@K0 8PPZ10SX1 bX! RX! ] XPoPx0S`1  mPP @X  0$ 48$ ⸉`!$\! 0 S(4, 1^*?,2 -LM ,00S- K3/ -L M ,0  <0S- K3/ K -LM ,  0 $0S- K3/ K -LM ,  0 @0S- K3/ K -LM ,  0 D0S- K3/ K -LM ,  0 0S- K3/ K -LM ,  0 0S- K3/ K -LM ,  0 ,0S- K3/ K -LM ,  0 |0S- K3/ K -LM ,  0 T0S- K3/ K -LM ,  0 0S- K3/ K -LM, 0  0$  0  40S- $K3/ K -L M ,0  L0S- K3/ K -LM ,0 0S- K3/ K -LM ,0 p0S- K3/ K -LM ,  0 (0S- K3/ K -L M ,0  h0S- K3/ K -L M ,0  80S- K3/ K -LM, 0  0$  0  l0S- $K3/ K -LM ,  0 t0S- K3/ K -L M ,0  x0S- K3/ K -LM,0 0   0 0S- K3/ K -LM ,  0 X0S- K3/ K -L M ,0  \0S- K3/ K -LM ,0 0S- K3/ K -LM ,0 00S- K3/ K -LM ,0 d0S- K3/ K -L M ,0  0S- K3/ K -L M ,0  0S- K3/ K -LM,   0  0$ 0  0S- $K3/ K -LM ,0P0S- K3/ 0A-L MS|l,,,,,X,X,,,,,X,0   H0S- K3/00 K<0;0 -LM,0 0   0 0S- K3/ K -LM ,0 `0S- K3/ K -LM 0, 0S- K3/ -LM 0, 0S- K3/40040/ - M@L̠ 0 @PK$R @p-PL@` P4D X? 4  0Pppu$! -L|M@$`p0\)  0@ PP00W00S 0 ! @`#T   \ Q T00S PP$K K PP x00b0at f@ 0-LM KP rPX l K00 000CSJ(@HPX`hX0KdpK0 @ @D0@ 0 h@\0@ 0 P@t0@ 0 H@L0@ 0 @0K|KpPK`4;DL0P@@@0DH 0 P$`@,p0(@0400K80<@@@@0T0@X@0\0 (K  $ -p$`LP00S3 @@L0S $0 0  p 0 4 @00c@  %  0S@ @ -L M$40 00p0  S, !P`Q VP! , 0 @0 RP 40  P000c@ , (KUP -L(M0`0 p0KH@ DP P L @0 < P,0 8p 4 @( W0 PK{X@ Y@00 (K0 PK}X@ Y@00@0 S T R@ I -@<0L0C<0P`p :0 @ -LM`(0$p @PK 80K0@ ,P 8@ 4P K 0 K -@0L00Q00\0S  1 S ppW P`V  'RU0 ` b 0a0 -LL0$  0 R40 02&40 P -LtM@0p`0 a 20 S] ,< D00( ,0PP100S-PK S>PH K ` 00SP< PP8 0ZPP1  00Sb  0,PP%40 H<00<0(K  0,0@0,0(zPP0S (e0P#  00l PPSPPK 㜀 00@ ( 000 0PPk { 0PP@;40  00 e: @KP@ 0|@ xP PP -LMPhp, @P t 000(K` H000 / k@P00H00\ 00 @P 00, @ < S-LM 1 P   K00 `P0@ L 0Cr 40 0΁pW000P @ `0|Pdr7 Q  0PP   B ఀ0000>~* R3 `1C"A c3  1C X0 ` 00@ 0njAAD1nm,1QQw0@- $@ 2 001PQ   R 0\$0^0T00S 00"0AAQ/ 0R 00/ -LS0@hx0 0-LP R@ 80S' P 0 0=0 3w -LMp0@L$ P PK0`K00 004 0 0 00  S 0000S K$ Kl PPH$ u$P uS $0 $0 $0T $ 5$ #40$ 5$ #40$ 5$ #40$ 5$ #40$ 5$ #40$ ``0$ #40S$0 d  S0$ 0d0#4s00S0$ 0d0#8s00S0$ 0g004 $x0s0`0#8s004 $x0scW YPm0z T0XV 0s0^\ S0 0S0e U0Zz0 -LM@0 p4SP4` x0s $ h *iP(K  qd0WlW;`0 00 , `pdX01oYdp0$00W 0, r 00KPPX0 G,2#tp 0Q= x0000s7 PdX0A1 A,0K?PPdX0A1)\0080 Y `0X,  c BHd04K 孷PP 4` XPPX `d07 ` 40dL80cat 4却4Rw 0-LM PRp@ 80SH0S` 00S`y 2H0S DLL $00  0H0`34x -LMP@404 x0s` S0p`d R#*d0X  B0C2!03r T0Q` 0`P0dP$00i!d 0p iXx -L MxppPQ(Ph"@ @D0 @P< `<0#0 0AT@T 0S$0W0V00S  PD0`@(K`#00K`P'= 0<#`@<00@0 ` `8`0 P0$p@ 0)O`P 0V2hD 004 0U 00b x0s\ ,K 40KP`,H Ws,P Rs,0 S ,0 T ,0 4 %,0 4 %,0 4 %,0 4 %,0 4 %,0 4`, 040 0 0d04 x0sA 4S0' 0 000`Q% "D @b@0Sw0 40040S x0s``1D @0`0d0!55T000 0 x80KPP P X g`0,0 $ (` X 802d0<AAX6tx|x40  -;L0P0AA -@LplP`0p8< U##00V 0aS0!40Xlӫ@-P`@p h\00|0S 1Ph 0\ RP00  h0Q0h0p0Q0p0x0S0#x0%/ -L MßD D@ 0 `0<` 4Pp `\0 o ^( Kd0000K`",nQ4 |T#000W{x00 00 s@0{8K4 K@0Kr4Q <P 40PQP2|0s L@VmZ0D0PF0sub,t 40h@Pp0, Qg p@ X,0K@P4 Op W0@|0@4 , 4@ B y B_(0S h$K``0\p \K 404`VWx0sA ,K` X0H0bLd0 pPA,L0 @ 3  jP,0x q4P0 40X`0S) U% q@0S (0%,塨 (0K,p pP(S0 `@0\p,p\ ረW,,p_y\yhy -L(MP(dp^L 4:dX0  a <à 0, `PX0,d (#d X4K>< K,0K`P,0( SH \00K H 40<K刭`P00(\ L @H RjP NjS 0 0 T0 0% 5#40% 5#40% 5#40% 5#40% 5#40`  `0#40S dS00d0#4s00S00d0#8s00S00g0040x r0`0#8s0040x r0c00,0SK7D  @  D 0 @ P9 ,0 @D0CS,03(0\ C(0< K`P0 (4K A(X>t`P0K<K40`P00\ (L @d 0(K0嘧0`PL R S0 `, x0s P0H0  H L0,`@0P,` H 4)-LhM0 ,0  H x @6| T0 0|0d 4 ` S0t , 0tR/(K@ 0Pt | Pt @40p@ * 7K0P Pb P t \ X  `\ 00R   S R\ q T `m 0Y 0R S .SY B0pl0 h0 D0 @KdhP K<0KPB`HK@0PK6@P4@PHHPL @0 s 3S00S9 \0S`lp R PP pϦh00h0 +X \ V\`lp  V 0fl2l Q 0\0"'t V |  ῴ0t0 N\` 0\\`S  P X0S@H` 0 0  H@7K hPd(pd 0,0`0 x 4r` <0SPZ VPR<` Hc v 3`x0s00@`Qw T00P00SS  Q u  0Pt d`0S  Z R t ` <D0KnPt p0|SD0 0;0x t2 2}0X0 \ d\(p\0A,00.S  R R0.St`R <` T d`0S  Z R=  |0  |  T   u ~ 0wPt |d`0S  Z Rr |m0 @40hQ`K0t0 aH嵥t@ ]P t Y` <D0KPhp R T0 x 060D0| T   d00S  0,Pt 1\d0@,0l ( p0\;0t #tx 06t 0x }0`60 <D0K@P!pQ T  &D0 |0 m` <D0KPt D0p R |0 x tU060x Pt@ 0t@ 60x P060 D0t ,\4/ 00 00$  / 0-L`P @gP 0 40 00 -LM0K@`:P000   "-LM0K@`)P0   -LM``B0$0 ,` (  h0PSp 0S\, K⾿U   0 P$ $K\y p-L00PS@  0< 0S  `P  0 Pph0S 0S p-``P,0dSd L L0@ 0@T  T0@0 @0@ ,00@$( Z fBZ f e| f t Dgp -L  p[`P`R 0x`@0Q `<";$0 :$0`" -L8MPx0p Y@P (KPڈ7 U@  `0 ``m @T$0040  0w@P(KH H@, :H 2@P" x0, P  4 0R f  V P <;`,; 40k040,L@ 0 `4 < !0 p4 L 8 !L0 \P4 "0 4 "0 4080 0$02 0$02 4$ 2@SQT  0 40 00,0 0 $8  0 PP $TQ80S 0 40S"x 0/"0 0 4(00080 0$ 00020<0St 80L pL Pm:0@j0 Rg 8^d 4@,0@ x|D 0 ,@ q8 <0 P 2@?0!4 H @D000H0`q80D4\t0 LP 3R#0D  0 D0x02t\8Ll00 0l0Q0P S@C,YP@l0 4p0d0$0B\0d @`dd 0@XR O@@0 T400,0Q,嶢0,0 |QIP00B P< P P@P$00104P00h010 0`b删 x0e"0# $4!X0 @0(.XH0 00@0&0%40| g0  x0y4; , -LM0p `, @` R( d0RP# :LO, 0Re(K0 b K `d KPP  04!0 0KY0K00 x LP HP 0 00 (x0 "0.00  K0PP0  0  0TKV KX0K00NKP KY0[ 0Y0K4K0 RK0M* U,L>4z -LM0 , `` 4pR( d0R# :yK, 0R(K@K 0@PK@KE`00 xp "0 00 x0  000 `0X  cH Bd0 PPP卢d@L `L@ `L  0#40%[ 5[#40%[ 5[#40X [ [5[#40$[ 4[#40%[ 5[#40x `r@ !4q s0  0%[ 5[#40%[ 5[#40X [ [5[#40$[ 4[#40%[ 5[#40x r P0 \  d KP  _0#80 [ `0#80c  @0S0 02v TKV KX0Ko@ PK K 0H YKL @ P P0  0  0(0NKP KY0[ 0Y0KB@L)0 RK0JT,L>64z -L`M@0p`,0 7H L L h1 x0 ` P 0 xTL L0R H0X ᥿HP .L,ǟ,  0R(KP L0R\ x PL t S0` T  0S t0Q 0 0 t0@t @0` T 0 0Hl0 Plp (0 d lL, px L ``0P TQ |  \  Yp0S H5ltPd0  HK kP[HPl Tp p  | \  p R S0gT\Ypl:PTH0 Hp 7 KvPB00 0 0 \QR  LK.LPU tX P\( h \ T0Sn\@L eL x __˾t0@00LW)T*(0 .RBx Hp R H屾@ \ | PB `0S ᇨ x ) x $T RB 0S x  tH@ BK^7K ^ lr0,0d0(tl p`P BK^ R x Lth00(000t@P RLyS x LpL+`0SXdl <t 0r@P Q x lRhRt  0S\0d 0$0XQB x | R: X0`@T9 ` X0H0bDd0PK ʠP'P $4L0@lx0s` 4p s0  0x0s $,$8  0P宝PL@0S  0PVLR,<z4ԥz{<{ 0-@PLQQ0h -LMPp`0S40s0s0s (K0s(0sX0s\0s`0sP0sTq L0$  0R PT!88S(-S0 0S00 00 y L0$ y0  s,0 0,0 0S P0 S 0, S p 00S S  0P,0s L0$  0R dP l0  0HP00S 0  ,0sq 0,00Z080sc 0800^\ 0S0 0 S0 0s L0$ X 0S *PQ00S 0  S0S0 00S0S0S0 0S00 q(KoS0 0S0cYw 0, S~ PrmL0$ ~ quPT@0sLf00sy80sv<0ss<0s00s -L M0,@KP`4p0 004 0 0| 0000S `K Pj S0`\240 S0 0J004 p8@ 0 040Xp d $X40 Q,0DTS0P 8T04 d0(04d \0 00@\0`@ 000 Kd0S P@X `H0 a@$0"2@0<@00 !!   x0s@00!} T0XV 0v ,0T D0\ 0^S04 0S00 0^0Z0m -LM@0S4p00 0 <@00 !!  0 0@@Km -LXML T 0 SP 4 @0UP PS00X0 Pd0 0S P(KRX0L c4c SbUsUaQL08` 4p P Xh d0 \@Q`@ dP\P H dD u` X0@P0b c# S8!P Q3< @0   0V: X`d0 ` ` P6,0K.QTP80KP0@0Ud D0ih@HD0cS0! d`PS0!\ lLS@1@!L (P0崘UCL0ST> @0Wd0X@P lp@ lP L \8BAQU<&`d0 ` ` P6,@K.QdT0@K @姝P,KP8 K0<PP`0K8K,0彝PpPUX^OTL0$  P 000FaD ,-L^M 0 , x 0|1 S 4 !  QKFeZx1xq01 `\ha dq | 0@vx|A1` 2R1 dAT@@pq ` \ x\ |Ahaqd0gaZ_K`.K XPU`X\00d 1 ՟pa50 ` 2 P V1Q0 W p!t! p1 0l1 |V/KS?KROK@P KVKH16P PX! H!D0 cQ!L! 0S> PR Z?K `p`p Q  ha dq t p! l! L!A0 P0S 0 @`pR Rh d ha dq t p l !LA0 P0S ᙗxa\{ |!ahAd0faZ_K`.K XPU`X\0d pa50 ` 2 PV1Q W p!yp!rx1^K`PX`!xA 00b0ZKx! |Ad0PQڜq0 0, 0R!(Kx0s `p `a \q 0x p40 40Ȍ; \ p@0D @ 021KlPQ  KK81Kp44 (@K x0C` @ < X8 0n9^ ^SZn<ZRQVp l0 T 0\0 4 ^d0 ` RMLDd0S*d0 B\ R X0P H` \0b@  0l \5 Qh0 |tTl0pP` P `5>VNP1hV0R3Q ʧ Ld0 0SXU H Pd0pppv0 @L W00Dp0|P`t0Sm |0s] THP`\0d iZ!L / d0Rp:LdP jP00 T L18Q\ ,H0d 0S* 0ȖL\0P00T \c H0XORH 0Kd0P P\ 0喔T0LQ0ؖ0冓@U]:0s\0STT\ 1x0SH `0X| c a51 Q0V 1`V@ `V; D1, R@T@T 0SPU 0 pR*0 0# 0 0# WY } P P P㨑 47 -LP0@S PP $v 0 PahĒQ -L0pS 00Cs0 SP@ 00 CSr  RQP@T`U 0S U0S; 0`V`V BP BP0gS"\ 00Ls0 S0gP ^0P@@00L\s0 SL0!lr/0A!b0RPXP0S ,7gfff -L@pPl`P R-62/0P@ 2/pn p-LMK`f@PP DPP pPP7P  -LxM\`XV, P@ <<V 4<Vc (<0S:pP <V pp, 0R(K;VM 0VR ;VK Pp &;V H;V P0CV0CV*0CV 0V# 0CV \  @0  p6 0#<0S Z@ 1pPpppppd:V} *N0CV[ 0CV 0Vj 0CV0pp 1<ph06 Y@ n 9V5 ?0CV 0V: 0CV1pp 0l9V 90CV  0V 0CV{xpPHPp ʕpA 9V\ 0VH 70CVfcpP31Si  3/00 pd8VS 8VO@1pp 0X8V 0CVC@pP pP  p @(8V 80S*&pPLPK 0KRpP 00 't0pp 0"p0pp 0p@ pP1S  3/p0Tp  pP6"  'q< 0 \&   -pP  gpP pPPK@ 0KQpPRO@ ?@ @p pP0p t0  :pP pp &!-pS@ qh X y6 h FqqR@ ?6 `R@ 6d2VR 5VNL2VP D2VL82V@KR@ ?@ 0KGQ p01h h s[p5Q@ \q \Ah0 h P pWHh  `@h0 h P pW0h bOp la`P2@P m  p ,i$ii$zi i$xi Jii pni x5i i i i$i i$~i ?qi i Fi@6i(Kii p!-Lhahh0@0S000 PT 1S 1 RP= T &0S T$0@(0$@0Q!R<10 R m T00PP  CDpP !?>  p a3H7D707 !2$| -L@2000  0@:Uh47 -L@00S0 0000@hr47@1 p-L PR }1!S0#R:6 h0 R0 0 00  h  h ph0p 0 h00 @0tP@[d0@P `v0S phu000 0@@0f~.5<7BB -LapV4P @)0(2pn -PLr6 ";6!1!1!`4 CỀ= R1 0 00  h  Qd10 0 0    @T 1S 0 0@T$Q  $Q1@ @A,040@T 0 R 010,Q 2/@TD0 01pn4#! """!1# 55   -L"@R\0700"R p-L@`PT6 T T/p v vp0S 0S0S @T   v vp3000   00up@T  lud up@0^  0@0X B0000up^7d7R7X7 -L M@,.PK4pK `P:BT/@T,  0;P *;P00CS0"Q4`00 000720C2 ;P 20C2 `(K pn -L M@ᔡp.K4K `8PP .0[ P(K40[ BT@T  :P  :P0007 @P"  3u /u00 p2 S0"04P0/B 2 02:P2027Ppn -\ \:6S0d0\-P@1P0p040\0\ i2i 1i i i -L@`D02 D0C2" 00/00 2 @ 0-L2@@1pSl0 P@m 1l pnPO(2m t020L 0hŇ -PpL`QD1W(0 &\ 0  (2 :PN   : P11<<1100@0@00@0@0@ 04!4s@, 1& 6 L 83Th $ TU $3T00S 0Sn S 9P mSW1 2T) 2TtW2P@ pq0Sw qXB@ D0RZ@  100Sa@`10`@  @ 6yW1P@ pq0S? qA6tvW1@P pq0SF q`A0S L1R0T4Q V`P  s gp QH00H0RP0Sli000 0PP0y000 0PP0y|cP000 0@@0yL7Bpn5݆BtE -LMP(DAp`y T (DAt 8 0@3-6A0AS2@ W R(KV 4 @>  `Z 4   P0 3RQZA@@@ R+ɇLJȇLJLJLJLJLJLJLJLJLJLJLJLJLJLJLJLJLJLJLJLJLJȇLJLJLJLJLJLJLJ( 6@P 804 0C`808,/@4K r@.K  r@ LUpP7@ ` @ rZv 4K r@b㲡Q< kW@PJ 1 01q 0.K PA@d.K  0xP 1  6  ?@TH @ $@0D!P`2 4 R!1R.@10!Rq@p10q! !0/0@ 0@ 0 0@0@ @ frA@ Q7@H 0TP@e  0 =@]D|*|pnʚ;Q0\0/ᨁ0 Q-L`p0CQ:x0Q %0CQ\P6@06@W$000p02i i pnʇ -LpP LP 6EUp 4 20S30@ P` 0OP`P` R R 8+1Q/Q@ᜡ@ D0RH00H0Q 7TQ@Q40 3A0 @  100S၁@10@ 0 @ >U0P@ `zo0S Yo0@ P` 0 OP`P`000 0PP0wA,|pnBB|40 -@ LPjB p-L`@PP p 08*0 p0&0 1!0 Tl0n m L 0Ap,@P|ʇdˇB -L@hl7- 0 `0S S 0R 0 R/21C 0/7 p-L `\Pp0#U Tpu@^ 00000   @Tp -L P@  @P 00 ST@P0 #>*| -P`QppW@L hTf 1R' 1RP  0SZ0PS000000P 0S 0S 0S @P @P P4   R01 Pp`PP`p \ P1P!p PU00@  01 PU@PP 㧿 @P0PP!$FP5i 6i( -L@`p  PṽP 0` pP0  0* } 0-L @P6P 0  T)0P 'P 0 P*,}T} -pRL`@PPU@ - Lw0P*ԇBh} p-L|`@TpP @T D[SP t  {@TpphB-0S  0 00Sp@-0 @PbUe\5* 0`  0`R Q T 0SQ 0S p?^00S eR 0SP 0S p~3p@-0\Π@    @ @0 -`PLp  0  0S0 @Q<* 0 RQ 1  \0R 000Q ^f 2 @ 0 @ PP0S:  0   @ 0 PP00 -`L0pS0S 0@T  0 0S@0SP U 0Pl 8/PU 0 p -L@`u40 R@P0Pp@ @ 0 0D0 80\ 00 00 0( (0p 0PއP<؇ 0-@0LSP0p 0P000h -L M 0P!0 R (0Q0 R0S Kh( ջ0P h0 l0d P*00PDP K,(((B}2C}B}} -LMⰒ`0P@@PRPU%U〢xx2 Em emQk*0PSh 0RS BQ:`aU"0S`1 @q RL!``0@ 0  @@0S  @3P@TX00S0 KP@ 0p m(1, K0j,0S@2\P P Q0g 100 0  dV3 0 00`0 R 0g1000<(Ѽ0LSC:BP6} -LMp` P@ 0  @@0S  e2PrWP~V UV PU Rm Qj 0]0R. ' Q pRy U 000Sp` 0 @ 0S@@0 @@ 00 0 00CS 000 ^)0S  \ R0S Q Q  0Sj'  P0S `V 0FS 0  PP  0Su PU{ P R 0S; ='Pm@ T0@S@@Q 0S,0S   0S@W`   pp0`V`  ppt0pS  W0@ 0 CT@ Q T00S 0S ` 00CS 0000R 0XX @&H&P080 $0\~~4~~~~B -L M` @  0  @@0SPU 00 Q *0 R  0R  Q 0P(K0S@0"0S  0S BfU10040 PPU  0U 04 RPU10,0 @PUk04QkPUd 0 pP 0\ P  S 0 0 0R !\0, 0S0!Xp1Z0 0  "00 p 0 0# ^P 0R !P0  0R01p Wx0  "0 0 0#\d TP`P^ Q0-L@P0h'0 70P0 @P00T00S0P00T0P0 -LM< P`Q@ 8 4` 0` 0<, K,0S@ Pp+ p@0pS @dP Q  V Q y0R nP  0R:r0P T00S p 0S < 0 0V 4 ` 00 , @RT VO 00~SJ@80S  T Rp@T& |p@T 0X0P  ,0SP 0U P  0R: 0Pp PI@P  00 0P0@ (KP0UP0s0S2 R 0xS0S R0 0QL80 9P4 ` 0s000 QS 0p00S  XUl Q  0R  R x0R0SX 0 SU PR 0S 00 0  00 0@P@]P PEUp@d@n@Q ^#3p0pS; 00 S R Z+Z  Rp$\l$Xh$Rp pP 00 P0000pp(N$pZ t$BL~~h/P/ 0R /Q/n n0R/q@Q/P/n0S/Q */ 0S/n0S Q/1 \/ / -L@@PA- 2\ \@Q`Ÿ2 00l0a6# a c$"cb!0b0a!6# a c("cb!0b0`# `^ ap P%"0a@0b@7#0lc! c a$"0a0b6#bc#! c a("0a0b#b`! `^ a%"0a@0b@7#0lc! c a$"0a0b6#bc#! c a("0a0b2#bc! c a^"0a 0` 7#0bc! c a$"0a0b6#bc#! c a("0a0b2#bc! c a%"0a0b'#Q 0 x0 b00b0l6#c! c a&"0a0b"6#bc! c a""0a0b1#bc! c a'"y7 p-LH@`P0S)P (P 0 hp -L pR` <0S 40 P400 R 0S 0 R 0SP@p@gg`UT0D@`fPUV00S@ PUP80080h=tG -@L pP `P 0 0 R -PPU 0 S 07: S c-P0 Q 0S R 0 S PUXn0nS i@T 0 00\ ~-P F@P Sn -Lpr`@n00S .@P @V PW 0P 0 RB-P @PPPP -qnpLPWn@`P[ 0SM Vo 0@S``@@ 0S Tp  0R0S @T n`Q< XW00S 00P 0PPP R 00S0 0S0Q 0 0P0`SPRV``@00PP 0RWp`P pGW0T@!x 0-@ L0TQ00 000h0 / p-P@LT`7pP0P ZPpP 04 a!0S00@@p::C0 /C/ Q-Lp`@0P* S 0S-` X FU` ܑT08\tttt|lt$t-` PI @` C, @ 0 ` `j`Y!-` 0S+ u[` [`W! @T8`0 0 0 @`ZGTZ``P`9` 0S  0`pn -d!-LM0@,0 0T` 00 A p@T3  0 P!0R!R 0SP 0 +P P  +PW  0mHP 0 l[P ZEp@TW 0 ][P KE(KOOpCʚ;0 R3 0% %'/ :CP (0 P0 Q// :C-///00p R3/10 P0 / :C@E 0-L@P0P0 080p PP 2S//: -LX`pP@P 4 #P P%U0pS* : -L< @R o00Cs0S 6 40 d40 n040n0400 -L pR`PP%U r@P P L #P0 #P 0`S*C :pP-Q2 S R 2S,00CS,0\0000 000j:@-Pp 0` V@1@!^ *0 00^:Vn@w* pP0-L@0!PP "h*"0  0 *0 -L0PS& @T<@T *P,00,0@Tp+ 2 S@rpT0W0 1`P *,0T0r,0  @ 0``@00 ``p:P -p`LPP 0@T \ l0$P7` @ P tP800C80 @0S} PZ =Y3`A`080,@h6 -LPM`PKpDd #d@d0K \  T 0X 4 0 n <`p0 0p@@Td 80SK080d| -L<0S 4@P # -L40 d0S  -L @R <0S 40  -L @R <0S 40 T0 0-L @RP05cP0P0 Q0.|6C -LXMphx P` Dc 3@Pt@ 3@& 0 t0 &30#P00S, 5 00 R' @PP 0t03 R00SI TU000!000pKD"xpK t0l hp d T *(K "P,,@0T LPA@,,P 0S 0S40 0A@P   040, 0 P, `@pKD"(0K#x`pK8 <@ l hp d @` @,P$P 4`P0t03.p6CCCP1 -L PR0vbU𯝈U?0A x`P  q@P= ȀP㼠p p  !`"  !Z"$!`@P0PD0 00o-0U .6C :C -L M@ 0p)%%!"l0l  Q  0S 0rQ}PK4|Dd@E2Cl@-0000 @/ p-@PL,`!Tp(^1 @0 CS  @ Q00T0#Sp p-P`8L!00  00 @p -L M4 , p4  R>` 0 Z0 PD 0`@PD 0 10 0BR0U `  P!@ TXU00  S@6 ,0S3 00S 0.0S+ 0T0 S, ! 4  R R000 վR000 Z0 P P2 ]P 0 S@, 00PUP U 000004 @ (K 0@! -LHMlKP D5!1pWX6R pWR  R@T 0 X P[0S `V 0S?0X0 @T/ X6 0ST 0`0 0 L P;0S` P 0S 0 60$00l 1P 000@TT@ L@ `@ pW(K 6l 0D10+[l0 0 1P0 0047 -L(MP@P`0AS`(KHK `  0`T<0 H D 4 @ [ pP 1H0vP0CL S(( )((D@PFL`1``H1L0@<0@ X < = 400hS `301  T0`L@`U @%T  0P U`P  `h0h!$qBK  ,0KK21C0b ?A1c0wpnC)<gfff -LpMl`0Q@(0 1 PKD < 00 P0   @0|0 x 60p0 JK0 `d /0Sp PU 0S ( 0R!$K 404 H n0(0 080@0< 0帠 00P00000,6 0@-L M0 S,,p,,@`P,P 9P00S?X/ , @@  ,Pp @Z `Q 0 70 0BR0` 0=PP+p W@00P0, 0 0(KP,P l9@P00S ; 91@ 9P@,P P@,P 9 0-L40@0PP X 0NP 8808 a0hE400400h_C,:gfff R-L@`pP TU 8@@TS S *@90@ 08 T@S# S U *@890 00 U 0S @0`v SP@ @8`U 0S @000 -LM`@pTPR T= T  0(p (K <㞦pQp@ h1S p@ pP;h1 Q$180@ Q0001 0  N0@004 0 a `R \0p40 pU ]P Plh00C0 00C 0 ,00C0000pn<,0E,: --LM0,0 pR \d2@TX P@T3 0 !0R1S R SP  P P  P` R5 0Q 02 0BSM222222U 0 `0aR  R  400407(K 0 MP  B78p240`U  0}:P0  0 `0aR  R0 0 qMP AP8 r 0Rz 40040Q0N7Po 0PkCʚ;t0 -L PRp`P@8V P$p  0h50E<:,:: -LPxM@ \ , `, 0Rp(KPpp YKDL YR00S p|p  X0  K0 t wP B 6Y0$00  0 0D! Q00 S! T*  00 pNK 0 p Kh OP  &0 4 00n 0  0 0 0D! W< 8 0p,0( (0Y0E,<:,::60 p-L PRp`Pp@6l 0D60h,P)W  0ph0E<:,:: -| LP \@P@0Z0 `p04 0尦T 0 @0 0mW0E<:,:: --LM∩P@ 0U, X0 T@ @  0S4;PP 1 0S`V p96, 0R(KQ+p_V V(p QP7p  0`5ȟ᠀ hP`0 `000V]PTp0<(1 RM P hᷬP p PpJ0SC `pX W p0@000S 7 V 0@@7 R@TX 09P_0SaU  ' 7T~7p|-pu poJpPC 00&s@ 08 @0T0 ) ?TKD 00 K0Pl0 #Q R 0#S0S0@S=<<;;;;;;0S@@ @8@I5P`scM3P `/pg  %`PI 0 `p[ KT0K_pPT`80080 NK 000  00 0 p 00 <Q 0 @0 60|0 @0 |  0 K0P  ?@P7p  U@  K0@l4 0 (0,@n H(  N0 0R K T0KpPT R} H ($ T`800C80T n00 0T <060T 400P80080Q 0 0s03R0#SQn QKpPQ 0P Q   0PEpP_ @P@ \ 0S0 X P_ .@T @P P 0S 3/@@@ 00 00 <0P 4 00 040H $(<060n   400@0S 0S 3/p@T $0X 00X0n8 $ 0X0 M@ P @P P R 4 0@P@T` n00T 80p080$#P Q  `V<pQ 0SS0S,<<:0E,::6 0P 0CP>@t 0C!/` @#2// 40P 0CP$0PN=@ 0C!/ ̇ P P10/"10/4/ P PP10N / 0\30S?000S \/ -L9@S0CS9 06 9S06p@-@P`0#U@Tpb0P#U0p0#^ # 0S0R  ^P0,0,P#x8P P0Q00P0S/>S/ / /-RD(E ED(ED\ 1 R7 0 p-L0 8@S`) 8PS 0F0Q0bC䁘 "--L0p`S1o Qo1_PA 00S   R` V0 00S   00S 7 17 ^ V 00S  ^Q 1GT@# P 1'R! 1?0Q x1GsT@l4 )(0`K d8 0-L8P # 0sQQ B0S10s Q "-0S1pT0Q@@S0a)00@ G0 -@XLQS QN Q` Q`  V`"-0S6  4pP VJ  9z  P<+ P PP81 R P48 S84ĨSUX 0%0Sx8<x8 K4``V"= Q2 RPx8<x8"-0S8X p ``PJ -@LKK?6,"R2 22 h 1-LMp O$2i 10v "-P0`00` VP O0S NP? 0 `8`  V P\A"= R!  0 Rd  d 10b 00 R" ->2pm,;Js01 f71f7 = S"-000 0S"-000 0S"-000 >S"-000@?f:00 0000  /0@- @81T^* T- 1T^  T00S00 000008S  0S00 000S8 0C8 @ R 00 T00S00 0S0 :[0(0CR 0 8080 0 T00S0̫|>0  /? 0 ? 0/? 0/? 0 2"/gg@P&XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX/ // //x8 01S^/="!B10b>0/0 0 >= p-LOPT`@@T 0R!   PV Pp -LdMP(!@0|  ,0 p` P-xK  cN rK_N P%lK UN LKQN0XXL00 0C 0 t )0C|H P @ P=L0@0/@D ?@1.0o@ -LRM`h V, l p!  p1 0K(K!H@^K  `V# 0 ps@hl!0(K@ p   YK VL@K K, 0R(K L,9 p-Lx8`P@9 0K 0 9 r 0R>:0 "#A10a>0 00CS/eeeeeeeeeeeeeeeeeeeeeeeeeeeeeee0 0  )R B0RLS0S *p1S^/phphphph  0As0S"!B10b>0 0 0C-LSgfffffffffffffgffffffffffffffff*hPhph h -L0@0CS gggggggggggggggggggggggggggggggh), ^ 00CShxhhxhxhxhhxhxhxhxhxhxhxhhxhxhxhxhxhxhxhxhxhxhxhxhxhxhxhh/ > -LO`T @ \D0D0D0?D0@H@ D OT^PpWP 21CQ! c. p@  WP h -LPTMld 0` ,0  \ 0  0)S0Cd0`pt` pp  0@ `$@ptKl` hp 0@p#D< | x  0@|pK!(#Lp4Pp=* @4K ?J  XK0VKD@K80W0K1J  PK-J JK)J\ڿ\XK ~  B\y\ٿ  EPm'dp唀@, 0R(K `@ P>0>O)d 0S:``P>0>B),^(( $0 0,9`p -L(M$`0p,0 @ Pt0 @00PK0NK80O0KI  HKI BKI n PK   B 'P F L0P 0 L0C0 `<@K"4 0040 "880 "4<0   [ ޿ > |I 0 0  00 0@0@t,  0R (K)P P400c ,0l> 0>(,9`p -L@P 㮘00 0- LPҖ@P 0ӿ@0 -LXMP` h d0   P, 0 WKp W0Kl 0 SV K UK @ I OK I IKI0 0S 0C KB0KApK~ 0 S 0 0S00000p 09K 8K90KHd0dWK#4x0 h0l#|ဠ 0 t*h#h l*XhXL*4dYK 0>& $ 0S0 10PP ;&1P0 0@00S000010PP 0S:>0>N&L& @>0>C&A& <& 7&@ R@>0>-&,9 -L@P >00 z0- LPb@P 0 +@0 -LtM  0 ,0 00 A'P   %P 0 0 R @ 0S p<0 FP`0P`@P` `0P "4 <003 00 "8 80 040PP "40 LK jP\K0>$$ >0>$,9G-p#00`$M 400400   Q     @ "$""4r 0 04 4!~ 0 $ ""4r 0 04 4!| 0 $ ""4r 0  04 4!~ 0 $ ""4r 0 04 4!| 04 0##$s0 00  4,4!pX$Ѝ$:G-Ms000  Q0  r @P0!0# "#4 "0r `04 4!p|0 庀$ _ " 00"40r 04 4!@t@@ 040##$s0 0 $ $!PuPP 040##$s0 0 $ $!`v`` 0v40##$s0 0 $ $!pwpp 040##$s0 0 $ $!tx満 0uw@40# 07~ 040# 07xp 07q 07| 07@t@ 07@   000 4#0#00Ѝ$: -LM`x8p8 Pܐ 0А 3 `1C cR0堏?XU Ux85x8| O?,@:0,: 0 4` 0-LM@8PS08 R 1S000 00hX -L(M@`p00SD̅8K00S0,0K00S00,0KPPK0+0K)0K*0KC*  ۸0  g@ Ѹ@T (K8K  tC2K pC8K  jC2K fC8K  `C2K  \C8K -LTMt x &p h 0,0 x00l0 t@T  0RbhT0 @a h00S   | D)L 4P`0@ H#H8p,xP!$0@`P @ 4p0$ P@Sd@ `P *t#PX . t h!PXX@0 0 BjR X 0S XhT BX0@00l!!R |x d0` #H0"HT.X# lx Eo⠠0`!1 0 BV[P@K  u0l シXT0nZGt @P\  0@a0h T@! l0፷\ ! dZ\ .P@ 0X 0U` p#P`t jZ RPPpp B;C"1P  t\ @PK 0 ! 0l I\ 80PYl4@KT!0X yP[x |d@K00 @PlP!!t!, X0Ra(KB pPt >0>}!X h 00S0h@00d `0"HHI ;X!1XPP0 0pt>0>Y!XW!X U/l0x@Eo`⠠5p t>0>F!XD!0X0 0S:t;!X9!p>0>dKX ,!PXP t'!X@ Bpt>0>!, : -L@P .00 0-LP@IQP 0 8S00110  !!0 -L,MpP T L ,"0PH0  T PH0 0 gR H 0S T) H < < yAP` P`%4P`H<<s0_  0 03 00 "880 040 @ 40L !R^ P`P 0@0PLCoS 8@K9 N LT< 0bY[H@0`pD @0 D@b@ 00gT@! D  d0@   LY@`p @D 0WpD  0VP!Pg PgY P P U`` P   P L0PCo"88 ^L0 1; 1PP PH0@0  P_!P3 0 0L 0P!P0<T @< 0@L坵 0@P 0$$$$ P @  L0㋵H 0 0 0 TH(KP T>0>H0H0 ;HV H1H P0 0PT>0> -L,MT pPP P0,0 L  T0 0R`<@K Y@ 9KU@  LT  0PD0 T PD0 0 BjR vD 0S D  1@D0 @  fZPTITD@PH  0@a0h T@! L0H dZH +P@ 0X 0U` p P`? jZ RPPpp B;1P  H P@@K 0 0L ἴ@0S"T, D0R,(K ;DD1D P0 0zPT>0>DD PT>0>TD P T>0>,$< -L@P 00 -B@LP 00 -L(MP `P 0L ,0 0H0 PD P PDD0 0 iR D 0S P@ D P K?H0\ 3\H0<@K1D0, ,400 301? 9K-?  HP0eZHD@`P @  0@a0fT@! @ d0@   HZ/P`@ 0V 0`Up PpM iZ RPP  B;1P  Dp @ P%@@ 0 ##Ƞ#\0PH0㮳D 0 0 0 P , D0R2(K00 Šh>P0p 0LP>0>DD ;DfD1D P0 01^@L P>0> ,<< -L0/0R  @?0#200   N000N "" N04\0Nx8 2S 3/0 SH> 0H>/0 SH> 0H>/ 0-LMP8@S0P0 0 0S00 0? Č 00 p-LȐ@\Pp|8 p8Sp 0S >0 >p` 'P>0>p 0Qp 00Sp8` BV  10Rx 0| 0  0 B C  R  0 00@00! 8Sh@`! h\80\8p0d  0-LM@KP= 0P P P K0@K \= P00CS$|(0H>/ B^0 RH>(0H>/R 0-LTP@0 0 0S0 ? 04P00;00 -L 0 S`𯝘00 $p"!@21C0d!P2S2S? t02023S  3/Q oU p-PL,`@00ppn -L 0pS𩝘00 $k"&( bSf@5S 3S 3/V ㈅h5S@h5@P Z0f T0@f@hn0h521C0bAP2S3S 3/bi -@LhN -L 0PS@𨝘 x>0Qp`x> Q8S6ha !*48 , -L 0PS@𨝘 t>0Qp`t> Q8S6h6 !48 a` -L,MPQ 4>04>(K8S \ 0P $0 L } p8 0Y`40 : 0Y:0D < H @ 0 S@`  Sz `pY: 0Y*H>0H>H0S 0SD0H  p>0p>LP804@$<0<2 @0^?n @Pi "0002 R 3 x87x8 x87x81Q3#551 RY x86x8 !000 o6 T1QLA@Q 00848 S808`>0`>WH` 2SD` ~ S{RH>0H>v+@K : >PkPi0Sf0< S < `<P bP D 000t0x86x80D < H @ OdGTT< -LM@PQ 8Sp 0 `P:0P:0S` 1:2S P*V 0S𯝉X 0 S𯝉S : R X>0X>H>V0H>;P0Sx88S 0 0  000P  pePPPP p-PLP`@ ેP p  :p 0@S k -LXMpȐx \|0  (K8S @P0"0S 'bPd>0d> Pt 0Q"PX0 0 P `\ \ VT  0X5:l d p h ` SpP  SlP 0P`X-: 0X%:00SdP  2ShP  SRH>0H>+@K 9 P0`S` 0l0 d0 p0 h0 `0 H>0H>lQ 0Sp R 0 S: R X>0X>|p0;PPx(0BS @P! P 0h>0h>`R6 X0t dl> 0l>00x0\ xIPl h0xpx86x0= d\ ?` R ?F(Bx0 :H xP 0x L KaPx0d04[SC +x0K 8x S8D"x0<0| PT0x  0|0x  c(xp0\ p06L K!Px`000x0\ x0 8p>0p>nȗH0  4[S *d@0 <0Q)[A?0@#[ #[  0@S  ^ H!80Sx8 ^( Q& x ]fP7xH @0 0RR00[A?!!20[0P0Cs0S20K}  xP@Pg20[.W< -LM `QP@p \>(0R\> Kć*60 B8 #8 8  -LlM(0 RR8S  #R(K8 p !0&`$P0 " T #0P0 X :% p\ 0X%p:\0x0 t0 ` |0 p0 l0 h0 d0 X0 0 S pP  S xP  5|P 5:S P`X: p0X*H>0H>xQ 0S| R 0p S`1'R!L>0L> 8S `\ QP>0P>0`/ @  |0PP `P 8P TS 4  p R  CHT 0S :Q ;@:0 [|0 7 '~7@0 0  -s7?00$#ḃp0X tt0x @!8S  UR: 2S7  3/2R ` d0S hP ` *S\R 0X0 W2S tP S SPRH>0H>J+@K P.7 P?0S dP ; R8S60lSl 0|8 WO x t ` | p l h d X '8S x8 hP ?TdQ ?000^8SN8SKt0XS 41 R7 x86x88Xt30( 9 0 Q(511l0S8  4 `P P L KP0d0]PH00@  <008 A?!#[ x86x8 hL KPh@ v<ă\< -LMp( WF`(K(0S(  Q 0 0 0@`W1(PU @P,  PfjU; 71P (0S 000C `b 0@P  P (( -LMpxP,  2S  \2R >0>oj00( @R0@ `W L0P0V0S5x8 1R2  oY 1R 0@) -P 8SW `pQ# kP1 00 @0@ a, o* 0`P+ 1<1!1R*@10!Ra@`10a! !W 0 0@0@0/0@0@,00 @0@~ꈎʚ; -@L 04"4s`V1ھ 0R p + PP# 3g@ 0S@P0>00>0S0S `FG50>00>mꪪ -LM` 0PSp :@00S ̿({PP0>00>"2K ,1R0S<  F fr 04"42Kf  500 iPP  $K2K  4,K  42K2K  4,K 42K  4,K 40SFK+ꪪ -LM`8 p1N#2,0 @P0L(K2?=Q 0, S PU @0@  `00 S0 00#  P00  P4 U 8 000 @4` `@T 0S000R@P o$0,? ޟ㌿ `  -L0 \ 0S00 RSS \  0J`䃘 -LMP p@@T0 T*   ềP 0 $a燽8@pP>@80| `PA @ X 0P(K(Koe8S8S L>>$ -LM@RP` 8S 0S >0 > V( P  g(Kop0>0>  X8   i 0P >0 > 0 0@V0@(K0, 0SY4 0  00S00040 000 R 8S Y10 . #0"=00 0 0S>0> 8S 0 0 08 8S7 80X F XR XR>0>8S>0> 8S 6  XX X 6P  ާ1s 0(Ko|8  8S0  u0Sd u 0008>08> PO PD ?8S;LjLjHĈLjHĈHĈtLjR >0>.R8S ' P >0>R8S ' pP 00#  4 `0`S x8  4 0@% $>0$>  3x8q 0@m0@(>0(>  `P,>0,> P  >H3 "% 40 ,0(Ko^XPX4>04>800@  `Pp4u0Su Ÿ00C00S  0QM0Cs B@00! 8S@10 \( \(0S8S ' PY8S] 10SV0 0 >0 >  06 B 0? 1 P>0>I 5 10Rx |   00C00 32C0%R 0 &80 0L P  ,0(Koo 00&A nP @& P 00 0wP`䃘PdL7 r - iL M!s04 00 00 Y0c, : #:SZ `pY^h@, p00\ h%02@0 W/,000b0400iY.h0 20Q 0, 4 iY΀ht@"0h00s "00Q40 i  Y.000C:0(K -r`LBM dsp5PS &80 00  A?   - 00c:#: Sʲ00g:#: S>0>d@V 24 00g:#: S 0iJ0 -` Lp  \𨝘0 4#&  10\80BsPU@ 0$ 4"0E@sPU0 4#2h -LM⼢`p . 0 S+  0T0 00 %1!2 c@80 4 5Sj x8  A?   %80 040 1(K!0S81  &8 $8 0a1Q 0҄%5V8 %S @bV>V. 00  h,0 0Es0SYN0P0ā04 0C0 :0 !40 0 ~Ph PP3S  3/P(8 0a0%,]0V V0 A?   t 400a:#: S 40(Koe<0Q5Ťh%8hUy<'܎ 0S/00S S/0S0S */S/sS/-P\2 ڰ\- ʀ\# \ |>0|> \ 0\ @\^\ \\ \0U$0Fr -LM0 S2<0 8P 0c!@V> 0, "4  0 0c! QKʲ 0j:#: S8 0bY.:#:SY`pY^h@, p00\ h%02@0 W/,000b08 <0cY.0 !0c0ಠ:#: c0!<8P0lYNh00"R , 000,@0@(Ko0 "40  4Ph500 h5"Q 0 ,N8< aY΀hx@"0h00s "0Q80\ ]>\) >\ >\  0,`, 0R(K>\z x>\ 0\J >\|8@ p>`㳀ᴁ`>\1 ET>\ L>\ D>\>h3`P >PX  P1'R!| 1?008X98S8SK 8p R 4`=\ 0\ =\H=h`P80 _T=\| L=\E D=\<h`P> RV |8: x8 ;4`x8{<\ <\ <\l+.`k<\ <\ <\\M@K! k8S#49 LKM0K-! `MD< @R`pF`D;h塃`P>xȘ  0S774`4`x8x82t;h參`P,@ Px8;x88S 8Six8   ' P4`:hm`P |8 0Sx8 <4`x8x8@<000=^000S l:hM`P0SS`002 1Cc `PZ@P`x8  :00?00? 000?00?000?000?000?S S S S00 0?00?000?0`0`  M`8S' ,`x8`900zx8`#500.00q8S48SX(`e@8h‚`P_8S\ 6A0AS2`Wp( 8 p( Sp(  88,(20C*`=7h嚂`P7MK! v`P1M0[ SN@ 6M [LK4)],4`!. 0ᦻ`7hv`P|8@ 20s0S4`6`6hd`P!8S x84`20x8|6hQ`P0S x85x8  ,4`06h>`P|8 W 0Sx864`x85h,`P@@P 8T` 8S SX S` 0d5h `P+`8xS` >15h`P8SK @ P{ PX x0 `~(R  x8KU   +`q4\) 0\cPPZ@P 0{S`̠K|P 000@PS 0|PSO:|`E  | `P BP  `98p(LK;:0 M0Ki+`,x85x8 24`" ,`00CSN @P`  R4 0S1 R b0a ! c. Q 0S0000G0ac 00 (`P `P P R @ x8 B<4`x8-o00?0o??0?S0?0 /0// /0 /0 /R0? 0S S S S ?0?0?0?00?0?0?00??S 0?x84`6x8  *`yx8;x8 *M1*`kX0Qg 8p Q4`b0` 8i,i 6i(i8i4<i i8i$i4i i5i iiiiii|i0p0 -L&@  0S 00P< 0-L3P@   Q" 0As0S0|8x0 0l Q 0As0S00x8|(6 x87x808S !؄ 0-P3L@ 00s0S0 |P`(0R00x86x83 x87x80( 0000|8 {! -L 0`p0C000 x 00Cs0S0 X@PP0A?0)'0R00P^/! p-LP`h%R @0@S h% Tu0h500Ps`Vp 0-@LQPe1 R>C80u0SQ 0S 3x8B\1 RM P1  >2S 3/ ȕ9S00!0 0!0080 Rx |   000C0C00i 10xP RZ•\ l0  a0<>[r@ p-L8`SPJ ,1 R*✯⚯1H9S 0<!0 !'80C8 R  0P0Cs B–\ t0 I0>Z @, X(8R/0W 0SphV  v30 8S" 6V K!ʭ8 -h&0X0"! 8 S 8 ,0(KX 8S S 8;SR 8S S Q 8S S 8S 8;Spn$L -L(8@RV(8R p-L`PP H0H@p0000$0d X #=C0p pn -PLXpN@`PQhpn -L@Q 08P *s80P $s N K hG$ -Lt`Pp@@D@T8S zpn -@LP! #02 8  PP H@p`808}0T>   ''L#8p p p p-L@`!PPT>0T>  p 0-@PLC#-,#0t1tP0]0h#  p 0p-L@8<18!841(8,!,1Q( ( 1@(0 1Q0` 0>BpPP" |8 p0`B p0P0P2  j  pe  `ph_XXPLDP0 h:($蒉T(<Ѕ 0-LH/P00000000/  x8 00000S /000000001|( 0A? ` 00000000 P  St" 0<0 p-L`pPp1GX)1RT@@$@ p0R@8SFF x(x10S: :  4)@R :0RE @x 7$ /0/0@@ @@)@@0SS S S@@/0A?@@  1 S@@|8   P@@p @@@@@ 0'  ~P @xx;uP@ -LM\0p-4K , 80 !4PK`Y @'0' <0 RP/ T [P , 0Ra(KX@8KP*x80x8  %[@TN 8KzP/08 48KlP T1@!P@T P08Pc<8@ Z  0`T! N'8 F<ݪA!تx<Xh @ P\Ͱ8K+P <Ū8 4(,T <`%0303x8 03x8  . *   ?/A ?0/ ?0/@!|8  00x800N@p }=(:00:, + 4}? |8  r0 008q  N@0> t>t<!0x,|<N?  -L$M␃6p $  x8tt# l8Ot8^PSx80x8-8S@~ P`GS08>U@ 8SPPV 0RU`@V(  Hpl2x8 0108(R7   /8Sx8  49S&BPp(0S  Ý0p80Cp8⼝t80t8b$ 0RV K p8  DK`P pg 0KpQ$@Ua0 B$@E\`P\   7S1 0K $0RS1\ s}9?\ 1 'R! P:,І|؆< -v^8LppPpWp1GT@ x8 0  8p RiAg0X <007pp -L@ h芪 -LPtp`@P 0S8;S08P@ hgpn -Lp(@8 Sp(x8>00.x8>6 . x8TT  L8%(0(,0 $00t8hfІ|솘 -L0(P @RppT`N TC T 00S!X$B0000PS S R  'PPaRd ꠁ p@PU 00000S񟗸W 0S00PX 4PPX Z '[[ 082S  3/R RR 'p3} 8 Pu 'p3npn h0" 0 0220 0\020  0#40=*0080  x R 0s   /.00 .0C 0/80@-"\030Cp0"h"D@P` 0-L8PS@A|8 +  0 0S$0 R s>  0S%@00! |0SxP@P! |P000@0u0S 0 0S0 RH0  000/0 0d`[ -0p-`P 0 0@L0 0A0"$  \\00 "$ 0#<0 "( 0#40A=    p<>8 0-L0S @200 P@PEP 0  0`(,1 p-L R@> 0C0S0S2Q` R 0S0qS R0 Pf000  v@ @ 0SX0 R00H0@ @p`0` (40,$ 00-P 0@PLT@#@ #0 00-@L0@ P0 p-L`qP@P   ;0 B 0P1 p -Lpr`PP @  K0 B  0`   -Lr@xP 0 0 K -Lr@gP 0 0 K -Lrps`UPP0 &D'  @`p -LMSPp" +@K\ 0 0  00CS'%'%%%&%%%%%%%%.@K q700P@ `6?I&40`P0`R[Z&40`0yA&40`  0 "#400<0P0^|8 O(K00P @`  *00@`  00 @r`   0r`0@&40`P0`  00`P   00r`P00P00P~ ? S0C0P 0 0S  P  00r`P{ 0 00Pr`n==Lh "0-L@M+pK`0P 8 00  0d0C0= 000-@P0L00C0d0C00 p-@ TL`$PP T000p; H1ph7눇 p-LPr` @Pp00`  0#40 b p p-LrP s@`Pp6  Ts +@"4& 0` 00b0 0p -Lr` sp@PP 0$$00CT0p@ @p t0 #0   00b0 0AY.03s00#40% 5C40 -Lr@ [pPafdP0 0 /@0 300s00#40" 2C40  0#40 b r Rs0 R /S *| S =SL4| ,Ƞs0QL4| ,Ƞs0n R-L[x8p p\L@`:W 0<S 2 PP^J 0 F ;0\ 1 #      pP2 x8P S|8!40  Z 0#40L : ;[P-[0S>x8%1 -x8 0  00c0 00  p0   O0  \0  p0  g '  -L`pP#?0̀4)p0 \ࠓL+ \ 000 V@P 4)0S 0  00c0 0)0     p-P=00 8`Lp9@0 0000{p -rp!P[@0T``DLW ;40T 1 #    `P(  W'4[@0p 0 000#40<[0S @W003 00c0 0p@ W003 /   k{ d 0-@L0p0 "-PxL[:0`8SppQ@@\L&# 0< 7R 0  440\ 1 #       fpP GpP @00 岀1 '  㶁#" 3 #4!0x8-  [@ 8S*0 R5 [0S*x( 0 00`0c0 0;: o x( x(x(!L7 |"-Px8L[S``: Px@@\LT 0<P 7PI 0 E 4 40\      `P1 @ ( 3 [0ȕ3#4 08;:   8SA 01 RD [0S5x!* 0 0c0 0(0 Fx &6(0 Tx gx @S 0 R ~ -LMQp`y PX $P @ @PP`!P 0001 ' |8  VV@0C 0@0068S? @00! 7Sȧ@10̧(0 6($K8S  PR 0"apPp@x@ 08Ad@7V 6 @0 @   *P fL>> -LMP 1P 0iSS3 0 SPP>0>" 6K  & pP>0> x8" 2S"[3R>0> U ]W [0P0(K00So====08x(D@0@0 H0`U  ```"[  =PP>0> @0@S00`2 < r"0< S2 < 21C0b10"R`< 0<<0021  02  "[2R @ @ < 1 "!8S񟗁p>4>l;p>l;l;=px`,pPK 08pz`00  x' t0K px8  $1  0@008S pY00' Y0K  U  Q00  J0K  F' A P1p2x\@000Wᘞ8 $>0>ꈎfpn -@L`AAQPp T ]2P PW 0iSSSpW!0 |8  0S L㲁Q kPP 1 018P!1R2@ P10QA@ @! A1010/0@ 0@ 0 0@0@6   0o07Ppn -LMpQP` @0>V  V 0Vx @P V6 VH(x0r @P> @0>V @P  0t@PX>@Px0((y@P 8S x ]@P 6 !⒝08 tx :@P 6 !”08 0@P pn4` -LM8SS5p1S7 0@P40 0@  0@,H`40K  p 0@P pD` 0@ #D<P`0@!(#Ll!p4R: >0>(Kh1S* 0$ , >0> 8 8P  0@pP,H` 0@  pD` 0@P #D p<P`0@!(#L 4,@p 0hl!p1 8 R 1S>P0>F E0@Ap $@`D0@C p#D<P`B0@!(p#L4 (Ko) -LM8SS0S (K0@ P00 ,@  0@,H`00K  p 0@ P pD` 0@ #D<P`0@!(#Lp\!4pR >0>`1SP>0>ⓝ 000 | 00Cs0S0 \ 0 000& !M ,80  -L,M8S8 $K@ <  0@8,H` 0@P@KDp0P`p 0@  L #D <P`0@(!(D`!#Lp4R: >0>8 \1S*80 H HP>0>8@ H NP4 H(  04Pa b04P04 , B@@10`D0 >0000 %D, @dI8 @0lIh9H0l9F E0@Ap$@`D0@4P#DpC <P`B0@4 4@!(#Lp4 D0tx)(@ pIc( H  80 HPE,  8SY8 |20s0S|2R  0@p8,H` 0@PpDP0`p 0@  L #D <P`0@(!(D#Lp4 \`!6 80 $Kk4 48 0  8!&@8 0,80@ BH H -LHM8SL (KT P  0@,H` 0@PTKDp0  P`p 0@  L#D<P`(0@!(pLPD#L`!4RpL*L` {P>0> 0$ H L  )Pa b0cPep4X:d d`0X8 %< % *0PpX+: `0X&:0SR+@K * P0S0>v\1S:<Qo L "<04  0Rf00X @0 X` dIL lh)00l9F E0@Ap$@`D0@PpLC #D<P`B0@(!(D#Lp4 X0tx)4@ pI0000 \ 0dIL |p!l9h)8 8 ` \  0@$@D``0KP8P 0@D@#D<P`  0@D D@!( #L4P` p)8`L L0 PH  8SBL|20s0S|2;  0@p,H` 0@PpDP0p` @P  h@ dP  ,hP$$0@`P H#H8$!,pL`@0\1`A& d0 L,haL 0 2% !a$8 01> -LM`8PSS0S KpP>0>g1 S p ^O |  P' 0008S|20s0S|2 6 0S00Kha02! L80<ap 0Kḧ -LMT 0P,0 4J, 0R(Kd1S<  0 0  0@,H`0KPp 0@PD0`p 0@  L #D <P`0@(!(D#L`!p4Rp: @>0>\1S*9   @C P`!PΆ1>  lpKKP p P@'P >0>T@ P  a b0cPep4X:d d`0X: S 0PpX+: `0X&:00S0SP QP Ro@K  FP0SP  Sp7 P d% RC 0S @T=  Q 1S @1 tQ  0R  00 0   PP  KP 0S  0S8[S ? !  0@p,H` 0@PpDP0`p 0@  L #D <P`0@(!(D#Lp4 0\`!d10& 埗@Hş8 04 PPk 9  04P#  | P r@K   P0S0SP PPUPUP `` KPUp F E0@Ap P$@`D0@pC #D<P`B0@!(p#L4p^O 1q匁|1`a    Pd3x#  \Z ʾ  0R@ @@ `>00 0 m 0dI l9h)@00l9F E0@Ap$@`D0@PpLC #D<P`B0@(!(Dp#L4 Ptx)` pi ]   P>PU 0S70 D0Ds0S/2P1Cqpc>00 0 0dI!l9h)` |  0@p$@` 0@PL#D <P`  0@(!(D #L4P` p)`   P@h 000  L0  Q|20s0S|2v02p,:>=̈7> -LPMtP`PP, @p00CS, 0R2(K!00 0CτlK1.KP5˿`P>0>B00`@ tQ 0 R 00 0-` P6s $8 0K,=̈ -LM4  0@  4H,` 0@P p D 0P  `p  ,0@)$ P` H#H8$p!,\1S 0  0>0>(K`1Sa b0cPep4`V7:d d0V ! *0S 0PpV : 0V:00S0PpV*Z 0 4  0,R+@K L8  y8P0S0 4 4> -L\MHt 0P,0 x (ß, 0R(Kd1Sma b0cPep4Y:d d`0Y# *0PpY: `0Y:0SRo@K   -P0S0PpY*X 0Sx0SSiX  txP x Ko xt C_0N @<0 }  3*x0t!p1>l`K PPt6Etx 0   0@px,H` 0@PpDP0`p 0@  L #D <P`0@(!(D#L`!p4R`: t>0>Px0tKo  & ᑔt H80 4y\1S@:倚,=>̈> -P`0OpL0  0 0@0@Uh<D0bS 0bS;0S>0>0S: S<  040\a0b $c Q00\0S 0D 0Bs0S0SS"R 0Q& 3&  3 7  +cPP>0>0S0S1S 0SRPP   0S   {   } y u "0-L@M'pK P0 ` 0U  Q 00  K C> p-@ TL`PP T0 00p; 1phԈ -LMp01 `"0#PK 0 @ B    00 0C 0 "40040 "880 "4<0 !D   0@>` -LMp0" `"  0'PK00@& p  00 @  1S0000   0F>`@ -L`p P PX @`2 01 P!  0  00S00 00$SS  1St 0S p "4r0 0@ CCq0Cr B#4Ac B a0b " 6|1=Q/ k0PP10 /0@ 0@A 10S0 0@#40\0S  0 400 0  !1R w7P101d9@ P10Q㬁@ ! ఁ101 ꈎpn M-LM0, rP 40 0@ P( X c @ ;@#$  0,o1 0l!"8 0l!"4 0l lk14 0h!l"880h!l"4<0h! Z? 0@h1lA,@& ,(?$Kk400$D#\#<@ pT l<[#4@<8@ FEpDPCB040[A0! 8 n $Kd -LM` @pPJ Pc Vc1 0`!"8 0`!"4 0` `_14 0\!`"880\!`"4<0\!!D 0S0 c 0 6 ?$Km!⿑ T80D 0#40  002"!BbP "4F0E04D0 "88C0 "4S1 -LMPpP> `c 'c1 0`!"8 0`!"4 0` `_14 0\!`"880\!`"4<0\!!D 0S c0  0 0& ? Kit!␐ @800 K/@40̈  -LM0 0S0z0Sc S0 0S0Ÿ   P0 p 0c p1CSb?r? ,0 W_` P`&<\Q`a 0`!"8 0`!"4 0` `_14 0\!`"880\!`"4<0\!!D ӷc p 0S6  (,0g,$ 00 0& 0?(Ko"!B10b>0!8 0[@ 0@ (K ( "4F0E0 4D0 "88C0 "4S  P21C! c.  P^08S S S o0S/o,o0S/  -L@ R' '  880C0C88 10P RZ 10P  R(  (  \8\80C0C\8\8 RZ -LM8  8s8p妰 4 8 [`?0 0 , pZVr Vo PX0\0  X@0^  V~ 80( 0, 0\ , F PX 0\;  0\5 P08 8S= 00 S0 0Fs0Z[0s` Y0[`0 0 V0A 0Z\04 0R00 R0S, 0r0300 (K\ Q 0S\P0P  P\ 5S40040 0 p- Q` `VLP0 0Cs0^S@0 0Cs0^S@Tt夽T`PP\䜽UDph藽V 8哽Vp@@$䌽Tp@Iĉ 6 -LM`X@Up弈 TCLlHU U:[0(Rm6+ (5R'E@ 8U0W:;8p0\@d5 0 PEx8HH% 05008x8 090ES؇؇@0ES갈XXx80x8 !B '>pf [4p4  U급舉舉ԈU U 0w# P P w P PsP@P 00 0@PP 0 9 R' '  880C0C881 10P RZ 10P+  R(  (  \8\80C0C\8\8W_ Wd00 0[6\!P808tK RZ0 0:W800 0/sx8* 00@ "8SX1Q / x00 0l000 08'‹8 %p@PP 0 R 00 000 0@@ T0HLhpL7dpnȉ> -LMp@Q`PḀ *8US1 >0>Q8US8SS 000 64088USx8X 6/8S808`>0`>  Ȑ000(8d^/  !Ȗ0\8 0{ 80ts p`P  ''0 0  8p p @`PgԊ -LMs@Pp480 0X 3S  3/0@d 2i 3S  3/cR@eV@ ∅h5S @h5@P 0e T0@e@hP0h5 -LM@PTp`V>0@c80$'  0|pn -LM@P|` 0S0C 0p S ?8 0c ' |0rpn. -spLAgM@Ē 0`_ 2t0P r2 X[/0:O000 ᰠp 8QX 0-LMT0@P+;:00"0 7 0h鸋 -@LdpP20S2`< 0;:0pn -p=LS`2 1CA@cP<di8 Ll)h {@p |8  >SP2 1CA@c LdY(@1 h9l)p0   h8 p-L`4P@ phRpn p-L8@S`p0Sp0P000P 000000p -LM@8Sx8 8S 3`P XU0S 2P EpP 0 pt KS  0<0hp@-P` \S0/ S0, S(p$ 00S 10 00P@J0Q@A0S PLZpV \0R*@p0 p-@ 0!0000 0!0LT L_H0PP@`8000BaPobTLPP`p耖C@B5010/000[ Q/!0S S010 0 0% !!/00 @p-L0`00@LP$Pp0S S 0 [0Qp(0 QpR2 0a0#20p R-L pP@pPT @ t&9/ EP` @-LM4@ t K 0@ @ PK>< <-L M0@ J K0 @PKF0Dp tQ 0 S"0!B //>-8JQ !0 S0F0@-@pqP 0l S 1\0}>EN-E Bs0Sr 00R 2 1C00 2 1C008DGDp tQ 0 S"0!B //>[X P/0 g| p-`PL @H^TP4X@T(phS QPphL갏6& -@PL@@4<(8$0 h0긏ďЏ܏ -LM#H`P@048 00 p  0<p<Q 8\@T@`D @D$K( DLT\hxp -L@0޷T   Է蜐P -LM0,0 QP3 p0@ 00@x :K=2K00<0<Po:00 P4K  0 < K;0K1< K<1 0, 0R(K,L7H -LM@ $, D P6 p  D1@(0@( :KP0P2K`<0: P`4KA  =@ 9D 50 < K;0K1< K<1 0, 0R(K 厌,L7H -LXM4PK`p@ @T@0 40K0` BK3K/PP 408 0B S800 RD W$KQ x@KD  0 t0 0 p 0l n a  p-PL0`Ppl0@T@T D1S 00 5Ppp47 0-LHM@T$ 80S0Q 0S XPKD l 0T0  L <0n SD0K0   40040IȐ -LTM`0,0 04"4s0 CRl0 , 0R(K 0h TK d0 ZPKd VP TQG 0 R<0@\ ` \ <@ X@ P 0X0SF PPSE X T@(R@@9 0 pPF ZC 0PU@  R<0 S L@KPK 0` 0$0; 0 x0P7 00 R+@T+ @T( 0 R(0S0`4S2 $`J0(`(0S3@$@0 =`0(@0(0$0%000,0 REgfffE0S S / P// 00 BQ0S 0`00//0 RP/0S1 Q/ -L$M`0@0C S 0 0R&KZpPP 0 ,0 0 K/K@ Kh`p Q000 0 0 006DD C,2i pn8I -L$Mh`0QP$0  Q 0 R 0@SQ0001S@$ 0R1 K06 ?BpP  00 0C0604KD K|@PhP0S 0  0 0 00p` 6C@,1i pnDI -L@uL0Q 0Q 0D!P,0( 0S -P0L 6p`<0\`L0@T, D0@T' 6<0\LD1 S^V0W  H0 00  =P000W  2000 0-@<0\PL  0LP 0D0P D1^6 L0R0 0\<00 R U 0P P00000 0-L @R P|Op0QX0404 40 400 h0 P4  0h00 00h.|I -LPT @0ST -L Mp`"H0 0,0 P`H0SD g ,"000040`8@ D1 <4!4"<00 0 1@T+@T( l0 3S3S08 0R(0SX0S  Q000 0S00@@L0 R(K,0   #嚦 :L -LM@Pr`p00 Æ'q, 0  "< 4&.4"? 40 ^E 0PS5岐0S P 0 i Y0801 0 4)4 S*C@Pn1S@40 ;P @0 00 080ᾓ$(K04  00#0l0E  @P=XBXϠ, `PUPE+10Cs0S1t, Sq: 0AP044$ 80P P0S P10  `1`!尀 , ,XI,@^6PUPE10s0X1*, R': 0AP044$ 80Pw@ 0RPY @0!QT 0k긁E 긁(KoK;808 尀 , @Xs n:::: -L MP@` 0 \G l0 J 0S&0S/"\! `1Q 0S<00 s 0&,80S/  p80@0@P0 K180S Q0h!1P 0800(0`c;L0S0h帣@@0 KH@cpP 80S 0 P1 <쓘 @3-LM RUC^  ㄚP7 2 @ h!0$2, R000 03 $#$ r 1S0!0 0 0 0@D!D t@0 0(P1 cp匂 $<&$ 4!4% 0xs 04"400 1D 0NS6: 0 0N 00 0Q 000A 04!400 0 >0>00>0EL 000Nx ;!3B媝娝밇蔘 -LM@P  >Ph# --L\Mtp0@,0  0p0 04"4s0PdU 8&000, 0R(K 0$U$Q  0嫩P %000pP%0000(S(e10  @AQ  p < < < <  < < < H 5 R 5 R1  0004 R U0000x0 14 R 4 R TD#U  10UR \PKLK@l`K  0 HKK0Kk0K[0Kl@K\@KL@K XK  hKx0K0`(LK 0rxP 3 Ri~LK㴽T@ڴ000T8 8 8 8 0 8 @ ( ( @ ( @ ( ( ( ( T@1O#U0 0U R 00S 0)SCU00Us000T@x2 R1 Y0013000tK 000Pt @@@@1 (0}xPpU500 5<@K M0 ;0K< K0s S80  080 Q ucP 00\  0S 062 LP0  0pP000  001$>p= -L @`T p PZ R0d00 嶌0U0C@0P00 000 h裌=4 -L⌀\p`00S 0CP\P1@0 00\00S 0CP@T踋== 0-L,PP0 @000P0踋 p-L`0PPT 0@0Cs0S0d 00 0xTH@P 80S0C8000pwpn -Q pL0 0`1c  " 0 0Q  0q03R0S \%p000基@<%00C0R R00 ^  0"$#4T$U@13 *?0 $!$r R@T^.  0 4!4$ $s0r PeU ڲ 04"4s0U du 04"40s0 $#$  04"40ls0 $#$ T/ P  0$ $4,.4r qs0Qcڲ 04"4s \ P" R0<00 ~$#@U00C0X 0S00`` @T0` 0 #44  04"4s\ 0Q4"4s`0\u0010S p< P;0U0C0  @P100C0Uv 0 4"40 00P00 0000 01 00A W   0 RP !0S00<0 0 0 0000 0  00 0S0 0` 0 `0fp| ` r 04"40 04"4p04 40 aD ph00h0=4 -LP`00qk0S~ 1Dl2@T @T 0S 0S 0S 0S"04!40gs0 $#$r 0X4 41s0 $#$r RTE 됡B04"4Qx!`00`0m`PM P@q8<1  R:Q Pd00d0 000 `P`P@00@0P0 0$q!$ r 04"40ꀠ40@040 |0 0 L   jd00d0 00 0踋==:2 -L @R b000 R P 0@SX00X0 hy~@P 00 0P 0@SX00X00qW000 0WW0SL 0SI 2000t00t0!P000 04"4sW000ſ Q000Ź 0S  b8WPP#0S" p P 0 R(00(0 h#0&p00p0  @P000Ph0Q Q 0 R0PQ| $ | 04S(00(0b`= p-L`P 1@0T R*pQ  @00C@01 $@00C@0'pn 0-@ ML 0@ 0@ ͳPg Q!0eC1q \1@P*e4P4*0 R0S sPU 0!L144P:1P 1R!DPP+@)؝ !0!\!2 10: \   K0ht0tl0d埒4:NİV 8@"Tf SV 0Sk @!T$T;#T S0@ 0 T+F0 D 0!R񟗃CC|ClC\CCCCCCCCCCCCCCCCCCCCCCCLC*sP6 @,@ A@ P`PE`A P0 0 `0 p,   Mp@00 F4 ,00 04"4 0s0 $#$ (K 0 0  0  @,@ 9 -LM< Pp001 cX80 ȱ((K 804"4, s0P@4 0 W0 408`04"4:1s 0 :004  $#$r Q0Ա40:0ı0c4z0 $#$ 0 ᑴP 00< 0R $!$  <0 P0S> !x000x04H00H04 04"4s0S+@ᩱ`PI 1`80 @@S00!1(,01(  0 @100 0202, c7,p0 $#$<0 S  <0 PP 8x00x0岘D\ <00<0 00pW75 <00<0202+9 -L8Mɟ T , 1X H Q H KHP `P 001P0 0S 0St DK@` bXD K`  P\ 40  0R 80S0C80000 0 00(  \ q \ \ L >꼋 --LML2pPD2( U s PUG @0 l0llg@(igTy R 0S8 RS( R 0RX$  !0㚯@P l 10S@0  (K 0Q@@ (0PGx(P t0(0 PUX$ l 00S@0   (K 0-@ (0fP T(P P@Ӷ$K0R 0S 0 @004  B4 0 3@嶶꼋>ʚ; -L4`Pp 1#00ld^q1q@000V㴀ᶠ`( tf/|Q QU% 40307U  0107tf. (*4<&X؋(1@-͠    QOP7 1p 1Cs0 r r R Ӽ Ѱ s0S0crA!B r r R0Ӱ0= Q 0S01S0#@spq p0 R681ʀ\ ü&,0 0 20YBN|1S(  S < t0b? S /Q Q c|0@ P1/P0pP 20Sp P(0p S1*(0P!> -L,M@Y0S5 S Q/ C/(K<(0 ,0 H <0 : R  0 00PD0 ` ,T00 SupP 00S; 㜫1 7, < H 0` `0 (0 ბY0S S @ P 04 0 80 D <4!4"<0  <4.,4"<00  0$04"404 0 :8#40* 00S # <4!4"<0: " 20T0 (<4"4!<0P <4!4"<0Y R R,0@c< q04!4s00#400b-Y 0S|RI R,@0 a@r 04"4s0`#$ 0Y Rf R/$HQ<.@H   0Pb` @ @ |@ 0(P05<=0 @0> ?@4 0 8 G7^400q x0  0 Y Y \0P0x 0 0@ () *04 0 80 +,", nr 04"4 0!ᩑY }< 0S;0H P9> t=x= -@Q`RLMQp % 02K R RP VPU00U0SRF R R @00`eV00S RU 0BP U 00  < 4!4"<0  <4!4"<0 / 6S,t0 -LMpQ,0 G Q`<1\pn A-L@J 0\:@T 0c 0bS R@TLY0D L1M0L1  l B  00C 0褕 p-L@(`P'zppnX t0-L M\ \"0!B Q0 @( $0@|K>\X 0-PLP P 80S0C80@ R0hSem -L: 0R: @000 0R0000 H"!B 00C0S4 00C0H0@"!B  \X -LM@ܠ`Pp0( K@P  < 4!4"<S * :S0:,0@[P lp!qpnY -LM@ᘠ`P0( Kp@P 0 0bSl,0@YP dh!BpnY -pL|dAT `PV 0@S PB$U0d1*pn -LpP:: S 01 Q: 1@PU TX!  P`g? 0@1A': 0s0:AQ00Q000@ P 0?0R @ Qpn>Y>8r -LM(`0S Y0S S0L0X0@"2  ! 1L0弢LR"2HACp2 , QO"P]? 0@`"Ut1xA r@2 * ! BR0 0R000@Y !0@?0RRd1S0d!000da0开001,`Q0t1 DH!L!`L!0Q,!W? 0@ !P\1`A@ :X7 P@800# L u0|0V@ P W21C W 80\!@T \84XXHY>\pn>Y>>8r䕘 -LM@P qKD` ! 01 f ! 夌X.0S&   0, KPP> c a?0@X1A P N먀p0P0Pd @0 0@0d (Kg2"(0K!Q|1H0 0P ( 0 P  |xpPz X Q t M0 QZ 娀00e  *1Yl!0l l|S0SD0Dž p0P0P!= S@ `0`S$ 00s  t@P sd @0 0@0d !0@Pc !q0[ 0 "r0 00| 0 Q0\000:0:TP!X{ ᚥWY>X1 -L|`娒P@GP |! @D`t`x2 20S? S A !0S01S 1 g\P W 6?R2 RT  R; 0j Cx@ |1Sp06 0jC0@P10%Tt h1l1 S 1% A5g 1 R0! S 1 !g0 RV (>P p00j C PN.j2 2:20Sp pS:0S0 Q020Sp  p S:0S S:00j C>2>9x= -L|0W`@pP@T:DWp0 Q!P𨝘@I80 Q!h|PP𨝘1 -LMT` 0, K@#pP 0 0R & (K 0aS0BD 0a0bS㼹P 0@l l0<0 l0w0w0000S S,0S H000 0yPP 0 0 }P Pp :0D@D0t t 0S "2S1 `0t0 R!:t0=t0KPx T0X1P pbT!0hR0 0010P2 84!0,"?0RO000g:Sp: S 7 100! 00&?03OD R1 0cS!`S? 0@L1PA"AP ģ 0(@0 @ 墣Z 0@P_ |!0 80P00? H@l0 PJ 7 jpnY>> -L6| PS@p@T  0S 0 g0 + GtV(  @0S"1 0`V 0000 0U00 | R l0  HP Էt04t0嚭t04t0xj -LM`0 xuP P  00lSڽ 00lSpWP, $ 0! lPU0U40 P` 0O0@0@Ң 7tP0֠00e0     0/8 4 0 W ! 1QV P嬢 \00H000  tU p0 0lQ0P,@ P尀T㲁 ,00S,   0R (KQ0` 0R(Ko0 Y  0R; m0!0000Y 0a1 ]0P,@ P尀T㲁,  0@_8@ 4P @P@P0,0 p 0@_8@ 4P @P@Pp # Q00000  0Q xjY --LhMdx  0 x , p0 K 1 0#2S S7 , 0R(KZ 0R p *:W 0@`jTh` TPP P  2 )@1@0T1 T ( h0$@T 000'Z   t0KP t 0R:0p 0h#21S  S R0 000P`eUh` ` ` P ,  PP8 0 ,l$PH<4$4%$,,.̃0`` `@.#` @ PU U > 00"!^00 ^ 1P01<  FP @ "`h`h``h` 0   (0 'B  R 0S0s7 0S0S 0s- R  0S0S0S! 0S 9`` 0S ( P - 000  0O0@0@ jh`0`j 00 h` 0S T10cS`!0bSڰ   `1R 0R 0R6 S&02 ' =06 00 0 PU |0@  |1SF Sp: wh@@yp 0R0%p :W N ^  `` 0S   t9R    0  @ <4!4"<0  <4!4"<|0 PP 0` 0(0OP @ `VXDP|0VO R 0Sl:U Q @ P1  #  0Q 6 S4!ʼQ 0K0( 0 5PjP |Q 0HX!0 b0b S0| |0 fV  @1 la0dR ?S0 0,1(1 V V Vz Q T!R 00bS/0c\0^   QL0A" 1ǁ h0\  0O 0@ 0@0` 0 `` 0h `lh` 1\0lࠣ ̣ 1DZǡ0h` 6h`VS00c 0a0Z0Z000/  0S  0R   r 0S ၟt00t0`  00cS%10cS!^ V = P 0(HK㤅dK㡅\ \ 1P01|gO  h0@$80 ?0J70 S@ 00S1Q T1 0bS00dS&ڜ@OlK 1990l0 U @0 `V101 00cS10cS  t0K9P t 0R0%p P* ez t0@@@ th 0O 0@ 0@ @`` t0E0@ @KGKH@Kr0d@K@\K 4Kc@KhK0 P Q P (   0#  RK0A2@TJ HKdK 0hHKdK 0PP 3 pC 0DP, P=0H0KGK D d0KcKK0`0 &K@1 |` (PP T!00bS @R00^0S Q0 S ,P ( Y,>tY> HkJ@YPP1Y>Y>`YGXx`DkLYH?>>0kY>PO V 00lSJI00[|6 S@7A@ 1t0Vt 0 0bS000ѳ 0 8?0?It0`0`SS1R!P1Q!k81S !c' 10 1   h0@S0B0 ` @T2  P 6 Sʬ!00S !0h` 00 V ᘝ0? Q< Q+0AS6PDTy 0bS R 0bSQ0`Vh0S 0R H0^0t0 Ń Hᅅt2P3CH0 |1Sn S@h~ 3t 30SK gH pv=|3P3CHj`f@F 0 ( 0 &\ 000PD4DD BPQ 00cS h`h`c& Re0@S0S'  h0K t0tV6S 0 S.0lS[ڸ$6S$! 1S !10cS000Żl 0O0@ R0@ |0Sh8\  <10cSx5l 1SS 40^ A$1TAP1&#Q  !U | R l0  HP 0 ` Z0b@? 0t# 0p!0bSth1Zh0 0bS6 0CS񟗧X쫊 姂( 㣂@0 = Q p7@T 0R `#3R{ʸ p HKKdK 0`pp3i06\@ a00 f cgR0TT10\13t0t0006 #EJ PIXdp(p8wlx/|8w000(0(8?0PGt0`0`S  00C0P# @hr 9@dd ۙ  K0` 00 @h`  ` hi\!00bSTʠ`h0O 0@ 0@ w R R_0 BǁPX101DPK 0P9Fh`V)  0R H1 0c0cS000@3 0@jP `10cS 0\1Հ T!h R 9 00cS0lS" 1S:6S0 0R0 |0S8!R <1 0cSXkba0 `c0O0 @ U0@ | R l0  HP 0 S_✭t 0p!0bSth1 Vha 1R 40T,0?0^F= ? 0 t0ătot0t0St0@ 0SES1R!P1Q!s010 Rt = R  Y} 1z 0Sw 6t th0@@h0O| 0@ U `0@| | R l0  HP 0 ^0  ᔚt0ătt0t 00cS@ 00C0b0SH00@00.L10L1h`v0P0  0jh`嗯t 00t0 Q f .cx 0S P*4?tE@0\00  6t/0s06s0S ڰ' 10 1Ph 0RQ  0l aS0 R0000 @@h0O| 0@ U0@| | R l0  HP 0 &^t`3 R @ Y8 15 0S2 6/ t`0 @&0S |0S ,!S0b"S":(1h 0(1p ȗ st0ăt:t 20St n ᪙d2t E ,A(A0\000, ភ  IAcO0 GP!P  @$1D'8a0 !0\0< \` <$!0, 0cS 圀ŠD_Dt0Ńtt0ătңtt 0?0D0P3CDT 069 0P3CDf T 0  \0 <P0 ?0{D & >0k>8k -L --L0@00qQ/s0A1h1 !S0 Q xQx<0 / ED&r0 S0Һ6 QtB>Ԗ -LdMp|0t @0|0 t tbt` -400aS7!0! 1%|0 d ?t0t !0rRP1P!(-nPx |0 x^jjZ|@W| 0x0U1!Z``` |`` @0 \b0c3QZ\ / Z dP \:|0 t0|1S Si S .t t(K1Sd t0r0SH1Z:S0!0bS\ R Q;!0\` aV0b0bSTt 00aS  0Q ^ 040@ t U-|@x`xVP"P3 ! 13^jjZsUpOC40 @ V\ |d<l  tp  t  p   0SI p(Pr>pl 0JP  aZ0`0 00Ƀ SdZK r0 S Z RY0!0bS-) 0OiHD 0@ D H0L@ `P |ɟ00S; 11 L9 0 P004Z|0 0x 0 0 0|0x@ 0S|0 (l   t00t0З`P ȟ00S|H0 P000 0 xQ p 0`R}x0 P  @B t0 1R B Z40! <4!4"<0 p Q<4!4"<0, |\0#P7P\ 1Q!0X  a47\2 S 0S0X0 S"r 04"40 00cS0ՠ0 & S 1r 0 4"4 1202r R 40 1 0cS!= |0|0 ( |1S S S!04"40| 0xh0 |0q  | |@% 0H S;0 0@t t`V8l1hPl@0X 0@0t 00 0tR X@ 10cS0`!t``VA 0 S   4TX0l H ,0 $<,Q$$p@T0K.UT`K4,, 0 @p@ ,d00d0tdh00h0t0d t     U t0 t1 0cS 81!S3 <8!0000@M 0RI #0?0A40> AF:0@(0CPs00#$ 0h0 00||@|0H 0PPNt M0 p TKY|p 0 #10 " 0t0FAT| x0 PY7t 1 3A| F@0S0KT@K^T0K(K p04 40l "|@@t ' T#R1!@ <414"ᵕ 00bS`!\Al0p000l0p0$@`p` |  0OTP 0@ P T0X@7V t(P! t  RA0t0  t@2TAT6S ڠ0t``t ppppt0 p0@|t FYt@ >>9Yx= N薘$0k0R1\R!/0  Q/ p-LlM4Q4a0@ S - tPKX ܵ|> |< |1S' |8 |( K 0:0X!0\KphiXPT 00|, x| s E\,[,kYJ p-LD@P`P00T00Sp40phO -LD@PpTPg 40 X0 600h.0W0mvP7S @0-M@L0  @ @K\ȽHk -L,M0p\@, ` , 0R(K0S PܒPQ 0@SŸ5P: PŸ0 P- U V)  0 !@ @L p Pm @0@S D^ <  ,$!$0,0cS10cS 01 RV  0 !@ @uPH DY <,$!$0$L0cS10cS`Fl 04"4s0SD0 ~* nh1DQ2*t05t0 p10dSnpA0^/t1000 00cC0 R] 3PAP @PW<@Kz P`HkĊx=JXȽ -L(M@PpQ` (K0S0SJ UU 0ES៕LU UG 1 R VA 0S a  0R:<Ky  <0KՒ[#[`0pZUF P3 @08S D^ <  ,$!$0,0cS10cS09 0S0S s娐 0pP l0Sl0 R L03PAP @P < K0P#{HĊ\HkX -LD@@6S SX06m1ኝh腝6S(0 R3QAQ@QN 0-P@LT0 Q00000  ے@d@T0xj p-LP8`@$.d 000ppn\Y p-@|PL@`t0xP t06t0 @>D@ݧp0t0= p-L6| @SP@`X 000<Uu@0 Rph06 00 0YN -LHdPPpL 81p@@P0.@7 < a@@ <T  <0 0R  t 0|020s Q?B!r &r RڀR0ü6l0 $1 1h!l!l  00|1|1 <0<0  w x DP\>Պ4KŊ>>?|Gt= -L8MPP@, P0 T X \0  |0|HD H @ 0`0lQ@ >PP D 0Rx$ D0SL T0L@  `0  PLP X0L p` 0 L 0 0 0TPP0 0,PPLs<4 4T$,$P ,%< `X  0Q!1@P3U"R r 04"40| 0(0D Ru R$ <, 0R(KT(p ( wP <@Kw` 0 , (>Hk29|`d d0S=0T 0S00D 0S=00S/( (0?0c0/Dk0k4k@kgfff p-LD`<0<@8k p-@LPt0`6 S h0P \ 400aSp0 0P0 ?0 ;pn8k>4k -L M@4k -@LQt00  ,00,0=`0 Qp 0r0I0r0p0p 40`P *vT ~01C1S01P:000<00gpnYB>@k$? p-@L8Pt0`0t0ppn -L4M\`0Ts,0 t! |^ p!0 RJ70cS60s06s0 S2 &$  $ Q<q , 0R(K茂-(00(02 0!lB! R 1s06s0SƱS0ü60"0?092 R# |@T 6SQ@0 R DP 40 X0 |1S (MPP X0T KQʰ0 GP! P 8QV AP00$!@10@1m |-0100^/P[ $Kt!5t0%KPK(0XK@0 <@Kfjt|0 <0K; K(0h80 d (0 ]@(>0X0,pnYNB>x=zȽHk$K 0-LP@@@79T0 p-L|0@@P`ןP 0`VpGPDvph譟P0 Q`(!10bQ0 0`V`!,?0?1 0-L|0@@P妟P h0GD I0S00h}00 \ 0! `\!(?1 -LMĢp`W, P P0SR@ Q㖟K"! * @P 0S:QR K /#@PW2[S S+ @, 0Ra(K 1W2[S\ J S  KPP <KL0K6W! X DP @0 5 <K 0 P VKLK0@P @\(1X% @ 0  0X0 T0 \0/ F@ 1T0 @ 1X0  KPP T1\= W[0Q00 Q KP%P0HLK茿XxjE -L6@S000$$ߊ06T 6S|0@6 SD DP0 ?070606q@8k 0-L6| PS@@ڲ0 Q e @P =00hQ0ht -L0PS 0S@` ᶟ`P`P p|P@7`000@00P@P@`8`P fl0 00|1|1(?,?Hk -LM`ᨂ@pP0S V;0P7 Ë6@U 0 R R/@ 0?@  00@VDP V@0W`1 W? W V *@ፋ6@㷌0W 0@ W8 W *@t0 0@0V7 0S0P@t0t000@t0t0V& 0S0 Rڰ7R@Ӱ'@V 0S0 R t0@4t0t0 4@0 7@0@t0 &4t0R@E@pn Q-LM@`p \ 0S T P(K 0 Q  0(Koظ 0 0y03X0S 3%SPPT X X֊ 0(KoY4 ,  DPU% 4P , X񟗭0P4l,0l0L P40S 004,  0r4 k4iP4 0 P-P0S S 44 Px 0X$4:0* #<$40800 & $ 0 ?054$400010Pl0L nPQl0<  PU40P 0 `0aR  rv37PH0S0@Z 0 W4L1S#Pw 0 04 M10L1P0#L1jeY8Pe PPa0 0Sx  0D040 Vl0 3  PM00T042P⦞4P>0W 4P745GP4 1 4{ P4 P/ P)P$ ᜿P  P ݾPu40 0 0r 44 0r0P R 0S0S0S 0S R 0S0s Q .PP PU  ڿP:P 0S  PQ ǿPP P ᡿7Ppn1Y>l Q0-L M@P K00S S *0 `@Pw!^D 40PK0hO $ 0PK0hF ?dke p-L`$P@ ppn --LMP0,0 @l0  pvX*Yf (08 S0 8` Z (K(`1 4 Q`PQ `P7`9 @ -o q0 4!408 x (0#4 4!#00! !xq  RH 202,00,0(@000:  P`A`Y 0080޾4<0(0S9` 4 4  dpn?dkx Q-Lp@` 0v03Q0S3Q~( P l0   0 o_ 0 o?ꔝ)`Y OZ K`l0L D`-`l0   0ok`VR2Ÿ @`P`P l0L| 0`L2l0 Pi  `29`-`scl0 E 0S 0S$0S(0S( 8`l0  0S  0S$0S(0S9` d1l0<,\80@,10`00mQ@`V_ឝ\(0SP@ ` `ᴼ`Ac`< 0ool0 ,0,0  w x )pn??k̀|Gt= Q-LM 0S K0S0S P0@ SAP T \ 0 ! HP觻0P @0S   04>k -LpM8@Q, p PU , 0R(K`VX0HSp kXg X 2 R W 0 S| 0x0 t | H KHK ImGPKH`K@0K0 P|[ HK00  P(p Yi |xP 0R:l@K'md`K0 |x7@\PKm0 c0KdKw|. 0L  PXK [tP&[pHK0P P0p pHPKHKP @PKP  @KHK0j P| t m @KHK0Z P _6HK@Kp  xp tPpHK h0\ PF[@K&[0,UP5,HkPK\ -@@0L@א@hҐ --L‪tMp0t*00`0 ,0 l h 0@#2S S4 2hP ., 0R(K0G0K 0S (:X 0S000 V04"4s0sP 0 dR' U00U0S 0000G0K 0S ` * p0K2P p 0R0% * _abKY00 0S 0S0s 0S R  0Y0 0G0[S0  SH@Kl0P HPKG0K0d@K4KK k0 dPKc0K06K? Y 0S V 0S ( PY (@ 0@yPU @0 R0Yh0 l `70S@0   h K'V l (70S@0   hK 00Y l0  h0Sh@K @0S@ )0㦗V l0  h0Sh@K @0S! 0㓗C@HK h0@P& 00 00002_  (0V0(0   0l0SO 0000S? 0s<Y S00d00dSP$U!X5PU  l0  ?@(?T PUq @0 Yl0 #0RY ,0S00S40S80S0S 0S$0S(0S R@ `$0@P9 Y 0l 440S@0   h K&V 0l 30S@0   hK 0b囂 HKh0@ ◚PᅄhP 00 00h0 @0  P QQ Y 0l (30S@0   h K&V 0l 20S@0    hK0X HKh0@ TP 0@ǎx]4@HKjH@KGK dK$K 0D0 }j0d@Kc0KK0`0 , UjP6T000 JjP+#0R'QY  0@华(@ 0l@\Pr> $0Y0"!$00- ( ,葶PUc000! 000Y' 0 "8 R 0R( R 0R0@LF( pPP Ghhh h0|_K00  0  ~xdk,@kʚ;`K`gx -LF0D?kQ-@P P*R 000P 0<k? -LMP)0Kp @Ă)0[ !#R)K R W (0/0(0 (K%aVT l5,  , D001S %1S ,5,  , 40701S1S1S ,1S Q ( -Ph$700001S41S81S 0SK S} 0SA S00S S000(1S 1S  P @00@0s  #04!40庐(1 0 ! j0 4 40)[Z Z Ƃ\#/(00(0n00S 00S0 0 0``000Ÿ(0CIs0 # 0p @@jB 0e)@[T T` ፂx"/(00(05 00S S{) +0K݁@0+ K*K*0KZ*[ 048( <"4!<0#,##8 0000 1S S0 R0 0(0C@0@0@0 R00C@  00C@0@0@ 1 00K(㌁00,<4) #:+0K 0(0C@   00Kt00,<4) #:+0K 嶐0+ K*K*0K*0[0 +0K]0  W0049C40kt= -LM|4 8 +0K `>+ ["2S S (00(0Ё(K( 0P "2S S <] 0P†`P + ["2S04 * K0S000姁 0 48<,<4#:4*0K0SY )Y( 0S:Y )Y p 0S 653 R1 (7<3PU0 )PU& D10 R@T@T W 0S 0R Z 0S gP$00$0Iw040`O0@Y0@ )YuPB8 R LP  0r@ D0R@  10t0Sa@`10`@  @ [@2@P `ᗟ0Sw v 1 q*K 04 8<< 4) K#:)0KP> 0 p$(,:0 ###̠ ) [*!4"<0##$#8 0Hp*K 0)0K P  )0[R 0 0Q0ẅ`P&000 00 0娀FhP|@dH00H0嗀 0 0 0000 @@冧}kė?47pnBBd0 -LQ1  0 ($ 00 0f ?k -`0-LM R1   00  0 _ K 00 0D?kG-0P` 0 8<0#40 0  (, "$ 0 8<0#DVM @' s`FP0$$$Ġ0 A 0# !0# 0#$0# 0# # ,` (V@  Ѝ0 8<0#40 0(, "ĂV-00r`F0 0! #0 P0 ,,0 ,ĠA 0# !0# $0#0#0# #  `" V0  0 8<0#40 0(, " V$$q00 14!0#  0#(0# 0# # , 0 0!!(!Ġ0 P  0A  1 ! 4 (  0 .,00!8`0!$S!L  [lslo -L\M@\0 2 00 0 0 0 L0 0 ^ 0 @0P8 , 0 @#\4@ ?0@0c80 X1" 0@ D <0 08T#8^H L0 !\0!pT..l<, 8 D[#4@ <8 -K2KL[T30K801PK CP4K .KP /K0pKP4K  {U'DP  0#<0 "( 0#40  Q X], 0R(K',?s08 @-@ 0@$ $0 0 00 /É#EgvT2ܺ @ -LaM 0lK,0 ]l0hc$c<( !@ pd$ aPnn!  |?ga jj|`0tPϟ|p0 & "p h =iieQ0.t.&|c͌p 0p 0#  0\X`(jj lq- fP0X PaĠ0a0T*d=-L@ H!  d\dL P D-L@il (@ DbaDpXQ  8a cQi<=唐 ,%0  08 L@@gĠ*gl0,nq=d8 l< `@ !' iiL 8@ ,@jj\ -` cabQ8&H @M|Q %HQ<,840iĠ i 0 |q0d =jĠ@ j@ 0@$ !@cQ` -h 0%h $,$aH @,|0 0#0bq 0# +1 0 O A  A0'na $hAʟ. ! P!0&`A-0.Q0#0_dQ  Q1$ d#d1bQ1͌ !  q0p' q  dqH1 #1 *0% 1   a0 `&a a. o` ` lq)Xa@,`.0'0 0#pɟ0@ 0-*a@.o!1 ` aP$0&$0`0 bA (Xq`"_0$Q `&0#a p a(1͌`Q &p ` p&a0% 0#1 d1oTa la!T1 0&@p 0#,-,pnAT0, 'HqP,p.0$0#1 P0 bǟ #P1 a P"P%Q p `p0.`Q0#''p `   HAp&a0%0#oa 1 `0͌aAH#1a 0$Dq `! 0#-lq `&D1 ' q0.o ` 0#DabQT!)Ɵp )"d!` 0%0#*`A&p* ` x&tꯠ韠p&`堀 0$͌0# adQ &`!,&` 0.lQq 0#p- &0%菠@`,` 0#p&aş`1 bA  &`"p &Dq`0$`a0#'qp%0 p 菠ᜀ 0& P 0#͌aq (0T$!0'_P 0#-lQ@ 0吀 )O0% @ 0#0`,尀bA *Tqo a "na $,t4  "& p0!菠P 0ਁP" aq (. Q0`!!ğP"! '`Q=!.菠ጀ ͌c@ 0#1  P1  !a1O@ DA`0  x@#0 1 0`!0q&a-l! ba 3O !  0p!0!Q01 D1 P'@ %pP0B @ P'q@=@n P%@ cqM%@Q0X" 1 0 菠! 1 $R0 @ #P0`1P!-,dAP1 !韠Pba],  0菠  )t t0 ଠ0., *`  . .p? 0?Spp0L`@  goW@@pb W ?0YP@p ?0Y@P 0 -L MP0p0K`(0   ! b62 R1<0Q0^ ~?@ Q R W 1  !1PV( 0R$K *!,藘ssG-!' ([?P`p  Wq Y@AB p Cp@SQ?p0)*0! "<P`0#@$1Ap0)@*j耡U?訁嬑j|0@ 1AN0‡0[_`ZStQxaYW_`TXQO/ O!Q/ !1S?1AWO0AQY_`Qa[oaq`!1Qaaq圁堑夡!p|  ⼡PqL*w8p *i 帑唠$ 8aP_ Ɋ帡夐P`#ό弑$P(`**iYቛV dž儐ࠍPaQᬑɠP _)nƌἑ娡婔*ሐ †XP`ؐ P% `&P`P` P% `&P`n_`謡3P`tPx`a<&Πr_`C!p$P`"#P` А)*Ȑ̠t0#@$|0@>  lpAQ$AT@0aR)*cLP尐崠H`nf_`> P `j 0 @ \0`@b? 0 @0@00 |0#@$0@\0 p l! ")* b_`AdhL TP`CD@ P% `&0訐 0 @0 @d0)Dp*@&0%8ap. @0 0఑崡!110~PSq́fnb_`j/ ,1,A 0 P`p<@( 4 800,08  0. j? bP`p < 0< @0n?4 48 f/ ,0,00@ 0@,1,!8<P `p<0,Q 0$@4`,(`,p,,04vߍt -pRLP`@D1>0A cWP2016:P VS@1@ T@D > `phW@;@ RpG@D  Q*H0 0@H0L@W`WP #S@1 0S@DR𭝘H0 0@H0L@SH0 0@H0L@ -RLM @D1>?0A @c YP20 1):Pp , R,@P`1@P`@PD` l?Y {@<@ @I?Y@D @Y P R@1@ @D 0-PPL00@ RPR@0@0D@H0L@0s -LM< < @D @ H0R8 4 b4 8 8Kp1A ` P 80KС̑ @ 0!D#L"$4d't%l|(0 , @T0K0plqd`Q\a `P00K!h@0H)#H 8%hXp"(* 0D @@< @pDH0L@# < 0pPP0P<0PP <~+R<`@H0 0@(KoPPp`R<@pPPR0P0< `PP R 0-L@MP4 8 00 ,@ 2 V8@0@P`0 , 0K言p 00K$!,0@#4<$DtPh` @  0 !H#H"(`4@8P0^``8(KoRQ 0-L@MP4 8 00 ,@ 2 8@0@P`0 , 0K言p 00K$!,0@#4<$DtPh` @  0 !H#H"(`4@8P@^``8(Ko Q 0-PPL00@ pQPjQ@0@0D@H0L@0v P-L M( pV @0D A1aQp @0!D#L"$pQla4h0@\q @0!H#H"(`@@8PA0@ D0.0 D@? A,@ @PD`*  08PP0+?PP@- 8PQ@0 0@ 0c8( 4<"$$ (@  Q $KkPPP8P0P0PP8`PP@@`P 0-PPL0( PP@P@0@0D@0w -L` 0   RpP @0 Prp00@ Up000@-pS`P@0 0s0s0 r   00 p0000  " @Tp@-`RPp@0 0s0s0 r   00 p0000  @Tp0@-PQ0@ PUr r0 0s00 0@ 0 0p@-`RPp 0!0S@0  "@  80#440# @># b1#  0^ p  0-@PLX 0#40 "( 00  0#40 "( 000w0 -84 0<00 0( $ ,  O - @LzP02  -LMP4PK0`p$0 P n4[  Z R0300%0[0%0K–\@ 4[  X R0300%0[0%0K 0Q1 0Q11 P0#1@1!@T0#1 z! O$ 0R2 K1 P0#1  R0300%0[x 0s00#%0K  R0300%0[x 0s00#%0K,w -pLP`@~Vz_1 P0#1`F V@  ၉b0`R1!~ w20VS  2𭝘1!P0#1z_ `h@ -LDM⬀`0dPK$0 p@N!N@0\0#0@@T n^N$ 0R K,w @R-LDM؀@0P$0 `(p L 01dPK@N!N@060#0@@T %N$ 0R KpNAY, x -LDM⬀`0dPK$0 p@wN\ vN@0\0#0@@TK  M$ 0R K&, x} @R-LDM؀@0P$0 `(%\p k00dPK@6N 5N@060#0@@T  QM$ 0R K\pN@,0x -LDM⬀`0dPK$0 p@NX N@0\0#0@@T , (eyM$ 0R K,@x @R-LDM؀@0P$0 `(yXp B00dPK@M M@060#0@@T^ ?M$ 0R KXpM@s,Px -LDMBl0 l`0h Q@` 4K,0  l@D0E@L H P@ T l R L0KX d0 `@ P@\@ 4K DKՇdK\`dP[$0@XLd0Kp @0L#D<P`d0K<K@0D#L4pd0K 0@#4<$Dd0K,0@#<4$LP`d0K(@$$4@pd0K@DK$<@P`0!@"\ D0 @@ 僇hDKD KDK 4K{<K \wd0K 0@\Pd0 `@ X@PE@TX@ \P l`0FLPK`@PU`P`LP H` T``FvT` tDKL 4K0L$, 0PR(K,ox`x -L4MX \0  X0H T !H6< \2H@P L <@ D @ D@XT @0 0HS< D @0 8KEL(K\ 8K< 0KT8K8 KIPKP[\0@$LP0K`X@0Lp#D<P`P0K @0D#L4pP0K 0@#4<$DP0K,0@#<4$LP`P0K(\@$$4@pP0K@8K$<@P`0!@"8K 80 4@ 帆0K <崆PK0@ D0P L < 0 < D0 |ox! !0p@-r `Pr .`@ 0" 0 @ . .0 0  .pxx 0-L0 10P  + 0@,00@0* -LM Y300 R.* 0 01,  s@#X`p  0$0#s@ `V  %ppP ,0 $p ,0S* * 4-L@K뤥h -LM,  9/0P`,0S,@p,Q@T@a0 9/p0 P`(K0S,pτ@,0S@S0 9/@p0P` G-MP$`Q0l0h 0Q0 1>0   @$T  p00 Rpp 1Tx?>   c0 i  0S0W d@JT 00` 1^Q?>   c0p@ C  0`0CW^ Bb 0  R 01Q0110`1X100a1 $Œ\ !  0S 02S\0 P3Ѝ1>0   q  R 0101 -L$MH L  p ?`0OO^P`1>PL 00B"aeQH LL08`0?pH>   c 0㠢2!s0{KPL0` l2RH LL8`0? !> c 00POP>p@` Q 804 \0 0S. 04  0 S ^,@ 0O QD  RH  06>|)? ?(KLH,0p S0QK 0H 0 >?U @yy(@엘 -LXMpL@ 5 RD @ 4 `0040 0@@DP(0PpǏtP DPt8@ ?@d_ɅD< 8 <@`8P a4!, QU1U.Q4P1D 80@Q< 8 @ D0DP @ ?  <@. _@P @ P8 Q @< ( D@<8`04 cQ PQC` 0@0 d3R D2@, 0PŜ00 P0 0^= 0/D 0O L0 H@ 0"DPL K @_`p 0P* ᖄ@_ p@ lP ĄDL K `F,PDppP l0 .?଄P00C0@2 RT@T0,0!00C0D@00@P <K 0(KD ɯ 0t 兄@ `P D0O  d  %h D0h@| x d < /X T  ?@0XK0@x `0 \@  x |K 0O R" /d@ hP9,`pK@popD @0@P%0 X 00 , 0 P CQ/d0 hP9,XpK@<PU T -LM0 @00_Bd @P R b04Q RPQB K _@P  <L 0S 3SK  U -L M, 4 0 0S}Po0@0<44SP`  t-= 0d3<`&=84S 4K?ể, PP, 4K?00L SP`$ T0YP3p0Z/`0 1>0@ 0R!pP`\WWPwP3ᢅ(K \0`R a`05!p, QV1V.Q PpP3PL0S@3C " B " 0S<*U  -L\M` p0S]`/0@0T8Z0LOPo P` 0OVʶ <4 S?ἂ0 @ `40 P8 4(LP 0S>6p\<@<`0?0 0P@`WPo<4$  $ 4 DL0@4 D d6 HP/<`0 800c@ QD0P 0;<@ 6`  QX"<<@_ `00bP"008(Ko=UF`  0s:f;v `@ 0tj:lş0p `*;(K< <@$80`$8D TLÙ@TP D T  n < 0S1P1@\?\0 0 010 0@ 00L40 00 ^$00C00 ,0 08  [W1> 00@ 0000?L000 #40 000800 *89*U \< -L(MD H A`PP0S(KDH P0 L @ $Řh0 R 0S0S\0CQ B0S P30呁02SQ0ɯ 0< 8 cH ɯ P 80<H pQ7'<0 ɯO/`< K `0@@ c Sl`0QQQ /@O^ P `1p> P4 AO>@ ,@ P L PPK` P`PU`0% 0S 04  \0 p,0  ,0@0S,0 H1@0P@_@PP`@@1 R @`0?,P4 @\H ,0`@0` k|HP% dVp 0@_D0 0T d 8 Q800cOWoU80pV0ۂ  8 8*U ̚ -L0ML `H T P0 L3P0 R00S  L lPD L\U #000S T08UZO 04 R40 p F0SFpW\ T K D@ < 8 Z?~ `p0 , 0 K 1> 0`# 8p^ 2Rψ0K0O` 0@1 >00SC 0@ <0 TZ p T K pQ8 4 }Z8PK` 1ψR` 1> 0 #0P @` ^$ Po j$ 4 DHL0S@4 D  j 40Z0C40  j! 4004008@K0L DB@@ 0A R!4E @ < S@ < @K(K80, bYm \^ 1/X`0 0O0@1>0 R!00 \ c! 400C40 i! 40040T0@Tà Y3 1>0 10  $0@0C$0 $0L80  $ 00C \ 0  0 R 0O0` @1 >004߀00 c! 400C400 a! 400C40*U S-L,M@L0 00T00S`H D  zLpW@ H  R\ \PLzPG 0: S t0D 0 ?Sʰ LQ ?HKg|@0,Py ?p\|UL20 Rࠡ02 0 P^W L#0Sࠣ0 PW(KL @10P80 0: SvD0S0X0S<0 @p0O0 , 0, |Tp P p0''<@P O ȟ P T0K/<Y8 4 l` @ ,0O0 |"X^8W[80< 0@ 0 0w t0D 0 ? SʐHR0T R80H RK< @ 0,,@0 0 w@ 0@p 0 0 l 10P0 5y3< 0 .,0 0 VX  045`욘3 -LM ,  @_ 0s{ 08 m{4  ?n40 0a{, `p x84@8 0 @ ,P\ 0T AB4CQLUPB!A0 00, S000 ĘT@!V4 < 尤x<0PQ`004xP`1`#Z ,xV`!@V`YL#20T 0U00 RH3 VHY@0SJL#20T 0U 00 RH3 Vt\AZ@0YLØ2 08@ T@!@`02 08 \YYPL20 80S@@2 08` BVPZ,(K004`Px~Ҙ,@,x, TPL#2, P\08`V04`V PT PL#^08@T04`V P P  -LMP0p40 00 `@$4 P @ 03!3p(K XO ,0P>* 00 ,0 w X= H#0S0C0h0 K P 4 L0 0pP+0匠0Q5h@T'dp@l0S 0l0@l0S4l@l00S0l0 00 ,0 H#0S00~ _0 DPa20hp0 0$Y2 L3 xy얋`(H -LM 00 $5Sm  @ @ 0T`t  !0|@d0 l4@ P\S,SQ00P ` VP 0Kt0  S; 2@0Dd^|80 |0 / S@ O0  pc8@ `S_YQY 0xy V0  |@4\\gyX1 (Kx0S K 0^ 0Pt @`Rx0S0S Q @_@|0 PS _ l2Y4KKx0KPK0@0@8KPo 0KP4 R @K00(00 0Kg80S`2 "K00S*40S2(K 0` `0CR 0K00 n HP P @0(0Ss ,zp0S22 avß ?<   ^V1ЀK 0^@ d|0 @`>@ PPS SQ00P @0d ` b|0 R!,#Q 4 d03|0, @<0Tx`@`,H 40<40,L :,00P4K40S{<0^Y @,H 40<40, 0L:`,00\0R 04.0/<0SDO@$ .0 Sv 4S P004SPzGPE84S\X/T@0bRD4K_ Fx8@0` .T/4SW:T@/</؜xy0DȞԝ,P M-LM0@0 0R`]`/0@0X0s @Tg 0S < D?`@tÙ n^c&8Q0` ^d tN0 \Q@d 0Pu@TPU\ 0 4pǏ,0  0L `P<4@S+&  ?s @H ,Q@P<ڜ0,h h 0(K 0..84 S  ?u#3 P 0@ x0.h;.`TP  0 .Ȟl$xy0D -LM P@8%0  X= Rh10  P 4R00 0a QUUQY00 @0@@ P  b PR0b1rl1eQWWY;0YSڜpK4K 0P 4Q A0! 4 X`V 0  LK0  ` 00,KU|P ,0@L 4 !T@_N R  LET2S85@%0L00@T  T R ( 0@<0K @000@ 0 @_0PIP P0@ c# 0S4!#Q P030 @!<0  \(000  MxX,xpup @0a0C @3/  V0 X 10( R" 0P 0 @ 00@ @ bb R3a@`QVRpl ^A 00 {P O uK00P @ @ bb R3a `Q\RH:D 0`( 0<0K 0 @@@_0PiP % P @00 @@ z 00V@`d 80< b201 R2Q0<0d 2|0!<0 (0000S*@5L 0` U 85@@0L 0P@T \ 00 zP  0@@,8uL@KTQs 0 0d0T@# *00P@/00\@^00 T 0  E@0 @I<0K0 0 0O0 @ 0@P <@K0KL@ 00iy, d0 c# 0S4!#Q d03|0, L@6,0D,wP H K !X X@@0 00vP VS( 00@ @P 0@<0K0 @_0PP / 2 0@L6 @0D@$D/00h00dh0@   m  {tVb2(KP,K00tEyPZ, l0L !: ,vK`t P  000K y@P9 000+00 x0 d0 c# 0S4!#Q d03|0 L@K0` 0g`HK ,:v,7v s00L@6600D0t@ Y+ V+<̞螘-  M-LdMh p l h0P  ` H `0@t 0H@ Hp0SH \H@  ?qP L `ph0@0 pKDD@ Txd 40}$$h000(80d 0 @(, 80<@4 @<0)Q4 d0| Adr@Pd L|8 `0 0嶽`pd@\ L0 pPt0Q 8100`0t RL0$ @du< \p8p p0K`0 @tX0 T@ H0`@XpK/OpWXp T LR  @ 0Q  ã?  8 AT\ Ry 9p@<@(KP Q81H0@ ?@@ 4 00 Q0 p ?Wx t0 `@tpxd0,K cS S8RCQQpA0hXK P@<,0@ P< `@xKh00@pDp@p XK4pK`F0OLX T TJʓP Sq < \ Jldq@<@ e P L drp Pd@40;40r`0_Hpd  l\ \4^ ?XQLp, KH0 PXKh@<,0@ P< W)<;H R-LgM ! `P.00AQS.!@0T% Q(L0( ?S; Qh0Saq (40@ 0 @ 0  P(K1UP PPiK 0@DP<0@@,00@408@!Rl h rn iK85 0|1 0iK 0iKP P 0O`0@0@3r b RTQT2 1 g/K  0! 1 0KT1 H D t T@_P`POp@P <` PU`Ġx 8P 4` 1!H@KX0 ORp0t@AqN 0@`^ p1TQ(0a OQ0(01S45AS0:+ iK0p``@,0K0 p` 0PPP0iK  Y tj ,s0 00 P905QS*P3iK0pp@,0K P@00 0PP 0d0 " A `iPP@ 0 A#O 1#  )1 ?p 0 P% JA`-8pP P P 00 /1>0 A! `gPP@0A#O 1"1?0P HA`p-8PP`# P P 0 r3p/1>0 AR! "@e00 @0A#O 1#"1?0 @0 P`% !-L M|`@00` ,p `$00KPp0OV V 40P  (0KڨP 0( P `V$K@0S | R$ 4O0@, T|ӎ|@0 0@`@Pd@P00K< @P#,$0 SQ2蟘, -LM 80 4 P0 l1\ \RXlX^QVp00 < #4 0 004,K 000rPP8 ,0R@4,,85L 0 80 (K,@m 00 @@<,^3 . R Q485@ 0L 0 U///// -L[$@\%P0R /0 R40Rh0 S8P0!R/Tc@C-0 LS03Q% 5p00P5,5MS ڬ4S9Ӭ4հ4S@0Ӱ4Ѝ0t0O/Rs QE.1EPo,`SH@P ``P`P`,L` `0` `@0/@P@ PP`O@D%0U4e85X< 8P 0` 4 @( X0<0 8P 0` 4 < K <@$0#= ,K ,0P@S ե 0A 0P@x@ =S P@(K C 6!  p-L00@SP 0h0S  +`P p0    Pܤ܍p -LM, `20\%R64d 00  8@c_Úd t(`p`p<@D_@,~g`Vp ` p, , 0C@$0(@[`4P8`,P0`哅 T -L$0P p`  }@P`@0 S` V@ j@P   0 0劣 @] -LM`b$0p "PUMT500#0=PP00U00S@ $KPH @x0 @ݤ 0@@s 0 Q喢P儋L$0`B:$0 R-L x 0F S,0 x tp x0@0 ]PZ ^@pt(0 cS S9RCQQ @P0(KX 0 ((0@0/S8P0@R pP0 ,0 0Q00QRW L ,0 0QP @p0p@$ 0 Sʐ U- P ``p pW V   Rڜ@! (0,(0P  | 0 S\ 0d1!0 ,倀K((0Sက | w|@ `PpQm 0^@ h t;<, -L M P0  000S Pt K`0` -00P P 0 S0SPmLmQ/ 0R 00/ -PhpL `@B0 0Q   R 0S0S (P0PPmLm0 -Lh||`@p0 0PP 0S0SP PP<PmLm(0 - L0 0PmLml0 0-L PR 80S @|i 0P }0 ~3X \1-LM PRp@ 80S" R 0S` XP 0S0S `0 0d~L $0P 00 00( ᰀ000`  {3t -L@MH 0L YDDpKP`1hAL,K 0 @`P+,0S(\% P 0L (Q  R0.SR 0.SH0P 0@P`Y X0P(KX< -L8M0P( @> P@; (p0@ K\09@Pha0 `p徙@P (L0( R-0[.0[S!"[0R4 0R R ~( 4(0KL@ @P ( T (Q ~$K@(@<.. -LL0(\;; 0P 0LS L tPUc 0 00h X0 `  'P p';;H 8 喓06D 048  ጓ 00K& L@ @PHQ U@ 000jU> < 0PD  ;;StP@0dt00S L0 00KPD 0 o <\k p0\h 00 p\c z D d2@P0 04 0S*0"L (0S0000000@0 @   <  0姑PD 0S D  L0 00KPD @@H00 S 0;0 8 D060 8 㥓P'0D@ 60 v@00H0@@S H8 ؒ060x u@Ps8  ん@P060K 04zD@ fxP `dL 0R L td;;Sd@PPD 0et t0Ad=t///////-//// -LM0K@P00 p-LM`0KP @P0000 Ry@F@pl 0R, -L0S004 0-L`PT @rP 0 40 000D d0Q  0S/ 000//E/00CSGhFFF|FFFEEFE$FF@FFEFETFFFE 00 /L04 / ;0L00  @00 :0 800 00 00 1s s s /40<0@00 /0<0 0<0 BBB@ R00/ 0S00  /0-@Q@00 08@0@TP0 @$P @0/00 000! 001@Q@- 0@ 0$@/!00100000@Q 0 S /1 91/ -LEM`p0 ,0 P@  Y00 N?KP c x, 0Ro(K81 `t0t 0p0P3  P-000x1*P"810  0 :0P"MOK i 8 0P0 4 fx810 0 8Xx Vx Px 0008!08Ext LP oP 0;0$ ,L>2| -L MpP`0 0"&1S00:S),0 (?z@P 0 00, 0yP*y@0(KS40040C\0(@ \0`@ (0\` PKS,2H4 0-L MP @0d0iK00   ʜ0   0   ٙ0   p-LM`@ "8"$8r #4~  0Tx L@0t0p 0o 00S $j KpϛꤤȤ줘$+ -LMP`00匀0CSH|t0S q$ px0 H ,0 Kx0S@|0@pP|0s0s@L|DprlPp@U408p;40,P@U pn0hE0 h0 h -0L (0Q Sh0S d(  -LVM  , L`p(V| P0KKU@, 0R(K [KUPd Xd2@SKl HQ  \Q hA XA q [Kx 0xL #\1Pcx1F/t QKtxa\f0 SI* RY0 SApa 50|Q@pQ <@0 @ 0  8苜<1UK LbN0 P <<|PMOK  I<8 0cP ׊ 8108,L>HB0B8|, -LMP`0p,0  8 00S L L0R w!t, 0R(Kjt~V  TPB@L1 R7d 810S PV  ㆌ000  0 00P   B 00C0    c _M/KM/K0P ,D|@L> -LOM`P 8 0< ,0 0 p  0 p ^L L0R @81W s8P s ׋ u<uʟ, 0R(K\ L0R9 d0St9 d0Sm ^m  ᦌ@P<9` T! Rd T90S}`D)0d Rv0: SHA DA   Ή8PT!L P 000 T T0 00@P] < ᰋP^ PsL!s tH1 ST000<RPT  B 00C0    <rytk@a0P@] Ar8r<zt00 0 0^ 00 OK e@PY jt  <坊@Q`; ]@7 X@20 < @<LLD0Pe HQS  R\ @1 X! TP1S 8rVnTL p@P0 x NK d@P|$t8PL M P P^H PL 0RT0Rk B< t 0㕉8!P00R00S P0S `TP 0 0 0`!T 0D! H 0HQX \ @ 0 .R <ъ@LT 0RX!R L14 R@L000  0 00@P L  B 00C0   T!P0S L 0 |P 0: Sp \Q@T1H 0#6 PLd@P\!R' @1SL  B P00C0  B 000P 0@P8 P @P@P Sq8 L8 q00 0 0. OK c@P 0 000ɯZp%? /@P000.p唐`W`Y00S4 0j0|0\ < 00S Vi< 0S p@ L000KP~L`V pW8 py060D0000 l Dp Lf@TZ 0!RV p`L0$ @ 0xPH RlpW h0d@P`P0t@p490L004 Yx 0;0H 5pL8 hy06H 0+Y}l@ p0wPH 0S0H0  p@ L000KPH Dp0 L` 0V;0p8 H7y060pT\D p00VY p@ 0wPH 0T t0bt00S_ p` L000KPH 0  5 @pQ1 0Q. 00 Q* l`H 8 px 00K& pL@ @PL\ VD0007p8 yP0H@ 600LDZpL8 x0608 pxy@P060 0*`H@ p0p@@{,=H@ wu뀐Kx K =Httx  2"@0Adx䩘,ЩX@ "-LVM 0,0 x 00 R 00t1  x6@0C PTt 8, 0tR(Kx`ePSOKlA hQ  XQ Ha \a `![Kp 0p L wPt D\1p0c0P|1 :*0`St pq1@_ @ PrQK >PP T(6(L 0  $K(8 0000 d00/-/ -LMPp;pp@N=+`LC5U 7KKh; -LMpP 6S- `7 6`S6& S/=6,ƕ  @L 5X: 6`S0z03Y0S  (K p-LMP`2 ^@@^@T` (0&^Fp 0KP@p0 R Z0F0p0Sd 0Rp -L$MD @ @< \H0 (<Dp`b~HP@' <"00KF]PP" h0"Ph⿁00 ጠ00 `00P p0(PP 0 \U (KPH @D K  0(@8 40 P 08KZ8$&?N8 0`p8KG8,&F6 Pd,K   T$1%,Q=PPPL0, S8KeL$&`?pp-8 TB@ :4,710'080'180 R1<00K PP 0Ud0S0000S8050d00L0$ 000H }0ZH00w0Z,~7H0o0  ^ꘫ`BXm` nBCTm* 0-L#R LQ0SlQ T0 S P\d0 `0 S䫘H -LM`r@&rPU(8 K00 , 8P 4 RX8`  r  0Mq 0P`r&r0S @0V00@GP`(KM @Ō* 0-L00@SP  0 0S  4[P  qPZY0h0S 0S -LM`2`P1#RcL0S(, v" d0 W \ࠃ@\ 0!@d\\ T\\\6 ƕ0& 0,圪"0a0`0b@, 0@   0@Q P 0@$0(@ ,0 Z 2BZ 2NYZ 2 t ISp p-LP `b^Q@P r0 0p @Sqp -Lp`P)`BP&r0S% 00S0x 0 q&0rQ o`X,$0 :$0`"KP303" -L M@ $0p@(K`2 @  0ITPn,K  ;";@PW,0$LPi@PO`2+`H2 0@c21 ; H 0O  & Ɔ6FP@V1L0S 1$(1 6S(!P &,0,ƖL 2,5 6PS6& S,K /:@P ,~5@0$< K8 40 <` 0 aP@ό -L(MRx0P` 080 0 PPpP (KYPڀ3 Vp 0SpP$0040  0npP(KH H@p$ ;H@ @y:pP! < ,P )5 p4 0R n +p<0S <0`2,04LpP ] < c<+,0Lv1,4<,p 4 0R& 03S030s6 0@cN0 ; 2C@0 0O 6F@0 & Ɖ6@@80L0S @10$(-0 6ƙ ( ~ 6S,&@&,0,ƙL '1,40@, 6S6& SH/9P0 ,y0p^<@ 0`B8$ *<0(0$ `6#1$0&0,0( x0 -L M8@T~W(K XP@ 0  RP3P@(p@D/$/`/,6" ,K `n 9@P,0L LPR$6e@`/0 V!0,%4 Vh똬 -LKMT Tl SK, pPP@$ E ``q0S  PP- =P3 # 06$ Hq0S $0 ㄆP3 &S 0#6LPTR/K{TP , 0R(KLKZ 0PPKKZ 0Lp @0,00C 00K(P 00JPP`00SP W4 PP x P 0 #40SP 2P $0 LMLo  0 m PnU$0Y 0SPWU`,P P1p T,L0S`FB Z /Z  YOKZ Z KZ q0Sp 3VS2 00Pye@ n  0 l P4nUB QKKZ /c` P@@ `^@ W, 0P gVQ ,$0~S3 nXm$ -L@ yh -@LQT0Qh8 -LM`0 P@_  Y00 (0KpPI(0 @ 0 00(1 P( ,00 ! 0 $pP %oT 000( 0(eT pP0  XT(00 \P P 0;0,BT2L>D@- 0@@2 -LpP`0 00V000  0@0@ 0:#:0 10 00 (0X0] $ 04@,00@ 0@@80<@ 0L@D0H@  T  0000T0 d0P000S;(0 S8L0(04 (  0@+` \0  \0d0h@  0* p-L M@0P`PP` d]EKp0S  00/ʚ; p-LP`@L0(0S S0S  phj( phv -LM@ 0" 0`P  KL0( PpP (d-/`P000^S 0@00 hA 0`@n`< -L@P00`S 0 0 pU 6S4S0  "pP0! B!TS -LM`PUT Sp0!R BpT SR _P 0 0 0 p pP10C1   <RP 0L @@p< -L8M 0  P"0Qp  ,0KIpP @b R(K,0 `0 00@,00 @$101   pPN DKT0 $K D0 > K L0S `0=@K.0<0K8 62K 0C3K L0S `01K0@.1 0K/KhA ,D K0@mpP L0 ` 00Q#/pP 0! B! 01000,1R~000  pP ,00qL><`x -L@`  00S_jp RL L0R SjQpU  :kpP-0!R" 00 8jpU  nj !0 00epP 0! B!L}jpj  lpP ꐭL> -LhMPp, 0 `0 @  0  eL L0R i,0Tz Q,P QiS0S (K\ L0R0 0c0  ^ P^  jP08t h !R~ 00vt 0 q0: S\ X  R,0Ph`0 d 0! !h PP ^ 0 iPd0S d@4Q`1Q\ R h@0000njPh0! B!h 0QRy00S$ ai Q, QR0R00 0 0L 000K Qp"n` d P d0!R\ R` 9ZYBY|Ul0SP 010C1000000AyOrL@HK10C1L 0  0 0 00@h 0 0@jP60[S#[0R  00@lT  0@ 0< @hA 0 0@i 9ꨭ 䭘<..@ -LMP 0p,0 0`S0s0s0s (K0s(0sX0s\0sP0sT0s! L0$  0R (P 000 0T0 0 000 0$T0 R0 0 @t L0$ t@  0y㘐ST ~P0 S R 0ᘐ0@00R 0S 0;0Q 0S 0;0 p 00S S S  0P|,0s L0$ y 0R ~P l0j ,0 ePc80s ,0s L0$      " 00008qh 0,q_ 0P5Pu0 L0$ 2@ 0R n~P% R 00S  O9~P   0:0000   40 0L L0$ v Iwqfu0 S  ~P=800sl80si<0sf@0Krr00sx<0smo0s8* -LM@ 00 0KK | p-L P`0@   @P 000X|0(M00@N@p2P  ,0S !5%P/ 0P-L0 0a00P0/0a00P0a0/ -LMPPp`  H0@ @6/00S  3/K3/t\// -LM @`Tp1 pP Q*Z  6/$0( ,@ TP ,Zp Ph6/($0,  P6/( $0 , ,6/  6/$Kخp@-`@\( 0S% ^P) ^  R  R@ 00 R000 S0  0S\ 00p0@00  R \,  R/ 0^00 S 0  0S0S0P@ 0 S@@ 0 @0@000S00S0@ 0^@@ P@0@- R 0S^ 0Sk 00R 0SI0SD \   R00 \0S0  0S  R( ^ 0Sm R 0S 0R00S00 S0 0S    R000000 \0S0  0SR 0S@0T00 S @0  0 S 0R00S00 S0 0S    R0 R 0S@0T00 S @0P  0 SP y -LpX5 PU?P0S`X`V 0S@W `RP 0WPP 0RPPV 00SZ  `X `V 0S` -@LP( ,\ R ,0S  R0P 0  \8 0R:\00$-P,P ,0 S 0SP 0 S00:S P 0S/0S/P/0S/0S/0S / P 0S/0S/P/0S/0S/0S /P/Q00S/Q00S/ -L`p@PP7/U@V 0S0 `P$0(,  0a7/@PPU@ Q 0( S$0 AP:,00P* <P7/U@w`P7/$X|P 0-@PL: @ P0qP} 0-@PL+0 0 00004p } 0-@PL  00000 0to| 0-@PL  @ P0q| -LD@D@@DT@d@ p-LP`0(0 @`0 pn8} 0-LP@WP .P0 0Q0 0P0뜯h} -L@<P뜯} 0-LM@P{P0  0븯} 0-LM@PhP(0$ ΄, P0 R 0S B^R* 0S P P0$$- 0 0v`Hd|}$0 P-L 0(p`Hzx p-LHP` 0@S O$ @` p 0p|`H R-L@@ b/00 bR*:^*0N3:#:S4 ^! 3 P`0 R R0f0g S:^0g0f  S* `S: R%# %( 0 HH D0K44 00F  0A  0<`Hذ$ -L,M< `pU@0 v*:Vp:1eP@HB6BfFB @TP] p0K$ 0 X !V01,K qP@ , 008 40 pP@p@PTW5 48 \0   Z:@J   048  bB80@ p<0 pAB <  0<  00<h00(K< 000< e,i 0`HT7@ -L(M8 `P (KaBp@@4 >P* 2P@T% 0S" 0S0$ ,(00 S ! 140,K0K P ,  @0 0C"0" 8 4 0$  04S0!0K,K P0  @0"0C0 -L$M`  PZ4 80  t@P,K0pK $ 0@PP @P (K40@$0(0,0l, 00f0eaQ80  n4pptoq -LMPp L$P  t$0(,@ \`,K 0` `4P #P  (K -LMPQp`, 0^ 0^$:0^!* 00000 0000@P0S @ 0 v$P  K @ @0 @* 0q`H䱘 -R  SL M R40 Pp`z  Xy:#:ST:#:SP:#:SL :#:SG$ :#:SB 0Vd*UAXPPx a@P; $ (0 V6:,00W0K0v#@T+ ( $0 V&:,00W"R 1 S0!,K  $tP X#@ 0U#RP (K@, U:00U40PX40  LLT T088H H0$$< <0U*QP`HqmTn|r0 -LHMpH L0 '@D "@00x@,P(@4 0dP40K40Kࠁ@K`00@KS0%5R 0 0T@%5UP @ P0e S* `0KV (K@j  DH L0P@ P -L4MPpU@80 { 0$%Q01Sr: bU0a,0 50 R 10 @>0 @?  80 0P, ```P(Kf4   40 ,80 PP   0 ,80`P P  4800P, zP -L$M`p @ PZg ^ 3: @f p@ P`WK 0-@ MLP  0P? 0P7 0P/xx 0P'` 0TP@DD0*0<0 K0qh.DLpX4pdnpto(p}P/,,0 S 0 S/P/ 0 S00:S -L$Mp@4 80  00 `0bS1:\W YM0I  :#:S R 10`h Y !3\ 1!0a 0PPPP\: @P `0S:`0V @T (K@ R 0S@(0$ ,00U: R `0V@@0ST  1)$ Y P$( ,0  0 R 1S0!,K0K?P, 40U@:00U8P80 448 80  (0  0`HذB|$ -L.^0 !P A1S  0AS 10 ! 10A0 01/`r$Hh: #:S-L0 !P0B.0` `$ p-L`!Q@&0 ,P&^  QP# P 0  `p Q0S 0000 00`p$$$ $0# `L$贘ȴ -$ 0@` cL  P/"6<@SpQP !R00R0S0!P zPQ<@T𭝨Q0P P h@TP  0` 0-L!QP@ 0 D.  R 0!0h 0d`5$8 -L`@VP`PVp$ 0SPP 00 0A S 10  ! 1 A 00CS0 UX01SZP `FU b-@L jP0 0 0R000 0: #:Sp-L@`"V  00b0eS 0S 000  p/0*`$\ -LM@p, ,P0, a@T; 0S"4PU(0 ( 0ᘛ,P ,P(K ,?0A0C0 ( Q~ ?,00,0 PP  0FAPi)N, ܵ䵘: #:S-L@P7j&jV8RhPp) $F%6p@l00 @` `` b10Qe&jP@  00!Rd R$0$ (0(@@ <0,, ,0pPrs` -L0@S0S0bk 0@sbk,h$$ 0U 0PPr`4` 0-L0@S700$ R(0(0(0  $R( 0 P 0S P 0PS0!P 0S 0CS00PS0000h 0뜶` , -LXMTK`P pK, 1@TO 0K( 0@ , (0$Q\ $ \0K((0$0^X0 $p ^0 !0SU000 0R0) P ^0Q $0S Q\ ,0(0,0@\, Q0 X0(00P0X X0S\ X (K\J 0s` ,0-L4P M@,, 0PK0hbPr4h. -L$MpQ@H L  `D@ Չ1P< P 0SC@WeQ0 0a00P 00< @00WTa 0S0C0@0 DP @0 DP T\LPpWAD!1P 08 0P 4 ,0 @W1 0SPQC0WdP00 `00R04P4 0080P0  'JD 0S U0000PRH @FW(K@Q Q0,,00000DP 0@0 \< -pLAQ@`P Q RU 0S W 0Bs𨝈U  0h<0 00RUh[ 0h+ -P0000L00 0@Sp` 0Cs𨝈  0h 0h  0S 0 -L M $0@pb< :#:S Z%ZU! ,& X0XX (K 00Cs 0@+j 0"0Cs@aQeb gPT  bi Qb g@P b}i0 00X{0 00 0!0c0,0  P4 !,0  P!4 40 4T P !  @Z1bP10  1` 0b.i0Esb(iu 0As Z`\100 !1 cttt t0``h h0 j 08  j01   0뫪`"#s䷘ -L@\`po 0S $ 0Pcz'zWZ,@P%iYiŸ0 p p b10QefP 00@P0S X0<00!  R 000 00 000X 0  c!00CS0K 00Cs>D00 D0< @@ R$0(0$ @(S; $ 0n#6S"(,0X0UD*^* ( <0#8(U$ R;$ R*)$  n< &P@D00D0 0$  c<"&0n000$ D  D 00C0o]@op@@@ @0,,/00$ $0Prs`J/, -@LPZ00 p-`L PP P P@Z(P% ;p:H -L@T 40S 0S (0(400C40 0-L@PT 40S0S# 4 R B004 2 0S#0S%0h@P0S p0S0Cp0ʀ |0<(0 ( 0h ;<< <0+(( ,0&y 0!s$u`lȸ -LP 0 s 0-@HP ML@@ 0P,0 QAK0hsh.ธ$u 0s0 0/ Ap-L00@_1 ` P 0S P 0S 0SpPRp 8u0S00`@ Pp 0Sps M-L(ML H  0D 0A D@0@S{L0H 0!P0 S0!BCB.8 4@ h@ < D <@0aVO 0Z0 Fʒ 4 TBʑ Yz 8 R} 0,0 , Q'10pP / 2B,N D&!*@q9PuT Y0Sr@@0C@@@ 0,PUp0S P00 0000`V< P0 R< @@TX!p0T@0ap0J(KOW/`pL0OWVL@@ QD 0P6Y@00@0 0OWPVZL 8 R4 R@@,@ {|VYi8Si<<< <0((0 00$ $0s$u`踘W\`p p-L0P@ R/`p0@S0a!p R P$ 0U10`P V000V000C0S\00 00049(R$EU V/0s`踘치 -L@P X M-L M0 0, `p0? 0P`6ɯ & ZY@P ,k8z@P`P (0 0 0CS;;$;$;:;,  0SF40S/ Z= (K4(!0ʔ@TP, 0@P6 @_Z4@ 0P 0@P`ڼ,06ɯ0QI9Y4@YY40S0Q} ,!h}980 Q-LMp` 0SF_0P/@_T0/P K  0  0`踘P` -L 0`s0CS 0o  Q$0$0$0 $ H@T( (00) h!0+@T( @R'R00R @P W !p00Cp0 0Rcdi !80XpQU @T 10@P qWH Tp00Cp0@0TPpW4Dt$upts{ 0-L M`PUL@LLT 0 @@4 0(0@PK08h.|spt  -LMpA P #$0KczP   $0R`0@P@RP0S   @!0 000P0 Rc0d @Q-LMp@E0A P #C2 S<#S >*c 0K7`P  L2 S<#S# PQ P000 0S00QL2  S<#SPcc 00`p  0  0~`踘غ p-LM@0`@S0C2A P # S<#Sp c 0KPP p  t0C2 S<#S 0!!0C2 S<#Scc00P`p  09`踘к p-L0@@S` caPP p0S 0  0Scmc`Pp  0 `踘g -L R @Q@Rh&hh -.0`踘 p-PL@cna`P p U P00c*cP`p -`LPcLapP  V!@ 01 P0 0S1000C0SL\000@@Tcb`ps -L R @Q@Rhhh  0~`踘G8 -LP F& 0S[1 p @U    0@S/D P #c0~P@<  0@00`* 0S4p00 2@ R 0 $0p$ c`P@ dTp`@0,($DD<D4D@DptP|Ի -LM@< k \d` P@ 4 0Z  4 <0Z :@P`0s  4pP (0(O@@ p<0Z4@ \ @ @(K0 0%@S@0P  07pP (@A0 P010 0@0<\`p<Z :@`p@T0Z  &*G60 ,0 T u4PP( (0 0p!@T a4PP(0 P6PP C@(@P(@T0 00@S8 #08 Qn4@(P Z@P (0 ᶏ 8 @S(5N  P 8 010 -LM`@$K/p 0K @ $p @ @@PP P   T I(k  5K -Lp1PUU `tkV @P'P@@P0W  X R`P0@Pe @`T. P`P^ 1@P  W00X0S \P^@DZ(`U `4D@D 00 0/M0Ѝ/ -LM<0 D00 @8  @0@(K80< 0R40 #404p# "B 0 8 0`P`"2P0#`0 e p,0 @ :@P`,0@X Y@| 04 0Y(b 1T(K  00!0 000? 0 Y# ,00O001T  , 0T000  0  0$u<` -LM!  \  @0xϟ 0 : P L H0 PK@Pr D0 <HQ jT0Q  S DR00 0 001  0P    @  QnX21C RL $0 b0`"vWp!#6 0CPWPS@ Y  <@K a 0<@ X0S00S< Y WP`P @T (040S0Q `VPPV < 40 Va  0O0@@ Y4-4.88!81Q0 00HP,(0~C PK 03PK0`PPPY00SV|4(0,4(@-0 00$u}ľpо<L@ȽrDܾX` 4(0!(4,PK !00x00C;@  0PK:;@7,(r'|4 0 0 0 ! 1d},(0v M !/(0k\d```!`1K4{<0L< b,Pm Um  PK03g Q-L`pP#*@JV  0rP T    @-6@004@ 5@80<@ 3@ 0$@ 1@( (0,@06@P0T@/$u -LM| KP l0 #Q*XXw/T0A0Q*b"!B10b 00p"8`Xht0 -L@TP" Pp` :S0x Q*Q@T (0" -0St0SP@pTVP0 RZ 0 0m 0`U0D$u 0-@L 0P PT*:TQ0|D R-LP@   0mX0 0.  . Q/! -L΂n^P`Up(S N@ PeB,(0 h  hp"|D.  . Q :/ -L(M@ .  ^P U< #: (K  P e8 !fV @,pK , 0S0R*@V^ 0 P  K @TM X18LpP  814@K0@ 4 0@ `.P04Q@ @\J00000  000 8(4Q8 `$V< 0e<@ P (8D88 O 00 0LM|Dp"`Xx  R-@`PN`@L@Hf pp .0 h @X |DX 0-LM R' 0+K KD0T>4(X0@$ H s80@$ H jK@$u(|D@' -L M@ < pW` 0G#X*qYp1Gp`00W80 M J$J>00>0S`1h# X00 V0nS`7  Vj3W@2 8 ,0K <^ P0d,S1! @ sP 4@K , 04 0@  @ XpiW@(K|D -L M0`SpP7 0SB0SS4KP40 0 %*@,Kh uP T,.&R*<0R*0a"!Bb 0 00  000 JU  ,0 0S(K0i@ 0`S00b U ,=$0 0S p"8v>00   -L΀(M\p@ @4 K00 DL0T40 @ 0 S00R<0 T  R 0S 0<S:R 0  48 0Sa 0S^ "000`,K 80, 0 P4@,`T<08 Dp,:,0 @T @0S8< E,:,0 @T?%@0 R\ 0S  YfA0S 1@ 妅0S  0S`4K+4K+(K0C ! S0,  1!h0Q @ T00 ₃ 0 @S@0 ` R V0 f4K` +PF xxx x0ddl l0PP` `0<</P0((D D0`p"vv< `࿘]8$P -LPp<눀@`:0N 0R 10 P ' )!*)|Dv -LPM r+ 0RZf 1    Pq 0R1   hK@h`Kt!p@P *T00 p`P1XP1 Q 0 hK!PR U市Z 専U1h K@U@PQ x0* 1(K0@p  P0 匄00 @` P@Vv|D# vl  0QT~t -LġM Q Q 1 R R AR   Q;* 0 1 S0P1* p X00W0S1 0h !Wp$K` 0@P0!&00 `AP?pX(10 0 Q *0h6 0(0  X00W0S X H 10  0 R0 0, S,0 P$Kvs|D# -LMP`Pp>0$ N@ lT(Kp,K, hh0  P,44/00*0 p"xv'`࿘ 0 p-LMx`\h. h0K@P̌.!' 0` PKp 0p"xv`࿘M 6 0 -LM\00 V> 0(K\~ !p@HPh0 0 wP4$1W, 0( 0cP`(M8 0:P@zG`W h 0 (@P0 Dh1S 4W00S,(K, `J,,  a$$$ $0p"xv'|D<`࿘ -L℀Mp@t `6.h (PK  @0(@ $P @Bw/ K࿘ -L M8 \ 0 S >8 @0n(K 0`̌@P0!Y# 0&0 PnZp14K ,0 !0aphp 0R40 0 d0  40S_,(K0b&S@@ 0@ (P3,P0U88 0,0Z0S :@p4@Q00000  000  0%(SZ8 ,8 TTY/P0宽@@D D0婽,,8 80夽, ,0埽p"|D$u`࿘g 1-LP5P`pW𭝘  $@P (0 (0 0@P`:P@`XW% %% P, p00Cp0 0PD$$u`࿘ >-LM0`~0^@Pp0 0` `P @P 000LT 0 00 0P  K0 T@P忼彼廼''d, 1p-LMP0 @{||` 0h `0R0  bL@P 0K0 P 0`Kp剼xvdp"'|D Pp-LMPp)@`Kp ;P \0 #Q*Hl0Q*b"!B10b >%JUpp"8P/ 0 S(0$ ,00\/1P/0S,  `0R 1P `0R 1/ -@PL`0P`@T0@-D0DQ 0$ 0PT0ST0SH H0RL L0RP P0RX X0R 0 00R 040c@P4@PP80S@Q 0S@ R00S0 0-L@PP D0 0U:$0U#300 0 0 P00P0/ Q-&:0@2 8P 0Q:0Q4(0Q*00Q:40Q:<P 0 R 0Q:0Q4^,0Q*LP0Q:0Q4 0 Q:$0(0@-P Q0#03 P 0S @@1 Q#3PQ8Q 0T # 3P R0T # 3S RLQ T0#03P0S T0#03R0S<Q 0T # 3P R0T # 3S R\004T # 3P R0T#3S(P T # 3 Q ,RT0#03\0S 0-$0(,( Q:,0P3400Q:40P34000/ -LpPU/ 0S,`@T1 T R& @TP @0 0 R0 0` 0S0@  0S@@@`P ~PU 0 00p 0 0  R P< X? P@0T 0` @]0S0P  0SPPP`OP K0SP0D0S0p  0SppP@6P 20Pp0p 0 0 y0S@0"0S0p  0TppPP @p -Lp` R 0SPU 0SZ `0 0R 0S0S @TP R0 0@ T`@0S0P  0SPP`PP @@P Rk Q 0S R 0S 0R 00  S`00S0@  0S@@@`:R 0S0Q 0@ 0S0P  0SPPP@P ~@ 0R 00  S`0p0S0@  0S@@@`bP ^ R0 00 0@ T`@O0S0P  0SPP`PAP =@v R 0S|0P 0@ P*0S0P  0SPPP@P @ \ -LpPW8 @TD@0Sp`W`V p 0Spp U`P@ 0U@@ 0R@@V @@TX  p`W `Vp 0Spp` 0-PLP@! #3Q0 R  0 S R0P 0 Q@@00 0@0P/  S/P 0S0#03 P/ P 0S/0S/P/0S/0S/0S / 0- LP@P'$ Q00R03SQ #PD0$ T(0, 00\ H00SP 0T00 P 0S/0S/P/0S/0S/0S /P/Q00S/Q00S/ p-@ P$` UZ3L<Lp000/ {0/N -L0@NhN0/M -@0LAMp3P0000/M0/N 0-L0@P!MP 0! 000 {00000~ -pL@P 0h!S9@ `T/ STD@T/  HIT>@T` $ 0S X:W  WP 80P L0P V@#P0$ (0,00 S%*LP$$/ 0孷 0娷`˜,˜6\˜ M-LM04 40`"P @Yxh 10 Sp!z3S0CD  , K00K0 P, fPFY`+,PU (0$ 0TI*,Q $ (0g (0R,T:00R4T*P* 0@P@T :,QP,  ` (K0g00T0@ , K00K0 PP hp 40`@y z&, ,P `$0T* , ˜! p-L0@@, x0|S ! 1QpS1P`#`3P Q#3Q030 "S0aP^ Q0#02SQ#3R0#0 2S%p /0ն`˜˜ -L$M@0 0 S80 < Q<@ 0Q:$0R , ,(K#|  0PZD0 D0$Z(0, 00Q 0ZU Z , D0@@4@ 4 00 0 R 80S 2 R} $0Q@!@1Z `1`!T<D A lDPP3 pW0 @ 00CSꨦ즍즍4 0S40S0Q(0d0S !1G00S  Da00CS0JV $0 Z `1`!00S @@ L0 D04Pl X0l 0l0`@P`0 @@0@`,P, P Z u< A$0Z `1`!< , 5<d , .0U o$8(L L0ݵ, 4 40յ˜D`^˜ Ø ˜b Ø 40-Lh t@RA->00 p-@`LP 06/ q6 6/Up6/4PP(  6/@@PP 6/0/B000cSp6/@PPLH0/B000cSp06/p(6/Up<ØpØ|ØØVUUUØ$+`Ø -p ML`2/8@0P(,0!08/ @04 0lP8/d8/`@8/V (0 a3P% 48/ K" Q Q9 8/(0+ 0B@@8/0S0S W8/8/@T 8/PbP Wl8/d8/ T@P8/H8/Ø~ØØĘ@ĘĘPĘvHŘ`ŘŘĘĘ|ŘxvĘ|Ę -L M⨒p`$0 , 6/(, |6/04 p6/0 \6/P$6/0@"Z380 0$@P4K0")P< 0U@ 0L, 0Rg(KP6/`d 6/pt 6/x| 6/Z PP 0 $04@ <@@@6/H0D0L  P0FT0T  XF T F0T06/(0$ D , FT @PF T 6/`6/D0FT 6/T  l06/8PPxL冈,ŘŘŘƘ0ƘǘǘǘHƘ|ƘƘƘƘǘHǘ|ǘǘǘ~  0-0L M\0\0\ 0d R@P 0xP勬h 0`dP@催L 0Dd@z(֤K0h&xvh.ǘǘ ǘt Q-LMP`p @D0 $ ^ HQ T R 0S 0T0V@``"~HL"]@0x03V0S@ D0 $ Q H0S X0@ !.!0 Sc$K!p!\t!Hd!0Z JD0  $0R H0S T00CST0- gPUV D0 $0R H0ST00CT0T@V0.00Sw 0T n $ $$  $ٲ˜ǘ Qp-LP`p@U@ T0S D00T0 $ U@p -LMP0@`d !T1 )@ pTP@ @T0SD0$0 0b@P$01 H R% ! !KB@ '$ 0 A lV 460V*Th ^ $ 0 ($ $0刲˜$u`Ș 0-L\0P 0 Rxp0h \0 RPL0hD@88\ P1\P0CP10.t pnxv$u p-LT0@SPD p0` 0R0 $e $`ph 00 r $ ph0T0$ D  pp0P $ \0 $ 0 0 ccxD00`0D0p((( (0 0p"|D`˜ 0- P@!J3>0 dPtu00LeT$0 -@@0L\1PU PqDa\@TP# 4 P1\ 0P10\0T10000 P$ 0 R#V@P \P 0 @Pd0. d0d0S0:!#:SS  R9Q)0P0$  8 < @ D H L  , ( 4 0 `B@0H00AlCP0pph!CP0P8僭444 40ʭ ( (0ŭ̘(p̘`˜\̘|̘ -L`p PP5@ 0@ -@QLP`p @0S@0A0 z0P0C@ -LMp ,@P2 00` K -L MpPU0@`0 U (0$ ,0 0S PP / $(000 ,,  V  0\0 0@0 U o ?0 , 0 0 (K $ X00R0S@ -LM<0 $`8 ( 4 ,0\p 00 ^ <0@ 0,0 0P408@ DPTP#PH  0,0 00 e`0\=0`KLO0@D@,KX `0 @PH c 0@8K 0D,K@ X`0 @PH Jx V! 3D @ @0F !Q0@ V < 0`K, K0P%8Q `D, K@0 X@?PH  0@d8K 0D8@, K X0`@%PH M4 0<0  @+8K "s c8K 0c` 8 K:T@ .`h@ hdP 8 S  0婢xd  0s'`00 bp\PD00D0`p|d 0劢hP/t0兢T<h h0倢@(\ \0{,P P0v.!˜`И|DИ'јr,јјP/ S/P 0S0#03P/ -0 L@1P  1S/000P (0 -0S"02 000P0,0 0l   `  l0000  c 0(0 $ 0x R010201$uD p-L0>005јO$umZ -LM !Q 0R aR >0. R 0\  0P  0-LMPP *"*R 0^* b^ >0^ 0\.0 H R @ 4d 6R0  0P 00`0S*#0$u - L -LQ 0  1` tP00 P00S#-@ !Q 0R aR >0. R 0\ ^,4  0j  0c  0\-0 " 0S  ʠS,ʠ\ 0R lR >0. R 0Q  0 03-@ !Q 0R aR >0. R 0\  0d -LM0^    ʠ,ʠ\ 0R lR >0. R 0Q  0 -LM@ !Q 0R @aR >0. R 0T`V0TK p a 0Pdh L$PK0@ $@ P @d/:ј -LM @ 0S0 , pP 0 h d`Vd0`0S0 ] > SZ UX )YQ>0^PUN  i:#:SG0QD0SA3Q>,  F r9@p@  0 0 !h0 6@Q 0S; @@ p1@ `,K0@!@P,000P  0JZ  0U@(K 0@pW P P @ @0 S  @@T @$ 00SS@@ SP1S``/ 0@ 50 @ @S Sx0 P: 00 v q  S0`  XʽW@ jK00 @P 0L 0S  @ jj 0CZ p@ i먠 p  R -L,MH T H0 P H :#:SD >0 Z< *2 P08 40 m8 /P L 4 d TD8 0P4 Y PP , KPD ,P <0S{D0ZL%2: <0,$ QS. 0R+:D0<Y!0 0 4 0 0 0sr 00 R* Y0 Y0,P, K <0SGD0UZ*xp p1̜P\I/^H T8  040 L14(K@0 Y@0  Y@0Q0 ,0<  a2P 0S000 R 0S,0 @4` @dP P00PdI/ H T8 LD8 4 (  $0x  0sј`јјј -LM@`0S0 pP (K 00Q, K PP00@0S 0 0K PP000, R 00CS 0,F0,0 00@SP c0 0 00/ M-LM0, Z (KYzpP`, 0P (0 :p@ Q P`ZY, 0P  0  0`Ҙh<Ҙ M-LlM0 | 0S@ #fjDvx  KWlKt p 0f0@ ,0 ~0  0 0 0, K0 0tK (0 @ (% , @RRP@Z  000000  ,PQ@, 0O`Vp0 6tKO Wt p 0ʘVHH[ D0V44\ 40Qp@t0 K@&x(K`Ҙ\ҘlҘp@-`@\( 0S% ^P) ^  R  R@ 00 R000 S0  0S \ 00p0@00 R \, R/  0^00 S 0  0S   0S0P@ 0 S@ @ 0 @0@000S 00S0@ 0^@ @ P@0@- R 0S ^ 0Sk 00R 0SI0SD \   R00  \0S0  0S    R( ^ 0Sm R 0S 0R00S 00 S0 0S    R000000 \0 S0  0S  R 0S@0T00 S @0  0 S  0R0 0S00 S0 0S    R0 R 0S @0T00 S @0P  0 S  P y -LpX5 PU?P0S `X`V 0S @W `RP 0WP P 0RPPV 00SZ   `X `V 0S ` P 0S/0S/P/0S/0S/ 0S / P 0S/ 0S/P/ 0S/0S/0S /P/Q0 0S/Q0 0S/0- @0 S0/ UTR p-L@PT `P`@ @T@p 0-L@PT P@ @T0 p-L@`TP@P  R0T 0@ PP P@p0@0@ @P// -LTM@ < `K Kh0p@-P 0U"F#``@ 0P !T01Rb`0^pD8 0-@PL(Q00! -@L(C0! 0-L00@S(0P PQ00 0  0(00!00C0(0 00 0000000Q 000 (  00C0Q$0 0  $uxv -L(0@ ,Q: 000 (   00C000S(0  Q00000  00  0@@QH0 0($ $00000$uxv -L000CS00@0<@0(0 000~ 00C 0xv$u 0-L@\ $0(P 0hgQ(PA (0P(PW A000$$ 0ȗ 0×A`ҘҘҘ 0-L(0@ Q10 0  0(00: 00C0(000Q$&0   @@(Pp0   (00D000h,0  @ @ 0sxv$u`ҘҘ -L(0@|4P|`[ Un{ (`jU00C0, p , (0Q QQǠ10 0 0   000(0 6Q@ 000 Ȍ  00C000$S 0  00C 0 R0ƌ00 $0S0 (U(` 0S" (㑿0``Qt0 (タ(0L0  DDD D000 40ޖ( (0ٖ$uxvy`D`ҘҘӘK,Ә -QLP`  pW& H(0K`VP @0Ds(0 MY(0 (`8VP !(*' P-L M4 SP80 2@0S@ lll"l2yT`2`Ÿ``V R<0 @_@TP ?ST[ 2@ ?S>;  40S 0s ,0S+(0S1!hD0Q `P0@K  0 @0 ,@ P P0@T 0S) 8!81%41 Q @(KRD0Q Po0RO 0@VXUR8 04 (0 V (ㄾ(q$$P P0D D0`Ҙ`Ә <;$u<xvxӘ@vDӘҘ -Lr\R2$ RP@L0R P U3 @0Q  Q*60 0 0R0 4 R0B60  B0CR0 \4 `LV`@DPV 0 SP@!@P@ 0R:P U&\ `LV`@DPVʹ|60 0 R \ `LU`@DPVDxv8ӘӘ -LdP *P0  0 P0@ 0P Ք$uӘH -L M4 0C 8 <  0@ D0 H < <0 B0 H 00#, 0  R P \2\\b>ȟX 0R #v @_<0@TPOTK{W(00\䁟Qh!D0R A0R ,0S Sh!D0R 0R  (0 0R8|A:#:S loh10 ZP*VR4<0A #F@|D80H @0"&@!(Kok 0@ ?SʯR@0D0@T P0U ?@P 0QʛP(KS``` `0hLL/P0c88D D0^ <;$uv<xv@ԘԘ`ҘlԘHԘ$Ԙ S-LMP0K4 0P , E  .0 P0@T. 6P` P ` 44000Hp(⡼(0 P000,0  000D 04 0@T(K/0 媓`ҘҘԘ -LM0.`p,@K 0@(@  , ,@ T" PP000(HQ(0  R000(0 0   0,@T$K/ 0嫓LM`ҘҘ 0-LM ] 0Sڀ0,0 @ `Pp0 T0 `pG0 0,  S, =(Ko9D՘P@՘d՘p՘ -LM4 t80 PP 4 Z*L2`Vm V80S  0SQ2 1C 408  !000(K 40pj 21C c 00 I@P4 W,@ W ` VZ%&0RP08P@0D0H0L0 :80RYE (㙻000`VT@Y) 0, 002TA1C 4080 0,00巑 4 (Ko豑寑4 @P 00覑t(Ko袑 j80h21C, cI<劒8划,儒$uD8|DL֘֘՘՘0֘՘x՘֘ -LM,aP0S  A* pW$ >0n`0gV@P0U,>0 N@ U $`KP% $J UBhh@0>0>0 0;U )'Dĕp"֘ ט<ט -L−M™0 @0 ,  0 @@^^ p80 0b\0 "6!v21C!@cw `0SG 0PcW@"#<:2TF1C! cU`` ƠTʌ0P08@0D0H0L0 R 0S0!% 0%0" 0%^  n2`1Cc i0S 0pePcUg塑 0, >0>00 00 >00a0h 0P00C $ (0 0, `\0T(XL(K,xxvDP58$uטvĕD`ט -@LPP`p (00 (800C0, 0 0, U,0( 0 `$p,0P qP (  00044 00  0z  0u`ҘҘҘӘl0 0-L PRLH0H@0D&0 0d $ d0HPdSP0h.PCxvv -L`\p@P(0 ! R (c˹!P\@P P W (0 S (0 R(㯹0P@婽\(⏹(0  0p  ! '  -LM`00 pP@, 0 \  0   , 0 aOY R40S 0C40(6(001001z$1 0$1(@`0@ 0Smh0p RIl pSSQL Sj (`000Y P R@q ( KY1000w @ XI04 S0K,0 0 Ll  G,10,1[Nٴk00 (KR (Ǵ0004AP`tK@, , K00K4A0 P``4@"ڋ 0P/@(`឴0F0T0 XXX!X1  4K4 kP0 0 @㐴w 0$#0 !@ } 00(@ 0$#^_00Z 0$#R(@llt l0ЋXXd d0ˋDDX X0Ƌ00L L0/<0弋 <;$ud٘`ؘ٘٘(٘@٘ -LM88c8ß1@_@TP0U10@@ 0dS R101d1 d0SP12d RP@D0 U`t",0 lh0Q| T2PU 0O Q ,R0jaZ``X@@00S T  0PD1V#W Z``X@@P4 ( p 0SM Q40SM 0C40(㪳(  W\<1W0J<1 0$ #<P 0(㙳H( 0(0㎳( HfPwtbPskp0Q  ^ R ezx@Se888 80݊$$, ,0؊ <;$uvxvv`ؘ٘٘ 0-LMp耟蠟h!L ``V  0SO``V 0C0`00d0V400< B6C0 P@U`D[,0<@Y80M(D7<xv$upnvvD-vvv4u $3-LMh!D 3 P1 0K?Wm @- ,0R0SLW 0T00000 0Q0dŸ000<00   L<4P0"@8pWn 0 00, 0  AQ4 z0!@Po?CSD00D0W0 #0/Q R 0O0S@V 0a0c0KW4, 0ȟ 0X@T@0@PoPU`Q{- 0D0Q Po0RO 0@Vi@iUe@eU\ 0a0c@`0 p`N18p0W1<00 ,@ PJ<xv$upnvVUUU; <٘D 00-LMx @hD0QP `c\ۘZۘdܘuDܘt8ܘ - V!fLSQ_@Pp$ pU 0UV 0V:,Q0000 004 0 ,0 a,$00p@P 岿0eS𨝘 0}vvvxv`ژPܘ -`t@L800p<00`4p,`8`6P 0`,](0P@PxvTM p-LP`U (@LXPU (4<S z{(04<S ||I.x0|tu\ dP 08@000Y\$:?ph@dܘ`ژܘv$u4u -QLpTP@`&(@`V& 808 @#6"STP(4<S ,{(4<S  0c| 0^|">8iP` 08 "6CV@1@! <@p `V000 "!B10bP8 M0P, ,00|dܘ`ژfݘ^ܘv4u$uo@ݘ -LLMP\ ` d0  \` Q R X T dQ d d0 Bl \Q 0A X0SXQ@@  X8  0L 00 m "10D0 姾0dX\00p0 @ p\ Q  @60`V Pp(0S \Q 0Q*` R 0RLD0 H0 h h 8KL0< P0 <H sP, Y da H E,0X R8 "F- \0T@1),l T08 S<0 "F `T@! R 0 b0T@!T. e0`S@0` P 0~U, b Pp  W, K@0pAP`\0` SI:tt/p4V{ 0 L0 0 gZ, P<  QP < H0DS00QH0 @ R,Q $ $0S`f,`Vc@0S 0 S  0 T0S 0L @0 <`D \0yXPp@c(00e0寽PP,  Pp@(㉣,(0 $00C$0W (0 000, (x,0T, ,,00,0 ,808 #Ơ"Q P@P, 0UZi(K 0b  0S,000,8 00L 00 4 XL L (K4 ! 0h  LRL 0S 0 0S C `0\@A &0P T9 % 8 0L@ 00 4  0kz 0fz 0az 0\z  0 z\\ 0PzHH 0Kz44/p0Fzl<\ \0>zvxv`ژLݘ$uݘݘtݘݘޘ٘ݘݘvޘ p-LA MP5/  5/ `  0`5/\TP`PXL `0`5/05/<p5/La`T5/ P1D5/@5/05/` 0`5/5/ a`5/5/($a! 1`5/<0!,15/48!t05/dx |05/hl5/h5/d0dh5/Kp$uޘޘޘ ߘHߘpߘߘߘ(X4lKpG0C0C+0@P+0PD0GKL4  0C@PD p$ t4 xt Hd @P0d0CS讎LL|L\@Z00S@x0! \ `PPW  .P@ 0C@@P\ D\ P00@00S0x0 0000S2  0\ $0᪐P@P 00S\a\^@PYH\T@8s0 ,D4$u p-`QLPp@@rTp -LMp`ᛶ0@,P@fyTK$@K0@ $ @ `PV@P$  (5 PQ000  0 U00 0v$uLM -L7hM0#0 )|0 000px  eP I W0$80 S0:S *0 80 S%:S#Q| p Lx R`& ,jPU%0S lK_@ lK fxQ  PW@(K@3#hD0Q|\0Ol#F #J*6x  t^4 434# Ġ`00 L|d```@p6Q@0<0B x RR 2"4hD2\@0"040 @ Pt  @0` l00l0| R0 p 0 ` Pt@`*㨷`(=VZJs(0Kp# [t p  >~40;@@|0S40 =^t W)| `Yj" Q *i<0S` p\ P h h) R tlKm0S LMpn(<<xv!Ce@ H: -L|@M t00t0 q pKL 9pP00P00Sp00p0 0 r$u`dE00 z -L M 0R d @\0!@@@]0P  0x@}jh d0@ujKhD0HP 0q,q$u480nt`Q70 a@P$ R, d060>0. V @P b 0 K0 P  aho K fd 00f#&Bd 0S* 0d 0c#&d | P-0L R.  . hKo 00 0/ -L,MP ` Zj @<0"030S_ R@@ P  Z00ST K0R00}  0 0TS0 C@ @ء00 KhP  @H` Dp < ,@ L 8 @@ 4 W 0S/0PK 00@`/ V @ T00T00S`' T 0 0C0 S/ V(K" R@f0PK 00@`h!X00\0S T0 `Nz0Sx)2 A`Ph \T {< -LM< -L M@H \?pP` 0 \p:@P`0s ZP,  (0  X 0  0p\00 0\P P(K(㭗,000P0\`p \:@`pPUY   U  R(,  (0 x0!,2PU (g,PP 0 PE R, (PPU ,K 0PPP ,@(V,州,000, (0 W1, (E,B -L0S0S\SnxpH0 `0@,PXW𩝘 M-LM p0   0 0U@` | x t 0) 0 R_ |t\  l hU`0X 0@P` K@V 0P |` x t ڀ0 |@ 0|tPxPK`,0  0 0  =P ? ( ?   D0(@㛖( S @2 0QD :P@|0`S8 PU `0S @␀0#00010S0 =0(K(  0S@   (\0 h#n1X3@P`@T R  M SA D 0S pK, xK 退K , K00K 0 Pp  -P 0^ ,0Y (04(@( @ 0Q 0  ^ f,0Y0S@0Y01 YJ00L/(@2U x@R x Qx0KP` CP (:@ Q P`|@T0\0 tkpk@ ꚣ(  s/0<l ㆕I((( (0lDP` -LM0`p @0U `p KT0 R 0-LM@01 00H00 0 P=0S P0000 R00S 0Sj00   P$0$0$0 $ 00 K0K0h8/Il 0-LM@ 0C^ >40 0P40:  0   0 S 0 ' P0"  0 00S     Q$0$0$0 $  R0 K0hK00 K0h. 05l`P p-LMPHiD1Da @ T`@L0S @T U0 0S6 0 0 R(0( 0@ @T@T"m(@T 01 Pp 0S0  Q$0$0$ 0 <0$N(@TKphz 0 -P0LpW `0V0e8@ 00 0h!:&h!< -LM 00 @"0>/0\{  0SR 0 0 0  0S 0  0$00$<0 P70\0= 1 Kh0  P"pK x D000p Pp0 <0S 0  0$00$<0  -0 0P0(K - 0x  0h!#40   L0 K0 P,0p(P0` @u(x 8 0#40"!B 0SPv@<D Ohd0  LQ00R 0S-LP P00S00S000PjTQ00R 0S-LP00P00S00wj| p-P@L` P?u00Pc` p p-P@L` P&u0,0Pc` gp -L4Mß `X V, p@\ 0S PU0S s 2i`Ÿ, 0R(K0Si ^ITL HK0FVS  T DXwpX82@0T`P0 L l0P ! T R ,0S00S40SQ 000Y00S @0S p0:0 S:  tP @UIL\@0S W 3S@0S<0S= ,@K utPX<\`Q P\ 2/`V\\ @Kp,@K VtP 80SH0S 40X FtP `HK @s80S40S 3S>,H̀\ -LM@`= 0 7, l09 n P aAq喏g`PUPEU10Cs0S1RSP:A 0P04,$D L,0蕿P Cᅾ4 0,0 l0 1!pᰀW5@X)PUPE 10s0W1X*qA 0IP04,$D t,0_P UPE1(Kq000 pᰀ@W :::: |2-LMP@`Q< ,0 E 3SD,0SA00S>40S;80S89 0 Pz 0@S.0S/+p 0P" R㲀 0S0s 0S! R 0SJ  0 .P 0 1(K 0 000  0, X,  (Ko04(4 S :0  0彾P @0 ,00 ,⾃᤽0S0S P , -L4M⠒ 0 S, P PL "0S/0Sr 0S 0S0si ,0,`Sg HKH@K@KL0K ^P , 0Ri(K 0 H0PK@PpP] H R 40<0L0 L$[w0S00S40S6 @0P@8P00S 00S 40S80SQ2 [p@0@p@ R 100S40s80S pP,<( " p89  K.0Xx80 f`1&04"43KCBK.,I*쀗x0h -LMpS0,0 @ m 8#QP 8Q ^*8T!0CT*8T 0T$`-` 8Q 8QU[  F`, 0Rc(KT8T L8TK 1CTJ 1CTE ,8T\ u4T+ 0CT' 0T$ 0CT! 7T\0CTq:Y 7T0 7T 7T 1S  3/`70S-`X7T[ 0TY !L7R/`U`U  0`|`|46T :60SQ 0S0S 00Sk 6T $0CTd6T0CT*%0CT0CT*!1CTM1CT 6T 6T`V5T~ 0T}U Yq 0s %`V $0s %`V 0s L@0@0@0s $@`0@0@5T Z,0CT34T 1 0CT 0T<0s P`!Q R@ 0A0@0s> PaPU`V@ 0A`0@1`4T 0T @i2.B`3T 0T6``p3T*|3T' 0T# !,I`d0lMTC P`VP KlPPip GpP4K K蘐K⬀ 夐 K p@K 嬐0P 0ଐ 0 Q @0[d|0!s @0K x0 K@ KH0 D &WP Z 0S00 h00h0X,F@Xi2 嶣`;(0`050@`0@/0@0@Q60@0@5U`U`U80@`0@P &04"4s0P R 6R00&04"40K KOZP40S^`,,liHMi iildiHNi4WiHeiHii "i %i i i>Ii i Qi *FiRi Si !i pn -LOMğR  Sd1  0R,0 ` 4Q 1CQ 1CQ -`, 0R(K0  0Sn0Sk1SSg1SSc R`3X_ 1CX\ 1CX0I dP P@QK@`0SF0SCpKh  hK h@T00   1FS0K0K` d1x " p\`K dh\P<0X@P80T@40P00  \P X@ T P ?hP <@KEh0)T2X  \K :hdpWHpWE 0SY L`K &hLP<0H@P80D@40@00 \K LP H@ D @ gP1X3 WOKh  h(SK( hd6 ^K`` g|| g` d1 1!KgT00   c1^Kg( (gd!6 `F` go00`\FgpK`g  gK g0,iiii  -LM@~@0T0 @T 0 R0 KN@T -LM`ptV <3PU,P  0, 00 PUE D1S@T@T@T 0SJ, R 0iSl PJk `2 R ,0 P00^00Sd V50 0 ,@ ,0S3 ,  0S9  0@hl*P hl* Z 0@hl+P hl+, 0 0@+P +,(K 0@*P *1@P ) 0@)P ) PZ,  [,` ^RlʗRV 0 0bSPRXWVU P y47G D -LMqQ@R  R$ ` $ 0R` K\a0S^ .S\ T 0  QO .QM Q0  0 n?R0ns 0tPK0K8g0[ K T At [R A0Bs0S 00 R@KXVf K [4PKEf00 < 0 B 04!40 7f00 n0, -LlMp@K0`X 0 fh0d 0PKN f0 000#0 QK /, -LM0嬀K8 ,0 e f@\KxPKHpK` p  K`KdKc`KK`K4 0 Hp PL, 0R (K<0 R  0  Z /,L܀I| -@LQQ 0S\  R lPpGP P GP P UP#P PUU` qeP  keP U U00 0  0 0 0  0000#0  Ye  CePDD -LMPpPDa0S"$K,1@T T P0-@TP0`0S 8 Z8 Z0S 0 @ P `p pP@ P`pZ8`0S 8800 Y8 *YI47(` "-LM`0FK8 @,0 ! d e&r0P4!01Kx (0Ky~P ( 0R:0PD (0Kg~P ( 0R0%p *S @0 /,1 -L R=@  ⴘ Ⱈ0 &PU `Q 000p W wxQp00 0  000 000b00 00C0 /LR?Sȕ$ 4T 00-L @R * #yPP70uw0 U 0 0C 0 0 -L∀p0St`00P XP 0 0@ 0$@mP00ȕpn -LM☡向, 0STtq00PU 90P0Cs0S900a (00@(0,@2UQ 0R*0S`0 R 000 @004@  0R:P00P 80S0C8000,@4,,, Q(~Rpnȕ G d4 -LTMt x X P0,0 ` Rp B:WP P@K$/]| (0 L @KG0KHK冗 .PP`  @0S 0`0 6 80S0C80t0P0  0$-0` R"!  0\\0@0@DL, 0R(K T0K|P T 0R0%p * R[`0 0?  00@` 0@R 2@0x x| 0x+ 04"4s0Sp0 - +D  h00@` h0l@R 2@0  x@P304"40e 0 n`0S "*0S"J0t0l:Q`: QT* Rl 7lPl 2 0l@484 <S  ?\P| 9\Pd p@T00Il,0 8  l0p@$,0P4"4ts00i(P=00S0I <0)0Y09, %p R3l0Q.l,h0 00Sh @\\@ X 000  \l @  _l0 ZX@\0D hP  P  04d 8 <0R 0P4<1  04l 8 <@,<4 ,$#:"*Q | 0q03R0S ql@\  @0T U0SPQJ 0 00dSDil@T  Q000  =uWl @Tl@pƟ00 O0@l  0$@Ql@P0000l0 0l@000 0l0b00&00C0`P " 00@0@  0U0@% 0$@Ett500\XPP -pRL M@kP `VPPsP4 ; Qr14Q(KX 0W0 0 ` @ X p`BpT  Y* 0.S  \R , vV0 ]* Y 1 1Y*p@0S .S p W@:000Q0D>S@ALaPLq u0RS00Ls0 S0SA Na0Nr s0RS00Ns0 ST0AALaPLu00 LqQSr P`0 R-\QPNN0`@TZ0.S 0 R P :,0 0RmQ 00,0 S 0C`00c 0a0,0 `#qX -L 1 0( 0*m UP2,p lG($ Q-LM@PpU UTP0 SRL00SSHDXE,p LYA@> ;` ?T4?R2T0HP4 R0I\/ T& R$ T"0X0Y`P UP,0pcXj Y X`Y@   wUP X0j S -L M(0P (  @$ (,< 4!4"|W`( 0Rn$K1)U0 10SPDKHU0 C0KD K,I(@Dd 'Q-LM@x0,0  `9 RkD, 0RK(K(Tv 0/Si:0(000 (0@0S; " B?0@1 A00S- " <0@1A"0S " 00@0@0S " 00@0@0S " 00@0@0S " 00@0@0S " 00@0@0S " 00@0@0S " 00@0@ R0S " 00@0@% ,I|G <#-L0M0p,0 P0T0 0L0 R0% :X{ HK NT0 H0KX G K  2@T `@TH l0  v0:S,0S00S` T , NP0S 0Sl X NP R 02   Ve !0SkP^ l 10Sg Lf@  L0I~PJ 7hLPG 3hEVG l l10S L KZ /f@  L0,~PhLP h, 0R8(K40S80S @r P0KBnP P 0R0% b*oC$0S(0S @rr0L0 `igT0@PP PT  L K ,ʚ;@ -LMR8 <0  08 `$0 p4 V PUPU 0 R0'0   PXUYE 0'X00SR `pS00S0 @ @P6 P0 P0  0 0  < R*  H!PQ 10,0 @ ,K M  M00S <4 A < 4 `00  0   808 04<0#404(K100S00 P p <4!4"<,0 0,0 0 4 00 0`e4 *47 -L M4  000 0SJ\H 0 ,1`VC @T= p,p @T 0 RZ0P 6P& P' P  0   @pT,0S`V p(K000P BMP0,0 P    pp40`47 -L,M\ş 0 S0, L0 @P` G:X+ @T@ HK@@KL0 TG0KHKLHK(^P  $0f4"4pAs0sZ wwvv R* Rp f@l, 0R(K RWp`ZO Z* Z y@yxxw P0KlP P 0R:0S W0  e@0[S S T xLPH`Kp |3  0L K28` Vkf@Py  DePVD V:#f!f@2  <`@0[S?0[0Sw2 !@P 0S 0S 0R0%0"` :V  0ZP ep~p<`8` ;gf1 ` `( ,L0(` &LZ zlzy,z0008 0800001 P 0S0 00s00e18 00 :dL 08 0000PK4 P0 K0000W`p 4?0[0S:17 0S&04"43K/?0[0S S)  P0KkP P 0R0%` h*@ce>,G@ -LM  0`,0  0RPf " 0@Ux-P`>0@ 8$H0S 2  )eM,  0R(K 0 S`  K:XY @: 0@ "pP. ̟! !=0@@8DH@T JTe T TLP 2@0  @T^< R+P`(8,H0@(8,H0S 0K kP  0R0% * :@ x;@P $(T5 T :T Tz 0; R 0Ps0Kn00S 2@08 8< @T  8H0@8H\U\ >0@@*084HTW TP 2@0( (, @T\ :T0SP "  00@0@ Z K.0@j0 Ly?M< HT)00S 2@0  UxT :0DSdq00S " @00@@0D@0Sv_T:UT 0S 2@0x x| 0(0f@P !A0S6 2@00 04 )00S 2@0` `d @T4UAt'0fP  300S 2@0P PT @TU#&0fP  ?00S 2@0X X\ @TU&0fPt  1d60S U U8&0nfP P 0@8xfP   @00S 2@0h hl @T'U%0 fP! uP 2@0  $ @T\ TvW Tl$0epP 1 0Y p V7cP A @AQ P0PQA@AA  D000( @PI I0 0 000f0C0`(~0 p(0  0@8x 0@ 8$H#(IxW@ 0-L|P@ R 0S00S0 R  P @0 S00 0)*0@0 @P0h @P-,0@0 @P0h @P<,0@0 @P0h @P  -LM`@p 0)S0(P 0 0Q( Q0%(":P*0@P  (K( ,0KaP , 0R:0( ,0KaP , 0R0% *870 EP00@ @ 0-LxM\0 , ! 0S 4/9I 0@/9I0S @ > > #=0@8H0S " 0@.P`0@ 'R!P00`S5 H.P`00@0@0S 2   %[, 0R(K (p"`P 00@W0@ 2  0l`p10  Pd Q0SW Pl 0Si0Sf0Sc0&d,P`00@0@0S 2  $ 0P l,10@#P (_<,#= 0@ ,8HT,'= 0@+9II+8H 0@+8H> 0S$0S00@0@0Sa 2  $ WQ0Sl ^a P 0Sk Q0Sj 3S. KP' *P`00@0@0S 28 8< 0S 2    0iP 0S0S0S 0S0S 0S$0S@0p0  (00 $04"4s00 P`  (0BSc:(R 0S  0 (000S T  0S 0S0s 0S0S 0s (P00 @WP0T@ 2@ @D 8V X@ 0R0V0Sx8 KK 2 1C 0\ȟ1 0 <8P` 0S @S0 R'P`00@0 @0St 20 04 jQ Q ^ ^ Q Q ^ ^ p6 ^00S *P 00 0@pJ>00@0 D^ f0S 40L&> 0@&pPT 0 @p%l"00@0@ R_ @00@@0D@0S " 800@80<@ @ 0)S(IPX 0`s 1 R@T <>P#0S p!hKPP0T0 6EPP00S!04"400S2 S: @T@T &0S 4P00T0 P` 0T0 P T KZP 0S0 000000S&04"4000S S,<G #A-L$M̒0D ,0 0L0 Qۏۏۏۏۏۏۏۏۏۏۏۏۏ4܏d܏|܏܏ۏۏۏۏۏۏۏۏۏ܏܏4(PO 4PL 0P0a V(pNW@V   3, 0Rg(KPpphPLPK``NW@ ;MP PpP`@@K3pP`P PP``PpP 0PP `PP 8PP d0SpdP`pDPK`P l0p0HPK`H0 p0HPK`H0  , )R0-L@ P\ L@0@0S*@ P00\0S LP 0 :RPPN0 @ 0PP@\ 0S @0@ 0 :RP@  R-L@p`MPP T V @  2P; M1L77 )R-L4M`PPP , p@  <@h0 T P, 0R(KX lLPT+R< 09R9 3R0R,RE .R *PT*R〠spt 9R 3R0R.R +R *PX RRJX 0SO P5LRRB R RR0B<SN$p\H400B P Q񟗯$|Tl0   P M0P 0 P00S)R PKl0#90P0 l0#:0P0 l080P0 l0#80P0 l090P0 )00S0P0 l0;0P0 l0#;0P0 l0?P0 l0:0P0 l0P0  00P0 P0 0P0 l040P0 &RZP5 X 0S<0 BP <R<@||||||||||||||||||||||||||||||X`|0|||||||||||||||||PZ l01l0PP 7 7PPl0l0Z l01l0PP77PPl0l0l01l0PP88PPl0l0l01l0PP88PPl0l0l01l0PP66PPl0l0\Pl0l0<< Pl0l0\Pl0l055 Pl0l0l0\55P Pl0l0l00/PK pPW? \Pl0l011 Pl0l0l0|\66P Pl0l0ul0q\88P Pl0l0jl0f\88P Pl0l0_3S[,0SX00SU40SR80SO5 R; \I PH0 SPCAl0>\77P Pl0l07l03\66P Pl0l0,l0(\77P Pl0l0!Xb#R R R& *P>R=Rl;R <RP>R=Rv;R <RiK 0P 0 ^KP @ PR BPPEp\4H0T@ 9P TK0H @PP#T0L@KS T 80T000 *K 0 /0z R R!Rp$RnRl #R R PXb Q0 PK0P pP Pl0|X0 0S 0 0pPm5RjPi@R 1RMJ0P 0 P00%@R d1RQX 0SY0 @R 0$1S SP9P@IGAPPDX 0S= 00:5R7R1R 0BS")X 0S)0PP P Pl0P00l0l00 0l0l0 00l0P\ P ,<$! (R-LPp( B(0&LP @@0S1` SJP  0 0 7GP 000 0 0 0 -LM`PU*JP1 @0 0P <4!4$K"<=  0 / 000XGP @ ZJpP ; ;I1H77 0 @ 0 0 000  .0@HPp r -LM@4 8 4@a@DX(@(<4"4 0  00 p4 S@l4pH@PPd P  G@P_1(@ ``i @ 4 ,0K/@PM4,q0 n00 4!4Rs00#$ ,000  g$, "$ N r 04"4 s00#4007KP!  R4 000,0)) , )<p00,08 Q _H@PP7@(K9 -LMXϟ<@KP@ 0 , 0p  <K⨐K 0 h 6.WD 0Q#  K !;`P GGGPG|0K0 G^ R t, 0R:(K4Q  K !`P8Q  K ! `P`Q  K !`P0Q S @ 0@0@ S 00 S 0@@TP00(@CT0*t 04"4s00#40 R U5 00  0 <000S U$ 0 0 00000S U 0< 0 00000S( U 0+ 0 0  P P0S|K`P Z@ g " Bq-  L,0S) 0S&0S#0S  -`P|0K0 0@  +|P1 80S0C80,'*U N`P 0SU ʟX0 0@^|KX0\@   W 80S<  & d^ 04t*8  R    R  *8#4"<0##$#8 00s 0X@KP,0 PKW0KPg0X0K( 0K K0 ( 0`PP: H0 0@H0L@ 0S " P00@P0T@ R 0S W 0S  1<10 SK<0K@K@`P0 S @  W h0S Q  6  R R Q Q R] Rz QQ Qo R 1K@0100 0K ! BP`PE1  @01W l0 0S$20Sp  p S:0Sc RaS:  0+ P`|PꨀP `P``a  7`PPIAV  00@|&0@0S9 "P X00@X0\@0@00 @ 0S\3 0@@ 00S Sk 04#pPh  ^0|@K-`P@ P|0S1<<1P " 00@0@6S 0 0 @P0@P3` P3` X0 0 @X0\@400  @P|@K$+@ @ e\ 0SQ@ Pe: 0$a 4P0 0S  ,00 0( `P0S " `00@`0d@P00 EU t`px00@Px0|@ 2p pt  0 *`XP 0V0 DP(` 00S000 00S0 0 00S 2 P(`h00@h0l@00S S 00S S~@T @T 0 R B*PT R 0S  /0S 60S$00S DP 00S@ 0L1  00S: 00S S.W h0S  VP p0 P0@p0t@(V  `00@`0d@50S2 " h00@h0l@'0S 0S,00 , 4G -LM@` 0pR :P" 0S*  @000g@P @P, 0K=JP  0R0% *TjD0@P4  0 01  @ -LMP8 `P} Py 0DpPq EP D1@(0@ (0 0@0 BY0`00 V 0* BRdVp  Ld`0@ 080P0PPPPPPP :d0S 00S P P24`K<2 )80@<10K04 P @ 280 S & S S Y00 @K(K c2  2B  !2 !` c;C(̀0 -L @R|Wi@T @T 0 R40S C R4 40  %000 @T.@P p-LX@0SpL`@ 00@TP @TpPpn47 -@L` p04"40 04"400 RP  (P 00S pnII -LPp0@  Ġ#Č`(P 00S 2D 0004000040pnIP T00-LL@MKP0`0 00P( 00@0Pؙ 0-LM@ `R0%P ::UF  0S GB 00S0SB S1@0S 00S `V `V 0 R BU(PV 040S 00S0C 0 0 (0KSHP ( 0R0%P *D@2@P $(60SQ 0SN0SK0SH0SH  04 4s0! CP6 $#$ `V< `V9 0 RpL B'P 00S0S- 0S*0S'0S$X2 40S S90 4 0SV 00S&04"4s0 0#4 00SFs0o  'P&04"4s0 0#4 0I 0004@(MbIPl0S S S S /5S GS/S / p-`@L(P'0V00@ 0`p D1-LMp0 W``, 01PU, PV,`U,$ W,0 Z:@,n'0 0 , *0V(02200 @ &"P,`UW@ 00S @3@#,0(Kpn< -LPMp (t x 0,0 p Rpd h t00d0 2X`  ` p R d@0Pl0 **` R@0  0Rs21C@0`Z` Xp R x0`tS @3@#h$, 0R~(K @& @  .PXX00d < P0(0T , 063P0sT HP`!Q R@<9 0A 0$@h040\ =0 ``V & pl`0Vs p wP2Cd0 S:l0@ 0 p0 `0Vs 2#1C@0Q0@ 0$@Z K.0kyH |0@ 0$@t p@`00vA,pnJP S-`Lp@`PQPR00S`RU  NP ` V V*` X  `P00X00S U  7` | -Lⴀ p0`V 2P@T 0>CS0`VD0$E D 0, #5#3 0pn\47JMb P-L \  R @T 0 S *01 0 S00@ 0(% $D -@PL_ 0SZ 0SP ` `1 RLT1` V 0SBP/ Qq 026 1`S0$ V0@ \ 1S 0 R  |v0Sh0`0p(@P0h% ,`$ IIh h -L‡x p4l1d`1P P0 @1TB? U(1\~ 1`^050305:000T @~ 0`^* mT0\ P0 s`pP h H0Q R US0QzpnDI<*J -LMPHpK`, $@K0 H0KGKZP| 40 3V1 80S0C80Y| VZ, 0RQ(K @P KD$0p <0;00 K |0K P|Q D0S "|80 0C80|40  R00 R V 0 R .0v KbwZ80`0` pD0S Z @0 R V G0,I(0\ 3-LM\, P@ 2\2 0\ 0C\( P, 0R(K2\W 2\2$P xPd2P @`TPqP PUp 0`S# 1P 0@@ 0S TPVP 0@S00S yTPA00S<`K^1 ^;  D1pPP2P @uDQ "0 0(0", 0 0$@c00S3[S&04"43K00S$dliH,Oi Ni4WiHpn<Jh -L0S/ 0\"\ 0S\0 0 ( "0 , "0 0 " 0 4 " D1oP 00S0 $#$r QJ0,t -Lpᜠ@T0 `\0$00O0@(0@90@ 0@$ (pn* -L8Mp0\,0 P@ ?P` 0@H, 0R(K  0@TF 40`0 \V?  = DVZ? "0 000& 2SS Ss P f< 0   `VR @( 5`P 80< 0CR80A A@X K<` P2 Z K.0nu 0`@ |0 P  w D1`PϱP`P 40 `40@}00"0 0 @Ba  0`_Q'`0( P`40 `_02l `0 0 2kL0C00 <0 2^,I\MbItI -LP@( 4 00 SDP00S0S2ST0 00S 0 < T0 0hQ  P4 00 SI !-LdMP 0,0 `<@KD^ < < PK p ! 2S  V R H!H ɯS"`X<9 1 X `< 0J @KD`}!< 0n |0 t D0\`, 0R(K2S < Wa),lGpn*I p-P\aLP $0@S0SD TP $0@S 0S6 T0P S) T0 R0 R'@0SpSp0QpS P 0 R 0S 6R20Qpp0h0<: @0Sp<JlGGI -L0\@p S Q@0 Qh08 $0 QD2 |0- LP8è0@ 0P0 0@z  ,Š?0 % :,#3 000uMb 0-L\P@T L0hD 0<<50 ,,00h#,J<t\ -LM@x$0S$7 PU <`V 2D pQ Q~Wy 20S*4)4)))*D)(1 Q>001 1 Ba0 X P 0002 0RZ0 0S0R0Sb!000S_Q10 0  000||!00C0 .00V K lX P80H1( 0RA$K1 R 8 .00V Kk P800   j 0 0 0Ba0V K.0 @k8@ H0 8,pnI\X`20Mb -L4MdŸdr`0Q,0 P2  0 PE  00, 0RK(K0S 0Sf 6 P8| ㏠PL 00 0 0R0-P 0V0 0  > @TD1r .00Z KKk P801X '0r0Z K.0 @3k8@ 0B .00Z K'k P80t04 t^  0D 0 H0Bax0J,\GI$`2`Mb -LBMǟ@<K( 0P ,0 dR LK`R& 0Q ! 0%P !:U/ p\K $ OR`V0 |V0S0Std6@P  14, 0R(K  0K7P  0R0%P * 5@P $(<0S80S40S00S $[5R xU0S x \ <KƦPd \0[S S NKH P !R! 011 0SS 0SP0SM0 s 3X RF T0S n )@K.0LK Rj c d4 R| \K .0Ej` V r K.0;j K.0@5j8 0C 0S] <K K.0&j 7 PS0SL / L [ \K ! 哦Pp`P`: lK@/X m0 00S $S0S) \K K.0im0A$  <K P Q <0S 80S40S00Si 0@K$K( 00KKh@P 40  00 Ry R0S ( [0[0S&04"45K$1 R  H0SD0S@0[S !<0R  S! P!80S40S00Sl`@@\(2V <K\ K Ġ%ČKpC @1<K @`00S@0`0Q   <Kp0\ K&s<K K.0Ei V i 9PP 0p3a `&,lGI @( |ddd0, NP, 0R(K0HK0 @>p @Kd`KGpKH@K93PK (\Kd@KcpK/D)H0K0 ` D 0K PP%\00P\0 D!<1@T T \0d0d R @T R 80S0800 R @K K.0cd08P ⯟P `P P0 R  K.0c8d008` ,ITJh -L`@T 0 D1P DP 2S@T -L8MDSDs@0T 0  @T X0 P @@2 R T5X0 \0O P\00\0@T 0S00S@T@TX0 \0PUO X06@T 0S00S@TR@T 0@ P P:@T R 0@00 R 0R`KnP\0\00\0 PP T1 R N K.0cd00P `P 1 R\0@T 0@ P >P000000@TN K.0bd0` \0T X0 \00\0@Tk 0S00SJ,<Ih -PL@ h0@#10#T`p9 p@T 0 R0@ Md0P 0kP 00Sp`0WV ` h00Ch0OPPh0`0h0EPPh0p0h0pn -L0S9l| 㡖PP3 l ITP@d`@("0( @0T0@0S0 00PX0X q 00 0( 0R$K y 8@P \0 R V K.0Ead080@ Q G,pnJIX -LM0@,0 $ T|@  1 ;|0 P X0X00X0X0X00X0X0 @@0P08`P0@@DPH0T 8`0K P $04"4d!s0@P@PRL@ HP 4K <(4"4%,LT0T @d0$%h#5$ T%#3 000`1`  0 48  <,$!$ , `PhKPQp% 8`Q 01`P:0SQI x4 R  8tp4@P $(&HQ 0S X\? 0 A= m0 00T8 3 R <K K.0\m0D  M?K)P 4 0R0% ` %;*@TD3 R  `83 R @ @ 0<K@ @ 0S~ Sx 0 S Kl 0 GK#1K$KC0 [01 2 K#0 K0r  #30 K00K0  $(,< 4!4"<0  0 @ P $(,< 4!4"<0 P8AK 8; 048< ,$!$#\ U*X1 RO h K.0\ l0%D Rp0 p0R@1*T:0PU6 ?4@00S0 R  K.0[ 80 R h K.0[ @0@Td @0 R  K.0[ `08,GI @*6MbJ؄((@h,X -LM`P0  0   00#2+! RԶܶ  K000"000A10 00  Kr0 0A100 0L0 dUU33 4-SLM`p3P:W) @P0@0PU (P (KQ @ < @ x, K00KR"P , P UJ U @0C@$;0 3$ 466cR 80 2 8"<08\!0l\<0  0 R00L @U^ U> d" 8T2< R42@:0#::cQ80 0@0 2 @0 !0S 1p!0P1\ 1R 04 K04 1hx!p,0d1 R P!pD1,P01P\ 01R' ,4 K,4 h00@  0 R p00P0P\ 0R 04 K04 hpl p`0,PL0\ P0R ,4 K(,4 0h0ܙLp"xDh"! p-Lp P 0 R L x 6tP h@0`00sG-nG00C0L 5Xpn@K 0-PSL@02~s 0H00H00 R-L@V0 R-L@K0 R-L@@0 -L M@4  ,  R uRu B,  tR RQT10P400Cs40 @`0 ' U% @ + T:/ +@ :/00 Ep6S :/Q q U6*P400Cs40 (Ku, RPE @`0 4@D 00`:/tU:x:/PP `:/ᤇP T1H,P:/8:/0:/`|$+(7o<XL Q-LM@|h+p(h%`!P$@H4,D h @h/ Q-L ( p-LMPK0@ ` % Pp  0p $0-L@P 0h$+ Q-L ( t0p-LM@ P(`K$0 P0( 0 0  P  0KpMK $0-L@P^ 0hI$+ -L < <0PP   `0P PpAA/ 0a0 +-L208<T,d 0-L@!!@ 0`82@\@0  "!,<D0 - "L 80!1,<\,D0 - "L 80!1-<\, 0 -LAP<(0 -L8@,,, 0-L 8@\,l0 -{@P`80L <$U08< 6600s0s0T,0 p-L`4^%@P00 R  0 QPR0S P Q 4@^P40phD2] 4,</ -L@0 t -1LPPp`540U208 R   @P, p P40p!! 00! 0Y000@00 @  z 0!!  ,XM 000 -L1@ 8h<`( 0-LPp0P`' 40@0 C@D@2A@ 00PU PP 0@  PUiD0 0@D0H@, 0-LA< 2-LM@D7P 00K,00 P ,0K00*@P,00 D<0@ 4 8Pv, ,0僒 p4pW?00âZ`BB@,A-0\` -,0\ VWBnK ,0T+@,0TTW00CbV @"B" @!+,0\T1 W0 0  00\00 @ 0 @6, 0\0 0\ 0!!(K40, ƐhŐǐlŐ`Ð ȐƐL@ l -L4P0@ , `, p,V0@@P`0(0 -L04,HL 81p-LM` @P0P**1%! 0c2VU!004 ,`d00  R00C0  R004 ,fU*pd !YUd00  R00C0  R00C0  R4LYQ'C0 -L @lp P`~0! ?0d0s2 R0 0c04LpnX0 p-L `O00@P @P8<@@PD@HP\p4LD0 @0\/00  0,!!4LLHLMb 0-LM@ ` 0000 R 0p 00Lp @0`P 0@P8<@@PD@HP\0 08\4LL ϐ <2-L M4 p0`S  \0$$ L000# $00d P   -L,M`$ʟQP 0S @0S @Q%9 (K @2S( %.9!  p@A0Ds0S, +4 3D 4 P0 H9L @)49 < $9$)TH 8 0 @ x #0DWS񟗥lސlސlސlސlސlސlސlސlސlސlސlސlސlސ4ݐlސlސlސlސlސlސlސlސlސlސlސlސlސlސlސlސ`lސlސlސlސlސlސlސlސlސXݐ@lސlސlސ@ސ,Llސlސlސlސlސlސlސtlސlސtߐߐ\ߐlߐlސlސTߐ$ߐlސݐlސߐސސ P0xsA0As0S Q ,Q, 3 <@T J%40S %%vD T  |h4%0%(0 0@%$%%( 0 4 D1?3  ?#%z t%ndi`@pT 04 Z DW p@T w04p@TB >%80!0 H)%t#%\,O8pOS"B %$40S 3  Z p%p1?3?3t3t#0JS$Jt %L30St 2t  W <%60S %08| thKA; @@ l DW!p `@,   da]LHXfT\THx<%(`s5e'P $ 0@ H, $+ < 8 TD L o XØ x d 4 \ ` h l Pt p @T / c L qԡ 7= / .Dx 000 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 2 R 2 R 2 R  2P00 R@A0P0A Rbs_notimpl_%s: args at %p-(O @mmap@r_1@r_2@r_4@r_8@w_1@w_2@w_4@w_8@rm_1@rm_2@rm_4@rm_8@wm_1@wm_2@wm_4@wm_8@rr_1@rr_2@rr_4@rr_8@wr_1@wr_2@wr_4@wr_8@sm_1@sm_2@sm_4@sm_8@sr_1@sr_2@sr_4@sr_8@|c_1@yc_2@vc_4@sc_8 -pT`P@L L8P,0$!D0< $00HT!0C00wwww -L0hA00(0 L0 R h ( LP!0P1$u<8<2-@tAPr?0RW` D ,8` B`p Bp` B`RE0C`R9`` B`p Bp` B`p Bp` B`p Bp` B` B`p @R B`p R BRR `` B`p Bp` B`p RpPP2-BtAP00O0RW` <$0` B`p Bp` B`RE0C`R9`` B`p Bp` B`p Bp` B`p Bp` B` B`p`p@R B`p`pR BRR `x` B`p Bp` B`p RpP2-DtAP?O0RL` (` B`p Bp` B`R:08`R/`lx` B`p Bp` B`p Bp` B`p Bp` B` B@R BR BRR `8\PD` B`p Bp` B`p RpP%t!$0000%t!$00000&t!$0000<0-2P? @P4@54?3P0p-2`? h@tAPPP`5P65?3`pp-2`? @tA QOo Q#A0L ;5> QOo Q#A0L ;56 QOoOoOo -d L 0-LT1P@T 4 8040< 8 H0<0 @ 00S 0 0/ ` Q-LPM@8 P `KP2X00S KTT0 0PL0 0HD00@<008 40$00(,0,0(0$040 80<0D0H0X\08<1 -LMp ! hQ1 T!D1$@L G08 0B`BKU 01 ! q 00  00  00  00 $00 ( ,00 0 400 8 <00 D H00 1 0 1"BK P 㫋p10! 8`HH1<0(K8PG0! @0T!t1*4 tRt!40L0C0(KD)p"s|DDM<HM$ux -L@Q00 L h'4h0  "!L lM4 @-@Q >0^ 00\R 00$0(000/ -LPpᡀX`@  (0@X -LPp!X`@  ,@X -LPpᡀX`@ 0@  XX -LPp!X`@1@  \X -LMp `( (@K0 PP$@ 4HP4( :8 ^ * 8\030#\03S@ %^ 8 R030#R03S: S@*21C "!B 0:0^ 0 K \ -LM`@Tp*  R $ PR @0PS L   0 rP  @R(K @ ` M-LpR0`7 0@06:#:S30!Q0 0SK! ^ PU` 0@0 :#:S :#:S0S R^R;9 7 -L.0 -LM@ \ 0P 0 0c80 0圢Xp{ `Z}0 K40K  0 0S 40 Rs @2.! ,  080@ \ @, T>0R:00P^ (K\ 00a, : #::cS1!^, ,8000`\! R P 0pWB21C0,0,0 X 0 `021C@0  R< ^ 8,0 0S< 0 0p  , KV t0,(!(, "*46*80,  ~p p"!l" -L$M$( 4 R80 `Y7 080 0 VR"PpPP$8V@1,K040K `V 00pR00SP 00  $00( 0(K!X -LM`p$(!3  0R,0W80,  PP p 3U00S 0S  @,K(K QR , 0 00$( p0$K -LM@\P$(`3*KpȌ$  K$K pP$0 0 $P(0`p: #:S-L 0. . hO|D >0-^0PL@`P 0Y`p@00T*U 0U  0 J0SjZE Z p d|Dp" 0-LM(KpR(0 $ '`00^*P0.Ơ\|@ : 0c \A 5110a00:00$00$  $ 0S`V ZE K8 -Lʠ,ʠ! Q`PNS$ S S010!p $pU4W@ QH `@H `@P h`bb@ PH `Z( ` Pj 8@L d-0D`00$0(000^n -L@p@  `,P~lP  `00  000$0(0 0P0@-@P# T!00Q:P  RR*> 00 0 bR !. .0 00 >00 >a 0Q00> 000 -LM< @  @0$ RY 0R:@0@0S 0 Q @ Q,X<+4'@P, 00 p0 X :00j 000 0 X*@TpPd@T0 <0`0V,0  V Q:>0 >0 S00`@ `h V `! 0eV`! Yy P@0,`pPXp e `"*<0@T Tf Q:>0 >0 S00`@@h T @!0T YI @ @,0p80 8 X :8j 8 8 X* Qp@a Q< 8`0VP4  V: U:>0 >0 S00P`@0 `h V `! 0dV`! Y @i0p(K ` 01, 0 +o4  0$ ,,J(H ED`(L -LM@xPQ $3\ b  S] 2"S0"p%"1E1@8 1 82XRR0S  Z$ t"10@T \\"$KmP2 RJ D2DD ?8R0 A0B%@ Z$K1    0!h!pPPLZ2 : Z18l1 0\T$KmH1P 1R? 0\1LŠ0aB%@0P @`1c`]}y $KmsA|\H$+T(8lL\| @00-L8@P 0|1x!0hD<-0 .!  !!-0 .!  !!<D<@@-``6$`t`6 !!@@- - pptp`T! 0 p?`T0 !@Ј!  :P"  Q -<p!W R !P Z4 xW(0  !@Й! p? pG!@- ?r  !iDЍReset vector called, LR = 0x%08x-DMO- i@0lP @!1 ! ,OiDЍN  0O   ! -- -i44HX Dl !-LMA0`00 p 0SF 0 !pwhQT1`  0p嫃oX W): N@ 0P1S*  0? P P+000S- 0S0) .   0p}0 R 0 : X  0 /  0p^0$uD<4d -LM@T\ 00 H  -LM`p \P@  0 p0T1` -L(MCH |#000D 0, !D+0"3<#<hQ8#UP0S\TjXH0H XN@! pD `` 0P< X ᖂ(KX080  $YD H 0HN@t T*T2 R0S H 0R6BS 0$"0Sp 0C80 H0D4 00 , 08, 40宂!1S0 @ 00K @  P< X b80K0 DH 0(#80"*^000 -LMP`0 Z*&:0:6h S1SZ F:#U@pT $!000SW-jZ1P@p 0P*0hp0P0@\ R , Kl}, hpH0j8Zx 000bQ00(Kp"h"D -`LM0:#5 pP6U0000 000 0 0000SY @8@pP\ 0R , KX , hpY <@P*hp" !!h"D Q-LM5 1@@h1S 0܁``T* pPV @T 0S 0P` RC WtP, KpP ,*h@pTW!$!$A80!0! 0!000S@8P0 KP(K0*0hp@\pP\ X0R , K$, hp<p"D |!!!h" 0-LM0D @P U`@D i 000 l0SN  1X\ 1h1S 0 XT PUO p@0  000JS$E0`  $1(!X$1$1 00 Y R 0 R @pP\ 0R , K, hp0Sp0X d0h1S 0 XX0(PU(K808@PUp"<x!h"D -~LMpTw: L#eP@X*`1!0S 00000 R8 0S p P\ 0@R , Kx ,+hpp P\ H0R , K , hpp"Dt!h" -LD00 -LD00/00 -Lh!R0 @<D 0-LDP000/0 0 /0 0 00<10/p@-PQ@` %ʠ  00S0C 0 ~ ,210P  21C0P: #50 p p !-LMHP Q:0Q*b"!B10b0 @ R  R 0S0U 0`0 0 pK $0K00P`$`  0 R@8Kd@pP\ H0R  $  hp8p"h"D p-@LP`HTpphT0 R 0S0S R/: #:/M 0-LM@\* \0 0 >0 0000@S0 lPpP\ P0R  K@[ hp00h"Dp" 0p-LM! P @+  0;00 0+ R 00Ppp`pP\ T0R  KD hp 00Pp!h"MDp"0/ X0@-@P R 0S \ R X0@-@P R 0S \ R 1- P1!Q1 0 0+ 0 00 .0U 0 00 0A 0 0 0 0 408 ,0D(!d"!t!!x!!! a!Lc!l"$ -L0 0s0A P0P 0fA.0 A@ 0! Ⰰ0A` 0 p0@ 0 0@P0?@/0R*@0 0 !d" p!p$!x!! t!!(l" 0 R 0a B0/! P-LM@ D 0 S S8 < 4 t3t#0 <0 h34 080 >0>0S00 n  ) ,#0< >0D 00@@02 RxDJD ZQ D @46ZS#PP @): RP 8#8ZS#;)6?>41@D0 pPU@" W,U>000 R bpP\ 1R , K, hPpU@D J(ZD 0(K)6;#;x!1@p1p18  0D00001 RD JD QpP\ 0R , KJ, hpoPpP\ 0R , K3, hpl0l 0 <0 `04 080 1 LY DV@Tt!h"Dp" !!!@   p-LMX`PP @ 0000@PKp  -SLP`p@ <yP 0*"5060@0 p"t !:-LMP@0S PY :h!#Šd1@ R`L 0D!0000S)(q81! 0S7 000 00S ppP\ 0R  K  hppP\ p0R  K`q  hp8 t!h"D(p" -L (h!< -L 0  ,0 R 0 Q 505055/3 MM 0-LM0S | 0@T00 KKhZL0.0*@ @@@C 0@ M|DM 00-@L  PRt P `00  0@@080) S 0P p"0D 3-L☃M`0 0 0, 0` V5 0SpPP F201@T 0 A@ p`P 0 "!B 000 \ P ` VYZ @: JT * P PJT:@b@rT\$,RB00 "u A0!l 0!d }!0\!0W1@ CD?FD@b0$J|!@$B!PE LP!l0!:41 P0  0 P* 0 P" 0 P0 PD\(KY 2 1C! c@@? &$Ԧp"05PQ pP\h5\, KH@e e, hp@T0D6Q0D\4@$؄@:#:S14$$`Q,K+P p 0!+P 80,0 Ld4 \4 ,Š,0  P 0S8*U `*:"*#:S+*3#$PQ  0*P 8000 |3 3 ,Š00  P L#0S8*!#P0`@>$<  PI2#$ Q4 \  0*P 80,0 ",@<@R"<00 4,Š000@0X2 R]<8*<,"B0S p<P\ 2R <, K<,*hp00"080!Bh0<  !001 0+; !0,K+Pp0K+PippP\ 1`R 0 KP0 hp0pP\ 0R 0 K:0 |0hpppP\ X0R , K4", 0hp4,pnDp"0!h" xv! !t!0 )Р)0 ) )0 0-Lp0 40"!B P0P0بP0 R00 0l1R0C00p1@C\PU0T 6 @^@D H0L@0 OMsM ,' 3-LM , ~p@g00^0PP U@`L@ $@K0 0z@$ 00ZUj KkHMp"# -`1LM0800 0(0K TpP (KKCpP@0(4 P 4 Kp0p , 0 (DpP0@ @_0  Kp0 DpP0 00GHa 0-LM  h Q $ (0 T +  T.@ 0T!.@ T1:40Z 0 T4PL L@E@T1)$ R(0800` E`0$0004 K0t5<<$0 / 0-LpD/ -Lʽ# -LĽ# Q0-L@P0`0 0hXp"|D Q-LM`R>00~D1N@pdPP B  0d0T09*JWZ3 Z,K00K 00P`0`  0 R pP\x0 \X #, hJpWZ (K |Dp"h"D!1!01!!!!00 / -@LP 0SL 101000S 0<pn -L0S @ 10C1 R0 <pn@) -@LP 0S 8 101 0 Ӽ<pn'$OOO0O0O0O 200 RO 200 RO 200 RO 200 RO 200 RO 200 RO 200 RO 200 RO 200 R 200 RO 200 RO 200 RO 2 RO 2 RO 2 RO  2P00 RO@A0P0A ROA- QQQQQQQQ RA- 0@P`pQQQQ R@-M Ѝ@-MЍ! !P: ZŒŒ#! !P: `B!,aB 0>ZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0 Q@-: R (2 R R -PPPP RrPP B PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R- RP1P P1P RrP1P  B P1P B  R010 1  B R0q0`0q0`0q0`\0q0`0q0`0q0` R 0\6 R B0-81, Ġ%̌T$\D#L0P  R0 Ġ01#̌  R R B0-81, Ƞ%ȌX$XH#H0P  R0 Ƞ01#Ȍ  R R B0-81, ̠%Č\$TL#D0P  R0 ̠01#Č  Rp@-@P`R p0-@P0/R0-@P \< 0L l4 @P0/R0-@P \ 4< 0L lRQ@P0/QP:/// Qp-LM@P` S 0Vp pppS`@rP`&0-@P0/R0-@P \< 0L l4 @P0/R0-@P \4< 0L l51@P0/ Qp-L M@P`S K 0V Kp  Kp K@rPp`(Ƞ"(,Ƞ 8! p@-@PpS`b `c0#3 Q a l.^#(8.(030# 80 (3#0"P@p.8BA Q ! C2 Q-L@P-S'pU#`S PW0#03d g0U f  e00#2 S06"l P@X t@P` r0(@pP` a@-@ \B/@-@/0@-@QP a0 ^1200 0100 -L\M@P`p H5x^`0p(KSP 0R p#83Kst00 X$rP 8"(KK<K3KsK#KKKSKx p :@K>[X: K0x p0 8@K6[X.[ *2[H%2[ \   p@ xp@ hR6@K80Kx0 p 3[pS20K0KnL0 |  0KL L LJ 0| S  j0R A EJ FK  0SbZ X#P l %*P0 l l0 Sl :\ p L4p Bl /@P@ x0pL0t0 \ ` T h ` h0|P0X0 Ud , HPPt d8RIPP:p^x\p@T0T \  a n @"((b.` P0n`s #Ȱ  pP0x\ pT0^ P000A#Ƞ`0 |0`I00XhFK 0h 峐`0T0Z`0 T ^" lP p ZL0l C0n0l A3><Z0@L0["[[2[x h[[$[3[xhOp@-c@bP`T !L2pQ:P:/// -LM -L MKyK K0-@"P#0/40 $ R/ 8 8#$R/Dm40 $ R/ 8 8#$R/Dm 0/Dm 0-Ln -LM @pn 0-Lpn 0-Lpn0!P!/< 0-L A<pn0/<@-0@ 0 0@0 pnnx0S/l 00X0R 000R000R000R 000 R/n`( 0-Lpn 0-Lpn 0-Lpn 0-Lpn 0 /n 0-Ln/$0 -L0S 3/n#$0 -L0S 3/n,$ -LT$ -Lp$ -Lߵ$ -Lٵ$ -L M 0 K@Kk{,00S  P ʴ\($ Q-LMP`Oڴq0ST 4KP 0 (S  R04P 0` ,0 G,04@K0@K#@@ %>@% p-PX`L@QTpQp phX V0 T p<pn 0-Lp@  "!0Sx b1!P@3HT]  01 0!!%0P  "!1!@ 01 0!!0P  "!1!@ 01 0!!0P  "!1!@ 01 0!!0P  "!1!@T @ 0!!,0 0!!n<`(pn (00-L P@! `A0`(<-0  "!@ @0  "!0!D<`( 0-PPL  R*Q U3AA8CS꠮$ܭP01P0@F ׿>  9  4P   @ 1@ 60\0#60 0! #60 $&%4,&%% ,%<N  0O   ! -- -i0 0C*0(H 0Q,%10`0 5'0 0C*0ϻ 0܄Q$10`00 0C*0帻0ğ 10b0尯px嬯d$p騯d奯 4 T4Q00C0*㕻 $哯ß #TA! E 2T PS?C E T P3S@sDP^Pp@ 0 p3N=A N@`0e S  DUß:  : ":   :  4 9@{o  P :@@U828Ÿ  0!?? 0S  p   : 0S B   $ 1!TWl!\1L1! |1|!|x1 ֮3lӮ   !0<Ʈ15#4d0\8`0@ >0 (K夯墯림垯)MhN8 )4, ), )s))<) )T)0*(4)$)4-))*0*)P*<*+,t**DUUUUtMl,)pM&*M**))( -LM 4"z6P!ʠSz ʠv00l W0 m?` @ F0WV04PsDd1 -@h!LL>H1 R3. 5v (1B/ R# |_ 1P 㯆0  "!   ="> >pS_h0P ㆆl00 S LHp@,>0<*XMpnl* T+ *+(+8+@/ 0-LM@P |ӭ)㻌0`P:3P0c 0KPP$0$庭1s+st+ -L]  00XMpn 0-LM$PK@`(%0  H`pړPP W 40;40- 1  $K(P,0KT` 04 ,5A$|0@,0K40 0@ (`4 40@`9040:/yPP4K0$@0+L0e/s4 ,4 409040:/]P4 -LM@pᔉ`P d0  (L0 HPpU` 40;40 0  4 p-L P@UpP`0Q0 0000`0 000ppn p-L`@P`C  R 02 0Qp400Pp 0-@PLDC004@@p0 p-LLM`P2CD0S U S 0R d@KLw0+8H0 0( 4KPDPKpDPd@KLb04KHP (P DP -@LB004400 p-LLM@dPK`BL98004KX0(0  04K;((0 H  P80D0#80Kp0 p-LLM`dPK@BLL0L 0SD0# (0 0H 4KcPD0[#SKp#0 0-LLMP`@KBL 0$0 04KFK0 p-LLM@dPK`BLطD 0RH0 704K08H0 ;(0 *PD0  !Kp p-LLM@P`oC80sB-@Kp@P d@KL㤷0H0 +0( 4K@ZB -PLT`@00`  `0@0`0 Pp\opnl0S/d 00-LX @RT0 \Po0  ypX0S0+p0 -L@\L0 P00R00S 0  hXphZ@BXM̑+ 0-PLAL@T+  @T 80 [P80 > P \R @TLP P 00@800++ -@LA80L0S4( L0SB80+@ - @L>  @ !! p-@LwA004004PP a`p004PP h`KF`PP80 400,PP80,4,a 0-PL7A80   080&LP @T0L H0P L0@008080 0-@PLB80 080P 厪0hAKP p偪 P 80 0800h@,o8080L,d,t 0-L00P4 P 80 00800h80 0@80A{@800080800 -Lq`|T0S\P P\@T0  nT0S 80T0s80 080T @A1@T0s @X@m@0@S VW0`S@O!1|It D Q \?HphT+0+ppK0Π004L @;40 50@ 5KT@ $K004P -LMp`Pb> 0@ A@@`F@PP@V 0@ K -LMp`P>> 0@ @@@`F@PP@V 0@{ K p-L M@PK` %>!C 0@eKp 0p-L M@PK`0%> 0C@NKp 0-L M@!KP=!C 0K@8K0 0p-L M@PK`0e= 0C@![Kp -LLMpP=@l`KL 0u03?dT LH000 05KPP _@P$  KX <0' -LLMp`P=T@PU 00p~48p@K4LPҲ; 40 405KT )P00@$K= -LM@P`pb="à 0 0-LM@ KPP= 0KK0 -LM@PK`ppe;= 0p[K p-L0@`HP6> 020 r ph0= -LP@00 Rp  Q00000`  Q h<400Hpn p-L0@`HP=0,r ph< -0`L0@Sp :PP ` p@lp 0S` 00  0PH004pn 0-@0LHP<0S0M0à r 0h0 0-@0LHP<0S040P0 0-PLr p-@LPp;0S p  `P <000p\0 R lp.0t p-L@H;0`0NP Ǥ000pH` P0 `P P@0SpP000P 0P P @0PSp ᠤ000p.. 0-L@M;80080 K5P 800800 80080">P@800800 400 0 4 PwP 4g0  P0  \0.// -LLM@`pPP $KpKL <180 @p K⦨ :R: # q,\0d0Xyd -`Lp᐀0S | Q00000|| @P@@@|@0|0 `ipn p-P`L @T | Q00000|0| 0 p -@LP100 p-P3!@L /Pp`0 0 ``d d0U 0@|     |\0p $ -PL2@T|p`P PP tP "1100pn -LM`1 =/ P@8/ LQ Rʨ0  QxpP X00K0P0: $@K 3sH`DP0< $ 'wP@ /@;p0l0 p-LMP4@0 0P!`0S 0S 0(0Kp (005STTHTT @K㓦 81R #0C0K##Ƞ#4 KK0K<10K#̠##4KK0K}}50S 08 <0 ă$08 Q 0Q:t0P 0 480R, - 0 L0R s  0 00- $@PT,00 L0P0 P00@T0 0-L$@PT0P0 0@T0 00- $@LTP,00 0P0 0@T0 0-L$@PT0P0 0@T0 -LMQ@ ?.0A"" 00 -PP``L' 0$QpU 80S T W0@T40404 0@0040rTV H0 Sɚ0 -LM00`@X 0| pp  0$  0Q"P< $ R 800 QPR 4 P00P0S  Y00S P<0W(K< 4< 8 4 0 @Kd d0, @@ 0 4 luP $0S00$ 0040$0$40HP(00(0 ^1 p-L(0`pX@X080X0 T0P$4P0T ppn -LP00S 0 3@Ń 0S 0 S ?>#R// 0-LX0@  8T0 $4T0 8P$4X0Q;+S  ; S800  ;  S00R@@@X  (RP/H0RA/0R /#R!/&R/ /#X0/0X0liLTn -LX0@ li 0-LX0@ TPN \0 B 6 +  `0   Y f t ?\00L  00hnL (0nL0 &n\0L0 &~n\0L0 #tn\0L0 #kn\0L0"cnX 0@ X h00<0L0 0Rn\00LX 0 h0X 0C+ Bn`0  LX 0 h0X 0C+ 2n`0  X 0@ X h00<0L0 0 n`0 z 0-LT,0@ P0 P0 &mo0S|0  oPS  |00PP0S -LTP `00Rp @$<0 T ,00LP@l_, \00Q0Spn p-@X0L$!;98T8}PdU 8 T0$4P` L0SpX0 p8;T$8p 0-LX P@+ `0   @  P0T$8 8T$8 <8TGX0700l@X0 8!g}h0\ <C3  `0 + +0T$8 8X0@ `0T*, ,0$8 8T$8 <8| 0X00l 0X\0@}T 8 T0$4@  @00p(1 0-LTP 6& 0 08 $4T08 @$4@h d0R 0h Sd0 P0d@Np0 -LT`@0) R421C  P ^{ —Y$8 80T$8 8X0@80T$ 8 $84  X0 h 噗tD101 -@Tp P`0P,@L 8T0$4T0 8P$4 @,00,0T0$84  00 P, 0P 00S0P 000 00P0P8 T0$4T08 P$4X0@@ & 0PVP0P'0S \0P`0  8 T0$4T08 $4    0PVP0P  0PVP0PP0P 0PVP0P    0PVP0P@ 0PVP0P 0P0PVPP0P0P/ 0-@(0PL 00ES ####0& 0 0 L0"S 0 L0"S 8 T0$48T ;$80 L0"Sp p-` @LP尕 0?.C""ᨕ(0L0 P8 TP00X0T$8 40 \ \0 `0  ph0ph胕T0$8 4`l11앗1 -@\0X < C30;L T8$8`0* @0S $8T <8T$8 <80T$8 8  0-@L$8)0T8T0$8 88 T0$48 TP`00;$08T0$8 4P 0U0 0-@Tp`L,@00 8T0$4T0 8P$4 ,00,0T0$84K 00 0, 00  00300T0$84 00000) R  R R00000d  00600T0 8$40 0S <0000000d@00000d@0@F@0@ R-L`P@ R R XL0 S4  L0"S L0 S 8 T0$48T ;$s080& 0S4*****************0 p0d08T0$4T08 @$4dpd0 Rd h0RdzF0p@ X0| K`0 0$8T 8C2@0 0 h0X T$8 40 \ T0$8 4`ph1 Q-L@   帓 嵓2 2 Q-L 婓( X0-P0L00@ᝓ< n0S  3/00h $+- -L0孟p3 p-LM@ 0P r ,`K q 00,0 02KD0 $ 0  P 0nKp,'+ r -LM0 `\,      0 ؏LqP0IP JaP P/ P `NAP GP #Ph AP Po H~P zU# JuPs -U .U ,0Es@Ti@f1 (0Es0S-0Es0S-U TTxpW ~0S V> P b#P AP.U,U`` /U ,0Es@TR.Un =6'P =2'P' VLU* .U2 =(3P =$4P5 T|0,S 0Pn .UU V/U?P{@ mw uUP \Pq,0Es0Sm?iPPmi ?`PP@:62.*&"0fLU?PfLUW MUo LU!P@* P}exL0EspW0Es0)US@@+U*U T+U*U0Pb WZ?V P0e0OPo]PkE4Pg&PcXPd^kP]@P PUPQMIE P> @L10Sar    10S`g 00 S00S`Y H-2 35 53l283X333 44D4P4p41J )4433333h4x4(3t22|2033H324@3\4 54344443485444P324523p3x33222d23223 3222`3h3344<4222(4 443(505 ! P! @ ` >?T:P0a0L P @}P(aw4A@Tq-P m/P~hagt10 S{aoPav[10 SyUPas?sP ?rP ?hPad ?`P ?bP bZ`=vP,bQHPPHP5@Ptb [Pb{ =uPb3P>?:Pb5AP P 1P* P,c 4P1@* Ppc @~Pc-@x?tP0c0=ibP8#@ePd3 _Pd5YP0d [SQP[N@OPVK PddQ=E0P =A1P= 9p5p1pd ?+ P ?&P@!e V@<P(e6G@P~ z Pv@ler p=fP'@Peg=hP)@pPe\ PeV>@/P+fX %*% P!4fJ rP@fx 3@PLft qPjXfp?P@|f% /@l phpf b yAuBf ofG0P=fCzPg@ P6 g<\@? g6\@g 4g0 0,0^ -L0aMq, f@0P00t^@0U0 T0p 0Srp  RX  /Pu@BW > h#P UX@@ <T,0S  o D5T5`5h5t5$+ 0-L@MX X ԡT  )0Kp徕1D0 P D  L PUM 0SH H U< 0 S1 R@ )0K@@ @w`P8X]TP 2/P0 @@K ẕX0T 0@ 8 SK4 eP L0 sPR*H PL U 0H SD D0 0RP D0 (KD0 T*@-48+/000  / 0p-@`L P`@pr0@- @$T P@  @ 00 0 00bS/- 0$ 400`S -L  $B (0  -L000p0 Q-L|5 p-@LMPޔ0U` U U p1  dp0 s03R0S0LāSXpXXXX MP pP) @P <1Q Q 0RS 0R S 6 0 呈0 劈 0 傈 0 | x@0@0 qP0 c0\ g 0L a 08 [X5(655D6@6P6h66t6 -LM80,Q$ 0 |66 p-L00P0`@qT  0 hp0Ds0S3Sp0 phX 0|R/tL20040365 8<0 <1Q@ᘔPpph20 @  xph20,X L20,6T677x7p|777$+777D7T7,7 -L00S S S@ 0T<8 ګL@DP 08@B 0-L00P0p0Cs0Sࠃ @^   02020 ^\\\<]x]]]^\0\0\\\\ 0$ R0@$0 @@@@X 0SC <0= P$RFD1R;B0CS0h<0= $R2 1R:BSV@< =04R SV@@ *<0= $R@@< =04)0!0Q\ 0PP6 04SP0Z00 0>S< P:<00S8  R00 0S 0 48 000S# 0 8<04@(K  0PPP"P0 SP R00 0S 0  4800 R 0 480@Ɜ N -LM*Q# QC @Q Q0 8<04@  0(, $  Q (Q Q |噁0 8<04@ 040$K0 480 @ P``0S<0Q 0@,0 (@  0@,H`,0KPp0@PD0`p0@ L #D <P`0@(!(D#Lp4  0  8<0409 -LPp`@P P 00$0 0"U0P  0FP@ -L0@S`McPP `H ^00 R00 A ` 00  0#40   0 0`P>00;00`0 P`80:0 0p0 p00( R00 R 0)P z0 0 00 000000C2Cp zP 0 0  ݛ`P U` -L0PSpG 0SpC`P p>  00 P700;00p0 PpQ0:0 00 @ @[@B Z (0S}<~}}}\~~0[0 R 07P zp JzP p 0 00[0$ 00b $0[ |: Y 0(0[0 Y 0(0[00[0 WpPϛpp 0-Lh\P T1\ L1\0@!Q*. 1\( 1\" 1\( 1\ 00@T  04/02 <008 00  0 000h50h02d 022 022@020202QQQ` Q@/ 0-L P@| 0\ 0| 0\004P/P 0S0S/P/4004/4 R040/ 0S00 /R@-@ R R R R R\000QA S S S S SL\00\ R*R Q 00\  R\R R R 0Bs0_S Ĕ\00 "#0  0@801000  0  0  @000/00Cs0S0/ -rPLppq `P@ 0@p0P  -LM< \ 8 40  -(K8K8[\0@$L80K`X@0L p#D<P`80K @0D#L4p80K 0@#4<$D80K,0@#<4$LP`80K( @$$4p80K@ $<(0K @#  @ @<  x/ -LMx A 0` pP 0p4x(K  hx 0P pP   x0 ,0 D @~L z v,0s 08xt -LM4xA 0` pP V w(K0 $Px 0 spP8@0dS,K 65)[ 0b S @/+0[0@ QY,[ 4 00 < 8 YUYp00P P Py408 AQ<0xX wpt p-LMPx@Tp $w>0 0Q`! 0$ P 0ă \ #\ @ 0S@ S Q PT $phYwUP P Ɜt -LMR pO , 4 P`,  VP- 0`S0S8 !P ݈4 PԈ0 0  84 000 P0R ,P ,(K Q-L =|訓 -LMp< =0@P,0  9`P ppß ^PKD `K=@KL \  0$`@|2 u  |#30 |x@T ^ 0S[ 0CS2<, 싒P20  P X{ꤍdlt|\\\\\\\\\\\\\\\\\\\č{x 03 0SP U0S {x 0P@S QQ 0As0_S7{x P@0S@, 0RJ(K>0P!P0{@|<|0SP${x P@0S|{x x{x t{x p{x l{x ȠAĠ?=꼠;긠9괠7갠5ꬠ3ꨠ1ꤠ/ꠠ-꜠+꘠)C|P,TД PD L䓙 680( I,',@8HPX`p$ Q-L@ { -LMp`xPP% @P 0 0 P4|  (0|P庀`000 0S 3/P V (K0S 2V02 : uPP 3 < R : ᘆ:uZ V2 z000 Q 1/<0 @R xRy R  `v`308` PP0S2  xQ xP Q R 0S ! 0,K >0|"0Q^C 202202 202,04PKS!2 022 003S2Ա02ı0 4@ SU`PX 80S 2 71 - 1Ub2   X1 -^`Rs0So$ P 1!2:2C2<2 P 0S:uP 000  뼀 :txzxP9 70 RfⱅPa< : 㝅P Y\t@h`VT0H0@-@QP0 2T?\0S 0R00@ -QLp`@0P02^-?\0S' 0R$@P! 2` ,R`P2 00 0S 3/xP /`l% -PQL`0p$2U!2S 0S @  0@P P00P00S 0S  -L0Pp2S``@ "@P00P00S`R -L MP`0pPP  P 2 L 0S@ 0S 8@P(K>0 !0Q tP 0 0P)0 8<041S,0  p @,0@S 0pS Z ] R s sꞫt' p-L0P`2S@2@Sp -L@YP40S  0y`\x 0-L@ P T,P 0h#Q\P0 -0LP 0pS` `@ 000@ P`R -L3PpS` `@ 3@P`S0@-qr@P\^  0@00@0@0 0p-LM` Q08`000 2S020 23 0S0 0(x03S0 @00Hxw040phE0(Px x0XMt$+// -RL(M000 `  L0 \rpP  7PP L# 000 p 0@T0 8<0 0Y@ H D0  0 8<040~r>00H@ R  t0sPUuL  R  rpPm  `Pe  020 a0p 0 P P PP P\s0@,0  Y0 040  8 0<0 P 0  8<040P /r 0@,H, P`0@D00P ` 4  p0@ P#D p<P80` !(< 0@p#L4P` P`  q@0s H K P`P`(KY0P`0P`qP`qP`q N 0p-P@k0@`2L  p 0 S :;;S 0S (0@0@p`0cS -L@` qPP p# #@P p 0 0l0 0R0 P0  0 0#40  pW00  vq0u -L`Pp@P P 0000P0V0B0 P00%$P00@00p P 0-L@P P }>0P0 0-PL@P P  00}.A0 P0P0 -LpP`@P P P 00  00G0P0p`0000dP^ N -Lp`P @  0L 0'̠''D;0(T @0pPA@;@  p-L`P_@P P  0, 0f0C P0`&P p@ - 202 0p0Cs0S.0S 0@ <0= ($R 0A0 0 -Lp@` pPP p @P p  0 0_0C p P0  0 0#40pW 4pp 0$ R pm0u -L@` pPP p# @P p" 0 00 0R0 P0  0 0#40pW 0 $ BQ p6*p0u -Lp@` YpPP p @P p  0| 0_0C p P0  03 0 "$ bp\W o+0u -@Lp $pP @1 oPP @( h$00 0` S#䦒T DD4[ 0  00 ;0@T0#30o @@\0 @00 30 0⩀0 @:0@T00 [0 0030 0 + @T ㅀ[0 0030 0 + @T m @\0 @00  30 0^0 @:0@T0000[00 0 ""Ġ" 030 0 + @Tr0 3 0,à 0#200$b[0 0030 0 + l@fT000L[00 \0#? 0Z@T> [0 00 ;0K@ET.0#30 !  000  00\00    0 :0(@" 0u -L@PT n`P e A@P \ T0 0t1 0R0 `0  0 0#40  XDP@hp0T00 T"" 0T00 T"" 0T00 T""  0T200 T  0T#20 T0T TT(, $ 0T T T T8<040 T0TTT(, $ 0T@T3 0PTRn0u0S / -Lp P`@P P l 00 P `/ WC00000&4 0`zPt p-ML@`0 PPP0\3 : c 0PKp -L M`S@P VP K n pPP% T%J 0S0a0a010 P0 Br R@0Cs R@J 0 P@PmP0EsPU ;@J -LMPp@`$@ mP   $0K `@@@@PP $Q 00  00  zm K -L MP $ p2L@1m`P @+ (K $0K@@@ p@P$ R@ 00$000$ 0S (0S T0 6@8m K0 @ N -L,M@`,@ pZmPP @I ,KN 0@@@@ p@P7,\:  04 <  @8 0K@@ p@P, R" 00 0 <0,  08,0 0 40 ,0 0Q t 0 @l(K@l(0 @l N -L M@`,@ plPP @( 0K ,0K@@@ pe@P,0S@ ,0 ,  ,0  0 R T0 @l(K0 k@ N -`LepPr} d0( 008,d 0誻40" P T )~ 00 @#~00 '7<M yl @$P0 0bQ 00  0  R10!ll'88'#  4000i   }00ꠘ0WEVD 0-PLH0h#88#!XN@P00 @( 40bS@0 000hYIt -ML0D )-ML0D -L (0`lp,@ S\tpp\tpp 0S0C 04 @+0804 D4 $)a0CRP@Rhp0 0 00Cs 0 h{@04 $)a0!R0K<0hA080@$0D0P8@$0D0pn -L(M 4 ,000 0@Pb4@2a 000,0 PV 0@|( D @ $0 D@ H0 B@0P "L0 0i@P0Pp@4@D24  yP6 0W*(( (h(%D P`@ W :;0@!0 L0001@ p0,l 0 0Q 0@0 <02 (K (KoH0  2 0@Q  R0@L0 H@ L@[L0@S<0 8@ T <@[W 000!!0@0,P 0 C(Ko0u -`LH0#88#! MpP 0@ 08040@ ;40D P@RWhH0"080 sLp ?ChG(P@0tpn 8 8-#DL$`LPP0@ G0pP Q@T PG.0" "2 K<@C  2<2t Q- L Q 0C@000S A  8 8-#DLMP$lL`P 0@ |Gp0 ̠PpP@0T X,@ @@S 2Tp 0, dQpP202Q iPTG2T-0. 2Pp W T .@2 02 .8pP2T02P 2p02 .p0 't 0-@PLP0EQ0Ľ 0p-@`` (0,R00Ɓ0L0LP2  0\ 0Q000CO@n4 )K (U>0X00phQ $+Lf ,-LMK0  K -L Ƞ Ƞ M,dP@, &KpP 0@ F@$K 9T ,9Tz K0CT 0CT 9T 0S@; F9T '|9T Xd9T :c Q@72T 0T-  0@' 0 u@p20S @ 0PM@P KP@M $2T 1T 7@ 0@1T 1T@ @ 0@P/0S 0"  04"40  BR !͈@f 0@00 0SJ!0  00002  <4!4"<0^!LZtc@c Q Q@c ccedA c@qdQ ccc cmhdpd dc c c cQ`dc c k~rdA (,0(-"!0202 u 0 R 0S S00" #042/- 022 0p0Cs0S0S0@ <0= ($R 0A0 0 0-LM@d0K0  0S0d0K4u ,-LMK0  K$ -L M`\fP pF 0 (0K pP4(PU7  00480 04H0,0K Č< ČL Č@ ČPČD@ Tpppp,0Sp W e$KpeXv\v,0  0X0 P\ 0 202e -L0p6`P @ 0PS 00h 0C 0J0C p00)*Ġ''D0@ p0@蠆 -P0LSpP)1 H00CXP!08`@P P  00 \0 ) 0 40q0!$#40 0000P蠆 -L M @RbQ_P\1P040 H04`0CVU1 0 H00C^M10,0 H0,`0CVD \0S1=  \0S08 088`8PP @, 40,0p  00 0 \ B0 4@q|~$4!$,T.d@0 P` 0 00 00 00 0I@ C(K@@꠆ -LMp @RAQ>1, H00CP91 H00CY2 X0S1* 088E`P @ ,0P 00 0 ] B0 4q|.4,D!$@0 0 00 0@@@꠆ -LM0@1PH R (K  d{8 `0P08p <0  V 8fd<0S 60  Ă0 WdH 00080 d88H `0P0<0 0 HY<  3 " 4  7Y< P@, @0 Z PP@ ,0p00  *04 <@- h@X.\@ @1\ 81\   $1\& 1\% 1\ 1C\3 0  0@H00CQ80040 0\ 0\ 0\@?@D8 400b0H  L00P T00@@f8 400b0 uFc@Hc Dc@Cc EcAcBc 8-LM8 #P30AT/ 0 2 K020-sPH0 0 L|0 P  T00 RP  K H0R\80400 202 ut <0-P00 00(  ,L @h0h$+H̒@-Q0 0""D0@ 0p@-Q0""H"T *(,d @P` pA-Q0#l#x# 0""H"T 0@P `p0G-,MQL.#L$@( #H#@@. 0@@ "$"h"DLh# `@ #x#T0. 0 @0 @0,ЍR\ \ 0Ls0_S BR00/ 0-PL2 0H@P0 5000 +0C0 P0 000h꠆0 / -LM@TP <0 RU 80Ÿ8 #t'"R00x0!R8 s ` ( , ɬPr,4 0፯@ f ,Ƭ 0prp3@@0 4 0 P` 0@4K R<9 Z> 0@@ 0@`p4K`pʌ< @< @T 0X  `p8 Y1#,@ 0PP Q(K 00x`u' p-LM@`  3bPP @  0`@ap p-LMP  `@b@P P @ 0PqPP @ap 04<S-P0 8<041 0(, $! -LMP  aP=  0@P>`P 0taZ   aP& 0 @P'`P  a0S`W S Q 0 SQP-` ` 0-L@PP0rP00hR -L M0  pLa`P  PP  *@K Cr%0*0K 堬 000 0`X &a K0 8<04@0 @1A 0(, $ ! N 0-PLH0h#88#!aC@P00 @( 40bS@0 000hb>`u -L0@0", 0p0Cs0ShO200S70S<0= P$R D0R h=, P Ph -`L4MP e, q 1(001,0!Pd088004 0 <00SL H ]r5@KD WpKL FK0!pveP r'r tq @<'X@A*8 8*#Č,   D@ Č 0PK0, 0R(K$ r;, WEV8 0-L M`,0 2p[-@ (K0CP@U`P @D D@ 0K ,0K @PPP@P,P@ 0X!!0 # 0X  _\% \00000S, , 00000000S 0` 0 @08 0 @0^tvdud@ N p-LM@P $_`pD v@L q\ l$ 09P  _$_p  ,q$_p -L Ƞ ȠP,D`$,ApP 0@ <@  2V -2Vh <2Vm 0Vp R @<2V 2V 2V @ @ 0g@T2V L2VR82V8  2V_ 2V0"0 @1VW 1V e/ㅪ@1V! :10S @0 E@P  /H@Px1V@ E  @0S<@2 e0@ 1e/o@~ 0#@w QK@p 0 P@i @d%$ 40H Q@`urdAud@pd Q Q@qdQ`vdhdtd@AedAmk~gd -ML0| )-ML0o -L (0`lp,@ SH`XXD`XX 0SK0C 080@S08040D;404 $)a0EQ@hp08 0 00Cs 0 h@@04 $)a0Di0I00hP4080@$0D0EP8@$0D0|p0 0pn -LM8 , 4 0@Pa82` 4  , EP0 T 400@|( < $0Ȫ0H0@<0 N20i@Pp ?8024  YH 0@Q `  0 U0(!:0 0 L0000@ 1 p00,l40SD4 0 00 40000 (K (Ko4 !;0 0L000@ p0 ,l4 0,D2 0@Q  R0S0  /,P 4O(Ko R 8#8 S  0 =0  "` -`LH0#88#!?pP 0@ 08040@ ;40D P@Wh:02008080?p O3h:(P@٬`upn 8 8-#DL$`p?PP0@ :0pC PD@T0 !22 022  I2O]rC]: ; 2<2.Q`u A-L@Q x(`(00  0 \0   H 8 0O@00 0-@PL,C Q E0=D0 l* ,-LMK0 ) KX - LM0  ,0 L\P * pP  0\ 0\eP00h|{P01S01S00hRꞫ 0-L0MP<0 ,0 00 40 80 pPF0F[P Pp`( @@K P 80K @@@P`P @0S 0S 202 /  0 + Pp` [@ 0 0S<0S< 0 Sj c Sg  Sd (KP000[P Pp`<00S S{ <38#0S 00 R-Lp`P@9 %:RJ V D@P   &&Ġ00`p! 0C 000000X: 0h0d00 ' Q'>00J <`000000  Q 000 ³0 `F ?0 4<`0000@@000  000000W *hq 0Sh00h0Wl0s d0hd r 00hl0 d Sl  vP0 -@0L ^`Pp |0^ ^0000 P00V00Sa0 hG00 -LMPp K0`@P00'>00D PP @ D0DW 0 p0@Th@d@0u 0-QLMp@l0`d0h0  K0PP40D@P P 0L 00 p0PWP P 0-PLD@P P U0 0 4 4 0C000  vPp0  -`D@Lp2`(=VPP `" @P ` p0 00  P0O`IV  04H0 0$( L U0u -`RLpP DZ@P P P00 0C 00 `00 &8&$`0 P0008Q 8 0  0-@LtPPf0p00 s0 00x  R| 0000 -L0M`@,` DPUpP ` $K8K(K0K @ ,0K @-`P bU K00S0022002280K($ T0X@` \202 0-L(MP,0 D@wUpPY rUPQ 40 @.U+UJ2l8K )f00< 8 K 8010K#(#43 K20K 0K ,0K```@P,Q 00S> 0 0b@C d0`V 000  000 0UD 0 @T @(K00#400 @ 000 @05LD 0 @0 4 $0b@C !0u -L@(PPp+ TpP P% ; 80 R 00`000Q 0 PP PP V 8 V R`00000~T 0-PLH0@#88#!1@P0D 000h1u -ML0?8 )-ML028 -L (0`lp,@ SLL8LL 0S0C 040@; 8 40DP@hyup0 0 00Cs 0 h :f00:00h!*080$ D rP8$0D0pn -`LH0T#88#!Q1pP 00  08040@ ;40D Q@ᕣWhK1@P  8@P#h91H PL0S PlX080DLP@eL0 X080upnD -LM00@ hp`dDP  K@0V -W00;00" "@ -W @  -L Ƞ ȠM,@.`p0PP@ 0  @38T<( mK@ ] :R: #]d',$< 0S4 4 44 4 4 4 4 4 4 4 4 4 4 4 4 4 44 4 4 4 4 4 4 4 4 4 4 446y2 -LDMT 0,0 T P 0S  `, 0RR(K LKd]PX ` h !<\0 \[!(!4l0 d LKd [l[ | X 4X<tIKJKK KGPKF0KEKHpKP!!h!D < (AK D0KC KBKPpP?PKPPP05`s2 8) rɌT0TLK ,4 R #>0K=K]T&,L p-LMPo0 S@ Kp `K\pQK ,  4 KK0K R #0#̠##DKK@K0K\ 0-LMP<2K0@K\ M00K@0R #K0K@K@K\l -LDM⤀P0$0 dpK@@`\N0c0Kp0< a Kd@Kb@K _K!`KP1@R@ #0]0K\D$ 0R K\&,d -LDMԀ`0$0 dpK@P@w\O0< c0Ka KdPKbPK%00]0K#4^0K" @0M KI0KPPKOPKN KLPKKPKJPK @R@ #Z\$ 0R K&,| -LPM qP0 0 l`KL@;\:  0dK h0KgKX 0 S 1@|0k0KeKiKl@Kj@K#\ 0RK0LdK h0KgK\6\K( 34K /DHL0%, -L(MpP0 0 XD`K$@[ 0 @@KC0KAKD@KB@K $R$ #[ 0RK%, -L M`.'pK PB[@@$@d ,4%0K$K0|"0K!K @d 0- 0KK(0T 10KK'PK&PK#PK[VK -L@MĠP0(0 bK:p`[[@[0ZK `0K@0^0K_K[@KbpK[6RK .BK :R: #y[%( 0R$K=%,IJ p-Lh@PTl` T T0(0 hxPp 0 0#2200020020@020020 0200(0(0$0phB sO(@X4 p-Lh@PTl` T T0(0 h,SP0(0(0$0ph$ UO(@X 0-Lh0@SlP hP:PSh @0R<<; S  Qڰ3Q 0Q K0<000 @T U \\ 0l@L00TQ @/ ;P; S  0 @0Es0 U:S00P 2UP 30Es0S0EsP8UP 00Q10sPQ*@K  p@L0 0h0 0b0 0\0 0V0 0P0 0J0 @0D0 0>0 980 <2 Q Qbq  0PE 1UX ;~ P P40S^00 RL fU0U 0U 0CU)㾌1 Q> ' ;RQ #ᫌ㦌 0p-LM R3 00S 0S, @P`0S0C00 00 ,Ar oR: S>+  R0S0C00K K 4g 0 Kp耩v| Ƞ00 Ƞ-,1XP u -L0M\@`  #4\ :40S P 3\! 13\f ?3\ 3\ d  0 `P3\ 3\ x3\ d3\@< S\$0< S<1S3P(3\= 2\ 0\s 2\0SIP2\ 0\x 2\2\ 2\N 2\p0P       00  0P0 0tx |0 0d  0`P!0p { aPPB Bt\ P$010n 0R 1  iIbPP,\0P     00 O  0P0  Dd p pPP| 5  卋\0$x\ 0>PP\7W W WW @W W@WWW@ W @vW WWv -LM\ 0\ 0\ XP*  1 P0\ 0pXQ 00S00XP  1 r 00 Q}f~fvt|f 0-LM@00CS0P00@- @.@u Q-L DО 0-L Ƞ Ƞ,A0SX0SDD0400K00CS0uܞ (L0 (-"LX@T 00Xu (-(L" PP0AT PP0SP X`VP 4p|0H0PP X`bPu -LX@pT` ^- 0 ! PaU " 10p` PI0S 0S0 h 4hD000Sh*DH -L0S 0 000 0$00/0TE뀩`,L -Ll0PS t!0S00SX@T( 0S% Hq00CS0`000 R00H0S00S'0 3 1CP0Q!ڰ 0 S00 S P0 ϯhC0 ~00,,, ,0D넩pn@mYh`,_d -L`p0`S H@ PDWO0 p0 0D뀩`, -p0Ll0 `R 1\00 \0` \` 0 d0 0 B0h $@ 0CP%\qPp@0S 0 R 0S|`?Cth; S/P/ 00S/ -L@Q oooo`o000000<00000000p00s00p000000 <-@00000 L!pW`V0S \ P0 UD*\? @茠 |0-L Ƞ Ƞ,A0SXP@(@00000CS0,y (\0 (-L"!QX@ T 0X0`\0,y (-(L" PP0AT PP0SP X`VP 4p0H0PP X`P,y -L(Mp0`L0  0'L0#0#H @#P 嘢XY 0S P00D0 l0d@0l0P@ p00p0P  < Ht00t0P  8 Lx00x0@D  2R!h040 , Xl0S P/",00 b@04S0 o 0So ,0S3 0U` /рp`@@ ",00 b<0S_t0S" ,PC 00t  VPP/ <@@ ",00 b0t0_ EQ 00h0 D0S"0S(K|0SP @/",000b, S 00`TP /|`P4@ 0 ",00 b@0Sp0S`/",00 b<0S 0HS ,0S 00HVPP/@@  ",00 bH0080S 0LS ,0S 00L|UPP/  ",00 bL00d@404$ ,0Sz,0Sv J0@S0pc000VUP0/P  0 ",00 b0,0SV @0=UP  P @/",000b, S 0 0'T :@/",000b, S< 00l  TPP/ D@ ",00 b0l00 (Ko,P 00p  U``/ @@@ ",00 b0p06P/",00 b80SPx0S ,P 00x  UPP/  ",00 b0x0P F00 P/",00 bB$(Ko>  0=?븠`ؠ -LX@PT( 0S% 0q00CS0`000 R00B0S00S'0 3 1CP0Q!ژ 0 S00 S P0 P=0 p00pn @mY{/ 8D8 #Q 01S 00="R//py/ p-L0@p`0SP *Q, 000 0 0S 0 @pS 00S0 pQD0  Q(0  0  pn... p-L<2S 00pdBP `.0S ph 000 0@@0呉 X-@ 0LR01S0 10<P V py x0-@ 0LR001S00 10<P0 <PP0 0hspy@ 0R/0!R/00 10<P/ py Q-L <@ -L@PPp0 `  R |05:Rt0 0P0R \~H0  @@ 0$npn...0QD@2/L Qp-L@P Q ph00U= L0S XP 0S `@hX00@P`Sp00`8p`p 00 -L M0P=2S @2* `2S1 R8Ls$K0K0`Kh0(p `VpQ*J0P0O8T ?N3cQa 0P80T 0 @2 `2S 0 @20@2, 0S0C00=@`p .Mb p-L0@SpH`0SP 0  0SppnL -L ğlM@.` 0=rW@ 3Q 3Qy 3QG 3Qb @(K3Q 1Q 0B~S1 0< RM L@K\` XpKlPKX3Tp `0 008008 PU 00 00K0 @0^!0 @ 0 K tp p0 , | xp @ 0B~S1 0< R 2@0 4p q<` 8pK00L@K8008e1S@ 0B~S1 0<P  @j  @  ZR 0< R Z@P 0@00 0Pd0 `@ 00K l P0 hP T , \ Xp T0S@0P? 0<1 P@ 0Z Q T0Sl K@U>ό@9 0B~S41 0< R 0@0 4p p<` 8pK00L@K80080S @ l K@P0pyUUUUU@ 0-L@P60h  0-P00L="0 80S @0S 4 0 8L\ 0CQ 0dP 0 0d20 0 @hfy -L`pP@T! @T- R00000      GP 00S07@T' P0  pn.T -LaqP@T! @T- Q00000 0 00 0P 00S0@T P, @T0  pn..\ H-L< <0P, ,,0P ::lyThy$d -LM|rP`Vh 0d000DR0 }?3H2`B9T490 0=2$KTK9 p`0S0 <20<20 @20@20@1\PX0`pd`00 d0d2SO 4 0@ P=@T0SO 008 R 0 @0 <20C<200="Rh00`"R!000008$KmT0 @0 @``` B900=r0S 9900=r00T 800T=r$Km)9yġTyء$+XM쉓.....X,졙 0S/0="R/00/ 00 0/\/40  /40/@-@00H 0000  8@ 0H@ 0-@L P 000  P , ~H08P0H000@-H@Q @  8Q H@40 0Q0-0R00\00^008/0q R2 1C/ -L,0L0S00/L0Sq/0S"4000/- 04 P#*0 \*0S \0S / -L 00Q -L  <2<200C<2<2 <2S00-q0^  0S 0S  ^ 0@-@QPs  ^ 0S0\\0^0 -L0S *@T 0S047P7 7갢\ -@PL P7䢙 -@PL ,0S 0S P 3/P(70 0h7 h7P$ 0p-L( @RP l7@p\0\`(00L0 L0@0 P0@ 0@YSUBlUQNOpn P-L P 007蜣 p-@PL d`0 $0 PP ,0P0 0pphd7pn -@PL Y7ࣙ -@PL LM7 -L@ 04gyH0067< 00H0@8 -LH0@0 <0 00 2p-L( @RP ph7U 0  0``P ` p-LM8P 0`Pn@PPp 0-LM@A K0KKK@KKKKKlK@-<2S\0 R 0@@y404, (όL#30@XM0Mb 0-LP@P00h -LHMp` 0P,0  L0PU@@8U4eLe0 040L0w. gK 0PPf [Rd[e0[ePP @ 0PP @T e`, 0RA(KeP0SPP00  0 \-Y P @   0@P- P ? _0^0Ki0^KT K]K[KX0KWPK\PKZPKYPKPQ0[ !PPpe 9P4P L0W 0@@W  .PP @TJ@TZVKOPV0[ ,8 -L`8Md\ `0 A0@C EBD@ČH TK\pDP #3@@ LP D <` 8p 0p ,p 4p T PP  @P e PX \0AX \ qn(KI RX@ XX PLe P0P0 pP U40"01Ue 0p ,P PXu U@@U P1 80 !1 L P \0X @\UeT\0S>XeNX0I 0X0 R0X0R \0 S08 40 L0   P 0L @P \\e TPX| \X0 AX\!m\ `0X{,gUe@Ta r@PeU.ؓ| -LMPI0`S@)pK (0[S$0[S I0@S   0pWP K ) #0-LMAD(0K0CP(K #@K'K&0K%K$K"K!K`M@P  K p2 @P0 0pW@W  @ #0-LM`AD$0K0CP$K #K"0K@K!K `KKKpP K @2 P0 0@TT -LM< @P0 `e ㄿ`PPv ,0 00-0 3,  0 P0? @./12 00 `Q 0XS b 0S^  R00 08 1 8 04 #PP98pd@ 0pP5 2@RT0 1 00, K+@D 0pqP 2@;TP@D1P0@, K}. 0pXPP  (KX! 90S)  {PT0 ^0 0 S  Q 0 S |+ P?0@S d0+@0?0P,80S?000C41048 0PPPP0P  6 P 0  1 0<`48 0PPP0  0`"R 0d 0!< 00PP ,@K  |ا B4-LM$ @s*pT TD0 P-L 00 ^*06 -LM0K0K⠠P.KBD/K -KNL`(pK0,PK+@K*K)KP=P(0S @ 0DĠ)K*@K-P (00$K -LBM`QP@PpP(K!rJKI7 ,K 0P,0`W`?0@CT  R JK 0$   00X00S"4?000T00P0#SV00JKI,K  0tP,0S'![(1[41s Ს -L@PP@@Qp`U V 0S(A @0 4 )XW 0SC B0 4p o)F 0i`OG 0bpH o6 6X8H -LMp0`@D“0  @E0D  !A@0!40CB0 B40ED0 40<=01> ! 01 R011 01XQY QP@S G 60+1X P@0Q0U0SU2G? P0U0T R 1\\ T 0\0 0S  04 \\T 01[O4 H0KhP!  -LCMXJOKP@D`K p0,P 0  !@(y5W p@ = p<0d (k5@;0E:PD`d T d(^5 @d"W5x Pe(P5 @dI5 0@ `(, 0R(K[,X`px|  -LPp x;` W @T; (Qq \(q L(W #,(q((z0@- @ 0 XPX ăP \0S $0R Q0 0耴XR R/04 -L00T`V+ 44 pW0P0@0 RP 0W@P f½8P f㽽0P f㸽f㵽0 0T0 Q-L00T X Zp`000 PU XP P @X0@PpZ` -LMpT 4 000 P50 @0S0 0S-,4  0S'`T 00@C P P0 DPZ P T0S 4 ` 0S(K ! 0S 0   M Kv UP> JP 04  0 00 0 `PP6 T0S  !0S00 0  ,  ['0S00, xR'0 l L'00 PF'00 <@'~00 (:' 䩙8T -LLMt`0,0 P 0P P< 0S?_0`KTpK`0K_K0 ]0KZKYK^K\K[K2R@[P00T00SdPT00TT&8P fㆼX 0P ff|0T0, 0RR(K 8&4f 㚺P f@ 㓺 P0\ 2TH0S 00S 0S&X K!PXpP< 00S X&0B 0Q1 0CĠ YKZ0K&#Bf< IP8 <X 40 `MP l&w fd&o@00>0S Sf P_ T?p00  P0S}?d0 00  00>0S0 S1 C00 ^pT p 0pT  P v 0l&0 R 0@0.T 00,|DۓĪ8ٓTt -@LV0S 0 S @-@ R000 R0S0SS0 R//P P 0S 0S 0 0/0 0/< S P 0S 0 0/00S 0S 00 /0C 0 R /0P 0S/ -L@ P00R00S,(1P 1P1P%0CP0CP! P0P% X>U/ 00 (@@XKphKph R-LMp@@ P $0KP@0$ S``R1 00S. RP) 00S%0V f$ @0崀S2  08< 0!8 0 P  R0 $ $ PRv K $0 95!8 -L M`D200Pp\ ,0S0Q\0 0(0(N  0pd0 0$ 0Sb1:D2$ 0,0Sp 00W({lP,PT W'H0L b@aT@!T@! /eL0H 0ST L0PD0% L0%RpdPT bpbT PW0` T0 P,p0@@d h0 @h$Km$K R-LM@  0KqKX 2-LЄ`@PqChPUP@0 R@X@wTP` -LMp, 0 , XP@`0\ 0P) h0iP$ `VldpP@2,  1C0 R @00 S00@0?0P X1LP @T\TqPP`PV2Q#Q0Pd0R@PJL,PUP@DZ@PT2Q#Q0PU?R@PJLPUP@DZ -@X L21C0  QlP  P h p-L2@S m2PSRRYRp p-L@0@S 8`D0PS@PDPD8Pp -L0@s 82s h -pX L2P1C` @P0 R  4@@ @ 0@P Q p  0@P 08 40  칗@ -L@0P`P 8p 0=P 0P  h8  < P`P+UD0S @@Tpn -L@0`pJP  ] 0P ]0P  Dp" "@`@Tpn -L r 21C0 R"r 21C0 R 2\1 0t0S!3 -L@0PP0$SHC\00 3$1Cp !K) 0 0 $0`V@ VM 00 (4;) < 0@0@0 0@@$0l +) @0 $ 0@< ) @0 $ 0@  ) @0 $ 0@ )0(0 `,(@D (X`  0 00b(0 00bS`@0@,P >00@0 0@0bS`(X)tex7p6 0- @L "ĩ -L@M@tWP%PĔU0 48 \0S  1S  R\`K1 K0P@U^!2`df Pc UT6pP\`K4p$ 00@400$@ 40 $0 $000CS( D D D D ` 0S P(4pS(PK0S B(4pS(P |0Rx 4(4pS(P0S@ '(4pS(P Kh꼬 -pLP8 Q 1 S0R0 aP% 00^`PA `R R ʮa0 00 0 c0P^ pĬ 0-L"10 p R P ڴ0Xe 0 S_ Q @P 0  na 0 00ഀ аP @U `V @1S@ °P`V㻰``` 00CS>T@0`` ҮPP 0SP0 @ ``0PSm; 㴮PP 0 @` t2A@ @``0`` ᘮP 0SP0 @U 00 PR0`` yPPq 0SP0 @5 ``0PSʥ0 @[PP]0$0`` KPPC 0SP0 @ ``0PSw /PP'  '@P$ 0@ 040m  ` P 00` \?mH:]<7̯@V  ``mr쬙  -`L@2fCpP TU  tL PT"!B%f㚯Th -L$M @`0$S\0SY0 R Tp0$SP0SM0 T H0S0SA0T<P U8 0 S H H0\0R0SH0SR0S!P0%S0S0 T \L #  RR R 0(K0S0@S 0@S#@,L 0S Dv00T0TL0H0 Sn L00SN a [4040 4CKL@SD KBK< 8 4 0p ,@ %H$Q0004404404R9 R< R4@040 $  DK0SL0S"Y 0 S qL H0RS\ tgdb404404,STX,| ୙ 0-LM` pKĐT0'@ 0P( 0Ĕ 0P 0U R04 RD 0U4S K訮خ  -LMp`f3CR@Ph 4S\D@00T0@A T? D|\0 N@0D|\ <QL0|\ @@n P00T00S @i]ė@T N`dK#!B#f㹭Kh 2-!L X@`P T0 0 U\021C01Td\@LP00S0 S0P 40000<0 <X0t@S*04a @ P D < 4B0P@S pAAJ p @TJt40`0S0  0S0W0Sp 0$ @TZ0$S0S 04`\`@0t03\03SX 7/t00t0q8T X0P@ @D0@040S \@Dk0D0X7 @0X0\a @0SPD P`PH 0IP\  h,pn+ /L/ -LP\`p 0 AT 0GPP(0P0000 00CS0Pdh P/ p-@@PLL`4 R040 0S00  ppn@0 ?S $0/R@-@ H@\  *0lO 0$@/D0< 00b0lO 0$@0  !p- D`$20LQ0Pp020!0D0 1s s p P00S S Sd0<0 00SPD0<0@<@00`p0<0|pn0  -`, DL$20Q0pP020!0D0@P 0S`0S``蔐0  RE` R R ` A` @ H0S A` 0S|pn q-LM K0P -LMp@0%KPP T%0[T07P P$Kt0, KPP&K, PP&0[S @D`,y0& [s@R0 3"10 0 0,4P! &0[PS , @D`R&[q@^0 3à"10 0 0, p ,C R-LM4 pE ,0K @0HS=:0  080 0 @T D P `@@`U@1 J@0D 0S@0<0Pd@0U`00080X00 0 44 00V (K,0QD @T d <0%H@0 H0%0 0Xg R-LM@ R R K0K < q$ 00' 0 04 -LpPD`@00@ P T^ U` 00CS0PND3@1D TCh0Q\ \0 S 00 S P0 ppnD@mYt Q-L0 -AMLM$P00@,0 PvTP 3"  D ` R P, 0Re(K0Sb 0L 0R  S0$ 1 SP0PL  0DT@!TE B~KpGpG ͵PPL0 0  P @P TP TPK0C0C @ lPP4W&">P#P#PPTP TP P@ @$K3"  D   0PL0 0 @L00a 0, K9PsP @4T. R4T 4T0 @P E;@W 3"  D  0S P @ 0 000@ 0 0 0@P 0s p P @0 @pp @3T1 3T$ 3T0 @P 0s p  0 P  pEڔ@app 00K0P @O0  R Rh 2Re  Zb*Z pP 0@80 0PP0 L@ 0 8K <0 TP X @ 4 H Dp ˒@0SPq XA10 @Pp0Z Q @0Sb Uy ~@0%KP%0[@000 K.PP 00@^ࠁ80K0 X0 0P0 L@ 08 X KT @p <0 4 H Dp ۰@Q0 PP  HPB@0, KP,=P 0@0 @' X K⩰pPX K⣰prU~fqUhU pUAdU@iU@fU eUkUmU jUoUnUlU p- LMx @.hPA`   0 0 900CS0`Kpl|D 0-LP@0P;P |0 PP0 L100h 40Q P "00hHl0D0 0$0(0,0004080<0@0/@-`pPW@U#(\0 0!`! T 0' B># g!R p-P`L@ 嬑@d0Pp -L` p$RP |R60h t44P0S* QG \!1  @0!\  @d P0S: 048T **0NS;LD؅ 0T ^񟗾䇔T\lt0 ā0 @T mP ^;h솔4$,TLCRz?C@$0 e$ >eSm0h@$0 WX0T0H0j^Tԡ$+܋pQشԀ -L@P P T0R 0S0  >CR0S ^/ p-@@PLL`t R0t0 0S00  ppn@0T ?S $0/R (0 (p-L"PA0Pp1s sL0t`<0p@@8@00Pp0t`<0 pn 0-L Ƞ Ƞ,@Qp0P@ PA @` T0S@ppn -LM⤑@P0`, 嶾pPt1T h1T& `1T<  0p, 0RA(K 1T 1T 1TQ| |P0|00 |P 1 Q0K0P P 8 D0R0 KP-000, 000,}fpUAUvtnU~f 0-LM \@.Q@@v00CS0@0g0 p-LP0`'PpH0@Tp PPPp0P Pp `00-L Ƞ Ƞ,A00000CS0P0-0 -LM℡0@`, p 8 D0PK@R@0 ^PPD P, 0R:(KP T0S0/ T 尻P0庽P(U 000T R@0T0U0S T@#T@!PK TD ΨPP ,E#PP,pn$ `00-L Ƞ Ƞ,A00000CS0P00L0 ( (0-"LAPTLPf |P0 8 80- #PL*0AT 0EP P0PPT AHf 0|P00P0 0-@TPL L0 p|P0 0h00 p|P0 p-L90@0Q$ژ 0 S00 S P0 bpT`00CS0PT۹@mYPpn 0p-LMP@@0 K40 K0080 ` 0 0 D 0 H H D0L Kp,`1S00`/-T1S0T0 0@S<0S=QX0S S 004 D0⣱PS4< @0✱PLX0Sx 0`@0I`P? V@X 0BSMP2 X R[ .:R,1T0Y 0BS;t!p!}l!{h!y@!w0Y0Q0Y0M0Y0I0Y0EP;ihi4X@Y@\@`@4˭`PY0X0P)="iOi >0S}=y`0T04> H0P Ⱥ̺,'躙pؗ亙ܺTp( dؗ -@L0J 04JS00X0ĵX0ĥ -L@4|0S06 0$ R 0R  R0Y00Y0 ?00-L M8P0ED0KKB0 KK@K0KKKKPKܯK04 p0-LMq3 z|ؗ p-@L0`0S00PPppn 0-PL@000pnS000(0RR00(0(00 (0SP( P0(0 2[0(0 -LM@Q` $pSJ2 %㼠 E00 " 0>00 01 0@0 T0%(KQ( 0 R* 0Q'0(00 (0SP( P0(0 (KoZ`0(00(Ko觫0ᤫ0 0!0(00(0t@0S8@0Ŋ{ -LMP@4`0ȪP3 pW00 0{0 0! T@  0 P0(Ko`0+ R  RW\0(0(KopZT@$ 0AP(K| p-L!M`4P00 R  0RKp0 "K@K¹ PK 1QK1@K L4 (0 Uex,ޗ p- PLwT T0@`a0201"(08P40`) "`p| p-LM`PK 2@!<202 00004  00CS0p1p p-LM`0PK22 @< ; 200004  00CS0pp/ -LK ` Xp PP L H0 d D` 'P6 = [>0[4S\00\0  >0K 0S/$ 0[S\0w0\0@PtpK [1R0Et0 T 0! C200p0 l p0 l !1s\ RP<@ʇ1T0 P0p0 tP lP 0S;p@0@St,ĦP  0S00S0@pSWXtK 0>< \0 S0 00 M0T0 0T0 0T0 0T0 p 0l-ꀴ T'0S/Sj,0X\ޗ|ϙKK,'ؼмļ켙0S / 0R 0R // p-L MB? KPCD`!K0 K!KKA@KKKPK0KP [ Kp$ $0 0-P40L@05 00R   P P800P0#d0!B !0P -L?L5c@C$s0r  00h胰D - L0@ 0h - L0@ 0h -@0L0S040 R 5 840S50SQ /<P j<P/i 0-@PL P  0hM0P M<0Ȼ@-@0 , 00\#^? 0-L@P C030,# 0 0-LPXP (3|S $CT HF0@T C0  0-LM@7>\dP S K0\h ?P D l\ \? @巩PP - T̠p34/ P̤彧Hh 2-AML@`P3p0 S 0#MC403t``  圤卧P  4X͠K303', 0-LP@XaP0|3S0601S kfP0 P 6;600 r0C0 BQ 1S kJLP  6 &;60 00S: BQ  10R!!  10C1 -@PLXPXhd -L@XP\xp`B|3S ,3 030S 2 S|# \0xpn -LP`pXף@P䀟9WI;9 WW0 0@0@& tW 0 0@0@ 8 p2S 07 tX pn 0-LM@P`pP`P`hd@0 $KPޣ$ 1S   Kܽpn -LX`PdP9@U UUpp3=03+PUph#R00@`0@00@0@C塱 0Gs 0-P3@SLSS XP P 070 -@RLp` D P; 0 0 PPPP7; 1 }7; 00 -LM`pPXڢP 9@ U UU(K3=03埤P(Ue ̠Ap0L  @Ӣĥ 00KP 00 !00S0 0@0@C 0ȣ+KA !)0[PU)PK0   B0  0 0@00@  4 Y7P |P  =  4@ p0 0@0@ Dpn 0-@PLS /7P 3S XP +P 070 Q-LX3 -LM0S0G P ޗ -@ALr30CS3h< A303r -L M@X`pP KF@0X~v@*0K>0CHT*K" K)K(@K'K%PK$0K#pK"@K!K&KP -L M`X@ϡpP Kt@0XND)0K?0CHT)K! K(K&@K$PK#0K"pK!K'K%KP - @L{  h p-L M@X`ᛡPP Kp?0XF"0KB0"K K!KK0KPK PKPK`KťP [0[ 0p-L MPX`0Kv@P Kp?0XF!0KA0!K K KK0K@K@K@K`K堥P[ 0-LP@ y@T T =  ~$ f& ~b=  (0h*%~ UA'd 0-P9@L=9 YB > pP pģP5pStP t廣P20t3xP x屣P0x3P 03P Ӣ03P x03P Ǣ030|30F 4@ : 긾x -LT3P9XSXPp9@`(L ?00S 0@ᝩt3S l30CS3˥p3Sx3S^ _pnؾ -L` 9   )2S<9 9  h@@ zTPpPA@P0%gWp -LPX5@Pop @MT9 2  A7P2 7P5 H 3 , % >p3S# 9@0;9 icj 7PP8P pn -L`P@XpP@ <01T 0CT"  00ߩ@4T% 0T 0T0,+@ @ @60@6 0 R @6@@@ Q@9@0$@0pni 5i 6i( -@LpP`X &[ %~ (z@@T ( T h.X4 -LPX@`7pP I' %Q@ (M@@T ( T &s@t&Xș4 0-@L '030S5 x 036S" m f  XߞPP0= 0  0s00hfJ B   0- LP# @@T #* T !0hL p-L`@PPU@40@p -LM`PpXS 3@P $K2"A3$CC DDcdm( K@P00G lL(=\!^0C p6.p0PS00Sh#0@St(州Pi   0Pd# Pl#Id3SS h3SP l3SM .@KP0p|ɦ L, 818!9!010!1!0` h{1!431\@8#<3  A 0s 0/=$#R  ᕤ\  嫦]Y pT"0"Ȼ hޗ軙pnH xxHLp2S/ -@PL@姝P@h -@p3LSx#l# @uPp $傠Pt po7 -@3LS## @ZP $gP T7 0-LH@P ; s1P ; 000@ -L$M< 8 P@@E0 4 P9@ U UU(KA P{U <0$$A< $\08 ;8,8 ,0KPx,$P`0@P` P`40 0 CPAP|P  ͐ 4唧,Q /00q,0 # Q$ @ 0K![2[, : :0#AS, Q0: 0s Q3 0, 5:c, UpP0 0@0@  |\i{h!pn Q-L@媜 -LMP 0" ~P  -L@刜Ph{ p-PL9`i=9S\P \(P6\c`P `P40`3dP dP0d3P 03P 703xP 0x3pP +0p304phC婪 <PhC墪 $IhC囪 B̿ ?-LMP`0@ @#გს @ 0j T"KK ,Kt@@LMt30 0p+P j@ xSpt3`/  p pP d(K02KKt,K pꂒႡ j t3 p303'( 0-LP@4S0601S kP0 P1S kLP  ~6 &;606;600 r0C0 BQ  00S: BQ  10R!!  10C1 -LpP`@uP䀟V VV' 0@  hSʩ qV 9i;9 `2S 0 0@ 0@0q`pn8 0-LM@P` t h  00 0CP@ - 0P@<$ H0P@ 0P (0P" P-LMDq@0,K $0 J@P $ 0R? K 0.Ke-[.0[  4    2S< ``9 0K 0D`P PP 0KU Q0 Ao,  -LM@r_`0d7Pk 7P 0P> 4@ P 4, P4 EPr 0K? [[0 _ 0DP ?ⓞP hCҧ pyK  4$40DT 6>wPP hC嶧 ] τ07PhK$\3/ PA29T@0;9㌣@3 Rh4%pn aph! -PLd@`pL1T' 0CT0  00@4T 0T 0T0,h@4T6@ @ @ @60@6 0 R0@@ &@@pni 5i 6i(  p  0p00 -LM@9@ ,3$0S00S S" S046?0 A0S  S 0 8P $hx?   -@PL@QP\Hp`74S 㵢pn -@L h30CS3h` 3 03h -LMP@@p`PX $KG4%0K&pKh 0`v&K 0Ho 80`@hT h !  -LMP@@`PtW K"`K!`K 0`A"K0| : h0`@3T ?![ "[X00 h  -LM`P 0`"Kt 0 0X `B[H2TBKR 08 `@(~$4Spl <`K @ 0@@l0 @@Kc 0@@Z W0 @ 0@@N H0@@E 00@@ < 0@ K 0`@(+p3` 0 0 3 0s0 0 0H`~@ ( 0`u@  " -LMP`0ph3@c ᡣ@P0 "җӯ33SC C4f3S3CC/^P (K!|3D p/pv0<$4`0S@00ST#0@StD!P   0PP# PX#@# 0S;9$4꼒 ˅0p O0rt a .@KL0@ ˅ 00$?0U^Nxl0pq 8 0Ph1!91!1!1!43!1@8#<3  A!1sa 0u5$#R+  `ۜᢠ 4 S 3N.@K0@)&^00"0"0Bpo< |04gH58$軙Jpn `0H2')6644,+`x@ 0-L@P ; 1P 0O@ -@3LS## 0变P 團P 剗7 -@3LS## 0tP 偘P n7 -L(M< 8 Pp0z4 4 P9@ U UU(K APiUn <0$v< 08 p8a8 ,0KP孕,900)#@ , B, *4 \ j1:, epP, 0P`0@0@40 0  d  PP @ 4嵟x0,\ \ 0K0 0@0@g 尘@pn -@L_eT30CST3h T30T3te Q-L0ޔ -LM0S0 展P  -@PL0幔P0h 0-L@P{34300# 0 0-LP,3S (CT 50@T0h;3 @0p-L M !DP_`$K0 K$0K<0C@K#K0KK"K!K PK弘@P  Kp 0-@L 0(, B$PP00 A$0h 10-LM@0  PP:)L3 LÄ <9s  7L37L3 C L#K0h3S:PL3 PP 0K U 010K0 ?0-L M!DP^`p0(K(0K KD0#@K'K"0K!K&K%K$PK6@P   00K 4p0-LM@P  KPP1  ((    ;PP0 0 0L™™ p  4p00 p-LM`p9@p 03$0 S$2 p , KP%460 L#0,@@ &L#00000 0  GP ,@@ p dp Tp430S S $L#@0&%00 L#™™ -@PL0YP_Hp` 24 ?㽝pn -LMp`P@$K$0 *dT  @ P   p-LM P @P PH(@ $`p  p  @P@T P(0/@P @K `P P @P0: 0 A8 =l*9 @P7 / +5.@P/0$ 0 G , /@P!, L30 L3 L# L#P PyP <sP (m™@ę ÙÙ\Ù0ÙÙę -LM`P 0P2@d3hclCpCa2c3CC/P tj$KH00 R;J<440PS@Y0P 4`/N4pl2"91!1 0!D3 B>B, KPM К_@ 11!831<# @3$#|!|1 s2 0F1(#R>  1ᬘs? (š00S#0@StH[P   0P# P# A( KP,0(2#̠#!$#4"2"0֠"(Ilę8P軙pnWRZ`YG DCC -L@0壑Phx 0-@L9PY=9?lP AP3SP 8P003P .P03P 03P P03P 03P0D030ş 4l꿟 f깟 `긾x -LMr0qGP: @K:`:0$ t0 :;~:$0 j30  3cHH  0!P p K303'S 0-LP@40601S kP0 P 1S kLP  㷄6;600 r0C0 BQ  00S: BQ  10R!!  10C1 -L`@P0崐PpU UU& 0 0@0@  U 9Y;9 P 2S 0 0@0@4x5pn -L4PLP P P 00pT30CST3`ሕ9@(O V/㓞40S 4@:ᅗ3S lOT30CST3h3S3S?pnؾ -LM@laPteQ7P& h7P) H ?)P i KH :>pP X 3`/ pؒ9?@0;94pnHh@ -PLd@`pL1T' 0CT0  04љ@4T 0T 0T0/@4T6@ @ @ @60@6 0 R4u@@ @=:@pni 5i 6i( -LDS@Up`eE P F%# EEE PhCh?ętę 0p-LM@0 P`9E P |*[p%#EvE PF K[p F Ktęę  0-LM@3>$P Q K0( ?PP B L̠03,/ PґHh(a 2-AML@`P3p0 #S0#C40O34``  崎契P  4K303'^ę 0-LP@yP0601S kP0 P1S ktLP  36 &;606;600 r0C0 BQ  00S: BQ  10R!!  10C1 -@PL+Ph -LP`p@P䀟9WI;9 WW0 0@0@l tW 0 0@0@ ~ p2S 0e 4垑 pn -LMp֍P $KP`0@P`P`hd@ 0(K  P( 1S-ܽpn -@3LS## P ㌐P y7 -@RLp` D P; 0 0 P]PPP7; 1 7; 00 0-LM@P,0 p`TP 9@ V VV(K3 03P-V_ ̠A00 L @M> ,0K`劍 0, d  04 S,0 0 0@0@Cz 0 뼃0 0 @0@,00@0 0@0 0 ]7P |P  㽀 ᄗ0800嗐0 0 @0@(aDpn -@L#67P 3S 塏P 㮏P 7噎7 Q-L岌 -LM0S0 免P | ?00-LM@ PK0KF0K0K@K@K@K@K@K徐PK0ę -L MP@S P { K!1 @2.1@!3#܃$ K܌@P$0PS00S(#0@St$富P<   0P$# P,#A*@K`Pp͔ 0 0 9!0 1!0@ 0h~ᶒ}  P̔ 4Ȼ"hxj軙pno\0_] Qp-LM`P ?0@0 0K 0K@0EĠF K@K0KKK0KPK`KPKp -LM`p‹PP KG@0HD (K(0K'K%K#@K&pK$K"PK!PKP p-L M@`ᡋPP Kp?0F"0KB0"K K!KK0KPK PKPK`KˏP [0[ -L個Pi @0kpǏp p؀mPoP` P`o0OP` P`P0 0@0@ 0p-L MP`0KI@P Kp?0F!0KA0!K K KK0K@K@K@K`KsP[ -LM@)P K@0  K0KKKKKKKKVP %d `0-P9@L=9 Y4 ؔ0P 0孍P30S4P 4复P00438P w8嚍P083P m03P 03P a03P00301 4+ % 긾x -L3P*>;p9@`00S 0@ᐓۑ43S L03S83Ss Ypnؾ 0-LMP,2S <90@\<3  ?u0 0@Q<3 P @@ > T <31<3`009@< ?J0,"  <31<3L7 -LPP9@@Xop" Agd @<T9`   3Q7P* (7P z$ %# !"  03S 9@0;9 iLP8P pn -LP`@pᵉP@ 蔑1T% 0T  00ԓ4P@ 6@*@ & = S3 @S$ @ 6@|3606X0 R @ @ c0|@@?|3  ` ` |3 `` pn i 0-@9,P=PLY9 ̊,P3,S0P Ê0P00034P 4܋P043dP 0d3\P 0\3PP 0P3HP00H30s 4m g 긾x  0-LM@? P R K0$ 3>PP C L̠\,`3,/ P\ӋHhx 2-QMLP`@L3p0 PC0L BϠ0,͠ L3?  lbA_HL30\\  守H埋P  0>Kt30t3uř 0-LP@tP0601S k|P0 P1S koLP  .|6 &;606;600 r0C0 BQ  00S: BQ  10R!!  10C1 -LP`p%@P䀟9WI;9 WW0 0@0@t tW 0 0@0@ p2S 0r 0妋 pn -LMpއP $KP`0@P`P`hd@ 0(K  PH&H( 1S:ܽpn 0-PH3@SLDTSPS 凊PH 㔊PL 070 -@RLp` D P; 0 0 PjPPP7; 1 7; 00 0-LM@P,0 p`aP 9@ V VV(K303&P2Va ̠A,0 L @ZK ,0K`嗇, R o 04,0 ,  R0 0@0@C傕 0(뀃0 0 @04 0@ 0 0 ^7P |P  z4 Ꮡ08,墊0 0 @0@xDpn 0-@PLXhS 67P \3S 嫉P\ 㸉P` 070 Q-L -L|3PSp`@P fQU0@39@00S 0@ᑏ܍03S L⦿0|3,3S43S7pnؾ -LM0S0! ZP  - L@P/P m hId Qp-LM`s@@0?0rP 0K 0K$4& KPK0KKK@KK`KvKp -LM塆P8 0 $R ,K0 KUP. ! 02 (K,0 ̠ČL ČD#̌!D"L  0@P( f  \ ,T,P 80 p(̠Č"Č#̌ 0P G  ,TL\̠h<Č4\.4L&Č!<"̌D.D L 0@cP   H,ZT 㟐S:TřXř,řřřřƙ -L MC^P 妾 K$ K@P$90PS00S$#0@St$P   0P # P(#l| 3S $3SHr 8m 0P ^3f 1CRP@) `O@Ppߍ B 0 9!|0| 1!0@ 0hȋᏏ0|30#{(ƙ軙HƙpnTtwpƙ p-P`L@ ᧑P cT0! L0@/@ R phI$ph0 pho Ȼt*< @0-LrM .ĠK0KKK K K K KK K -LMP 2S  !00  Kh/0P00" @3p`4 88S @T` 3p@4 88S0!sBO@Õ0,)000 P Kh -LM@9@P Kq 0`9/   00 p@ l7P a7P w,3S 9@0;9PB8;*P pn -L@`Pp P1h!R|Pl`1U% 0U  00$4PP 6@P  P& = S @S& @! 6P83606b0 R0P@ x83 ?  G83  ?(  <ƙpn i R-LM R R K0K I Q-L厃 -L@p|PP`0P@` P`h腼ܽ 0-P\3@SLXlSdS AP\ NP` 070 -@RLp` D P; 0 0 P PPPO7; F1 C7; 00 -LM`Pp,` @P$9@! T. TT 3S! TG 1#3 S03ʸA40  @(KxR Xc ,0K`=? ,`,``F,` V p ,  R 0 0@0@4z0 0 @0`0@ 0` 0 T7P |P  wv >0800 0 @0@'ƙƙpn 0-@PL@TS ,7P D3S ZPD gPH 070 -LM@aqP 3SL 7P 7P ,0 ?xP  L_K0WP,8 ?YpP  @H3D4 - p6D'9@0;9(1΄hq ? @P j 0pnHh(ƙ 0-@94P=PLY9 r4啄P34S<P i<匄P00<3 P _ 傄P0 3LP U0L3DP 0D3dP I0d3\P00\30 4 庺  崺 Ǚx -@`LPpᐁP@ 䠟0U 0U 0 0ᯋ4P@  @@60@6 0 R0k@@ g@pn i -邡ႂLM0j`@P`3p 3/00 `\  @0 Q0 0! "0j0$K  ` @j@0dc"!B \`3< -LL  '\P $Kx30x3' 0-LP@P0601S kP0 P1S kLP  t6 &;606;600 r0C0 BQ  00S: BQ  10R!!  10C1 -LMpP`墀@P $K09VI;9 VV0 0 0@0@ 噹V, (K 0؀ P  `(0S 0 0@0@2S 0f 0 0@0@< pn -L3PS`p9@`00S 0@1|03>pn 0-LM@P ՁPP 0@  P 0P 00 SS0 -LIM`pPs8@K岁0 P?ềP pS P 0$S0S? 0SpڀPw (0S@(0@SP$0rP 0S$ 1@,3(0S,3S ^03 `R@0S3stP  @ 00S0#(30S,<@EP0p,ȃ@P,- 0#8#0`S0@0S8#0St,Pj   0@0S0#0S03s 83spW03s 83s PrZ` =K0K0C 幍PKY 2$KO0` DK~< $8 #44"<,K ,0 02·@ 01!9!1!1!0@ 0Phẅ၉03 Z0Sp  $K3,3,3S@  0$00B SAB Qa0B7 BSW B? 2"0 P2O XշLѷ@ͷpn*DĒǙPǙhǙpQ4ǙǙșǙ/ -@LO30CS3h̃ 303(OP/=0z p-LP@`0~Pp6@00"00pH0  #0  03S00p;x30t# p 0-LP0`~PL0  p3S lCT 0@T0h0 -qLM0P@3`0 -C;QA4sq0+ @/ 033H  :~303(30CS3@T z d!0az K< a<0>.303,<ș 0-LP@0}P03S0601S kP0 P 6;600 r0C0 BQ 1S kLP  q6 &;60 00S: BQ  10R!!  10C1 -LP`p0}@P=WM;= WW$ E? 0@1A 叶W C? 0@ 1A pd2S xq 3H0330CS3ሂpn 0-LM@P`pP`P`hUd@0 $KP}$ 1S 8 Kܽpn -@3LS## 0P $P ~7 -@RLp` D P; 0 0 PPPP7; 1 o7; 00 -LM`pP0|P&U& UU h0l0h0~PCUK @Ÿ@BD0  @|30330CS3'(K,0K P|,0S 04 C, 0  G? 0@1 A R"A? 0@1Aᯁh@ 0(凵h3D03%30CS3ᘁ꿠0R Px0 0@0A,   0 ;7P P  p  ؆08 vA? 0@1APDpn -@L#7P 3S 0~P ,P 7}7 0-LM@0{PP K034038 D0P WP 30CS34< H0PP BP D<D3,/ P{~HhP Q-L0{ p-LM@PPr` 0{P KpFL@0  KK 0KK`KKKK3 030 K30CS3Pᾀ -LM@P`P 0{{pP KNL@0 ' K#K(0K%pK!K&pK$K"K3 030(K30CS3Pᎀ -LM@P`pP 0K{P KL@$?0 KK$0K!K#K"K KK3 030$Kq30CS3P_ 0P-LM  K@@b0P[ -@PLMP`p 0 {PUo @ LGĠ0 K KpKr  @   9G 8Tș p-LM@PP` 0zP U p; @       K0 f [0[p ʳpTșP -@PL0zP_p0 ` p@0PIt30 x300S0#R00S d2 S# xpn -L M\a@00 0 jzPP 0RJK7(pK  l=   -D3S<=  r =  0 r }!0[<P<@4T% 0T 0T0/⊇@6 @ y@60@6 0 R @6@@@ @1@x@(pni 5i 6i( -Ld0@x`:0=Qt0Nt30CS3p}=@.0 _# x0S ᕁH0S ⪱D0S p⤱L0S X垱P\_ pndșșș -LM0S0  NyP d @-LM`Ppi0` @P `0Px(K2C3CSG2DDS3, Kx@PK,0 400 y24y080@0<0 `RAS7 0@St4xP2 00S@8<0S80s' <0s$ @0s! ء2@K 0pP  Q@h`ᄀx`H 㮼 xP> 1 !=1 "!21"!|3 1#O 3h#0 dc؅ 0   0Pl#R  ҆M~P c J"0ᧆ"㿆pQ̻쫕șdpnęəəT֙螕lL|h -PLa@pQ kz@P 101!1R#@10!RA@@10A! !0/0@ 0@ @1017@pn 0-@9P=PLY9 xyP3SP xyP003 P x yP0 3DP 0D3<P x0<30P 003(P0x0(30Q 4K E 긾x -LP`vP9@VVVppp30p3xPVhnz`C 0ps  0-LMP? {P  孯K0 ?{P  垯@ 2>@ Pj{@P  T凯ˠ<@34/ @v<pyHhd 2-AML@`Pp ,3?0S(,3O\\  Xv(IyP  0I KT30T3Lș 0-LP@vP0601S k&P0 P1S kLP  i6 &;606;600 r0C0 BQ  00S: BQ  10R!!  10C1 -LP`pu@P䀟9WI;9 WW0 0@0@ tŮW 0 0@0@ 0 p2S 0r Py pn -@(3LS0#$4# dxP( qxP, (^w7 -@RLp` D P; 0 0 PEPPPt7; k1 h7; 00 0-LM@P,0 p`!90 @0Pph|0 0@l0 1$zP{8偬 (|Ȼ軙pnlŕĕܸ -LM0S0 8tP ؃ 0-@9,P=PLY9 t,u,S0P t0u0S4P t4u4SXP 0X3PP u0P3DP 0D3<P0t0<30 -L@p sPP`0P@` P`hܽ -LP`rP9@VVVpp303tPV,hvxCD 0s  0-LM@? wP / ֫K0$ 3>wP  ǫ7( ? @wPP  T尫̠P,T34/ PrPuHhʕPѕ 2-aML`Pp@00@#@@3o@#@Õ  0@ÕC40 @ÕB( 0@#C<0@3 0MDC <@30\\  fr<WuP  0W Kh30h3ϕə 0-LP@,rP0601S k4P0 P1S k'LP  e6 &;606;600 r0C0 BQ  00S: BQ  10R!!  10C1 -LP`pq@P䀟9WI;9 WW0 0@0@, tӪW 0 0@0@ > p2S 0r 0^u pn -@<3LSD#8H# rtP< tP@ <ls7 -@RLp` D P; 0 0 PSPPP傪7; y1 v7; 00 -LMP@, `pJqP9@ W WW(Kx30x3sPsW ̠B,0 L @Eq6t ,0Kq,Xb0 840LT | $T ,0 840Z04 Z   40 0@00@   Y7P |P  d  s{ 0 0@0@xC, 08ҩx $̩~,nt{Pѕ4əPəpnDə -@LL\#7P P3S |sPP sPT 7Ptr7 p-L@pPp`P7P 7P ,3S 9@0;9pPpP ppppn -@`LPpIpP@ 䠟0U 0U 0 0hz4P@  @@60@6 0 R0$@@ @~pn i Q-L p p-@L`9@P00S 04w03S @p,3S43Spnؾ -LMp@ ~|P ިKC$ KNp@P$pq0PS00S$#0@St$!pPM   0P # P(#峨 3S7 $3S4 (3S1 P0O `K0`h c02-x@ 叨0 p10)1 01!0@ 0phߴvyDt 4oȻ軙pn*4`Օ͕hʕ -LM0S0 (pP / -@L?30CS3h^t 303? -@PL0oP=0hok p-L@P`0 oPp6@00"00p x30t# p 0-LP0nPp3S lCT :0@T0h 0 -qLM0@P `3C ;R' @H3 /  n303q30CS3@T } TƧ0k K<b<s3038ޕxə 0-LP@0nP03S0601S kP0 P 6;600 r0C0 BQ 1S k{LP  :b6 &;60 00S: BQ  10R!!  10C1 -@PL0AnP_xp` 3S t3 x30S d2 S#Pxxpn -LP`p0n@P=WM;= WW$ E? 0@1Ae| W C? 0@ 1A w pd2S xE 3H03q30CS3spn 0-LM@P`pP`P`hҦd@0 $KPn$ 1S   Kܽpn -@3LS## 0spP pP mo7 -@RLp` D P; 0 0 PQPPP倦7; w1 t7; 00 -LM`pP0JmP&U& UU h0l0h0oP4Uq ̠BD0 L @Hm3036p30CS3(K 00KP|m 00 V00SA? 0@1AlK -LM@TS04`^S0FtNT!0" $K$0K#K!PKpK"K `K@K@KlKT0S/TS0S/SR R R/  -LMLp@`ႬP@ K4P0ED!0 (K #@K(0K'K!K&K%K$PK"Kk@P -LM(00KCC$C80K00KK: KK0K  000K0K<  S0 0K  S0 0K  S KP KS0 0K0 0K p-L@0P`fgPp$0U 1UpH00pU@ 0-L0@PPgP0U UU0d0hkh0S0i0 S0o n0$R L0hNp PP@00X0 000<<00hʙ -@dLPhdiP0d0u '0d0(ʙ -LM@`q d0S Kh80qLd0 @kPL -LM@@ 0`K00P0phgP* T( gP 0S@T 0 S0SxgPx (0S @$0ghP 0S (0@S(K$S0S S S00fP@00 -L 0\0X04\0 1,H 8p 4 00 < L D @ ,P P" bn 0_i0_c r`P4 Mn 0_Tx0_N\K` `0t`GP0_A<ۘ0_;P˙˙4ʙ(̙˙˙˙KKʙʙ -LM0S0( `P 0R`00Qa00/ p-L0P@H`_PpT TTpDphCca@`@ \  0a0a0<<a0phc 0-L@0s_PP0DP0`D"bPHf.DP0m vHf .DP0 Ǚ 1-L M@#R#R1K Qp ` 0 3 Q p ` 0 G Qp ` 0 K Q- p ` 08P00K@0EDK(0K<0C(K K pK`K'K#@K"0K!K&K%K$PK^cKN 4 (s`r a@P0 &Ġ0$@K#@K"@K!@K(pK'0K%K&`K.a@P KUk ̙ 0-@( LK RPT ږ RM %ʖ RF K RB 0RF #KR? R;       < S$ SP00 R 0R R KR S  S DP 0    @0p-LMq@.T ` K0@K@K@K@K 0KKPKK`@P j }Kp̙Q/@Q0S/QQ550055P0S/QP550055R R R/ 00-LM@P 0KKK0K0K0K0K0K0Kc`@P j 4K0̙ 0-L@0\PP0DP0]D^PHf*DP0mj Hf*DP0 Ǚ ?00-L M@/PK0 K0KB0@K@K@K@K@KK0K!`@P Kj K0̙ -LM@0[P @0s D0SV00P KV0.pP `K0 YV0PUf L 0 (L@ D0H4Xd @`P @ 0⫔U D͙t!͙ Q-L0[ 0-@DLPP ]D+^Hf *0D0XP0m0X00 0-L4M@p@00pD L0 P0 ZfPP i $f0V[ K0 ]PZ 4 [PP i S0C[4\0`80 R0P0s[ L0s^ @0sO 0504QPT0 h1̠@ < @ 0p , (0 4 D 8 $@ P0 {i "0[00SL 0PSu4r[P   00SP  S@  04L00Z 0ZTKl l0oX\0ZH0Z~40ZxP˙ə(̙4ʙKK˙ʙʙ -LM0S0 [P  RN00QO00/ -LM`0@DPZPT 0Sp@ PN 0O0 KipTT K@ Ki9^p吓0 @Hp 0 S 0$ uT͙͙͙ 0-L@0TZPP0@P0[@]PDf(@P0h WDf(@P0 Ǚ -LM@03ZP<0s @0S Kf H'H< @0D44d @_P < %(,͙ @0-LMrP8`#K%FDp 0$K$0K@K!K"PK `KKK2^@P00T00S Vh K,Ι00  = !% , R   R  R *     Q  M0S/M Q  L0S/L Q   K Q0-L@P  Q %0Q Q Q  T 0hQ KQ Q Tp 0hp Q K Q  Q KQ   0-@LP( w0R R R/ Q-L0PY 0-@@LPP Z@[Df'0@0PP0Tk0P00 0-L4M`<@00LM L P dp@P g )0Y K0ZPR 4 Y@P og 0Y4Z0P80 R(<0sR P0sU L0sF 4PDT T@TKH!H1@ 0 ,P ( 4@ 8@ $` mP00SL  04<0 0@St4=YP   00S SP  04D0 ˑ0X<  04H0 l徑0XX帑0XD岑0X0嬑0XDΙlΙ$KK4ʙʙ˙ʙ -LM0S0 fYP $/Q/ Q / / p-`L@P4 0S p@@ppnT/ p-@Ll`` 0CQP 0Sp(0 .Uppn\/d/ p-@LH`<<0 RP UppnX/T/ X0p-L L`@< 000P0S Tp'pnh/X0 p-L@H`< 000P0S Tp'pnh/ 0-L Pp@`cPh 0000ST 0 'pnh/( -PLp@p 0 S` R0,0/ $  Tpn /$/0 0,B$ rT//-0< ?0R< C4/ 0]T// -LM`Ḑ0, pW h] @P^ሀ 0 6UpWH0  0h,$0 , pn\/<d/`/Ι -Lp<`@P 0$@'( 0-@$PL00h'( -@Ltph0 R` ]PP 000< 0T(0 R0  pnT/X/Ι|0 -LPl`p@T00 @ #1 00P0$00C 0@'(/,/8/ - pL #tt!000``=HOH0S(3(Q0@&-22PU000 @iTP0S 00CS0X"00b0`0 00D0,000(0([d(h/XpnΙ(  0I"; -@L8pP(P`ᖘ00pnP/ 0-L0@P00~000L/ 0-L@P Q00 S x0 00S:R   B@0 /   0hR / 000hR// p-L@^ `P  ^* ^&0 ^"1 P 0S ᭚pl0P T0 ^ 0  0CRp 0P'(/,/L/P/ Q-Ld @T0  0CR  s0 Q'8/(/x0 0-LP@UP0T0TT0T08@8 000+Y00CS000hZ(d(4( 0-LP@\UP`Tp TT c h`T @@@ 000X00CS0hZ(pnd(0( 0-LMP` 0 2p@UP"T" TT; T9 TB 1QA 0%͠ %L @!U000X00CS0%K  0K@UU R0 QF Q? 9CSCCCC\B\BCCFc 0Z@ 000X00CS0Y֍ҍ-7~  ^(4(d(ADΙΙ 0-L@P 00 0WPb P0t嚍d 00CS00P 0D hR, 00C0PP 5  C0?`% V Pn%-@$K0S2*@KP0"KRK2K2R4 0R0SO2K?2K*@K02K00C SCLLLKLLLKKKL 02K(22K0*@K2K 20Sa 20SW S*@KK!PK`0LK20p&㵗W?F 4K`K᪗vPV000000 R  B⒗h- K  0<@/\ P `R 0 @P@ ag0 R\ 0*@K2K0"K2KD      '$D(0ϙ'(($,$0('A/ 2-LM ?Rp` 2RS 0RD BG2"p 0 00@ [0LŸ-0 @ KPpP81! @! 0C͠ `0Ch!`(0C PX1p p pQ0`S @00S1 0@St kPP   0P0  P0 0  #P  PzP `߈TۈL0  @Ȼ((T/X/ ($(((軙(/pϙh(= -LM0S0' PP X-0S @Q 0 S 0S 䰅?#=?c1P20`s/<Pr0`s/ -LEMpl, eOP <, 0RI(K(1P L0I͇p 0 p 0KK @0 1 P, 0R(KW WW G 0NW 2P>K pwM01S0 L  0 40C 01 FL! 01H 0 0HL; D 00@|!0@ @ q7PD P0S @1pp0p 0  0!@0 1 ,Ksƀq0 S '@ { w4A  q0 %k g c   ]0 %W S O  J0 %D ~@ 00Cs0S  ZZ ^mS8 t 0-06L0PS0CS006 0hi(w0 0@0@0` -LNMP! 0,0 00H1 0@ H6o  HrP 0 P!\Q 4! 4 \(5` VʨX 41S S8S S@ | D! 4P x0Cr 0C 0 4`V" P0@@$41J͉0px47 P2 Bpr0C t0$ 5APࠁlLß, 0R(K0 u qD#P08020 0\GjX@ P!p0  081  8 24Hp  4@0@!R@@t@%H< <1S<v p7R?4H@i(0D0PS 2D D `VSu8HS   Hr < F 0 0  000a 0dpqA PR `\L P!000P!P<<0 0<@1 S8  0L8<@ 0X B@ @ =w@P@ =LD F 00/D .000b0,X\PLәpn  p-LM`6P=@Sp 0 B0Q4@r8Sp1SI k4P| F= Rt1SI k(@LP  0 K@P P  0 ?PZ1  06F= RKʃ.0@ BT20S*0 0  P  0 P p q Bp 1AS  00S:A BT  10R!!  10C1 10R''  88 0C8800  P6;6ppQ 020 0@0@p -RL@ ZZ J uZ) 0 0@0@`0P p F0 P0@ B 0@xәpn -LMMRR0`,0 p \\ \; "ˠB0L  @M<>?, 0R(K>K <01'S0 0@0@0@@Ps ; 1 uᕚ1? 00D! @ H1  D!00H10 04D!8<#8:#:0 0<14!@ 0S( $1 <1H 0IL1 1KKp0p0L10010$ D1  ,1 - "P2U@@PEbl2-P `"DU@@ Pb<2-P 0"U@@b2-@ "Tp  @Pb?N. !PU@1!9!1!10@!0` h׶D>fh1d!`1#3TT!4dI  X0'818!8 D0C0!<0@D BD0 K Kip Ki{p Kivp Kiqp 0"Oՙ,֙6(&(&67X$x\t0ꨑL/pn -L M@lP0t`xp|0t0x0@@0W PPV 0 pPnKpnԡT֙ 1-L$M@p t 0h,0 Q0`4pt   (@. , 0R>(K>HQ0Q rt 0t08@ LKH CPP @0@@ TT l008 X @08 X t Ho1H#C먑,pn `!-LMpp0(@0TQ`04%$0S  < S +S  1T tH 0 @@}00C0@P cT @0$ ( 0T@ S  S8 08   8 <8X8 08 ꨑ י (-LM4("$4   R8 <0 Z0YV s@Z@ t3# 0 pE   <0 0S0 4 t0  0@(K8  0S 0@ \#3 ťt|@P t  t0t@́t 2 0 0R@K<|20  009000800060420 00 0  S{0@4`Z?.0  ( ( ( ( t1X0` S?2c0Cs0XX, P$ 0àL\,4s007/004P @\`,0 06/.@0  -Lp04@P\`, 86/W004@ P\`, 86/.0  -Lp04@P\`, 76/W004@ P\`, 76/.,2 Pp-L`PY P, Pp04 0\0@40!\04/1\0@4 0\004!\0@4/h1\p04 0\0@4l˜8 1\ 5l˜ 0\lB94 \l2pBh P\`,0h ,0 06/l2xBpRpD@ \`, 46/0,8 0rP'  wh+P ,\ll˜0 2 0X 7  ٦ զ:$[ۙ$+) |@ۙHۙ쇓ۙ/X/P// Rp-L@`P 004 ,@DTTp004 ,@T p Rp-L@`P 0@D4 0\TTpT 004 T0 0\p 0 -L004p,0/040 0\3  004@0 P\`,0 <6/D1\0\0\0M(8\ `8 \ `\B004@8 P\`,8 006/ -L004@pP\`, <6/004@, P\`,, 06/  Z 004, ,0 Z< 1-LAu?x0&\@\P\@  0#P\0A?\@`@ h0\0 0 S\ 004@8 P\`,8 006/pnٙ -pL044 0\0@48 0\hP)004@, P\`,, 86/044 p0\0@`048 \004@( P\`,( <6/  pn7 -L00Pp`4$ ,OW@T 04$ ,0S  @< -<04`@VLp03АP`dsVP 02  P 0Pd$80<V@@@  `drVP P<0@0<00<0 1-L`LP%V# *r@ *@PT㊠U @p @V*pW004@ P\`, <6/ c@P%004@, P\`,, <06/004@, P\`,0G ĠŒ, 06/ <@ 0pn -LMP4@T80T``ḞPc  Y`@< @J T T$1 Xh>ۙlܙȓh(OpenBSD5.5RAMDISK-IMX#8 @(#)OpenBSD 5.5 (RAMDISK-IMX) #8: Sat Mar 8 15:48:10 EST 2014 OpenBSD 5.5 (RAMDISK-IMX) #8: Sat Mar 8 15:48:10 EST 2014 nick@bbb1.openbsd.org:/usr/src/sys/arch/armv7/compile/RAMDISK-IMX ahci_get_pmp_ccbahci_put_err_ccbahci_get_err_ccbwi_do_hostdecryptwi_do_hostencryptwi_attach  @Xp     000@@@@\\\\||||00 0!"#$%&'wihap_assoc_reqwihap_ioctl 7nehci_root_ctrl_startdb_fncalldb_commanddb_print_cmddb_examine 88888 9 7 6 97 5 9 423 9 2 9 1 0 9 9 \/|\/O|/-|db_show_regsdb_printsymdb_write_cmdau_get_muteau_get_gainau_get_portaudiogetinfoau_set_portau_set_gainau_set_mutewskbd_set_mixervolume_callbackaudio_silence_copyoutau_portofaudioattachaudiosetinfoaudio_rintaudio_pintaudiostartpaudiostartraudio_clearaudio_drainaudio_init_playaudio_init_recordmidi_ointr  !"#$%&'()*+,-./02468:<>AEIMS[g****++++(((())))....////,,,,----""""#### !!!!&&&&''''$$$$%%%%::;;8899>>??<<==2233001166774455   jnbfzrJZ镗 "&*.26:>ACEGIKMOQSUWY[]_abcdefghijklmnoppqDqrDrsDstDtuDuvDvwDwxDxxy$ydyyz$zdzz{${d{{|$|d||||}}4}T}t}}}}~~4~T~t~~~~~~~~ ,<L\l|||||||||||||||||||||||||||||||||<<<<<<<<\܆\܅\܄\܃lL, ̂lL, ́tdTD4$ԀĀxph`XPH@80( jkhinolmbc`afgdeu@ut@tw@wv@vq@qp@ps@sr@r*."&:>26 UWQS]_Y[EGACMOIK~~~~~~~~~(~8~~~h~x~H~X(8hxHXzzz z`{{{ {`xxx x`yyy y`}P}p}}0}}}}|P|p||0||||@@@@@@@@XHxh8(؁ȁ聘XHxh8(؀Ȁ耘` ` ` ` Ђ0pPЃ0pPchacha_encrypt_bytesextract_entropy_rs_stirrandomreadexpand 32-byte kexpand 16-byte k n;AvXaM ְdx coredump_note_elf32coredump_notes_elf32coredump_elf32elf32_load_fileCopyright (c) 1982, 1986, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. Copyright (c) 1995-2014 OpenBSD. All rights reserved. http://www.OpenBSD.org 8MLdJJJJLLK\LLL؀?? $$l=HAt=|===sched_chooseprocremrunqueuesetrunqueuesched_idlecoredump_tradcoredumpsysctl_diskinitkern_sysctlsleep_finishsysctl_tc_choicesysctl_tc_hardware-resetprioritysetrunnablemi_switchupdatepridisk_mapfindblkmajordk_mountrootsetrootdisk_attach_callbackextent_print1extent_freeextent_alloc_subregion_with_descrextent_alloc_subregionextent_do_allocextent_alloc_regionextent_destroyextent_createextent_registerdb_show_all_poolspool_do_putkprintflogpriassertwaitokttwrite@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ttyunblockttypendttnreadsoabortsofreesbwaitsonewconnbiodonebuf_undirtybuf_dirtybuf_putbremfreebuf_free_pagesbuf_alloc_pagesbuf_unmapbuf_dealloc_membuf_releasebuf_mapbuf_acquire_nomapbuf_acquirecache_lookupvprintreassignbufbuf_replacevnodebrelvpbgetvpvwakeupvwaitforio|tttttttttsys_fhstatfssys_fhstatsys_fhopensys_getfhsys_mount  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~!#$%&'()-0123456789@ABCDEFGHIJKLMNOPQRSTUVWXYZ^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{}~Ͼ󨷵ǎԐѥ噞᷵ǎԐѥ???????????????????????????????? !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????msdosfs_lookupUmsdosfs_mount( P ,|, 0 (߆,T msdosfs_createmsdosfs_mkdirmsdosfs_renamemsdosfs_readdirbpfwriteifpromiscifnewlladdrif_getgroupmembersif_getgroupifconfif_clone_listif_group_egress_buildif_downallifioctlifa_print_rbif_upif_downif_startn; &C vkkMPG&"֊/aK+d 5ӆ1 q^h,`@yFgKrޔԘJk*OņךUfϊDx%K]?!HpcwucB0 mL5&/ᾢ5̈9.WUGz+2ўfD~T; ʌ)k<(yv;VdNtے lH]nCĨ917Ӌ2CYnڌdҜI%ϯʎGooJr\$8WsQ#|!>ݖa B|qؐ_jiX':'8+3"p3-"< IxPzY e1ƄÂ)wZ{m:,ieee80211_wep_decryptieee80211_wep_encryptPPieee80211_recv_probe_respPPPieee80211_ioctlieee80211_ibss_mergeieee80211_end_scan  0ieee80211_free_nodeieee80211_node_attachPP ^/ f ^/ ^/ieee80211_recv_4way_msg3ieee80211_recv_4way_msg2ieee80211_recv_4way_msg1PP ,Xq'Of ɴ:}Jc1`3QESbwdk+XhHpElޔ{R#sKrW*Uf(µ/{ņ7(0#j\+ϊyiNeվb4ъĝS.4U2u9 `@q^Qn!>=ݖ>FMT]qoP`$C@wgB谈8[yG |B| H+2pNrZlV8ծ='9-6d !\hT[:.6$g WҖO aiKwZ *C"< Nj򹨶-ȩWLuݙ`&r\;fD4~[v)C#hc1cB@" Ƅ}$J=2m)K/0R wl+pH"dGČ?,}V3"NI8ʌ6 Ԙρ(z&ڤ?:, xP_jbF~Tؐ^9.Â]|i-o%;ȧ}nc{; x&Yn쨚Oen~ϼ!ٛ6oJ |)11#?*0f57NtʂАا3JAP/MvMCTMўjL,QeF^]5st.A ZgRے3VGmaךz 7Y<'5ah,4$8_@r %⼋I<(A q9޳ ؐVda{p2t\lHBWЧQPeA~S^':k;EXK0 Umvv̈L%O*D5&bZI%gE]u/LFk_眒zmYRڃ-!tXiI)ɎDujyx>Xkq'Oᾶ f:}Jc13Q`SbEwdk+hHpXElޔ{Rs#KrWUf*(µ/{ņ7ӥ(0#j\ϊ+yiNe;b4ĊS.4U2u 9`@q^nQ!>ݖ=>ݮMFT]qoP`$֗C@̞gwB谽[8y |GB| +2HprZlN8Vծ=9-6' d\h!T[.6$:g WґO aKwZi *"4$8,@_r% I<( A9q ؜Vd{a2p\lHtWBQPA~Seä':^;kEXK0 Uvm̈v%LO*5&DbIZ%gE]/uLFk_mzRY-tX!I)iɎDujxyXk>'qᾶO f}:cJ1Q`3SbEdwk+HpXhEޔl{Rs#KrWUf*(/ņ{7ӥ(0#j\ϊ+yiNeվ4bĊ.4SU2u 9`@q^nQ!>ݖ=>ݮMFTq]oP`$֗@Cgw谽B8[y|G B| +2HpZlNrV8=-6'9 d\h![T6$:. gWҖOa wZiK *"$8,4_@r %<(I A9q ޳؜Vd{a2plHt\BWQP~SeAä:^';kEXK U0mvv%LO*&D5bIZ%gE]u/LFk_zmYR-X!tI)iDujxyk>X'qOf }:cJ1`3QbESwdk+pXhHElR{#srKWf*U(/µ{ӥ70(#j\+ϧyNieվb4Ċ4S.U2ኤu 9@`^qQn>!=ݮ>MF摵Tq]o`P$֗齉C@gwٰB8[yȡG ||B 2H+plNrZV8=ծ6'9- dh!\T[$:.6 g WҖOa ZiKw *h8,4$_@r %(I>>>KKKKyyyy xxxxZZZZݨ33331111YYYY''''____````QQQQJJJJ ----zzzzɜ;;;;MMMM****뻻<<<q//^SShѹ,` @ȱy[[jjFˍپgK99rJJLLXXJυkл*媪OCCMMU33fEEPPD<KKܽa ppB>>|ĵqffHHaa_55jWWйiX':'8볘+3"iip٩3-"< I·UUx((PzߥY  ڿe1BBhhAA)w--Z˰{TTֻm:,ccƥ||ww{{ kkֽooޱőT00`PggΩ++V}׵bMvvʏEɉ@}}YYGG AԳg_Eꜜ#Srr[u=&&Lj66lZ??~ÃO44h\Q4qqثs11bS*? ǕR##FeÝ^0(7 / $6=&''Niuu ,,Xt4.6-nnܲZZ[RR;;vMַa}))R{>//^qSSѹh, @`y[[jjԾˍFg99rKJJLLXXυJлk*OCCMM33fUEEPP<!KKݽa܋ pp>>|Bqff̪HHaa£55j_WWiІX:''8+"3iiһ٩p3-<" ·IUU((PxߥzY e1BBhhиAAÙ)--Zw{TTm,:cƥc||ww{{ kֽkoޱoőT0`P0gΩg+V}+׵b׫MvvʏEʂɉ@}}YYGG AԳgԢ_Eꯜ#Srr[u·=&Lj&6lZ6?~A?̃O4h\4Q4qqثs1bS1*? ǕR#Fe#Ý^0(7 / $6=&'Ni'Ͳuu  ,Xt,4.6-nܲnZZ[RR;vM;ַaֳ}γ)R{)>/^q/SSѹh, @` yȱ[[jԾjˍF˾gپ9rK9JJLLXXυJлk*OCCMM3fU3EEPP!KKaܽ pp>|B>qĵf̪fHHa£a5j_5WWiйX:''8+"3iһi٩pَ3-<" ·IUU(Px(ߥzߌY  eڿ1BBhиhAA)-Zw-{˰TTmֻ,:ƥcc||ww{{ ֽkkޱooT`P00ΩggV}++bM櫫vvE@}}YYGG A쭭g_E꯯#Srr[u·=Lj&&lZ66~A??Oh\44Q4qqsbS11*? RFe##^0(7 / $6=&Ni''Ͳuu Xt,,4.6-ܲnnZZ[RRvM;;a}γR{))>^q//SSh,@` yȱ[[ԾjjFgپrK99JJLLXXJϻk*O媪CCMMfU33EEPPxD<<%K㨨QQ]@@?!pH88c߼wuBc!! 0mҁL &5/__5DD.9WU~~zG==Ȭdd]]2+ss``OODf""T~**; FF)kӸ(<y޼^^ v;dV22tN:: II Hl$$\\]½nCשּׁĦbb917yy2CnY77ڷmmd՜NNI੩شllVV%ʯeezzG鮮oպxxJo%%\r..8$WsǴQ#|tt>!KKaܽ pp|B>>qĵ̪ffHH£aaj_55WWiйX:''8+"3һiip3-<" IΪUUPx((zY  eڿ1BBиhhAA)Zw--{˰TTmֻ,:cccc||||wwww{{{{kkkkoooo0000gggg++++׫vvvvʂ}}}}YYYYGGGG𭭭Ԣrrrr&&&&6666????4444qqqq1111####''''uuuu ,,,,nnnnZZZZRRRR;;;;ֳ))))////SSSS [[[[jjjj˾9999JJJJLLLLXXXX着CCCCMMMM3333EEEEPPPP<<<>>>ffffHHHHaaaa5555WWWWiiiiَUUUU((((ߌ BBBBhhhhAAAA----TTTT @6MD5FinalSHA1TransformSHA1Final؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHG"(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDlɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~[/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxqg jgrn<:ORQhك[ZAES_CMAC_FinalHMAC_SHA256_FinalHMAC_SHA256_InitHMAC_SHA1_FinalHMAC_SHA1_InitHMAC_MD5_FinalHMAC_MD5_Initaes_key_unwrap H!x-ML.RN8D( `hz=Skc|j9{Б/Uڅ?AZX_f ؐ53eiEVmv° GJBnI[#Q")yq~ ruo7ӎbwO$26󦻬^lW%㽨:Y*F?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@ffs_mount CCC\`LD ufs_makeinodeufs_readdirufs_mkdirufs_linkufs_renameext2fs_readdirext2fs_direnterext2fs_mount<ьCȌCC|ƌČĿ$`׌LD|X xX\H `X8 h ȳ0 ( ܳl @L 쳘X uaddr_pivot_removeuaddr_pivot_insertuaddr_bestfit_removeuaddr_bestfit_insert|D@'DLMLMLMDvuvm_map_printitvmmapbsyBUSYWANTEDTABLEDCLEANCLEANCHKRELEASEDFAKERDONLY ZERO PAGER1FREEINACTIVEACTIVEENCRYPTPMAP0PMAP1PMAP2PMAP3uvm_unmap_removeuvm_mapent_freeuvm_mapent_allocuvm_map\uvm_aio_aiodoneuvm_aio_biodonesys_swapctlin6_pcbnotifyin6_pcbconnectin6_prefixlen2maskin6_prefixlen2maskin6_ifpprefixin6_delmultiin6_addmultiin6_unlink_ifain6_ifloop_requestin6_purgeaddrin6_update_ifain6_controlin6_lifaddr_ioctlin6_update_ifain6_nigroupget_last_resort_ifidin6_ifattach_loopbackin6_ifattach_linklocalin6_ifattachin6_ifdetachin6_selectsrcfrag6_inputicmp6_redirect_outputicmp6_mtudisc_updateicmp6_redirect_diagicmp6_redirect_inputicmp6_notify_erroricmp6_reflecticmp6_rip6_inputni6_inputicmp6_inputip6_nexthdrip6_savecontrolip6_inputip6_forwardip6_setmoptionsip6_getpcboptip6_ctloutputip6_outputmld6_checktimerfill_prlistnd6_lookupnd6_ioctlnd6_outputnd6_freend6_storelladdrnd6_cache_lladdrnd6_rtrequestnd6_dad_duplicatednd6_na_outputnd6_ns_outputnd6_dad_timernd6_dad_startnd6_ns_inputnd6_na_inputin6_ifaddnd6_prefix_onlinknd6_prefix_offlinkpfxlist_onlink_checkprelist_removend6_prelist_addprelist_updatedefrouter_delreqdefrouter_addreqnd6_ra_inputnd6_rs_inputrip6_outputrip6_inputrip6_usrrequdp6_output䲐Բ|| = = = F cc c      $ , $ 4 $ < $ p D L p 0P L p `X L p p` L @h T`l TP p L P t L P @x L P P L       Sx S S S S S  B7B7 @    T  T  T  T  T  T    / co  0/ cp ! :   @  `$  (  ,  0  4  8 < 0@ < @D < `H < L  P T X  \ T ` d l d  p d 0t d @x d P| d ` d p d  d  d  d  d  d  d     0 @ P(' ` p             Ĥ0Ĥ@ĤPĤ ( , 4 <DHDLDTDX`d`hp tpxp peqnecsccmiplvsvchilsgeltgtlenv0.01.02.03.04.05.00.510.0daiadbibedeafdfasdeppmzlsllsrasrror_bus_dma_busaddr_to_paddrA<A< A<`A<A$<`A,<`A8<`A8d>>>> ? P? ? ? ? <@p@@@A0AhAAAABTBBBBC$CHCpCC C C C D D ,D @D HD tD D D D (E TE E E E E F 0F TF F F F F F G h>i>0i>Hi>hi?i?i?i?i?j?0j?Lj?tj?j? j? j? j? j? k? k?@k?Xk?hk?k?k?k@kAkB$lC$nDXlDqplElFlGlGlGlG(mGPmGmGmGmHmInJ4nKHnK\nKnKnKnKnKnKnLnN$oPDoPXoPtoQoQoRoSoSpSpS8pSlpSpSpSpSpTpU$qU@$@c@c@eaQ@X@W@@0@ w@Q2@U@4@F s%^^uhub_attachDHޓٓړuaudio_add_extensionuaudio_add_processing_updownuaudio_add_processinguaudio_add_featureuaudio_add_selectoruaudio_add_mixer)*(8)DXwuaudio_chan_rintruaudio_chan_openuaudio_identify_acuaudio_create_encodingsl 9|97t8Dp ucom_do_openIZWugen_do_writeugen_do_readLa܁ikugen_set_configp4 uu ; u%5E u%5E     uu%5E )u&5F 2 5u&6F 0 1 3 4u0uhid_do_ioctluhid_do_readPx=$R B—]V—×FėIŗƗJ(ƗRƗ7`Ǘ Ǘ Ǘ  ȗ .ȗK>ȗȗ@#ȗȗȗȗȗȗ ȗȗH@ȗ N$ɗ _ɗ~ʗ˗\x͗ 0Η HΗ 0ΗE^Η ΗmϗKϗApЗ[Зї0ї &җ6ӗjHԗ՗?<՗n՗ ֗J֗>חabcde f g h i jklmnopqrstuvwxyz1!2@ 3#!4$"5%#6^$7&%8*&9('0)( ) *!+ , --_.=+/[{0]}1\|2\|3;:4'"5`~6,<7.>8/?9:;<=>?@ABC D E FG HIJK,L.MN-OPQRS T/U*V-W+X Y1Z2[3\4]5^6_7`8a9b0c.eh i jklmnopqrstuvwx yz{|}~ mMqQ@zy2" 3#6&$7/{%8([&9)]'0=}-?\./0+*1#'2#'345 6,;7.:8-_d<>| .'`0+*~5^q,?azw&12~ "3#!'4{"(5[#-6|$7`%_8\&9^'0@-)].=+}/0$1*2*3m4%56;.7:/8!d<> bBeE hH iI jJkKlL|,?nN~aArR,sSzZyY2 "3!'4"(5{[#6$7%!8&9%!8'0-)}].-_/0$*2`@#3mM4%5@#7:/\8=+g= aAkK~xX}iIpP& eE ,; c d tsrqQ'?ljbB|oOuUv.:yY{!\"12< 3>!(4[")5]#@6$+7%-8&/9'*0, _-=^.%`/z0w123n4m5$#6gG7h8fd/ 2"@ 3#!4$#6&$7/{%8([&9)]'0=}-+?.|/01'*2'*3456,;7.:8-_d<>\ .'`|0^~2" 3"5%#6&$7/%8(&9)'0=-'?.^/{[0+*}]123@4#5\|6,;7.:8-_d<> 1!2" 3!4$"5%#6^$7&%8*&9('0)--_.=+1#~2#~4'@5``d\|2"#6&$7'%8(&9)'0--=.^~/@`0[{1]}2]}3;+4:*5\_\|-+?\0345d<>| .'`|0^~.\0345|d<>.\`0^~xje.> u i d c htnbrl'"poygk,<qf;:-[{.]}//?0=+3s4-_6w7v8z9: ;<=>?@ABCD E 1!|2"@ 3#!4$~#6&$7/%8(&9)'0=-'?./[0+*]1}2}34{5\6,;7.:8-_d<> q,?azw&1|2@ "3#!'4"(5#6^$7%!8&9{'0}-).-_/[0$*]1`2`3m4%56;.7:/8=+~d<>\ aAD$bB8cCA!dD2eEC# fF0 gG? hH@  iIH( jJ>kK;lL4mML,nNB"oOI)pP7qQ9rR:sSK+tT5uU3vV<wWF&xXG'yY=zZO/#6^6,$7&7./[{E%0]}J*3;:64'"M-6,<17.>N.8/?Q aAD$bB8cCA!dD2eEC# fF0 gG? hH@  iIH( jJ>kK;lL4mML,nNB"oOI)pP7qQ9rR:sSK+tT5uU3vV<wWF&xXG'yY=zZO/#6^6,$7&7.--_V.=+T/[{E%0]}J*1\|W2\|W3;:64'"M-5`~6,<17.>N.8/?Q eEzy1+|2"@ 3*#!4#6&$7/%8(&9)'0=-'?./[0!]1$}2$}34{5 6,;7.:8-_d<>\ -'?.^`~0!]/[34{2"@ 3##6&$7/{%8([&9)]'0=}-'?.<>/+*012345\|6,;7.:8-_d<> .+*/2\|4eE a`~}kj!1@-2_ /3#!;4$":5#,6^$.7&%=8*&[9(']0), -?+'.xX%//.{0wW}1qQ|2qQ|3sr4"5`~6   7fF 8\ qQ@1!2" 3##6&$7/%8(&9)'0=-'?\./0+*~1}]2}]34{[5|6,;7.:8-_d<> 1!2@ 3#!4$"5%#6.=+/0[{1]}2]}345'"8;:c.d\|/? 1IqQ@2' 3^#!4+$"5%#6&$7/{%8([&9)]'0=}-*?\.-_/0~1,;2,;3_^4i05"678.:d<>| /1,;`2,;`3_^'aAcCeElLBAnNDCoOsS[ZxXzyzZ|{ bB{cC& fF[ gG] iI jJnN}qQ\vV@wW|xX#zZyY>1'~2" 3+^!4!"5%#6/$7=`%8(&9)'-./QP01qp2qp3$4506,?;7.:8-_*d< bB{ fF[ gG]kKBlLAmMnN}qQ\vV@wW|zZyY1!~2" 3#^!4$"5%#6&$7/`%8(&9)'0=-'?.+*/a`01~}2~}3  456,;<7.:>8-_d<> mMoOpP1!2"@ 3/!4$"5%#6?$7&%8*&9('0)--_.=+/[0']1<>}2<>}3;:~4{5#|\6,'7..8d /^^[0]4``{8aAcC  eE gG#" iI+*kK76lL<;nNFEoOMLsSa`uUkjzZ~} cCmMrRsSxXzZ1!2" 3#!4$"5%#6&$7_%8({&9)}'0'-/?\.'/0*|1<>2<>3+45@6,;7.:8-=d][ .~/"^4'`eEqQ@2"#6&$7/{%8([&9)]'0=}-\.-_/0'?~1+*`2+*`3456,;7.:8d<>| 4^    4 ԰䯔L`ر5dd5(I*LCDEOMPJQNRKԿ@,P(0ʔD˔ɔʔH88ޔ`Ҕؔxєє0Ԕ(  v      W 1 Q `  <@  0 2 A@ A   @  @ @   P0 P  A   h }  } } } @  85     L+ L pL2 D   O  {4o  A umass_scsi_probeL@@AZPZPZPd|fGg ---0000 0@0P010`0p0aLfLLLLi@dF  @@@ @ @AA@:F:FP 43W  !      @ @ @ @ A n@n n@n @nn@0Df @  * Q k k"k"k"k"k @^z BF 9 |t axe_iff B  w *w +w +~ W UP  < 1b0 0rk {&"79n= wF@W wn a- (,$:*$\CLT8C$$0$0$$$$$$$$$$$$$$ $ ddkc@ 'W W@ @EEE }WQ  k"BFFeeeZZ Z 0|{{2V{%1" `"'`~%ZP `px0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-udav_iff 贕4udav_miibus_writeregudav_miibus_readreghF F hF fF t@ɕHǕƕƕٕPו֕֕ <url_int_miibus_writeregurl_int_miibus_readreg@@9WP P Q@hdTuftdi_2232h_getrateuftdi_openL  `VV !y`V'V%V&V3V4VPVIVVVVVVVVVV}  H(02135HPPQ nY ol\k] ih^_mZ[Xj 2``` ```x     tq?=:>9;<8pq8     JKLIؼټy`ؿۿٿڿHIJprsq"`r``xȽPW8P3 & & & & & & & & & &     < < < l F F ! ========== = = = = =================== =!="=#=$=%=&='=(=)=*=+=,=-=.=/=0=1=2=3=4=5=6=7=8=9=:=;=<===>=?=@=A=B=C=D=E=F=G=H=I=J=K=L=M=N=O=P=Q=R=S=T=U=V=W=X=Y=Z=[=\=]=^=_=`=a=b=c=d=e=f=g=h=i=j=k=l=m=n=o=p=q=r=s=t=u=v=w=x=y=z={=|=}=~=================================================================================================================================0 B9 !PPPPPPPPPPPPPPPPPPPPPP PPPP PP PPPP PP PPPPPPPPPPPPPPPPPPPPPPPP: :  !R R !R !R !R !R R "R !"R "R ""R "R #"R $R !$R 1$R A$R $R "$R 2$R B$R $R #$R 3$R C$R (R !(R 1(R A(R Q(R a(R q(R (R (R "(R 2(R B(R R(R b(R r(R (R (R #(R 3(R C(R S(R c(R s(R (B@  >d l,G W WnPnPA   !^y 4Xhp9{#{{{{ rS#S&@'ah 33.U 1(Ex$ #h P0    \+ )((   &  l! eT411p1:5g hahh! !(3P@3vKVXZcfk3 3 3 3 3 3 3 3  3  3  3  3  3 3 "3 f`&3 g`*3 h`.3 i`$3 f`(3 h`,3 i`03 j`43 k`83 l`<3 n`@3 o`d3 h3 l3 p3 t3 x3 |3 3 3 3 3 3 3 3 3 3                    " f`& g`* h`. i`$ f`( h`, i`0 j`4 k`8 l`< n`@ o`d h l p t x |           # $ Zp [ \( #"<$<-.q2q"<<<?   imxesdhc_card_detectphytargetlunconsolemuxconfigurationinterfacevendorproductreleaseportnoreportidloopbpfilter%s: error %d loading dmamap %s: requested DMA at an odd address %llx %s: requested DMA length %d is not even %s: CLO requested while port running %s: CLO did not complete unable to reset controller 0.951.11.2 unsupported AHCI revision 0x%08x 1.3 AHCI %sdiagnostic ../../../../dev/ic/ahci.cap->ap_active_cnt == 0nextccb->ccb_xa.pmp_port != ap->ap_pmp_ncq_portap->ap_active_cnt == 1ap->ap_active_cnt == 1 || ap->ap_active_cnt == 2%s: invalid ata_xfer state %02x in ahci_ata_cmd_done, slot %d ccb == &ap->ap_ccbs[1]ahci_port_err_ccb_restore but SACT %08x != 0? ahci_pread(ap, AHCI_PREG_CI) == 0%s: invalid ata_xfer state %02x in ahci_put_ccb, slot %d ccb->ccb_xa.state == ATA_S_PUTahci_get_pmp_ccb; SACT %08x != 0 ap->ap_err_busyccb == ap->ap_ccb_errahci_get_err_ccb but SACT %08x != 0? ap->ap_err_busy == 0ap->ap_active == 0%s: error on PMP port %d, idling device %s: unable to softreset port %d %s: failed to port reset %d, giving up on it %s: attempting to idle device %s: failed to soft reset device %s: failed to port reset device, give up on it %s: couldn't reset after NCQ error, disabling device. %s: couldn't recover NCQ error, failing all outstanding commands. ccb->ccb_xa.state == ATA_S_ONCHIPtmp == 0%s: unrecoverable errors (IS: %b), disabling port.  CPDSTFESHBFSHBDSIFSINFSOFSIPMSPRCSDMPSDPSPCSUFSSDBSDSSPSSDHRS(!!(ccb->ccb_xa.flags & ATA_F_NCQ)) == (!!ap->ap_sactive)%s: NULL ccb! %s: port multiplier identification failed %s: port multiplier found: chip=%08x rev=0x%b nports=%d, features: 0x%b, enabled: 0x%b PM1.1PM1.0AsyncNotifyDynamicSSCPMREQBIST%s.%d: cannot clear PHY status %s.%d: port is unplugged %s.%d: device is not negotiating (cmd & AHCI_PREG_CMD_CR) == 0%s: log page read failed, slot %d was still active. %s: read NCQ error page, but not an NCQ error? %s: failed to start port, cannot probe PMP unsupported%s: CLO %s, need port reset %s: port busy after first PMP probe FIS %s.%d: unable to clear PHY status %s.%d: PMP port softreset cmd failed %s.%d: unable to probe PMP port; portreset failed %s.%d: unable to probe PMP port due to softreset failure %s: failed to stop port, cannot softreset %s: failed to start port, cannot softreset %s: device didn't come ready after reset, TFD: 0x%b BSYDRQERR%s: stopping the port, softreset slot %d was still active. %s: failed to reset port during timeout handling, disabling it CRFR%s: unable to disable %s, ignoring port %d %s: device not communicating on port %d %s: PHY offline on port %d %s: device on port %d didn't come ready, TFD: 0x%b %s: unable to communicate with device on port %d %s.%d: port signature returned %d %s: failed to start command DMA on port %d, disabling ap->ap_active == (1 << ccb->ccb_slot) && ap->ap_sactive == 0%s: ahci_pmp_probe_timeout: failed to clear active cmds: %08x ap->ap_active_cnt > 0%s: ahci_pmp_probe_timeout: ccb in bad state %d%s: unable to allocate memory for port %d %s: unable to allocate DMA scratch buf for port %d %s: unable to create register window for port %d %s: unable to allocate command list for port %d %s: unable to allocate DMA memory for port %d %s: unable to create dmamap for port %d ccb %d ahci%s: %u (%d dBm) Unknown PRISM2 chip%s: Firmware %d.%02d variant %d, Symbol %s: %s%s (0x%04x), Firmware %d.%d.%d (primary), %d.%d.%d (station), %s: unsupported crypto algorithm %d %s: wi_do_hostdecrypt: iv mismatch: 0x%02x%02x%02x%02x vs. 0x%x %s: wi_start: dropping unassoc dst %s %s: host encrypt not implemented for 802.3 %s: wi_start: xmit failed %s: wi_cmd failed with %d %s: wi_scan_timeout: %d tries %s: invalid data path: %x %s: failed to allocate %d bytes on NIC %s: device timeout %s: init failed %s: wi_mgmt_xmit: xmit failed wiiocwiscan%s: tx buffer allocation failed %s: mgmt. buffer allocation failed %s: wi_cmd_io: busy bit won't clear %s: timeout in wi_cmd 0x%04x; event status 0x%04x %s: received packet of unknown type on port 7 %s: received packet on invalid port (wi_status=0x%x) %s: oversized mgmt packet received in hostap mode (wi_dat_len=%d, wi_status=0x%x) wihap: failed to copy header %s: oversized packet received (wi_dat_len=%d, wi_status=0x%x) %s: Error decrypting incoming packet. : unable to read station address address %sWaveLAN/IEEE nodeIBSSwlanwiLucent WaveLAN/IEEESony WaveLAN/IEEELucent Embedded WaveLAN/IEEEPRISM2 HFA3841(EVB2)PRISM2 HWB3763 rev.BPRISM2 HWB3163 rev.APRISM2 HWB3163 rev.BPRISM2 HFA3842(EVB3)PRISM1 HWB1153PRISM2 HWB3163 SST-flashPRISM2 HWB3163(EVB2) SST-flashPRISM2 HFA3842(EVAL)PRISM2.5 ISL3873PRISM2.5 USBPRISM2.5 ISL3874A(Mini-PCI)PRISM2.5 ISL3874A(PCI-bridge)PRISM3 ISL37300PPRISM3 ISL37300P(PCI)PRISM3 (USB)Sending deauth to sta %s wihap_disassoc_req: unknown station: %s wihap_assoc_req: from station %s wihap_assoc_req: bad ssid: '%.*s' != '%.*s' wihap_assoc_req: rates mismatch. wihap_assoc_req: capinfo: not ESS: capinfo=0x%x wihap_assoc_req: WEP flag mismatch: capinfo=0x%x wihap_assoc_req: polling not supported: capinfo=0x%x wihap_assoc_req: already assoc'ed? wihap_assoc_req: returns status=0x%x Sending disassoc to sta %s wihap_data_input: no TODS src=%s, fctl=0x%x wihap_data_input: incorrect bss: %s wihap_data_input: dropping unassoc src %s wihap_auth_req: station %s short request wihap_auth_req: station %s algo=0x%x seq=0x%x wihap_auth_req: new station challenge: 0x%x 0x%x ... wihap_auth_req: algorithm unsupported: 0x%x wihap_auth_req: returns status=0x%x wihap_init: sc=%p whi=%p wihap_ioctl: i shouldn't get other ioctls! wihap_deauth_req: unknown station: %s wihap_mgmt_input: len=%d MGMT: assoc req: assoc resp: reassoc req: reassoc resp: probe req: probe resp: beacon: ann traf ind disassociation: auth: deauth: unknown (stype=0x%x) ftype=0x%x (ctl=0x%x) wihap_shutdown: sc=%p whi=%p wihap_shutdown: free(sta=%p) wihap_timeout: disassoc due to inactivity: %s wihap_timeout: deauth due to inactivity: %s ehci_freex: xfer=%p not busy, 0x%08x ehci_freex: !isdone ehci_ctrl_done: not a requestehci_device_clear_toggle: queue activeehci isoc xfer being freed, but with no itd chainehci_idone: ex=%p is done! ehci: isoc xfer suddenly has 0 bInterval, invalidehci_check_itd_intr: not valid itd ehci_check_itd_intr: itdend == 0 ehci_check_qh_intr: not valid sqtd ehci_check_qh_intr: lsqtd==0 ehci_abort_xfer: TIMEOUT while aborting ehciiawehciabehci_alloc_sqtd_chain: curlen=%u len=%u offs=0x%x lastpage=0x%x page=0x%x phys=0x%x ehci_alloc_std: curlen == 0ehci_alloc_sqtd_chain: i=%d ehci_device_intr_done: not done, ex=%p ehci_device_request: not done, exfer=%p ehci_open: bad device speed %d%s: Error opening low/full speed isoc endpoint. A low/full speed device is attached to a USB2 hub, and transaction translations are not yet supported. Reattach the device to the root hub instead. ehci: opening pipe with invalid bInterval ehci: zero length endpoint open request ehci_intr1: sc == NULL %s: unrecoverable error, controller halted %s: blocking intrs 0x%x %s: halt timeout %s: reset timeout ehci: isoc descriptor requested that spans the entire frametable, too many frames ehci_device_isoc_start: requestehci_device_isoc_start: not done, ex = %p ehci: unexpectedly ran out of isoc itds, isoc_startehci_device_intr_start: a requestehci_device_intr_start: not done, ex=%p ehci_device_bulk_start: a requestehci_device_bulk_start: not done, ex=%p ehci_device_ctrl_transfer: not a request EHCI root hub%s: port reset timeout ehcidiehci_sync_hc: tsleep() = %d ehci_abort_xfer: not in process contextehciawehci_allocx: xfer=%p not free, 0x%08x %s: disable schedules timeout %s: run timeout ehcidbehciradio at %sradioRAM diskfictitiousrdattach: out of memoryrd%drdattach: device name too longhfsc_enqueue called on hfsc-less kernelhfsc_purge called on hfsc-less kernelNot set. All breakpoints used. Already set. Too many breakpoints. No breakpoints set Count Address %5d the kernel did not panic Bad function Too many arguments Argument missing %-12sNo such command Ambiguous Bad modifier Count missing ddb> procscalloutpoolsmountsvnodesbufsallbcstatsbreaksextentsmallocobjectpagepanicpoolregistersuvmexpwatchescrashdumphaltrebootpoweroffmachineprintexaminesearchdeletebreakdwatchwatchstepcontinueuntilmatchtracecallpsshowboothelphangmandmesg.strtab[ %s symbol table has bad start address %p ] ELFbad e_machine.symtab[ using %lu bytes of %s ELF symbol table ] bad magicsymtab unalignedsymtab corrupted[ %s ELF symbol table not valid: %s ] ELFAddress missing Value missing : %*lx%*ld%*lu%*lo\%03o= 0x%lx %-*s%-*lx%-*ld%-*lu%-*loSymbol not found Syntax error Divide by 0 Negative shift amount () Score: %lu/%lu ^R Bad character in number Bad escape String too long Bad character Faulted in traceback, aborting... Starting stack trace... End of stack trace. -%#*lx-%*lx-%#*lo-%*lo-%#*lu-%*lu--db_more-- %-12s%s %s+%s [after %6d] [%s:%d]invalid symbol table nameSifting table %s: Unable to find symbol table slot for %s.No slots left for %s symbol table%s%s %s bsd[ no symbol table formats found ] After %d instructions Breakpoint at Stopped at RUN AT LEAST 'trace' AND 'ps' AND INCLUDE OUTPUT WHEN REPORTING THIS PANIC! DO NOT EVEN BOTHER REPORTING THIS WITHOUT INCLUDING THAT INFORMATION! Unknown variable No value radixmaxoffmaxwidthtabstopslineslogNo watchpoints set Address Size %8lx %lx All watchpoints used. Too many watchpoints. Unknown size %s = %s Nothing written. aud_qmimutex %p held in %saud_draudiooplaudioprint: unknown type %dmpu%s at %saudio_attach_mi: NULL audio: missing method audio: could not allocate play buffer audio: could not allocate record buffer sourceoutputsselectauddetaudiodetach: %s didn't detach aud_qwraud_wraud_qrdaud_hraud_rdaudpquiaudrquiaudio_open: 0 precision aud_qiomutex %p not held in %sinputsvolumeinputdacmastermonitormiccdspkrhpcnopen: recursive/mnt/etc/firmware/%sunconfiguredmidi at %s: <%s> midi: missing method mid_rdmid_drmid_clmid_wrmidiwarning: no entropy supplied by boot loader %s@%dOpenBSDcoredump: offset %lld != notestart %lldcoredump: offset %lld != secstart %lldcoredump: offset %lld != p_offset[%d] %lldexec: a VTEXT vnode has writecount != 0#!exec_script_makecmds: epp already has a fdexec_script: copyinstr couldn't fail/dev/fd/%dexec_process_vmcmds: RELATIVE no basevmcmdset_extend: not necessary../../../../kern/exec_subr.cocnt > 0/dev/consolewarning: /dev/console does not exist warning: /dev/console error %d initexecinit: couldn't allocate argument spaceexec %s: error %d init: not found no initswapperfork initcfpendcannot mount rootcannot find root vnodepagedaemonfork pagedaemonreaperfork reapercleanerfork cleanerupdatefork updateaiodonedfork aiodonedscheduler/sbin/init/sbin/oinit/sbin/init.bakbqquiesbqqueuebqwaitbqdestbufq_init: type %i unknownbufq init failbqinitinitclocks: unable to register softclock intrfd_unused: fd_lastfile inconsistentfdrop: count (%ld) != 0closef: count (%ld) < 2fdlockfileplfdescpldup2: fdalloc../../../../kern/kern_event.ckn->kn_status & KN_QUEUED(kn->kn_status & KN_QUEUED) == 0kqreadkqueueplknoteplexecve: argp == NULLexecve: no vmcmdssys_execve: falloc indx != i../../../../kern/kern_exit.cpr->ps_refcnt == 1TAILQ_EMPTY(&pr->ps_threads)waitinit died (signal %d, exit %d)thrdeathpr->ps_refcnt > 0cpu_exit returnedprocessppwaitunable to allocate kthread_qWARNING: thread `%s' (%d) exits with status %d ../../../../kern/kern_lock.c!((flags & (LK_SHARED|LK_EXCLUSIVE)) == (LK_SHARED|LK_EXCLUSIVE))!((flags & (LK_CANRECURSE|LK_RECURSEFAIL)) == (LK_CANRECURSE|LK_RECURSEFAIL))(flags & LK_RELEASE) || (flags & (LK_SHARED|LK_EXCLUSIVE|LK_DRAIN))flags == 0No KMEMSTATS compiled in ../../../../kern/kern_malloc.cflags & (M_WAITOK | M_NOWAIT)malloc(): allocation too large, type = %d, size = %lu malloc: allocation too large, type = %d, size = %lu malloc: out of space in kmem_map???%s %zd of object %p size 0x%lx %s %s (invalid addr %p) Data modified on freelist: wordprevious type%s %zd of object %p size 0x%lx %s %s (0x%x != 0x%x) %d,%s,free: non-malloced addr %p type %sfree: unaligned addr %p, size %ld, type %s, mask %ldmultiply freed item %p free: duplicated freedevbufdebugpcbroutetblfragtblifaddrsooptssysctlioctlopsiovNFS reqNFS mountnamecacheUFS quotaUFS mountshmVM mapsemdirhashACPIVM pmapfile descsubprocVFS clusterMFS nodeExport HostNFS srvsockNFS daemonip_moptionsin_multiether_multimrtISOFS mountISOFS nodeMSDOSFS mountMSDOSFS fatMSDOSFS nodettysmiscfs mountfusefs mountpfkey datatdbxform_datapagedepinodedepnewblkindirdepVM swapUVM amapUVM aobjUSBUSB deviceUSB HCmemdesccrypto dataIPsec credsemuldataip6_optionsNDPNTFS mountNTFS nodeNTFS fnodeNTFS dirNTFS hashNTFS attrNTFS dataNTFS decompNTFS vrunkqueuebluetoothbwmeterUDF mountUDF file entryUDF file idBluetooth HIDAGP MemoryDRMsysctlklk%s: lock held%s: lock not shared%s: lock not held%s: lock not held by this process../../../../kern/kern_rwlock.crrwl->rrwl_wcnt > 0rw_enter: %s locking against myselfrw_enter: %s downgrade of non-write lockrw_enter: %s downgrade, not holderrw_enter: unknown op 0x%xtodo < 0; minphys brokentodo > MAXPHYS; minphys brokenphysiodone < 0; strategy brokendone > todo; strategy brokenmawnusage: show all procs [/a] [/n] [/w] /a == show process address info /n == show normal process info [default] /w == show process wait/emul info PID %-10s %18s %18s %18s COMMANDSTRUCT PROC *UAREA *VMSPACE/VM_MAP PID %5s %5s %5s S %10s %-12s %-16s PPIDPGRPUIDFLAGSWAIT PID %-16s %-8s %18s %s EMULWAIT-CHANNELWAIT-MSG%c%5d %-10.10s %18p %18p %18p %5d %5d %5d %d %#10x %-12.12s %-16s %-16s %-8s %18p %s PROC (%s) pid=%d stat=%s flags process=%b proc=%b CONTROLTEXECINEXECEXITINGSUGIDSUGIDEXECPPWAITISPWAIT PROFIL TRACED WAITED COREDUMP SINGLEEXITSINGLEUNWINDNOZOMBIE8STOPPEDINKTRPROFPENDALRMPENDSIGSUSPENDSELECTSINTR SYSTEM TIMEOUTWEXITOWEUPCSUSPSINGLESYSTRACECONTINUEDTHREADSUSPSIGSOFTDEPCPUPEG pri=%u, usrpri=%u, nice=%d forw=%p, list=%p,%p process=%p user=%p, vmspace=%p estcpu=%u, cpticks=%d, pctcpu=%u.%u, swtime=%u user=%u, sys=%u, intr=%u enterpgrp: setsid into non-empty pgrpenterpgrp: session leader attempted setpgrpenterpgrp: new pgrp and pid != pgidenterpgrp: mksession but not curprocchgproccnt: procs < 0procinit: mallocprocplprocessplzombieplucredplpgrpplsessionplpcredplidlestopzombiedeadonprocplimitpl../../../../kern/kern_sched.cp->p_wchan == NULLp->p_stat == SRUNcpu_switchto returnedci == curcpu()curproc == spc->spc_idleprocfork idleidle%dsensor_task_register: period is 0sensorssensor../../../../kern/kern_sig.cpr->ps_single == psuspendpausesingle_thread_mode = %dsigwaiterror != 0p->p_sigwait != 0usersystempid %d (%s): %s write of %lu@%p at %lld failed: %d /var/crash/%s%s.corepostsigpostsig actionProcess (pid %d) got signal %d issignal psignal signal numbersigaplhashinit: bad cntureadc: zero residureadc: non-positive iovcntuiomove: modeuiomove: proc%02hx%02hx%02hx%02hx%02hx%02hx%02hx%02hx%s:%s,sysctllksysctldlktsleep: no identtsleep: not SONPROCwakeup: p_stat is %dsleep_finish !SONPROC../../../../kern/kern_synch.c(priority & ~(PRIMASK | PCATCH)) == 0thrsleep(priority & ~(PRIMASK | PCATCH | PNORELOCK)) == 0mtx != NULL%s%s(%d)Timecounter "%s" frequency %lu Hz -- Insufficient hz, needs at least %u Time stepped from %lld.%09ld to %lld.%09ld dummynanosleepdenied attempt to set clock forward to %lld denied attempt to set clock back %lld seconds ?%9d %2td/%-4td %p %s ticks now: %d ticks wheel arg func timeout_add: not initializedtimeout_add: to_ticks (%d) < 0boredunexpected %s wq state %dunable to create workq thread for "%s" wqdestroywqtaskssyswqunexpected %s tq state %dunable to create thread for "%s" taskq unexpected %s tq state %utqdestroysystqsmashed stack in %ssetrunnable../../../../kern/sched_bsd.cp->p_stat != SONPROCp->p_cpu == curcpu()preempt: cpu_preempt not yet implementedphzconfig_activate_children: device %s failed %d failing resume cannot be handled resume %s config_pending_decr: config_pending == 0config_defer: can't defer config of a root deviceconfig_defer: deferred twiceconfig_defer: can't allocate defer structureautoconfconfig_detach: bad device fstateconfig_detach: forced detach of %s failed (%d)config_detach: %s attached at %s config_detach: detached device (%s) has children%s detached config_make_softcconfig_make_softc: allocation for device softc failed%s%dconfig_make_softc: device name too longexpandcreatconfig_make_softc: %sing dev arrayconfig_make_softc: duplicate %s>>> probing for %s* mapply: no match function for '%s' device>>> %s probe returned %d >>> %s probe won >>> no winning probe ../../../../kern/subr_autoconf.ccd->cd_devs != NULLdev->dv_unit < cd->cd_ndevscd->cd_devs[dev->dv_unit] == NULL%s at rootroot device %s not configured not configured unsupported /dev/%s%s%ccannot obtain vnode for 0x%x/0x%xcannot open disk, 0x%x/0x%x, error %dcannot read disk label, 0x%x/0x%x, error %droot filesystem has size 0filesystem type %d not known.. assuming ffs use one of: exit %s[a-p]dkopendisklabels not read:root device (default %sswap device (default %s%s)%s%d%croot device (%s) not foundnetbootroot on %s%ccan't figure root, hope your kernel is right (%02hx%02hx%02hx%02hx%02hx%02hx%02hx%02hx.%c) swap on %s%d%c dump on %s%d%croot device (%02hx%02hx%02hx%02hx%02hx%02hx%02hx%02hx) not founddisk_unbusy: %s: dk_busy < 0 ../../../../kern/subr_disk.cpart >= 0 && part < MAXPARTITIONSdisk_detach: disk_count < 0dklkdisk_attach: can't allocate storage for disklabelwrit%s%d%c: %s %sing fsbn %lld of %lld-%lld (%s%d bn %lld; cn %lld tn %lld sn %lld)%s: NULL extentextent `%s' (0x%lx - 0x%lx), flags=%b FLWANTEDWANTEDNOCOALESCEFIXED 0x%lx - 0x%lx extnt%s: extent `%s', start 0x%lx, size 0x%lx %s: extent `%s', region not within extent%s: overflow%s: start 0x%lx, end 0x%lx %s: region not found%s: NULL region descriptor%s: NULL result pointer%s: extent `%s', ex_start 0x%lx, ex_end 0x%lx %s: substart 0x%lx, subend 0x%lx %s: bad subregion%s: extent `%s', size 0x%lx %s: bad size%s: bad alignment%s: extent `%s', size 0x%lx, boundary 0x%lx %s: bad boundary%s: extent `%s' (0x%lx - 0x%lx), alignment 0x%lx %s: overflow after alignment%s: EX_NOCOALESCE not set%s: can't allocate region descriptor %s: EX_CONFLICTOK and EX_WAITSPACE are mutually exclusive%s: extent `%s' (0x%lx - 0x%lx) %s: region lies outside extent%s: name == NULL%s: extent `%s', start 0x%lx, end 0x%lx %s: end < start%s: fixed extent, bad storagesize 0x%lx%s: storage provided for non-fixedextentpl%s: already registeredklog page %p, nmissing %d item %p, magic 0x%x POOL %s: size %u, align %u, ioff %u, roflags 0x%08x alloc %p minitems %u, minpages %u, maxpages %u, npages %u itemsperpage %u, nitems %u, nout %u, hardlimit %u nget %lu, nfail %lu, nput %lu npagealloc %lu, npagefree %lu, hiwat %u, nidle %lu empty page list: full page list: partial-page list: no current page curpage %p %s: pool(%p:%s): page inconsistency: page %p; at page head addr %p (p %p) pool(%s): free list modified: page %p; item ordinal %d; addr %p (p %p); offset 0x%x=0x%x pool(%s): free list modified: page %p; item ordinal %d; addr %p (p %p); offset 0x%zx=0x%x pool(%p:%s): page inconsistency: page %p; item ordinal %d; addr %p (p %p) pool(%p:%s): page inconsistency: page %p; %d on list, %d missing, %d items per page pool(%p:%s): page inconsistency: page %p; %d on list, %d missing, %d expected usage: show all pools [/a] %-10s%4s%9s%5s%9s%6s%6s%6s%6s%6s%6s%5s SizeRequestsFailReleasesPgreqPgrelNpageHiwatMinpgMaxpgIdle%-12s %18s %18s Allocator%-12s %18p %18p inf %*u %*lu %*d %*s %*lu ../../../../kern/subr_pool.c((((vaddr_t)pi) + ioff) & (align - 1)) == 0pool_put of NULLpool %s: putting with none out pool_do_putph->ph_page <= (caddr_t)vph->ph_page + ph->ph_pagesize > (caddr_t)vpool_do_put: %s: page header missingdouble pool_put: %ppr_rmpage: nidle inconsistentpr_rmpage: nitems inconsistentph->ph_nmissing == 0destroyed pool not on listpool_destroy: pool busy: still out: %uLIST_EMPTY(&pp->pr_fullpages)LIST_EMPTY(&pp->pr_partpages)flags & (PR_WAITOK | PR_NOWAIT)pool_do_get: %s: crossed hard limitpool_do_get: %s: curpage NULL, nitems %u pool_do_get: nitems inconsistentpool_do_get: %s: page emptypool_do_get: %s: items on itemlist, nitems %u pool_do_get(%s): free list modified: page %p; item addr %p; offset 0x%x=0x%xpool_do_get(%s): free list modified: page %p; item addr %p; offset 0x%zx=0x%xpool_do_get: nidle inconsistentpool_do_get: %s: nmissing inconsistentinit pool already on listpool_init: pool item size (%lu) too largepool_init: too much uptimepp->pr_itemsperpage != 0phpooldma%d0123456789abcdef%llo%llx(null)0123456789ABCDEFbug in kprintf: bad base%s: table is full panic: splassert: %s: want %d have %d spl assertion failure in %skernel %sassertion "%s" failed: file "%s", line %dassertwaitok: non-zero mutex count: %dpollpipeplpipelkpipeclpiperdExpected pipe buffer wraparound disappearedExpected wraparound badPipe buffer overflowpipewrttrstrtttckoutqload: %d.%02d not a controlling terminal no foreground process group empty foreground process group runningrunnableiowait cmd: %s %d [%s] %lld.%02ldu %lld.%02lds %d%% %ldk ttyrub: would panic c = %d, val = %d ttyfree: tty_count < 0b_to_q: required clalloc putc: required clalloc mbuf %p m_type: %hi m_flags: %hb M_EXTM_PKTHDRM_EORM_CLUSTERM_PROTO1M_VLANTAGM_LOOPM_FILDROP M_BCAST M_MCAST M_CONF M_AUTH M_TUNNELM_ZEROIZEM_COMPM_LINK0m_next: %p m_nextpkt: %p m_data: %p m_len: %u m_dat: %p m_pktdat: %p m_ptkhdr.rcvif: %p m_pkthdr.len: %i m_ptkhdr.tags: %p m_pkthdr.tagsset: %hb IPSEC_IN_DONEIPSEC_OUT_DONEIPSEC_IN_CRYPTO_DONEIPSEC_OUT_CRYPTO_NEEDEDIPSEC_PENDING_TDBBRIDGEGIFGRE DLT PF_DIVERT PIPEX PF_REASSEMBLED SRCROUTETUNNELm_pkthdr.csum_flags: %hb IPV4_CSUM_OUTTCP_CSUM_OUTUDP_CSUM_OUTIPV4_CSUM_IN_OKIPV4_CSUM_IN_BADTCP_CSUM_IN_OKTCP_CSUM_IN_BADUDP_CSUM_IN_OK UDP_CSUM_IN_BAD ICMP_CSUM_OUT ICMP_CSUM_IN_OK ICMP_CSUM_IN_BADm_pkthdr.ether_vtag: %hu m_ptkhdr.rdomain: %u m_pkthdr.pf.hdr: %p m_pkthdr.pf.statekey: %p m_pkthdr.pf.inp %p m_pkthdr.pf.qid: %u m_pkthdr.pf.tag: %hu m_pkthdr.pf.flags: %hhb GENERATEDTRANSLATE_LOCALHOSTDIVERTEDDIVERTED_PACKETREROUTEREFRAGMENTEDPROCESSEDm_pkthdr.pf.routed: %hhu m_pkthdr.pf.prio: %hhu m_ext.ext_buf: %p m_ext.ext_size: %u m_ext.ext_type: %x m_ext.ext_backend: %i m_ext.ext_ifp: %p m_ext.ext_free: %p m_ext.ext_arg: %p m_ext.ext_nextref: %p m_ext.ext_prevref: %p ../../../../kern/uipc_mbuf.cfrom->m_flags & M_PKTHDRm_zero: M_READONLYm_copydata: off %d < 0m_copydata: len %d < 0m_copydata: short mbuf chainm_copydata: null mbufunknown type of extension bufferm_clget: request for %u byte clusterm_defrag: no packet hdr or not a chainm_copym0: off %d, len %dm_copym0: short mbuf chainm_copym0: m == NULL and not COPYALLm_copym0 overrunmbuf prepend length too bigmbinit: the largest cluster size != MAXMCLBYTESmbplmtagplmcl%dkm_apply: len %d < 0m_apply: off %d < 0m_apply: null mbuf in skipm_apply: null mbufWARNING: mclpools limit reached; increase kern.maxclustersrequested tag size for pool %#x is too bigm == NULL in m_pulldown()unixsoaccept: !NOFDREFreceive 1../../../../kern/uipc_socket.cm == so->so_rcv.sb_mbreceive 1areceive 3so->so_rcv.sb_mb == mnetclssoclose: NOFDREFsockplsbcreatecontrol: message too large %d sbdropsbappendcontrolsoqinsque../../../../kern/uipc_socket2.c(sb->sb_flags & SB_LOCK) == 0sb->sb_cc == 0sb->sb_datacc == 0sb->sb_mb == NULLsb->sb_mbtail == NULLsb->sb_lastrecord == NULLsemi-panic: sbcompresssb->sb_mb == sb->sb_lastrecordnetlcknetiosbappendaddrnetcon2netconacceptunp_disconnectunp_connect2unp_attachuipc 1uipc 2uipc 4piusrreqCurrent Buffer Cache status: numbufs %lld busymapped %lld, delwri %lld kvaslots %lld avail kva slots %lld bufpages %lld, dirtypages %lld pendingreads %lld, pendingwrites %lld bremfree: lost tail../../../../kern/vfs_bio.c!(bp->b_flags & B_ASYNC)biowaitTrying to undirty buffer on freelist!Trying to dirty buffer on freelist!bufcachepercent <= 90bufcachepercent >= 5bufpages < dmapagesbufplbp->b_bufsize > 0buf_put: releasing dirty bufferbuf_put: still on the free listbuf_put: still on the vnode listbuf_put: b_dep is not emptybiodone alreadyClean buffer on BQ_DIRTYneedbuffernobuffersbuf_get: dup lblk vp %p bp %pgetblkbp->b_lblkno == blkno + 1bp->b_vp == vp../../../../kern/vfs_biomem.cbp->b_data == NULLuobj != NULLpg != NULLpg->wire_count == 1size == round_page(size)bp->b_pobj == NULLbuf_page_offset > 0(bp->b_flags & B_BUSY) == 0bp->b_data != NULLbp->b_flags & B_BUSYbuf_needvabufinit: can't reserve VM for buffersnchplcache_revlookup: found entry for .cache_revlookup: found entry for ..../../../../kern/vfs_cache.cvp->v_type == VDIR || TAILQ_EMPTY(&vp->v_cache_dst)wtf? leak?cluster_wbuild: size %ld != filesize %uvop_generic_revokevop_generic_revokeallnameilf_findoverlap: defaultlockfplrelookup: null namerelookup: lookup on dot-dotleaf should be emptyrelookup: symlink found.namei: bad cred/procnamei: nameiop contaminated with flagsnamei: flags contaminated with nameiops vp %p lblkno 0x%llx blkno 0x%llx dev 0x%x proc %p error %d flags %lb AGENEEDCOMMITASYNCBADBUSYCACHECALLDELWRI DONE EINTR ERROR INVAL NOCACHEPHYSRAWREADWANTEDWRITEINPROGXXX(FORMAT)DEFERREDSCANNEDDAEMONRELEASED bufsize 0x%lx bcount 0x%lx resid 0x%lx sync 0x%llx data %p saveaddr %p dep %p iodone %p dirty {off 0x%x end 0x%x} valid {off 0x%x end 0x%x} tag %s(%d) type %s(%d) mount %p typedata %p data %p usecount %d writecount %d holdcnt %d numoutput %d clean bufs: bp %p dirty bufs: flags %b vnodecovered %p syncer %p data %p RDONLYSYNCHRONOUSNOEXECNOSUIDNODEVASYNCEXRDONLY EXPORTED DEFEXPORTED EXPORTANON EXKERB LOCALQUOTAROOTFSvfsconf: ops %p name "%s" num %d ref %d flags 0x%x statvfs cache: bsize %x iosize %x blocks %llu free %llu avail %lld files %llu ffiles %llu favail %lld f_fsidx {0x%x, 0x%x} owner %u ctime 0x%llx syncwrites %llu asyncwrites = %llu syncreads %llu asyncreads = %llu fstype "%s" mnton "%s" mntfrom "%s" mntspec "%s" locked vnodes: %p, %pall vnodes: %p, %p,vfs_register called with vfc_refcount > 0 bgetvp: not freevdrop: zero holdcntbrelvp: NULLvref used where vget requiredvref on a VNON vnodevinvalbufvinvalbuf: dirty bufsvinvalbuf: flush failedvwakeup: neg numoutputsoftdep %d %p, type %s, use %u, write %u, hold %u,|VROOT|VTEXT|VSYSTEM|VXLOCK|VXWANT|VBIOWAIT|VBIOONFREELIST|VBIOONSYNCLIST|VALIASED flags (%s)vflushbuf: not dirtyvflushbufvflushbuf: dirtyUse count is not zero!vnode already on free list: vnode already on free listvput: null vpvput: bad ref countvput: ref cntvput: bad writecountvput: v_writecount != 0vclean: deadlockvclean: cannot reclaimvclean: not cleanvgonemissing aliasvgonel: not cleanmissing bdevvrele: null vpvrele: bad ref countvrele: ref cntvrele: bad writecountvrele: v_writecount != 0vrele: cannot lockvgetfree vnodefree vnode isn'tcleaned vnodecleaned vnode isn'tClean vnode has pending I/O'svfslockunmount of %s failed with error %d WARNING: some file systems would not unmount retrying syncing disks... giving up done kinfo: vp changed VNONVREGVDIRVBLKVCHRVLNKVSOCKVFIFOVBADNONUFSNFSMFSMSDOSFSPORTALPROCFSAFSISOFSADOSFSEXT2FSVFSNTFSUDFFUSEFSTMPFSsyncer vnode mounted on: %s sched_sync: fsync failedsyncermount: lost mountunmount: dangling vnodevn_lockgetcwd: oops, forgot to null lvpgetcwd: oops, went back too farspec_badop calledspec_ioctltag VT_NON, dev %d, %d spec_close: not specialspec_fsync: not dirtyspec_fsyncspec_fsync: dirtyspec_read modespec_read procspec_read typespec_write modespec_write procspec_write typechkvnlockdead_badop calleddead_write: lockdead_read: locktag VT_NON, dead vnode fifo_badop called, fifo with %ld readers and %ld writerstag VT_NONfifo_write modefifo_read modefiforfifowdos2unixtime(): month value out of range (%u) msdosfs_reclaim(): pushing activedetrunc(): can't truncate root directory, clust %u, offset %u msdosfs_inactive(): pushing activedeextend: file too largedenodedeget(): pcbmap returned %d fatentry(): function code doesn't specify get or set fatentry(): get function with no place to put result extendfile(): attempt to extend root directory extendfile: pcbmap. .. doscheckpath: source and target on different filesystemsdoscheckpath(): .. not a directory? msdosfs_sync: rofs modmsdosfs: reducing max cluster to %d from %d due to FAT size RRaArrAatag VT_MSDOSFS, startcluster %u, dircluster %u, diroffset %u (LOCKED) dev %d, %d, %s msdosfs_strategy: specmsdosfs_create: no namemsdosfs_mkdir: no namemsdosfs_rename: no namemsdosfs_rename: lost to startdirmsdosfs_rename: lost from startdirmsdosfs_rename: updating .. in root directory?msdosfs_write(): bad file typebpfattachbpf_mcopybpf: ifpromisc failedbpf_detachd: descriptor not in listbpfifa_update_broadaddr does not support dynamic lengthegresstoo many interfacesifaddritem%s: trying to send packet on wrong domain. if %d vs. mbuf %d, AF %d %s: can't handle af%d looutput: no header mbuflo%difmedia_match: multiple match for 0x%x/0x%x, selected instance %d ifmedia_add: can't malloc entryifmedia_set: no match for 0x%x/0x%x ifmedia_set failedcan't establish softnet handlerrtmaskrn_init: radix functions require max_keylen be set rn_initrn_init 2rn_addmask: mask impossibly already in tree rn_delete: inconsistent normal annotation rn_delete: inconsistent dupedkey list rn_delete: inconsistent annotation %s %p at %p rn_delete: Orphaned Maskrn_delete: couldn't find our annotation rn_addroute: t->rn_p is NULLMask for route not entered Non-unique normal route on dupedkey, mask not entered Non-unique normal route, mask not entered next == NULLraw_usrreqrt_timer_remove_all: rtq_count reached 0 rt_timer_add: rtq_count reached 0 rtflushclone: called with a non-cloning routertflushclone: no rnh_walktreeifafreertfreertfree 2rtfree: %p not freed (neg refs) rt_timer_init: already initializedrttmrplrtrequest deletertrequest1 RTM_RESOLVE: wrong ifa (%p) was (%p) rt_timer_timer: rtq_count reached 0 rt_timer_queue_destroy: rtq_count reached 0 rtinit: wrong ifa (%p) was (%p) rtentplroute_init rtable_addroute_outputunexpected mode %uUnexpected mode %u%s: invalid channel freq %u flags %x %s: invalid channel (NULL) Bad IBSS channel %u%s: bad channel ignored; freq %u flags %x number %u Pairwise key expansionPMK Name../../../../net80211/ieee80211_crypto_bip.c(wh->i_fc[0] & IEEE80211_FC0_TYPE_MASK) == IEEE80211_FC0_TYPE_MGTm0->m_len >= sizeof(*wh) + IEEE80211_MMIE_LEN%s: Michael MIC failure %s: station %s disassociated by peer (reason %d) %s: station %s deauthenticated by peer (reason %d) %s: %sassociation failed (status %d) for %s %s: impossible operating mode../../../../net80211/ieee80211_input.cieee80211_has_seq(wh)%s: received %s from %s rssi %d mode %s ni != NULL80211scan../../../../net80211/ieee80211_node.cic->ic_opmode == IEEE80211_M_HOSTAPbogus long slot station count %dbogus non-ERP station count %dnot in ap mode, mode %ufreeing bss node%s: station %s purged from node cache %s: number of cached nodes is %d, expected %d,possible nodes leak unable to setup inital BSS node%s: no memory for AID bitmap! %s: no memory for TIM bitmap! -%s: tsft offset %s%llu %s: ieee80211_ibss_merge: bssid mismatch %s %s: my tsft %llu beacon tsft %llu %s: sync TSF with %s %s: rates mismatch, BSSID %s %s: sync BSSID %s -> (from %s) %s: creating ibss passive%s: end %s scan %s: begin %s scan ../../../../net80211/ieee80211_output.crs->rs_nrates > IEEE80211_RATE_SIZEinvalid group data cipher!invalid integrity group cipher!management frame too large: %unull node%s: sending %s to %s on channel %u mode %s %s: no node for dst %s, discard raw tx frame %s: failed to queue raw tx frame %s: station %s deauthenticate (reason %d) %s: station %s disassociate (reason %d) %s: received msg %d/%d of the %s handshake from %s group key4-wayEAPOL-Key frame too large: %u../../../../net80211/ieee80211_pae_output.ck->k_flags & IEEE80211_KEY_IGTKk->k_flags & IEEE80211_KEY_GROUP%s: sending EAPOL-Key request to %s %s: sending msg %d/%d of the %s handshake to %s "0x%s: no recent beacons from %s; rescanning %s: bogus xmit rate %u setupassociatedsynchronized%s: %s with %s ssid .5 channel %d start %u%sMbshort protection enabled %s preamble %s slot time%s newly%s: station %s %s authenticated (open) %s: open authentication failed (reason %d) for %s assoc_reqassoc_respreassoc_reqreassoc_respprobe_reqprobe_respreserved#6reserved#7beaconatimdisassocauthdeauthaction_noackreserved#15INITSCANAUTHASSOCRUNauto11a11b11gturboaeamaratauazbebgbhbnbobrbybzcacncocrcyczdodzegf2fifofrgrgthkhnhuiqisj1j2j3j4j5jmjojpk2kpkrkwkzlbliltlvmamcmkmomxmyninlnzpaphpkprqarorusasgsisvtntttwuaukuyuzvnyezazwAPL1APL1AAPL1_ETSICAPL1_FCCAAPL1WAPL2APL2CAPL2DAPL2_ETSICAPL2WAPL3APL3WAPL4APL4WAPL5APL5WAPLDAPLDEBUGETSI1ETSI1WETSI2ETSI2WETSI3ETSI3AETSI3W,ETSI4ETSI4CETSI4WETSI5ETSI5WETSI6ETSI6WETSIAETSIBETSICETSIEU1WFCC1FCC1AFCC1WFCC2FCC2CFCC2AFCC2WFCC3FCC3AFCCAFRANCEMKK1MKK1_FCCAMKK1AMKK1A1MKK1A2MKK1BMKK2MKK2AMKKANONEWOR01WWOR02WWOR0WWOR1WWOR2WWOR3WWOR4WWOR5_ETSICWOR9WWORAWWORLD la_rt=%p la_hold_head=%p, la_asked=0x%lx [NULL][, ifa_addr= ifa_dsta= ifa_mask= flags=0x%x, refcnt=%d, metric=%d rtentry=%p flags=0x%x refcnt=%d use=%llu expire=%lld rtableid=%u key= mask= gw= ifp=%p (%s)(NULL) ifa=%p gwroute=%p llinfo=%p Route tree for AF_INET (not initialized) arptfreearp: ether address is broadcast for IP address %s! duplicate IP address %s sent from ethernet address %s arp: attempt to overwrite permanent entry for %s by %s on %s arp: attempt to overwrite entry for %s on %s by %s on %s arp info overwritten for %s by %s on %s arp: attempt to add entry for %s on %s by %s on %s arpintrarpresolve: %s: route without link local address arpresolve: %s: can't allocate llinfo arpresolve: unresolved and rt_expire == 0 arp_rtrequest: bad gateway value arp_rtrequest: malloc failed in_controlinvalid argument to in_lifaddr_ioctlin6_pcblookup_listen: laddr= lport=%d in_pcblookup_listen: laddr=%08x lport=%d in6_pcbhashlookup: faddr= fport=%d laddr=in_pcbhashlookup: faddr=%08x fport=%d laddr=%08x lport=%d rdom=%d IPv6 pcb passed into in_pcbconnectinpcbplin_pcbinit: hashinit failedin_pcbinit: hashinit failed for lportinterneticmp_do_exthdr: m_getptr failureicmp_redirect_timeout: bad route to timeouticmp_mtudisc_timeout: bad route to timeouticmp_erroricmp lenipintr no HDRipqeplipqplip_initaeshmac-sha1deflatemalformed IPv4 option passed to ip_optcopyip_output no HDRrip_attachrip_detachrip_usrreqtcp_pulloutofbandsynplinvalid sc_tp in syn_cache_cleanupsyn_cache_insert: bucketoverflow: impossiblesyn_cache_insert: cacheoverflow: impossiblem_pulldown malfunction../../../../netinet/tcp_input.csotoinpcb(inp->inp_socket) == inpintotcpcb(inp)->t_inpcb == inptcp_input: TCPS_LISTENtcp_output REXMTtcp_output: options too longtcphdr too bigtcp_outputtcp_output: template len != hdrlen - optlentcpcbpltcpqepltcp_inittcp_usrreqIPv6 inpcb to udp_outputudp_usrreq../../../../netinet/udp_usrreq.cipip_input: should never reach herestart = %d, len = %d, fs = %s ffs_alloccg: map corruptedbno = %lld, fs = %s ffs_alloccg: block not in mapffs_checkblk: bad sizeffs_checkblk: bad block %lldffs_checkblk: partially free fragmentffs_freefile: range: dev = 0x%x, ino = %d, fs = %sdev = 0x%x, ino = %u, fs = %s ffs_freefile: freeing free inodedev = 0x%x, bsize = %d, size = %ld, fs = %s ffs_blkfree: bad sizebad block %lld, ino %u uid %u on %s: %s bad blockdev = 0x%x, block = %lld, fs = %s ffs_blkfree: freeing free blockffs_blkfree: freeing free fragcg = %d, irotor = %d, fs = %s ffs_nodealloccg: map corruptedffs_nodealloccg: block not in mapffs_clusteralloc: map mismatchffs_clusteralloc: allocated out of groupffs_clusteralloc: lost block../../../../ufs/ffs/ffs_alloc.cindx <= 0 || bap != NULLmode = 0%o, inum = %u, fs = %s ffs_valloc: dup allocfree inode %s/%d had %lld blocks out of inodes %s: create/symlink failed, no inodes free ffs1_reallocblks: unallocated block 1ffs1_reallocblks: non-logical clusterffs1_reallocblks: non-physical cluster %dffs1_reallocblk: start == endffs1_reallocblks: unallocated block 2ffs1_reallocblks: alloc mismatchffs1_reallocblks: unallocated block 3 %lld,dev = 0x%x, bsize = %d, osize = %d, nsize = %d, fs = %s ffs_realloccg: bad sizeffs_realloccg: missing credentialdev = 0x%x, bsize = %d, bprev = %lld, fs = %s ffs_realloccg: bad bprevffs_realloccg: bad blocknoffs_realloccg: small bufdev = 0x%x, optim = %d, fs = %s ffs_realloccg: bad optimffs_realloccg: small buf 2file system full %s: write failed, file system is full dev = 0x%x, bsize = %d, size = %d, fs = %s ffs_alloc: bad sizeffs_alloc: missing credentialffs1_balloc: blk too bigffs1_balloc: ufs_bmaparray returned indirect blockCould not unwind indirect block, error %dffs_indirtrunc: bad buffer sizeffs_truncate: partial truncate of symlinkffs_truncate: newspaceffs_truncate1ffs_truncate2ffs_update: bad link cntDisk overlap start %lld, end %lld overlap start %llu, end %llu Disk buffer overlapsoftdep_flushfiles calledffsinodino1plffs_vget: alien ino_t %lluupdate: rofs modffs_statfsWARNING: %s was not properly unmounted WARNING: R/W mount of %s denied. Filesystem is not clean - run fsck ffs_mountfs(): obsolete rotational table format, please use fsck_ffs(8) -c 1 ffs_reload: dirty1ffs_reload: dirty2WARNING: soft updates isn't compiled in ffs_mountroot: can't setup bdevvp's ffsroot_deviceffs_fsync: not dirtyffs_fsyncffs_fsync: dirtyffs_write: modeffs_write: nonsync dir writeffs_write: typeffs_read: modeffs_read: short symlinkffs_read: type %dufs_getlbns: Invalid indirect block %lld specifiedufs_getlbns: indirect block %lld not foundufs_bmaparray: invalid argumentsufs_bmaparray: indirect block not in cacheufs_reclaim: pushing activeufs_inactive: pushing activecheckpath: .. not a directory First bad Second bad %s: bad dir ino %u at offset %d: %s bad dirufs_makedirentry: missing nameufs_direnter: newblkufs_direnter: compact1ufs_direnter: compact2mangled entryi_ffs_size too smallufs_makeinode: no nametag VT_UFS, ino %u, on dev %d, %d flags 0x%x, effnlink %d, nlink %d mode 0%o, owner %d, group %d, size %lldufs_strategy: specufs_mkdir: no nameufs_link: no nameufs_rename: no nameufs_rename: lost from startdirufs_rename: lost to startdirrename: EXDEVufs_rename: same fileufs_rename: lost dir entrychown: lost quotaifree: range: dev = 0x%x, ino = %d, fs = %sdev = 0x%x, ino = %d, fs = %s ifree: freeing free inodebad block %d, ino %u dev = 0x%x, block = %d, fs = %s mode = 0%o, nlinks %u, inum = %u, fs = %s ext2fs_valloc: dup allocext2fs_alloc: missing credentialext2fs_alloccg: map corruptedext2fs_mapsearch: block not in mapext2fs_alloccgblk: cg=%d bno=%d fs=%s ext2fs_alloccg: dup alloccg = %d, ipref = %d, fs = %s ext2fs_nodealloccg: map corruptedext2fs_nodealloccg: block not in mapext2fs_balloc: ufs_getlbns returned indirect blockext2fs_bmaparray: num=%d ext2fs_bmaparray: numext2fs_bmaparry: indirect block not in cacheext2fs_indirtrunc: bad buffer sizeext2fs_truncate: partial truncate of symlinkext2fs_truncate1ext2fs_truncate2ext2fs_truncate3ext2fs_inactive: pushing activecheckpathrec_len is smaller than minimalrec_len % 4 != 0reclen is too small for name_lendirectory entry across blocksinode out of boundsbad directory entry: %s offset=%d, inode=%lu, rec_len=%d, name_len=%d ext2fs_dirbadentryi_size too smalldirenter: missing nameext2fs_direnter: newblkext2fs_direnter: frag sizeext2fs_direnter: compact1ext2fs_direnter: compact2 %u %uext2fs_direnter: compact2%s: modeext2fs_write%s: nonsync dir write%s: typeext2fs_read%s: short symlink%s: type %d start %lld, end %lld overlap start %lld, end %lld ext2fs_vget: alien ino_t %lluExt2 fs: unsupported revision number: %x Ext2 fs: bad block size: %d (expected <=2 for ext2 fs) Ext2 fs: unsupported first inode positionExt2 fs: unsupported optional feature ext2fs_statfsext2fs_reload: dirty1ext2fs_reload: dirty2%s: file system not clean; please fsck(8) ext2fs_mountroot: can't setup bdevvp'sext2fsext2inoplext2dinoplext2fs_reclaim: pushing activeext2fs_makeinode: no nameext2fs_mkdir: no nameext2fs_mkdir: blksizeext2fs_link: no nameext2fs_rename: no nameext2fs_rename: lost from startdirext2fs_rename: lost to startdirrename: linked directoryext2fs_rename: lost dir entryext2fs_rename: mangled dir- uvm_addr %s: NULL - uvm_addr %s: %p (%s 0x%lx-0x%lx) entry %p: 0x%lx-0x%lx G=0x%lx F=0x%lx free: 0x%lx-0x%lx start=0x%lx, expected at least 0x%lx 0x%lu entries, 0x%lx free bytes pivot 0x%lx, epires in %d, direction %d empty 0x%lx - 0x%lx free (0x%lx bytes) contains pivot %d (0x%lx) %s: entry was not in tree%s: duplicate insertion: state %p interting %p, colliding with %p%s: duplicate insertion: state %p inserting entry %p which collides with %p../../../../uvm/uvm_addr.cp->entry == NULLuaddr == (struct uvm_addr_state*)&uaddr_kbootstrapuaddr_hint_pool.pr_size == sizeof(*ua_hint)offset < align || (align == 0 && offset == 0)(align & (align - 1)) == 0(offset & PAGE_MASK) == 0minaddr < maxaddruaddr_pivot_newpivot: cannot grant random pivot in area less than 2 pages (size = 0x%lx)align >= PAGE_SIZE && (align & (align - 1)) == 0*entry_out != NULLuvm_addr_invoke: address selector %p (%s 0x%lx-0x%lx) returned unavailable address 0x%lxentry_out != NULL && addr_out != NULLdirection == -1 || direction == 1(hint & PAGE_MASK) == 0 && (high & PAGE_MASK) == 0 && (low & PAGE_MASK) == 0 && (before_gap & PAGE_MASK) == 0 && (after_gap & PAGE_MASK) == 0high + sz > highuaddruaddrhintuaddrbestuaddrpivotuaddrrnd(map->flags & VM_MAP_ISVMSPACE) != 0uaddr_linuaddr_rnduaddr_hintuaddr_kbootstrapuaddr_bestfituaddr_pivotuaddr_stckbrk../../../../uvm/uvm_amap.c((offset) & (PAGE_SIZE - 1)) == 0amap_unadd: offset out of rangeamap_unadd: nothing thereamap_lookup: offset out of rangeamap_add: offset out of rangeamap_add: replacing null anonamap_add: slot in use(((entry->end - entry->start)) & (PAGE_SIZE - 1)) == 0amap_lookups: offset out of rangeamap_splitref: split at zero offsetamap_splitref: map size check failedamap_cow_now: non-resident wired page in anon %pcownowcownowpage((sz) & (PAGE_SIZE - 1)) == 0((padsz) & (PAGE_SIZE - 1)) == 0amap->am_ref == 0 && amap->am_nused == 0(amap->am_flags & AMAP_SWAPOFF) == 0amap->am_ref == 0amap_wipeout: corrupt amapLIST_NEXT(&marker_prev, am_list) == &marker_next || LIST_NEXT(LIST_NEXT(&marker_prev, am_list), am_list) == &marker_nextamapplamap_pp_adjref: overshot targetamap_pp_adjref: negative reference count((entry->end - entry->start) & (PAGE_SIZE - 1)) == 0((addsize) & (PAGE_SIZE - 1)) == 0amap->am_maxslot < slotneed(entry)->end + (entry)->fspace > (startva)(entry)->start < (endva)anon_pagein: uvmfault_anonget -> %d../../../../uvm/uvm_anon.cpg->loan_count > 0uvmexp.swpgonly > 0anon->an_page == NULLanon->an_swslot == 0anonpl../../../../uvm/uvm_aobj.cuvm_pagelookup(&aobj->u_obj, (UAO_SWHASH_ELT_PAGEIDX_BASE(elt) + j) << PAGE_SHIFT) == NULLelt->count > 0uvmexp.swpgonly >= swpgonlydeltauao_set_swslot: uobj = %p uao_set_swslot: attempt to set a slot on a NOSWAP objectslot == 0uao_flush: strange, got an out of range flush (fixed) uaoflshuao_flush: weird flagsstartpg < endpguobj->uo_refs == 1uao_detuaoeltplaobjplUAO_SWHASH_BUCKETS(aobj->u_pages) < UAO_SWHASH_BUCKETS(pages)aobj->u_pages > UAO_SWHASH_THRESHOLDaobj->u_pages <= UAO_SWHASH_THRESHOLDpages > aobj->u_pagespages < aobj->u_pagesuao_create: kernel object already allocateduao_create: asked to enable swap on kernel objectuao_create: hashinit swhash faileduao_create: malloc swslots faileduao_getpageuao_getudv_fault../../../../uvm/uvm_device.cuobj->uo_npages == 0 && RB_EMPTY(&uobj->memt)udv_detachudv_attach../../../../uvm/uvm_fault.cp != NULL && &p->p_vmspace->vm_map == map(map->flags & VM_MAP_INTRSAFE) == 0start >= vm_map_min(map) && end <= vm_map_max(map)uvm_fault_unwire_locked: address not in mapva >= entry->startnext != NULL && next->start <= entry->endanonget1anonget2flt_noram1result != VM_PAGER_PENDuvm_fault: fault on non-pageable map (%p, 0x%lx)fltamapcopyuvmadvice[ufi.entry->advice].advice == ufi.entry->advice(pages[lcv]->pg_flags & PG_RELEASED) == 0uvm_fault: uvmfault_anonget -> %dflt_noram2uvmexp.swpgonly <= uvmexp.swpagesflt_noram3flt_pmfail1uobjpage != PGO_DONTCAREfltagain2flt_noram4uvm_fault: want to promote data, but no anonflt_noram5flt_pmfail2../../../../uvm/uvm_glue.crvva == sva + szuvm_init: page size not set../../../../uvm/uvm_io.ckm_free: unmanaged page 0x%lx ../../../../uvm/uvm_km.csz == round_page(sz)kp->kp_object!kv->kv_singlepagekp->kp_object == NULLsz == PAGE_SIZEkm_allocvakmallockmthreadvm_map_pmap(map) == pmap_kernel()vallocwaitkm_alloc1w!(flags & UVM_KMF_VALLOC) || !(flags & UVM_KMF_ZERO)TAILQ_EMPTY(&pgl)uobj->pgops == &aobj_pagerkm_pgrmuvm_km_suballoc: unable to allocate space in parent mapuvm_km_suballoc: unable to create submapuvm_km_suballoc: submap allocation faileduvm_km_init: could not reserve space for kerneluvm_km_pgremove_intrsafe: no page../../../../uvm/uvm_map.c*start_ptr == uvm_map_entrybyaddr(atree, addr)*end_ptr == uvm_map_entrybyaddr(atree, addr + sz - 1)map->flags & VM_MAP_ISVMSPACE(flags & (PGO_FREE|PGO_DEACTIVATE)) != (PGO_FREE|PGO_DEACTIVATE)pg->uobject == NULLpg->uanon == anonuvm_map_clean: weird flagsOBJECT %p: pgops=%p, npages=%d, refs= refs=%d PAGES : <%p,0x%llx> PAGE %p: flags=%b, vers=%d, wire_count=%d, pa=0x%llx uobject=%p, uanon=%p, offset=0x%llx loan_count=%d [page ownership tracking disabled] vm_page_md %p >>> ANON DOES NOT POINT HERE <<< (%p) anon backpointer is OK checking object list page found on object list >>> PAGE NOT FOUND ON OBJECT LIST! <<< page found in uvm_pmemrange >>> page not found in uvm_pmemrange <<< checking pageq list page found on pageq list >>> PAGE NOT FOUND ON PAGEQ LIST! <<< MAP %p: [0x%lx->0x%lx] brk() allocate range: 0x%lx-0x%lx stack allocate range: 0x%lx-0x%lx sz=%u, ref=%d, version=%u, flags=0x%x pmap=%p(resident=%d) vm_refcnt=%d vm_shm=%p vm_rssize=%u vm_swrss=%u vm_tsize=%u vm_dsize=%u vm_taddr=%p vm_daddr=%p vm_maxsaddr=%p vm_minsaddr=%p - %p: 0x%lx->0x%lx: obj=%p/0x%llx, amap=%p/%d submap=%c, cow=%c, nc=%c, prot(max)=%d/%d, inh=%d, wc=%d, adv=%d hole=%c, free=%c, guard=0x%lx, free=0x%lx-0x%lx fspace_augment=%lu freemapped=%c, uaddr=%p (0x%lx-0x%lx %s) exeany[%d]brk/stackvmspplvmmpeplvmmpekpluvm_map_pageable_wire: stale mapmap->flags & VM_MAP_PAGEABLEuvm_mapent_alloc: cannot allocate map entryuvm_mapent_alloc: out of static map entries sel_min: 0x%lx, but should be at least 0x%lx sel_max: 0x%lx, but should be at most 0x%lx sel_min: 0x%lx, not aligned to 0x%lx sel_max: 0x%lx, not aligned to 0x%lx sel_min: 0x%lx, aligned to 0x%lx, expected 0x%lx sel_max: 0x%lx, aligned to 0x%lx, expected 0x%lx uvm_map_sel_limits(sz = %lu, guardpg = %c, align = 0x%lx, pmap_align = 0x%lx, pmap_off = 0x%lx, bias = %d, FREE_START(sel) = 0x%lx, FREE_END(sel) = 0x%lx)uvm_mapent_addr_removeuvm_mapent_addr_insert: entry still in addr listuvm_mapent_addr_insert: map %p entry %p (0x%lx-0x%lx G=0x%lx F=0x%lx) insert collision with entry %p (0x%lx-0x%lx G=0x%lx F=0x%lx)(entry->etype & UVM_ET_FREEMAPPED) != 0 || uaddr == NULLuvm_map_uaddr_e(map, entry) == uaddr(entry->etype & UVM_ET_FREEMAPPED) == 0entry == NULL || (entry->etype & UVM_ET_FREEMAPPED) == 0uvm_map_vmspace_update: vmspace %p invalid bounds: b=0x%lx-0x%lx s=0x%lx-0x%lx(map->flags & VM_MAP_ISVMSPACE) == 0(min & (vaddr_t)PAGE_MASK) == 0(max & (vaddr_t)PAGE_MASK) == 0 || (max & (vaddr_t)PAGE_MASK) == (vaddr_t)PAGE_MASKvmmaplkuvm_map_setup: rw_enter failed on new mapuvmspace_fork: no space in map for entry in empty mapuvm_map_splitentry: split address 0x%lx not on page boundary!orig->start < split && VMMAP_FREE_END(orig) > splitentry->start < addr && VMMAP_FREE_END(entry) > addr(entry)->end + (entry)->fspace > (start)(entry)->start < (end)last != first(first)->end + (first)->fspace > (start)(last)->start < (end)(iter)->end + (iter)->fspace > (start)(iter)->start < (end)RB_EMPTY(&map->addr)which != NULL(void*)map <= (void*)(which) && (void*)(which) < (void*)(map + 1)fork: encountered a submap during fork (illegal)fork: non-copy_on_write map entry marked needs_copy (illegal)uvm_map_teardown: rw_enter failed on free map(start & (vaddr_t)PAGE_MASK) == 0(end & (vaddr_t)PAGE_MASK) == 0 || (end & (vaddr_t)PAGE_MASK) == (vaddr_t)PAGE_MASK(start & (vaddr_t)PAGE_MASK) == 0 && (end & (vaddr_t)PAGE_MASK) == 0(sz & (vaddr_t)PAGE_MASK) == 0uobj == NULL && (flags & UVM_FLAG_FIXED) && (flags & (UVM_FLAG_OVERLAY | UVM_FLAG_COPYONW)) == 0(*addr & PAGE_MASK) == 0(map->flags & VM_MAP_ISVMSPACE) == VM_MAP_ISVMSPACE || uvm_maxkaddr >= *addr + szUVM_OBJ_IS_KERN_OBJECT(uobj)../../../../uvm/uvm_mmap.c!UVM_ET_ISSUBMAP(entry)start >= entry->start!UVM_OBJ_IS_KERN_OBJECT(entry->object.uvm_obj)../../../../uvm/uvm_object.c!(pg->pg_flags & PG_RELEASED)pgs[i] != NULL!(pgs[i]->pg_flags & PG_RELEASED)../../../../uvm/uvm_page.c(pg->pg_flags & PG_TABLED) == 0dupe == NULLpg->wire_count == 0(pg->pg_flags & PG_DEV) == 0pg->pg_flags & PG_TABLEDsaved_loan_count == 0obj == NULL || anon == NULLoff == trunc_page(off)pg != NULL && TAILQ_NEXT(pg, pageq) == NULLuvm_page_physget: called _after_ bootstrapuvm_page_physget: out of memory!uvm_setpagesize: page size not a power of two(alignment & (alignment - 1)) == 0(boundary & (boundary - 1)) == 0!(flags & UVM_PLA_WAITOK) ^ !(flags & UVM_PLA_NOWAIT)uvm_pglistallocuvm_pglistalloc: Upper boundary 0x%lx not on pagemask. size 0 uvm_pagereallocuvm_page_physdump: physical memory config [segs=%d of %d]: 0x%llx->0x%llx [0x%llx->0x%llx] STRATEGY = RANDOM uvm_page_physload: page size not set!uvm_page_physload: start >= enduvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX uvm_page_physload: can not malloc vm_page structs for segment ignoring 0x%lx -> 0x%lx uvm_page_physload: tried to add RAM after vm_mem_inituvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: pmap_growkernel() faileduvm_pageboot_alloc: out of memoryuvm_page_bootstrap: no memory pre-allocateduvm_page_init: lost %ld page(s) in init../../../../uvm/uvm_pager.cpseg != &psegs[PSEG_NUMSEGS]id >= 0 && id < MAX_PAGER_SEGSUVM_PSEG_INUSE(pseg, id)npages <= MAXPHYS >> PAGE_SHIFTswap || pg->uobject == uobj!write || (pgs[i]->pg_flags & PG_FAKE) == 0pseg->start == 0pseg->use == 0pagersegsize <= MAXBSIZEpppp->pg_flags & PG_BUSY../../../../uvm/uvm_pdaemon.cp->loan_count > 0anon->an_swslot != 0uvmexp.swpginuse <= uvmexp.swpagespagedaemon: pageout returned invalid 'unlock' codep->uanon != NULLpgdaemonuvm_wait emergency bufbackoff pagedaemon: deadlock detected! Ranges, use queue: * [0x%lx-0x%lx] use=%d nsegs=%ld maxsegsz[%d]=0x%lx free=0x%lx #ranges = %d pagedaemon: wait_pla deadlock detected! pmrwaituvm_wait: failed to free %ld pages between 0x%lx-0x%lx ../../../../uvm/uvm_pmemrange.cpg_prev != NULL && pg_next != NULLpg_i->pg_flags & PQ_FREEstart == 0 || atop(VM_PAGE_TO_PHYS(found)) + found->fpgsz > start!TAILQ_EMPTY(pgl)pmr != NULL && pg != NULLsz >= 1nw != NULLpmr->high > pagenouvm_pmr_split: lost one pmr drain->nsegs == 0prev == NULL || atop(VM_PAGE_TO_PHYS(prev)) < pagenobefore > 0after > 0sz >= high - lowFlags: 0x%x, will panic now. (pg->pg_flags & PQ_FREE) == 0 && VALID_FLAGS(pg->pg_flags)atop(VM_PAGE_TO_PHYS(&pg[i])) == atop(VM_PAGE_TO_PHYS(pg)) + i(pg[i].pg_flags & PQ_FREE) == 0 && VALID_FLAGS(pg[i].pg_flags)pmr != NULLstart == 0 || end == 0 || start < endalign >= 1powerof2(align)maxseg > 0boundary == 0 || powerof2(boundary)boundary == 0 || maxseg * boundary >= countTAILQ_EMPTY(result)flags & UVM_PLA_FAILOKpmemrange allocation error: allocated %ld pages in %d segments, but request was %ld pages in %d segmentsCurrent UVM status: pagesize=%d (0x%x), pagemask=0x%x, pageshift=%d %d VM pages: %d active, %d inactive, %d wired, %d free min %d%% (%d) anon, %d%% (%d) vnode, %d%% (%d) vtext pages %d anon, %d vnode, %d vtext freemin=%d, free-target=%d, inactive-target=%d, wired-max=%d faults=%d, traps=%d, intrs=%d, ctxswitch=%d fpuswitch=%d softint=%d, syscalls=%d, kmapent=%d fault counts: noram=%d, noanon=%d, pgwait=%d, pgrele=%d ok relocks(total)=%d(%d), anget(retries)=%d(%d), amapcopy=%d neighbor anon/obj pg=%d/%d, gets(lock/unlock)=%d/%d cases: anon=%d, anoncow=%d, obj=%d, prcopy=%d, przero=%d daemon and swap counts: woke=%d, revs=%d, scans=%d, obscans=%d, anscans=%d busy=%d, freed=%d, reactivate=%d, deactivate=%d pageouts=%d, pending=%d, nswget=%d nswapdev=%d, nanon=%d, nanonneeded=%d nfreeanon=%d swpages=%d, swpginuse=%d, swpgonly=%d paging=%d kernel pointers: objs(kern)=%p ../../../../uvm/uvm_swap.cuvmexp.nswapdev >= 1sdp != NULLsdp->swd_npginuse >= nslotswarning: resource shortage: %d pages of swap lost vnx->vx_pending == 0swapdrum_addsw_reg_strategy: swap to sparse fileswstrategy: vnode type 0x%xswap_off: swapdev not in listswap0x%04xdisklabel reserve/dev/%s%d%cblkdev0x%xswapctl: copystrflags & PGO_SYNCIOuvm_swap_init: can't get vnode for swap deviceswapmapuvm_swap_init: extent_create failedswp vnxswp vndswplkuvm_coredump: user process with submap?sbrk: grow %ld failed, error = %d uvm_deallocate with null mapuvn_iosyncuvn_getpageuvn_getuvn_cluster: offset out of range../../../../uvm/uvm_vnode.cuobj->pgops->pgo_mk_pcluster != 0uvn_flshuvn_flush: PGO_SYNCIO return 'try again' error (impossible)uvn_flush: obj=%p, offset=0x%llx. error during pageout. uvn_flush: WARNING: changes to page may be lost! uvn_flushuvn_termuvm_vnp_terminate: io sync wanted bit setuvn_attachuvnsyncNULL pointer passed to ip_ecn_egressNULL pointer passed to ip_ecn_ingressHuh? Thought in6_pcbnotify() never got called with mapped! in6_prefixlen2mask: invalid prefix length(%d) in6_are_prefix_equal: invalid prefix length(%d) in6_unlink_ifa: interface address %s has no prefix ADDDELETEin6_ifloop_request: %s operation failed for %s (errno=%d) in6_purgeaddr: failed to remove a route to the p2p destination: %s on %s, errno=%d in6_update_ifa: a destination can be specified for a p2p or a loopback IF only in6_update_ifa: prefixlen should be 128 when dstaddr is specified in6_update_ifa: valid lifetime is 0 for %s in6_update_ifa: the prefix length of an existing (%s) address should not be changed in6_update_ifa: failed to remove a route to the old destination: %s in6_update_ifa: addmulti failed for %s on %s (errno=%d) prefix ioctls are now invalidated. please use ifconfig. nd6_prelist_add succeeded but no prefix invalid argument to in6_lifaddr_ioctlin6_ifawithscope: output interface is not specified in6_ifattach_loopback: failed to configure the loopback address on %s (errno=%d) %s: got interface identifier from itself %s: borrow interface identifier from %s %s: interface identifier generated by random number %s: failed to get interface identifier %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x %s: no ifid available in6_ifattach_linklocal: failed to configure a link-local address on %s (errno=%d) ia6 == NULL in in6_ifattach_linklocalin6_ifattach: %s has too small MTU, IPv6 not enabled in6_ifattach: %s is not multicast capable, IPv6 not enabled in6_cksum: mbuf len (%d) < off+len (%d+%d)in6_cksum: out of datainternet6%s:%d: ip6q lock not held ../../../../netinet6/frag6.cip6q lock check%s:%d: ip6q already locked ip6q_lockicmp6_redirect_timeout: bad route to timeouticmp6_mtudisc_timeout: bad route to timeout(src=%s dst=%s tgt=%s)ICMP6 redirect sent from %s rejected; must be from linklocal ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) ICMP6 redirect rejected; redirect dst must be unicast: %s ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s ICMP6 redirect rejected; no route found for redirect dst: %s ICMP6 redirect rejected; neither router case nor onlink case: %s icmp6_redirect_input: invalid ND option, rejected: %s icmp6_redirect_input: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s icmp6_notify_error: in6_embedscope failed sanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d ../../../../netinet6/icmp6.cicmp6_reflect: source can't be determined: dst=%s, error=%d ICMP6 checksum error(%d|%x) %s icmp6_input: unknown type %d(src=%s, dst=%s, ifid=%d) ENOBUFS in icmp6_error %d icmp6_mtudisc_callback_registerip6_nexthdr: m == NULLip6_pullexthdr: invalid nxt=%d ip6_input: packet to an unready address %s->%s ip6_initcannot forward from %s to %s nxt %d received on %s cannot forward src %s, dst %s, nxt %d, rcvif %s, outif %s ip6_setpktopt: impossible case ip6_getpcbopt: unexpected optionassumption failed: hdr not splitscope error in prefix list (%s) ndopts == NULL in nd6_optionuninitialized ndopts in nd6_optionndopts == NULL in nd6_optionsuninitialized ndopts in nd6_optionsduplicated ND6 option found (type=%d) nd6_options: unsupported option %d - option ignored too many loop in nd opt unspecnd6_lookup: failed to lookup %s (if = %s) nd6_output: can't allocate llinfo for %s (ln=%p, rt=%p) nd6_setmtu0: new link MTU on %s (%lu) is too small for IPv6 nd6_init called more than once(ignored) ln->ln_rt == NULLln->ln_rt->rt_ifp == NULLrt_llinfo(%p) is not equal to ln(%p)dst=0 in nd6_timer(ln=%p)nd6_storelladdr: something odd happens nd6_storelladdr: sdl_alen == 0, dst=%s, if=%s ifp == NULL in nd6_cache_lladdrfrom == NULL in nd6_cache_lladdrndp info overwritten for %s by %s on %s nd6_rtrequest: bad gateway value: %s nd6_rtrequest: malloc failed %s: failed to join %s (errno=%d) nd6_dad_duplicated: DAD structure not found %s: DAD detected duplicate IPv6 address %s: NS in/out=%d/%d, NA in=%d %s: DAD complete for %s - duplicate found %s: manual intervention required ifa == NULL in nd6_dad_na_inputifa == NULL in nd6_dad_ns_inputnd6_na_output: max_linkhdr + maxlen >= MCLBYTES (%d + %d > %d) nd6_na_output: insufficient MCLBYTESnd6_na_output: source can't be determined: dst=%s, error=%d nd6_ns_output: max_linkhdr + maxlen >= MCLBYTES (%d + %d > %d) nd6_ns_output: insufficient MCLBYTESnd6_ns_output: source can't be determined: dst=%s, error=%d nd6_dad_timer: called with null parameter nd6_dad_timer: DAD structure not found nd6_dad_timer: called with duplicated address %s(%s) nd6_dad_timer: called with non-tentative address %s(%s) %s: could not run DAD, driver problem? %s: DAD complete for %s - no duplicates found nd6_dad_start: called with non-tentative address %s(%s) nd6_dad_start: ifa->ifa_ifp == NULLnd6_dad_start: memory allocation failed for %s(%s) %s: starting DAD for %s nd6_ns_input: invalid hlim (%d) from %s to %s on %s nd6_ns_input: bad DAD packet (wrong ip6 dst) nd6_ns_input: NS packet from non-neighbor nd6_ns_input: bad NS target (multicast) nd6_ns_input: invalid ND option, ignored nd6_ns_input: bad DAD packet (link-layer address option) nd6_ns_input: lladdrlen mismatch for %s (if %d, NS packet %d) nd6_ns_input: duplicate IP6 address %s nd6_ns_input: src=%s nd6_ns_input: dst=%s nd6_ns_input: tgt=%s nd6_na_input: invalid hlim (%d) from %s to %s on %s nd6_na_input: invalid target address %s nd6_na_input: a solicited adv is multicasted nd6_na_input: invalid ND option, ignored nd6_na_input: multicast adv without TLLA nd6_na_input: duplicate IP6 address %s nd6_na_input: ND packet from non-neighbor nd6_na_input: lladdrlen mismatch for %s (if %d, NA packet %d) in6_init_prefix_ltimes: preferred lifetime(%d) is greater than valid lifetime(%d) in6_ifadd: wrong prefixlen for %s (prefix=%d ifid=%d) in6_ifadd: failed to make ifaddr %s on %s (errno=%d) nd6_prefix_onlink: %s/%d is already on-link nd6_prefix_onlink: failed to find any ifaddr to add route for a prefix(%s/%d) on %s nd6_prefix_onlink: failed to add route for a prefix (%s/%d) on %s, gw=%s, mask=%s, flags=%lx errno = %d nd6_prefix_offlink: %s/%d is already off-link nd6_prefix_offlink: failed to recover a prefix %s/%d from %s to %s (errno = %d) nd6_prefix_offlink: failed to delete route: %s/%d on %s (errno = %d) pfxlist_onlink_check: failed to make %s/%d offlink, errno=%d prelist_remove: failed to make %s/%d offlink on %s, errno=%d prelist_remove: negative count on %s nd6_prelist_add: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_update: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_update: nd6_prelist_add failed for %s/%d on %s errno=%d, returnpr=%p dr == NULL in defrouter_delreqdefrouter_select: called unexpectedly (forwarding=%d, accept_rtadv=%d) defrouter_select: more than one router is installed defrtrlist_del: negative count on %s nd6_ra_input: invalid hlim (%d) from %s to %s on %s nd6_ra_input: src %s is not link-local nd6_ra_input: invalid ND option, ignored nd6_ra_input: invalid option len %d for prefix information option, ignored nd6_ra_input: invalid prefix len %d for prefix information option, ignored nd6_ra_input: invalid prefix %s, ignored nd6_ra_input: invalid prefixlen %d for rfc2374 prefix %s, ignored nd6_ra_input: bogus mtu option mtu=%lu sent from %s, ignoring nd6_ra_input: bogus mtu mtu=%lu sent from %s; exceeds maxmtu %lu, ignoring nd6_ra_input: lladdrlen mismatch for %s (if %d, RA packet %d) nd6_rs_input: invalid hlim (%d) from %s to %s on %s nd6_rs_input: invalid ND option, ignored nd6_rs_input: lladdrlen mismatch for %s (if %d, RS packet %d) rip6_attachrip6_detachrip6_usrreq db_fetch_reg: botchaddress %p is invalid branch_taken: botch address 0x%08lx not a valid page Faulted in DDB; continuing... spsrr0r1r2r3r4r5r6r7r8r9r10r11r12usr_spusr_lrsvc_spsvc_lrpcund_spabt_spirq_spframetrace: pid %d not found at %p scp=0x%08x rlv=0x%08x () rsp=0x%08x rfp=0x%08x%sr%d=0x%08xBad frame pointer: %p Bad user frame pointer: %p frame address must be specified frame address = %08x r0 =%08x r1 =%08x r2 =%08x r3 =%08x r4 =%08x r5 =%08x r6 =%08x r7 =%08x r8 =%08x r9 =%08x r10=%08x r11=%08x r12=%08x r13=%08x r14=%08x r15=%08x slr=%08x mainbuscortexampintc irq %dampintc_intr_establish: bogus irqnumber %d: %sintr_establish: can't malloc handler infoampintc_attach: ICP bus_space_map failed!ampintc_attach: ICD bus_space_map failed!irq1023/spur nirq %d ampintcamptimer0: adjusting clock: new tick rate %d KHz tickamptimer_attach: bus_space_map global timer failed!amptimer_attach: bus_space_map priv timer failed!: tick rate %d KHz amptimerarml2cc_attach: bus_space_map failed!: rtl %dL2 Cache controller was already enabled waymask: 0x%08x armliicccpu, rrx, %s r%d, %s #%d%s%s#0x%08x[r%d][r%d%s, #0x%03x#0x%02x{r%d-r%d}^f%d#%s0x%08xcpsr_p%df%d, c%d, c%d, c%d, c%d, %dr%d, c%d, c%d, %d[%c - unknown]und%s %08x imbimbrangeswiblxblmulSnmsmlaSnmsdumullSdnmssmullumlalsmlalstrtdaWldrtstrbtldrbtdsbisbstrldrstrbldrbstmYnWlldmXnWlldrsbldrhstrhldrshswpdmoswpbmrsdpnopyieldwfewfisevdbgmsrpFmpF2bxclzdmbkptSdn2eorsubrsbaddadcsbcrsctstDn2teqcmpcmnorrmovSd2bicmvnadfPRfghmufsufrsfdvfrdfpowrpwrmffmlfdvfrdpolfpbopmvfPRfhmnfabsrndsqtlgnexpsincostanasnacsatnfpuopstfQLvldffltPRgdfixPRdhwfsrfswfcrfccmfPRghcnfcmfecnfemcr2#zmcrmrc2mrccdp2#ycdpldc2L#vldcstc2stcNo support for this CPU type (%08x) in kernel../../../../arch/arm/arm/process_machdep.ctf != NULLprocess_read_regs: Interrupts blocked in user process../../../../arch/arm/arm/syscall.cnargs <= MAXARGSUndefined instruction in kernel ../../../../arch/arm/arm/undefined.ccoproc >= 0 && coproc < MAX_COPROCShandler != NULLreal mem = %u (%uMB) avail mem = %lu (%uMB) Warning IRQ's disabled during boot() WARNING: not updating battery clock uvm_pglistalloc returned non-sensical address 0x%lx _bus_dmamem_alloc_range_bus_dmamem_mmap: offset unaligned_bus_dmamem_mmap: segment unaligned_bus_dmamem_mmap: segment size not multiple of page size_bus_dmamap_load_raw: not implemented_bus_dmamap_load_uio: USERSPACE but no proc_bus_dmamap_load_mbuf: no packet header_bus_dmamem_unmap_bus_dmamem_map: size botch../../../../arch/arm/arm/bus_dma.c(va & PAGE_MASK) == (pa & PAGE_MASK)_bus_dmamap_sync: mix PRE and POST_bus_dmamap_sync: bad offset %lu (map size is %lu)_bus_dmamap_sync: bad length%s: curaddr %#lx not in range_bus_dmamap_sync: ARM32_BUFTYPE_INVALIDunknown buffer type %d _bus_dmamap_syncProcessor failed probe - no CPU ID %s %s (%s core)%s: IDC disabled IDC enabled DC disabled DC enabled IC disabled IC enabled WB disabled WB enabled LABT EABT branch prediction enabled%s: %dKB/%dB %d-way %s unified cache %s: %dKB(%db/l,%dway) I-cache, %dKB(%db/l,%dway) %s D-cache %s: %s does not fully support this CPU. %s: This kernel does not fully support this CPU. %s: Recompile with "options %s" to correct this. unknown CPU (ID = 0x%x)ARM810ARM920TARM922TARM926EJ-SARM940TARM946E-SARM966E-STI ARM925TARM1020EARM1022E-SSA-110SA-1100SA-1110IXP1200i80200i80321 400MHzi80321 600MHzi80219 400MHzi80219 600MHzPXA250PXA210PXA27xIXP425 533MHzIXP425 400MHzIXP425 266MHzARM1136J-SARM1136J-S R1ARM Cortex A5ARM Cortex A7ARM Cortex A8ARM Cortex A8 R1ARM Cortex A8 R2ARM Cortex A8 R3ARM Cortex A9ARM Cortex A9 R1ARM Cortex A9 R2ARM Cortex A9 R3ARM Cortex A9 R4ARM Cortex A15ARM Cortex A15 R1ARM Cortex A15 R2ARM Cortex A15 R3ARM Cortex A15 R4CPU_ARM8ARM9TDMIARM9E-SCPU_ARM9EARM9EJ-SARM10ECPU_ARM10SA-1CPU_SA1100XScaleCPU_XSCALE_...ARM11JCPU_ARM11CPU_ARMv7wr-thruwr-back**unknown 3****unknown 4**wr-back-lockwr-back-lock-Awr-back-lock-B**unknown 8****unknown 9****unknown 10****unknown 11****unknown 12****unknown 13****unknown 14****unknown 15**rev 0rev 1rev 2rev 3rev 4rev 5rev 6rev 7rev 8rev 9rev 10rev 11rev 12rev 13rev 14rev 15step Jstep Kstep Sstep Tstep Bstep Cstep Dstep Erev 10step Gstep A-0step B-0step B-1step B-2step B-3step B-4step B-5(IXP1200 step A)(IXP1200 step B)(IXP1200 step C)(IXP1200 step D)(IXP1240/1250 step A)(IXP1240 step B)(IXP1250 step B)step A-1step C-0step D-0step ?step C-5step 0badaddr: invalid size (%lu)kernelFatal %s mode data abort: '%s' trapframe: %p DFSR=%08x, DFAR=%08x, spsr=%08x Fatal %s mode prefetch abort at 0x%08x trapframe: %p IFSR=%08x, IFAR=%08x, spsr=%08x r0 =%08x, r1 =%08x, r2 =%08x, r3 =%08x r4 =%08x, r5 =%08x, r6 =%08x, r7 =%08x r8 =%08x, r9 =%08x, r10=%08x, r11=%08x r12=%08x, usp=%08x, ulr=%08xssp=%08x, slr=%08x, pc =%08x Fatal abort Non-emulated prefetch abort with intr_depth > 0 UVM: pid %d (%s), uid %d killed: out of swap data_abort_fault: Misaligned Kernel-mode Program Counter Non-emulated page fault with intr_depth > 0 uvm_fault(%p, %lx, %x, 0) -> %x V7 fault 00000Alignment Fault 1Debug EventAccess Flag Fault (S)External Linefetch Abort (S)Translation Fault (S)Access Flag Fault (P)Translation Fault (P)External Non-Linefetch Abort (S)Domain Fault (S)V7 fault 01010Domain Fault (P)External Translation Abort (L1)Permission Fault (S)External Translation Abort (L2)Permission Fault (P)V7 fault 10000V7 fault 10001V7 fault 10010V7 fault 10011LockdownV7 fault 10101Asynchronous External AbortV7 fault 10111Memory Asynchronous Parity ErrorMemory Synchronous Parity ErrorCoprocessor AbortV7 fault 11011V7 fault 11101V7 fault 11111mmrwpmap_map_chunk: no L1 table providedpmap_map_chunk: no L2 table for VA 0x%08lxpmap_map_chunk: can't find L2 table for VA0x%08lxpmap_alloc_specials: no l2b for 0x%lxpmap_bootstrap: No L2 for L2 @ va %ppmap_init_l1: can't get PA of L1 at %ppmap_bootstrap: No L2 for va 0x%x, pa 0x%lxpmap_bootstrap: out of static L2spmap_bootstrap: WARNING! wrong cache mode for L2 pte @ %p pmap_bootstrap: WARNING! wrong cache mode for primary L1 @ 0x%lx pmapplpvepll2dtblpll2ptpplalloc_l1_vaalloc_l1_pgpmap_map_entry: no L2 table for VA 0x%08lxpmap_map_entry: can't find L2 table for VA 0x%08lx%s: va %08x ftype %x %c pte %08x fault on exec pmap_enter: failed to allocate L2 bucketpmap_enter: no pv entries dump to dev %u,%u not possible dumping to dev %u,%u offset %ld dump area unavailable device bad device not ready area improper i/o error aborted from console succeeded vunmapbufvmapbufarmv7_io_bs_free(): not implementedarmv7_io_bs_alloc(): not implementedarm_clock_func.setstatclockrate not intializedinitclocks function not initialized yetarm_dflt_intr_string calledarm_dflt_intr_disestablish calledarm_dflt_intr_establish calledarm_dflt_intr() calledresettodr: failed to set time WARNING: preposterous time in file system WARNING: preposterous clock chip time lostgainedWARNING: clock %s %ld days WARNING: CHECK AND RESET THE DATE! atag core flags %x pagesize %x rootdev %x atag mem start 0x%08x size 0x%x atag cmdline [%s] atag serial 0x%08x:%08x atag revision %08x uboot tag unknown 0x%08x size %d softintr_establish: unknown soft IPL %d%s: armv7_devs == NULL: PhyFLEX-i.MX6 : i.MX6 SABRE Lite : i.MX6 Wandboard : BeagleBoard : BeagleBone : Gumstix Overo : PandaBoard : A1X : A20 %s: board type 0x%x unknownsunxi_attach: bus_space_map failed!%s: device %s unit %d not found %s: device %s unit %d not configured imxccmimxiomuxcimxdogimxocotpimxuartimxgpioimxesdhcimxenetprcmintcgptimeromdogomgpioommmccomsitaracmedmadmtimercpswomapidsxipiosxiccmua1xintcsxitimersxidogsxirtcsxiuartsxiekernel does not support -c; continuing.. bootfile: %s bootargs: %s unknown option `%c' cpu not recognized! %s booting ... arg0 %p arg1 %p arg2 %p Allocating page tables freestart = 0x%08lx, free_pages = %d (0x%08x) initarm: out of memoryinitarm: Failed to align the kernel page directoryIRQ stack: p0x%08lx v0x%08lx ABT stack: p0x%08lx v0x%08lx UND stack: p0x%08lx v0x%08lx SVC stack: p0x%08lx v0x%08lx Creating L1 page table at 0x%08lx Mapping kernel Constructing L2 page tables undefined page pmap boot: howto=%08x curproc=%p The operating system has halted. Please press any key to reboot. rebooting... reboot failed; spinning Attempting to power down... boot device: lookup '%s' failed. boot device: %s wdsdraidmmcdiemmcdly%s: i/o init failed %s: mem init failed %s: can't identify card %s: can't supply bus power %s: can't supply clock %s: can't enable card %s: no functions mmctsk%s: can't create task thread sdmmcSpectecSDIO WLAN CardSDW-820%s: CIS version %d.%d %s: CIS info: %s: Manufacturer code 0x%x, product 0x%x %s: function %d: wireless network adapterunknown (%d)%s: bad CIS ptr %#x %s: CIS parse error at %d, tuple code %#x, length %d %s: bad CISTPL_FUNCID length %s: bad CISTPL_MANFID length %s: CISTPL_VERS_1 too short ../../../../dev/sdmmc/sdmmc_io.cTAILQ_EMPTY(&sc->sc_intrq)%s(manufacturer 0x%x%sproduct 0x%x%sat %s function %d "scsibus%s: can't read CIS %s: can't set I/O RCA %s: can't select I/O RCA %d %s: can't supply voltage requested by card %s: can't send I/O OCR %s: can't read EXT_CSD %s: unknown CARD_TYPE 0x%x %s: can't change high speed %s: can't change bus clock %s: can't re-read EXT_CSD %s, HS_TIMING set failed %s: unknown MMC version %d %s: unknown SD CSD structure version 0x%x %s: unknown MMC CSD structure version 0x%x %s: can't set mem RCA SD/MMC Drive #%02d%s: can't allocate ccbs %s: can't attach scsibus OUI 0x%06x model 0x%04x rev %d at %s phy %dmii_detach: phyloc and offloc specifiedmii_attach: phyloc and offloc specifiedmiiautmii_phy_setmediamii_phy_setmedia: MASTER on wrong media: Generic IEEE 802.3u media interface, rev. %d: OUI 0x%06x, model 0x%04x %s: no media present ukphy: %s, rev. %d atphyF1 10/100/1000 PHYF2 10/100 PHY"%s" at %s addr 0x%xiiclm75alm75lm77eeprommax1617xeontemplm93lm81lm87adm9240adt7470adt7476adt7475adt7462adt7466adt7467adm1033adm1034adm1030adm1031adm1025adm1024adm1023adm1028adm1022thmc5047m192sch5027emc6w201asc7611asc7621ne1619ds1780adt7460adm1027lm85adt7516lm63lm86lm89lm89-1lm90gl523smadt7461adm1021adm1032g781g781-1max6690max6646max6657max6642tmp401sa56004xw83791sdw83627dhgw83792dw83781dw83627hfw83782das99127fw83783sw83791dw83l784rw83l785rw83l785ts-lf75375asb100gl518smadm1026se97max6604mcp9805mcp98242mcp98243adt7408stts2002cat34ts02ts3000b3lis331dlit8712lm96000emc6d100sch5017it8712f-amtp008w83795gw83793gstts424e02%s: addr 0x%x %02x=%02x words %02x=%04x: %sunexpected opening returnedDiagnostic Failure on Component 0x%02xTagged Overlapped Commands (0x%02x = TASK TAG)Decompression Exception Short Algorithm ID OF 0x%02xASC 0x%02x ASCQ 0x%02xCDBParametersError in %s, Offset %d, bit %dActual Retry Count: %dProgress Indicator: %dprobe%s(%s:%d:%d): %sCheck Condition (error %#x) on opcode 0x%x AT BLOCK #: %d (decimal) SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Setoff INFO: 0x%x (VALID flag %s) COMMAND INFO: 0x%x ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s DEFERRED scbusyunknown error category (0x%x) from scsi driver scsi_done called twice on xs(%p)unexpected xsh state %uscsi_ioh_del: unexpected state %uscsi_iopool_destroy: scsi_iohandler on poolscsi_ioh_add: unexpected state %uxs->cookie != NULL in scsi_xs_syncxs->done != NULL in scsi_xs_syncsyncxsscsi_link_shutdown: scsi_xshandler on linkscsi_link_shutdown: scsi_xshandler on poolpendxsscsiiomvscsi_xfer pool exhausted! scxsplscsiplugscsi_cmd_rw_decode: bad opcode 0x%02xNo Additional SenseSoft ErrorNot ReadyMedia ErrorHardware ErrorIllegal RequestUnit AttentionWrite ProtectedBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare ErrorNo Additional Sense InformationFilemark DetectedEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnCleaning RequestedErase Operation In ProgressLocate Operation In ProgressRewind Operation In ProgressSet Capacity Operation In ProgressVerify Operation In ProgressNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Not Ready, Rebuild In ProgressLogical Unit Not Ready, Recalculation In ProgressLogical Unit Not Ready, Operation In ProgressLogical Unit Not Ready, Long Write In ProgressLogical Unit Not Ready, Self-Test In ProgressLogical Unit Not Accessible, Asymmetric Access State TransitionLogical Unit Not Accessible, Target Port In Standby StateLogical Unit Not Accessible, Target Port In Unavailable StateLogical Unit Not Ready, Structure Check RequiredLogical Unit Not Ready, Auxiliary Memory Not AccessibleLogical Unit Not Ready, Notify (Enable Spinup) RequiredLogical Unit Not Ready, OfflineLogical Unit Not Ready, SA Creation In ProgressLogical Unit Not Ready, Space Allocation In ProgressLogical Unit Not Ready, Robotics DisabledLogical Unit Not Ready, Configuration RequiredLogical Unit Not Ready, Calibration RequiredLogical Unit Not Ready, A Door Is OpenLogical Unit Not Ready, Operating In Sequential ModeLogical Unit Not Ready, Start Stop Unit Command In ProgressLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorLogical Unit Communication CRC Error (ULTRA-DMA/32)Unreachable Copy TargetTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureHead Select FaultError Log OverflowWarningWarning - Specified Temperature ExceededWarning - Enclosure DegradedWarning - Background Self-Test FailedWarning - Background Pre-Scan Detected Medium ErrorWarning - Background Medium Scan Detected Medium ErrorWarning - Non-Volatile Cache Now VolatileWarning - Degraded Power To Non-Volatile CacheWarning - Power Loss ExpectedWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedWrite Error - Recommend ReassignmentCompression Check Miscompare ErrorData Expansion Occurred During CompressionBlock Not CompressibleWrite Error - Recovery NeededWrite Error - Recovery FailedWrite Error - Loss Of StreamingWrite Error - Padding Blocks AddedAuxiliary Memory Write ErrorWrite Error - Unexpected Unsolicited DataWrite Error - Not Enough Unsolicited DataDefects In Error WindowError Detected By Third Party Temporary InitiatorThird Party Device FailureCopy Target Device Not ReachableIncorrect Copy Target Device TypeCopy Target Device Data UnderrunCopy Target Device Data OverrunInvalid Information UnitInformation Unit Too ShortInformation Unit Too LongID CRC Or ECC ErrorLogical Block Guard Check FailedLogical Block Application Tag Check FailedLogical Block Reference Tag Check FailedLogical Block Protection Error On Recover Buffered DataLogical Block Protection Method ErrorUnrecovered Read ErrorRead Retries ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block ReadNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite The DataDe-Compression CRC ErrorCannot Decompress Using Declared AlgorithmError Reading UPC/EAN NumberError Reading ISRC NumberRead Error - Loss Of StreamingAuxiliary Memory Read ErrorRead Error - Failed Retransmission RequestRead Error - LBA Marked Bad By Application ClientAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRecord Not Found - Recommend ReassignmentRecord Not Found - Data Auto-ReallocatedLocate Operation FailureRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorData Sync Error - Data RewrittenData Sync Error - Recommend RewriteData Sync Error - Data Auto-ReallocatedData Sync Error - Recommend ReassignmentRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data Without ECC - Data RewrittenRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With L-ECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteRecovered Data With ECC - Data RewrittenRecovered Data With LinkingDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationMiscompare Verify Of Unmapped LbaRecovered ID with ECCPartial Defect List TransferInvalid Command Operation CodeAccess Denied - Initiator Pending-EnrolledAccess Denied - No Access rightsAccess Denied - Invalid Mgmt ID KeyIllegal Command While In Write Capable StateObsoleteIllegal Command While In Explicit Address ModeIllegal Command While In Implicit Address ModeAccess Denied - Enrollment ConflictAccess Denied - Invalid LU IdentifierAccess Denied - Invalid Proxy TokenAccess Denied - ACL LUN ConflictIllegal Command When Not In Append-Only ModeLogical Block Address Out of RangeInvalid Element AddressInvalid Address For WriteInvalid Write Crossing Layer JumpIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBCDB Decryption ErrorSecurity Audit Value FrozenSecurity Working Key FrozenNonce Not UniqueNonce Timestamp Out Of RangeInvalid XCDBLogical Unit Not SupportedInvalid Field In Parameter ListThreshold Parameters Not SupportedInvalid Release Of Persistent ReservationData Decryption ErrorToo Many Target DescriptorsUnsupported Target Descriptor Type CodeToo Many Segment DescriptorsUnsupported Segment Descriptor Type CodeUnexpected Inexact SegmentInline Data Length ExceededInvalid Operation For Copy Source Or DestinationCopy Segment Granularity ViolationInvalid Parameter While Port Is EnabledInvalid Data-Out Buffer Integrity Check ValueData Decryption Key Fail Limit ReachedIncomplete Key-Associated Data SetVendor Specific Key Reference Not FoundHardware Write ProtectedLogical Unit Software Write ProtectedAssociated Write ProtectPersistent Write ProtectPermanent Write ProtectConditional Write ProtectSpace Allocation Failed Write ProtectNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedFormat-Layer May Have ChangedImport/Export Element Accessed, Medium ChangedPower On, Reset, or Bus Device Reset OccurredPower On OccurredSCSI Bus Reset OccurredBus Device Reset Function OccurredDevice Internal ResetTransceiver Mode Changed to Single EndedTransceiver Mode Changed to LVDI_T Nexus Loss OccurredMode Parameters ChangedLog Parameters ChangedReservations PreemptedReservations ReleasedRegistrations PreemptedAsymmetric Access State ChangedImplicit Asymmetric Access State Transition FailedPriority ChangedCapacity Data Has ChangedError History I_T Nexus ClearedError History Snapshot ReleasedError Recovery Attributes Have ChangedData Encryption Capabilities ChangedTimestamp ChangedData Encryption Parameters Changed By Another I_T NexusData Encryption Parameters Changed By Vendor Specific EventData Encryption Key Instance Counter Has ChangedSA Creation Capabilities Data Has ChangedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedCurrent Program Area Is Not EmptyCurrent Program Area Is EmptyIllegal Power Condition RequestPersistent Prevent ConflictPrevious Busy StatusPrevious Task Set Full StatusPrevious Reservation Conflict StatusPartition Or Collection Contains User ObjectsNot ReservedORWrite Generation Does Not MatchOverwrite Error On Update In PlaceInsufficient Time For OperationCommands Cleared By Another InitiatorCommands Cleared By Power Loss NotificationCommands Cleared By Device ServerIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledCannot Write Medium - Unknown FormatCannot Write Medium - Incompatible FormatCannot Format Medium - Incompatible MediumCleaning FailureCannot Write - Application Code MismatchCurrent Session Not Fixated For AppendCleaning Request RejectedMedium Not FormattedIncompatible Volume TypeIncompatible Volume QualifierCleaning Volume ExpiredMedium Format CorruptedFormat Command FailedZoned Formatting Failed Due To Spare LinkingNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorEnclosure FailureEnclosure Services FailureUnsupported Enclosure FunctionEnclosure Services UnavailableEnclosure Services Transfer FailureEnclosure Services Transfer RefusedRibbon, Ink, or Toner FailureRounded ParameterEvent Status NotificationESN - Power Management Class EventESN - Media Class EventESN - Device Busy Class EventSaving Parameters Not SupportedMedium Not PresentMedium Not Present - Tray ClosedMedium Not Present - Tray OpenMedium Not Present - LoadableMedium Not Present - Medium Auxiliary Memory AccessibleSequential Positioning ErrorTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyEnd Of Medium ReachedMedium Magazine Not AccessibleMedium Magazine RemovedMedium Magazine InsertedMedium Magazine LockedMedium Magazine UnlockedMechanical Positioning Or Changer ErrorRead Past End Of User ObjectElement DisabledElement EnabledData Transfer Device RemovedData Transfer Device InsertedInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetLogical Unit FailureTimeout On Logical UnitLogical Unit Failed Self-TestLogical Unit Unable To Update Self-Test LogTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has Changedcomponent Device AttachedDevice Identifier ChangedRedundancy Group Created Or ModifiedRedundancy Group DeletedSpare Created Or ModifiedSpare DeletedVolume Set Created Or ModifiedVolume Set DeletedVolume Set DeassignedVolume Set ReassignedReported LUNs Data Has ChangedEcho Buffer OverwrittenMedium LoadableMedium Auxiliary Memory AccessibleiSCSI IP Address AddediSCSI IP Address RemovediSCSI IP Address ChangedRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureATA Device Failed Set FeaturesSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorData Phase CRC Error DetectedSCSI Parity Error Detected During ST Data PhaseInformation Unit iuCRC Error DetectedAsynchronous Information Protection Error DetectedProtocol Service CRC ErrorPHY Test Function In ProgressSome Commands Cleared By iSCSI Protocol EventInitiator Detected Error Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorInvalid Target Port Transfer Tag ReceivedToo Much Write DataACK/NAK TimeoutNAK ReceivedData Offset ErrorInitiator Response TimeoutConnection LostLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureErase Failure - Incomplete Erase Operation DetectedCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedMedium Removal Prevented By Data Transfer ElementMedium Thread Or Unthread FailureVolume Identifier InvalidVolume Identifier MissingDuplicate Volume IdentifierElement Status UnknownSCSI To Host System Interface FailureSystem Resource FailureSystem Buffer FullInsufficient Reservation ResourcesInsufficient ResourcesInsufficient Registration ResourcesInsufficient Access Control ResourcesAuxiliary Memory Out Of SpaceQuota ErrorMaximum Number Of Supplemental Decryption Keys ExceededMedium Auxiliary Memory Not AccessibleData Currently UnavailableInsufficient Power For OperationUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change InputOperator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedFailure Prediction Threshold ExceededMedia Failure Prediction Threshold ExceededLogical Unit Failure Prediction Threshold ExceededSpare Area Exhaustion Prediction Threshold ExceededHardware Impending Failure General Hard Drive FailureHardware Impending Failure Drive Error Rate Too HighHardware Impending Failure Data Error Rate Too HighHardware Impending Failure Seek Error Rate Too HighHardware Impending Failure Too Many Block ReassignsHardware Impending Failure Access Times Too HighHardware Impending Failure Start Unit Times Too HighHardware Impending Failure Channel ParametricsHardware Impending Failure Controller DetectedHardware Impending Failure Throughput PerformanceHardware Impending Failure Seek Time PerformanceHardware Impending Failure Spin-Up Retry CountHardware Impending Failure Drive Calibration Retry CountController Impending Failure General Hard Drive FailureController Impending Failure Drive Error Rate Too HighController Impending Failure Data Error Rate Too HighController Impending Failure Seek Error Rate Too HighController Impending Failure Too Many Block ReassignsController Impending Failure Access Times Too HighController Impending Failure Start Unit Times Too HighController Impending Failure Channel ParametricsController Impending Failure Controller DetectedController Impending Failure Throughput PerformanceController Impending Failure Seek Time PerformanceController Impending Failure Spin-Up Retry CountController Impending Failure Drive Calibration Retry CountData Channel Impending Failure General Hard Drive FailureData Channel Impending Failure Drive Error Rate Too HighData Channel Impending Failure Data Error Rate Too HighData Channel Impending Failure Seek Error Rate Too HighData Channel Impending Failure Too Many Block ReassignsData Channel Impending Failure Access Times Too HighData Channel Impending Failure Start Unit Times Too HighData Channel Impending Failure Channel ParametricsData Channel Impending Failure Controller DetectedData Channel Impending Failure Throughput PerformanceData Channel Impending Failure Seek Time PerformanceData Channel Impending Failure Spin-Up Retry CountData Channel Impending Failure Drive Calibration Retry CountServo Impending Failure General Hard Drive FailureServo Impending Failure Drive Error Rate Too HighServo Impending Failure Data Error Rate Too HighServo Impending Failure Seek Error Rate Too HighServo Impending Failure Too Many Block ReassignsServo Impending Failure Access Times Too HighServo Impending Failure Start Unit Times Too HighServo Impending Failure Channel ParametricsServo Impending Failure Controller DetectedServo Impending Failure Throughput PerformanceServo Impending Failure Seek Time PerformanceServo Impending Failure Spin-Up Retry CountServo Impending Failure Drive Calibration Retry CountSpindle Impending Failure General Hard Drive FailureSpindle Impending Failure Drive Error Rate Too HighSpindle Impending Failure Data Error Rate Too HighSpindle Impending Failure Seek Error Rate Too HighSpindle Impending Failure Too Many Block ReassignsSpindle Impending Failure Access Times Too HighSpindle Impending Failure Start Unit Times Too HighSpindle Impending Failure Channel ParametricsSpindle Impending Failure Controller DetectedSpindle Impending Failure Throughput PerformanceSpindle Impending Failure Seek Time PerformanceSpindle Impending Failure Spin-Up Retry CountSpindle Impending Failure Drive Calibration Retry CountFirmware Impending Failure General Hard Drive FailureFirmware Impending Failure Drive Error Rate Too HighFirmware Impending Failure Data Error Rate Too HighFirmware Impending Failure Seek Error Rate Too HighFirmware Impending Failure Too Many Block ReassignsFirmware Impending Failure Access Times Too HighFirmware Impending Failure Start Unit Times Too HighFirmware Impending Failure Channel ParametricsFirmware Impending Failure Controller DetectedFirmware Impending Failure Throughput PerformanceFirmware Impending Failure Seek Time PerformanceFirmware Impending Failure Spin-Up Retry CountFirmware Impending Failure Drive Calibration Retry CountFailure Prediction Threshold Exceeded (false)Low Power Condition OnIdle Condition Activated By TimerStandby Condition Activated By TimerIdle Condition Activated By CommandStandby Condition Activated By CommandIDLE_B Condition Activated By TimerIDLE_B Condition Activated By CommandIDLE_C Condition Activated By TimerIDLE_C Condition Activated By CommandSTANDBY_Y Condition Activated By TimerSTANDBY_Y Condition Activated By CommandPower State Change To ActivePower State Change To IdlePower State Change To StandbyPower State Change To SleepPower State Change To Device ControlLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackPacket Does Not Fit In Available SpaceIllegal Mode For This TrackInvalid Packet SizeVoltage FaultAutomatic Document Feeder Cover UpAutomatic Document Feeder Lift UpDocument Jam In Automatic Document FeederDocument Miss Feed Automatic In Document FeederConfiguration FailureConfiguration Of Incapable Logical Units FailedAdd Logical Unit FailedModification Of Logical Unit FailedExchange Of Logical Unit FailedRemove Of Logical Unit FailedAttachment Of Logical Unit FailedCreation Of Logical Unit FailedAssign Failure OccurredMultiply Assigned Logical UnitSet Target Port Groups Command FailedATA Device Feature Not EnabledLogical Unit Not ConfiguredData Loss On Logical UnitMultiple Logical Unit FailuresParity/Data MismatchInformational, Refer To LogState Change Has OccurredRedundancy Level Got BetterRedundancy Level Got WorseRebuild Failure OccurredRecalculate Failure OccurredCommand To Logical Unit FailedCopy Protection Key Exchange Failure - Authentication FailureCopy Protection Key Exchange Failure - Key Not PresentCopy Protection Key Exchange Failure - Key Not EstablishedRead Of Scrambled Sector Without AuthenticationMedia Region Code Is Mismatched To Logical Unit RegionDrive Region Must Be Permanent/Region Reset Count ErrorDecompression Exception Long Algorithm IDSession Fixation ErrorSession Fixation Error Writing Lead-InSession Fixation Error Writing Lead-OutSession Fixation Error - Incomplete Track In SessionEmpty Or Partially Written Reserved TrackNo More Track Reservations AllowedRMZ Extension Is Not AllowedNo More Test Zone Extensions Are AllowedCD Control ErrorPower Calibration Area ErrorProgram Memory Area Update FailureProgram Memory Area Is FullRMA/PMA Is Almost FullCurrent Power Calibration Area Almost FullCurrent Power Calibration Area Is FullRDZ Is FullSecurity ErrorUnable To Decrypt DataUnencrypted Data Encountered While DecryptingIncorrect Data Encryption KeyCryptographic Integrity Validation FailedError Decrypting DataUnknown Signature Verification KeyEncryption Parameters Not UseableDigital Signature Validation FailureEncryption Mode Mismatch On ReadEncrypted Block Not Raw Read EnabledIncorrect Encryption ParametersUnable To Decrypt Parameter ListEncryption Algorithm DisabledSA Creation Parameter Value InvalidSA Creation Parameter Value RejectedInvalid SA UsageData Encryption Configuration PreventedSA Creation Parameter Not SupportedAuthentication FailedExternal Data Encryption Key Manager Access ErrorExternal Data Encryption Key Manager ErrorExternal Data Encryption Key Not FoundExternal Data Encryption Request Not AuthorizedExternal Data Encryption Control TimeoutExternal Data Encryption Control ErrorLogical Unit Access Not AuthorizedSecurity Conflict In Translated DeviceXS_SHORTSENSE scsi_do_ioctl: impossible cmd (%#lx)scsibus at %sscsibusprint: qualifier == SID_QUAL_RSVDscsibusprint: qualifier == SID_QUAL_BAD_LUdirectsequentialprinterprocessorcdromwormscanneropticalchangercommunicationenclosure servicessimplified directscsibusprint: device type T_NODEVICEvendor-unique targ %d lun %d: <%s, %s, %s> ATAPISCSI%dremovablefixed %d/%s %s%s naa. eui. t10. serial. wwn.~ offline../../../../scsi/scsiconf.cSLIST_EMPTY(&sb->sc_link): %d targets, initiator %d, WWPN %016llx, WWNN %016llxPLEXTORCD-ROM PX-40TS1.01MICROP 1588-15MBSUN0669DEC RZ55 (C) DECEMULEX MD21/S2 ESDIA00IBMRAID 0662SIBM 0663HIBM0664H3171-S2KZ-CDFRSS2FQUANTUM ELS85S iomegajaz 1GBMICROP4421-07SEAGATEST150176LW0002HPC3725SDCASSONY SDT-5000 3.WangDAT Model 1300 02.4Model 2600 01.7Model 3200 02.2CR-2801TE1.07CREATIVECD3630EAC101FX320Sq01GCD-R580B1.00MATSHITA CR-5741.021.06Memorex CRW-26421.0gSANYO CRD-256PSANYO CRD-254PSANYO CRD-S54P1.08CD-ROM CDR-S11.70CD-ROM CDR-N161.25UJDCD87301.14ATAPI CD-ROMSCSI CD-ROMNEC CD-ROM DRIVE:260SPECTRA90000200SCSI opticalSCSI disk%s %s(unknown)%s: %lluMB, %lu bytes/sector, %llu sectors, thin, readonlysdattach: unknown result (%#x) from get_parms%s: WARNING: unable to establish shutdown hook %s: bad residual %d out of %d %s: block wrong size, %d blocks residual %s: bad request, must be multiple of %d %s: bad request, must be between %d and %d %s: cannot set selected mode TANDBERG TDC 3600 TDC 3800 ARCHIVE VIPER 2525 25462SANKYO CP525 ANRITSU DMT780 VIPER 150 21247VIPER 150 21531WANGTEK 5099ES SCSI5150ES SCSI5525ES SCSI REV7EXABYTE EXB-8200 263HHP T4000s ????TEAC MT-2ST/N50 ata_polled: xa isnt completeata_polled: xa state (%d)no free xfers on a new portatascsi_disk_start_stop_done: unexpected ata_xfer state (%d)atascsi_disk_write_same_16_done: unexpected ata_xfer state (%d)atascsi_disk_cmd_done: unexpected ata_xfer state (%d)ATA Port Multiplieratascsi_atapi_cmd_done, timeout atascsi_atapi_cmd_done: unexpected ata_xfer state (%d)atascsi_passthru_done, timeout erroratascsi_disk_sync_done: %s atascsi_disk_sync_done: unexpected ata_xfer state (%d)atascsi_disk_unmap_done: unexpected ata_xfer state (%d)atascsi%s.%d.%d: Port multipliers cannot be nested wsevent_readwsevent_fini: already invoked wsevent_init: already initialized wskbd at %swskbdread: evp == NULL wskbd_input: evar->q=NULL %s: event queue overflow ../../../../dev/wscons/wskbd.cwskbd_console_inittedwskbd_console_device == scwskdetwskbd_detach: %s didn't detach !wskbd_console_inittedcannot load keymapwskbd_console_device == NULL: console keyboardwskbdwskbd_get_mapentry: %d(%d): bad entrywskbd_load_keymap: %d: recursion too deepwskbd_load_keymap: %d(%d): bad entrywsmouse at %swsmouseread: evp == NULL wsmouse_input: evar->q=NULL ../../../../dev/wscons/wsmouse.cev->value >= 0wsmdetwsmouse_detach: %s didn't detach wsmouseusb at %sendtaskusbatskusbtskunable to create usb abort task threadusbtaskunable to create usb task threadusbpalock: USB revision %s, not supported %s: can't register softintr %s: root device is not a hub %s: root hub problem, error=%d pre 1.02.0usbusbd_desc_iter_next: bad descriptor usbd_desc_iter_next: descriptor length = 0 usbd_desc_iter_next: descriptor length too large usbd_get_quirks: dev == NULL usbd_start_next: pipe == NULL usbd_start_next: pipe=%p no start method usbd_start_next: error=%d usb_insert_transfer: xfer=%p not busy 0x%08x usbd_endpoint_count: NULL pointer usbd_abort_pipe: pipe==NULL usbd_get_interface_descriptor: dev == NULL usbd_get_config_descriptor: dev == NULL usbd_free_buffer: no buffer usb_transfer_complete: xfer=%p not busy 0x%08x usb_transfer_complete: pipe==0, xfer=%p usb_transfer_complete: actlen > len %d > %d usb_transfer_complete: bad dequeue %p != %p usbd_close_pipe: pipe==NULL usbd_alloc_buffer: xfer already has a buffer usbd_transfer: has old buffer! usbd_transfer: not doneusbsynusbd_do_request: not in process context usbd_set_interface: NULL pointer usbrefusbdetusb_detach_wait: %s didn't detach usb_block_allocmem: in interrupt context, size=%lu usb_block_allocmem: in interrupt context, failed usb_disconnect_port: no device out of dataiface desc0 lengthusbd_fill_iface_data: bad descriptor(s): %s usbd_fill_iface_data: bad max packet size usbdly%s: device addr %d (config %d) exceeds power budget, %d mA > %d mA %s: port %d, set config at addr %d failed %s: No free USB addresses, new device ignored. usbd_new_device: cannot find HS portusbd_new_device: addr=%d bad max packet size %x.%02xvendor 0x%04xproduct 0x%04x"%s %s", class %d/%d rev / addr %d port %d configuration %d interface %dNORMAL_COMPLETIONIN_PROGRESSPENDING_REQUESTSNOT_STARTEDINVALNOMEMCANCELLEDBAD_ADDRESSIN_USENO_ADDRSET_ADDR_FAILEDNO_POWERTOO_DEEPIOERRORNOT_CONFIGUREDTIMEOUTSHORT_XFERSTALLEDINTERRUPTEDXXX%s: illegal enable change, port %d %s: port error, restarting port %d %s: port error, giving up port %d %s: strange, connected port %d has no power %s: port %d reset failed %s: device problem, disabling port %d %s: hub depth (%d) exceeded, hub ignored %s: no ports, hub ignored %s: bus powered hub connected to bus powered hub, ignored %s: no interface handle %s: no endpoint descriptor %s: bad interrupt endpoint %s: cannot open interrupt pipe %s: port %d power on failed, %s uhubmixeroutvideolfephoneauxfmsynthuaudio_round_blocksize: blk=%d uaudio_get_cluster_nchan: bad data %s: error creating pipe: err=%s endpt=0x%02x %s: error creating sync-pipe: err=%s endpt=0x%02x equalizationi%d%s: no memory slinearslinear_leulinearalawmulawuaudio_merge_terminal_list: no memory uaudio_io_terminaltype: no memory uaudio_add_alt: no memory %s: ignored setting with type %d format %s: sync ep descriptor wrong type %s: sync ep descriptor too large %s: sync ep wrong direction %s: sync ep wrong xfer type %s: sync ep bSynchAddress != 0 %s: sync ep address mismatch %s: sync pipe for recording not yet implemented %s: ignored setting with precision %d bps %d %s: ignored setting with format %d %s: ignored audio interface with %d endpoints %s: no usable endpoint found uaudio_mixer_add_ctl: no memory ext%d-enablepro%d-modepro%d.%d-enable%s.%smutebassmidtrebleagc4 msdelaybassboostloudnesssel%d-mix%d-%suaudio_identify_ac: skip desc type=0x%02x uaudio_identify_ac: unexpected AC header uaudio_identify_ac: bad AC desc subtype=0x%02x %s: failed to get configuration descriptor %s: audio descriptors make no sense, error=%d %s: alt %d missing AS interface(s) %s: audio rev %d.%02x, %d mixer controls uaudio_chan_rintr: count(%d) > size(%d) %s: count < n %s: transfer count - frame total = %d uaudioUSB MIDI I/Fumidi: missing intr entry %s: illegal endpoint(out:%d) %s: illegal endpoint(in:%d) %s: disabled. %s: out=%d, in=%d umidi(genuine USB-MIDI) Fixed EndpointYamaha Specificucom at %s portno %d%s: lost %d chars %s: read start failed ucomstart: null oxfer ucomstart: err=%s , %sucomlkucomugenpoll: no edesc ugenpoll: no pipe ugenwrite: no edesc ugenwrite: no pipe ugenread: no edesc ugenread: no pipe ugenriugenclose: not open %s: secondary, not changing config to %d %s: setting configuration index 0 failed %s: setting configuration %d failed ugenBAD LENGTH %d Main bTag=%d Global bTag=%d Local bTag=%d default bType=%d hid_report_size: lo != 0 uhidev_intr: bad repid %d uhid at %s reportid %d%s: could not read endpoint descriptor %s: unexpected endpoint %s: no input interrupt endpoint %s: no report descriptor %s: iclass %d/%d, %d report id%suhidevuhidrea: input=%d, output=%d, feature=%d uhidno usable key codes array%s: was console keyboard : %d variable keys, %d key codes, country code %dukbd: %d button%s, Z dir, W dir, Z and W dir, tip, barrel, eraser %s: mouse has no X report %s: X report 0x%04x not supported %s: mouse has no Y report %s: Y report 0x%04x not supported ums%s: could not load firmware '%s' %s: failed loadfirmware of file %s (error %d) %s: ucode upload error=%s! %s: offline %s: out of paper %s: output error ulpt: iface desc out of range%s: setting alternate interface failed %s: couldn't get ep %d %s: could not find bulk out endpoint unibi%s: using %s-directional mode ulpt-hp1000ulpt-hp1005ulpt-hp1018ulpt-hp1020ulpt%s: got polled xfer %p, but %p already pending %s: CBI bulk-in/out stall clear failed, %s %s: CBI intr-in stall clear failed, %s %s: CBI reset failed, %s %s: CBI bulk-in stall clear failed, %s %s: CBI bulk-out stall clear failed, %s %s: Unknown state %d%s: BBB bulk-%s stall clear failed, %s %s: Invalid CSW: sig 0x%08x should be 0x%08x %s: Invalid CSW: tag %d should be %d %s: Invalid CSW: status %d > %d %s: Phase Error, residue = %d %s: transferred %d bytes instead of %d bytes%s: BBB reset failed, %s %s: BBB bulk-in clear stall failed, %s %s: BBB bulk-out clear stall failed, %s %s: waiting for refcnt Bulk-OnlyCBICBI with CCIISD-ATARBCSCSIUFI%s: using %s over %s %s: isdata not configured %s: command protocol=0x%x not supported %s: bus attach failed umass%s: Unknown status %d in umass_scsi_cbumass_cmd: large datalen, %d %04x%04x%s%s: setting config no failed %s: getting interface handle failed %s: missing endpoint urio: failed to set configuration, err=%s : failed to get interface, err=%s %s: device is neither visor nor palm %s: init failed, %s GenericDebuggerHotSyncRemote File System%s: no proper endpoints for port %d (%d,%d) uvisor%s: request failed err=%d udsbr%s: open rx pipe failed: %s %s: open tx pipe failed: %s %s: open intr pipe failed: %s %s: aue_send error=%s %s: usb error on tx: %s %s: watchdog timeout %s: %u usb errors on intr: %s %s: no memory for rx list -- packet dropped! %s: %u usb errors on rx: %s %s: reset failed %s: close rx pipe failed: %s %s: close tx pipe failed: %s %s: close intr pipe failed: %s %s: detach has active endpoints %s: tx list init failed %s: rx list init failed %s: MII read timed out %s: EEPROM read timed out auemii%s: couldn't get endpoint descriptor %d %s: address %s aue%s: usb errors on rx: %s axe%d: close rx pipe failed: %s axe%d: close tx pipe failed: %s axe%d: close intr pipe failed: %s axe%d: usb error on tx: %s axe%d: watchdog timeout axe%d: rx list init failed axe%d: tx list init failed axe%d: open rx pipe failed: %s axe%d: open tx pipe failed: %s %s: media change failed axe%d: write PHY failed axe%d: read PHY failed axemii no valid PHY address found, assuming PHY address 0 AX88178 AX88772B AX88772 AX88172, address %s axe%s: warning: Failed to write register 0x%0x %s: warning: Failed to read register 0x%0x %s: warning: failed to read SMSC_COE_CTRL (err=%d) %s: warning: failed to write SMSC_COE_CTRL (err=%d) %s: warning: failed to read initial AFC_CFG, error %d %s: warning: media change failed, error %d %s: warning: timed-out waiting for reset to complete %s: warning: timed-out waiting for phy reset to complete %s: warning: failed to set the MAC address %s: warning: failed to read HW_CFG: %d %s: warning: failed to read HW_CFG: (err = %d) %s: warning: failed to read ID_REV (err = %d) %s: warning: failed to read MAC_CSR (err=%d) %s: error: smsc_chip_init failed (err=%d) smscmii%s: warning: MII is busy %s: warning: MII write timeout %s: warning: MII read timeout smsc%s: cue_send error=%s %s: read MAC address failed cue%s: kue_send error=%s %s: warm boot, no firmware download kue%s: failed loadfirmware of file %s: errno %d %s: cold boot, downloading firmware %s: failed to load code segment: %s %s: failed to load fixup segment: %s %s: failed to load trigger segment: %s %s: loading firmware failed %s: could not read Ethernet descriptor %s: no memory for multicast filter buffer %s: no proc!! %s: usb error on rx: %s %s: too many errors, disabling %s: open interrupt pipe failed: %s %s: close interrupt pipe failed: %s extra ethernet descriptor %s: no data interface %s: no descriptor for interrupt endpoint %d %s: interface alternate setting %d failed %s: no descriptor for bulk endpoint %d %s: could not find data bulk in %s: could not find data bulk out cdce%s: udav_send error=%s %s: %s: dying %s: detach has active tx endpoint. %s: detach has active rx endpoint. %s: detach has active intr endpoint. udavmiiudav%s: upl_send error=%s upl%s: ugl_send error=%s %s: bad header (length=%d) %s: bad packet count (%d) %s: bad packet size(%d), length=%d ugl%s: url_send error=%s %s: %s: bad register %04x urlmii%s: failed to get interface, err=%s %s: couldn't get endpoint %d url%s: Invalid notification length! (%d) %s: close notify pipe failed: %s no %s: data interface %d, has %sCM over data, has %sbreak %s: no endpoint descriptor for %d %s: Could not find data bulk in %s: Could not find data bulk out %s: could not set data multiplex mode %s: status change notification available umodem%s: failed to set configuration, err=%s uftdi%s: failed to get device descriptor %s: failed to get interface, err=%s %s: Could not find interrupt in %s: failed to get second interface, err=%s %s: reset failed, %s uplcom %s: failed to set configuration, err=%s umct%s: uvscom_intr: abnormal status: %s %s: uvscom_set_line_coding: %s %s: uvscom_set_line: %s %s: uvscom_shutdown: %s %s: uvscom_readstat: %s %s: cannot open interrupt pipe (addr %d) uvsopuvscom%s: this device is using CDC notify message in intr pipe. Please send your dmesg to , thanks. %s: intr buffer 0x%x 0x%x 0x%x 0x%x 0x%x 0x%x 0x%x %s:notify serial state, len=%d, data=0x%02x %s: ubsa_request: %s %s: failed to set configuration: %s %s: failed to get interface: %s ubsawiusbthrwitxlwiIDLwi_usb: received USB_BUFAVAIL packet wi_usb: received USB_ERROR packet %s: %s error=%s wiTXsyncUGH TX UGH RX write_record buf size err %x %x invalid packet len: %x memsz %x max %x %s: %s: error=%s %s:%s: invalid packet id sent %x %s: already detached %s: open pipes failed wi_usb%s: could not get card cfg! unknown-device%s: %s loadfirmware error %d %s: reattaching after firmware upload atuatu-rfmd-intatu-rfmd-extatu-rfmd2958-intatu-rfmd2958-extatu-rfmd2958smc-intatu-rfmd2958smc-extatu-intersil-intatu-intersil-extatu-at76c503-i3863-intatu-at76c503-i3863-extatu-at76c503-rfmd-acc-intatu-at76c503-rfmd-acc-extatu-at76c505-rfmd-intatu-at76c505-rfmd-extRT5226RT2527 (MIMO XR)RT2528RT5225 (MIMO XR)%s: could not retrieve Tx statistics - cancelling automatic rate control %s: could not multi write MAC register: %s %s: could not allocate beacon frame %s: could not run firmware: %s %s: could not multi read MAC register: %s %s: could not write to RF %s: could not write to BBP %s: could not read EEPROM: %s %s: could not read BBP %s: timeout waiting for BBP %s: could not allocate protection frame %s: could not transmit buffer: %s %s: could not allocate rx mbuf %s: could not allocate rx mbuf cluster %s: could not allocate rx xfer %s: could not allocate rx buffer %s: could not allocate tx xfer %s: could not allocate tx buffer %s: timeout waiting for BBP/RF to wakeup %s: could not allocate AMRR xfer %s: could not open Tx pipe: %s %s: could not open Rx pipe: %s %s: could not allocate Tx list %s: could not allocate Rx list %s: could not queue Rx transfer rum-rt2573%s: could not load 8051 microcode %s: could not set configuration no %s: could not get interface handle %s: no endpoint descriptor for iface %d %s: timeout waiting for chip to settle %s: MAC/BBP RT%04x (rev 0x%05x), RF %s, address %s rumboard type: phyFLEX-i.MX6 board type: SABRE Lite board type: Wandboard board type %x unknown board type %x unknownOpenBSD/imximxiic%s: %d silo overflow%s, %d ibuf overflow%s imxuartprmimxuartattach: bus_space_map failed! console%s: can't establish soft interrupt.%s: frequency must be between 648MHz and 1296MHz!%s: parent not possible for arm clkimxccm_attach: bus_space_map failed!: imx6 rev 1.%d CPU freq: %d MHzimxiomuxc_attach: bus_space_map failed!imxdog_attach: bus_space_map failed!imxocotp_attach: bus_space_map failed!imxgpio_attach: bus_space_map failed!imxiic_attach: bus_space_map failed!%s: imxenet_dma_malloc: bus_dmammem_alloc failed; size %lu, error %d %s: imxenet_dma_malloc: bus_dmammem_map failed; size %lu, error %d %s: imxenet_dma_malloc: bus_dmamap_create failed; error %u %s: imxenet_dma_malloc: bus_dmamap_load failed; error %u hcintrimxenet: tx queue full! imxenet: packet too big imxenet_attach: bus_space_map failed!%s: Unable to allocate tx_desc memory %s: Unable to allocate rx_desc memory %s: Unable to allocate tx_buffer memory %s: Unable to allocate rx_buffer memory : cannot map mem space : unable to establish interrupt i.MX6%s: init failed, error=%d %s: data not a multiple of %d bytes %s: too much data %s: card is write protected imxesdhc_card_intr_ack imxesdhc_card_intr_mask %s: unhandled board imxesdhc_attach: bus_space_map failed!invalid capability blocksize in capa %08x, trying 512 imxahci_attach: bus_space_map failed!omusbtllsxidmacohci/d'(3     30$45123A/,('&" D  9%C@B  p  dKxK vKK 2KL  L4L tLL LL 2tt 4tHt x\tpt xtt  tt  tt  u u  Lu`u  tuu  uu  uu @y,y py py  y yy  { ,8{ h h#к|  л 1ח4 1(ؗH 1<ؗ Pؗ $ޗЂ Hޗ ޗ, @ T h    $ă     <@ pt  ܄  DD D    x  2 2(< 2Pd 2x 2 2Ȓܒ 2 2, 2@X  2x 2  2,4* χgZ\7|p*Wp!rbu#1.׽"Oo[H@(K@w[K0q*fȿt3|k(QHf Z(2vg#҉\d%Q  o>oQf.DhsWY˗u0O@"cb"1{O 1C "T<ek>l7. l$˯Ǻ+|e15 Oc:~mv5X$Ra9GBP./#H452;*!0Ok8<S3AA INIU%D&%2$tWs~KU aj,4NCsHa!]БB_IJ$ICy :w R]a_y V+./x)vw`5I;ܡuS_"0A& S*|!YQwm ^I*{pA0sT\#h |K_DT^:GÁrD< Hp bk:2a[eaXRLuFw]Š Gޱ"ӓag H^}/o*i) jׄ>˿bD-s/g]\WßG@x7 %H.Z)Wr-xrT8m0>r"C.V=\+2L NH@^_e"v%}IЭ7iTx[cLz&1;#KKU+Ȉ_d]>FbFWY95{a& YӝQ %o5VU4k*@r ... export VNAME=$(sysctl -n kern.osrelease) export VERSION="${VNAME%.*}${VNAME#*.}" export ARCH=$(sysctl -n hw.machine) export OBSD="OpenBSD/$ARCH $VNAME" export PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ umask 022 set -o emacs set -- $(dmesg | sed -n '/^root on /h;${g;p;}') rootdisk=$3 if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES mount -u /dev/${rootdisk:-rd0a} / echo ! : > /etc/rc echo 'erase ^?, werase ^W, kill ^U, intr ^C, status ^T' stty newcrt werase ^W intr ^C kill ^U erase ^? status ^T cat <<__EOT Welcome to the $OBSD installation program. __EOT timeout=false timer_pid= if [ ! -f /tmp/noai ] && ifconfig netboot >/dev/null 2>&1; then echo "Starting non-interactive mode in 5 seconds..." >/tmp/noai trap 'kill $timeout_pid 2>/dev/null' EXIT trap 'exit 1' INT trap 'timeout=true' TERM set +m exec 3<&1 4<&2 >/dev/null 2>&1 (sleep 5; kill $$) & timer_pid=$! exec 1<&3 2<&4 3<&- 4<&- set +m fi while :; do echo -n '(I)nstall, (U)pgrade, (A)utoinstall or (S)hell? ' read REPLY if $timeout; then timeout=false echo REPLY=a else [ -n "$timer_pid" ] && kill $timer_pid 2>/dev/null timer_pid= fi case $REPLY in a*|A*) /install -a && break ;; i*|I*) /install && break ;; u*|U*) /upgrade && break ;; s*|S*) break ;; !) echo "Type 'exit' to return to install." ksh ;; !*) eval "${REPLY#?}" ;; esac done fi #!/bin/ksh MODE=upgrade . install.sub while :; do ask "Root filesystem?" $ROOTDEV resp=${resp##*/} [[ -b /dev/$resp ]] && break echo "$resp is not a block device." done ROOTDEV=$resp echo -n "Checking root filesystem (fsck -fp /dev/$ROOTDEV)..." fsck -fp /dev/$ROOTDEV >/dev/null 2>&1 || { echo "FAILED." ; exit ; } echo "OK." echo -n "Mounting root filesystem (mount -o ro /dev/$ROOTDEV /mnt)..." mount -o ro /dev/$ROOTDEV /mnt || { echo "FAILED." ; exit ; } echo "OK." for _f in fstab hosts myname; do [[ -f /mnt/etc/$_f ]] || { echo "No /mnt/etc/$_f!" ; exit ; } cp /mnt/etc/$_f /tmp/$_f done hostname $(stripcom /tmp/myname) THESETS="$THESETS site$VERSION-$(hostname -s).tgz" enable_network startftplist munge_fstab check_fs umount /mnt || { echo "Can't umount $ROOTDEV!" ; exit ; } mount_fs feed_random install_sets finish_up  . .. bin dev etc mntmnt2sbin tmp usrvarinstbin.profile@= install.mdupgradeinstall  install.subELFa(4"4 (iiiiiSS==88pTTTۣeiiiOpenBSD -L0! MP@ -8AL4@ ` \p+  0/R R  /R0S000) \' P00<Q  A \ 00 W U <00S Pػ <, h0-L` 0 R   1S0B@Ct1P @D0t0x(<0< 0 R-L @ R0  0S00꼹H, 3 -x@x @0LS ``00T0H 0S 800S$0h|D,`$  p-L &0P `P dp&P q@POU8 & (4&PP &\d$T\Ti -PLU`p 0S /t0PPQ @Q qP P0 f&iidT\Td Pp-L@P`D ph$ -8 L@,9wPH   edAYY -LlM`KϟP<0: S@  S ,Ჽ@ppPP" @P`T#00D S 00N S0a>C"0@ @00@0 0 S (K@ tzj`T@U 0Dl 4h 0$c 0^$ZHZpcZtZZ -LM4 0 @00 ,K4$, pQ 0SgSQ kQL MbQ: gQB 001GQ< >Q-T0`0& 0"S V f7RF 0FSS4UWU 0 40XZ-* 0U0 4000@ P`BQ`T00# (K0 `KQ `mQ sQMQ 0 `Y0 40<0 כ0 40 қ0TZ[\[,[Z -D@D0L <=% 0(/0  /di[[Vq -;L M p 0 `T P , 0l `+GpT D0@2S2<D4DD(DDDDȑDDDxDD@DDD4DDDDDDDDDDĐDDDDDTDD DpPDHt:t*0S\UL:K 1D @Q00* *pɟ*0@s 0  0dSKAl oZL @] I0S<00S)0SڐL)ypX : 1p2 PXl2S 89,ɟ 0n)9WP \ \P1 &K ᚿpXr 5eP (ȟ0 @S Qc&ڔL 0pVǏV OL ;|p 0OPU`VD 2a,H0SA 0S0k'Q kQʊ :0007崧0ǟS7 R5@P 0!bn@kQʆ kQʄ 00LX Xp㿜\3XY00S 0060 AP06h60 c@P0606l0 AP0<6580+JP0550+JP05P |50 @P0H5uD,0HP00%0@e X4H0 @P0,5S$0 s4 4  IT FD4 K4 h"0SP P4 ΙL/P LxPX ݜp 4 R_LxPKPP L#$h"  nPL0h2 UIJdR?XPd2 BJ` mPr00hr`dRmP mPL#0僙U U0S"Ÿ0@ #"pr2L#00PǛ ᩛ0/m XL'>KTP 0S}H0S<p2( R 7B0SV;K' 0m0@0S, R( #]U[I倛Pr;0qL嗙z#L#qX 0 @ @  Pv10|Px$10wLX!41TlHK<p 4L P5 DL# @L#<L 0mlL#0˘L#+L#'i\+@l\l]Ȭ]8l4ll\\\8 0BP!0104Ÿ,&6 ,00C0  B 4@&(p 0S 4@80!@r8 \8 RP8K`P` 0l$&?=n @ < 06n,&0&@@K02 ,0 2$&?l0pP` 5 P0 @_i00: S 4(0Q(0Ugl d, ) (Ko]PD 480<, p 4@80  @^Y0l^^^ -a,6L R!x  P*c@P ,6& 0T?*0S< 0S RPQ0e Q0<]P 0S1] Q221,&6 ],&H0 0C0,&101 0 0C 0  嚖 _Y -QMLMO0|oP  PK@,0 J\/0@T?P@H0Aϟ0Q: P: PP0S RC.帯 0@0=>  @0A O6F& -_@)np`vig&p R07`Y$ 044| 57 g2 WV1Q5 q@l7g @`D.g-͟0U S 00 80eS05  gPt 0D e gX0S5C %BYࠃ@E00 ؍ 0c0bP 5 f % b  f P u $FDfe<`f< tL<A|<"3tK 0C8t 4 D , uP20-S) [РBKAL L P0 0$RpB.K0 B Bxpppp~0H50<$唋p $压ihiȬii+lhLiiti -LM@pP4 PP 0S nS6 =]`P00QD @ Q? P 0V0S D 0 YppV 0`pY" 0 0 p 0oSPr00 ,K, ?R0S@p @ `师0 p00V0"S 0(婈$P 0 0塈L/Hjdjjj,j -LM`PP( @(K,pK 0 g(0@S N$K' -LM0S S SL0 0@0(( Kh0hs|j| -LM0S S SL0 0@0(( Kh0hsj| -0L iidj -Lp,P`ET@P| 0 `$00$ (0@ -L`PVp$T@P[  0}p0  [mTN j -MLM[Pa `P LE@ SP $@TY  h1\P P@ $@TYK(PEPE)0pP00S0#3P PPPUp V V@唐PK 00 0iMVT   $@T(Kn`k k$ks| -L0 K M, 8$0@H @0 000 ?Pe bP@@  H$p#00#< 8 4 D 0a0@SM$TTTTTTTTTTTTTTT 0STcBd[@ P R r@P00SxRbRbRPP,`pWP 0  s00 2U" 0@ 0SZP $@T 0KLLPP4B80P  ! < 10D0 80080 4 H!Rps1 pR18 040DR0Q  R`Z00R00S< R 10S00S41AP P ,@P@@ 0KH<0S 00S  00 $0SVPHPA0pK  0KrP  lP`Fv@TLdU(Ks4kȬ+rLkDkPk+hk؜s inlk -0L cidk -LMP@`0p8h [U@ 0S T ړ 0(({蜹kd p-LP@d`P P@*p P@X@ꌆ -2L`M2\Ÿ\[\ @ll2` y$P 0 06yL/Hjdjjj,j -LM`PkP( @(K,pK 0 g(0@S ?$Ku{ -$0L0S ZEdTtlt -Lp0L0p3 P``0@@ PPkP P sP@ aP P ႗ph00STTT.DO< ,Iit,WgttȬ t -Lxl@-0 S R@4 00 ӑR^ ^R-0S \ Q-0L Q* vx rxvv -LMp@`  $KᏙP0S 0S $0 UR#U 0Nxv -0L idv -MLMp0,0 /ޖpI B0@3S3 p@lH0 T> >~> > .唖p. 0b0CS/[>KQ0C 0C Ap KAzPD?@T 6: S8  S ĘanK`F`F@ KpW@ܭP  KP @TDP w= =(=a\= x=t= l= U,=.T=P=L=|.8= 4C<X.D>=:<,5< .<<,< << < X< << < (< |ʋ  0I &R06 \4VD'D7U v@@^6 %WU  & 僐 b I FF0F@$F@J#&R 036 5%:W!vW pU71C0eP ?F71C0`PF@0F6&C#00R* FP Q F 6 S 6 6S< 6 AF6 S<^:;AFP  0&"1. `` cc  &  &6 R R  &AcF60#r0P`6 1 H$0@T~ ^ P *&R6pp 1H$P`P`V  t u3 R0S3 R  FP3T@1t K@ĕVȨP  XIP p *p R00Y0S 0rS Z ``? V5  U @ 7IP0@X S HP HP 0t Q  Yx^ \ P Q T e/P 00B0R SW 00B0R SQRM  00B SQG `RIpRGqaPB ? R.R<t300 Q &R&  5S 5SMKx Npp u8PU 20 @  V Rt `E6q0#0P` AtPit+xȬyLt0yxx p{$X{(,x0x48xx<@8x,xHl]{ x{z/@{\8]edAyLy${{x|d||} }} }(}@}L}`}h}idxLxD}}XTgfffP}Pt|{xxxxApy}Zyypzzzzd{Dz ztp}L{H|{YY,]{ 0UP &P v S{V&\s6 S F &Ts 6!&a 0 . `& @P 0 2" p0! lJ ^ 2 6S22S \< D2^0B0 D& R 0@, & l& lD6 `@P p! 01J@@T@!^4: Q0 &R0:S P03 83Q2S*& RXC 6Sh3B@6 L!!  +6R 00 T@̵6S%%R006  P0xc5 0S 05 Q5 6 % &6H嫵 QXQdl堵Qx%5嗵Q6S%匵劵TDP倵Q{ $PU , 0RS(K r (r]K@@d5E K@@5 E i#>pP9 &R%6"&  P660X*0 ^PPS00SB %5R> P;X9:@X &0ST#3*&p  6PX&  \ 6S X*cQPCP60U&00Q* ^ 000S 0@6 # 06U0$!4060 !40 4 06 0!4 0  40 ,40!̠!4!05#Ƞ##0  %$0""Ƞ"$ %@"̠""    $ !$ )0`X(00ST h8 4  (0p8 [NKR@D@D6([E '0S66 { &Sp 6P &}EGX 09Q  ( 520#$ 0 0 P0C"$ "40 && 9  0@!Nav. 4 0 %9R X2 5S X R 0SR0aA006 6 r0CC C C C CCCU B!!!Ƞ C CCC CC  0C0 [0C*00S @T SC&U0& U 0A Ah 68&BFP [NK@D@D6p+DGP cs00 5 % \6 S(+h 5S,+` 5S0,X %?RB5( c02?  5 % 7 Q`<Ps 5P n @ S%<T E I @ 6S FpPC&p<Q &Rp5F0%p%r(=R66  Qk T Ujd%ppp |0zp vpsp0oplpipTq 0ap ]p r&0Sp&r LpA YA6(~0#0P`6 S ^ʠ 6p0p5o+pp %prp'D -LM00PKpa@ 00p `KP2 `00PU4 @uT <T  0BS0^T0(@ 0 0 K?P@ -P0(CP0 0( CP 0`KKPӐ$K 㼥P@$0 R 00(@< ᾐ$幐L9}~ą P-L oot -LM( :CP( (( Q5 (Ki`P0 0S- =|C@PS 00$pK PcU% iU, lU3 oU: 1Q@ Q 0ShCP0$ 0 Q (Q K( SCP($00JCP($00ACP($0 08CP($00~,CPt .($0$0TCP@ !($0(0b{}Ć̆Ԇ 0-LM 0 P`寱X0Q @0D0 奱 Q}P@  8h蘱܆}$0 C 0+ 0| B-00 $0 0 0+ -00S 0 $: 00 $ 00 $: 00 $ 00S 0 < 00 00 < 00 0$ 80 0 ( =K 0  $0 $@+0S  $",  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P 0 0 $ -LM0@S 0 K0"0H0 00 K0" H0 0`t - LHPpot ( - LHPpnt 4 -LM K00"HPpt@ -LEhհ0$ϰL p-L MP@`0KP U0S00Kp ZpT p-L MP@`0KP 90S00Kp >p\ -0LS@ h?p 0 << 0 -@LU/O0 0 -@LU≭0 0 D0$ D0 -LM Pp0`-S,0C000P(K 0(P I@P  0SK0 Q0zC$u>  0 ^K0p4'> W ՟ӟ pG\W K˟Kɟ, 0R(Kp0S i^0b ^ R@ |W0S  dP^  L/ E80A$=@061U4  +@3'5# 7 U6 i@8  < S1x 5 U2     @U.  ., 0 2 *0S2@T P`K0 0d$> @TO0xtld0-W  R0Q4@eU   L@ZU _ 357 9.@< 9{ [ wU8 @8pq:dm <Xi F LeU;  ;8_ B ,[U:   9S@ U S?  SsGp ;X @ R @; 8  45 02  .st咬@t$+\!"0 04 t  2pPFlPBhP>dP:`P6X:i|Ќqp݉܉$4\%5aٌ%T5EetЉԈ͋(9 }%]݋܋̋,Ĉň-$4`،$U4Dduщ8T`p8H -0L cid -#L`M#0㘣p , 0x0 0S`pAΨP]=UH#嬇p a0@SVVVVVV|V`0`K1`x ` (Pxt KPCP4Kx ICPXqVP?> *Q-L QP!00P,v>P`V'=,$($0St$Kl0ST`h 8PT`P8P@`8`vrdADPedA0sd 0 p-0008L`@P0S pd v8P PUDD m8Pp(pV`WEVgdedA0 p-L`@P}P e/P 0 1V  phjp ]똵 -L─ M0 `("HPpP@0,  40 0 `("8@@p00@0N 0  0 00C 0SX 0KPl08#HP P0@@4Pa 4B0Q0, @P 0S# , 0S% ,!10!R ,1 RX, 00CS0W, 0 0(K h1,!` 0S Ƞ,Ƞ,8 0 00C3 0 01 0 0 0 00CN. 0P ("8 Ƞ @,HP``pP00@p@P,0`a 0p, (Ko, (KoȵDv - LM,0 3 _ Rp3 !hWd 0 RT 0 MBCD@EPF`Gp@ A0$ P@ P`p= 0 X02 R00CS00  0( ", 0 8 4 G<PP@ 0 T7B0S007"0002"000-PB0S00&{2~T`(@>TV;@TN1 RJ Df@0DS>e/P,`PI N0@PD0@08 D1 R 1Q0DS$@ e/P+/@P @ 00 0T  tp@ l[ \[ȹvȬ+h `d820P#! 00"8Q#(-0 P`0@p` P0@ ` R VUQ -LMPP`0 ` TP4`@p080 00 R0  ԛȺ -LM@ p^ 0P`PBT 0@帛 i貛(' -LM, (0 @壛 0p-)t 0喛`P 0p勛,K 0 XXX 傛8S P 0< 8PS$K8HT`  -l@LP20p pppp qPUC 0C`0A 1 A @TA R 0SSr 0P`@@0@0Q a f $0p`p@ p@ pQ  /,  11(x p1v X1l~p ``@PZ (1Hrd0S* 1(i[P0@`@w_K`0@a0@TḀpr?K 0S@ @0P `a K !_0B 0SKe/+S 08. 8giPdTp0T -L*MgKJ0J e/ ,0 0: P P P ; KAA  R PP[( K0S@ (K0@ @0@0 5 S:5 5S:5  e/ K e/K y:K@0@: J :   ᦛP $@P |$PuQUQ 0ApS4LdTH8(xHC 0`p: J@P 0STHK@ @H qdp 4܃PP  0 ሃ    Ke/pPA ?P< NKKAe/ 37 RR .x@      P  ǟ, 0R(KT4 47 Re , JP7ǟ e/NNK@D e/K e/e/K~ x l wUR l@Pl  0FG `@0p`p @TP0,,@ P0 0  0nU @@ 0 c5 R  [ ]WU $0N YK0 $[E PB > =: 7 3ğ$00s03S0勅' Ke/P NNK@De/ Ke/ e/K B ? <1Y@B P K 4 NP0s0 !40 @_ 0n m4 0K0, 0 K+P_s ,04  ,0 `0WPV(Kvv$vTvmDp 0-0L@T 500S ͖Pڼ 0P0# ;;S 0@ ḖPp0 @ L0P@TPs0D >4 03@0vvvxv 0-T0L?M0S@00S ?KK0P@D?+ざP 0K0vvv -lb0LPPP2 P@8"000"0P002PU GUE&Pڀ;;SB a 0"!Q8pPď AP01@P1+r0S! r0S r0ESPr0 SD{3 $1 xr0S tr0S pr0S  0@TT0 0 00TSPP T0 L3Lr|00t 3 l00Q PL63813vvvv8dvx -t0 0LSd0 \@ 0  R@P r$ G3vvv,-0 CR 0R0 S;00 p-43LM0S 3 3 330S 30S20S 20S  B2 R0S p2B*AP 0: SH0D@@h2@\20SP20S D2P}18@$2PK æ10S 10SA31 1 0Sx1 p1 RT 1 0SP1 P1 !000<1 RD 410S (1(0S V 0 1PU  1@ 0~0P `P 0 l0 B00 @00@X0  080] 0 Kpvv,x`Lv x0v|xvU p-LMP K`@CPlJ0P? T C ??T  CCh@}CzCL@ p?n? 0P ?Kpvĺ -L M0U@pS? 5 005 5 5 5 5 4 Qdt\TT$4@  $Pp0$1h4pG 4Q !AT2   Q @ Kl2P Q   0opqo0S  2 2P1  1X $2 21 2dPX L L D L ?+RX1 R1 1T1 AR;;S1 1* X P?+d1 X1 4X@1@T  ?D1@1@" !?;`00D@00p Vp ?lFʴ0 + X0 0?;0,0 X0 Kvxxvv(0LXtv m @v p-LMM@K <P=o#x0L 0P1od#l0X30SL30S @30S434@P D03@yPY tPT 20SP SN S" +0 %0#02NK0@D0CS0dblR@D0000|W0Pl@P8,[R <[SYR SR sR yR  Pe//1/NK@DpQ@D//0PP 1 1@@/x1  4<[S` PL/7 P8P($Q0S 0>00 x0P0 0 @0 0@@\//Kpv`U4L(vvdx,T| L<\lJv,v-0 CR 0R0 Sh00 -L%MMLEK@0@8%,0 < Pp0[/S !nK`F`F0ZD/S/0000Kp+gKP<%m0$$/#0: S .q%PP %P\40S M%P %\KΎK(PEH0PE H0,0 !`P 0S40SB :K<5@/Q  K<P .K @K1P`(6|#0S p30S  h0R,l0R830S ,\0R ,`0 ,h0Rʩ,l0R&PYPnK A #Pg0S20S& K91P!p"0S d20S  h0R l0R,\0R ,`0 m h0Rh l0Rd0S 1#1 00 R!0 I2P4ڠ<S S 0CSFP$#!(  .P, l0!(=6.#(V@P,`K  ,kc  0S 00S 00S  l0 (P d " (KD ,Lt<4x,$ -LMS 0,0 @Y`4$P^PV0,P#0 00R@0  $PZb}Xp,K< 8 P4#0S0,0  &P Y %P"0 SS SR P, Sl0"-;P,K> "h"0S , P. "n0S S 0<K1 !000@0P,K R0S 10S 10S  3d1  24 K,P 0S 10S 10S  0 U4KQPPQPP`!PB V <004X H00S!(Kx<4Tx, -bMLMP00S %P ;P ,00<Pb K @@ K4x -LM , 3S 0,Q, 0 SPWhPTp`P O, PPU@$P= P:W0S9 D,P p3S P 0!0# @ 1S#Wh0S X,pPEUH Oe,, wx|xx} -L M 0(K *P1`E 0 p @4 @0P 00p3P_PT+MV p \*0/S0C7SC-p 0RP`C!CR00 Q0%2>&B P`L 0S W*` P0@ 0P!00*0@00P*-S0!P \P0307 p-t0LM0@SP }~P`K 0Ui0S iKp蔻 -LTMpGPa=0`P`VUTSd@`@a pPK 0@<0PpK0@K* 0K-0 CR 0R0 S00 -LlMDŸ@Ÿ^ \P`p^q 1ip28KX*a=0  RQTSAAa  0@xKp1PxK0C@t1P[ 0P8 KP P8100CS (1 ,8,$8 #4a=0 xKh00S y V0 0BSRh  h00S [ 8@$K ,04 p-4L0S$1`@ PP>000-S 00 00 00S  phB 0P0P! P P00:U0S ll00:SLQ10 0 $(0z?Pp+Ȭd  P00x 0P-L 0S pPАРP(x,`P=@P  P|f2@P0VPPS0    Up 0S<xxP| -L g݊d -L gӊd -LlM@P㐀K/pJc@X`0@zP W0pSP  P 0: S 0( CVp$K@ -LM K` 00s@PIrF 0SC kR bR&mR wR!$+%$+*$&U*T'0@P 0 !$/UT0 0 @P 0xS S *S d1#pUT@P@P 0-LMK@ἫPP00S0#3 kVPp0@ 00S S00 0P@80     B@0 0 C8蔻 -LM8 8 4 /㷉/P800O0P|op , 00@JSrrrrrrrrrrrrrrrrrrrqrrrrqqrrPrr\r(qhrrrrrrrrtrrrrrrrrrr|pprpprPrr qrrqrtp0qDqPqXqpqPqxqqqrqp^NP 040 = ? = 0-S0S, n 0,0 h= 0m= ph-00|-Px=  @=cPYW H-00?<= -00-7 =0F,0 00=< Z  @P \Gp< I00< 00 < < x 0S80S50S-10S(  0R# 0R!  0R S  0R 0R   0R 0R\ppx,=x0x -L@p  Q.SW}p 0S0C +WP `Pm 0##!>C=S0Hcp0H S^,ę,,T,$,ܘ 0 <#d !>Cv.B B 0@<#!>C0   0##@!.CDR  k?C0  0!!!.A0r03 R0S )0B0@ 0#"!.B0r03R0S @ 0##!>CS0@ 0#!>C;S0pq -pPL 0Sd&/~`P00  S,UXB .UQ  a w PR00EU0@PS ZV 0SP00MR CR cR mR00000X5 $0` Rr9 0S P 000X% 0S" P  #000  0R  0R 0p \0P P0@@@@, <Xtxx 0-@PLD 0SA Q0SrP4 0#S \S0#S@᥹P@   # :8@$| p0Q0 R 0S  #P 00@ 00  0x=0 0-@PLD 0SA Q0S P4 0#S \S0#S@#P@  b # 7@ጹ|p0Q0 R 0S  P 00@ 00 = 0x=T -@Q@0@L@ M@!Qp$`K 0^0\$0 QT 0 K0.00P:$0 c -h LM0S T`p0PU 0 P` V$Kx -LM0S. 0p0`C 0PS1S x `F0S0S  0pGw ~0 (Kxxxx -L@`Tp# PU 0S 0S0S 0 PS 000 0HFx= -` L0S `Lp0PU p@-+TP` V y' -0LpW- 00S)00S% S# S! ; 0`@T h0S 0S 0R 0@S 00i y(  -(1LM0S`@ 10S 0/S BKA{_P` ! 0@0Q P00P  000p0 d0@傜PP T 01,0 0 0@嶡000$Kxxx -L@L0S < @00_P x  -@@L0S 0HP x=P -@@L0S 01P x= -@@L0S 0Pl y -@@L0S 0PU  y  -L M, P@`T 4 00 0 qP 0S 0S0 S $@P ,śP P `4 K  080 0 0@(Ko (Kx= -0L@pT` [QP 0SW u@P@00 0` 00@x=L -2LM0PS0 { ; 01pW@X ,  00,0 `P 0 S0 S R30`+ 0G0 0@S@,00I 0!`P< 0$00 P2 0@ 000 0 xP 00 P oP@00S0x@0SP +0 080( TQ(Kxxl -0L:P -1L@`Tp1 Q@@T PPP' ḚP  @P ᬚP ᧚P @0 00@$y ( -x0L@`TPp X AT DP  P:0E0@y -1L@`T_ 10S] 10SY; 0h P @U, L0S 0S 0R 0@PS  ! 0  S;00 S00000CS000SQPP P t0+0 00 @L00040 00P2(a y(  P -MLM1@Tw pP!@T; nK`F⼑`F0S!0  0S0S 1F|!  iP  #FH!^FP @T a= 0R0S:41`P% @ 0~Q  P a=0l0 00`E\ EL < (KyGyp 0-@LPU 0dPld0d@` :iP0PE08 0\0yGH@0y@ 0S P  PR00S0-SN S S  L0 00N L0 L 00N00N L 00L0B 0R00*0B00R*Pp@-^P`@L ^ ^ A0 00LA0A 00L 00LA 00AP @0@ 0P!00*0@00P*@ pp@- @0R\  0R: -5L~MP0C  Pt50SVPP P p-L`\ P0  @P@E"600pphN  Qp-LPY1S0S  D `P  Q@2TppP -L$M P 0'e,78 `0`0gSxS  |( @PT< Y pǏWX<@PP; 0@0 0 d0@000C Sl;A0,K ,0P0` SA0"S0A0U@tsVUVU 0f,0 @=l P 00000 0S S T<00xQC T4 P48<% ,P4@% pWXW  P*0S YP@ V/ 08s808@  /00@8 0K0C0S dd8d$ 0<S 0KS LS  d  $0  da4  | a=0 Qa- 1@a=0a= 08 0H1p30SJ0BPt -830(1$30SB,Pl 2b 0@ 2@@4^3^$*1^t:C6^ :K0NSmSt"`0:0 =0TC 0 /SP2) p0C `` @t4^  2** R @ 40@44!0`0R2^x!`0 :0 t1 GTh1   p0` ;@Qa=`00@ Q b͊K^1    `"a=0PHp D ` <@0S@pb0 @P  0HK``(KHp ldh0,4(  Q0-LP0S  P P  C@$T0 00P -LMpP# Q3  `0C`0K0C0Sd@"0@ "0@  d2   l2 tt2  |Ia=0 BQa- 1@a=0a͊b 0[  08P 0F5^9 1^ 2^.K0NS*1  *px1 )p0C CTQa=0`b 0 @Q K^1    *0< <0/S 0 ) p0C  Pa=0`@ <0S@pb-0 @ T0   0/S  00C0( dh,0 -LP4P -LP0P -騠娀Lp PP`P  0hdd T000CSH 0pu@Pxx --LP0M0 |0  t00S h@0S \0* P͔00D0D 4应 $ 㿔K(,xd` --LM(@ P  Ky -0- LP0M0 0  0P0S @0S |0 p劔00d0d TwH Uo8 $k tK0(,xd`` -D0L @R ,bP  嬕0 0 y 0-L@PpۖlPP \ԖX0P • <00S , K00؜y`y<(_M 0P Q0A000  B@ Ѝ 0-P`L p 0D  0O?0@@c0@0S@ 0 @TpS 0@S 0S  O0 R 0 S -L NzqDd -l1LM0l  y 0D8$  YhK0 0(0 0,00$(0480P@`p $,00< 0 Pp 4@`pPPp e @ 1Q0^l0  L00@ @Ll4L@T $%(KtL4@ -|0LM0 K 㢠@PPD0@ @W@G0 MKLl-0 CR 0R0 S䉓00 0-LM@P0>0 !PAL));L 06L 1LPhQ(LUTPE@H00S< K0h( K0h0H@  -@L0 0Q 0 $0Q0 $ hK -L@Q񟗤|x$LxLWQ6 (08@HPX`hYWUS0SO #SHFDB@><:864;0Q xtKlhd|KLT!PhZ=HX=0 $#$(,"(hhK Q Q  C=0STKhC <8#"h;K(4Pp$4\$HXl|$Hh,8H\p -3LM,MQ (K@ 30S  ld K(@T*GT IK@3(@D8#0 K(@*8K(HJK0#(@Db*)0"* 20S "*P% `V"4@P0 06 L2 0T 0("z KK(@(A* K*(@1 Ra 10S] 1K@1@P 0p` 06(J@P/1)K0 B0/0z9K00C/0=/0l/01/0 `/ 0 %K0L/0S)K0 B0/K 80  K(@ *JK(@D (K HxTP,Y@PHyPy8y@yd -@LT  p3p3znT -L$M@H <KL %H001@0 0T 070  L $(@PH @e0SD@ &0 S6 0 S pO 0 K0,0,<4 ,!4$ !$4 <,,c<0K0S@ P< 8 4 0@ =9< 8 =40 <08 P @@$4 pWş` P`^`0S%0S0S*0#|5 l R0 T,0 0 B0 00 0406  pL` 04!48#8D:IH 6I40S /0B/@P0 t"IZlID0dD C0RX5I;T4p0 S A$ I@PR I HPD` T#*0T@:D Q* Q:\30  0DP010UPL`LD lH H\@`Q p1:Q2 Q(HP@U@pA*A 0@$4,<4("4H! HPEU pGlWQ "0S3 㲏0 @R !@0PRpCV 0U T8 ᕦP 0{H00@pc@'U` PmH@*A 0@$4,<4("4[H! pUHPUh pG WdLHH!0S, ]4?H@p(;H0@PD Cpb@pG@p @@P^`0000S  ;C00  (KLT@B8yHyPy@yyP$y y y 4TXlt  -MLMR`p2pp ("(082800310 01!00010S 8K#80@,̠<Ȍ8(2Ȍ18.̌$< ,K, (0 41@PJ 10  P8#8 A$#$ :`00 /P00S` R@IJK$@D0@D0 `T H00PT   000$K yxyyL|hH%y -L78@:28@ 0-L,8PS0 R 00S* =00S0@  0;@P@\0t X00 c0BQ T T0 0 S@  7P0xT4y@y@B(yL@ -L@eM0   )0K4@ *@KZ(]P P  _p<|0lDK 1   /D0@3S*<<<<<$<<<<<<<|<<<<<<<<<<<<`<<`<<@<<0<1 $D ;R 0}0 ;! 0@00090: PW00d 00@KP P ,0 0<IPʟ@P 00?xP*:lsP  :3xP P h hJ 0#xP00X: *K  P g,  1夊D R k 0I00000 ]00z0 0w00t9 偊D |9RG 0lˌ 0mD )KR4 0$ 0]D H R0|(H0Kyp0<11 >D 8R 0|h(!p\8 0hSHXg s0@ 0@ 08 㖿Nw@a 00@P7`PP  0fOK00 ,qh7@6 0ST   D#F0S47 0080 P F x60! 0 Q:+<60  6 60<2S<&000 FP ,50000 0P BPD'E0@ 5 40K0 T5 40K   50<2S\%;0000U B>BS3  % 4E 40K00@000 ' 0)[R00@ 0  0 00  0400T40 ! 40<2S@K(P #K K0 KPRPtNF30 3@ *0K@@P030 X3@ )0K@0Pp30 3 00K P}BP@KP#<0K@P Po< 80Rd#80KPPTa0;CS08XTb,CP$#0PP 3QՀ"q"ۘ"`R0S@ 0D D@p a0 pA0 02qbPPHpKPKL`KD0 @0`0 \@ 2 X0 0    `K0"PT TK8 0z@P40S ~E:  P0  @ P R ,0S:V$h|pX y+L{Gz? 8,yAT?ly!4yȬ.AhH@TxX 4TpXy ( l?'@ TO -<<0SL`p@V( = T 001`P,*X# L0S'0S 0 T$0/S \0S /S   0S /S  \ 0S* 0` 0S3P)t" - @L R000#) -LM )AL0&`S B0 P!09 `0004 L0S, |1` t1&  Pp(0@S, , ,0 0!U A, 00C0S 0000V q0p    , 00 0S Z1014q0, p 000t"|y)) M-L SQ7JKII  3,p&0BO?  D80 hSRQ Xp<  0R0 80 S p tB, 0R(K| BnK`F`F@0 040($P@b&1C1/)1p@Y XP Pq\&T 21COP  pǏ R380S00  BnK`F`F@00 $0PP) P 6 #1@p$Q  $  R  $41 ~ x;PGvlV@;dt`Pp (($0P`it"|)x  -L0P"Sn@400!0002  0b1  44d1 RPe 1P1YKAh2@000 00] |&t&l|& dy&\N Ts&Lp&zDm&84041(a]&(?K P j i)Ȭ`@),)t"(4H)4)P)) H<"P))))))@D)L)+`ypX:8)8*X)xX wn\ -@L`pPXPU#!1S<000!0,!,0PU0,0 @W gP ,0PU0,0T!0>D!0 S00EYP7 @Q 001 R 0S R0S0 0S 0 0 S00ڄn x0 R l%\p XPHH D)4)|)()@)8| - LTM6S `R0,2$0T9(&Rژy,1 01`9(&R,6T K0CD0C4 4 < @$01 $0Y44Kh$ W*(0* RWQUPt60CO fN^KPEPE 4I( K@(4(0 g0d4 `D 0\4 XD V XpX `@0  ( ,0  Ti rk  m`ß  @$P  PpXBn, 0R(K"72V@(0,@ P|(~BnK`F`F@0 00Bv 6t( D0SkV(0EOo 0 5" @(0,@ R ` PkG(IcU rs   ~pE P 0!000p0C0@0 @$P0PX[{40$ P/  0:P ec P ! 0  0p0CX0)I P||=xNi)< D"L"0C It"!0СP`(0K\ XP T` 0AS<WWWWWW!0QMt R PP R 0S0S00  0P @`R*$K&   0h 0@ 0 P0SR@0 R*AL4 Q)`U))<"< xLl -QLp `<*P@@(*T` |X -LzMf0,0 KPHP00UQ     6Yf(pQ ,6& } P ,6 0&s &˻&ǻ Kû( 0R01K1Kl1Kf   0S*1  11( \* P00P0S 1  1pG1( \:6Q&00R 0 >.9! Q ! E 0!R!0P52 5:1  11^ʤğ0S ,6 1R 0l p :*JKJH$ 0 ,6 1RK K P$0Sh# 0 &+PM0S{ 0# 2&P`1!0  1 +d3 0ASdZZ]]]Z ?,1   1pG1[0S1 S,6!0  ,6!  iK ?P l2&1-001&LJP,B H4 iKP 1& 00&ᤇPA{ s"mo,6KQ01,&K p,6hAQ000E0S%\!)0 R !Q0 S  1R) 0`S KP h, 0R(K! |@1! 0 w000SL_HIit"),)<)L(4X)` 00 yyy0y0y -LmP  Q-L@ ްP T P-L LP  0-/LPM@P 00+8/00,+ +00 p-LlM/PL@P KB=P0: S Kp0`rS@; Ẇ P0-L@P0 R 0 R 0(0h;8t0 R0h0lx( H0 R <0<m(808i(L0c(yyyi --LM0 0 L --LM0 0 K --LM0 0 K -L@I h -LQMH0@K0<PP`pK<<P0: S V@@ S00S F`P<P$KDP T P`0 R000 ZK@w<P h1: S 8'(('y@L,< --LM0 0 從ALd@-@0 0   0 0 0$  (@$, (@0@, 0000 D@0HD LH0L 330## 330## 330%% t"p@-`L0(&SP d0 60PpP0\ lSQ!A\SQ0t" -T L@HP4T I f edAl -L`p@gPP  Ua0B0S U00@ S0a>C"PP R R4144!!0 00B S c. P 00C %`f;P0Fx3 @O&6F n  P' @06   )?P00`C ذ P-L@ 00 R$hk&@) -LM0 Z3 ?᪷3s ;@P (K謓k  `#3R 0X 0@cX, 40 弴"8 @0E8  OƉ 6F&V婴3 ($6壴 0( ૴"00ᥴ80S2 4 ,0|B 0S<PUL2   00  0 0 00 ,0,0 00000 330330 33033 @0L@0 D0PD00 550550 55d00d0d0d 0 d  `0d0 1 R0H0C+܃P 0 R04 0 / d0\%d0L `P@ 0R@X  aA% T8))H"X)t"SP"T",)h$4 -,LkM0 '@,0 7@'0PKAP6 ` :P6: S 0WPU 뼖P)0S 6 Rr 0|SPX%0Sr t&tPpvp0@P PPPP宮 㫮0SM PK P(0&&<0000PFU0S 0Se.K B BPT, 0R4(Kx5x@l5 RdU.3S0 ( @@%@Q$e $R3  !4P0S m$4 RxT$T0S|lF p$0S DP, 6S!@Ƒ` 6S3Ɠ,6@ \   0P VS`zP ` 00B10@3P TPCd3P H3P ,3P 6cS00 ,20!6 S 2" ثBӫ0"SZ PX %# F t6$hdP@6嬻L"L2?뻹g@@*1 Ra^p1OZP @0S@@0@S H6<4"D0# \P @0T!1##e1d#P#HC@#0$@# 1R  uiP")<),H"@)L)x))X)T"0))8),)t")P)p`h))())D"8"L"@"L,`?Hd < |@-0 @BTx00 Q< 1P 0<000  ))4) -L;@1@ 0-LMMpPANK@D0@D\ 0 Ҵ 80 ǻ 0RK0 Ci`*  -L@MR@  V0 0  $(K!PU1  00C0S  W0S 1< dK J0PX,0K 0d0 h T P @1TK `0 \ X T` Pp 0 dK:"0V0/ h ?00bh h  a0YV$ 0 `0 0 \` Xp dKx0 Eh P`  E0h R/  E:\`KW W 00@y)lJ -L=d+ -40L0S$00S  0 L282 0-L M@P 00S00S 0 QP K<] RP P *@KD ᒗ80 0QK#p$5 K0L282\,P2<2it, -L M K,0 AP\$0`Sp 0X000 P00RPPU@  S N  @A0SS c020 Kz, p-L MK,` 0 AP\0S M0V000 P00 R0S P0   PBL0S S c020Kpz, -0L(M08@K( p d0 \偯P0S@o( 80 000$  K,2P2<26i(,0, -L M0p$0 00|t0$K @.\$0PS` 840  0 . K,2,,0- -`L MPp@Kp P$卖1 @P\ 0S 0,0 $P#K/P2(-<2i 4- -LMP, 0P ,`p0  R100 ӑxRP 0G`p@TR X pPPJY t H0 0D 0s 0D0 V Y ^P8Z P4Y 00D ST00ӑW0A 200B SR0000ӑW0C00P\T00X0S '0PP0,0 @cT d@(Kht@-X-t- -QL(M5K ! ܧ00 0K  # eP D@0@ 50K̕00 (50K0\PnK/P2<2i - -QLM@ K 㯧 xPP K&@K4 ៕(0 1pC K-P2<2i- -|0L0@S h ? R00S L00  ϥ,0T, @00 0 0 002@242/y -\1LKMp@DK QZ0W@0 < /|P RoK`F!KAP /m000@pD K$0KpP  0Y$0 R  Q{0S 00S Q  R ("(04"40$] Kzypc--0 CR 0R0 S]00 Q-L X6 p`@ -0CU3@% R 0S,,\0SR00ӑR00Hӑ\@ 4 R @0 S0S蔻h  -@RLP 0S 0 TC 1@0S<p `(<\0C3@ R 0S,x ,~\0So|u\@ l R @0 S0S400S(>hT>hZ\--  p-LM*@KxPx` Gh @ڬpP  :0 01K̬p Kp/<2i -i - -L M K0, @Y$0 x\p  0806@K|P`x  `d @嗬pL  @rKᎬp0 K(z-$z/<2i -i - -LM"@K ܥTT0 L@mp [Q"0[S "0[ S K/<2i . . -LM0@KQ ᶥ!Ქ  P 宓0 @P Q- 0`p@P0S {0  v 0S-|-[0lS v P|[PU@K<+P2<2i,.@.T.\.d.p..  -81LM@8Kq`P  VV@! V/u8P  0㡳p@ 'PK 0P !400`wPh@P 0 y aeP  >$Kz.- p-L M.@K `P0 @啫p'  00SA[T[0K aX0SK XT001K,0H mp4^Kp/<2i -$z.(zi - -L M K@,0 0X$`\p  0 0@0P0S phϤP\0@Px`h@lP @äP,0@Pp@tP|` K@B.42./d2 // / p-x0LP5 @O T 10S T pZZh<vX7x0v</S`RV( ?@Ƈ묪d0SB0S 0B00S  Z5P "X00SL  8 Zx07D ph p/ /(/4/H/B@/P/\/`// ->ML@M|10ld@K PۣL ؑ 8kpP 0S=:>[KD@K$PE@PE >k ὣ ,P 0` 帑 KP \40S >KK$@D`@@DPq*0tS  XYP|@40HUZ<M$KH21<2P2i 0i|00D0 L0P0 -LPp`@P0 S@ZP 0S@ 0-@PL0 p0 }0yX0 -L`Ld00XoTp@Pp 4d 00 0  2 ,2t000 0-@PL0 p0 C0L&0 p-PPL@0S000p d00X L'<8@P`RPPPp2,200(10 -@pL`@1PYP@T* p-L$M@`P x <@K$ dP¢` ῐT RP@ 4` IP$:KpX1<2P2i$@+i$T+ -Lp V`PP h#d p0 @80 0P(@P|1D)1L/ -L@rD008 ,$00,21100 -L@UD008 ,s$00,21$20`2 p-L$MUPP& ˮ`@ C0P Q `Ὦ@T ѧBOK`4 3 0 |çt@K   %H " H嵧F@K    姧\@K    噧@K   勧@K $ l  t}pwp3`v`3   2"RS XZ 2SP=$$NW @[H T KNZ[Q 4Q.@K 㶠X7LPK mP0 4 4KK^rOK| ᠠ{K h,( ᙎ4 H+P[P Q[U$ @2+dVZ 01SW]K-K0  0S X3 Xph>,AT 1S1S1S(Q$!000C S0:S Q $ )WP$`T 0S,+,1VQV@P T "R0S x@0S,PK 2S*0S' ,0  {0 s0 l0dQh_L"Rd0S`2S |[`1P|!A t0l \P01S H10S  U|0 10S  xU00S 00S `p@Y(K/<2P2i i8i4iiiii$2 222i|2B23 33$3(3432L/@3H3p2T3`3p3333i 3L282 -ML MPDDpC<5< 850%,5Q$6 5Q15Q ,50S 6 KBr OK.ᅛ` ႉK,2L PB01S ,42Q 42M 42I 42E 42A 42@= 429 Z 5 10ST OK.D\ AK(1 p͡P01S: T7,"(2 4"02 / 3@ P K0 UTP|   K0 UTPf   g$K<2pX87H2P2"i D7X7%i `7t7Ii 777777777yQi 88(8080 0-LM 0 0 !8 a Pp8  P`!$0 Y,0pW @40Sڠ!0S`0 CR` #X0  @X0`!0ST`00CS`0<X0  X0000 S00 (K B@ Bp0RX C@0 R0 R ` 0BO? l 姃@P 0P 0@kX B00^$ 0@@0jDz2 X3343TA -0L PB idA p-LQP@4 `@q 0  00 R?`0 CR` X0X0@Q 0S q l0  0X0 R?L@mBQpp0R0 SwBꔻt03  -pL@P`nP`  p00pT@P a@Tl0 P @ \P@0㕓#PU`pW*d3Ad bȬLzh3 0-LM@P  K0K PP}p (00S K0d3A -L MP@ `$K 0PP\p $.pP 0 PPOp ,00S   Kd3A @0P0 R0 RP: -L,bM00  Cr r r07~0 Cr P .~1 @,K@<P3,PU 0 @  0 R% PUQ EPE <14101 R Q @00@S,^<(KJ00PY& }P @ T0 Rq P` \0@>AP 0004峹 $容嫹zzzCCC|1 -p-M L M0` R P  0 R 0RKp  \pT @ANK@D@D08 尊 $zizdCTB -LM0 0PT0<0@0D0Rp0!K800 S80[T<`p0Q80<`@pA(K(K<` 0D81 PHL P0@ =9@HL =CP00 R0 w40S)`p<`@p90Ϡ Al $!B30b ` 0<`@p@DTQ 0H` UX0 R0T0 `p<`@p`p<`@p\BC?BzD@BCDz -Lp`PW PPJh㘂@PV h ?` [D`P/ `冂PL z0Vd0PPPPPPP$0 ( (0S<0 0P000 P0000/ 0S0@ 0m0 |0dh PX |0$8 w|u|:|BDpB`D4DDD -@PL 0S@R 80PI.D0PdS J 0 DITEdE -L,M`@VPp 0S0((H0  vpH 10@<S<0&################## &#&##########################&##%#%######% -p'0cP1@ QP'W0S7  0S '0S  )K :G )C\7P 0Sq PZPL 0L <0 0D 4KP0Sz&0TP@ P"P㸖4KPU  `T0SH40KP Q ʶ  Rk 8&0S0<<&000SU&((\(\( 6 +%00'%00#00 %00%00 H lP) P* :P, )Ps P$5Pqn@@T 0$q0004 RT0SHV] P X0\Y 0SR`pPUoVz 4KQ R0KH 0S| 80@  S0S00$ 1H R; P R 00S \0S3 R(KP F-P000 P000040SV000PW0Q0QP ,0R  P  > RN$/L#b DKPEھ3[ L4KPU`|"QkP0 S00k,0@ cW P0@=9 =0v"00040A Q> $0< 0bS$080$00/RR,0Z00R|0S x`L0x!/P  {10SU0@lO0PdS 尐0H0 0:P)PD 0p VX P@ J(t DEzȬzzzzB|F:BFzFFl3HGMb4GG`GEEEF\FDFF -LLMsC0 0 "Pp Q20S/  0)SP`02 000 R%U ^ PO0PU3 ^ K.040K@0"@ 0RK"S  0)S00.S /S00Q  Q `0P0PU8PU ^ K.030K@0!@0!u0!V- 0S% ^ K.030K@]0@T!^ K.0 30K@M0!@y!t 00S@P ^ K.03 00 ]\00 0R\0m04000gx.^ K.08k30K@0@ @UiT99BGxG(HGlG9THHGHBH -L(M⼁A0@K$0 `q@0KP0d@0(P D0 `0@0 ) R ࠓ 0 .@0@@@ PP00 00 P0   DK+ BWP0 00 P`0P 02S 0TX 40$040 Q K00 R izp9BH:IzB -"L,M0P Sz 0Sd "P@PPP PPPP@tq8P`\: TPqpDD"P0KpBP_(@K`$)$ 0p8PU0)% p,` /P`@ : L0K0P < LP HP DP @P 8P 4P ppW t!10@Pp!0|1 0t1@0 `P `(K0}P,,!6p!0/p0}0P~ #p0 0 pp0 H0\ {{zXI:!p99x3T999B8I`IIxIKII0 0 :90S GS  -L$M,  (K  K0K,@K$ @(  SPK -L M@   (K K0K$ @(  @;PK 0-LMPK5PP@@T ۄP 0S|0P @ 55@8 -@@0LS  GS ,, i@0 h͂CI -LPM☡0H@Kp⌁P `(0 HP DP @P |P00 p 4Ο1 1 0`KKIIT] " 0@D j=P0 R== `0Q  Prl0 4S- M.K B B@@@@@F>K@0C @"0C D ;=Pp$0S ̟0 M 00 )pPps*,0 ̟ 0S  )d+0 R 0,00$- ANkP | ̟0Tt+00B0S |X[T+0 00000000`@o`@ T @D0XD @0˟@ 0\$ SE>K0C0C 5  \ )* 5\ pA M.K B B0% L* R44:0  4 4 ɟ: 5Pt0 ʟ$0R pspW@$R$ 4S #P P0s 00) /0:   ,)00P@@X04 .PH{ 00) 30 ) B0w{pP UFnK`Ft `FP@  0K<Pzp4 RzPwPp)U@ȟ0) h$R ɟ0RFNK@DP((0PkP7|x)0PbPǟ@)$ 5\ @VP[7)% 5@MPO#(@! @H4t~.`Q @y%@Tzzǟ0@r |g00 wlKIGK I0JPUW@T0S,0 p6@6x (K @hP KAPP(6P\Ɵ 04 H0K4 4KL 4 D Д -P %5 R `Ɵ0RP&p6 0 aBQ6 50S'PU p5 %0:;:0%0<0%0:;705EKAA P6Pş0 R `4 R$Ph%000`ş|5   W$080R$ $ N P,%EKAA P7ş0 R2 `4 R. 7$EKAA4`p0SN `4 RJ 3Pnt0P@0w 0Y 3ZHSU@t3Pڨ#000 DEKA A3@ R `4 R0 S 啝4#0:;80SEKL L @0$d$l R4"F>K0C0C"~ptԟK.K B B@@@@@@2Q@ N"0 :P0 }o02 ' "090C!070L2 0*4 !080!050!0@00zaEKAL L0 P k$d$0Ri 0Q0EK0AA `4 1@h 0S 0 R `4h$TQJ it[;;VȬ[X[ !;|[;YY4; x[4{@dU ;?.A'T!|UT d[[VU'l\[8;`[YYYl[;xWd{;WB8{p[<[D['uxX0{XX[x`U0VVDWLX$X+UUTYpYpX@UTULV`VW(WVWXWYXlXWXXY XW@Y({Yt[V1 *++ 0S @A0C2SFꀉlXD0lXD0kP "0P00L@"060104 0S"0<0"0:0"0;0"0:0"0;0"0900S3 3 0 4.0@>@$ 4 %FnKT2`F`F@P)' 0pD Pi}P2)( 0P`}P A30%P b ϛ3P-4@( 3P!(0  8uZ0S P3}Q0S p*|4p3M>K0C0C 5 ko$1 0`PAy?$4 ZPd ,$)+ 5\ |p4֝h$E>Kt 0C| 00) 0p   0,0Q @@$ yg5P @p5F>K0C0C@)& pD |P 嚝vIKK,6NLN L |X6 Rwu'$0p4 C@P6| 4 &S00  4). }|P ^0 Ps `) 0`l|P0s 0) `a|P TBQ 0)3 P|P 1p$啕PF.K B B Pz 巚忻 寚嬚 崻p$E.K B B % ) 5|pTCw\ 㒚}/t博|劚 党 做 }؜՜00k0g 00a w \ Yw$0S(P0屜8宜@嫜H娜P奜X墜`埜h8p噜x喜/$+匜)0 S -ˤ9ɠE>K@)0CX @{4x 0-8P8@L4 #an  0#Cdi4ZZ - LhZ -BMLMpP<|>8E04`00 ,0 6rP dP jP5`- aP* uP zP# tP#P, 000O}4 p 000C Sԁ0 L$Tp00S84@,0S 0KПP Zwpq 1 dR 0+S 3L4  L$ H@TPp00F S.VWppP`V@6JW0P 0p `mP_ 0RR!>C 2#=S0Vm@ PR긕ܕܕ`ܕ ܕܕ@ Td0 T?#C0 2#0@0TT!>C 2"0r03 R0S 00C0@0TT!>C 2"0r03R0S @0TT!>C 2#S0 0RR!>C 2#;S0Hx1@PQ0GT1pW*@10S HK⦷pLJ 1HPK`<K0S@<0 8@ 4p up( <K<@ 8P 40 P/ P %㛺HQ 0+SL HXä Y ` PzIP|㦘MK@D0L$TZA+[[[ZZZZȬZrZ[8[X[LN`[p[[C0 S S  -`0@P@@T0 LV <00S 000S.99[t{Ԅ -Lb@PD/@] p-L@lP `Zp p-2 B 0L`@0PP 0S00X/|2P $ -8L2@yl0P/S @P,"lP$2 B v30S ,,,, 1R_P @lP`F +V 0+S-S0SP*PM*P *_L10S I*PT1  @` PP_$P`T@D00S4PMP P100S 00St0Q. !')9s8P)PQ@pЄX]ԄLUtd]h]l]ĺp]Xfx]|{ȅ|] 000p` 00@`{ 0-L@PU0 0 hX`R -|@L0p0h  h0\0L h0D00 g0,0 g00{8`RP`H`@` -L@`0X gP0@ g<0( g(0 g0@<`RD`L`4`{ -L@$000P h{ 0 0S00gR0`,` 0 g,`R0 0g(`R00S 0 gT`R 0 g `R 0 g`R -D0L0S (0@ThVh{ꄅ{0 0bg`R 0 Zg`R -h@L0S X00SL0L H0Gg@00S40$ 0=g00{``R؅h` - 0 @L0 0)gp`̛ p-0PSL`0S <0 S @Tp{00Sg,l 0-0L0S0 0f|00Sp0` \0f\00SDP@o,0 T@J$0 0؅d`R\`{ - 0 Le hf$`R p-LM`[P& 0S0@ iP& @T P:j@}0\ tiH 00P (@K 0W i'Kp]{]] -L@P h}00Shdl` -L@P 0S0S00Shdl` 0-LP@P00S0hPd0l` -L `pP@P0000P0S00X -ALMP@ # P PP P P P P P (P |Kplhd`\KP 00 0000_]]]]]]]]] -LM K|oP![A[R0 @bP $}x0t8d P00TX0@POP }804%$ PP00Kht@]^4A^ -LMP3LE0PHKP @P@cP00 P00\-5@K 44444P4P4444444ŬPŨ40$4P 4 P4$0tP`4h$0\P@4P$0DP<$40,(P 0S$0030 K30S P 0S#0030 KP 0S#0030 K#P 0S  30 \C\S\3c pK LL0`444#43Pp   # 3Pp # 3 Ppze"0P00IPBYP 0S20 KNP2 PP0PS@  c|"  `U @+h00 0 P"bH2 K@-1 `P0`S@ 2  Bkc!  `U @h00 0 Q >1 @K1 P  `PPPp0P0ASP `100ST1  K^l`ذ^D@^<^ ^( ^, $08$^[`+g\`0``(^d`jh`,`{,^0`l~(`00^$`4`8`4^$}d<`@`8^XD`H`L`P`<^@^T`X`H^D^ _L^`d`8 `dP^`~ -2L,M0P t2pPpLPK `2`bX*0S HB002P2pR nP2 2P+ KP+ P1FP+ PA%P' KP<& P. 1P$ KP2P K P- P# K P' P X1P!              0 09[7[0@H 8@[0G  @0@ H ,0K1K+K.KX0,@L Kї坟0 K{ {_+D -PRLp@Y*pq P U* ( P pU P@DTUt`l`@ P@ P@TZ<U  i p i%)T^h^^^Ļ^0@-T0P?0" 0@0S0S0 R0t`00P $00SCt`Hp@-@00Sp($$,F6PI`pt`P<0 5-=?0S> 06S000{,0 0@S200 t` 0Pt` 0- L0S( 4 @ 0   0*X@0Q@ DLP 4 0T4X0@0h,0t`l{ -0L sp0q 0 -0LPU5 40 0@044D 0S%040P`0$44p Td$T(d,t$0@044D $ 0zspqh;(t`^ -0Lp`PP#[0 4@0$($,T044Dt T$F P 404(0$00 4sil{t`8 p-L@ 00s'0@{^ -4LpMP7 Q $$0R($0R,0Q00$:$($? 20€0 S 0S0,$R030 5: Z02Z00 L R 0s0s* 40S 4 3 R 4SZP3 3@ 40 400@000  T3   0 0 0 $4(D0@0 00 2$($6F`Ip\ 20S C. rs SʡR4S4S 4?  0trp@PqD4'W20dt Ÿ q 00010*b%pl P'71 4D0O4D0P0030d4tp10S) 0S6+K X&\qL10S@1wKNP(0 S 0S1 0S 0 +00 00S$00 S 0 0 0  0 0  02 0 ,0PG*0(Kt`{ H^{(kl{LTX 0-0LPU ,4S0C$(QP40@aP $4(D 0@$4(D0,40h0t` -l@L0Swp D0,$R0,4$4(D 0@$4(D0,4t` -1LpPW`` 10S CVYqr V0U00I0O,?   69F$4S4S  P4S* 4S&p" 0ꀀp 4S4S:AX0Q$(0<0@00,00t`H -LP l0 P 0R 0R Q0$4(D0,4t` 0-PL@T 4 m 04P X00S Cpq 0hH0 0@ p0t`Hp$ 0 010#tQ0S4:Ss0p 0 00 t p-L 000 x 0Pd `3PP @ r 0 04 (0$ a t ]^x`__00 , (0$0 0 0 b`bbbb0 0 0 bbb` -LMp@P `@_00C0 S%"0 .S0K0 $ K K` p-RL@Py0` AbTUp -LM`p$ @PL0 `p` -L|@||PM$pK(`K  ](0S0C(0 0$ 0b0 0R 0 000 Kbbbb` -LMP@p`a   e0` p-L@LMPK@%a`@@00S x` -LMP@܀,pK(`K, 0(  R,00# (000 0S( ,0S(00#D@(`K,PK 0S#@0 S$Kbb4 -H0L0S00@@Y$ 0@00`bbb -P1LMH!0SK$@K0$p,`K0PK),0S(0S 0 ,00R$ 0 ܠ p@4`K8PK4  80@00l?T 40S4 h0 c\0@d0 ]H,0 ( c,0 0 h00S C$Kb`bbb4 0-P0@LT0 0S0 <@/800 0P0s300b`b -0L M 0 PK Ѐp %@(`K(0@00l?T $00S, (0S ,0$0 ,PK(@K$ 0S$ (0 c,0@0  Kb`4bb p-LM@ 0S0 K K 0P 0 0 R0AR00S t 0 d@0000"`K PK 0S ʋ"000 0SKpbb4 - 0L00S Lb p-PL`@Y`0 Rpl00 AP@*D0P0A0Q: gp`b p-2b0@S2LTP00P P} P PS PMP $ Po  P> J1PD eP PyN{yJB00S SAA00 S nrQA0S0S S gQA0S\0S SXx1@@`1pDA00SG?/=-p1 1R0R S P@0S00S S ,P@0S%0S S!, 00 S@ #h@00 S 00 SS 00pPphp{bbb`b -LMPl_|||p`,K  ,P }@TP!,0PT@:0S0 0 0 0S{bb0PPb -0LMK0 ! KH _ -LF#P x0pq  T0 hH00S <@ N*.0S.0SPK !>P 5 P H>g P p>0S H P 9D>X P 8^0S= @T3$@%P\T 0S::PP>0S 0S9]>(0P 5A;}>`-0SD0eSKpd](4-@TD0eSe @D 0S Sf Sc S S/S 7S[ S00G.W S}dPx @,0S P0!W@  +W W R0R00@0#0<0WT <0WP <0WKF+Po@ @K0@0SP +aGQ0+tx;/$P%W} W W W !Ws W*W @W07S,g 07S+b07S ]*Z W W LP 0#0CS<P9&0S <P P )0K*pK*K 0K0 @0PuT 0DcSh\8@LDtXL,< XX0t,$@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ 0IRQ|80S0SL80S8t  2RQ80S0Sf +0S0S0@W70S 0S0S@7@  B 0S0S0@9 , 0S0S0@)60S'0S!#0S 0S0S0@0S0SnP60S6 $6  5@T 0S5 %0D020D0 50S 5RQ45t50S85 5{RQ44~ %# k0S0S0@!0S0@40S0dSd0@h4\4p EQP < :{0S0@(4 ; /,m!8 8KT%f{"00S0S00S00 0S0@# a0S 0R<00S0@52P0  0S2P0   ,Sl2 0S0@02P&0S0S0@JP iP P !r 0S0S210S0S0@P 0S0S1x18K80 b0S0S0@Pdzw0@ P P k{ h00 1! j X0H0p0PN 00PJ 00 PPE PC -Ab܄bbb{bl{|\p_t_bb_HeԅHtth ____b_ ``_ `4dX@,`bb0L X0p0P h00P t00 PP P : 0GRQ000S00գ?0O0 R0S0,! 0c0RQ\1h10Sp10գ?0O0 001 0S  0 `p10S !1 !0SY,00"000S{ -LMS0P`pYp (K0`!00 40 0@80 < K0 40P00S T AQ:0 6 R0S 08 R PP,00,0  ,0 P ,0S:<0S r 000 R00 ӑX 0e!0S 0f0@,Y: T00"! 0T S@D0Z00e0X,0 e0f1(Kth -L@0 !0S@-P@p`E5 p-0SS%0P gP' 00dP ^S0gS 0S 0S  0S  \:QfPd 0{ 0{ -0LM0@P3 00P/ 00P`+ P=pK,KUF@@ PP`  0@Sd`0dV0S0E@U@DPE,P `(K 0-LM@PK ^P8WP  0S NP 88 -LM@R,  MP @- R P`Pp WPڤ`0 C @R`0P R0  0S0@  0R@S  TP1:, 00L` - LPh{P` - LPh{x` -L h{} -LOph+ 0-L MP0S& @Ki 0s0s flP@T T0XP0 JI000 0@$0 0 K0l{T~bLTPN -@LPFl{ -L|MB0PP 0S U N0,K0 K00 `P@@00SpJ@VP82p0,0 A P8  8Km8HX 0 {HE HHZ g 8aP, 8 8K10SP ,"P T8K8` yPYP ,叄pZ(1 w10 @1 P0 , K{P 0K 0 0P@ HPF0 0R0 @yy0Ul00S(8K8` qH(Kl{nP~`p{T~bLTh{t{Ԅ[ 0-LP@6@P \P0h#0 -`LP`pW!&`V@ZP PT 0  0 l{ 0  l{ 0 l{ 0  l{ p-L@P`P U  P V  P php -L@~h P-L 0hl{ -00LP S hP~`nĺ -L@U 0r/S@ R -LlM|K@`P8K 0acK -L0P` -LAMPP2  0Gcpq) NK,ePKp@%`@ 0S PP  z 0S*# P cP` 0S:VK̅ -HHaLp@P#R %RT0TS 0S %R #RP I*UPP@ Rg묐0ਠ`P@#R %RU0US 0S %R #R P ! d}BT@ P R p{l{ 0-D@L0PS0P(000TP0~aa -L M`?, T@pP@0S 0S P W @P RX Y"T@XP@ d \00T @S P  d,B@000S0(K{{,a -LM@pP 0S `PKhFsT@pT@@L0H P`SxF /@rFKdc`ĺ4a -(1LMP, UARͿLpP; AT@>T@,;T~@`PZ0%S00sSZ,  S TS,TP@00@TT:@#FT o荿@a -2LM0S4 8 2@TtPP 0|S0P0@ 00 0-SP <SP S@S @p`Y0%S 00sS  SS@`00@ST:+PEUV 00S h10S@ @)K P $B)[280P40@p9d0p@d0S 00CS00`Ӥ0  ` V g0H v R @@~EeSp@`000Sp(K褅Lan -L@LS 0 pS` R0S000S0S`PU4SP@000S 00{{ 0-LlMKP P@0: S@@EK0 p-LlM0`0SP R@9 Pl@ KPPl00S0: S R*@ PM@, RPDKp踅~X~<00S,0P 00S00C~x'00Snl 0S00\` -Lp@P`WV 000CW`K@tPuZ 9X`yoQpWZVX (00S@ mU  -LMp`p@P qV i 0 0-t0L0Spq p@Pq0T0U0000H -LP  00SR -L@pP`\T p200CW `20SWD200CW @w$200CW uUV iUVP@ x1P @1@T@ ZZP`!hpP`qX9p4q2P P AP!<T 0 0S0uv 0 0S 0S0x  Up 00pWZYT+00 oZ 00Su~Xah`\ -LMp`gP P @;P9  Kihp@P(q&V 0A8P 00S BP@P 0p@Pq Kif 0 KH0PP~0PP~< P000S SP000S0~0~P0000000   -0L`Pp@nPP `VV'(` W  00P`p0@ 0 @ `000pW 000~~ 0-@PL tP 0T T00 00C0 R( 00C0}B0hzB0l{~~ p-L@Pq P`pvp P P@P40`0pi@Pp P P00x{{ -LMpXtWr`#0S PHC0S <#0 QPW 0@PNP B0S "!@ T T "06 P P p/ `B0* P 000 ,0 pu0 , 0KP0K0PK` p@ !0040  6` P P=ڄA0S9x!0S5@D 00< 80  @P(!0S!0S4@ 1@M P ` 0P`@DTʵ0@0Y@XW40K@Pp6T00S  000K@P*(K谅~ąd| -LMpwx 0S P#0S t3tC 00S@_ 0hP0p , @P0p P70 K  00 ,0 80K0KI0@K00  i @0P`Pڲɯ`V* @T PXW5p@q P P`pR0gt T"@lTP`80S4!P00PUo-[  ) TPPx1@Tl0ST!0; Pp@@?41P`@ 8 P?P`@0K@PpA00S 000K@P*00SZ 0 P` D@ P P pY(Ko(K谅~Hąd| -L MP`~, )P,0@cT D dqt@P X(Kopw0x0XW0@,@p(Xy z  V0 U00 1 ,0@c 01pP`q @,0T (1(,0@d@ 0@7pP`q XW 000S (Ko@00CTy h00SeD0@@\$0 0@@(Kha`X p-L`@PP } P p @P$00S ph꼅 -L`ppq|Ap@PqTh 0:UT0 haah -L MKWK  K p-LP phP`pqP0  Bph4@  B@PQ phpa -LM`pp@Pq AP |00Sh0 W V @P,0 $K!nK輅habP\0 0TSP0 H0 D0 @0 <0 80 40 00 00ህbbbbb`dbb000 @00X\d00S X00S P~0 @P 00 000000b\X0 0 bb -p堀0L@BPP B`PBPhz `K `KP`@~X\ Q-L?P=0@P60 `Cp) PP 0p V@P  @P@P 0`d0`FP@PZ<0000Y$000C0f0@P~X p-Lpq0 6PP-p@) 崠`t T 0 }@P00CV]P r@P@P0@`@40W 00 X`@P~X -L0<0  000 $00 00 $8 -L0<0  000 $00 00 0 , Pp-LP@1 00S PP@&` Rڔ@00SP 00S@@P @0 R 4000SP@p{b\ P-L0JPb P-L@ P0JPc M-LMP0X20 p@ 0(K=P U@P20S62 0@ (`K( PP P& (0 S P1P-!0 xA0(0 P (0 SPP b<1 F$10SWW 11 0(K(  4`P`00S 0@0@0@Tʐ0X 0 K0 0CphRd\0 0X0H0P0 0 0P  K`̅Xbb4~\ -LM0@oJ`p P@D\0@@0@T 7P \ 0  b{4 -PLM@`pS3 R 33\ ڼ0Sڰc000S0  R0  RtS(@K  00$ 6@ p,0 0l0+ 0`  0P0`0 2 \0S000S0 2 Ÿ0S#ڔ2 t2Rx2  d2 0TP _TPP^@20SPPX_TP@` _RP0P0P TJ10SnSSjK11 1 1Q0cڨ1!0\A1!1@ `JF`` 0 B\AQL!01`l  @0J$!00 0S10! VP`F(V(00S TP 00S STT0  0 -P(Kbbb\Xb{`bP~T4@̅ -2L M@xx2 0 d0dR R `, mH"0D"S PP(2  fP`p4 04 p00P`K 00WH 0SDPP #PpP3V!p0x!0S0Wp!0d!ӷ0P#D! 0P(!09!P0W!0P P  P0W !P, 0iSɟ@,0Y| T0  000 @ `@HH0T,80 0i `0 (Kbbb̅X\b -qL0PS`@ 0 2Pp1 T 0P0p@0`$0Q 0p00\p0p 0 ?R\0X0 00lW 00psp3bb{bd4bXb0b -2LM0PS`prp10S' 11 001st TS !0S0S1 @0t1 0l0 L1  010S (1 @ T 0S0S: p\ 000  P`0 Rh0P0 RQ0@^0 00 c$c(| Q-LP`pr1P PU 0 S0S:Q R`\ x1U 0Q 00X@R%Q#@yPE(`@0 /0`p9pq7  0@P Y0$X!VP"`@0 0`ppq 0@P U0T 0/`pc$$0S0  00mꔅhbX 0-T@L0S0dS0 PP(000P>000,|0|b -2L0`Sp pq WVP2 X 0S0S:0S 0S{ 1X1 0 0Q 0 @0S@T6S4P[1刡@0n0@P3pqI  0 W0V  0U5T30@. P'0帠@00@P Jpq R 0 U0T 0 Z 蔅c0|,| -L@P`p@Pt 0u 0 X00S L0XR@P*TU0@0 50SD|, -50 S  RD|a0@ S-00LA0@S0G4vyb 0-L MPP @K0 000K0l{ 'Pp-L7 $P'.P ^P"L1L!@00 0%bP 1 !1L0 0 0  P- 0s0sph0^ ND3s H3s 0@D3HCP0 d00@#L3800 `P0 -P phpl{4|a8|bh -L M@KC0s0s ?00@3KD|l{ -,0L R00@0l@Bh -,0L R00@0p4@B0P 00ԅP Ps 0 b؄ -PL M P P"P00  R 0ShX0RH0  80< (0K0 K0K0 0K0K0 @ K{{bb -PLM@) T TV\Q@p ` "00C0 S10R!@¤0,STT901 0b 00@0PK 0 0Sp` TCcC1` B@0|T @KTCaT B@KLC,0`04 B0$K$@ K~TPcL/cc -@PL ThL0 D6@4<2804.0,,*h@t{,cH4c`ccc dP, P P0ꐅ 0-PLM@& P P*0mS MS hS =S sS wS pP hPdP`P\PXPTP@4.808 0K10 dK0 P-L (0 00Shht@ -PL M0 " P P>00K.S K 000 0S0-0S $0 0 00S00K,@Kp AwB@P0t @0S  K0 4 CK,0K0 K@dpDd\dtddd -PL M0 " P P>00K.S K 000 0S0+-0S $0 0 00S00K,@Kp hA#B@P0t @0S  K0 4 CK,0K0 KdlddhddeQ PPP0SP 0 ጑ 0P$0$0S0Stt -LMK i K8e -Q0LM00SK0 X KTe -Lp@P000C0 S @ h,,@0`0 C0 ST e>@DT  0@TU0 `0 p-L`P@0-S000C0 S ph!!00 C0 ST00^ap -LM 0R0*, ,@0* @pexe -0Lhd -LPPM0 pb @`V0@ , `,KWV0  , <,KM 0S SV000S`B V? i 8 fV V V 0 1 0 0s03 V V V&@  00 0FSPV V V 0K$ KO$0S0f90S V0V 0 @00SSS 0010,K0,0 AV 0 \0   000CSF4GGGGGGG KeeeeeX -`LPpP`$T X @P$T T T-T00@f y 00P@T -L@0 ?f -PLM8 B Rp,K4K 00S S 0 8K@h2 @9P8@ 0Pz`#80 %5*$P  P P+P -PnP! `$0+SX080 p!000 l, 8 0+S0,0 G1[X!0Sn`z`@YPPT 4@ q,p 000CS9KLLLLLLLLX@ 00s03X@ 00$aFQ 800S8 80 S  08 800SL0P8K @0S,80Pi(Khh{t f< S 0 Q $ 0S C x -LxP 0S0  @刐匠匀pP`0S dR`P PP pP R000 $@$ TRPft`f|f -p@!`PL>PQ > 0> 0> -LM d 0 K p-LMP`d@;002 0@?Kp'@B -LMpA)`>@>@@/0 P`%>pc -LMKg K -锠PLp` 0@SP0000ST0S0#S H؄ -L P P Pp h -0LMo@p@`!0K!PK =; 000eR;@PV-00e + K -QLM@Pp@tPp0%0K%`K 0B00 f=0@PW-00f +$K -QLM@Pp@tPp0%0K%`K 0B00 f=0@PW-00f +$K -\0\0L@S L0 P1KP p> 0 0  t{X 0-L L0PS000@00 R+0 P00 0 ˃ -L@0@S -LMpP`5K+%P0 p`$ pnR sR dR @`0@SP  = 06=`P K 0-0L0PS@ t00S P0@0S @00S i$00S0 Z0t{Ԅ4X 0-L@P\D 0 0܄ p-0L0 S P` 00S 00S 60@@ct0P0S h00S ph1XJP0 @@@400T,0 pht{Ԅ,4X -0LM0  l0 `0Pp `K  0T0LPa@PJXp3 -LMP @` <\Q  0R QW@X@T11: \ 40Kp3Q 4 ,0 0 0 00S0!P$K -@LPZ00 -0LM0@SpP <q 0Pn@ @X`P .4@PVZ@@U.pop p p @00C000C 000C?0010@-<0  0{0@P4 p 0q-  + Q 0%P#Op@q 0Q 0r S 000 KP nP808 PHZ0P:j蘄Ѓl{dn(0$0 0b0c0AV4, -p0p 0LS@ 0@s@3H0H0@0<0 80b0cA6$0 t4,0& -XLBP@L>D;<8804400,0(0X\\\[[D\@-p^ 001`0S10tu 0S 0Sqr, R*Q'00S  0S qr 0S0S:\^00H00S 0S000s3舅x{{4 0-L@PF<0  0S0S0 R0  -0L  0SWp3 -L  hĄ-  0R 0RQ^  QP 0 0S  SR 0 0 0R 0R "*00 0- LP@* R  0@ 0蠄 4 -@LP)00h.$00S0 0  괄p -@Q 1LMPp@  PP)0T0  `Kp@&7P@ p 000  0S : L0R  @00S 00 0 0 踄tp 0-@LPT 0S$  0 0ĄX -LM` 0 , R\4 ԠP 0R0pK0 0f 0O 00f0pK0O 0@ @T U @  0d 4PP(K踄4 -L@MP`X T0 c@P <` @p < P`00X r T0s  T@0TX\00 Q R` 0@0C 0 , K00K p 0@, K00K p 0@P`wx R@0K0S @ 0bS0c S  0>PB0SH 2Q H l20SHH  S H  H QH ,B00SHH Hi@L H@D ,LD 00K@aP  AP 8K00L 4@K @sP ` p\XPB H008KL 4@K@ WP3 PQ 4H@8D00L  @"AQʸ00S C4H@800DL  @L;(D9(QP 0 `L/(D-(@@(K̅Ą  -L4MP43@(3$H D @ < PP Z 08 40 `8 4 8 4 V8K0`2pq tu Q P`2YXtu 42 0@_` pH D *tu UT@P1 0@_ QP1 0 QP`p` p`VpH` Dp t u  80s04q 00 4 U80T8@K0t u U0T00" 0 0K 0 )Ph0qr ,0S00S0K@ < 0HK@K 0(K蠄~ -LLMvwJ 010 @0R0 , (Ko00S )p@Pq , R00Sp q Q0P 00 }8 00CXZ (Ko(Kx{{` -0L0@SPTpW"0000S　`{pI@tPq AcB`00CV0p` 0-LM K @K0tu  0K0 -0QLMp 0S#BP 0y:*R B0S 0S"0S002 d P\B0S vH2 V0S YP `@P1p@Pq@P$10S S  1 ````KV@P 0@PLa0Z @Pt u Z J@Ptu t,@ (P u(y$,K  0pP h00S00X0S  D0,K r $0P$K踄oo܅ho -L 0 0S0 h谅 -<L<P(h+ 00s030h긄o 0      ḄĄ 000 000 000 -LM0 $ KK0 0 FP$ K -@PL \TL h,}D}\} -1LX@ @@ 6W㢞~0  @`Pp0S0S 0` 0?0080  W000S iD}X4܄Ѕ -LMLp`KP p@P0[SPKT[  - LE= P00  -0L idq -LMP@P 0S 0S1 S K R3 rP 0B?SP (KdP (0Sp`$K $0(RpQ QP` oWQP00 -L 0KM#++ -L0S #0@S #0P<00"P ~2 0@ R80 4@ 0  0SV 40K,K80 6PU( k@ 0T"D0 @@ 0<0 ``2`@0 DKP00"P P A0T~A0  00 [L0S1 RC x3~DX ,0KPXΠ[0,4"400 0 0D (KQ@P 0 //t!`_P:0@P PPP }}H  0 LP`DA @2@ Tp -@LMh %Too`p20p0`W` KU -LM @`, pm%` poO&>@P2Ό P, 0U@(K -GMLM䐟0,0 qoK 0P@TUt K@PLL 00npK`2@PΌ  0`0Vp, 0R(K倵it -P<&> Y0L\"]280` R0<2<… 0S30@20D2 叏00CL2 0 0CH20P20Tr( $@S 0w&X2g0`TX2i=ST0S0@2U܆ D _R 0S2! 0 tĈ0S0?S4 0S 0S0?S0S -!0LS PU  0 0       0@PN#@cH#@@cPE@>#@Pc8#PPcP@ -`!LQp 0 P 0CA2$,0 %@$U00e0PDR00e0P00 -LHMpD W@ !!8 2@  `0 @Pp1C4p 0V< 8 `*`p,0 <040(@00+@P 0@<P 0 , D 800$a(K CA(Ko=|4l M-Lx0\@ P7P3!0SS`p P4 00 ,?0"10  !00  0,?0"100P0fY(Kx0 P0\0 0     !0   PՅ< -L @ p ?  0 1<00 `! 0! 0 ?  0 1<0PP0 P`| o -L M嘅`Hp  p⩓`W` 2QPY.EEwOE B1 @@P@啓^WP, pl`W` Ktt 0-LM ,P@$P | p0R dKgqp PҐ@P D0D 0}  +88@P؜@| -LM040K00 m,K0 @,P\`  3(K0pP 0 ,Q 0 x "10 0 d @T1"0 0 0@1!T$기̗$ -LQ @  QL -@L K" &> 彄UX -L4M0t(K(0 (0`S $pK0 pQ$@\P  峒 K唄0( p:$0`Sp ( 園P# 2pL`K2A@ @N P0LK000 p기p -L -L!M(1`"( S92RS]2S\@pAP KP :/0p Q 00`( 0R $K@0OQ@iؘ8| 0-PL@V0L -L MP$K@p`0 $0S   K"100!aRRl@0S`VX幃LϑD̑@_ ?0ꐘԈșX -L M`(K@0 @(PpU  `墑$K A2@ @ 1Pꐘ p-`L|yP @ ;`P 4 8$0 $04 @4 4 '4 $ 4!00 4 $0@'P l!P0PP D K<4 ,4@0`pSp@0 @HLD 4@ipP3H 0c40l@8T4T3P)`p@P 0 S 00KPX#0S0#3 K~PP   M'PU<0@S@X00SX00LS  %H20S\"0000SD"0000S 10S`\B\TRD2p` (",0QP "0B1 ,;P ! 30S:S0S6R) 20SQ b 0R20SR |p2 2R T"&p2HR 0R08 KPK:r D2b PKR8 K-i00C020S 0S0`KH Z\ 0S00R0S QPK000`` ``` `P 0S!0S D10S`10S h10S`@[ X`X`0K 0C;QPZwP -P PI w嫨0%dD404 oL1 i404 eB.K 1 B B]1 W404 S05 0 L404 HIKAA5p U44 V44 Y40D;0D;4 d0%HC0!8+F ,'FiȬHp0t tDt+Pti -LM@pP4 PP 0S nS6 =`P00QD @ Q? 9P 0V0S D 0 YppV 0`pY" 0 0 p 0oSP w00 ,KWy, ?R0S@p @ `OC0 p00v0"S 0(@C$P 0 08CL/Hjdjjj,j -LM`PmP( @(K,pK 0 g(0@S $KwE p-0LS`p@P  P0P@T@T  TPP0  r 3R p00 R P ei`q 0-LM@PP 0S TU6 80K ycpE4o -PL`p@0   0@ -4LM@4T, 8 <( @  @T  P@C BK3APAD  0`D#D80x3P| T  YゎKH p HPdp4  $>@P 0GUE0S -SF 2 1AP,@Pp!8R00  @2P"< D8W@@T p]BOp@( P" Y @P1 @@, 0R@(K2p`A=P0P0P0, yBY caT p ~KAA@(囄P008#4 P@ N8 bjNK@DQ@D8(FB0S 0 Vᎂ[u0S 8Q0B-BLu0S 88S  XBPBiDnnȠL/0oРԠppcqȁ -L$MDPK`po4P`P <0KD0 @@ 8PAA -0H +0K) K$`p; T0L%S񟗰HHHHHHHHHHHHHHtH,HHHHHH,HHHHxHdHH,#000C+K *KH#_p30V1P@`P@   0] Z P@, XP HP 0P p@`P P P @"000s20K ap `B0 00cX2P R^ :Py 00@Td@Ta  P  C1 ڧ!00070SQQQ4 F 0SC nS 1 4@K t!,h`PPHP 01(D10AD0 @@ <0 8@ 0oS1 4@K 4 | 0PoH0S @H`K0 0 (K PA@B;@|8@ p4@(Ȭ\ei`qq+PidpL/@|@mPmX00 00 -LCP _B Q-L@ P T]NB P-L P AB 0-/LPզ@P 00+8/00,+ +00 p-LlM/Pᶦ@P KP0: S Kp0`rS@ z P0-L@P0 R 0 R 0H0h  t0 R0h0l8 ZH0 R <0<-808)㫦0#i --LM0 0 㒦 --LM0 0 K --LM0 0 K -L@r徣 h -LQMH0@K0nPP`pK<fP0: S V@@ S00S F`PPP$KP T P`0 R000 ZK@7P h1: S 8囁((|s吁@L,< --LM0 0 ~d -LM @Tp`P0S   0P P 000$ -L,MD H &L0 0@  0 40 pP @@Pl HP U@ `0YX 4\{ V 4 R08  C@Vp<@ 0S00C S000C S BV0VPpU @ P0S PUWP80 0 %0 00 ğP0P00 @TT@TQ -P&_P@PX! 4  Y4 @0T l`VR hƀ @T P@T HY`V$`>SVXg 0 0(K4 妀k `00 U  0L P0 I @8 <00  0@@30f0cß`D0S D0XX @T` LP@ 0 ,K pq Ÿ@TM@TJ 0P,@,4pp PB ^^I R0000 0W G 0020 0  0PP2  A R00C0VV X0Q1 `V` 0S 0SLP 0 YtP^ 0`, ^^  0(4Pp0\/ @T3 0Q  0 P 0@TRf LEPa 0 ||^0 F0 ,$ xtPdd$Ȣ]L0$D -L@ P 6? D -PL` @Pp 0eS P  0<W + P#%?+@ pPt  00  4P H < 8 aP, ePdȨ p-L@lP`P p@> ?p$ $00 >pn g8g -MLM pPNK@D`+H 呓p 8>  0piRI}>$K  P-L   0 d|di0 - M DLM`pP % $% % (nP& cP# VPeP  mPqP pP sP xP  UP 0 5  $% D#Zp830V %0y03R0S P LK@D@D" 5_ P1:;U 5$%RS 5 S  *K>p|  1: Sd  `KWV< ;P@  Ւp c @P`U =ZK* $0%KR  J0P50 `V p5  J 5Z K0K +PL@@@PPtq K  @ u  @q Z0K 0K0 p@x %R  eP  p %=`@`Ta=5i(K+hȬn|Щܩ  <\@-@|0  " 0|0  "4\ 0 ^|-0,0C/1Q0#0C/00CS00 c0 0c|0x0\0nx0A0 0b0 01 R|00|0 0-LM@K P  10 RK0 p-LMPK`FOK     0RQKp -b 00"00#0\ -LM@K  K00 !0 S0 0S-0 00\N-0|v?M0|0 1?01 R  00b0QЍ.A-0MP`  0S3 0 ##\0 ^+ @0!" |\|0|0@|0  " 0|0  "4\ 0 ^  pAЍ -LM⤀KR^KPEJNK@DpIoK iK K oK |`@@ TOK/Kf@``V/KQ`@@ TOK/K;}@y@u2TBNK@D/K%jg@`b`^dVB.K BTQ`M`I2V/K@=:74 i/K$K -LM`KJNK@D# I_KiK  oK P@@TOK/K@@ TOK/K@PPU/KP@@ TOK/K@@2TBNK@D/Ku@PPdUB.K BePP2U/KW  M$K -LM@K  0| 0C00CTK -LM K0 0 R0 0S K K0@- MtP @0 0 c / QB @ 00#00# Q0 Ѝ0ģ -0L!M`PK  0BS0KK 0SK 0S| 1##@0!\!P?1!K#$1! "41 00 R5 T 1##@0P ^+JKK0 #$ PKKK0 0`0b/40Q$K8协Kp@ KKKnK@@ģ -LM CK01 R 0 0SCKy K 01 R -LM CK01 @R c K 00 @R0 0S@  10 R 0 S R 1 BS R ! 1LR*|-0 00\ "4\ 0 @-@  00b0n  #4\ -0LMP@K  0 S  1##\0 ^>K0 #$ 0K\ K~K` p-LM@KP`d Kp@-P`pP@0000100 "#  010 " 00000#200 #  000 " 0#1000 200\x0@0P0x010P0x "# R |0100#R0|0340P0|0#20P00000 <- 0@0#1C0T\T00T00@-@P0000 "  010 " 0#100 #  000 "  ""  020 " 0000 "#  010 " 0100\x0000x " 1 |0100#10|0#10000000 <. 00#2C02\200200@-@ 0 010 0"!#1 010 0""#2 010 0"##3 01|\0| |0 01|0| |0"!#1 01}0| |0""#2 01~0@-@ 000  |\#|0| 00|0@-@0 <0b0  |\#|0| 0b0|0-   00|Q"Ġ|0 00|0|  00|\"000G-Pp`& !0\.@0 .Q@ TPG@ G-@pP`&! 1B$0l\:  !0LJ$ ^: 01 @ 0 0:#P`@G0@-P 0@C0  # 0"00 "  \0 -ML M HK00 R)0[H [0 @0;KH K)0K A 01 R;K KA00 R02 0/K0S0H4 =K0C/KSY0HK 01 S20>  KK-K?K@A BMK@D% KK @A#mK`FK A)}KMK@DpGK A'KHK A+K- K%KJ@A1]KBPE >/MK @D%-K B 3mK5 K `F@ K%rOK-KA  RK04ş,"00|Q"$L1,"0  RK  0 0|P"0-MK@D0 K]K0 PE+-K B K K@rK!MK@D5KA;mK`F K@K  KI 0@K yXK H00 Q9}K`KpG_KROK rK oK !MK@D p`@@ TMK@D!-K BX}z@v@rT-K BChe@a@] TMK@D!-K B,QN@J@F2TMK@D-K B:7@3@/dT-K B%"@``2V-K B  9MK@D;mKr/K`F7 K @@ 10 R7 K@p rL=K!00"0 0#P1 1@0 R(KAD M-VMLM@00 Yp @h?XfKPa 00 P 0 Q 0 @ @P 0 0Q R@K 0B_KQboK` @ K 0@KH@K`KA 3P ?  ?  ?00RP` 0@Q5 R 0@Q(KĤ -LMpK@JK‐joKP 늏K J= C HP C 3  ;  7(K -LMp`ᨠKPOK  တ&  "JK  =   j_K 0-OK+t ',#  2  2 2 (KĦ -}P`L@    h 0-L@P ,0h -LMM KK(@2 " P" K(@ K(@}K! K(pG(@OKzK,*(J>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>@<840,($ $f$(, p-@L M0KP`  @0S"V8#4,|4 <0 @!0 0 Kp@8<#4,4 < @0 u.0 -L,M0 K@ 踵 P0U`p@K$ K(0K@< 0@ ,` ( @ 8P 4P PPp Ka A.,D -H@L"0 0 P 0;0).\ -0@LP p`0 A0 S` a0A0SW`AA0A0S7`AQ\ ABABAAA0d0P*P2 -L Ml pR R P- P`@0 (@K@`(\;@^ ^ T$K耠P`0 Q  P ~ R 0p) pi ȭl -LM6 0PD(F p-L M A`*Q4`FEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE<0 0R000Kp,@K0P D0@S 00  Q 0S00000AP0K $@PP 0L@  N0 $, ,Hܖحh0 -LP  0R S S0RS  P0 0訫48+ -L Mq0PQ` 0 4 lP 0RKKD!0@004K0 辳4^:0`\0 0 Q0 B0lP0   0S  0S 0S0S0SlP 00 S 0C$0 00 ,0 (0 (K P,P(ˎ 0(,i<$t -L\MpEp0S, p`( P5G @ Q.dJJXJJXJXJXJXJXJXJXJXJXJXJXJJXJXJXJXJXJXJXJXJXJXJXJXJXJXJXJJ:P$$0000t+p`4  XPPW W , 0R(K @ P0DSLKKKKKKKKKKKKKK MLKKKKKKKKKKKKKKK X+P+^PK2 Y1P/}P00@ L Kd0K | x@ t@ p@ l@ h@ Pfd Rj0Sd0Sc Ss 0S+W  00G}Z00W% @ رP Pr Z0 e$00^\00 0R1PU@ 0C  P P0  8 #"  S7 Kd0K$@ 1P  * 00S0S 8#8 $#$0 0倍 00S SP P 0 R  |* p*  P*@i،@Pxpؖ-P P-L 0K,0, ($? 0ؑԮid$ P-L@ L0VIp el,+$^P~,,d p-L@P`@DT'0-S;@PQPPPQPPPPPPPPPPPPPPPPPPP@DT!`h0h ph`@T ``(0 `~{,8 -pQLP@S \ 0LW3@ \ \\PB T1 RG0 CR F0>  0aP0,<S*0 CR )00 \ 0 CR 00 \0S ᰳ \0 R \ᠳ0R P᮳>h蒳0R>h袳ꔻ -pQL@ᜡ0S:`00CS`0UX0  X0hm}`PUlPP!o0S@0`00CS`0BX0  X0 Q 0 CS  \  XQ BP` X U& tl0 CS @` VP0 %X 8X 4ꔻ pt p-LPL`@LDk8  0k$  pht $ -LM`@ kQ (KoJQ P 0^, ` pP , Rp RP R0S0C000 \  R  R  R,  R P @U@00R kT B0P0 hkPW 0~Z  @tkX z $mkY @ p  bk @ [kYk!s C, R Mk0@00pD+](8<0 L @L@t @6kd1 R+ 0 (KD+k@!  E41 R-(`00CS`0,X0  X00Sc0S_ (KoVI SI:(Ko)JppW jzP (Ko X (Ko꼙$<8`th İذt دL -L$M@B@0 S$ P Q I$ 0Ry K0A0Sjj0 0CSd[d[ [0Z\Z1j jQQ QR j #C xj 0 dj\X!0S 0`0`p;8 <0 L @L@( @ojq4@Khj3HP `jZj Sjxx m xHjpEjh"iI`Vpꤖi8ı hDP\p -LM@[e&.0aT, P cT , P gT0,0 P t(@4P4 00|4   l4h$d40$` 0 $4 ,`P $40S0C0a P  dP<0S#0 30S0C0@@  )0PSx0 30S0C0@@  0PS(#0 @304S0C0@@  0PS0  20S0C0@@  0PSx"0  20S0C0@@  0PSh80  \20PS0C0@@  0PS@f@2 R 0@fS@ k1 RQ PN, R\A&.}P 0S@ 0Rl!0S|;  7 /(BRbr0S, Ph 0 T 0, P00 R &t&Lܖ<܌,PxPt$,4<DtX -7LM@ T0 P`0gS l7D`wK0C0C@ @p> 1 R1 1R v㦊`9 8  0@p%nK`F`F+zp@V0S p%'E( $ K@ He0%(%i,0PpX -4L0M@PT`4APEU50-S@Ponnooonnonnnnn|onnnnnnnnnn?PU  ,K@?03, RPEUʤ30L0  0CLpK0PKH <0 4 D @ 8 qP  0@@p^V0 S@ 0@@p 0QPr0SX X *0@P0 0S" @U(K2! {2 wp2 s`2 oPUt .Pi 4x"0SP 20S 2  Q 0QY 0 SZ 0 S0S 1 R00P001 00l1`PNP00P0 `1 R0S?0 `7 (d0S0C0dV 00PsV0 Rq dlr$o$]i$"0|!<\Xw"PdY꜖,@p $дسCh -PLM`P0ڐ@#z@p1 T0@"S",u8s8s8s8s8s8s8s8s8s8s8s8s8s8s8su8s8s8s8s8s8s8s8s8s u8s8st8s8st8s@s3 "H@p2pR2A@"P >"P0`gSX@@bP P 2 Ri xIp2p P"0SXb 0E1Sixuuxuuxuuuvuuuluuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuh1 ad1 ]X1 YL1 U@11 MP T  z# 00 Q8.0 0pb#Qx0@ @64 /FX+ ;&@E#,,ȬtH<+40pX$0 R P"!P <0@-t0Q Pl@ O\ 0 l# BN0R0.0N0N 00B0@LPwxwpw`whw ጑- 0`S$1S00CSxx$x$x$x$x$x$x$x$x$x$xxpxyx$yLxP01 `R$0SX01 `R:H01 `R:D01 `R:01 `R:01 `R:L01 `R:T01 `R: P-L   <4("4#6$ $ Pn -LQ 0S 0S S hwh{0 踸P -LKM−0HK,0 @T`? 00CSPPU`p@\K P0 0Z000 00 R@U0 0Q0V @0S <0S80S40Sd ZDX1R_K@\H[ <@+P;0!`, 0R9(KP` P` P` P`P` P` P`P P PW@`4 `܁i<PԸT  p-<L 4(M"4Q l 0SPx1 r3VQ0X1@@UT ,80Kp <4("4!\P@ 00@U \bT!P`UU U&Ƞ& &< PP&Ƞ &<t hPx&<X HPq&Ƞ& @&<, P@ Pc<Pܸ -LM@0DSllllllllllllllllllllllllllll00 0+(hkhhhM P -T0 ML\@4 <@P ,c+K<PT p-PLM@  0 R @,h*`xK +`P @.GPP (NP@T <PP p-L$M|Ÿ|b0 S P? R6 @!T#꼁āPāāāāāāāāāāāāāāā\āāāāāhāāāāāāāāD"RH 90! 0RYKp|,lpA00xP! 00t8@K0 0 80 40 00 ,0 (0 $0 0 S08 K70K ?.P , B00[S S/0[0S S Q"[-K04"48#8 0 .K05/0[0S긎iPP0, 0-L(MtP9@K0l 0 0KS00 R00-` 0RK0i`8 p-L`!\P@ p0R0S 4 L`. 4`$ph`# _pA  p-L\P@` !\ "10Q0S 0S- S ]T)0 R ph_pM 00S S 0004"48#8008 ph_ 00Sph_<pA( p-L@\ `P_TN  00ES؆̆_00CSth\PD$z_w_t_q_n_ R R |phf_d_ Rxph^_p\_hY_`V_XS_PP_HphL_@J_0TDL8@ht`$f 0-QLMP@& 0S S Ux0 R h 0K0h_ U04"48#Ƞ08h_0  _8<Ĺ0@Sd<<<<<<<<<<<<<<<<<<<<<\<<<<<T<<H$^  ^ @Թ -PL$M@C !P- 5T H ldd \\PP L1L ^@1 R;41 R2(`00CS`05X0  X0K  0^@ 0@x^0 R Kh膥||h^X Kh蔥̺Ժܺ4PȺt@HP8< < 0-LM@0PS$ @K RL@@\ H@@X TQP 0v 6K0I000꼎 -L@M0r`@0TP 0   \KP201 0S0C000 R2 R X0 R 0RKP0SaD"0T @ \@T`T C0 <<0 0XS0[  r( @]<Q<a]0S;80`  B LR` BX0X00K @i; @]<1 R 4Q  ]0S `00CS`0,X0  X04P P `s]0S 80 L つy0 R00p0R PT劤X ㆤg@1}i8DL`nhX <@ -RL0(MH0  0CPP`HpK,KD 80 4 @ < 0 P ` 0@@p7N0 S}@ 0@@pm ,QNV V*@0@Y0SZ0 0 R0@Y`ZZ@@ (K,0P 0D < HP @ 4@ 8@ @@ep7 ,PV N V*0PS@ 0PS p01@YdP `0 @@;p,0TELBD?<<|M0*S $52됻ĻسCxl r 0000 W0700c00B0200p  4000 W0700c00Bt -- LM 0P Q KP 0 -0PLM 0F̻ -dL @2P H ,P 4 &P  P$,4< -pPLy`P 0@0P +R %R0s 0D 00s 0D hP P@ Rd t@ 0-@LtP 0000 hP%T r 8000D p 0D00th-0 CR 0R0 SԢ00 -t?LpϟM080 0 P<0  P" <s 8 ㆣP2@p  }P@p  tP"@p`r ,"/P 0S U  T  0  S2  0S` UT@ 9PB B U0P/S4P O4 40S 400ST   0&P00S 2 s 域8 80SV8` P80p 8D P80p @ M9P " " W 0S @90\/S/00L-P 0S00@$@P2 0S/ PP:P   0Sx 9R q*6P\  _ "*0p0 @008:*  0@Sp  "" V < <@t bP02 4<Kp0@0Kl,$<@T 4,@ @0S 4 EB "<0S; qo@ 0D0 H0 P D0SDH0S  H [0D0 @0〛@WP " @\`H :R0O@p@4 HwP P0P0`P0 P Rʼ 0S *0S ʟ0S#g#10`0S0S*/(<nP P H:0S/ :0S+:R&Q$90OTS 90S9#-9#90S9  x9 h9P@T hi@90SDTPS0[S ]}P 0 :SSp`  :}@P00 K7T00 00 7PK0`K 0p70X p@K l'P0` 0P i 87 0P$0oK<0 B 00   0IP,wǟ0S' #< <0s# < ZP0J0S ,J<0@'Jh0@<0  00p@K00@ 0PPU0<0S 0<x6 0S6 џP`@*P@PUmP〕@Pl"P00  0@PUPP8@T 50S58  "R ğğ $ 0nEğğ $ 0d;ğ$ 0\:P 7PPd %P@H$0HV#0@X P0$5ß3#.h40ST4 P 5P p@?P " P K(P K0BP0 P R 00 S S  P P,@K mLK> L0SPKPP 2P "0 S00`ڜ6`"0@LKP KP H0BP0 P R 00S S S R  PP@PP0 菜L0 "S5 V2  PP,2 @gPp e@P\ #1PP0S18 \ <0s<Q4 %PrTo@x,$4ļ4\`tL pcذ YpX X0`lܾ ,30x\D0ؿd <x8h DX 4td00 S 4|| x@ @0S 4!t00S0Nl@ 0D0 H0 P D0SDH0S HP0D0 @0a@6P L0\P0 DpǏH B8"b0OPP @ p@4HPP `P`U"0S 0S 0S#8#H"0pÏ0S0S*P0SHn20S/ 20S+2R&Q$20OTS 20S2#3#˝ 30S 3 43 徝D3ŨPQ h`.x3qr P0S0S0S 30S 3X30SDP 40P2 2 4P\ 嶞 <0s <`%2 P 8 (K -LM0T ,0 X \$ t@P 70Sj,0 PH  0 S H$ PD  0SD C.K B B`$ ,0X:UP ,0X$瑚0PP4 DJ @ P P, P Ɵ0PD\$0Xpa^P @PH$R P\$HpNP4/p :`@@P00T00S/ T-*P0#03V0S& H@ P@@PTT*3W P$0S,0X pL  L$ 0[S]P P0#03V0S @T 0:S*0p0@T# :/P U P00S P:R V  R0305P1 :P:Pt`PL PW 0S V @@V 0S /yP@@@`@ß0Sk(#U0 @0 K  8K DK0 K40KpK$ P 00Sd40Sa80S^  [0[[(,[ D0[@[$Č<4 4 "<, 0 K0 p @P`$,0( 0( ,00 K0KK4 80< 8K4 80<p@DDKP0 K40KpK@P`$DHȵP 7O00S40S80S  t[[0[`[ [P[[p[@[h1 [唠[lXᤀ[[[\`@p[D0[H[L P [T d4@1 D|<, ă $x q  1,(p,4Ɵ&<.  01*$t$%,.t0pMDV@Po86D@ 00CS, Kq4H K1@JP ,5N-0[ [R~[Q}0[S q5 @ Ƞ,Ƞ0 4,40=0S le@T R $ 00 p `'D  PP0S((0K  # iP j `K` |ğt\hğ\p D 8$P,K V 0t0p0S \,0K5PL4ȓ0S S ß,  ,0K!P |, ) ,0KP  0RS 0S Q00-S ? pґ R>`̑X>0S D0S   D,> 04 S< 0@ D00S0H0 #PN0SpNPn 00<0S<w80S8r\= \= *thl0<0 c08 SHPQ 00|SM P>;0S ;0 S  q<C8@h= /n@P000T  T T/00P<0Sp;0 SPL<0S c;0 S (<0S  0S DQ;0S  ;;0S x;P PTD0S ;0 PQ  ` T PvH 0 00S6  R'{P;,0 :)00|S @ G, ,0S  D*0S00<:: 刐, ,0S:8 40 `:0S,0,^KP P0S;0 $j0 SJLP0P0 P0: S H)0S00D9  90S (9L90S 0CS 49 00 @90S,0,^90Q:0h; o0P8`t -2LTM!0p`0UP^1A0 @0s 0 @0s 0 P |1|;000 0000,K0K4K(0Kd@K@$ K$8K 审, l80$ d0 40(`0 00v.B\0 ,0A BX0 0T P D0 僦pP@uV00S 0| @0@_ V `@T: @P(0tpu0 Kt`0P -0L |:|@lt@ RP T@:L@08@ R f]iddpt -Lp` X@1K#  zPP <j  p 0e0 0`X茆 -MLMB~K`pG, t,$  PPP H? s ` 00 0 +M@P(K茆 -MLMBKp `H, 0  V@1K#, LPP0$  P@ < < p 0`d0 0V(K茆 -LMBNKM@D, p+`Z V@1K#  PP,$8   0p0`e 0V(K茆 0-L4M@4 HKPLp  4P 0w  XH P0RD[P@  P4 00 ( K0茆ELF)\0p -4LM$d嘤D0 P04K0pK 00 40 lP aP` eP oP tP00  nP     #p# P 000 Q7s P pQ x7p{P Q H7|@C0 0cSw 00@ tK3t0 0`4PL,<̠4(ČH" !Č$4@%̌p&< tPK `0 0l d VKU0KX@KWpKg `P  Hi/YpP 0 KKp  tK@ @P V0[PS (`K,<4("4!<0& P P@ P,P P P PtK   0(  0 >V0[Sh00h0 h̠,<4Č("4!ČtPK <.̌@ h0 \ <̠Č8#Č ̌ 0p 4@@ w@P(K2itt+(TpȬ'Vp -LM@Kp4 P1KpU 4PP|K 0pq -([(00   K Ph   @L`K5[d $!0 pq  J PEL0@S8 D0 5[T 70 #1 1`  0S00S 00 00CS000`( (8[\ ,` 5[d !!0 pq LK J P  L R w:Ru 3Rr H\D ` V f 0D`P<0S@Y D@ R3:0R0*H 0Mpq 0@d 0 @Q0  ,KHP 0.pqw < dL 0PH 0pqe < 0P 80<P S l  0HP80@80`  5[\g0`V d 01P[ 0 S( RQS 4 0@  K@ HKHK0   P40`/00CS& 0pq   0 `  0P 00S  0 `P@( 8[T,V  m(K`ۣe -LEM@K  $! @ (1  `Ip @P`KK0^pq !:[31 u !rIP !Hh! GP7[ሐK0O 02pqn hK8 QI8Pfh0S@pKX0KpP7[UG011 0@1 A )Aq@ 0 p0@001 A 00CSp 00@1>AAN1  @@:[^ 0 , 7[ 0Kp 0pq hK8 H8P !h R :R R X0K\ YZ i $(0XK`H0K  v !XpKXI WE0@T?!S<`K0pq A?K0S@0 @ p@ $!(1`0$(!0K$`0K0 @K p0XpPq H@ e $!(1Lp`K0Cpq Hp $!(1I@KH0KQ`R c $(0m`@K   ! @0K  7[@T=0 0@ @1> Aqᄁ Wᣎ X  a$(0C`[ 0 S@ RQu @P@ P @@P@0$(!@ P K@KKKK0$(!@0` F00CS;0pq !(c@p`@ @0 $!(1@ p 0@1>A0 ,! !.pKpW ` $(0p`0@0@@0 @ :[pW0KYZ 0$](K`ۣe -00L((\ 0 0y{WtiYd -5LLM % , 0-S ``P@+Pp00`lp $p d0@ S h;9999999`;9T;9<;4;P$pD4 U @P ZY $vW /p 5 2pL p@H P9Ep p pP   UX@KT00 T0 ,,#32N0S0jl0 `pl}`K N20S `0#40Sj@\K \@ #Z/PS WV  O/p@ @ T  D/p #0S j%6/1pU ^ h d `KN hK0P`@ pT"0-SP MU`@P9 Q 0" l0S$  @="0S ( "  ,^\_\YP 55&ʒP@@S TQhNiitUȬD8X`@E$UU4$pxLNH -L+ 0(Vd -GML1M a |!@0P$4 X![ p oP9 4!R p 0bSQ`A~K pG0pG4 8P3 $$004 4 =K 0C0C P"'"P -P P "S0$toA.Kh0 B B\T0$8`U ,iȬ+sn tDt+0tti -LM@pP4 &yPP 0S nS6 =5`P00QD @ Q? xP 0V0S D 0 YppV 0`pY" 0 0 p 0oSP!00 ,K#, ?R0S@p @ `0 p00!0"S 0($P 0 0L/Hjdjjj,j -LM`PuP( @(K,pK 0 g(0@S $K0h@-PQ @p`0N S3. P P 0 CS @ Tp@-PQ @` Q 0 CS @ Tp Pp-L@P6 PQ5 0R14 40 0R+((P P% Q# YP ,,P`@PP Q JP 808PS <<P`@ Upp -LMP00K/00BP a@p)T'Q 0,<4("4!| ,K10 `V,0 0,0 %00S , ,#0 `S:(K -\LM`P p 00Q 0 " 0@T K 0-LM@P  $ K@ @  $K300P $0"K0 -LM`0P!PD $opp= %Q hg A $p/ Q Z  4P 115S ;7pD Q0 dE $p DT P 0$4 h<Ph -@̠Lp`.0'.TP! .U.S Ut! 000t0 00000s03-T0S _T _TX0 0`@Tt -L]KCMPE쐟MPE@p ` ݿ+ڭ P:$0 0L0P < 00 8KLp H @` 8P 4 , D plP 8 (KLdl -LAMJ_K, ,KOK᛿vp`P#0S @ [vP @T T } R 0SR( K0ACp <~v`V440 JKp, ⸽(KL<  0-L Pp@P8 pO 0h0 p-`(LPͱ,Pʱ0P Ʊ 80PS< U@ph躱@P -DLP㊵pP`H 00 @0 0@4 40 0040404 00 4 ( 0$ P` 0$  ]rP( ,P VrP, 0P OrP088OP< <8 @+TP @`8 -LM, P BR00S ,PO0r,BR00S (PB0r(T"P0H<`S 00<S$0 (00S`A<'8< 0V 0Vd18S_\P@OpOOa@80S< 01800Ea@80S<, 0p188дP<B 0!竼0<8 <0q`80S<,0@188岴P<$ <8 叼< 8 0!a@80S1S 800痴P< 0!rPU `X$Y \` -LM@P4K 0S   K p0 0 Xq 0S/ 0S  4@K$ $`K PtP 0S  pt @T `PI4pK@0PS B@ UT $1 1P 6@I`40(K  p (%P`P ( ӽ(.  ͽ (@4pK0S  ½@ T<0 80Q K@8H Xd -L$M@ᘽPPT ppd @@K$ SD P8 p 0S M0`᮳P, ~  pMr,P@QlPUT@D0 PM`X,娯~@0 P,JKi$ D` P-L@`Pp\i.. r 0000SR 0 嗼R``P'R"R $R `R \R `F0 `F P@T:V00xtxXM4 p-0L0S00@T,``0@ p Pp 00\PD8, phpl| C -L Mp@p P lhRp` \2\ D埴@P< ᯰ,R,,Ka( 0,0 0 2KGp 0S L P 2[ pLB`P $0S tA0S H2pL 8&a0S D@KP   0L 04 000  @T00P0#@\0)0@L tH0s T.O$K@(h   < Lh -L M`*夻24 PB2 @Ur P0"0Xp P*J`P$E0"LpP*,0``Sp! `"@pP0*,@P``0 ?pPv*@`P"'pPm*``p(0Sj !pP0`*(@P``ϻ0 pPQ*@`Pl!pP``0p0H:E1=U80 80S ,1 AE0 !pPp``+*P U0 P @`P0 P @`P0 ڨP @`h 庺pP 5:L P(KxVt<4T  p-ML M00@S`0 ZKPE*ǺP * P%*P  K@* P\%*TJK@D( 00.@KpX` p-DAL0S8 {.$1` P@00S 0S 40 P *@T00Q P 0*}h@c{p00S0@ 0>@8PK. 000S0!>ph{xvX$ -LMM@1~K pG`pG@P+PK&_- !1!0x6 p& V !0K @QF t6 l& =8 46 p@ 06S L0 ; ;KSK?; 05%0&$0&6@0 & 0 00& a>0K D -LMMA~K pGPpG0`+0Kʹ_- Ź0Kt6 ,0x6  t1d& 0@h6 0S1!l6 p& 0SS 0 ;0& 6 0ˇ 0S R0 0 PK @@ p@ 06S 0 ; ;KSK?; 05%% 0$ 0CS\0&0 0606 6600 a>0K p -MLMq`KP @@+@@KJ_- E`1V0K,t6  H1d& xF 0Kh6 00+06 k1f 0 AA+ ˁ0SP00 Q K @@p@ 06S X0 ; ;KSK?; 05%0&$0&6D0 & 0 40& a>0K  0-TPT0L@ @04 48#8 0 0hp  p-LM,B0 KP@0Sl0SCh 0R, 0R( e0 R 0R0000 0KQ 0h!0aN00LH\  00 000 00*0 R 000 0 0 0 000 0 Q0|000 00S UPL`PPF00 00<0< 0<,0&Kp,PoLh k -LM(K:x2t2, (0 b0/S0S*L4 80 <0408@ h2 `4@0 0ʼ@P4@8P1AP08 ]=0R40SL0 ]=0 㰼0O?0@@@c00@408@H1@!0 <0,0(`K400@T SP0@48X("(04"4 0 0p0 `020@^04!4 @8 #8P4@00@0 R0, 4v K p `h 0-`PL@س$0 00 00@,0 0@408@0h5 -LM(Ko(`K3,0PPch3@_0,< 0S0S*00 P 0S0S *R 2 L S2 004 80 20<0408@ {2 `4@0 0ݻ@P4@8PXRX208 ]=0R40S_P 4 Ļ0O?0@@@c00@408@10S (`K4@00@PU T0@ Q 48 8K ѶX10SS $0 S (0S 10,< 0S0S*0040 070KC,080K#K0S 0X P 0"P8#8 $#$0|0 l04@J [ @04 48#8@8K C0( 04f K k 0-t@LPʲ$0@ 1S1000p,0$0 @408@ 000h -t0L0PP P P0S 8@8=0 00 00h p-L 0P0 @00S 40` 00phu$08 00@,0 0@408@ph -L@OPPlT"p0S. 8 `0V (2pP y 0 GS R 2 P10 < 80p W@x1xt1  018@T R0 Da1 SL0 0P0$0 10h0S AP@(R*@ h޳( 0@0(W@P(((@1S 10t`00S 㿭P@,X  ⺳, 00 8<$D  ` -LME0P 0@  0@ p50 @`50 0S1@0 @<50 0S0;S<0@0 @š5\ 0 @ 00O?0@@c00@š4\ 0@0pPo?P P` a`P`%1?FA   ,K,Kß000@0 @0(0 S ,0S1@0 @ß,K000@0@0(0 S ,0S1@0@,ß,K000@0@0(0 S ,0S1@0@R0000 @0000@0000@ 0! 0S3@P0 0000000@00 0`0@0p@TP 0X\AqL AL @0SD0``0L0 014S08S 0L4 P0ST0vP 0 L00 <0 0 o0 0L  v@1S00LSP0h@0000@T ᆴ 0i/@ l@0P 00 00 00X0  0, 0 $K<Po 0-l0L0P0SS S S@P40h$00@ 0hg0 -L 10PU R  00 0 S   00`Zq`@TUh1S#P0@իP010@˫P 02} 0@P02p 00h00 00@l,0 0@408@vh.' -x1@L0pSPL` R6PO PU  .PPi+6 P=1S400400 0<40,0`p\0 P + 0S 00P0P0000 000 0P0 PHWVi: i Lz -0L hFFid -L0MDpP T+>6p@0S P0T0S0 0CS`~$XT0 $S )P EPQ P$ d P@0@0 H0`0@0@TP 0 00 00 0 R,pK ,B@K n%T0  Y08 0\S0 $S P P ,K SP$ "P00 2 0 |2@T0S 0PhM 0 (@ H2! fQR,pK $B@K 20  e$0 0\ꔁ 4R@0 ,KN2@K C ` ~@P ` P00P081 50H 0C0S00S H0H0S 00@  0S 0$S ,K 00P 0@T 0 0i/@<p` \, KHp`h<$h -88LMP(8` `ZR H pK⤠ ;iP8 cP dP71 LP.qP㤀 + uP$ lP&0' 00p 0: Sx+d偱\p 0: S 44,'00M'p7p0gSBT㘧솟Pg 吧FP_ 0PP 000P F0 0|PL 6P&]=00$0S0X 0T&pL6 DFR@6  P< 0u000 6`C<0 PL0Lp0L@A  Z 廻pp 0SH mApKp{cAL70\K@0@T-s*d@ U00S^FA0\ 3pQ9A P \0SX0S D P`"` V < 8f f(dq0,$ `0@_S0S*Ľls倃@ 0P.H0 Vڨ  .3p@x xnt媀pPli M w  40K p@0Y4 4X0 0R044rQBPA R0^2.p`@@ .Me2P@@ `BE %@Bp@$ (0K* #P Pdpp@,a0L0 PTpx`@Fp p  px  pd  pL ~@ -0H0S \0 00I(Ki +xlt<XȬd pd PTp|  XHtdH 4(dD`؜xv|@ -LM␀pP(K` P  t@Pdf (0`0 000@0@U,P,P  T4 -LMp 0 ,Kh;PXP; 0P P0pP ,`@0eP @T T00X s R 0SR@  ,PP 2,PP P;U(K<Tl -LMP$@Kp A?@0CS@P@ T ;P% :P0P $` R@X ά  @4;T $ B@ -BMLM`,KL  D4@P P0pP,Pp1@xP p WjC.K@ B B@D P$ D 0K@4H4 AQ SQ^ CQ BQaIQ/ LQEfQd XQlQ5 tQP$+hap ,K{ 3@P Y,Pხ@0 S P4 M D$ {4KP 4K @ TP4:j  }Pl  uP Hp   hP    ^P  ,K( !@P P1pPI ;T] ,PsdP ndP0 00KpddP `_dP  0KD9KP7 9 [9K00B1  H$ H$ H4Q? H$0AS,P H$0AS,P- ]P D4Q`᪥L$P@| CKAA ᢫L4p(K<0D`ػ|b,T p-LM@PK <@0C`SZꔕd|ȕܕ40040BKs 1PP ;U30 )P0 * P(x$P"x,x(xxx x8fx0f ;V xx| -PL# {P@ PL ;T i8`P0 $"㝬40 0 4  0s/ }S X "1R0 Q R$syP " =xp i2h1 P T 0   00$P 0@RXq 00S0` `0`00000S% @0NQP0  0S0`0S0  000  000 0 00`8  , p-LM@{ <@0CP&Sp,xHȚp̙ȜȜԛ H X 3sSnp 0 1Rdp 0 1(RYp 0 1ROp 0 1d2F_K,p ,02 , F_K,py 1 , کnF_K,xpf 1 , x1$`1}PD1,,141<0]0:/+ (`P0@`P0@PƝ0@X0D0P 4 ;U Kp  \`` p-LM@`Ks 0PP 0 ,P d {PP l ;U xP' 0s4~ x}S H x|x 0-l@L\1`@P PP3 0s S ( 0ha0x`  p-aL 0<$0 <0, @ 0,4 @0@<<0 K?,,  0]- @ 0, @81 , (A 00 0   000   000   y00 0P0 P0   000   00 00 _@P | p #phiapt L`0  0     p-L M` ipP :TR 8@K   (ᕰp@(@jKp Ki -L M@0PSD0 p` `,KZP& ,@"P P 00SP0 0 00 40  Z R4 @T,Z(K -LHM` pP <@K ᜩ ᙗ ,p` H: 2[A0ASp0<Qd@K( ~ { \p 0<0 L0  K i I6i( p-L M` p@ 8PK L I ܯp 92[0 2Kͯp 9\ 2[ 0@2Kᾯp9$ Kp i i T p-@LP`0@P0`p  0-LM@K,K:pP@9 @ t @00@0 ;P <0S @0S , % P [(K0 -LM,KYPD ,`B0Z=(!P P6 @0S!pW/0 4 0P=S=S  P  0=t 080S @P\  剖< 08@`V$080S  ,Y  -xRxxL M{`p0SX0 L@DT@ O0S 0Kg00KRQ0PQ1P/20S qV?!0 H @0 0K80 KKA0S #K HK)p0#S% 0S! 8/4[ R H0S 0s3[ 0S 3[~3[ 100@S 0S 00 $l0s H?;(Kh $< ld h -LMPap@K 0@ 0 2T [P 㼋@ H$H08#8T K#0pL0K0T[K0K0T`KH0 0 S0K0TKK5K4K4KDp @H$H Ġ$Č(0K Ƞ0,ȠKd0;h` 3K0$,$  2K0K2K _^ P  0@K  0 s(0K!0K`d0h@dhPpKP0  /p@K ῦ 0l p hp dP $ p@h7(K p-LMP0     p@cK7` 0K`0pT<7T0L0@ `!pE-7 0$@Kp! -L4MPNpK02 # V`PP $0S 7XP@P08 ެP @6 @0 K lB 8 p-LM pR2XoP|$ @0Rx1 10Wp Q^KPE+ТJ oPKM.\P x6S 6S 0  MP 60h@ Dx6S 0S S SQ``P`P`P PP` <0 S0PP0``B@;t 0$Kcp VKA$ $ NK@D[0S P@T K Py{o&Y -0L0 S 00CS00Ӥ0YY \00! P 0 000p0 T0 p LPQ(0  B000蔻4  ~$  -PQ@`Lp   0|0 `t0Pp0pl0 h0d0 `0 \0 X0 T0 P0 L0 H0P~<     $40,(8    -3LMؓ ԣԃp@ 0`bPep 0  0#PWp P "P9X3XPT3`L#圡@8@`"U00ST P@`\U@@ V 0pP0$T2 00d " u 2P"2堂 \00A S-Q5T"d2PP"@C $0CSL @ᙊ$K'h$ H ` x      p@-<@< `P 0000PQAp|  -$0@LP N * h -d@LP NPH Dg0,0 ( 0@ 0  h    -L 0LR RP 0R > $  |00-PPp0Ll Pd'\dp@ LdOH0P 0(,0 , 4 hH  L  -DL@ iP(0( 00000 S贻0    0-@AL81 PP,1, 0P  R0 L\00P  BRʔ00 0 0 QT0@0<0UP<@00{00耐4   0-DP@L0000@@0 0 0 04  -`L̎pP{0 SPfu% ࠟ0S @ PY 00000 U`PV p 0@\Jڈ@P`0 @0O`d   t   1 P-L`h 1 @0Q0S 1 00 P\DX` Q0DQD0 Q@L00ΌpP00CS04@0U0, )0@0CSp0@0B0@p00 +LPP n\, 0O00    t ` G-鄠儐Pp0 0S0 0 BS00R \P@`A   -D0D@00  R P     p-P@0|`00t0L@l0@d0@`0@0@0CS0 @@00 ph&p訐      -1q00SL-P`0L00 P100CS0#@00 0@0CS 0`@0x0(000     ` -LMP@0 2!PB ,K A@P zhhhrhb`"PYm 0 P40S0`00B P, 000S SPp PP aP PTAZ,KPPU 1 ,0Q.0 Q@L00h P8H00CS0<0A004 [100CS@ 0@00I,  忒@p0P@ e P P \0P 00S Pp(K$     ` -LMP0@ T T4pP- 弐0帠S0@0+@P`P 0S  0  0ip3PPP0T@$  @ ,  -0 CR 0R0 SI00 -@0LP`rPe`Z !`0Vh?`c0SUJ L0SF I0S\\I@U`T xΓP 0`!Sb/*0S@,0@0I0US8080I0US00tI`zUlIPX*\00S` lP ^I U 0@0^S00\P0S蔻 TД    -LLrLLL`~@0S 00CS00PӤ0JJPuG  Q/0 Q@L00 P00CS0^A0w0V S0`0CS@ 0 L!0d800 S0!00 U`!00000 +0S0#3 PP {0S0`00D` 0S0`00:V @V00 00 0 <0 `蔻 8 `, 0 $ $  -3LM, 0 0 S@`TA9P, `3@, P00T$0S p>0`>PsP0 nR pR lR 0P0P00PP 4=  Q =0S ==~PI==QP?P0 nR pR lR 0P0P00PP d<  Q <0Sz <<JP,0 0SS0 x<0S <0S( p<0S r ;000 8@P P0 nR pR lR 0P0P00PP 4;  Q Y;P+ $P\PP0S!SH +t0S, 0S @P ; ::;0S[ rc T:000] P 0!S4  P0 nR pR lR 0P0P00P\ 9  Q 0S+ 6t U9`V 9sPaGTPPgTPXVTP P0 nR pR lR 0P0P00P\ 8  Q  P(00090SP0 nR pR lR 0P0P00PP 8  Q ) 80SP0 nR pR lR 0P0P00PP t7  Q it'00cS0 `'0S TTD;70S. P0 nR pR lR 0P0P00PP 6  Q 860S @7@c(7PP\0 nR pR lR 0P0P00PP 5  Q H60S 66P} $0h&@ 0R P0 nR pR lR 0P0P00PP 45  Q 5&@5ZPH 0 nR pR lR 0000P 4  Q $5 55/PT`pP40Se @Tk40SgV`pT P0 nR pR lR 0P0P00PP x3  Q j30S? h3P( 0 nR pR lR 0000P 2  Q >d3 \3H3P 0 nR pR lR 0000P 2  Q 2 220S;P0 nR pR lR 0P0P00PP x1  Q 10S |1 Rt1 d110S  0 nR pR lR00P 0  Q L10S d10SqT\ P6q 0000 10S1  1 g@P" P0 nR pR lR:0P0P020P$ t<@  |d + 0  Ȕ $ ( t 0 ؜,W L x ̔4   $  0 @ @P 00  Q X00S- 0S0!S+q0S0S @0P 00P 0 @$q,Q`0gS  S &:00C S#pS rS` 0`0`0`0 t1@sTP000`00V FwV 00 S 20S@ p02  1 0 S 0 Sp pRV000|2@  @P00CS0MB0y0E BRT P bu 3 @ #00CS0,C0[0VPP?PT3h#0$S0000W0#00#0#00# 00 0nS pS lS0 00 00 0 0\ 3PP0 nR pR lR 0P0P00PP X4  Q N40S# 444 ~g4PD{P40S(0pW50SH'P0 nR pR lR 0P0P00PP |5  Q 50S #50S,P0 nR pR lR 0P0P00PP $6  Q PTRpqW QWPd6 Pt60 r 6000}`P8 60S6 R6 6  68P&0 nR pR lR 0P0P00PP \7  Q 0S0!S+o0S0S`{7WT7 70QP7(0P00 0S 80SqWP<80S0 nR pR lR00P 8  Q D B8 8 P010C0S  I1@s qP00 0 nR pR lR 0000P |9  Q 9)00Q0 mP0 nR pR lR 0P0P00PQ (:  Q H:T 0S8:`:Ml:0Sx PCP0 nR pR lR 0P0P00PQ :  Q \;; ;0S, 4; <; P T;  PPt P -LtM  k5 8Pڜ0000SrSh5hehhhhuhU@sP xP pP00 @ 0  536%^p0 10 00b0 0S 000-S 0@S@ʜ000 00C0 CTP@K⧯P0: S  0㥎040CP ʇ LJćV@P >7*#000S 000S 04P 0oPX30S 000!S 0+Ln0S 8000S  20SsRcT0S 5䒟䢟"P h@PB-"0S& <"0S"pW820S  p2Rlh2 0o5IP20SH"0`0087"0@09"000 S 10S!@0`00@00@P @P  @Pt t t$ @!00,00S  1R 1 050 S 5h00Sc 0R0 04V` h d+ȬĔ        D |(      0^S0]S[S 0.R =R:R  S0Q]S0]S S]S -1L`@[S \S`P t0 S\`0S S,140 pcQ0A0 QP\00uPx00CS0-P0/0% 0P0CS0@00\@DP | H0 0`S  0o $  $(`,  p- L P p P 000 S S@0S~ pk`Pp0P 00Sǜ v|0P@pcp\0P@P P?P 8 80اpPpp$  ,(Ȕ`( -L Mğs@, 0 40 0&S903` 0hQ0 QP\00t P{ 00CP|S 0l#0uX0, $3 0P0@ 0Sv\SC00S@9S>400CS:0 2`2 0hQ0 QP\00t P5 0l0CPdS 0T"0/@0,  2 0P0@ 0S0!`V&0 VP\00st PC00CS080t0CPlS 0 \!0H0]01 00@ 0 0c SC R/`p0 RP\009t P g00CS0@00 ,0P0CS 0PP00(0 00@(K` -LM  @$" (2 P  Ld0S  0@_K  0 B qP$" b  ," (2S  S ;#rPU0 U@L00s P; 0ß0CS@ 0 h0KT#00ß0S 0B %{ K 0P 8"RpW$0 W@L00s PX00CS0U0pŸ0CS@ 0 X0D"0s Ÿ0S 0 zK`0S 2S ,\    ?KԿPk  "向0pf 0 Q2 /hQ`0 Q@L001s P<_00CS0AA009 $60@0CS 0@00W "1 $ 4p00S 0T@ tz HnzQ"(K, `< -L M0P䑟0C0 4 , 0Q000 400pP^A QPX|0`00pPY`P UDA  MPP!00CS0:A0*02 /V00CS0  00 P,00,0 p@0d 0b, RZPP  P(K @ l  -L0  0%Su0 SqB 0Sp  Q.0 QP\00-r P[0@CT@xR00  0<0CSP 0000  Q@ 0S.@D/\Q)0 S0 @!!0S 0S0`00 tQP d!000S SPFq@a$@00 S R0 a䀟0 RP\00qpP00CS0#@0?0 0P0CSp0XP0,0$ H0@00$ 0 `(   -@p@@0LP` U0@ P0 R00R00 10B0S 1@s @@ gR0000$ x  -`吀L p Q0@P @lT00Cs0,0 (0000 0804 <@ -2LM0s22080  20s.xB0Sl2  +`"0X0 @0A0 S6`a4 R, D$+0S PD00CS0 0`0 Pp@@ 8$0S0($0CS00 Pp0@@yVYV ,`v֡ᙣ{`0S 1 ,`v KZPP$1:( SPP~@P0?8 0 K ᵣ. 勂p  0T00(^@PU 2 AP/0'p8 t  00 dPz0?PX \&G T] P( I< 0 00(00 >%P;0075\+] P 3H( 5.:㥛0E,p 00.S.0@0K`8,0 , g bl]0,0 0x 0 0E000 ?H%000!P P D(5Pp@P5@XeP 4@0H8S 40TS4T 0HST 00 R|š$0s400s030 P CK.KI B BI`X( L(00 @0-S 0SH8SCC000S40C S;ꔍ\\D\D\\čl30S| 㮿0S.P,  @KoP @KX$#0n P *XH7PH00: S m JH00: S S0S2P" 8XH0S d"0SP d(H8S)0S @+\!0S  +P10SP妻 @pK !0p0n P: ᘻV`<H!0S t0S<10S # H0t\0l10  P8 P P`0S00S 0S mP |0SԚV`}PPX00S iHL< @4+D0T@Ȭn8<P0 `Phpc|hgd| 0-D0LS@ 0PUPHP)OPP0D00 0C0 0 -L`pP@@PHpD@ R-LP` q@0@P T@T hO0 0VX1Xq 00 @0D00 00 0@T:p VOp@@0P00 V4vpV00 0P00 d@ep _]8 000DP  O00 $H@L@ -鈁LMPpH,  F@T @ )PD p` p 00;P'  gIp:0P  010P 000 <@PD`  (PD0S0S(@  g0, cP@L@ -PPL`p/ (0S 00wSp rS"ppV 000x000p000 0 0@00@ 2Wp 2_T@H@P@L@ -`QL MH p0rSwS ?R@@T WG00}bPw 1,@@0@0@4@@@@@@D@ 1嬑0 PwS 0 !@0q`P ^TH0090` 0HwS:XW@ W@@0 #020Kt0"̠10K"$}000K- K0 ` )0KX20K/K,K+K*@KD0 . K@  < l 08 0X  DKxyp  05P  KP  0(P(KX@H@P@T@`L@ -RHL`p$H X 0P @@ R,B BQRQ0Q@P`Fvd2TLDX@Dh00 0 0 0 0 0 0 0  0  0  0  0  0 0 0 @^Plhd@hV}VmFP0p0`F@@ VV1E0\\0\ 0 \ 0 \ 0 \ 0 \ 0 \ 0\ 0\ 0\ 0\ 0\ 0\ 0\ 0\ 0 @`FPV 0 0R@P`Fv  _h@[hP[ -PpL 0o눀H`$HCh%XL\8@#8P@'XPfTPLD@DTLD@D(0U[E>^E0PEU\EPE@- 0S  00 0 0cRÌ`@0  0"0Q1 P0 0SPL&0 -0L0SL0 -`QLp@00SP(0^ ^0 01^ 4# # !^#$""1^"4##!^#$""1^"4##^#! ! !@D!$""1"#T T $0@T0 01 #L0 0 "Q p-L`P@@Tp -pLAM0`, . 0J/K(1 |00R0@KJ_K   Pf@0    pd`0,1((K 0@-@P $^ 0 SΎ809P  L0  ( , 0 8 < lPP0P@-@ $P Q < ^ 018 0C0,0<8 0 Rp-PL@4 0@Q1S``.Pp(0 `S00`(0,0S0 ,00(PpUE20Pe$00E`S0,0$0p040$Pphp 0%0  -@PL $Q ,0S 4Q00$,0$0P $P 00  00 0@-@P \00^ ^l\P:0 -LMpPL $`VI 0S<0S0S < 80 0(K08< 80080< #4 B80< <0 S0 h0 hh0  `h0S @ 0 0P 0@P0P $P 0 S<0s3 -P00@Q0SLT$PUQ (\N ,0SK 0(! `P 4P $ 0(P0,p gLS.Q :%<,0Q P0b0bS.00 L P0l0S.0b0S>0Wl0 $0 #4f4p$`0% -$@L40pS` $P0 (P47 (Q$ 02,(000( PcU4:b f (0,00 0e0`U`1`!  fPU 4e f(0,00P00( 0S00, (00PR:0,0 -pPL`P4 $@T1 0S 0 S+0 S  > ;0P P 00( 4Ubkf(0,0e cf,P0 0 -L0MPP  $PU 0S 0S0S0 S00D < , 0H0 8p<`@ 0S񟗗P<pȫԫ 4PPL̵D(< y< !  ;< 0S  0  Z  0RJv`V0'dP0S'r0$ 0SH͟`F 30 `  0 0p8Z  0RJv`V'4<'<,4<0`80 00p 0S < H  D00<`8p k 080P\ 0S  07s`0Z  0RJv`V 0 SLT 0 0T0 0+X0 00LP 0; 000!q`F<07s` Z } 0RJv`V@˟("('8,Rc`0@ 0p@0Sg DQ01 S@1 @!T`  HLe@0D H0d d dD H @0Z M 0RJv` V"'5t  0 0Q\0`d 'w`FR0 0h Z + 0RJv`Vʟ00 0'hq`Fh\0Q* h00h0S S.0L T0l T/p l0PZP< 00<0h0T03L@ C 01QZ  0RJv`P Z  0RJv`V:7q 0`ah UP  Z  0RJv`V:^`a7q< 6 0n00'q`F(P   Z  0RJv`V:71a q`AZ  0RJv`V:71a  s`AL 0S \7 000 h0 0h P*d `0h ^L x:0S! S>/΅T 0 l@L0T l0p` 0P< Kl0`P00X0X 0  p0d P0< 0 h6 05T030CL01 P0 Z . 0QJv`S4  03 @C403<1 R0 Z  0RJv`7|`lS``@ 7p0  0@ L% 0H000HQ Z 0RJv`V:1H0C07q@ `a @ 00X030CP01 P0 Z 0QJv`8 03 @C803<1 R0 Z 0RJv`7|`l@``7p'0H00D 0HQ Z 0RJv`V: 1H0C07qD `a D @,0DD 00`R00< jD Rr @D0 bSH @c 0 bR a(00b@40bRD@0 Q10l@0D0H0lD0 0 R0@0HS 0L H DQC @0H AD 0H 010S4  Z 3 0RJv`V@0Dl00@0@0Q00 H0 a8'4<,'<4 <S D@  00D`@ p0 0< H00D(08pS<`0S 0@P @P0< 09,0@ pc`b0 00@ 0@0 0RV0 f q8 QS@00<`P  \ 00R40 <P<  < <(KZ4G-|M⠀P00\ 0 S |@0 2R02BQ0`\ @00S@T@ \0@ @@@'@\ 00S@T 0 sJ QR0Q0P0S< # 000 Q | 0S4Q 0$A\0P P 3ß(0,  (,0 3ß(0,00S0!Tp!p1' PP#0 \00LS`$P08 8  8 800@0i^040@(,Ŏ0@`@0ià0%3l l 041 R @0@# R@0B00|0 02S0C8#(@  P P@@a800@|0T"C$ \ YPi0 \00cSPR :  0<Q00SA 0P0 0pa 0bC1 0wY $ 0S0`4 @8914 @00Q  0A0000S@010p|ЍX` 0`YU[z -0L R0 R P0 |P0 |@||L0S X@` @PQT0D0L <0S 45`Xi\d: $ T  -L M0@SK+1P K0 R 0华  0-L M0@SPK02P K0 R U0k  -L4MP@2'唧0匇oS000 `gR   0P` mS000 HfR  pT` H` $'p= H0@0S0  H ,&宬p 0P0 0S 10 -R% 0bST0SL  H0SOWppV00Lp L0 `QV< (  8 000C0Sq004K 8@i0S540 R- @ D 0@  T q`pnp`kp`hpW0S `:aP p @ ` D < L`Pp ήPP+ 40C S@\hh@ {p0S Z 0 qP ᒵPPp0S 廏0SH 0!R0S0S Z@Xw hP P R 0S0SH0S[ D@ 崄PP PQ@ -pT RJ 0S0S@000C0SU4K` PPl0S40 R| @ XP D c8K0K, K\Pl0@0 ,00D ,0 TH0 X00X0H, X00X0H XpPL sD@ UP |H0\嶇0P0S0L00@ D0 #@P\ 1 0@0 D0 .`pP@  p D @  @ `?"00|双t8 勌d8 X8 僌 H 8ߎi\d`X Ȭpc@  !Lp@-@P0S@ 4 p0S\ /+0;;0b @ f0S V,0S -P 0 R-P导0S 00f0hH 0Sl0 0 PHh :4"pPeD H 0X   T< p  -LFMM <d;6*D0T0C0 :!6+P( 衟00 PuTuM 0000 *0 00pg!$r2 $XA)000@0S ¡BKJJ`+4KjQt p$  00C0tp \0@ 0R 㠡4s~R iD Pe 0pT T  < XH H t  h    lJ  $! -LAM p`@PBK( H .H ` 0)W   ( 0R $KV 0S: @x*P 0T: SD0P 8 0S: it hD Pe ,! -LM0  -X2LM 040p  4 ;;S  0SSYEPPV 0SJ4 Y, P` ,40+@+PU`RP ` YV4 "P4,/+0;;0b\c/00S@\40 @ + @,0 T0000 00S0SU,0S x* @f40 TP0PPP4@ 040P<  40~p  -LM⸑<0Qp,0 [8P 00 4P* /00S@0 @P, 0R(K0Q`0@0 P`0OO 4D;$+4 04P  KW?K0P  40@ hKV0 0 0<+ 0SP0SPip8!  0   p-d`L0S TPT 0@1@PK0S K K000p  -@LPJ00t M0-LM0@0P0f ş'00CS D,$$'00K0''00l$L  0-|0L @?PYd0 P 0S P 0S0S00S0 $ d  -LR(M00Qp h0b43X^u  0LQ OTUi H 8\J0@O /00@@D @ /T<9 H 0Po 0W0O<0 8@ H, 0H< 00 8<  5ɯ @0O 0 @T40 0@ 30 ,0O$!D@K0@P U`] S1 R(K  0@OP`0 @nP SWSH@DPK`0PO` 0 @VU1 R 0 40H<0OQ 0p07 g20@ W,L4 Rw0S04 R# pyğ0 ?MU404\ 1> A0 10408 j  B V V  V p(KI#0S:B# 4 00083@ @U(ß4#0P\Q (pt"0#\Q t0p  0S80Ÿ00"\Q "0"\Q >cxŸ"00K\Q00d0X0lL"0T"\Q00000K 0$@ Ÿ,"0\Q00"0D00"\Q00000K(0,@!0\Q00!0@00!\Q00 000K004@!0\Q00d!$0H0d1\%RB 40O0@41<1\%R404h0 404O0@ 0@n"F60N"00ZE"p00=(00s03ix'(Y0Sz Spg40O0 @btg,p4hpU %T\% 0-PLM@ |U K0T\!0S:N i@Q@<04!\Qp"P# ~ {1 R(0 \Q, n0 \Q0O(0K / ^0 \QpUhRd0 R \J04 \Q0S: hp Tt0  -MLMDEH <\, 0X P( L8 D > L(RH80 )P D, 0R (KX(HH0 B8( 0 ]'48HT00tpǏ Po t Po8"5XHpQ0K@0@ 0T QQTʑ 4 H8 4R 4(R3^z  10 8H^ fHD(g4(Zk >K0S@P8 LH pCt#0\^K  1   RHHL<0S00^3 0 nKH(`F`F@0 00!"PH8B\0"\Q 0K0S@0@X|2@@000QPQ0 ! R H8.K ' 000<0 !?0003Pk4 j4H\la@ 0@  r 3 H"P 0\Q <8! 0@0 00 #0K0S@0 @q0<AHD ip T|X0,@! -LUM,0S 0, ,00806 6\Q 00 @xF0P: S S\ ST6^n 0(ŕ /R \ 6^i  0 RKAAh ,hN($R>Kp l 0 \5 XE 0BOhE?DE SpU\ed ` 8U 4e @E Kp l lBnK`F`F@0 0\0 PL!P,C3\%R 0 L5O0@嵰3 R @U(0/08 20 \P 0 \UXe21COPU`p2TU Pe P`hpǏHe 3 D 0  R/ $2PX0OD%0T%P5 H]aHDH D Pt0r OS(!\1pTP%Q PT P% X0 S R<0PES00T1 0 BnK`F`F@0 00z  P( 0\Q) 0TUPe0S@0@#0 (0TUUh0S*W.K \% X5 m0 L5O0 @MD0TP%0S@0 @ipT|H! -L@M\@KP`@ O 0 0KL @P <` p(t0 p0\Q `,YMpH  0@K FMH pT\P -LpP@T% @0S 夯 0`@P``0 0\Q ,Mc00i*P 0: S`0P\ \ @ L0S 0\pTPeD 8P -`LMXH RS, @4ȟ (0S 0Sp P ǟ'0S0@0 G0S ǟ0S7 R n&|0@S K 0S 0S 0S XX 80   O  $ Q ?KP``F0`,_K`P`P`B2 MP`K 0 N2/R 0O? 0@l& @Ācp 0M 0RB K2@ּşu0S %`PU`0P@`P`%`M5 R 50,PO/Q o 5 p@PELş@_@P004@J%8Po% "2"_K`PU`P@`P`D0`ğ0S z|4@T s@T T0S8 th@T `b@T *#0S84Dp {00Dp {00, 0R(K`" (?K 分PS3T@@@@0S3 R2 ,ß 0S. p, R*D0 O  & _? d0 0< l21 \>Q,ʠ0p, @RʰrH"0TBS8000, Rb xb@ 10?Ÿ@ ,0SHR@?@~?@0Ly?v?2s?!0S tA0S 0Sh0S喭Px &K|Pf 0S8 X8T/9x~p{ 0S^\u 0S\HoY@lJ @媚04@0 0T vP W lOL a>0i4p\ %&h d&LP,n@ p xX8&L&P! p-L@M P`K^0S 0S  x -Lb@P00"p~ N0@+S+x \ \ \ \ \ \ \ \ \ \ X \ \ \ \ \ \ \ \    \  \ \ \ \ \ \  x \ l \ \ \ \ \ \ \ \ X 1w!0001m 0>0!Sd00!000|1 c 0|t1PdK@1 T 0bqD1  8嚺0!000 1!0000z0pSP`g S0 RSV 1P@@ 0T0PlR\&i&0+Xpl& &X:(8XdȬ   \ -LM`0 HP0pW-"1> R.#` 0@ 0. 80pW080 0@P`Z  P 80pW080 0!`!0@0@Q ڠ1 R= Ы / OCP1 ``Q 00L1 R R 0S0S R0S 0S0 0S P CPPH0| `Wt 0@0@QTY PW |&08)x -\LM,0SPڼ0@Px@ tP D x 0, xPK`@P`RxP t` 8ڼ0t/x@ 00T 0 PoPpǏ`pT 0/ XP`1> 0P@`UVW4HTLd@GpǏpXʠ @ hK*J=@P-m͟00,0KX 0-0=0, R|ڀ@ |P @0 @ PoP ` 4m|0倠O *Q0   0OP`Ǐ`L 0T<\%R0ɯ \0Sg < Rc l< R\0/ X 0 0@ @1>0P  1  |00@@P$ `h̟0 P,@0[0  0, 0PK`@P`QP |` ʄk00*(K0@0 @ pPK`0@0 0P@`P`ȀgpYZt˟0   ?P 夐 U 8;`  p l JQ K GD Ka0pK@p l K P l  R@ T DR @ӕt0 BR @P  0@!K000S00S  R K00KP!%601@P00 K hKL H0 $,10 404 10 \Ph0O0 /S x1APh00LK 0S 0嵧KP,!0\Q00h0 00O0@FQ pp RPm0Ws0 0@#1?@rp  \1 4T0U '4'\xLL'Pxd'pT(w'L'W\D1> 0P@`UVI K60`0\%RF 40O0@0P0\u Z=0PV='=@Pa V0 8Q`0@0@TAT!0\Q  0  0S2 K00K 0 40O0 @=P 3 U0  aF  `>P K4"00K00Th0S1 Gx |Pw  S -D0 ML8 , 0N$ 0pEPKp' -L@M@ hKE0 00, KX0 0 ,0S+ڸ P`Rp Vp`Ui@P LP H` C0hKS 0 P@`R,0 S 00(Kp3 3  -D0 ML8 , 0N$ 0p5EPKp' -L M0 0Z , :0쐟쀟,0  KP, P U, 0U PU 0S\0 | 0U R 0R Z 0@`p0,0 ,(K|@-0,0,0S@TTS -UMLMP'0,0 00CS񟗎; `5 5 ; ; `5   PP 0:0090J|F>K0C 0C t5 66咛@ tD|0 1p6 bB! dd6 `4 X6X&Z4K0d0`00 0SZ S;;SV~KpGpG,D5)5(K \%5R 0@`5 \E ( R01 0#SP %0\Q,0(0,0p0t@(  R01 0# SP R P(%0(%\Q0X000@\0T4 PD t0L4 HD kZ4$p0Z0 "0`00@0 0S T r  Pğ  @$P%DPpZ#0P1`0U0:0@0PV @ 0S0SPV@, 0R(K`#A< 0 PF $#0\Q: 0@0 @L7 0@h5 dE GB~KpGpG@0 002 RSB 0̠  0SS 0?044 0 R|P p4"04"\Q 0@0@U{ rjsw  h Ÿ Pj /0p00(0!0C0@0 @$P0PsZ1SpA 0̠ xd 0S `5H Dr {P( 3 0Pr  ^ gP  Y0p0CZ0NPQi<  4 = = pTT= P0<(0  `lJ( x`! -LM$$ @0 @BPd( -LM44 0, @BPhdC( -ML M8 `R0,0 (@TR8(04 KK ,.1K-K00-A[S00@`VʆT7(K MK@AP 8 RP0S, 0R(KQ0.S 8 0`80 R`p `(00CSSB 0B C C B B BP0@S &P 0S &00xP8  8 R 0,-1K`0KKL.1K4 E0-1[8 00Rp 000 P8#8E c(K 08  8 0 0C0(K B(K@@@T0W .80 8 Pk 00C0e0Sz*<ş 0$`Y4(K` MKH@80@f 8 00C0 A@P68 58 RFQ 0.SA$PP'TP`& 80S< 00@@[0S ğ0N00PE00C0V 0 080S ß080S-0S`ß \3 RP3 RDß 0t P` S0@ 0: S00S000&<  0 80Sڒ~KpGpG@0 0l0RnKL@`FP `F 0@0B04"092 Re  0`UAPb .8 q)8 lPlDAP<0@ 0$@ Ra !QPV` H@0 0$@0!Tw $ 0(K MK+?lPLAP  @0 0$@iLh|lJ<0p(LPhh!4 -!̑01@!1PL0B-0SC 0HS8000PP4  0 0S 0` @$1 R@ 3P ` 0S  P_0HS 00Q | 0@ 0$@00C000P@00 H $  -LM$$ @0 @?P ( -LM0p`W0,0 C0,0  P0,0 "1> R*A R P) R 0S0S@00p2T pW 0@P`0:0 @   0@pW,Q  -L@M@ hK?|"0t",0KX l2l"0, RڸX 剁0S\ڑ pPoV0U.LP H` /00CSQK K lL K K L !QW R P^ R 0S0S001hKp x p0S0@P`!0,!\Q0  000S hKX p0Sʸ0 ,0 S$ڸ 0hK ?hK :AhK 00 0S Q 00(KpH M L< TxLl -80 ML0, 00p0>PK( -MLMXXXO0 KPK(JX!J,0 HK TQ>? R KH!8KX1Lqp Q[ PhKXaXQxKHŵXKXQ$ETnTTʠnxKXqQQ$PPpxKXq`0\3  BqB00B"1K1X0 000SXN0S  KX$@QPPӼhKXa`0^3  BQxKXq0@%0 B 00B!!L0   KH @ 8KX1 LqHKXAt0XK  Ba?0\a/PŔbL8KXQ`AKKT K0dhl!P5K(@KA/@8KD`@KXKpxKp!xxa p+>Kp0Kx@ 0<0|0XK>XQ808t< Po 0c O`VP' (K0X!0,;+HK;XA ,0SxKP`}G4K`tKDKX0XK @OxKDhKXa,HKXA 4 X 0`OPǏ`XKXQ 0 hK5TaH+0S 3S K DKXK0@O8T 0p@W(K4!R7  R\0?00 10  B\ HK8QLAUʠ KX$5S.pPl h0U`0&p@ @ T 8KX1$%T  1@01pP0SUT XKXQ$%T  101$0hKxaO0@0@0KOx0@0 @P`(KD!  8K/x1  0hKO0xa@xKXqPL#@ W PKH^ 8KX1KT E:0 0XKXQhKDaK,L0 p@R HKXPPL5hKsKd!8KP%X1x?N % P`, 0RP(KXK 0R# 4  R`0?00 108KX1p80P@`PW7 W"$0#0$0QK`0X800cPK0ϊ/.Q00b\Kt!0KKX80O(K8! R8K<1SHK0APHK0Q0HK00XA$%RhK808l 0 0 08WKA`KX8XKhK Tl!P 2 RQKT2xKQ\01h!\XKTQHKTA\0gP Kp@! P KT1 DARKT \0|1R\08Kh!U0 0KTx0 R0R0 n8Kp P0 0K`Q8KT1 `0Q\0?0@0RxKTqXK\0TQ0?00SH qP#ip4 `))4 L)a %TL*)))4TU )0)p )8)(t!PU 05 D0RKTK\0T0?0S5KX(K04q!8KT1PU HK`A`VXK\QUA`0RKTxK`0Tq0?@1P`0?000S' qPPU 05 X1RKTK\0T0?0S5KXK04q!KTPU 8K\1`V xKpq2 P KKT l!800 0(b@"0\Q\ 0T0xKXqXP 0\KX\ K00B` `0XK  Ba\ad$5SAh$501l `R 00Bdd0(PlHKphKKhQlqdxKp\ P KxKX0PP 0(KT! BKX$5S0C0S$ PKH KX0$54 KH! HKXAXQ,0$EUH P 0SS Od0Sx -LM$$ @0 @9P *00 ᰝ0ᰝ0ᤝ -LP 1h Q-L@ p0P T/, h P-L 1P h 0-/LP@P 00+8w'/00,+ 9+900 p-LlM/P@P KԼP0: S Kp0`rS@9 L P0-L@P0 R 0 R 00hFFt0 R0h0l  㔀H0 R <0<808}0ꨝi --LM0 0 d --LM0 0 K --LM0 0 K -L@ᨘ h -LQMH0@K0@PP`pK<8P0: S V@@ S00S F`P"P$KDP T P`0 R000 ZK@ P h1: S 8m((Nbꤝ@L,< --LM0 0 Pd -T L@H>P4T$ W edAl -L0MpPj8@P"  Ta0B0S0 T00@ S0 00a>C"0, ,0 ,0 R Rt3tt#!2(K0 00B SH' 0# 8,@ P 00C 4, Q0 0C#4 4 4p48@ 0, 40 0C< 80 0@(#5D |,0P@@`0D@ ?:8<00夐,@@8嬀 ?5845<P%0<,D 4@< 0B$%pH /T P @DL@ X 夐 Y 00S  0I 000DL44 0B440D0<4,0P@@`0 ?:T K <@ ?:D0 S,d 0S d H\`0H P3  B  B00B11X@00@0 SY0  0040(  , 4A!4*ذd P-L@ 00 R$hEz0 - 6LM , RvfFXS$3S Pu Y40ȟʠ 0 Pş5 \5 SS SU us :0,\ڴP\%85R h0 S0 0B RR40NRR00^td0OS),` 4 ?6t$0ttS} \%h4R& 0O044D $0O84 R P 0Sl> 4Op(0S `p ϟX.p 0P`@`` pp pp }-.N x-0^St Pr mP(0--<0000P@o = RD0  TJ$N0S ^hm84P :H08<%0OQ |J 0hZH/8<%P $P 8:L]`0OU  0L/@D%)PH P 9L]`$堀Q@Pu`0\3  B‘B0"0B11 00 0@0/@P`PoU i$QPU@``0^3  Ba@5 B0  B11L 0000ȟ RP l\7xP0 0 "DCQ Q ,h\`P &RT3<Pb F0 6 00`pWU p0OO  Q^Pa `0O?0@@ c@Pe)5P e0,\)x5P 0h%?>T 0 H5HU  E),5PE =)5P <ş 5  44  O+ 4 E4w_ 务, 0R(K40Sğ@T" 0(ßP=HD0SF yCf+3P) ]% S` 3-K B BP P S@Td 000P c\54 S0 `5S@Q@=4ZE %D2` ß0+DLMPbR  0<0 iVfV$:RFTS8*06pߒl2 Rb `BdR0 0 0a<Ғ82 R ,0"0 0 0Œ2 R AQ0 0 0帒 Rf a0 0 0e嬒1 RD !0 0 0Cp埒l1 Ri hA\Q0 0 0k@哒 RF 480 0 0\0 E兒1 R @0 0 0i,,dxh+`+,4,X,|,4-T`----T-.($   LL`!h++,0p,T.|...|!Hdh+ 0,,,x%|0 Rf @P0 0 0L]`e R< `0 0 0; 0 R  0 0 0 1 R ,A(Q0 0 0HD!h t/\1\lo0,d5S/x5tp d0 pP!tx5/ W.O/0,@`0@L l3B \AQ<0P d5Ww"2墟?2 2R -BMLMp0 0 h0P0S ANK @D@DPYP 0R K};`Pt0@ 0h0 < 84 4$ 0D 0CKH0 A, A (4 $ =^*iT " - L0S* | t0 @_ 0P3T0 `q0 10pP 1$0S*h.p -L@=77@ 0-LMMpPANK@D0@D\ 0 /0 =80 7 0RK0 i` " -L@MRP`@ # W0 0  (K!0S y0S s0S  X0S l1@@ @hK/0 U,@K<0 # DP @` ,1D@K0X0 L@ HP Dp @ P fhK& 0W01 ?00i+   i-VW 0 X0 P Lp H HhKp0 XX 00 / @` -D0/ Y D:LpKX @lJ -L@ML H LK J K -0L: S  S  S  S <0P ,& S  S  S - ! @0@@L0y'P; 0 ` @ @ ``0 a,Pp&p  @0@X ` P P $S'0P0O'@P00UQ !!XPqp4 -,2L `Rc /@p@3 FvT1 RO1 RK࡟0SBT 1 R<qQ埝0ST00CS0SX0@X0FTR T00CS0.0 R0, 02P0 S  P 0S VPP 0 e`0@ PyTYT nTNT uYTyT  `0 XE@XE@000d,X  -,0L@SX P H P <0S d3`0 R T0,0 n,:P00,0,0 0  p-T0`LP@P  0,(P p nu 0.T -LMP@P4@ < 80 @@P [a<</Q80P ,` ,0`,` 0K$<QO@ 4g;@P81  > ,<K0K40<Q5夜@ R*0 4J;@ ` P0@_4 0K@P ; *<0K0@ h|0@@ T (Kot(K4<Kt <Kopxd&h -LM 0@S `V 0* V up̐ pp d T 0`V0p8d HDLTL? 0<` @\ l2>4Q,h\pC00p`V.p, -LM,00K, K00 %0S3\%RX` B2 R7Br @T T `U@ | PU`Q\"\0Y00/H2 RB0 !A `gPP@0A#O 1"1?0P HA`p-8PP`# P P 0 r3p1>0 R! "A@e0 0@A0#O 1#"1?0P01 FA`5 -LP`  PT  P P@  P8  P( $ 0  @ x $0 000, R0  0 4  -@LP  P $h 0-L@)l0PP HP5P@@P5P0p/ -\0LM@(0K( 0 @ K$ K0 P K$'K8  -0L@T P  hn# --@0L M,K0,K  K Kt/ -`0LM00 0@0 K P @X@ K8 / -t0LM $0K 0  $  K K0P $0@5 K8 / -0LM0S P X@0 @00P  8 // -LM  K K0K 'p@Ѹ aK/ 0-LM 0PS    KK0w'p @Ň學0 ;K00 -L@)a0a50H0 0S00 -p-LM@0`P0 RP0200  0S CKp -0-L$@KM0 0 '0P@$0 S000 @ L; 00 0SK0 --LM0 0 tumu K p-PLP`  0_tpV rP@@p0S PP@ PpUP@$0  @pp8\0|00 - 0LP`p) 0S& 0S# 00 @0'00pll 0 tp\U PP@ V0,0(0(`@,@(`@Ph\0  -T1L000,Q,p5@p 0`)'P0 ,@T"0 0R0 0Hp 0 0S 000IP 6000ϒ QPPP@000 ,@T 0 0\0 0-|0L@0S,@TH0@?PP 40PP@PP PP00  --LM0 0 ct\t3 K -LM@_p`PK! 0P4P4$0^$0 */0 1(1 -LM@\t0pP0K]/pt P_p`lP Uh ,T0!K 㤩P 0T`\0T!0[ 1S000SU% 0T@!1pP0S ޅ0S څ0S ,3,tT2 ,3,mTkTv3X W WQPLc3 0S f\30 (K(0 0Ԓ0 ,E.` KX1h|11 p-`L0S+ @P(  0P00 (0, S , , R(0(0phJp0 00 ps php0   -Lp0@000,@T 2 p`Pxp?0S P13 Lp0S/0 S+0 S @ T 0 D8P/4 1 0-0L 0R P, 0 @0 PU0st d0  0;s ,@Tp [@0S 0x 0  -L@,20p$ |ps-22 -X2L$M0  D2$ ,0 (@  $K,K0^$p0-S@1@0000Ր,@To!Pp/ ^p`+ P#8@K $P 4` 0` 8P W8 S8P p<0!$14`<,$!1l- K{ 0 @p`P#40S 0:0燐pN0S P@2 [p0S>0 S:0@ S TP0Q8@Kh/H20 D8X`E@d2\/4 1 0:0P0 K -L$M]pP*0@K 6$P ,p (p 0P 7 710aS1 @0 8 <` 4p @K ,w PK l`T!U P13 p@ 5TÃ0S  0S( MQ 0 0R0$0 $@K.V\ |p 6"4 H0xxx }pQ00 SK`2XE@2222x 3 DUd -LMCnKЁ+~K+cPÀ\PP|(K 0@K(P R tt0p ,P PX<0 ,P w<(0=u MP 00p$`K Ap@ T"0S $0[SI0S p0@T$00 S\X0,D0 @ K@V@`\3Lw333 4`4@4 -LDM@gUP ɳH DGP 0(儓o  p0P a QP [ fVP sVp QБЁqP !mp`10S@   P 0 P0T  P< (@K `$ ` 0 p , $(p`0P 8@Ka " 4P 0P 8` 36 /6PPP00,w4d4P4444 5Ȭ5 l 8 200 "P: -LM@pPg ^`P 0S nS0oS` =h"PP00 @ P @Q  0U0P P00 00 X 0000X  5NU 0 Ӂ00 ,K!, ?R0S@pÁ0"S4 0N@PL/jj,jHjdj -LMp`FP@( P(K,K^P  0mP(0S_$K -000 0LS    [!i$5d5 --LM00 @MP 80 ~o }ovoni p-\0L0`SP@8 ,(P&Nphp!gd66 0-t L@h(P\PP P 000 {@P 4,N$@0< edA"!pyY؞ -MLM0@<0 8@ =!P = = = P |ˬ =t* P-] p4`Kh* dz -N0@&S:X d  \ $ d $ < < +0 `c40S<0t:  .t Lp RQ`<@0@0 L  @< 8 `54 <R 1 `%4 ;R  1 `4 ;R 8 `4 d;RX 1 `4 ,;R 1 `4 :R o1 `4 :R _c0 `4 :Rx O0S \\*TF@Pg P@ @000:,\ P*:1  o-xɟ00)<K6p 80S<0S [ 0s 0d  0Spx* P 0d h*jp0S89P ( 0e 0bS t80S \@K>PT0K\0 X@ tC 4(1 R0`: -W opP& P! ^KPEeNKPE@D@Dh(0s\(\8Pplᤌ4(88pcᛌ $N\70S- PP(OKe/r?K: 7x* (K |J lZ p <42 =C02 =$2 7P00C,0P 0 1K," ("  6 Rp A 00KcPp %   ,K0CpP#  ,@ PPPlP gP,  |,0?,0 d  P ``rpWZt50S EP xP| ` |  x l* c  0 Px ~崯  Ix K:NP~娯  x=40S 0: Sh 3 0: ST l`:@Pl  P`P`0P00@ Sx Sl| 00A Sa>@2 : 0 @@00@0`:   0 S`l:   |(0@S`Ld <`KP h30 0 0J# 0@ 0 @@*0 @@0Y@P X 20Sl` 0PP|2|`0O?   4D;S##t`2^`V u2 (2 R P 00C  p R |*(0 S;30 R 0S1  0#R ʄ101 S90!0S`1010p10S xA0S d10s%k00!0S00S00#1ѣ10L@Kp:  x* `00S  P |*p8,00Sp 5L x 3L+i|n!Ԟ!6747+T7!l7"77!77Ȟ 8̞(8!H8d8О:Ğr|88tnȬ88rr8n0@3C 000t30SvL3 Q`0P0 20D080U00@ d b!0 0G4K(K ""U H:`::" - L0R  P)G: -2LM00 S8 4 N0lJ0 P2R@ d )! 0= 2P)G 00C 08P4`\\0`"1>\\0?0 80(R0! @ d !2 0; 0@4D1 00C04P ,0OT8`S8 K F0O,0 (@ 8K 00 O Pop@P <` @S!.Ǐ@ 0@W< !@p`p, K 8Kx `?v` d 0 0@P0 0S 08Kx ?00 08Kx ?00,$000 (00$Kkh꬞ ""U H:":! -LMK@P,'0 K`0@ P A P @ P _e ) 0!C p  0 K4 0@ 0 @ ^K`pL =0@0O$+41 ! d 7 004 0 KA "! -LM@PpGK,`$1@ 0 A SA  9 K00` 0  0K e ) ,K01B00@S  0K42P L=EK0@0O4;0 dH04 0GK DK!A " ! -:L0MP0OH0 D@ P `HL` ȟH08d 10S70܀80P)0p@^pl@`x0W0HOH DpP,0 /0Od (00 0 080P0x `R!U(K "!!:""U (;!T -LM  0 <<P ) ,;P4Kd;0S ; 0t{Wdov 00)E: @P0=:p   H`;:Q: `: Sr\ mQ (:  S4Z@ ,0BttJ @P@PPjɟ 00T 0L59 0$: 049 0B90A  cB`0UT T0PD R@: R08R0EBY00 8 04 000cH0 400cL0 H00O85 >H>̞\>hTT> "ht@A!!>"d& Ԟ!!>>" " ȐY `400S40|  00 00 ,00p0$@QPU``0^3  Ba0B 5 =0 B110L 000@x0`S0 0OH4LD ,L=2 000 `1Pg P=LV>00h0 h0 S:h0<2 0<0H2 0\ T2 0 0R0PT0XT0P0P0HU 00 400@|0PP40@`0, 0a84 0 =(0 H4LD0 ?>0 ?0 ;0 4 D0,40S0 ,d@8t<.4P`D? 4  4d U0O?`@P$+4x K ФPp Z@p4P`m 5bP`8, 0>D @ , DK< K,0KP<KQ  P  K < 80 5,00 `d6F8< ?Đ .Q  P33 5 5  08q@ Rܠ #㑊(d&0  K@0@1K>P A0`@ @c0 0@` R pQ 0帐崠 J)F#Z **0P_70S>@P'(*0\% 8R8\5*0MG*0P$8l(t8Q0\5P80Shr d8PP 8ppD K p [P1P %PP80Y0 i R01:0 P<&~ I c*+`p㨐K:x4K`0S-p 0O ,00 /0Od )P0d PcP@c@t 0 S X4  < 0@P`p8ZXJ0P,0V0S X |:0S :Px :4K0S P  ?>0 ?0 ;0 4 D0P  =K*0`PTH4LDVlKd 00 f0 R P000`P pV`0 008P40 A @@>A@p; 008#80(K 0-LMopX0@K P0,L 0P< PX $ZpPK0 """? -0L "id8? p-LP`@T 0@T *0P/S @0P/S00@T:/っP@0.S P@Tp0S .S0S`V (0  0S0l]4"X? -1L MС`V( p1 R 0: S C<P8( 0RX$K dd\a\q0SB@F00CS0A0P0 Pp 0S0!0CS0 0 Pp0YUyUto0 S7KA. [0 R@@>P>0d6 KHPn@FQPnP(僞,"i("x?d@? ? -RLM`p, $0 W @P c   ,/P `VpW V@ PVQ -LMq0@QP(0  0: S ( 0R:$K0S \oK3P`% P<=D1  ( Dp` K>P  03S ,3S o00@ (3S43: SK_p T2 S!3 mP D0`P KHP{= =i?4"(?? -LlM`@T PK2P 1 R n0S ;0 @TK0 Q p0S  Q 0 RP 0S x0 Rh[T0  P 0 Q9-+ "4"0"$"? -bL0Sp2 R p (dPP b@P# 0A S5   ,  0    $ WZ 0Sj P @- [1 b@P7n0SchR_0SH %P ,_0 00SB 0AS)<  <  t   t @ 0e: 0S ,P 0S:0 0 R Q AH\P 0S m0Sl0 RpyvH Pt << ","pc4"0"("@ -L@Pa0p0!Xp- P0@"S" (  ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( (  (  ( (  ( ( ( ( ( ( ( (  8 Xp0 bQ!@+60S 0W 0 0 0|0 t0h0 p0000(0 R0"?Ȭ("4" ","$" -000 0LS     Π4X"@d@-0 CR 0R0 Sg00 -@RLP 0S D#| 4|TH UF 0@SB 10S<p `(<#0C3@ R 0S, ,0S| @ l R @0 S0S400S(>h>h--  0-PL@0S(0h{BQP x{t d\00SP e < 0{ (0h{8@@`@|@ @@ - L ?P1;m @8"@ 3m -LM@/幟"P0002 Pp2 lR dr`X* T2T"PPPfP tP  @Wp2 10 bSP PP P 0@SX :w P:10S Ya@a,@  pQl 4  PP `@a0<S 00K@P k0S 1 0S08+0S% 3KP ,K .n 04 P,00S )8040 8K[P @00S d: 0Xz:=TX",V4n+@Ȭ@0@0@pcP -0L s6iddA -LlMp`@ V,*U&/00w@0 PsP3U @-*P qkKP0: S fk0 0 $KDP Vk @ -Lp`71u[[!HVp mP2 pP X!̂r`P y @R"2 0  劺PP@dЕ 0ld"0S 00CS00 Ӥ0叼 r@ 处000010S 00A,K߹1P0S00#3 dPP h1@d0S d凕 0H 0 , P4! 0qa00!0P 0 0S 0PP@ndV 0| 0S 00CS00 Ӥ09 r@ *l$$$0 `pc$$ -@L 000@輥 0-PL @ 0P@000踥 -LM0S`p00S; :SiP 000S S,坹"PP 0@c 0l0 00T2 0DD"P<< $"0 00001,K@P# Q000 ,0S:, , E,0  RO0#SL0nSt1 G0H00@$!0S 0#S0nS 1  0,0 ,0S ,0+;, a0 @\ \0 0 0^0^ d 0000H000 0 00,00C败$$$`$pc$p$L$\F % -鐁向吡L`Pp@)fP aP eP EPrP uP nP 41 @@p 1@ns1 !Np0 00@pQ @0S@Pd0x@^P bٓ< ㆖+%%% % dFdFȬ$F --LM0@``0 s0DSL0@ D0D0堸  奸T[KdF$$F -L@Pb嘓 茆 -L'@Pb刓 茆 -P@Lp`Z8 0H,P 0?,$ -LP`p/0wS {S& sS'0 p 1P 0@ebM 0p0 pp 0P @Sb; 0(npPUpc -P` PLpK y@ W000 \ 0 0 -LM`0PPp@0S1 T 00S S@D 0@0V l0 l00 T00E0P S  0P$ h$F%%B-0 CR 0R0 S00 -L`zK((MP$pG!0 0R R0mH@P e*03 P0` P0V00S06#3 dpaPP a0S ak<  00$ 0$K$% `F$ -/LPM<K0t 0N00l 9.00l0Q0Sm l@PT 0" R 00$P RTΟ 0SH0SPL l 000> D R000P RM 0S͟0SP) l0Q|M 0Sx͟%!%*ll000 R000 R$͟M 0Sl0 p3Pl  g l@0=0C>S񟗭S S S S S S S F S S @G G S S S S S HJ S J S S S S S S S S S S S S S S S S F F F G S S 0G xG G S S G S I S J $K \K K Q S S @R R XS S Q [k0SK0000P 0 0 0l0 0 @l @ )Sl  l L00l@000S6 ˟0S= 10S? R  B Pd 002d 0` c : J0S 0 ʟ 0 0 l 4 0J`0s P  P KP4[S 0y䙟䉟PD9< 0U aPVp )000 \P 0S&P" P 0S\ \t@V ;P 0iS@0PnP`0VS80S$$80S  T80S`86#3 _PP~ _0S _凐 q880S0S 8J }P 00] tPW70S0S71 0SH 7'B0S? R  B Pd  00bh@ 0 ,7d\h& 70S0S 6 xhƟhf 0SXF 0 zP4 0 0 0l@0 0 @l @ PP6l 0p0 @T\@ X 50S  0S0xl 00 " \X0P< E0l0  @` `P\0 HX0T4   00 `Q{l D0p`Z&Up% \U 000C SS p0&S\SpPğ0@0S :K@ p0@` X$P0001 @D"0T 00tu& qr ßPd0@00S :K@ 0@` #T@0X `000PUl0@0S :K@ @#0@` `0PS@`@  ß0 X0 `A` "0XSX00X0 0S @X@0 SS S X0` X0X0 @`0 /Y00 \X 0P'`@TVYXX 0PK  @PK l 000S 1l @P- PU* 0s<@ 01p@Wk `PVk 0S0N K0S2 TPr 0S0PP 1S0S@T 10TyNtA ppq0_? P .U?0#K"0KR0(0Y0@ ;0-Q6  ݕK #Kؕ0@ RU t3AN=N0+0#0K"K!pK  0| , 0<t<MzdZܥXTZ[TTXZ$T@TtT 0-PPL $0$@QoPP0XZ[ -LMPP 0-S- `pC#pp lP sP ?P`Kg`PhM`PCP#pppV OA0' #0@| 2  0 =`Px @T3 P @, 0T00S&R+PppT] 01P` KsP@ pKZgP=@T 0%S\TP`{tM`T; 01P `K0S OM@T' sPw !0LSLL 2Q0 d8MXKM`Zʋ 8BM```T6M`O0 R @[$ R @MT M`GQ 9G6G02G0.G0S0D Dp$Gh!G040 xVVZWVܥVW(WdWpW|WYZWDWPW@p@ xhp`0QU `Ep`0@ R V"T AP4Ep}f@P `*E\0pR廃44Epn@XZZWp[Z|ZW -L0M8dP0D($)hp LP PP ?P(KC#hp0S EAL H X PU 0S xDl3p0S\D@P &`#T @gT 3p"P  "0 @T0 D P 2 ; 80 4 n80 0x@0 < 坊0pK@`K,K0 < ,0@\P)00S "0 mZP<l<@HU ~DD0Sh !b R mD.t10S<<@0/S4ZBT0 MnL P  3D0S> !D7 A띍1P+ 0D0 P0 <PH厍0P DP P |.Dn<@H 㯋"DxDm@P<@XDXZZWX0X4Xp[ZlXZXX,d` ܥn`Xb|C0XKP:KfK 0p@!0TRK0K \4 0 , 0@ =9L4 0 =C,0 4 O_K`0KP`Q@P <` 8 0P=)A@` -BP@P <` 8 W A4 K0@t@ K0@`LX K0@D4 K(0,@ K0k (K0P@=9B` =C4P 0` ,0 N0P@=9B` =C@P <` 80 _0P@=9` =WXP T` P0 e0P@=9` =@P <` 80 <0P@=9` =4P 0` ,0 pDY4Y?BZY(Z0Z Z8Z@Z -LXM@tPK`ሀhK 0lpx 0r 0i 0c$KX@ -LPp@ Ndp fP/ vP ?P>@@ ?dpp01@T `P0 [P`@T W,@TpAZLZPZ p-LM 0S@P1  KgP/0S"  D 1`0P @g0P0fC10C0 0S0 ,0 R$0xmxxZXZ$[H 0-hALM`!Pc?PA 0AT00  KfP5 \51 R= 08S9 R 08S S\ 000 R\ 0 S Q0000 lp0*@0bPE\K0@h@ (0@ZܥZpZ-`Z 0-ALM P]c?P80AT KKfP%  0 0 rR P0S @[\dDP0@0d0 R R 00C8S@ 0  ?ZܥxYZZZ -DLMKP`@0 0=00 0<00^L@D,00tP@T@B>FD>AiZ]([ZZZZZGZZZ|Z p-AL!`a?P8 0Q@P `{P# PZ{P@ NzPp@B^ 0S > `l>T @pT>pP@U 0-S0S>@pZܥ(]ZZ -`L @a?P@ hp4N0T 10 00PS<0< Z@ ZܥZXZ$[xY -0L8MT0 0\0 0CPX0 XEP%rap2 rP ?P pP,K<PT ,Q>(KsP uP@PT  , KN=PT , 9>D0$X0 ?ap01 `Rl40&Tx=`$Tn?@PP 00T7P  v=X0STp 0 40 0 40P0<0 8 `0IVP0 8`u UD 0S C0 P0U u0  $0S1xP 0;0 0S ClP0\0 hX0S L0 cRLK^pPp<0  cR<K^`Z4 UJ uPu U0S8V  Vx 00S 0V0 R`FV00厃0`D2 R98 Pg0\0\U00Su U 0!0  80S 0SPr1$ RPkT偮P LP1L PE][  0圇qgP0E=igX0S@x@3u00#T uP0  D0 @ D0p0H L0 p` 000HG5H@T<ZZWWXZ([XZZPZZ 0-PLM @ `?P0 01P@PK +C0PS80S08PKCP0Zܥ p-,QLM$!@_?P5 0aV/ 1 0K&P+ 00 R 0 0  Q  0S  0YPx9J!{ X<xx>@xP4  <x {ZܥTYZpc p-0LM` P@_?P 0AT K0V4\0\  00 0l x4W<xO<ZZܥZZ R4 5:0Qhm -0L` Q\p 0PS @0S 0S P00@SHI - LR@:Q0AS Q 80p3P000 J -LM0P@ @ P&0 pP#0:0S0: pP]  `PG00< !@@p@3{0@ `P4!@ \P `P  P. @ 0@@ @ P @ 0@L @|4 @u @n\[[\[ p-L@PY0`PP p P P` `V`p p-LP@0`PP p P P``V`p 0-L@0P 0 P 0u30 4\ p-LlM`P@PT0 RKpK&lP@ : S I@@0Z -LM`PP@p1 0A#S꠪ t   h <  h  ث \ 0  \ 4 | p @ @ @ @ @ @ KbP0#50#0# KKkPKkP|d 0Rh 0RKkPKkP 0R 0R $K 0S2P"000^PKP|@TKP0: SKP0: SKP0: SK P0: SKP0: SKPy0: StKPn0: SiKCkp3cKp3]0!SPPU@]P0 0 3U  0p03 0 G0s3CD#<0S8KkP2K kP d0R?) h0R$p3p3KpP050#0# RO  K_P J0 00 KWPL0S0 p3KFP1 RK:P040#0# 0#  -_p30  #_[ 0Rq Lp3FP(K 0)1P 0ES񟗡꠭ t \ D , $ (0Rӓ$ (0R$ (0R$ (0RÁ$ (0R|$ (0RvtP0SwXZP\0Z-@-0S0%@0#0%*0Q00 @8 @8pc -L M@2@"P40 0 020"P,0 ( @ @ @@1SP1`6 T8` < >@T\J`@pK T; 4P` @TJ4PP*T 04PP<<00C<0 4P`<  @D1`P 8$K@pK 00 RxP @ 0, p3p3@pK 0 0  ,@0 괡 Р [t\l\XZx\ 0-LM@P$K. $Kp  ?<8K0 Kpq8\ -@LM`P@Q $K 0/P $P 0 08 K0C4pK4@ 0P ,@ (P c PE@T @Eiv (7 7\([\\\ -LL0PS8H 0 S S0 0   0#  A0A0 S00p`B"Zp?@C "P( $ $ $ $ $ $ $ $ | $ $ $ $ $ $ $ $ $ $ t $ $ $ $ $ $ $ $ $ $ $ $ $ 0 0SV0SR 0RQQ  OP A!zZpp?@0!R a7``oXhA\!bZp . ?0B"S( ܳ ܳ ܳ ܳ ܳ ܳ ܳ ܳ ܳ ܳ ܳ ܳ ܳ ܳ ܳ ܳ ܳ ܳ ܳ ܳ ܳ ܳ ܳ ܳ ܳ ܳ ܳ ܳ ܳ ܳ ܳ 6W |Q @x7QQ@T  8P$ %$JZ\]]4J0 X0@-@^ 0#S^ 08 S00S0 0#S 00 R00^P P0 SPR R^ J0Q S0 B00Q B\0AZ# 00000 -L@`>|T- p@PP 0`pc@W P`tP nP@W ]] -LM@R00?P`p@ 0pUWlŸ (0K P{ T0\\S@DLT\"0'P "P `P =P :P @DL^m0 g'Qe "Qc `Qa =Q_ :Q] PP^0 'Q "Q `Q =Q :Q \QP^TJ q7 1  01 0D@q* 0' \ZU-0/S '0/S PPpp0PdpU@{ Wl{y0Sp(  0 0 008PpP ([t ] Q-L@' T# AT *0Q/S 0/S@T:0/S d 0R /S @T:0/S Qd p-`PLP@VP 0R  0RQ^p^p -PPL`@p 8p@@P ThZ -@QL.0  V]00X p`@[T*T ?T $T P(U /TpU @\T0 SP` U~X 0* 0 P WZ] -RLxMJaApPD0pp0G P P4`$KP10Kt!( , 0 0(0Q*PP, 0` 00 @P/ ``QUV ;V& @`, @`DA xA@(@ , 0 KP0 R7`T (0`0@ZZ]Z  0-@ 0PLbP 0c0 -LM0K` m mPp   ZP P0xU*oZP omPp  (K @`DA AP@PZ -L,MP L T @hL 0 40 0 H 40T0<0 8 p P:P8@w  YD  0< 0 bR<KU@Y R   P /00D00D0 H<0  cR<KT@PH T 80 T0b CAT00jC1T@0 $1`p@pW` 0,0 , K~P LPQD p@ u@`WT 1 00 R P80$(K,0S 0Z -RLM<0 ; @,P`4`KH#-8#000 40 , ##0@T T@T"0 !>y|2P 0 0p400gCz @W `2  @Y8 @ ` P X`P @ 00kV 0P fP XP @  817 80 1 RW 1 !0 04 4,0Q8*00040 ` 40 <  (K !VIZ0 P`` VP @PA0L<x D0X0@` DA A@,@ 0 4  4017 8+ZZYZTY]ܥ< ! -/L`sHPDp`@PP@ T iYJHP -!LHMp0W,0 H PM dpK PLAXK@0[?[ 0H0[XL0D[1EP[C`[@b0X KX L 70K`:K9K8@Ks0S0S 0S0 S0S0S  P H, 0R (K40$ N ' n8%iXlaDJ -@TLPL x0S C x  Tp0@ p0TP`[]@X(x R p0 Bx p0`L]X -`RL@YPPT^ Tp ppTPW o U 00 S/R  0R B/S PUjW10@  `1`0V0 T@j DA  f1A` 0V@0T00  oP@j DA  AA Z[Y 0-LMPK R@P>0SH0 R lm R@PT[8Z -L M0S 0 0@Q@ K0 KP1[S S|ࠁ ࠓl 0@d{P[,y1[S < 0W{P [yX[TZDht@A] 0-L@P}\ 0S0S @p00S@ ᷈@XZd0 -@L! @@@ @@44okP, 303 0 h X `(]X P@p 00 t 0-0LSP @P0PS0 0 5<0404 00, (0 D5x5T5L5P5X5-l 0S ^S 0000S$ >R@0̗?R!00=-0 0 L550̥ -tLQhd0d @pT *T0`VPUzTP@00x5X5T5P5l5 - 0pL`P@0 ^000@S@0C@0000`ZP  r 0  @t<% 0p-Lp0s TT 0RHHr P@4bU0c00D0c "S00!000o!0PL 1pW)a0 S@10`PcU]0 0CSX@0 0CS@ TT 0R( 0R <qt Q!0@TtP0S:00 0R>*@DVt Q00 QP>d\@P d0 R} X0 >wt@\5T5D5h5d5l5x5P5X5L5Z55 -\0LT0L0L0@DP 0540 ,0 7hl5L5D5`5T5d5x5 P P p-P0P`0 0LR@ 0 R R00CRphp!0DS 00C0000h5d5\5 p-08`PLP @0U@Pp`5 -L - L p0   P5 -LM`@p0Pd K"d@P `00`H0H T wD5P5H5L5T5,0 (0$ 0c0ALZZ55 P-L@ p D 00 hK^IT?@hvtg -$0L x vX -Xp@LP P <`0T: 0S0UP`5X5 0-LPP @@ T0 0-0 L\+ 0P @ @T!:\$Q \ q 0_Qq 0_Q $Q\@T*@00L5P5tp5 0-0L@Q 00P:|0@0hlP P: U T00B0R T*0B0R T:T5l5L5 -1!L@P\j q``VE:\ 0$R \ r 0_RLUD r 0 R0@!0 ӑ  T q 00 _Q $QUU q 00  Q 00ӑ\`V* `yq 00  Q` 00r 0 R0, 0 &L5P5p5thCL}U{ -4LP $0 A 5L5 -0@LQ 0 Q 0 R 0`S Q0S0S0S0 SS CCQ0y0Sv0S  CD5L5P5XZ -0LD5 -0LP5 -H0H 0L S 40R L5P5p5 -H0H 0L Q 40R `L5D5p5 0-0 L P- 0P  @^!: P$Q @ P@ Pq 0_QPq 0_Q $Q@ P@^*0H@L5D5tp5 -L -L.0 gL5 -LD0<0< 800 00@@KD5x5T5P5L5X5 -L> -0L `R0 PhP0@z|0 p d@`0@fTPT0T @@@Th PZZD55H5T5P5x5L5 -T0L R D0404 00 0@t5PZp5ZZ - 0 0Lp55 -0 LA5p5 -0LZ -0L|PZ< P00( 0S P0CB̥50@ Q-L@!00@0@ QP =D0 @<0 40V 000p5t55 -LMpP` ȀȠ04 <0 8 0 00 , @@@@4 0 b00Z<08 040 00 ,0 0DJY Y (KT5D5H5P5L5DS p-0L@`0 ^P :ϠQAQ 00S 0U^@*ppL5p5D5P5 -|p|0LP R`*\@  `ʥ ƥ0 0 0 P5H5L5 -L@.P嬀`@P0 ㌠ 0 |pS030#0j0V 00@0Ttw0S:00L5`5x5X5\5 0-1L @Ts 1 RD0S S S "S 'S0S  B0S0S"S 'S 0S S S S S "S 'S0S B0S PU "U 'U PU U U00zP0 D0T'* P P "P 'P 0CT: P P0_0 P P "P 'P 0CT:"P 'PZt5p5 -l0l 0LS`\00000C0P 80 40 -$555L55] 0-PLM T@00Cs0 0K0KPK 00Cs088p5 p-d0LX RT@T`0PP8f8 1?1c"10c QpL5@555gfff -tpPlp@LX`d@D0 <0 40,0p pP5D5L5X5x5T55 -`PLP LPD < P0P0f 50%QA!V0Pfp p@@Tp e` PAP0 0 B cRW@@T P 1U@@+T00T0 0@Pt0S:\5L5P5\5d5h5x5 p-0L MP 0 K$KK a0a(@K @`PKp0 !$0 `xV P0AP[H aPU$PP5L5D5X  p-P`L@T @00TPc@PdH@p5L5 p-0 LQ 0Q` 0 pl`tP0P `0@d0S00CP 0p5H | 55 ^5L5 -0 0Q tt0 `L X0R 0`@RJ@dt5D5P5p5L5 -LB -L -H0H 0LQ 40Q,P5L5p5000 0Q 0 R P5D5t5 -T0T 0L Q @@0R `9L5D5p5 -1L Mxx 0,K n0nP(K4@K0K @`P3 U (4 ) ($K,00 (pcVW00S@ X (0  0R/S 0!U00SQ((4 0,-(0 vP5L5D5X -L -L -L -Lx -Lp -Lh -L` 0-0L^S@P Pe0@ P0 -0QLp @aT`*@DT:PPX`0@@0@^SDN(0P  5PZD5Z - MLMKK I0 , -1KZ<p`P@1p@0T-9K.yK@ ^KPEPE@T9 P0V 3 p1R5 h1R; `1RK-0KS20Zp0'81 @nP 0i-![ ^R@Z /`P, 0R*(KV Z ^Y *00hY ND bZAciĥ D5$^J -@0 PL 0px@`00Cs0 V U PP{PPVP5L5D5p5 -L,`p 9\ 0S  2 1C P@T@T 0U P0@T @ W0@0 Ps 00  0@@)&Kĥ5@50^ -p-ML M` 0 R0 $ P#  $ 0SQNK@D$ @D NK@D$@D $ 00\ | 0RKp$ }biJ 0-PLM00 @R 00   Rp0 RP0 R<0 R$00085 -h8LM \ 1T8  %@P 8P,8  $ȟ@0 i0 d 0@^ b0@X <0@R0 M C0@G c0@A #0t@; 0`@5 0L@/ 08@)0 $$ =0@0 0  0@ 0@ h0@ d0@0  B0l@ L0X@ l0@@ >0,@0 0 0  0@ *0@0  C0@ f0@ g0@0 <0 \ ?0L@ ?08@ 0$@0 0 0  .0@| _0@v0 q 0@k0 f0 |a 0l@[0 XV0 HQ A04@K U0 @E u0@?0 :0 50 0 y0A@) [0B@! [0C@ [0@D [0@  O0@ O0@ O0@D O0,H`@ [0`FP@ [0,P@ O0`@ O0P@ 00@@ 10(@ 20@ 30@ 40@ 50@ 60@ 70@ 80@ 90hPE `F5p@ [0@ [0@ [0@{D [0H@s(KP |5@55l<XZĥ 8 , | < p P @  t P X \  8 X  ( H | p L^ -0L @ 0S (<5##,h/#0 h'#`^h^T^ - @R0 000  0L P hĥ@5 -MLMŸ帢@^(@ `Pp: S B_ @T Q 0d @"T( 0R$KP" }낎KHH0"V^ 0S2@T@S PP0"1@T r@TUpAp t1@T @S P0}< 09P9U @8 P P0@T @S P0[21C 0@T @T PP"|TP L`"t@_<p"m|5iK|ĥp^T ^T^J^ -3#ML M3#3#3 `3 S3#帓K@A A@`, 1P48#`0e0||#Pp@@;0c00 F cDCD3  h10S$C\ 3" #0l0cCP00쒟002 `-(K CP40( Ks`(0K A2B"| R# @Z@Vm PF Pb PQT0, $2@ $0 -8KR000```P01@T p@T PVʂKAA PVpW@Z@W00S 0`!Q P0 0c, 0R'(KW! R 0S  ]F=gN0b0 0C07P0J]H5T5L5X5D5iP5Z5Zx55d55h5\55l5`55ZPZp555t55ĥT ^5J -PLp)`P- @eT: K PR 0gXR@ @ 0gR00@  LP Z 0gX(00W  ʼa -LM` 1 pPM]V 0U/00ń/\@0@0cS AP@P/\ /PP 0 0hCPN 00`3T >%P _ 'PP 8 0.S0S .Si 0.SmFP 0 0cS ںA@  0H0Y 1!0@'PP s$ f00 lRA@ d*1 `Y 10I(K@0S `0Vሁ5L* ` kH1`0S KPT U0U/S0: S SKnQP1: S  0 SU0U/S 0: S SR 1: S/0 0 PP 1H@` DA A!`@`K2QPLZ -0LM<p00 , BP@0U @PP0 8K(K8 4@ P(@ 4,U `jcFa@f$KZ -L`pP@PP0U* kPX0@` DA xAP@Pd 0A0b CahCZ! -L$MpD H0 0{S qPMP0UO*DH `0P(KPQ  z0C RS R {R0 }R0C ,RS  RS0S0Z0SP Z  Q8P ,  P U Q0P{S0P O }S ,,SQ 0 PD+(Koe1@` DA AP@P,Q, D0H0  @cj804 PBPc4 0`` D@@ 0 8<0  4 <@00< 40 @pZ0 P8P ,00,0 Z -tt`0@Lpw.@@PP0 P 0pQ0msZZaZ -LMPHK @  /0/S000  0S0 S 0@00 0  00 , O00 (0`K ``@   80 4 L 80  cR8K?P0  x  H    Z   0S PD0Q D0 D =ZHP  _ Q    00 ZPY 0 0 "" "Z  R Y ZV Y 0 -0  00C0 40S  00 Z !  0儠 0C0 p Z p$ $ $ @$ # # x#    D@T QA  Q0 R00S 0S0 `,0 R `Q !0J]S񟗀         4                   t  4                                                                R0 B 0Z Ze  RnL  000 00 0 R 00   00 䨐 0 00  R0 S0    R0(  0  x0 t x00| 0 R  pz0P/S@s0P/S W :S 0 cR ڀK> @ 0S 0SS|p0S" +S2 -S  U V0P PL8U |tQU 0S 80 cR8K=0S00 00 STd X@ , <`` X> S`S0@P {Z @K 00 Ep N)p |0〠 p A00 p 0 p 0 A   00#0CSp) ( p) ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( X*  3@Te  #T  Q00  0 9 00  000 RQI@T*T000 #0CS #450S:00 R 0@T@@@  0 @PD0   0@ U5Q00ST 0-S=S ?S@ 0S 4P 0S0   S0S 0 400c0 P 0P0 0#0C S81 * 81 * * * * * * * * * * * * * * * * * * * * * * * 1 * * p ' `p  !0P  $00(   0S @80 cR 8K<0Tp00S) 0  `p  0 $0( 0 0S @80 cR8Kv<0Tp00S)00 `p  p p Yp 004, ` `@TQ 0P0U*m  PZK 1 ( 000 ``, 000  80 4 Yc  /0S  Q   0SzczJQr0 t 3 0@  0  0 a P0UM*` ZP(KMZ$[,bpcZbbXZa([a4XLZ` T0Xܥ aaaZ 400c0 0+40S{pP 0P0Um*p0 P I@ 0@` DA SAP@P !P11 @`DA ?AP@P<@|  0S00 0R+00 %` 0` 40!0@P ac R0 00    00@"00@040jcpP0%S! ڣS S `V0S   0S` p  } ?P;PEW0 P40@XC *  0<0 ` X#Sk)pp@`R3 J`P( 0S K& J`@|P  4| 2f=  0D`     ` ` 4 0 | dPK@K0 i b0S @80 cR8K:00 R `0`PV 0S|[DP 0@S*S0]S @V*Vo@ 0Q  0S00S T  .:&00 Z?  P  0  SD V` A\P?0 00 c[P 0@S*S v  =R e ^POb@ 0 :S 0  00S     0 R  #70SS P@V @` @0'Z`0 R 0@T 0S 00SGg 00PI`PP Xp3X@ 00s03S+P@ 0 ^Pa@ 0]S  #0BS 8@pE\r^PP@ `aPU 0 T @g DA :A`p@#SRW@N`UK:0` 0>P p`@0` 0>P`EW20` (  N2p/@ PP`F  U  Q22p 0@P 2U @ -;X  t2000Y @ @ 0"00P00 Z4^ 2P 0 P 1 P  0@D&10; 0 8 Z P5 0S0 l .NP@@ 0  Z PU00SP NPP 0 P 0 00 00010  -PP 0@poZ]h0P@@  0_ 8XN0P0yXZ ZTY6LZZ]ܥZZ -LP`000iM  @0`|;X nR0 00P;000 #QXPMv30Pb -x0tp00lL @`0PPD0D05 @$>0000ZXZZZ 0-@LP M ,dM@P 0h  Zpb0PR000AS ܥ 0-PLM0( 0 , i AF/$ 0 0 R<  u 0S41  b/d@PA, R  (>. CpB K041,Q/#( 0 0% P H0 0. >$0 P0R@@!Q0  0S UC h0  .`$0@ Q 00ZZbZd9bbb -0LM  00  P,0 0P, K  0 .\? R>0 R@ 00 0;0  0S O@P 0 @ 0 R^ 0 RY `(X >$Q \KP00>X #,QT X 0HS񟗥I H H G F 0-S 08 KpP<0S! WN= P @0SP  YQ  :P3X W 0S 08C80CS4lQ M ,P K M M M LM N N N `O O O `O lH L L P S Q \R < R  ,>pWw 000 00 S<  0S0 00|,0-000S 0  P 0S!N< R0(Kxpy; R 0@H  (X[M @+\0KS C\K003SWr\+BmPh 0Se 8;Ra0 [0 R  0H0 R 0 RK-CP0: S`0Sz M0 Rt: @@d:  A4 0 29# R& 40 R" W [P .@40 R @440 0\9 0@40 @Rt ;40 R| 40i x0 O0 0 R  C0  * (\0K GS@O 0X XH (8XX@@O 00  0 0 0 0 p30 0<P0 000\0  7X 'P0 L 7'\KH0 D 0 0 0 0 0S00Q0#S0<\0 000 0 080K 0Sx 0 64 006@P t6 ("( [0DSXT0 r00@ 0Sg 0 Rc0 4 40 R 40 qP  y6Pg40040 4 0S0 0SB0 R> 0 dP-0  [0 .,5 5K@P 5 ("( 0DST0 00 0T00 0 @ 0 @ 0 R@@K <0@0  @I000 00 0S C0 A0 0  @{00 0 4 00 0 @Y4 !K++04 '0Sx|@4`UYYPP 0S0SLS 0 0P0  @nN0  8 Kwp2 @P@"0S 0SH,R{0 @% 0 @ @`K1@PVTBP<0P0PT ?8K @1 00 07 0 0g+4KR\0K ,!^Q 806*R+P+0 00 60 0  -0  @@0 0< 0< 0 0 P0 0=PPH|PJZZXZ xYbabYL $[YPhbcbd9cb B b pA `c@lc,Z4ZTYM\cܥpc@c0@ 0 Rd 4@80[ R`  `0`SQhTXX0SPPlTNXX PTAX0S P00V00SP 0DQU000 t0@ 0 0 0  0 S00P0#S\@8@K0T @V0 y0 40 RH 0T40 40 ,V0 e0 40 R48K ()e*'M LP -L$M< \@0 0,0 ` 0S<0 SH < <0@T8<0<) Q <0,) Q <0) Q- o/PpP(_1pP pU H  8 R=0H0 (01@PTs H0`< <0SX 0S <0S <0  xY<0S <0 R4 0D0 7 0R Ru Pp"0'0Q70 <00 R   0GXD R I p Q0SO 0 47@# R WDS5W4 V<@PTP  < <0S  `H 0PS @0 0H @0 0SE @\ <X 7U7 D 0@pW Q0SPU <0S < 00CSY<^ ] ] \] ] ] \] 8 <0  005 `0S 0SLe0 <0  8ş#000 < <0#20#0 ,4 <0<0 00@P 850$<<#04 <00< 0< S T(  @0,(KV7. XH XLD <0 `<0 R <0K 08 ~0,0 < 0@<0 R <0 0*Pq F P 0< l< 0 0,0 <, < 00D0  `3 , 3 R /ʺP  ( 0,0 H< 02Ģ@X`D@ B\ @0vŸ<0  @  0`, s] ,p n04M  b l2 , d XM 0,0 ]'g(<0@'K0 ; 0,0 K0`H0 <@ K<0 RS <0J 0' ~0,0 7<0  < 000<<0 ]I< 00<0@  L1@ H@ 00 0P01@0 0S @F Fy <}V<0 Sk`   0,0 , d0 'XZ L |u ZY@YPhbfZZTd`d4d$[b 6cxYdc[h]xcc" 0-L M$Q0 0 @R! ^0\ 0A|3SQ/ P 0R+K00ҹp3P000QP ^ K K  L0S0K\ K00r 0S. 00 0  0p0C 0 0S q q Q p,{!p 0Jp 00s03 0 e0p$S {  00p, 4   M0e@e$e 0-L M,P0@4K4 0@ (00K00H6-D0D 0lCQ  /10 00ZPZH6 - @L.00@6 -L 6PХ -LMP@- ḵP00PT"QaA0 10Q*(K90100CQ*00 0!  BR 0P!` pP4 ) P 0@0CpP 0 R @40 c0 0C0. 0PP `E̠E-K0 ED,K+K-0K*@K)PK ឵0  0`$0LZ@6[ZPZD6T6 -RLM@PB `0S  U@PER8u u u u u |u 0U `0 d0 h0 lX0 p W:0FS 0bC1AVV0a1,0 PL @-,0  ``  ZPZLZ -ML3M 3R, , 0R(Kh#00`#`LPTP H,I*P-u@PsT 0؂P  0@P0Sp` 0S0SZfJp J@ @0S00P :Sx py hy `y Xy Hx P0*2PI P PEV.*0S PEV:U&  RU! BKAA! 0!6- P$ cP@f @d T/ n7*5*P[@t000^@0 J0_ 0%9-P 3IKAP$$400Q+P8BXZiP6T6LeL6LZ @6D6[[XeO -<@L0S (0}/ }啶0 @ PZ[LZZ p-0L R PP P l`PdphpL0@D@@880( ,0 B @@P6L6@6T6D6LZPZZ -`PLl0V ``p0`C!VQA8 Y0`0Qe @F[ZPZLZ 0-L L0L@P P 0dCPB00P0PZZ -LMQ@,0 ``pᕳ PhEQT00?@AP*Z:a@ 即P X@0fPZ :,0S WP 0hCZPZ -D0D 0 LS:PS0C  0ZPZ`e p-LMPK`@+P P11 0 b! PU3 S'x0P?S0 b@@0 @{0P 1xS*U xVSTxD 80 x xT6ZPZe`ete -$!$A0LS`: q Q0 R 0B0 !00C0 V pP yP@ 00 R0 plP@f!@0 ,TP 00DPZZT6ԥLZ|Z -:LM$ `R pp p p p I)M'pV 00@CS0 0 0 0 0 0 0 0 0 0 ( t d < PPHx(&p0XA P YW pW 0S㰀 Q Z0S0S  @TK X  7  000 , q004 080 pP ^00S  8  bRڷ$P@ ᳯ ᯯ0 PpằP `g 0 .8KQ}yu(K6 3^ # Z 000   ᡱ$6@  q+ pPW  l0S0l Z o S[Qo @Y@X *P X  "X Z 0 r 3 Yy H%H5^ppQjZ00 ` & 0  fB!A|1@y1@ PP0 d k1Q00`Z  X 3R-h|dp`d\^ 00S 0Y   ZJ =㫰P 3P(00c  Z  `0P3F/P`U RoZ00 @  $10S00@Z  X 3Ro2pZ H IBWPbPP 03PP K mP`0T20 (0,0 00@ `4 8  1P08 @d\400c00b S8KV#8 @` RP _Y   aZ  @0@ 2004`#4`$@@ 41I80`@ cR8K#P@ 4, `²>q@~f@ gb40(([@ XZZenZfeetlTT6ZX U4T P@T ,40#00 W  @ 00CS0<0V 0P T 0@   T  }(KU<0@  o0$0!,ZX`6hOpc 0-0LQ2 0 @P ^ T\ Q  P 0S R pp0R`  0  H0H0 P 0S 0`6[XZTZhhhh -LM`00Ȃ000pSp Q  Q2 R  5P 0@`00@ 00|70@00 00/ 00 R 2 R 0S QZ 1QP̑b 0SX 1P 0S3 !f 0S0;00< S 0S, h,0\ 0P@ 0S 0S $!%/% 0S 0S U 0S0  'lPP 20 I7x0墶P0p;00D 00 lP@lT9 00XZZZ6D6laDY4YY(]i -L M0K pxH,KPP  RI Wx8@T `0S0C00$3`\# @Tz$V @HW. 0SB0SU0000 U00 0S W@ 2 R0x">0@  (K @[@ 0SȵPW`A00 R ܑVQPY  ͠8 1@0 t- pP0 -  㯠0@ pPP80  @  ✠,0!@"$k괐D /0S0n  &x 0S T0P@w_8 0L,ZܥHiPhX6h6i(iD6i@iLiOpclapi -LM$`K@p( LPTP  KP0 0S$ @ 6T0d0K0P 0 P 0S 0S @ @  R@ $0!o@,Z[i`6Opc 0-LMPK x0P h  }@8008, @ ן8,Zd6iii p-8@LTP` `@T P @P`Tp -LM$pK` P嬟 K@P'  R 0S P @ 㗟KP{7 \@UUb  { 0! @,ZpcO0800 R <0S0 x6[ -LM@K 8R40 R 000 E,Zd6 -LM0  Pi@(K,K ,-(%`V00 0 0000S D0S $p0``0$00U:PP@0#SuTs 4@ Rnᴳ|PP@@T zd$0S Q  c44 R  4Z0$(33 ~T<Z @  ͞#pW00| 3P \5 0S0 R  + 0@ 0$@,00@D34(  , 0"0002@8`p`{   ㉞,A. @嬨`T2   | @ 0p00% o(" 0S DD H&8@T $(A&@T  *#!@}1 ,ttp}!#@l Z E 5X!0S = @!0S 1d`1@!@ 1@ @@:B3 0I$HR 0S 2 2_0@P  l @` PD@D 1T,Z6d6\6ZXZ6D6`6[@Y4j@jLZ4ZY|jljjXjp6`jh]]HO(] -RLQ5 0S^ܢ܂P0Br `D@D 1T0rS Bb0S PxP d2 00U P@ P8m&h 0 "S Br `D0@D2 T 0S m\9! |1Aq `D@D q1T 0SdP90Sh1 R80P0Hj00aP @20S#  I10R n\ P15 GP00l&5 <00P`5x 000x4T &P00KXZ6DO(]TZ6إlahak_jjjj -1L@TX pQpqpa@T 0Q 0S S0% P 0S @TP{ 0R 0S㝱 0SP 0S 0 R0Q`0  hT@QH0u P p ``6[XZTZإD p-LMxa0S'0@KP $KP P $P T M0$aS 1 R AP#0eP&R8Kp@P QTPPI14 _A)4h WP8 4H NP/4$ E6إTZDla`k 0R, SK 0 , b  nR,,PL 0 R Pq 2  0 <@@$00$0"<0Q0$ $ $Pa $00$0000<0@ 0  $0S `1 R, *,P`0S7 W@5 * RH  00S< 00S60 S6$00p p0S Y)0t |0,n<0   f@ZXZPYZYܥZtZ([Z p-1L R 0 0P0@0 p`0SP 0  0P0@0phyx@\T0 0R0 P 0 0R@0a P 00p6Z6 - 1LM  0(,0 ( ,00P40 0 p@`T`\T00S 0 R00 @``40 cRP4KP[T@p ]TpGW00S T000( `w3$KZZ6 -LM0/K,0  " ?@ 0@ 2 ! >K*.KH! 0  B 凞101 ? @  p@`00`" <` `X/ P\PH @ϟ0S00B P P #PL f? $0 0$0.0S, 奟Kb  P\P Ο0S00 X V V00.01 cRKp V4   p t P | 0S0C0  P\P ͟0S00 )P \X[ `X $X  00p8= R X-!X  $01 P\P (͟0S0@0 @ TT T !Tc 00D-T S}t  l 00  " PK@K T T% T# @-0KU t  P\P \̟0S0@0 n@TPKhPU+1PUO 0 !RK 0(n0˟00; 0 0< 6}Xm |X (Xw @X*X ?X+X !X 'X \X= "Xm000 Y 0 p`0)X |Xt (X 0 0 0 Y p 00"X \XP* P\P ʟ0S00 $X> "X; X9  \00 p2\X 'X "X, 0 `0 p(X000 )X p}X1 IY 0`0p"X1 IY{ `00 p'X00p1 IYe ` V 8 00 p B `X0u \X  P\P ȟ0S00$P "P? P \00py)X (X000 'XI 50 V0S0T0 0  Y * 0 p`0Y0S 'Xx @T~1 IY, `@ pB"Xr \X@00@0C0(X@@@ O"X 'Xd  000@X' P\P @ǟ0S00(P 000 Y] 0p`0(P Zt x00 }N[X`  .P [00 p` P\P HƟ0S00P00pP00p0 Y 0 0 0C%00 pS  `0S CCR 0S BR 0S0C`0L% P\P 4ş0S0P0 P(U| {U 000@ X0 0 1@ cRK @P P\P ğ0S0P0 yP00  0 X  pV $ P\P ğ0S0@0 Y@$T "T  1 cRK pT3 0\  p@) 0@0p 001 IY ` p00 p1 cRK p P$<XPP>X V`  Af V` 00 !`T0FXbSB(@T0"0PQA  `-T0S   x#@  #@Pz 0w 0S  0To   0Tj < 0S (  @lh0 <0$1 ⵚO 00 p0W S WV奚(X* ;X |X>0 P\PK 0S00EX^ |X&PF+ )000 p`0j\TA `T?  $ ;itPZ|YYYi([ZZXZP00S00 &P Z00 0|P0@00 000 0 傘7E`KPs 00p0S @1 cRKp00  0pSP(YA0S p:K@00E  KKf  K  K`$0 0 sp  K  K.!p0 Yc 0`0Y` Q@ dTb00( 0C p( B`0 ! 0S    0B)000: < 1 ! 10 1  `0P pa P\P 40S0@0 @T W T p0T 1 cRKL`@`P P\P0S TT @ UC 1 cRK+@P@8  P\P P0S0P0 P U 1` cRK @`P; R P\P+ 0S00%(P( D  K0pPC  K  K~  KM  KH;9  K?P  K7;XȀ |Xㆀ =&XK00  K#AH   PP1 " h=R }R(d= |0(00 00 < ^0`!8000C02 S " :2,,tx  KP"  KWh.>X00`0  KF  K>X00) 00 P\P 0S00 -P0 00U000,06 -LlM℁P`U @Th P~H{080 `PG K:ՓpP000T\S/% `%œ@PPD0 R ㊖00@`P P0: S 0@ 0@0W0P `?㟓@P 00d0K 0@0W0P$K6LZXZ 0-LlMP@PPpd 0T  KP 0@ 0@K00: ST0K 0@6LZ p-LlMB  | P@@PPR@ X1PUC P K`P0: S 0@ 0@PUKp@ <0 XK  0XKS `0S& * @,0SBa)XK0S0SD+P 00Pd0S666fdl|\l6 0-@PL 4P@T  0R@T0[ -$0L@T @TZ p-t`LPU R @0@8C8S @TO0 0PU 00pZ -(@L0 01h\Z -laLPp0S  0R:0 R @@ T 0Q A@+ T 0S 0S Ws 00h `V0 R 0 xP0@CTT WR%HPꎟ@0 P42 ZYXZxYTZ(] -P`LpGP@pP⿔ P00 Q @Z P-@L 0 RP0S 02n T000eИPPh0 R \0 RH 000 <ܦ -pPLDM䀟00PQ0S$ @ $ 0R) Kq`nT@P0e@@Td`K Ѹ p3 0 0Š`iZ4P 0-LM@P K0S  P00Q0Sp008 0-LP@P0Z p-`PPLP @ᆊ Pup 0-L,MxP0>Kp0 @Q X0 R%\<000 0RK0+iHPXZZKD40D !R 0-S+S00S 0SQ h!0S#0D0 \ t1S P D0! R  t1S 0S w0S  7x\ D 1  Q 01 0Sl t1SD D  ! tD1S1 0D S D<66HPoXZ4eosto|oX+ XT! o 0-@QLP╈0 00h0@-@Q$ /Q``V/Q P Q7 .Q \ /000S/S 0S/S/Q00/^^ 0 .^0p/SS0&\00S \/00 0 P0 \.00\ L U*0/S -`QLM`< /QpPy .Q8 | < X 80S40 00 ,0 , 0S:S00S,0   0S:S00S Q00,0 P00<R04 0 ,  0/S4  0  000 4 ,0 Y 0SR0,0  0c0@c P0 bR,@ )80S<0(K40@ cR4P@4 4 0 S/R/000@80 00< .S0S/S000#80 Xy8 4 0 , 0@ cRP@  0 S/R/00Pܥ -MLM0 c1\, @ TPA @/T@/T T9 /㊄P `eP V9 V:  @/00 0 0  cR@B^K pPE⚂PEp P@'( K0tC,$[/R0  0a P PZ, 0 R(K.T.T0.S Y0y/S0Sፄ`ipQ -LM@~0     00 K 0  fP 0Q/0000 `KZ -`PL@$ SP0Up T t0T l0h耆LpP PĆ T0@P@ZZܥZLZ 0- L @ 0  0 0S[ :Q0 a/ 0ԑ0 0 P0  00h t @$0 0 q -`L p 0SL;z ( S , 0P@aT#T PP@`0S[` k`  0Q$ 0% ` 009 0~`j`0i `0` P000 0= S,  @0  d0d`0 0 `$004q -P L`pM WP@T 0P Wd@ 0 0 dX`0 WXDp X0Q@ @`Td#T! 3P`@`e0S#0 ;0\ 00$ \WL ~X ΀ 0 0h0 0Hq\q 0-@PLP  0h0 p-LM @`, v  0`KS' PK+ ܏P P0S  ;00`$0x R 0 B `0xT$H $0`0p`  tqq -LQ@M0\ ,0 H H X  P %P`  R 0 B 0HH P0 H00H0 @, 0HR(K0pT0 P0 L0 W 0GLSLD C C D C C C C C C \D DD C ,D D C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C 0 ~ @0G0 P 00D@SP 000L0 X EpUpUX `T P plWpL0L@0  `L0 L {L p `L uL0 ` LppL lL p,0 `L P0 dLp `L ^L0p0 `L0 X\ L \0 X   pX `\ P JL p `L DL p `L >X0Sp `\ T0 6 pL\ X  b `L T )A0G0S 0LP pc0G\L S HI E I I I I E I I I I I E E I I I I E I I E L p L L0;@L0 \\ `d0GSHF I I I I HF I I I I I H (H I I I I hF I I (H V0X0 Pu`X ,Kh  0d -d0l 0d 娃 P`duWt XQ -00lh lL  XL T L T XPL0TPh p L Pe= S L0 p0pUX@0C0 0 @0T 0S @d TdHH US@0 B @Tp0  R @TH  H >L 3#,Kh %2> &BP0`lLT ^x0X00L L00B0Bh0l,Kh 1>A P0 0` lL: 0R 000lhlx,KuL  0\0\  P`P`\ \ &L\ 0 L \ CKC0KL!40#0X0S^ \CKCpK\0\0 02\ d Xdh lA-P+PR PP 0P 0pT0Sf 0C0 00 HHXH 0xS0SW 0C0 00 H  H0pH 0L05 +00lhl @`` 0 B p0` @0T  R d &` @0TdH00ePH0 0S 0C0 00 H00H0pH0 L E 00lhl d d d d d di([Qoqq --LM0 0 4 K 0-@LP" 50u    P  &P0 : @0 P@ 00 00 0S P0 X0PS 0@0 0p  q - L @ 0S# & -*  P 0S0 0S0:0x  $00Np 0+ 0 00$ 0q - L@ R 0 B 0,p Rq -P L@3 T6 pD `Q!   AP 00a0S@@ |pW   0Xd0P0 `\p Q V`KT`r -P Lp! X `$R9p R V@@ | 0`d d0Vp0 V f4X ` 0;r,r 0-0L@P 0P  0000   ,嵀00 0- 0LS@P >P P 0P 0P 0 0- 0LS@P'P 9PP0  0,倀0,{0 -L^\`pP@%T㼀& 0W, pE <  p0$ (P PPPB0BSU@P?ppE{k(}0lo@Z@r --L4MD@K0B 0 0 SVK -p-`P00PQ0 L4MS P 0LL@K0 0 0 2P4KpXr -pl`LP@)# T P (0V0W< `0``0$     \d T NP PPp P PPpPprxr -l`LPp@% T9 V`+0 0,0$ (` p ` P   PPP P PPH[P 0\00@0Zr -@`L#0p00 0,0< (0P z@P T00ӧ2 0 o3Q00 㳨ժX@,"Z@- 00,7Z0  ,7 -<0@L 4  @     Z p-LP`@@P`p p-@L0`S 0 P p00P@0T * 00p00@[X0T0@` DA A000 0@@P4787ZܥZ -RL0pS@3Q0@A00T2 P- T<2P``V 0T0 XQ P@0T*00T+ T4 T- T: 0DSLQB`1 P1 R|1@` DA ~A000 0@@P41P``(P``Q 1{`p`3)P``0  0{`p`3TEP0  0BS Q` L M`P H040R@0@ `w4787|YZZRhR|RRR -PPLML H00@!@1  Q@ - EQ5 Q 1P AQ 0 S P0AS0KK0K@K0  /P 0  QP 0x  X\ 0KT  0p @|= @0@40 8 < |ԭ@0l S` 0P0=URʨMUq0KU t tt 0KlpP `p1@U@PBPUt  t 00K00Sb h7 7P_ {P0Cd0 N0 Sh \ i d0P 7@Tz`0pSr 6 (P0@@P0 &00P 6 |P  U:t@f DA @z&A0P@0`P||P T1@@ f %z)]%0S d0S  O\Q\ hp p0\p Sx5 J ED5@f DA yA`P 5 %h t0K 5t P<@40PT*$! <@ <@40T*4lp  `<@ S P0 ylpP`t E@P $y  0 0 4 3  PwU*00Pp3@f DA yAP`@@3  &0U0;0g0S7<80 0c0S783 RC0S!3 P<- `X :2@g DA LyA@p`@ 00Uap0P_vP|t, <80 0c0SX2 R40\?*(00< f d P;PppT;p f yd OU8h1@` DA xA @4@ @8 < ,8(1@` DA xA @4@ @8 < 80 @` DA xA @4@ 8 < 0@f DA xA`P)P806`t w0UuP} uPx |uPLrZ4787 xY X X ] ZX"0@0Sb0"0 0S! 0!@ T! ! !0PU 000 !  0S @\)| t!}0S00T!uPU 0 RH80  RX00  R(l0  R L0 R^FPfP ^@D@TY00S@ l7tH([ (0 R00PP0XZ P-L@ 0 p-D`L0@ PR  a+ e 00b 0p7 p-@QLP! R `0 Q 0Q 0  + 000pT`  0Spp0 a+ 00 07 0-hPL@T\@D P0R  P 0,0 0S0C00004H7?7 0 0  U+7PH 0-4@4P0L H+0 0 07HP `,0R- 00+G7?P0 0ࢿdH`HZ -pPLP@`0e R0@0Q~0U0C0P 00 0b@A~0U00P 8~8 0U00.~0U00PXH\H -PL@4M<$< 0,4<<0 pP@p WV0`@T3`VG3 Vb 4 у 0U{3# @<0S 4 _QQ„ V^00@0!0<0pWS0N 040  VP\ 0SYW00S4 0 Q 0 V0WP ژ 0?, PÐ @ 0 ` 0f S,0 0P0@  D `~@TD b$2`?ÐY 0@m 0` S PPT M0 V0 0C V00@p40 W0040  V080   0Q00l 0C 8 00@!V@8 0P 0 qS 0S  F}000PU@08 0S  +@R<@ P0S | 0 $}0@0004S  , 00c0(KP @>@H7hHxHlHXZ\HXH|H -`0` \0@L \T | |$0$  0 xHtHlH\HXH|H -,@L0S V_0000LHLZ -L|hT} 0- P@L?_0h;_LZ -L0L @R TT^|@@$h| |@XZtw 0-@P LZ 0 00h p-X`@L;_P7_ Z0 0 pLZ -LM@Pa0SW P 00|q$K(K0 @,K @w`PJ (1 ($9 $0V0 P,0AP|\ wP#U0( bQ P0P00Ť0 00 @@ K lP P4Q (0Ph@@6P`77( @H4H8HDHH -L MK0 K @KK @qw@P {|xK -L$M@PPb0S S P 00吢U0 ,K0K4K8@K @[tp@0 P0C 0 ' D0 P[L$0P埬@H7լ.Pը^0l0ŠnN cR0N 0NRtN lNh.0XP.X  U  U0  c> B > . >.@@LEvQ4  P 00 S 8v@t) R ] 0S 0S 0S# RPH \  L 8-0 0 @[00,QB T00^@  T  0 TPPU Qb Q < R B 0AL c0  "P< 0S P"0S S S00j000S 00LPm0 x  T00e ˟0  @0 000D S` `˟Q\;X;  H;  @ T " +0000010DS 00D 0 1:ʟ @ T  *0 00D Sp 0!0000C00 T T`` 0(*TT 0T 0T :'Q{  :@ 9 R 0  R)l9@ M0 0 0C0 TT70  R@9 ^0 0@0$0  00^u@t }t {tu R8 0 R0W $8PȟȟH yP0S cQsQ CQ d8P#P8 po8   0 B y T TPP& '10DSP00D P 0iǟ`@` P 0 S0@ @@NT t t ttH0 SD Q  6D 0 0 (Kt&0SLƟ00*Ɵ0 ( 0A00ct P$Is\@T] P6 D 00`0 0Ɵ 00@m5@T5 R@0T 0T 00ST  R %PTd`  p   b,P% #@E! 00C0>0 R84 0@ L4 P 3ß P @ğ@$a00@yP P. pc00v3! R|S0 0CR4#@0#Q@3 $ß0 @0S 0P0 0ż/ 20P~ @ R B0 0P0 0 з0C 0 0QH2P0" @0S 0 ` a1 0 f0b 00R0bP0`l"2`<0 @0K0` 0PFP @ `v}PE`X@ ڰ 00z P  aU 1 0Pc 0/T PP  XPx\b,10cSsS8 CS6 2 rP aX )0  c 00 0;HH? X|S 0R KS| izzw -LGMđ0Pp,0 g 0S@`KS@' ,S0 0,SSBKHH j ,> 0/FpP; IKAfp: ~|41` V,0@SV1S   Q RQ\ ^00\0S l|`, 0R(KD| 8q~S~ $k~|iX{8{{${zw p-L M`P 0(0P`0,P 4@0 0 0 L400 PPKp{xt{4z p-0St0``QLP @3!   @~@Q0S pQ{i{ -LMMMNnK`F0`F@/㸀K,0 prO[K mO"K hO dO Ka=!0,2 0 (2 $ UPP6NK@  0= 0 8ONK@D0@D ,2 ( $B t t U@ 1O -O  )OT NK@x(, 0R(K}ip(B¨{t{{x p-LM`0.^K@/0 Oh0 ,K <P0 HUPKH 0RKpy}ibp'B¼{x -MLMD0PQ,0 p H  'GP +N |CTPJ cT zT0UCTUCKHH/N2"2CT(K! W`` 0( K@V0@  1 吡 W00 S[K=00 'U@ Ntg  A, 0Rb(K0[K PK`uN qN10 x1 pQ |a T@PJt1S* 0 |1 x! pq  0ZDp@8 JKAA}p6 |@4[K 1 >N0 D1 0Ch! |A x1 @! lA pq 0  *NPz||Jzt|phBz`| T|| @|i|tbp&BX|{{ |h|$x4|P|{${ -LWM 0`(0 pXpP* OK/M ,` xT@P"YnKK`F./M0$K0 ᳀ r cTP7|( 0R $KD, I| 40y(A|$yix|BbB$B¤||4x -ML M/NK0 /`q(0 M0 2 )T@P0K00S$^^KPE PE2KMP 00@S,yM0x 5 @C TP V( 0R$K({$&{ibp B"Bø|@x| p-LM@a0_K@/0 FM !0d0C Sx  h  h h h h h h h h h  h    Sy0$0 0 SP-Kr0gS 0R|| 0RKp0$0 0$0 0$0 0$0 ({$ib|p#Bl`U||Tx -\LM0OK /,0 L4&4Ɵ0 (3 vS@P 0Sw ş, 0Rv(K;K!0SjKA AI  I , L%ş0e6 9u4 (K0P)|0PGS@PO)R KLP9S (K06PK8C8sj@K 6K %YL( K0S3S4 , $    dQt $4QppA?KK $:L3s s 4 R K Kj>C^ c^ KP6KjK 0K@K p>3S b'}KpGpG`/HL#09 9 g 7 RP7S       p G 3CSL GW`3 Rt  K >L#(KH0( K<#(KFK(#K6[SW V@K :6[SI PK 9 0KχKݺ2 RK3`S)0 S) "儢 7K p"K3CS GWK@H"H2K@<840,b=a;b9b7b5a3PK 9V@K 90K@!PlKT  0P儺OK0K0@!PYKC^+p 0KKjKX!MKPPPP!P1g 3S0C9 $  0KKK6KjKR3S9 yyy ibp B(*"B8}\}}}}b}!B \~~bP}@~H~P~8~,~}$~l}d}}t}p~h~}~}D}0}}} }(}}~||`x -L`M0xpKP `(0 9:@KP @@.P8KP @|K< |\ ( 0 R$K|K< m|\< b|i~hx -MLM 0/KA A ,0 + POKℂ/J;lr 3K; TK00 PQP2Sd St ZNK@D@D/J0 5 C0@3S3& # # # # & # # # # # # & & # d& # # # # # # # # # # # # # # H& & % % # # # % % # p% P% # # # <% 0% $ $ # $ $ $4p$0cP1 @ P`T ?K P?tp0 Q"#U U U U0 @ 0@0 0@0 Iu4 {#0 @P`0# 2 q3 m1 K@"3R_ 0%u Xl3x#SX#8 @P`# K8303 G0@P`B(3 >0@P`92@ P00@ S` . 0K@ C2S8#82 "0 @# P `" `"0@P`D" 0@P`02 02 " 0@ P`" ! 0@P` 112 1 /x, 0RB(KbV=  SV08LcSp= 8..K0@ N@P2K1" 0`V V"h 0@0 P #U]tZt|WttTtl0 D0Ot\4 viȬp b+|xĀbbtx|Bbx4 | -LP -0L fidH -L M@PmO!ὒp1` fRp0`S.S0C  " P5 A1!O @_@P 0GP (KQ0`S.Sp0C  .S W000 4K4` 0p , [P m00CV꘠@0@* ?Tᚐ)Ac 0TPS0C Px0T0Ct0PS0 C RY  þ( ȬgfffE 0-,@,PL(  dil -LM  QP: K -p* 0#4 BP; K p 0#4 `[KUPspsd@dd d0墵TsO @,8 ,0唵ЁāTVx]$ -L$Mp L QPP= -QPv 7PD H 5b e0S㨂 <@P *ڀ2WTT p gs PY&u $u(KT000>P@Rs@LLskD H huH0SS %PKZ00X ᏑP8(40!Ϡ @0`,`?AlN3c @K@@ Q !Q0 0l0 \0 0XPCP <0 e 0,0 00 0 0 0ccb4 0-\PL0S S0@ S 00@0)cb -LNM`0\(0 0P S:NKXT1*D1S8 @1Ho@RPa0P Sv` .`P V?K嘆P 4P=@hF@( 0R$KP.@JOK I`$ (0Rpp31<`$ (0Rpp&$/`0D S񟗯A A A t? t? t? t? t? t? t? t? XA A @ O `dOPpp`VOpPp`IOPpp`;O`/Oppp3`" Kc p-L|`P0S @PP 0PS pc p-LT`@0S PkP 0@S pwc 0-@PL+TlAPX0H0@ R0S(>:x]cc! -0L idp-0 CR 0R0 SG00 -PTL8Mp`@MPP NP@"pp3&@pK0K`< , K00 @` }@@P,00,0 J9PPm , @0< ,0 0 @@b@P \noXK 3?pL0T PR0T0 T0@`5K,0T@X >\P <\00S \ 0   \PPI40[S  5[0Sl|t ዯ`@L0VU D00S8 W $(K+܃  -0L $id -0LAM @Pp  Bp sPp  8p0` fRAT @SPNKPP W.i@PPnnidȬ$ -@LM `P%@ !@00 Q03*,  0,, pW00P0 U 00 @ep 0 -P02@0P5 :0-P *0@@,0 PdW p脧 0-LXM@P% @\@0P00 lK-럟`00\0P0  :]2K0)cc -LXM@%\@0P00 hK-z\00X0P0  :n82K)cc -Lp`,P3*@P04`0K*K0C8M4>K0C4A=K(0C4$QK 0B*K44(I C:K$$P0B*Kp(I4 0 S9M R M R R R R R R R R @P LR dR 40S0000 0 0*$(p 0%  (00?0bS fS)0S00 < 4<̠Č8#Č:K"̌,K$,4, ,*K 0$880Si0 0000 0 0:K P$ Z0`<`:KdK G(pM0`04Z@` 0  0Kj P T d K:P @T`P d "p@ d0Kp @T ` 0`*K@yV@ 0SS h8+P 080(x0 0S$k $@`PO dK %,dK<K-.3[0C3K:K3[dKS3dK H. R)0S S S"Z  Z:Kp0S   p ,<4("4!< 03[0C3KA3[Sm0`$j0V0 0000'0S<0 00S 0SU0000 0T`0 000 00S0T0 0-0 000 000 0(K0` p-PPL^@00*`,(@P L00040P0 ''@*p M -L@M` Pc= _=0 \13000 55:W00000 0 S,0 ,, pW0000P U>*0  0 @ep 0 -+P02@0P5 :*0 $+P $*0 @@00 PdW p0@ TP3 : 0S 0 0@ 0@,0qU dP"(K舧 p-LXMP@`"0 |P0P00 pK*발d00 `0P0 @@ :f@ m/T  00圜@Kp)s,s 0-LXMP@"u P@lK*|`00\ \0P PP :1@8/T (0 g@00SK0)s,s -L@"000  Ph)G-M T 0 $0@(@ P,P`0`p 4p@0Tp  <0P<` 0Ԣ($ 0,($0P00P4@ h ! @(`$, <@0g\ P. 0@!g.,P(@T<@`0$ 04@, p$0( 04$(0Dp4pHXLP @ @0 ! 0@!0@ Q18 P!@`!@08P! LPpHI$PDHpf.. 0 p 8D0#Hpj!E$ 0#j 0P%@@X@ 0H @^LP@D PpX  `DHL@PPT@00P0 00 pD0 00H000000000 L@000 PP`000ЍG-M0@ Q0@0@0@0@0@0@0@0@0@0@0@|0@t0x@<0@@408@,00@aAq@P `(p08! AQaq ,0d481Q   0p^P0Qp nt ^Q nt 8tP@ t ~ 8tPp t 8t0P0L0#,0 #(8 , 4 #@ H0 < D H #",#,L P H .(#T X H "D0\ #<`0 D d "(h D0l #4p0 @Dp.\..40[8[T@[?  08^P0Q8 n< ?^Q@ n< 7<P@ < n8 7<P8 < 7<0P0D0#<00 , D04 #880 @0D#\#.pT.l0[#4<8[0@0 @P劐pP0(Ko: 0-PL@ 0#<00#800#400 R0 0h7 -pRLPw D@A1>0O `cWP: 5@1@ T@D SH0 0@H0L@pf.5@1 0S@DBR@H0 0@H0L@@00 @TpG†@0D@ S H00 @H0L@`W W  P5@1 0S@D RH0 0@H0L@ \00-PLP 7@0@0D@H0L@0 -RL`? D@A1>?0( @PcXPp: =5@0!0@@0D@e`.5@0!0@@0D@T@00 @@0D@@H@?X X  P5@0!0@@0D@ D00-PLP 6@0@0D@0 -LXMP`@dp 0+PZ0 S 0U 0p xK_$d0 s000Jl00d0 KQ`0 S0$00DS$0 0!$0D -MLM`p# PP' 0V0 BNK@D@D 0PP0 Z P4 W\  9 /6`p  P#$K@s  -L0M`PpP) K.0 P 0S ٕ0"S UD@K 600 KBP(@嬁u("(04"48#K -鈑LM`, W0RSd0 S SMZK hP0U UP SBU U8p UpK0C*KK0C*K8K8R-K( B( C:KԨبpJ( A((0B8 8PC 0 SdTKpPh rS-@L`P"@3:@p 0P@5@3p 0-@LP 00>,@r.0 > 0hsXP0, 0-@LP 00>,@r.0 > 0hXP0, p-LM 0`|>0tr.@l>PX>\00SgP  0`P@>KpXP0,T 0- 00@R@ @0hb>tp 0-0@LPW> 0 0PQ>0p p-LM⡐`  0nxPP  `0cP@ 0` 4P0S( ~ 000x蜈tl -LMT@Pp ( K0 PE$0(SA`@P0S0P0S0 @K  G CP0P@S0P0S0 P0S0$P0S0 (((0$ 0cR00  Kt -LM, `p=00S`P` 05@KVP300K ,PK50K0 0 @KP@@ < yX0PP`U4@0PY`=v3(Kptx -LMK@$@, ;P@ Kx -LM`=00SP x@K0 00 200K娻 H KD+@0 @ +P,@@ ?=Kptx -L0Mp, `)=00SP`' 0Vἀ,K,0PP@1@#TPK 10T0K@h  4K04P 0@ P`T0PU8@0P0S`<v3(Kptx -LMK@$@, ;P@ Kx000 0 000ᄋ -LnQS(0  hH00 -0LM0@` @0s 0P$pK L$ P00R0SP :R Ur 000RPU$ @t 0-LP@P 0 S Sp00@ r 0R <P  0豎000tn -L0P贎 -MLM3PP"0, 00S S0B,0 , 0R-,0(K0  CCP  .@PRnK`F`FKK,KPe00(K踈` -ML MpPP#1, 00S S0B,0 , 0R,,0(K0   C CbP ^@PBnK`F `F2K,KNP 00(K踈` -LM@`p@P0 P@ Pp-K茧Ĉ -LhMP`p@2  0 P0 S 0  0xKd0 s׍l00d0 K -LPpa`@P d000S@  S@ @p080400<0 0\0B謒 -LM@A0p8`PDH 0P' A0S#XPU H 0-0KR0,0KI00SR I0P P,KazP0,K j- -K-K -L$MP` LK 0 Sh S S A 0R0R0TS@0SQ@0S  4K*K0C M8>K0C8a=K(0C8Q=K(0C8(P 0B*K88 C:K((40B*K88( C:K( 0 SP D h D D D D D D D D  $ 40P0 P 0000 SL0SRL0S 000 00S0  .V S:V` 00FV08 KPw40p@P  `p 8K pP@L뀋0 00kp 0x (00?0bS fS0S4 0R  0 :K(45<*K 0880S 0RPX:K P(t 0S<`:K(05`P0`0*K84pL*KpK )p/0`0>:K8S@ p K%P@pH KP TpH KPHK 6P`P l p@p0Kp @ T HK 3p`*K@QV@P`0S 8P 080(pw0 0S$0P04 $`B@P  pKpKHKnK`F4[0C4K4[pKS:K"r_*KpK:K8"`VR0S SL- S SG6Z:K %<*KP8*K$"2Z0*K}P**K Gp#:K ZY:K 6*K Z Y :K (*K p 4[0C4K4[S@$ T>0 000090S <L sp`+0 0+0S00 S0S0P@00 00 0P0S00 00S0P0 0 -0 000 000 0'`(K` -L@`pP 0I@{ -`PL@ىP00mpPP d0T04@0 T0L0`P0 VSPpx   -LMB^KM`PE@p x0OP 0 @j@P <00+PP<4p8?@ K -L@P 0@0B -LMBKMH@`Hp 0 S񟗶  l 0D00W0 pS048 oP@ 00 00(S 000,@P. @p0S( 0S%$ 00D0 0 0S00< S00<000D0s00 0  00($p-0 0 ?(K -L@`p6P 0@, -0-LPM@a?KC/_K@0 Q Q (06Kp@ `@ /),0 pK\ L0 ,P l  K0 -L1M`0pPKA4 8 0 p 1S01 R rP 8 00000C00S3P0 r [000%R@QgQP'eQG*GQEQC*9Q0Qk*%QA *QP Q7 AQ6 DQd[Qq OQf XQj LQBcQLP aQ!pQ jQ3 hQ4 iQKnQ LlQ1tQ6 qQ1 sQ xQD zQ. uQ=PP0SP 0S0 0C rK@@0hS@@0lS@@L@@ 000C @0 w 0# t@K0lKl"K60^S  0J_C0 S RJ!- JK0P-S ]S S@Q00]Q0SJ_K0 RLP8"K @0 2  0p0p@  0p p @p p 0Oq '000 @ 003  P0S P0S P  00CS0P0 r T000U񟗶D Ь X  PT0*0PdP # 0hP P 0zP 4p4 X P0P0CU  SP U/0(K 01SSU$@P0X0C000  0SP Ti (K001SSPTd 43p043 HX @ 0@ B0T0  RP 0 r U000 'P@ 0C00X0  0ScP 0 r 000 4 0d p4 dT0HʏKS8SJS0 9R 8R%*0R +R+ -RH(XR+ A0BSAaR>:fRxR:0PI0 J"00003 J000S03 03 S  :J   60K0UI0 0 0CS0000PU  ?K0CUUɥUXPxPPE¥ ;-0 80#80#   0p@  0p 0p @pp4# 4# 8 0`_ H?K8RPPJ,0 9R 0RJ#*-R .R +R!ER eR  J  J9S:J0 0CS0000wPX   _K@PEtLT-xePEP Bx?;0 8I0p@ 8a0p8%0p4# 4# 8S 0e4P4 4(Kt -DpL0`S@Ps 0@Ss蔻 -L M0`ჀpBX?0S 0@P03Lp @ d0P0!Lp@  '_@  b%$K -Lpp p'  @0S1'*p7@ @0S1 8CX0 8CXp@  P 1 A P<70  c`<7 p, 0R<000`< & 00 0d P`V U00D< 0DO/K<' D %2 <>&B aP`< <'O?KPbdU87L7 Z 0K⠡K)0KL7 < P)0[Lp'PS*0[H H SHH  t' ,h7H@lT`$H` \0 R0\0 ` xdK PK@DT 0@` \0 0R\0 ` xdKPpK)0[S )0K000`  \0R0\0 ` xdKPZK*0[S 00+0K+0K000` \0 R0\0 ` xdKPBKtP,hH'@bTT`$H` \0 R0\0 ` xdKP'K@DT 0@` \0 0R\0 ` xdKPKL7@eT`$H` \0 R0\0 ` xdKPK@DT 0@` \0 0R\0 ` xdKmPKp <!` \0 0dQ,ާd `'R80S\:000`  \0R0\0 ` xdKDPK87Sp 00d`  \0R0\0 ` xdK+PK80@cTjP$(` \0 R0\0 ` xdKPK@DT0`@` \0 0R\0 ` xdKPxK8808 a<0<'XG0bT@T` \0 R0\0 ` xdKP[KX? @cTkP$(` \0 R0\0 ` xdKPCK@DT0`@` \0 0R\0 ` xdKP.K<8X'P< p7 00d`  \0R0\0 ` xdKPK<0<8G0`T@T` \0 R0\0 ` xdKPK8?@cTlmPʡ(` \0 R0\0 ` xdKhPK@DT0`@` \0 0R\0 ` ҂{8'Rp7U <d01K01K>K000` \0 R0\0 ` PxdK9PPK<T'0B0` \0 0R\0 ` PxdK$PPK87T@iTܮ`2H` \0 R0\0 ` PxdK PPK@DT 0@` \0 0R\0 ` P <00`  \0R0\0 ` PxdKPbPKXK\` \0 R0\0 ` xdKPOKp'* h7H@lTaP"(` \0 R0\0 ` xdKP4K@DT0`@` \0 0R\0 ` xdKP H'hl1R 0aR\0Sl  xdKP 0㤐K`0 \0S xdKP0`0 x'0@0l7 yp 00lw PY ĥ@P 0KP DT8 Ml(K谧 -DpL0`S@P5h f0@S/h蔻QRP000S0 -LV`P\' @ 0S\00R001S @  T0p@ 0\ (T0Wp@d 000X7'T00S <0@@ \ 0 07<) -LMGPPX 00z`10>CNKTa@D @D 0P3KHH k p* T0S \PT3 4`K XpxgK0D@K0@3[<3K03K\ Tl  (0!"(80S *y00 @3[P3<8 P@<0X0P(K  0- L@RpP  Ep  |Ep  @p x0$S x@GxP@0 p-`PLU@`cP`0h`  h0S0#*P0h``0p -AMLM8pK`d P(K,0SF"[3RB2[S?2[p< : 8 CNK"[ @D0@DD0H  ,0S+#[<0R'#[80R#@P2[  xW0 02["[[AmK0`F@`FT@D,Pd 00S  rx00 K -L0MP`XKphw0S&P l0`d 0Cpc@ pUw0SPNw600 l d0 0Rl jvp ?w=w@E9w0@05w0SZ 1w0 S-w00RL 0,1\ Yd0(0`0$0` D0 0 0A R  0$ (0 7H0S H0000DP* P0 P000-0 00000h S?0000 00000000 0 0p (K -L@`paP 0F@W -BMLMp`MPP& 0 0<@K*00  X`\`TpmK`F,K`00S v00 2[34[<03[80(P@ <P K .S 0S0( <0R0(0 -LM`Kp&@P0S@PUP踰 -L M `p6P2B@P/P+ PP&, 00S S0L,0 ,0P4*P 0 SP ,K4K @@P {``(K\` -LMp`P(K &@PL( 00S S0B(0 (0# P @d -0LStpPB`. T@! 0PU`pPE@TU E000 L -PQL`p@P gP) 00S.S%_P 00S.S 0.S PP*L P *  P*h;L -p LP G`@CTP@@< T`h6`P@ P00CS0 -@PL @@ 0"@T 00h -Lt P =00D00H00L0(0 P00T00X00 \0 h 0-@PLP  P 0000000 000 0-MLM0P S ANK@D@D @0CP @AP000K0 -LcMXK M`\ , $@P X&KeK @ (K00C0eK S@(K0eKXK@ 0CYP X@`$PPBT0S ZT 0[SOK,]P P0:S 5P 30K F00S8#X VOKTp W1[S S04%40T0VK1`X![T00T0DPZ 0ST P\Vp 7p@P @ TP Wpy<X KQ0P @ P0b @ `P 0f@< p W8t<@Tp PP@P U@ @ X0K@ TWuP*Z00Z0SP IXKAPeP p`P= U`@PX KUPDP@ U$!0@0' EPXPKp @=P000  P , 0,K o,0SpP W0SX[T@V AP`*(KXtx̮t9`so p-LM`?P0:0/mPP JK@D***|* P11;dSPP JK@D*L*$* P11k;Kp訉̉ 0-LMP^<0SY T0ST 0S OK-P.Ph 0S @ .@P@ P TK0ԉ -AML8M0`SZ (K+8pU (@K0 PQP F @PK⤖p?  h0R d0R7 pP4 h0K@P# A K@08@ m0P0S020# p3PP6u A=K0C80C  kp9"PPpK` p-!L0@S00K `PP6 T>P~@P@0P!SMP 8p 'P i0S:P T%p  ?=PPpħ<  0-@PL\\0  0PS@T02 0000 -0L@S4 (p@TP 00  `P@@P<8P0 PP0P4P|P `Ph p-LP@q`P@ q`p -LMpPq`(K0 S00( 2K 9pq0S @P q` K0 00 0 -QLMD H0  Qz H<̠Č8#Č"̌,,H0 @,̠D!d , 0 @ P ` p @0  < 080  4 000 .2 0$20%20&2 0'2(0(200*280)2@0@0#2H0<0@#2P080P#2X040`#2`000p#2h0"2p0,0 #2x00 , @l  D<,  L8  T4 \0   t DH4 d @P`$p,4<5(K8 -QL MPp` Q QiPc  a$ KPZ@ I$00@PP%jP @PF  f008 KP :8 KP0@  80K@ X 80[S70[0SS 70[0S SP @0(KP v(0S K p- `LV@P p 0P*(0 0p000p褊 -L M`Ạ pḀ0@P `4 ĠDT"4!Č'(D*T0K 2KKKBKRKcK$K -LMK![K04"4 1K -`LpHX$H %X P p- `@VLP p0lS*(0 0py000pG - Lp @P`p 0$ Ġ4%.$$&Č'40  - L@p ,<4("4!<0 - L@p 04"40 -LM 0pSU 4 0 4 \ 1,0 5P1)::0S 40P3 0T U.*X104 PU%0F>S-!@ T @!  8 8 d, X100,0 00`VZY`w 0S0%5,0 r<040R(0 0ZY (K谊 -LMkP"{`@p{xb"Kq 0Sn"[0hS*1 0Q Q Q QD1Q Q6 Q=  O4!Y;   !O! J&" 00S   0S   [`0 $000 0S 0"[0hS,0 0 0SG ؊ 0-< LP@ P0 -0L.S@P#P*QR00)3P00X0`dS F>R`V@1@! WP P0@0S.pJU000U -h3LM008 ,0 0s ,0 S P R P u@0+S  -S00  ` Pp4 0 !R ZZZ Z5< I$`V^n"0I405<A$  4 0  0L.\  0 S00S< P 4 0O0S "4S 4P 0` `0` \8@4 K  V d1d0@0\ 0 R \Ap ,P0 n00<110 05`p1J W  0Vd9#Zp `p X 00045# 80 @Tm00 (Kth8 -?@p##pWL MX8 0O?   BE!5;t l@کm"0 01`V#U!42T1,0  4 0   04 0  0 T 14K1  4 0 @T0 4 00 0,0 4 20|A$p0OT?@ 00@@#U[ UDe VZ00@@P` @ 8| 3, 0r03Z cY 0zdyVUZ00@@l ,@ 08X   D , 084 `  (K@8DL p-H8`LP@Pp0Sp -LP@ R@00 00 -@L};p- 000s00 (p-"XL`  p@pp -LM   Pl@"00S0  @0  !K00 @P K p@K$ -LMP p@ 0^ Ƞ,Ƞ0@P` ("(p V`00 p-LM ` Ƞ,H@PP  p 00nxx -1L`PV@7  0pA("S*)l"0 0(Q% 00P  000 `0 P*@` <$0@0    ? - 2L k0S k0#S 50 !S0S0` 0C# @U  000PP P6:@` T0L 00P00 R p LX0 Q dp  PpWU? ,0 dSf(Ki ȧ \ 0-@LP0  (0P0CPl00@000 $0 R00c 0 0 00000000 -@Lh 0- R00 0P0Lp@900C00h -L@0S - L`@p 0QP@150` !!@c + RT -LM0MJK1@D00@D`* 0 LK  P Q  0000 0b00@sPU:K0C00CUD0 @ 0s 00K<0 0 ,0 00 (0 8 0$0 LpK  Up@ j0S j07Sj#00Pj@ U p -900 0 SvKih -LJKM@DP* `  V@  0`000 0b0QzKpG p@ Qj0S Mj07S Hj#0 0 PAj @7 K 0- 0PQL@,j 0 0,P0 0 0 0 0-0 0SL@Pp00  0 p-0P 0SL@`p 0 {000p p- L`0PP PeP@P0 `0`p Q-L@*P T@ -L M`p<0 i 1! /8 P +@,WP@& +p@ 4PK  ,0 0,0 Z,00,0 ,1040 0@ LpP!8}i@Yt2vi0S. a8 0p]  P*@^i?00tYi0S8`l d0pE  P*8w@Fi?00< R00(K`Ďxwd \ -LpM`10@W,0   @Kl@PK rrp@K@ F  `P060#0P@U@Kk gr  cr r (  P0\0#0P@U@Kk Jr  Fr r0, 0R ї(Ki -L\M` @ V^PP, p t x a 0Cs^0l0 =PX  < hKTpK| :(< 0|0(((  lp t0@iD0@00 hKp t0\X0D0 @0A 0@A0#Q 0@ T:V@1@# x@Kx `d x V@@PKl A 4AhKA@KA ,0 S P(Ki -L@kP p :::T6at -0LMM0 ,0 XPPWoKJ%T1[S   @P UKG,MKC RV0 d .㩋Pp 6 ,0 S(Ki -LAM0 , 4$ 84 `@ Pg?0004A<pP 0OAP g0Sdd!0U48$4PD g0S@ 40B^KPE@DPE 8(0K@tD^P?p%0 U%@P P 0+4J Pghpl 0U04$84!aP] ,0 S0n(Ki$LlJЋ -LM8 < Pg `,pKV4 D0 S `PT 4 40@#P0S> 4 PP8 $ P@ @P8 00S0 KP 0 R ;;S @P"0 JU8wP 0l Q<  0 4K'@PV a$@(K`n\8<He4RA Q:0S  -LŸMS 00 8 `0 40 < @ Y0,K00<PPU ,00SQ@00 S  P80eS\,0 @,00T:, R 00S S0B,0 ,4 QR 0E 40R P,00C,0 ,8pqp3\pW  @P8A8@ Q , ,08@  pX00V00S< 8 R9 P4 08pP@"0B 0S S 0S 0S4  S0 S S 4S S R`00 0S 008@ R8(KN -aMLM20$0 pP" ;p` ]KPE[NK@D 3+0 0K 0 E 5 U\e pT4cK╉PXGk06: S  S [NK@D+  K@@P[NK@Dp1l!v 0K@@X@9@UTSaD[NK@D`Pe0S \ K0UC`PX% y2!n/K_ PX[KAm204-4 K2SPX [KhAR\00S $0 S4j Kixwd \\edAԌ`T -LM  K K0K P K 0-L@PPP0.S 0a C00C0  SRQ00 -LM  K K0K P K -0LM0`p  $0 5PPKz4PUOK N> SKJ>,KKF>J4S.P_K33 $0 Sړ Ki p-LM`0`@K KKK`K`PP +0 000KpĒ -0L: _PĒ -$0LM K?`PĒ -ML M⌢0划`,0 0PphspP 0/Sf PlPj BNK@D@D+BNK@D@D+J^KPEPE D 0S :S S000S S:S  0SA0W0 0S /SHBK@@P 0T $d@PV00SV00S040 t, 0R=(K0P 0+`:ㅗP 0SPBNK@D@D+PP 0S BNK@D@Dt+A`PೱBNK@DD@D04  P: iĒ4T<` `, P-L 3 c@pP 0S %S@ ß V *00SS@f| Tt0%0CMST<$9$9$9$9$9x:$9$9:$9$9$9,;;$9$9$9$9$9$9$9$9$9$94<$9$9$9<$9;$9$9$9$9$9$9$9$9$9$9$9$9$9$9$9$9$9$9$9$9$9$9$9$9$9$9$9$9$9$9$9;$9$9$9$9;$9$9$9$9;$9$9$9;0PUUwWx 2 Q PP U W1  PP U V*PpgWP Pm Ux cUh Vz*p!?A1c000 Vr*P!?A1c!000c000 Vd*!?2c!  000Pb`*`(P;/".000bPE4p P10/A!b000c"P&0 U0@@P@ V0*%00" U,0 R@EȒҒ+D^+gfffQ p-PL`( 00@ SP$.P1 *PP @PU 0B8 S8 7=@PڈP@Tp1  0B00@ S!0.PP00@ S 00@ S00EP++ ,"-L Ÿ  RP`@ 0 0: Q 10m Q 0 0>P`bN Aʠ^   0b< 0BcA4H6&? `? 0S_ c`\  pQ @^00P00S PpW00Q n B2`@? T P  |0 ` 0:5 6!ƠP `ᨍ0@-QMP 000SP'0QPE0 01 #U0 @  0" "1<"( 0#! 0#$0#0# # #!,#80 "1 "4 " "0" "1<"(  0#!0#$0#0# # #!,#80 "1 "4 " "0" "1<"(   0#!0#$0#0# # #!,#80 "1 "4 " "0" "1<"(  0#!0#$0#0##$# #<̐!1 0#$0## PEU0 @jD0PE0 #$# #<̐!1 0#$0##UU @ğ 0 0 01R # 4,<4 <<#0QPE <#1:0#U0 @C 0" "1: "(0 !0#+ 0# 0#0# # #! *#8 0 1 "; "0 " "0" "1 :"(0 ! 0#+0# 0#0# # #! *#8 01 "; "0 " "0" "1 :"(0 ! 0#+0# 0#0# # #! *#8 01 "; "0 " "0" "1 :"(0  ! 0#+0# 0#0###$ #8 !0+1 ;!0!! PEUE0PE0 ##$ #8 !0+1 ;!0!!UU H 0PU <#1:0 #0#$,$#, Ѝ0訍 0 "Q p-L`P@@Tp -pLAM0`, . 0J/K(1 |00R0@KJ_K   Pf@0    pd`0,1((K -QąL@P$ML@ HP @PD SUp`=TKTA*T 006P%0\! 0aa9s&x'x )8HR@J*RJ@@bP 8#8R0PE*RPE 0U0D L H0 RLK p(KT`V:4V006$0\0@f(&x80 2 *j 0j7C93&x40 < < 4@($8HRR[R0:4R005%0\, 0l\9c%x'x )8HR@J*RJ@@b` 8#8R0`F*R`F 0SS:4\00< $ࠃࠓ0^,  VY0!#*0H D0 HK(KRPU:4U005|#0\@e(%x8 2 *Z 0j6C93%x40 < < (4!8HR<0@0C<0 :@b`s48#8R`F:@b< h8` q] )8HR@J*RJ@@b^`J 8#8R0`F*R`F80 S00<!ࠃ ࠓ0^, q ,0,p# 0c5'6C93( 00 3 @ x@ 'x0!8H,0RS@@A@ >:@b  `0p8#8R`F(:@ b.Ƞ%8 8"H 8R:,00T00S+ N0(U 006R 00R`FRA@@ R`F]R0C@<0 F(R0@-@P l^0,00 nSBS\N_0 0- L@0@P቗P $0+0&0A -@`p0 0V@TL  0Y@P 0sP 0@0 <0@ `P @0`p?A -Q؅L@P,MT@ PP @PL S0 KUH `pJTzT:4T006X%0\, 0ll9s& < @X%X *)8HX@*X@@h .  8#88U0*U0H0eP < 31P T0 T0KL0PS0KUT P TK0 , L0S 0Kp0 , (KU:4U00<#ࠃࠓ0^ WY:Y pH R T Pp PT0KT`VW:4V006T#0\@f< (&x( <0 0&@-/@d4xB 02d @-M)Ѝ@4=> 0\ Uꨮ -L 0KM# + -LMK  KuP K -LMK  KhP K -QL M@ K0 0#0  / 0p03T0S00#0K -@@L0MP 0 0 D 03000 K( K P(K0X00+88z$* -RL p@@@pT `v%  P DP 0AS2 0SQ0S 0S .P 0S0 .SQ00Q0S 2 0S .PQ00áP00@-@T   0000S  0P0S  0 RR00ӡ? 2 -LMp0 S( @0 ( 0R$KP !ᥠZP2`P8@KE X`PEKi -PRL@`pP@ m00PPPPPP p- @0PSL`R p0S 00   01 0 0pQ)03 0 00  TTL#*Pllllllmmmm m(m0m8m@mxtplhd`\XTPLHD@<̮t\@ԯpH( #* M0-LM0 0 0@ Pv>K0\Q0@-P0@  % < ^9 qoooooo@q\qxqqqqpoooooooooooooooooop^@7!10# ^00S10# ^00S3 @\^` 000  RE C ;@\00M00q 2  0  ^0^0@0C@0@000*^?^: :!20# ^00S  0D ^Sp 1  0~ ?^*^ #^[^\00!0 !@00 00 0000@@000[^#^ s @1  0y0\  @  0\  @  }\00 L0 R,0C@000ĕ@p0\  @  i0\  @  b0\  @  [0\  @  T0\  @  M0\  @  F0-  @@t p-0LQ`P @0 Qf`00p R-Lp`P@@D 0T 0G 000jR -LM8  Bp`4 -PK 0e@YX: p`WGQ< L VJ*\Q  Q *Q?Q< [Q#Q9 q! X1  0 *10# Q00S10# Q00S @\Q @Y7@*20# Q00S  0A QSq 0  0  @80S00Y*<Q @-PK0 A0eS`40c(K@t!* -@LP /00 p-LlMP@T Ii KpdK[x`P @ <0  0: S TO0 09 P D` -AMLM0唣,0  8x@P |j`PW B^KPE PE` XsP 0#S 8 (  P @ @@P BnK`F`F0 P0DT P 0 P04SBNK@D@D +iD @P PO B^KPE PE  qP 0#S   P@ uP~  @o1P Po BnK`F`F0 `堧0DT`  PZ 0 P葧04SQ%`@P& `:P `4P `.P `(PX `iw@P00, 0R(KT` <墂inL/Dni`qe 0-L@P0PP P0 0-L@P0PP P0 -80L R PP P@- ^ 0S^@0 S 0SS00@0DP0 4 -QLM@<0 zR| P8  h0 p 0Q `pY:%o$<0P  0Q0` pY*0@0 0Q"0h 4 ,0 @ 4 080 R@4 0 R0PI@Y :&D! 0 R0P@Y*U p P8 @<0P  0 R0U p 800 R4, Y4 8w (KR0 0@< PpPp< P@`* p-L`RPP$p@ @ SP T  0RpnR0S p*yy*QQ*vv* 0] 0-PLMK0@P0 K,K @ P 0 dP0@,0 (@ ,*( C ==x*iit* P-L `hP^R00c*::_*))[*$ -0L0M`p4KL K@P4@ 0P (` $p ,0 0 P80S@K@0K 0@@0 <@ 0*DEE+* -LM KPwt@LL* 0-@PL PU0. @ 0l @T *0P/S 0/S BT:R T*0RB/S T*0p/S0Pa U*T@ 000/U$0 @P Q@?008 -L M0 0L9 K -LDM\\`, 0 \ bQ/00@, 0R(K^PK2 1PYQQ@(00P0Qp I00A SFs@g P!00@T8Q 00A S`V:/QQ@ .Q(%00A S"P00A S  Z R r@jg P!00@ TQy 00A SPP@00/P@P00 PT@ 0@dK 菤d0S@} P@00x0XSxS r 00 D~ V pp QP. ,q* !000D$  Qx!00ӑhAdPG0W02p0 `VI:00pv ! 1DW`F/Qm Q@Z t 0h1 T!V00h!( 0T 0Q 0S SS 0h1P@@8e4 80$ 0 ḭthذ( -LM 0 <d -LM0  dx @b2b 9̧0̧ + 0-LM4P [[@[0[ P@K08""M*jjI*++E*MMA* -L$Mp0`QP 0 " @@K]0#" 00 P 0@0$0 @0 <0 80 40 00 ,0 (0 0RKADP `~iر -LMX0@K`P$0 p' ۸$ 0R K~i -MLMK@ , l p`PB@F XM 0QLOKHHV !+ spP#  ីV'0OPU``O@ \O@ lh, 0R$(K U rpPHO@ DOW@UVKAp X$U eʷW$%~  iȱ 0-@MPL 00~K0 0-H+LdM0@0 PV`(    Dt< <<(|<<<<<<<<<<<<<<<<|<<<<  <<<<<<<<<<<<<<<<<<X<< <<< << <<<<<<<ĖDDL#K0 @K\ P# 0 00 ,  K0K0Kp  !" ++@K8 P@Kp QLW0 00K K0K$@0 ,@ zp P 0 00 , r.0 00 ,  0 00 , L0 0,P@p K00K0K,  @0P @KpD p! A/0 00 , d z@K P@Kp@ QpQ P: evL @% oL@P X  U S@0 0K$ K0K,  @@pM $@K0{ ?{ 9Spj 4qd 0q , i,  - LMK0 @ @ pK..t* -p-LMP0U0  @ 0 0Q a0k`PU 0  Kp` 0Pd  ,K K$0K@( $@ P, PP 00LiLЧ77+*[['* #**;*; p-LMP4K@1 K70! K,@ Lp`( P  K0 4K(TPP$K@ Z ` KC@v$Kp K 4P$@ MpX 000 P@ 00ӑP 00ӑth0 S000P p-`L^P%*00@ S!@ T  00@ S00S !000V0@CT  \00S p@ p@-0p@T` P 0 0  00a^0200C S  00C 00S 1>3 01 -L@ X 1:%\" \0PS0]S0phPU ` P0S PUW kfp 0-L @\*0S:00[S.QPQ*0R0.S :06 \:00]S p-0LSP@p `P @ `p p p-0LS@`P\ 0  !p0P  -L M@ 0S-: @0 0 T4 `4\ Q| ?>   cP"T001 X   R!*0^SD ]S5 -S000 -00-0 -  R%*0]S PU-S [SY < PR*0-S& @ 000 T   R: 0Sk 4 0u 40@^Zq9  0#@TfJP0` t4 ]040 4@ @0}0 @(KoL-S G P0:S% =S0S0* 0-S]S =  000  R*0S*0=S  0S0*p0-S]S P r `ǟ00   r 00  PPg7@T ` P0S? @T  R*0S*0:S  L0]S -00-0 -  S0҅>]S00:<, P  P  000(K0P  000   P`0S  @  e0 `R P @P@ P @ q mpZ hQ d 0-S]S* \& X R|*u P R,*%PPP 0!0P 0T ^001  ^0 f 040 >00  0 R (KoI & 000Y 4 Y& ^J 0@ @ 000`000^Z040 40 0 0  0 0C0 4 40^ @ 0@QT 4 0@2000  T, /*0,S  T R" ^w p0`P  00 2 0 00QP ^V 0 @R4   bB"(Kos 4 %00 ]00]0 ]   R !*0P0]S Q*-P0@0 @P#:T0]S000 0]Sq(P 000   PE v040 1tԧDL p-LM0K KP` 0 ^00K K0C B@0K K#P`x -LM0` @8P pw 0  0  0S04  4pP 0KP00K@ 0]0pK0K K@Pt -`RL@PpP  0!000 p-L`\P p@  A$0S0$0L0U0L0 P  1 e! B4 0Ap -LP`@p0 S#T TW0 W000S@PPP00000,ܭp000000hg0f0c0  f00   fA  f" 8 B a  h.@0 fw  f#  f"  B a   @pG`@  f0R  fh-@DpG`s&@D`m -LMP\@, *0^S) `.U ^*U Q*0*S  ^\S $U`\?* RP%*P U5 \U $ 4U* 4Uy p>E0CS<0pC!`H0S   H   0H0^p0 0D4\U0 SP,0X [UG JU0D  D D` V1 0  i R *0Q0\S \) j V1 0H  R@R*0^0\S0)Sn Si3UbKa F\MXVR ;N 0 M J/  0 hb  h   h0V  h@70{S1 `R*0,Sa P 0`@QO* ^C0\S@0}S:= H  (00(000000,0XAo0)SX[  (00(0,00,0P0}S ^  R*0R\S ^  @Q*000C S\VP ){} - LMP,  ` R*@|T T  $0D XSaꤸ̷̷̷ R*000C S  R*@*0D0?TS{T `| R :` VU RZ*0|SW0, 0R1  i00 aC80" 00 P (00(0 ,00,0  R*0D  D D@ T1 0  R*0)S ) T1 0H   R*0)S  x(00(0 00000up 0@ Gg R*00T]\g000C Sc^g+Tj 7*T  R`**0A0?QS{QN0\K000C SG A ` 0  fr  f   f0f  f?T= {T& @Q*0,S p 0s Rd:    000C S|Tp  +T   f0&  f 0  f  f  f/"  B a&  j  G 0  j 00 ,0 0}S00I0}S  \  R:, R (K0  a  i (Koo -0LMS@ `  PPa :RP  0    hP   (KiP00   | @ 0KpK H 0S0\P@40  ( , 0 < @ D P `8H@ K00C 0 0R*K  0R: K8 0A $00S0 00 ) lPP QP: (@#L D0 03 0Q  Rʠ    0S 00B\p0S?0 0S7 Q^`L0>#Re ]R R @0^@@R@P(@c P<@ @\ >3S R 0L00QP(@F40 00 4 Q 0眀MQ @00BaVP 0R 0R0\000XwR R RL>310>#R R "R (@@(@0>3S  S S 0>3S )R@(@5\ BK)6KK K 0R:K PP Ee -t0 LR  @T P0R000P#P P<PheE * * * -QL0 M4 0 0R000(K00* 4kPP- 0 P0S p`@P `@ |P$ pW21C0 R4Q  000W |=PP(KY  0W0021C0 R 4 R 4 0W00P p- LPy@P` x`P T,03040S000 R   R0 \00pT * * * -LMpx~`P 0SLXQ0LL!PP00P00@$K(K BP (0 RP@Pʐ T-LP0SMR kR mR gRPAx-GR KR R P-L(P8PK,PFꜹZܹ DwE-p0 @  R`&@P0 L 0@B?AsP00 R00S 0/S9ST00T0S@gfff -LP( <3aL1aa Q -LMPR, `VP `ZpA  P p WVP,0p -SL M` -=M =  , Q qT ͟0 N ,P0s 0 00  P,P r`QX=qHM <=4-0S0v>C 0C0 M000! 0v^ PW ,3`20!0UԌW 0S p ` 0 K 0 0, %Q`p ,P0S,P (KWp%0AUS@ $Hp @p@Tpp@<HHHd,~ʟP,P ~ 00 +0N, /StWU,P0p  1 0@Qp ᱕P AGp ᧕P Q0 4W2,P0p   !0h@.p ᎕P 8@$p ᄕP Q0  ,K0K8'P 0 t8v.BhH B 000 ,K;0PW,00 xPP,  ,K =0P}W,0 ,K0K50Pn,K0K 50Pf0|, W,l0,P P,P 000C SO,K 0PF,K 0P<W,0Wp  ,K0Kc0P 0010!h00 ,K 0Pz 04FC000Wp,P r ƟP,P r 00 W]%@^,P ὔP%0 SM Pp,P WG,0SA,K0K 0XP: 0d5(E B`10`c000 ),K0AP# D0000ğ, ' ,Kc0-P,K0K c0%PW,K 4P 0@DC000WB WI 0 ,,K  0P C000w겹,@ P~P ,P k#2`10!0U 1 V R`c Q P,#? 2c10!0 c;Q0 0 0A0MS, ,P0TS,P DQd00a 0C\0  1 0\00 00g, P@0@K0pp",P p0P,0 ,P"pPq 0 0Xe A0P00,P Z[ A0P00,P 00K!P00 00 0P,P 0 Q,P!000 A RPPx:Q0,P @-p ፓP 0 S S 0P0,P f@Ec{EA!/0C!b10bcd0 B!a10b cR0 0,0L CA0C0  RSP,P lxpttQ8'ĺ$Inph$|0_t*p*l*((h*G-Q M 0ࠑ@90PP@e1A 00 q$b%(?P @RJ: 02!!b?P J$0  ^0 @Z) 0 0 0 0 00 R0P P:02.2"!0Z  01%3 0 =00@T* 00 Ѝ =00ꫪ -LPp@Q qP l2  0=QV PbP TWAQ@T W"@W @W@ X*0f1@0Z0 fB200Z 0ÅP@Z0 fB100Z 0ÅP@Z0 f00T񟗹X=QQ q 0  0s 0 0SW X*0S Q q D0  0q 0 0PSt5*WW1*  10BS)000C 00S 0 0S0 00Q:  -0L)S@P 010CS^ 00  ^:`pV`` W0S P`P```00 p-0L)S@ p010CS^ 00  ^:P`UV P pP 00p PQ 10C0 Q-L@pRPPX`VP V W P `0 B  d00HPP00 Q-LPpR`@@- P 0S @V000 B  e00 0-PL @e0 0-PL @Z0 -LR0L0@@PT@ lR0  0 R B0 0  -LXpP`@@ R0D0TST0S: 0 P` @UTW YPP Y I00 P0 0 0QQ00 A00  -PBRU`L@0R Vp Wp00j d00``p P j0@0@@b00P0PjQ0PE0P -pBRWL@`0R XP UP00jm d00`f@000 R0pp00P  x j0@@@b00uP0PjQ0PE0P**bb&* 0-LM 0@0 @P K0* *0@-0PgS6 -S@ XS4 +S6 0oS6 uS= # @ @030 010 000 T 0301000gS80 400S 0 00 I@@-gQ@ oQ uQ =Q! /+Q -Q"\00  00  00 0 +T -T =T000`0R0- 0+\ 00XQ000000 -L$M@`T80 0(K4@K00K 00 APA P8 P00H S 8P p0P< 30D0 a0H@SX4$$$$$$$$$$$$$$$$$Z@ =XR@0=X0 W@0 :<⌑ < `P 0e0 F pP8 0D FpH R W:<00⃁<0 `P 0e0 FpP8H0XD *pX ,X +X -X=X>@ =X @ D0H0 @D 0X0C S񟗦ll`4lTI@D0S 0 Ď@D D R  @꒠@I@Z W:<  ₑ < 6`Po 0e0 F pP8 0D p=X @ " H+X00\0S W:<  ₑ < `PI 0e0 F pP8D H0X pH W:<00⃑ <0 `P. 0e0 F pP8D 0w@p_I @H [D '-D DD D0C>0D0 DΌD `   ,K>$,0P R>0SK v6"0 0`0+S -SXS S P0`+S0 -S0   +S0   XS00P^ -0 0 `Q +0 0 `\ X0 0 ` W@1 :`a@Pp! C808 =0 08F60 01 -L8M4\( p& < R R S @WP  O( 0R'$KR Z@K2 A|PU`@ PU hPZ@K024 Z@K2 @ditt996* R  #R , R R R  R "R, \\R0 0 R00A0"S0 0D0  0 S S S0 0 0A\ -,@LP 00` -4@LP J$P`` - TL0S D $YP  P q 3  00 qQ#Q cs0 0n0@S0000 0PU L P q 3  0 00 0y P q 2  0 00 0g P q 2  0 00 0U P q H2  0 00 0C< P q 2  0 00 01 P q 1  0 00 0 P q p1  0 0 0 0 p P =Q PP@Um0#S+ #U) @0PS0 P  000 0 R r 00CS0r Q#Q 0P  0 S S 0@S0+ @(`|tD\|bػ  ( 0-LP@P P0 -LIM0TK(0 p@P4K@P/0j V`W"( 0R^$K  0@PP 0l Kh0 0d `0 l` 0dK\ K @P X 0GR@"4*@P -P$ 0R 0R 0GR QKWPP @1R <1R 81RD*@*<*,b\^i\<0 0-TLPA/H0iP@ @A/cPP03@Phd* +!!* --LM0 0 -H0@L`P8 4gT  塹 j!gid\\*;;* @-LP7X   (     @ R0 0" { lu Xo 93 00,c   L|\3ds* --LM00  K p-L@P3X0` PPT  44 0廒c phψidT| p-0LM@P0 ) 0S& =S$ 0 S =S00SRPd`K P X0 ! 0S0 tP x2 00xP$ -LM0@=SS00S $  0=SS00SP$Pd$`K GP! q$0 A$  ;P $0 1 0S0 -P x20 0p R`  0S0a`LiPP  0(pS PP@0 0 P$l -0L M`Pp,0 P" 0S =S 0 S =S00SR@f, KPH ,0U00PK00  "20 0(K P 00 1 0S0 PP,@P 1 ,0Q! =Q =S 0S0=000S0 ꐀ R4   0S0aC140 P PP < 0S O 0P P4 ,  P$l -L@$X~@P0 @Rt@ -pLPE@Tx` S+P00 @ƥTH R<3",/1 '@tx 0-`L! 0TPt1!@PP@T 0f1P00xp** *- 0-Y+ ̌!00@  0 --LM0 0 -L@Pp/1\0` TTT  8;8 $0ېb  didT| -LM0  K ?0-Pp1@ LR` 0S P P@ 0S@D0Sp00Z0 谩 ?0-Pp1@ LR` 0S P P@ 0S@D0S00Z0 IJGG*Q  ;)<??*55*E-M00L SJ20\ p` P0 @ 00L @  S4$ 00L @ UQ | 0D A0a00cB.\! 0W @00L S0\p PX\x\PPT*0S R<8@%Ѝ\ Q| 0 0hC10S(TdT0SQ R<84@Z,<$!$$, T*0SLt -LMKnP@0 !H -LMşR!  ,   e! e 0@A0!S1S UK  xş@K0 K0 X0 T0 P0 H0 D0 @0 <0 80 40 00 0 0 |0 t0 p0 l0 h0 d0 `0 \0 0 x L  K~ Kz,K v Kr Kn Kj Kf KbQX0K1   @0PC⅀K  !SPp0[ Q- Q+ T*00K[q 3  0  Q#00ӑK[ Q #00 ӑ K[  RPp 00C/L0l XKK, fPHK K  K K K K K K K Y=P@@!T 1S !=;T04@P!TU!X}w Q (Ÿ, 0 R(K  Kp.0SX0S  p !RK  v X K! } ?0KK1 [PXK L00L0 60[X KS060KI0@K0 1 K0 0 w Ks Ko,K k Kg Kc K_ K[ KW{.~x.0 A 0{s.0  0u e]iHth 0tĻ p-L0M`0@0 P HK@00@0 H KQ Q Q ?.00 0R Kp0$!]it,t,t,: Sb00 ^ Sl00  Ss00  Sv ?00 r0-000w0-000!=@Sx00 > SS00 ! SS r0-0t!00w0-0 00Rx00 # RS00 ,1R8 r0-0!00w0-0 00Rx00 - RT00 0R 0 0 R-00S-00 Sc00  Sd00  Sp00t00 00 s00s00R-00 00 -00 -QLM (0 $@ 0 0   0 (KKdd*KK**oo* *DD*R0S 0S0S0  R00ZZ*GϠ*''* -0CLMs,0 @ Q* 1 RPIf 0R) 10CR 0YS!Z0s3(KZ 0S  T1R@Z TK  ,0PD0PSpYW P0`U00S00 P0@U 0U 0R W`P0@U00VW:0S`#@ P0 S@T 10P`@0YS?*!]:-D0P P000P R* -`LP p0W 1@PPP@aU]00Q R @1@S O RI00 -LM`qpP r 0@r   t00 ( pDW PAbRP P # 0  R 0S 0 U@R 00P=  t!, ;Pc 0Sa 0 0 0S0 g@00PP  dPk0 0Q 0@0A   0, 0STU ˾0 0 ,P% 0S4 U, 0l 0  R=*@0l@eP  00l _ 001 0  g0S S1J0 R0(Z0 0Q0S S1J0 R0)Z+ @mu i+0 0d -MLM,  @  pT2 /T ` 0 @C@T/TPP  0 W*Pdğ, 0R(KRr/T ` 0 W:/@/T W: 0@ 0  0 S00:P+P/@@BNK@D@D+P@ 0@ ^KPE(P5 0 0Z/S 8: S S 000 0(PNK@D@D+cP( 0S B^KPEPE+WP@ +P 0PZP*P0SNK@D@D@+ 0@w $ Q 0P@ 2( 8 P. 0  0 S00a* .R1 Z3* @R  W-0S0T'*  @0mP  D0@ PP 0@5 %Y^KPE`0.S @P+P_ 0@" ,PV8: SR0S /0 0JPV!  k*P0/00 NiL -LM M:K0P~UK4  >KK0C*K080K₎KU, @H ?U@B [U4 *U00! PU5P(K R*K, Q 0 ` I**K, 0b5 !(K*K 08 <R 0 XT5R L50PP!U00S !U[ @DP 0 %< 0 P`]0P 4!Up0:0C0Pp00-S@3 ]S> P`[U8#80@0:S0@ : P 0]SLğ0i@T 4Q:0 RR0S< ^ @]Q 3 00p]S@ 0#< 0 P_KLK*KA KKA(@4 0 Pk*K, QT 0} :KK0 4 0[#0a1 0 0P[Up`b0:S 8#80 @w 0  nK`F0F[*KV8`@*0S /S  *K/S 0 R@ 0S00 R P* _P*K0 PP" U R^ 0*K S C  0R0S0 U `1 (KPpPK0P ]U@^< S~ *K, 0pb@P@ W(Q@00 \  0 0 0P@Pᔻ  D0 0X)**?[D-]:` ) -LM0@{SB {P T႞KI p KI0pPC0 P\ @ `{Q` }Q Q [Q]QQ 0  0]SSS@Q  (KV `F0}S0SU0[\ 7,\ T:P[\0]SS   0]SSST0*VU  S:0S0 wP  000{\ }\V`F` -ML M@,K`pP0U P K0 000  <R 0p Qr q 10bQ KK @ @ 0 S L \S0N @9R8#HA@L.0K^: X0 Q  R00   Hꬾ\@80 R00CS000KkꔻRR* -LDMp0PQ` 0  `@Km0#" 00 @\  0RKP POVi -LMX0@K`P$0 p` ۏ$ 0R K0Viľ -MLMK@ , l p`?PPB@F XM 0QLOKHHV !+ JpP#  តV'0OPU`&@ &@ lm, 0R$(K U JpP&@ &W@UVKAKp X$U eʷW$U i eiо 0-@MPL 00~K0:*:R0S0  RR B0 0Q0 0Q*__*W̼ *A*//*aa*P0ᬬ -$0L! 0-$@LP'P$$"P0h p-LM$`0PK@.08ooP nP 87,00SKp,0 -L3S Sh 3S\ S S WS= S S S00> QS0PW @ SO V&Sv S1X 0PS DS S>400 2Qa A0B !>3 S >3 !>3 SQ!1XX 0PX >320  0P0PS "S>0!># R0\PSu0S qXn 0PQ>30Q,  0P,  0,0 ES @J`@` 0P  T00S0 R@ 0 \ (K>3!>3 S,  0`,  0,0 FS0H P0>3@ P 1>3 @!>#"R@D0  @V 0 @_ywQ& .Qr,  0@,  0},0 DSP`J  0`qP 0 `4N 0>#" 0c OEQ QA 0>#" 0c O0 @6G-Q` $P @>3 S Sw 1S S S @XSO <S S S0>#00 00@0S0   @XS xS S 0>00l0 S00Sl@@ S G&Sr S1Z0   @\ p!>3 S >3 !>3 S 0@00Z >320  0   @!1ZZv0   @"Sl 0>00 1>3 S`  00@0Sv @USQ0 S @MZI0   @h80Z @=3S`" Sb JSl >3Sc Sq S S `(KS{ S0^zQ>3S V >320  `0^d&SC S0S00S* Vr 0_R0^JS S V `0Sz 0 S0 0^30S0 0S0V S V 0R` RQ Q0V SG R* Vr 0_R V* r!>3!>3 S0^~S S; Sj @>32@d00 _ 0 0 .P `RP R r 0H_RsE00 090^B0^>30 @C  1>3 S% 1>3@!>#"R@D 0  @P `0 V0C 0 >3 a 0c  P A> 28 0qH D c @ < H  R4 V 4 0lS:@   ჍP80P 1 0P 4 @>32@d,0 _ @ P 0 PU0,`0  0pPA>3q 10 `g 0dS0 0r~00`0y` Vuut -L,Mp P@6Q >3S`" Sb JSl >3Sc Sq S S `(KS{ S0^zQ>3S V >320  `0^d&SC S0S00S* Vr 0_R0^JS S V `0Sz 0 S0 0^30S0 0S0V S V 0R` RQ Q0V SG R* Vr 0_R V* r!>3!>3 S0^~S S; Sj @>32@d00 _ 0 0 .P `RP R r 0H_RsE00 090^B0^>30 @C  1>3 S% 1>3@!>#"R@D 0  @P `0 V0C 0 >3 a 0c  P A> 28 0qH D c @ < H  R4 V 4 0lS:@   ЋP80P 1 0P 4 @>32@d,0 _ @ P 0 PU0,`0  0pPA>3q 10 `g 0dS0 0r~00`0y` Vuut -LM`< 004 (@40 0P8 Q p_0 0 AϠ0 @0 S0 0,, ,0  XPy  X| , p R@ ,0 S T  0  Ppm@TP2W  X* x| p00 00_X00So 000_X0S 2WX ,0 S sS 0 , 00_R00SHA?G0CSE@ 00S 80 < ZP]  4>0 89, 40 P0 S,0,, ,0  XP00, ,@ Rp0 0 0Wpp@vp 0  PpP,  R r h  0, 00_R0P Sp X x $v0O0(Kt -LMp S, WQU Q0 Q Q Q Q  \A0A >Q>30Q,  0P,  0,0 ES @J`@` 0P  T00S0 R@ 0 \ (K>3!>3 S,  0`,  0,0 FS0H P0>3@ P 1>3 @!>#"R@D0  @wV 0 @_ywQ& .Qr,  0_@,  0W,0 DSP`J  0`KP 0 `4N 0>#" 0c OEQ QA 0>#" 0c O0 @6 -LM 40 \  ?R(00 Sp 0 000 $   0  X 00 00_W00S1 000_W0S 8U  Y y 0  00_Y00SA?E0CS <80^  R@ 0t`  ` p(K x0`  `p`d \ |   0'00_\0Sp Y y  0 l0l't7Wpp@0 ,@8w\0\0hH 0S x P H0S `KH0H0   0PP ^u X0S `0D R X" 0@0 @`0D PH0S\0  LPD0S H  0dH E U 0 \PP 0 R HMP P( TH0`0`O/\ `PX`^  D0"P0@0@0@X`VDP㎬<匬" q u:D L0SPXx H  R @T 0`   Y y   0#00_Y0SP W w ` 0 00@#3UPP` 0 ,@lS~\0y` \0z` lSH  v ^H0S `KH0H0  0 PP Q X0S `0D R X" 0@0 @`0D PH0SV LPD0Sp H  0*H E U 0 dPP 0 [ HP R8 TH0`0`O/\ +`PXp^  D0"P0@0@0@ ᒹ ` \0  H 0XXpWDP+)H0STH0X``0`O/ H Q ` H0SaTH0Xp`0`O/  H 0EeEt`0DP`X M<P D L0SaP_XB@O`0DPpX # X2D0<.X*D(@0`0 R T`0 CR` X0 X0({np0R RXnꔻ H`0 CR` X0 X0p0R RXsn괻u*E-,1M p 0R  ``XRxR `R,! B00BP@ S0A Vr 0D A0a00c BR,! 00BP@0jC R17 1RЍ.R0X r 0t -pa`LP @*`P` 0`!P0i5V1P Uj!0\1 X -LMßß8 < 4 =@0 `P j @Ty Pp0 ,P P2@pT&  5P'P2  0R0X0S00s0P  0 20RE P2, @pT, R 2 Rt2 ? (K<0:S  H0P 0p, 2@ YR00S5 1 R <0:S  0S 11   < 0:S:? 0R 0R RRd1 R < 0:S Pd ᰷o0BS-R @0S0 R 0 00 R0 R <0:S @0S 00   0<0C0 :R:?Q l0 R48L 10  4 0L0gȬجĬ̬4+ -LMR4 , 0 80  F0S0000s %0S40 -R 0S+R 5 0R0%0C00%5  huPu` X@t  00  e00b 0 000%0S0 R#, `4V ^0 4A@-QPpU4嗶P @t $0s`U p$-Up 80Sc T 01S\ -Q W :Qs 4tPn 048 0mpPF 3#040P -Rt44 u+Rr44 n-U30S5P(KPsP3PLu0 0 @00#@d00d00P00"0P@0Ђ0s02`p@P:U@30S0002 R 40:S |t2P?P0Su0r0"P,2u a  000 d0b01 r-U0S4ܵP 8 0R0WU0S0 0;S7 :S 0S000|H00 R@!0:S 0, 0R0 1! 1Q  40:S 0P40 :R:P?PV0 100 0 0L0S0,0Q0 |0l  Q 4 0:S010048 0yP Ȭܬ++ԬЬج wĬ̬ -LM@@ZK -LM@@OK -LM 0D K9*75*7CC0*,*$$(*6$*6PP**33*##*- 0L0 0 0 0 0 0 0 0 0 0 0 0 0 0 0  0\0 * -`L pPIwPܴP 0Q @Q ϴPX ȴP @TP k@ - L0 0P̽+ -pL P@ 8`P0SX 噴P @TP k@ - L0 0Pܽ+ 0-PLP {k00@צ@@Ӧ @@0+ -LM0PS ,Ki@P ,Q 0#S S 0i@P $K0 S RA,  #xwP0d,0 ,ت`P , U,0pp&*P @p0 S S0 S S *`P 00(K (0S ?R0SP("(04"48@#80 @PB `8)P7 @00T2 P.@)P( 00@T# P P P@ 0@!0SqP 000  b `llhP0^q0 0n PK@.G @_기\L` -L70P+ 0-0LS@P ' 00 00h 00 00L`+ 0-LM@KPIdPPPQ R 0S0S *.d@@8(dP@@8 --L]MqPM?KC/`KK `1 4Q 0Q @0 K 0KQP   0 K|1 1 8 Mp@ 1P復P 0RKP u01 00@ 00AiB` --LM00  K 0-@0@LP 00\hT  喘  0h^hid -LM0`0  P@t 0-T^ +T0@,0 ,  v 3V00S 0TS R0㼯p㨯00D S t, (!000& W070 cV \Q00R00S!! ("00@0T  ㈯ pt `,0\00S00aS \0E(K@ , 0XSxS@P `rt0P0A0\A -LM0  pA p-LM @K`P0 ܟKpl --LM0 0 K -L M@KPT KKK 0-L@Pp Pp T U 0㓺0X ᶼp@ -*'T0H@*{{*0(0 -0LP0 0@-Q@ Q QPP000P0P0 0-@L0PS T00SP0h -LHMP p៩P h㛩`Ph p 0S, R00U@ @@4K돭PPd 04 \ X T `@ YdKTYP0S ᴣᲣ0h0 *0  U@P04,"40ᡣh埣h@ T0T L0S00A0@C$1HXP! h(K 9ZP P00  0@Zp 0000@ 0000d@ 0000p 000@0=p 00}0h 00dl,x -LXMt \ x |0 Q d `0 40h P`0 d K  00Sp 0p0 @l@ ( P 00C,̠Č 0("ČT@L # P_ T0\KPX t0  0PO |x@PH pz!PP pP d `0 h@TB 0A嬡P0LPK0<0 8 "XpKP XP(P (KX0Y(X(P( l00Csl0 t@  0 P(d@`@h  R p (0S0(0-!(0(00(0t 0P0 (0,  H0S 0P0vX( P(0S0(0\, -RLp`PU `p@`P` 0(0,  -RL,MT P T(K0 @1<K0/L#b00 0@2K 0KhL HK<0SI 8 R P PA$0L00c 2< R{0@8PS B< tpP R $0 00  40 4 0< ph 00X$0J;, P0 $$0 :, $0c ?00$00L00 04>0S 040. S  @PI P,] P0 $$0 :, $0; Pp0( 0 0LiyT ,P 404) D $@ @ < $D T P <0S$$0BP> P 04$0 :, $0=,(Ko: P 00T R0,0 - P὞P0 P0P X0SP 04 P 0, 0,0 P0 $lJ -`Q00 V@@TLP 00p @$0 D T T P V$0@:$0<0S0 /R $0` P ǶpPP0,L 0-0LSP@ 00T@1S00 -`LVp$0*-0Q4X Q$( R> 0`VR "<0Se 4S S 0$  0R/S@/00(  Lvx`$0  `$ 0B8S P$0 SP 404Q $@O 4 0RK 4P %04P͝<0s 0$ `<QC$0 0`S004P$0@wP( L$  x/7>P XW @ካP x(P04 00 `\P  % :$00P| `e44 $0 ;PX L =P6 04N 0P 4 04 P 0  Q %nM0S  0tP} $0P:$0Pt $0 ᒵP 404$0`:$0!U ``Q @ M @$0P:$0F 0 $0@ 0 $0LlJ -0LM@p` / 00 00(K(ʠPP0P  0P `00$@0 0$0 P 08xvS <  vS x vS x@@<@TU wSrwS?A vS]\vS]vS]h DHpAvS;zvS;zvSCtycAvSj"vS>~vS>~X fnAvS(vSrQ3vSvKy:{K(VAvS*,vSvS| AvS¶2vS+}7vSvKy:}wAvS~vS~vSg~-vSq2vS&vS&` Z u!vSmvSmvSm2!vSmvSmvSmN#9f!vSIxvSIxvS]z:v!vSIxvSIxvS,!vSIxvSIxvSIxi*!vSIxvSIxvSIx W-B!vSvSvSo!vSvSvSg~\w!vSvSvSA!vS,vS,vSn }r!vS,vS,vS,U!vS,vS,vS,pavS,vS,vS+K!vSAvSAvS+avSAvSAvS+6}!vSAvSAvS+AavSvSvS+wo!vSvSvS++~avSvSvS+ǐ!vSvSvS+&}avSzsvSzsvS+2!vSzsvSzsvS+( avSzsvSzsvS+˭U!vSzsvSzsvS+VavSG vSG vS+r=!vSG vSG vS+awavSG vSG vS+!vSXzvSXzvS+@avSXzvSXzvS+;M!vSXzvSXzvS+$avS5=vS5=vS+ k!vS5=vS5=vS+ HavS5=vS5=vS+ Ce~e!vS5=vS5=vS+ Q)avSvSvS+ E!vSvSvS+ 0^avSvSvSA#, !vSvSvSA#, ]avS5nvS5nvSA#, !vS5nvS5nvSA#, ravS5nvS5nvSA#,U!vS5nvS5nvSA#,CavS2yvS2yvSA#,!vS2yvS2yvSA#,DavS2yvS2yvSA#,e!vS2yvS2yvSA#,6EavSvSvSA#,^!vSvSvSA#,&vavSvSvSA#,'!vS7 vS7 vSA#,oavS7 vS7 vSA#,Y6D!vS7 vS7 vSA#,avS7 vS7 vSA#,,!vS% vS% vSA#,ÖǖavS% vS% vSA#,0'!!vS% vS% vSA#,0avS% vS% vSA#,=N!vSvfi!vSvfi!vSA#,avSvfi!vSvfi!vSA#,R\!vSvfi!vSvfi!vSA#,]avS"vS"vSA#,tt!vS"vS"vSA#,avS"vS"vSA#,Q˒!vS"vS"vSA#,KE3avSe"vSe"vSA#,x!vSe"vSe"vSA#,y皴avSe"vSe"vSA#,)KH!vS5!3#vS5!3#vS,\avS5!3#vS5!3#vS,.!vS5!3#vS5!3#vS,avS5!3#vS5!3#vS,8!vSQe#vSQe#vS,<avSQe#vSQe#vS,[b9#!vSQe#vSQe#vS,\JavSQe#vSQe#vS,I!vS d$vS d$vS,avS d$vS d$vS,!vS d$vS d$vS,DavS d$vS d$vS,"L!vSd$vSd$vS,ˀETavSd$vSd$vS,E!vSd$vSd$vS,qB[avS %vS %vS,!vS %vS %vS,xavS %vS %vS,~!vS %vS %vS, avS`-&vS`-&vS, !vS`-&vS`-&vS,+avS`-&vS`-&vS,!vS`-&vS`-&vS,fK]avS&vS&vS,@!vS&vS&vS,bfavS&vS&vS,r {/!vS^'vS^'vS,*JavS^'vS^'vS, !%!!vS^'vS^'vS, &uavS^'vS^'vS, <!vS'vS'vS, ߴ:)avS'vS'vSjAT- (!vS'vS'vSjAT- #?avSpQ(vSpQ(vSjAT- DN!vSpQ(vSpQ(vSjAT- ȏ¼avSpQ(vSpQ(vSjAT- d!vSpQ(vSpQ(vSjAT- D&avSX()vSX()vSjAT-UV!vSX()vSX()vSjAT-:mavSX()vSX()vSjAT-r!vSX()vSX()vSjAT-r_4!vSP)vSP)vSmB !iBu!vSP)vSP)vS&m ԤBuavSP)vSP)vSjAT-5m!vSP)vSP)vSjAT-JnavS. Z*vS. Z*vSjAT-!vS. Z*vS. Z*vSjAT-!vS. Z*vS. Z*vS. Z*?uʣ!vSKP*vSKP*vSKP*?:avSKP*vSKP*vSjAT-?"&!vSKP*vSKP*vSjAT-"avSKP*vSKP*vSjAT-&@!vS +vS +vSjAT- ֎navS +vS +vSjAT-#|!vS +vS +vSjAT-7avSZT-vSZT-vSjAT-@i!vS-vS-vSjAT-X|ݓ!vS-vS-vS-<e!vS-vS-vS-=!vS<.vS<.vS<."&!vSO0vSO0vSO0"m# !vSO0vSO0vSO04hr!vSӂ1vSӂ1vSjAT-föQ!vSD;2vSD;2vSD;2(!vSD;2vSD;2vSD;2(suj!vSD;2vSD;2vSD;2(Zg !vS2vS2vS2(,l+$y(\xIK^zvNg`NF Cs- qcչXoB1@[Ɖ;M {|KzGN&QJQ "q A˽sp(s-k[uܬBy\nu XM]n'D)tV1@D1oA}M}X<v̹AYɤ(9QY/LQWny)!_gـ>_ FHHaD-iEDh?$ PFTXo^que? KGo${%X<&Q=zaeT{4u2,Wu=#jLKȥD^YYtȇ"TZ E^!;*O . ..MAKEDEVconsole  tty  mem kmem`o null`o zero`ostdinostdoutstderrksymsoklog`obpf0`owd0a`orwd0aowd0b`orwd0bowd0caorwd0cowd0daorwd0dowd0eaorwd0eowd0faorwd0fo wd0gao!rwd0go"wd0hao#rwd0ho$wd0iao%rwd0io ... . ..chowndhclientm disklabeldmesgfdiskfsckn fsck_ext2fsfsck_ffsmifconfigminitnmknodmount mount_cd9660K mount_ext2fsK mount_ffs mount_msdos mount_nfsnewfs newfs_msdos newfs_ext2fsKpingnping6reboothaltnroutertsol . .. binmdecsbinshare . .. ftpgrepnfgrepegrepgzipngunzipgzcatlessnmoren sedPsignify . ..misckeymaps ...aPW _PO 0<0@T . AT% ᯪ P5 I@PL 2 0<0 $  P04VY`, @, ,@ ATVX# #P  04$0 X ፜ 00 ᅜ僜ၜ 0 *   մP$00$0L -PL0@S 0` 0]0SXh-0` 0N0S p0S ꔻ p-LlMK@`P 0: S f 0P0KpP P Pl00@0աP  @0@`0@``P 0-L@pP  00R00SPP 0㧷 0 P 00 0-LCp@P PP 00 -L,M, P ,"pT0 0 rpP W ZD oP,@P0PC$@,P(P@Z%,`)T0PcT0P`@DQ,0, 00 ,,嗊(8 H @@ 8@ PTu*Y H,j 0lS0P`S& DQc,X 0\0 0h@dgQ!Q D\a= 0Q0 W:WF*`d,` ,P  P0ZD0 , ) R@100*, Tg`g $ 00 `, 0R*@PT0PDP DQj 0P0 `, 0R:  0gY@(K,T0Pg`g " 00 g `0S @t:,T P0D\ DQI 0\0 DQOH0@8 H 00 HH @@ CDP,Ř 0P0 .DP @08@ 0 0 @gDQ 0Q0 0 0P0 0 0Q0 9 T0,3DQHł 0P0 P,1 T  `,0PL0 T P0i<0 T P T PL0i0c40 T PT PPT0PT PPT PP@0,0, 0P 0 ! 0^0 #,0, 0\ 0 T P`h0H0H 0Q 0 $P, 80)) S@10*,0Tg`g $ 00 `,0Q*@PT PD\ DP 0P0 `,0Q:  0gY@0 0P0 0 0P0 tT P\4T04PPST P(,T0,`P`T P)<T0<@P@ 4T 4PP)<T <@P@ ,T ,`P` p-00` LP0\00\ P! " @!R 000lR  0  00@pf 00p 0-LM.00La L Q A0LRW0LQ70LT0X\x\@@0 -Lp= @P@d㴜P`d 0@:SS   P0Pfd#P `d P@f P` D`V ϖ -Lp= E@P@dzP`dP 0:SSo ^S \S0@ PUPfdPl `dP0S:SX 00@\:\O 0L0S 0/R@ 7R 0 B1/P07P0 @10@0B0L@2SDܺкĺܺкĺ00U@f {P`VD`0T0 00} 00z 00w:00t00q 00n00k -8@LP Z000 0蜿 0-@PLpPPd0@@0ޣLP00⩛40P (0@ @墡00蔿 -MLM@d  ^, ` h8 l p( @0S`WP lmPm  vP 0pS LH T hL(Q\(  h =T80T8 X 傎KHH`YP 0 S 0Z@PY+h8SYP `0 SU0U@E\S 00 HX #RR l#Pp^ 0:SP P0:S0@0pP@ P( = @Pr P0S :SP:0C0EK0@ @A\(h8@c`P vV v:0P E0E 4 0S :S00i c 00 4  S`D:R:0 00H0f c a0 X0;0g@MP H0g gg0 0H( `pPH @ ejo40(fo HDH ;Pg)P: 0g@pPPX(RhYH8dg S0A0:P`@^@pß, 0R(K3 Rfh(02@X8S\T 0h8 0L0SL ᷔT(R@@WX\K@ 00BNK@D@D"ˡ P)*2 R% h 0rP l^K< uPE@8 PE @D 0 p& P$ D0Sh@8 0C<( 88 L @WPh TT X hYhV@hX@ 00TT a 0P  p000\H H8 X Ph Hf0X\!3@Z0@WW+X(R2 &Z@ 00JZPp@Wn k@D Q? `P0`?SP``L0@p go@pb@ {?0YP@p s?0Y@P0 -L M⼀0`P$0 ,pK  !62 b1 R<0Q0^ph ~?@ Q R $ 0R K *%i  0-LP@ 1  !1P\ 0hG<<d*- 0BSR0S񟗹t?Q00 000000\Q0000 0AlS񟗠P`````````````````````````P````````````````````````````````````````````p```t```\```````D```,`-Q00f ^Q,00` 000Y0A0S0Е 100ࠓࠃ00 K0A0 S 0Еࠃ10ࠓ0?00;007003\0 0 -0 0 '0 0 !0 A0 0000 0 0  0 0 0 0  0 0 0 0 0 0 0 0 0 0 -LM pK00'`P@T  0P 00P@PT 0PPh@ -0LRM 0 `pC CP)K0K@T  0PW0#3#0%(KU)0[505PW)0[0Ņ@PT  0wP U0h0ŕW)0[0ŅPcc*( *=*=UU* 0Q0   -RLMPpkܑ0SaVU0 P @0P 0000 R r0 11@```CNX@' ,K0 KUW@,p. Z, ,0WKX@0@p0  g00 p0S&4V(K,0W`'0C0 0 00S ZဌP` Z@徆HH?R0S` pf`ꔻ\-  S 0S@nhh*$%%* p-LMa0PS-@T 0S00S @ R0S)xT! 00@0SK`K pP 0S [xD Tx( @00 ꔻ̿ p-LM, 0( rSwS@T l0@0Kp  0S $K⩜P2 RRpPB P#1@T 0@T 1 R T, 0rSU $P[(0!3d1 R6, 0rS8 , K@$0(a@ P0S00  0 R$ @хu Pq  000Q0 g d a $`K@  @$T $z埅iꔻ̿@Eĺ -0L IP$ -BML Mß0P,0 T$  0S 00ß, 0R(K/PP0P4 L 04  T$L 00C=S h     R  1!S  b-1A L401!0>T$忾BNK@D@DP  p0 SP&1KH4 1D A  @d < 84 4 廟X^I`P 0SDa ɒBNK@D@DPQ 00UBNK@D@D (0K@/04L  (K 04BP0S<8Α0@P@ᛒ00 c-!!R0$ 0  BKA@@DAPT L 4 00iE@DPHeLLw\3$0 P$ -0-LMP0 S  @     0S0! b-1 00   0S0 0  Q 0RK0x ~ 00i, --LM@0 S       0S0! b-1! 00   0S0   0S000 Ľ 0RK1 7 00i4 -0-LMP0 S  @     0S0! b-1! 00   0S0 0  QL0 | 0RK0 00iP$<0m --LM0  0 v K  0-LM@Pq;PK0 J=P ;P   ;P $@ 0@P -LRp` @PU  PP@ -L@pP:P `V0S p VU Vp @0pP00@V00S P0S-00@T TpV ׈PP  } 0Ppdd` `      P0 p-LMP` P P |P0l `0 0 Kp@ 4P0( @@l,п -Lhd -L  hE|d 0-LM0@ K Q0!ŏp@\ Pڔ!廏|K0@\` 0S-       8           0!噏pP, P 0 ሏpP0  {p0 P0 R@` p01S ` gpT0< ^pTпpc0$|LX -Lrhd p-LM P|` 0 S 0K,0 ( $ 0 R r 1S0C1,K'O0@SKpꔻ -LIM0 P$0  0SQKO_K`NK@D y @ gl0! 螜$ 0R  KD! 寏,0 MoKK_KQK@ <1 8! iT@-0 S 0Q S0 Q(,0^ 0a(00 0Q<@\ 0-L 0Q0l0CP< (4"4!<0 @@b T 0 0 0@-Q @0S 00@  0S* n B!< 4!4"<0 0 0  0- @P  0SL 0  <4("4!<000 0P 0 0 0-@0LS@ 0, $ 0 P bp 0,0(P0 p-PQL@U  0(0PbU (,0`SPppcP0à - @LDP`Up$P  bLP"W000H$P1 H04 X0T  cP@ X0T PX> 00࠱PP L0 R0L00P ࠑ0H<,$!$ H \ QT0PR<0TPU$фP $(0lH0 (0, P$8`P, 6<PP$, 0 @0 X 0,`H 00`(40L P,0 D P @ T ``0 (KoK @08Ko~ 0K~o~꼭Hd 0- @LP 0㘚p 0S S 0 00b0q( ,00bc0 p-L@` Pp 0fS  0 `P0P3 5: pS0( P,0 `R$0R0` #00%( %*P 00 -(0LSP< 0S2L0 ! P` 00/`VpP <0O`Vp0S R 00cO`p 0(p`p 0q 00`p0ꔻ -LQz W00 p - L@<0 R0`00^00X00蔻 0-HPL0@S0`0000`00 R 0hꔻ -LMPD \l (Q  &0SfXF X X7 `p@R, 50 S g5QR ;0LPK0@p 0P @0P }0000 0@8 0@0S E0S0 0(KK0  P` 0S  0bO`p0K0@0 @ @/08CJK0P0: S0@ ;L 0XoKT  P`0 0`VpS < 0O `Vp08  c0 0@P@ 60# Q0`ʜ ` 0@0@ Tmj L00cO` p  0@p 0@0P @0P (}0@0@Y 00Ÿ0Sd  j00/`VpP <0 O`Vpr XKⰹP&PK K q* Ÿ0SK D X00SG <@0@ 0 @p`p" 04g# S@ 0` c00 P @0P |000 0D0 R Kq0S @ Pa_7 00   a0@ P0 Bq_ 0@p`pq AP T0 d00 S0 00xU0/`P  0S SL ߵ* -2MLMx$@0TP,0  |<S   0/Sk @P B.K B B, + w X030#` V0#ScVH < VD / 嬉P< PP#@aTQ~KpGpG ɇ(K0YC`d   mV,@B0 /S (3X5/00,8[S 剉P 儉PP0XP /o,0VbPX A0/S/0C0@0@0S^\, 0 Rz(K?00,R,  {0<  +TrPK AìPPh<: S Qk®KJJ  ἖pP( K`\F,<[/SD XP /P0aY 00qiLlJh 0-@P00QPLTP x p 0K@00 ɀP @P{@*||* --LM0 0 b K 0-L M0KK 0PSH(P(@(8((P(H(,(@ AK0 "000@@@ 0$0%K -LM< |<0D @  Pu 0-U +U 0P8 80 D@ t 3T00S 0U RUD0 ?4 00 8 RX 4 K 4 K `V0D0@`c`f,` `p 0E Qࠑ uz \B000t W070cDPmR8Q4 YNK V0_ , ^00SD041 ,/@`p`Vp P0U8  @@RD@ 4 0 4 K g4 K , 㖇 W# 8 V0& ,@^00S0040 ` `Pp XH"00P`q V>"00P`q W0 W0@Q RJ< <0@ 0(KP8 ?0XSxSEP D 4 0 Ct -L@)T`p@P  @00#:k0cS:UV@ 0'p`p -LxM`OP0 U80   0@D0 @@ 4 40 -SX.d.d.d.d.d.d.d.d.00000d.d.d.d.d.d.d.d.d.d.d.d.d.d.d.d.d.d.0d.d.d.d.d.d.d.d.d.d.0d.D0p@`PM  | EPeP Y|0x@0`V ptp 4 @T400t`VDK(K@0D`t` 00Spxp | /Q9Qp@`9Qʇ!000T0pCچ!000T0`C@4 /QP R 0S J0SG0 RT4 | t 0@ Q  |040|0 R" |0S  P 0BSpچ0R`|PU 0A R;ʇ!00 p0|0 04 0t0 4 0Sn 00Spxp 0XS xS 04 00S S_  x r4 @t@ |x 0 N 44 0+Q -Q,A    00@ S4 20P404 0P 10@S%40P@p p 4 /P 04 0@!00/PP9PpL*0aUS RaY T @l@ P - Z@PD@ @P D:H A n@P 03mD @ YQP` 0j@T 9 DKnD @ 07 MSp`p dp \p Xp )0@ D0 `\ 8W'dU'\S'`Q'XO'M"00 4 s%P}P`  fsPx8L d8 0R$P` d \ X  X \ ` <'Pd `0  ! ▃DK, K00Ko'P8 (P\ P@, TP`PPf00ࠡ࠱Rbp t B gR 6cT PbP @0"00C`T0 T @0` @T00 S 0S p pc@c`cU \(P\ c 8(PP_ 8&8P T8'P8 T Xd(Pd L Vd'Pd D W\'P\ < d8E'PX 6 0 0\@&PK X\# 1@P%PKYe u` l h @5 Z 0Q0jZ0S lKx%x5u%P lKP l h Y l0K`pk6pjDKt 0m 0DKlD @ P@`\050Zp 8@&d>&\<&X:& 4cml h Ylph@@PQ\ P`p 4k`p@D0SH@ 46SE 3%PA44 7ml h l`A0`p | ]I0@%Sf:....:..........................:....:S@  2r` l h0 I0P|@  |@ 04 |00P0|0 10@S 4|0@ | w\2 l h0 BCbVD@K0@1 ` l@PVD@ @P @05&C@ ! DKlD @ @"1 R6CR0!0 5&0C@@ D0 @ @ ?4@K#"P 40 (R D @ 4@KL"P 40C44 "P40\!04 @ D0 Qt80K4K< K0S@t 4  S S 8 RL`K L`K!8-%0DK< XPP\ ~\cʄ0 DKFlD @ N?A|0 |?5?55tP9?5&HDK@PD`K@ ` p  0l 0DKjD @ @h0 0S56@0 0pW @0 0D0 lKdje 0lKljY@PD0S46S !(1#Pu8$d$\$`$X$h!h1#P|!p1"P\l`hp0A;h@d 1 DKVjD @ DBZ T30j0T0 DPK`2 @ kP`TDP @` `V @820#:kcQ Q4Q0 AD0 0"7&@ @ DK 0a P&p`p dp \p Xp 0@D0 @@ Ry|nY| @#46S TpW  Y DKD@K0 0iD @ 8&$d$$\"$` $X$Q #0 0 K DKAkD @ 3@ 0S}YD0S@ 46S30kSX 0S0SX$0PX0 \#P@ ڌ`V L40kS7S8#d#\#`#X#Y0ц!0М `0| |0 տD0l0 h@ D0@ 46SD0SPiP0Q; E DKjP e jD @ D0y jP0s$|DKL `iD @ DKD@K0} 0/i @P0D@ @P P2 XL K!PH0$L0&@ D0 @DT (60jS#:k0c&B# P)X6Q `60&0@ D0 2|606C#**0@ D0 )D0 1D0 p 0-P0@LS CDCC|CDCC000 0100."000 00 1 000 0  010000 00100C.0 6:0 0100 -RtL$M@K@P`p0D 0@ K,@K$0K4P @P$ 0 K  T00 5CS0cC*R7S0BS c020 -LM< p ?4 00 ڃ4 K O, P` 00D S t= 0007 W070c Z1R V" U0& , \00S0040 Po P` @0T   04 0 UX"00@P` V080R00S Pu`@Q RpG <2 R] 00SV0 R r 1S0C10B <000PD `0S@0PL vpP- @ u~0 @p000CC000 R0@ <08 000B 0C B0S %@P, 0S0$0 0R0 R*0\SL ,xP 00π0;0B #A03@ #000000@-@$ 0@0 0 0 #EgvT2ܺ -L@M@ hK} ph( 0 @ 00# d ,0*0 0#`a0"00# \@dȟ0! 00#X@Dlŀ0 0 0#T@$(0, 00# P@ b* 0.0 0#L@0"00# H@ǟ`0! 00#D@̀0 0 0#@0n)+C0,0O B0#  <`G' 0.@0 0#@8@@dE0"00# 4 0$00#0`ǟ` 0! 00#, ǀ0 0 0#nd@& 0. 0 0#  -P@0" 00#<@|0!00# ` h@\Ɵ0 00#lƀT@<0,00#@@& 0. 0 0#  +,@0" 00#aX@0!00# `D@ş0 00#̀0,00#\@% 0. 0 0#  b)H`E0"@ 00#@@dF4@0$00# ` ş0! 00#ˁL0,00#n$ P.0 0#  T0b&P"H@`0"0# ğ<0 0 0#lȁ0! 0#d@d$0, 0#  HX0b. 0.0#L@, 0"0# ğ@0a 0 0#4@ā0! 0##h0n 0,0#\@  * 0.0#P0`0"0#D@ ß0 0#ll΁0! 0#P#,0 0,0#`@ 4 b( 0.0#h@000# L@Ÿa0 00#lˁ000#T@"0 0 0#  % 000#\@|` 000# @@\Ÿa0 00#d@<ȁ000#H@"0 0 0#  ,Ab- 0@00#@@PQdK0P00# PP4aX0`00#``Xe000#<|` 0 00#` \lˀ000#D@? A10N@b@P, P0@ R?W@pG 0 _?W@P0 W(K (KoQ{@, M{ I,0!pc?WP -L(M< 1>?0@0c@ S80 D ,;8#8?C0C0V`p Vpp@P 0C P00@PP00T0#S 00@ P00T0#""S T % * 00@ T46"*C2&b& :460V0+ Vp0pS0Z0p0GT0  AT,K 1c, ( 0 #2>;8#8Hat.t>bp.p>Ta@ P7\\.\>b 0Ha@Pw[ 0P-\ࠃ|  >  P0L࠳|0 | 0jS SaB0Ct U U Et0 E\t t p   Q00 @  x !Ps \00S ^$-01NB0H D    ̟ `0`p@0 T P< HKP PbH D  @H K `X T |^ XK4< P00Q00S ROXK; )b0X T 0L0 8 4  K b; `40@S UA ;XK` 0`pP 1P ` \   pd \`0S d\\`h 0S00 p` p00S  0?o \00Ӏ!  \ `: a 0P ` \ p100 d Q @ B¤ Ť0@Sbbg gff x x 0Z J∠ ӄ 删  x 0S00 0 0 x x ,00 0C Q 0A63@ a 0aCA~J Al  4 8 Dx\@` 0tS\t0tS0ct @cc Rx0S ` P` [ hQPPW hhP P\ O pQxP R00Sp Vn46Sj70Sf t0@0t0 p\0\t00t 0 t @Tt0S|\6 R`U XY` ` @P `0  ! KvP `` pd ` ` L <haP Q U00S 0S X^00S \W UbL 0`R h  HPh d`\u d  =Pd `  6P` LL \hdh `\@P 00`S gP Q  0 cc p Y0 _P00C0 x\ 4@5 ( _ 0^@ < XK$Y@Y 0XK^0@ pP`@@K 0(P< 0^ 0@KPv4Q i^@ K %4 P 0jW_ @K 049` $4@ < 2``PX@Y 0^0@@@ K `PP 08 ,P0@ pP0 `@P 0^X`uY 0` 0t^000 0@PP 3 P\P  0p^@P  0P  0P 8  w9R W8008  000800 hPh 40 820_  XKgX`Y 0XK^ 0@P~PP 400 p\00W 1_P@GX`X 0] 0P@^4P00 000 <1K] 0TP K ] 07P0w0S 8p t408`0 \0 @nT/X T   ` 0cS0Ct @4S2+  P` S d '?aCoc?`(?yPD??$@@@?0  _Db 0@P0 pH0 p _@P `X@ TP p@Ph  \h0`h`h0  \0Sڈ T@d hPh \_P0w9S{ W p100  h\NPh  QPh UvN  \010! 0`l^,0CN@6@c+P` t @t E0SS\ %P\ \h\PʔUP\ W\TP\ xzhLPh mr`DP` rjh0S0SU%`qd o9V00k90000ez0w0S p] X T p`  P` ;h Ph U \P `:V `>9V X1``8`3 -LCUp3 -L0S@  ?0< B<R0LA0 0!88S@  ::S T0 0@ -L@\`n0P0Q`  RP \  P p|3U 1R 0 S 0 S?0 ^^/0nP  VPPP8PT00p0 P 0S 0Sp0CP 0Sp0CPp0　PXH06+@P00 R ! 3R$0P VPP  -LPp SR 0S40S1`T000` 00R` 0SJ0S`@S @Z`0 d 0Fp> p P` P@ 0 0R @`ZWP0  d 0%p p P @`ZW0P  0 0`` -LM`P4 8  n0P0(KZA 8\S00P0P 3 P S0M 80P SV#4pe00 0@SW p@40 0P00,K@p,K W:o 0 40 0008 RP P @Q 80@TP 4 0Q,K ZpP4 0 0-0LPM@ dK P6@Kp zo 0<K <0 i0 dKl0 HKD0 @0 H0 帄yi -@Lt 0 0  -LpM؀0 s`$ Q $ 0R' Kj@PK pph K@KpK^ Ηp@pD@ "p  0siP( P-RL@  ?  000 -- LM 0  L K -ML M@H,  P, PL, H$\4#0$@K$K0 S2`, 0R(KDD 0KN@N0($P -p4HPP,Qk`p H<VF``p  @ R@ 0# pVF ``p0S V`FV:000C0`F RBKII ! BKII KT @D R %RP0mSL %S00T0S0 @D P R@@ L<4V 0FP `aC0S: P 0'P`pm 0j ( zpPdP > pPPKn@1AlA 8 4< <\ 0L 9}?NH^6 D 0!oPD@`P  0@,`0a0cK8< 00< @<AA 4 << }ꊔ0!doVF``pY 0 S0GQ D<SoZ07SNK@Dp@D p 00@ ~NK@Dp@DgP 0&PP907S w8+i\``(iD8 0-LM@00 P?P8 -@L w -L@TP`pJ 0 T0#03/70! "]W8?XQd@@0 1T  R#*0B0L!000c00R0nT-0 0@ L 1Z \W@ <"@ 0-LMP40@ L0 @K0P -LM`p@P0PP@0  pt@~TPPK萻P p-L@ P  c3a d 0 0 p-Lpd ` <4("4!<SVJ@L@TP0? " !BP <4("4!<0cS ,  < @4( "4 ,\,.<4("4A$<U@%LPU!0? " !Bp <4("4!< 0cS<,$ 00 q 0 @ @p@ 0+Q> -Q  9 00@ S@p 0P@0@ 0P 10@S@0P@ 0@ /P 0@ 0@!00/PP9Pڌ*0aUS RaD040 @p 1 @ l 0\ P0`40  P  p3 Y ppT @@ bp W@PP@ LP 9H A R@PPp 0hQP L 5RYO\0So \\NP 89R QH  HK 5@`\L9 PKR@P L 5T@@4K 0PK@@@P 40S D0XS xS 0@ 00S S  @ @KD0K@P4 { PD @p \ 0g@T 48 PK}RP L 0 PK< K80K PD W 80<@cT< <8 <  0 @n0TlT @  07  0CP| + |2 P $ |0  ! gD0% P  D  ! g8P<@ Px  \i\\ pnp  0@Pc@0 d0^0j00n`PU00S0ScPc`c\ x Px   @P  @ iQڄ P  Wڀ P  Vڀ P  Xx Px  F Pt  0St0@ p @x= P00\``V 0 03 0 4  W !0@ 40 X T 倔 <\` 8,  , K00K pP| ,QZ pPu D`R, 010 D PD e 0@S20@DT@ T D9 PD R <0C< 5 A 0 D? PD = 0 0CSv R 80@0T80   Q6` <08 @ STQu "2 ,Q @P2XKO 1`p P 0P[ 0@O 0XKPO40040 Q80 @cT D PD < d< 0  x | t @<0 R 00SO SI S D 00 @021T0D 40 * 00Q   0 b320PW   x t lP tx 1@P~PW 0` 0 ` p 0^0Z0S0   R 0S N?V瞯<A?00S0 RT@   0 @ R0 0 @ Q" R  P 0BSچ0R`Ф0PU 0C R.ʈ!00 0@ D@Tj0DPD0C< @8 PD =Pgb_P` g UPg20S60P40 Y RD0SR@ 0 SJ @DTʳ 2OW @@"2@ P H 6I@P  06NX T ^ ^ ^ 3P 0 00c 0 I@P@@  CbVڈ3@ h d L 46 56,ʠL0 LLPKh K @O`FVP L L0# "*/B B V L pP@K0D4 ` cO@PVpP@ LP XK 0$P40 040 G0P@  @ 0@ 00P00 10@S @0@  ` X T ` @@KDP 0 40 0@ 0(S@@  000 Rc 0SD40 0R  04  @040 "00D@@KP @0C@ |P@0@ 0 40 D0 4 "00@`-A0=@P9U}R@d 6 PK[MP L 0D CbV6@ p l L 46 56,ʠL0 LLPKp K @N`FVP L L0t' "*/B B V L pP@K07 p` N@PVD<0 < *a P@jD2PD K <0d8 < A0@PU <ZD0P 4 "00D\  PbU,D P80D 8  \< ! 0\D0D 0@@P040 Pw XK 0PfoQl.aN* Y!ц00 `Ф Ť W!0040 W R 8D210 R*0s  R*0 s 040 @ T00\0SD0 W {PD 08@100@ @d@P80!08 40 W040 !0Z40 ʘ\00P0SttPt x"P040 ŗژPv <0Db< 8 w^\ 80C 8 ?Pi\0\K PKyM\e sMP L 0PK4K 0PKD00 P0< 40 RZ!040 s4  4 4 1L0HK6H0 @`y\|\PKL K 0 1SN  @ 0CD0  !08 < 40 D!040  R0S0 DdRQ8 eDIZ |040 qD08  -L0<0ጽ 0-@PL0 D@0 -LMIPU8 < @0  00SU @  00R@`0`@ `0R 0S)\ 0 \,0 0p00  70S30 R 0S0 0R@@ 0R 00s03p`00 0 00 p8`pQ  0S\P P0`10c , ,0  PR pR 4  V0G000S@Z)0g0CS  0SRP/ 0S  0S W @!`#*`P @ |0S ` Q` `00a W:`@iDA@80BP`Q @a P ,00d,0 8 p0, R80, R@I,0`cU-8  0S; S S- P@"00F R0 0S 0S0 R@0Sc  0S@[W@FpT p2 02 p 80Pf0@,0 W 8  0S S S @@0,0< 0(K0+S- -S 04 40 ) Q! Q 4AP P\ 0>!0L0P40, Sa ,  4 0C000 0Cp,0 p,0 @000 @e P D21 0 " \  Pppp ,  , 8 0, R2 @"00 0,0 4 R 8  0S S2 R/ %P000.@r`bxZPPPF b PP>W 00S `P T@ 0VP @F R 000@0b@8 0< 0"00:1 0W 0eP %8 0,  R, @"0S@ 0bVUE P0S 8 00CS"@21 0 02@"@8  0S: S4 Sh 8 0`BPP0 0@0Pr TP0 0Q0 0U f R!10 8 @0< 00S{J R20S. ,0\  0@RZR R 000A10  R*0\0Q00Q- 2R  101.Q  10 P *0 BSP*02SP: -LM@(KPp`,K0( c,0 c R0b::p  0H$K -L` B/ bR@pP00RP 0 WP0 0@ P VU  0 B_PP P 0 BV0PP0 U @980"p@-R`1Q0@  0 ^2$ Pd050 ^2$R  0fC1S00p^0^0 0fC1S00p -LM0 10R@# *P0@ @0S Q @K0 @0S" 0      $ ( ) * + , !-" . # /D0S 80 00 00 ᘻ$0-@P 00@ b@-A d0.3Ġ Q -LM4 4@00S 0"! 000 004 APP@Q Q00S p ,  QP- 2`VM Qn,X W0#03R0ST WՕ@ `' , P@ Q0Q0XSxS0 S@QPX\ W0#03R0SgZ1* 0Y0*00Y*0S  Z QZO 0AS (K R WՕ@00' 020@ 8 _800S 0 `0320)QX00S400Q" 0R )RP  R0'O0 XSxSa0 S҅@\00 &Z*4 00,0S  0 S  -4@L,    h,$| -L?` -Lw?` -0 `R0`LP: 0P10p@ 8!#800"( (!( 0( W"H0 0b1 P 0("( #8!80 P#HT 0Q 10  @P  ! ]  0"1008#8S"("$"""!   88S00000P 00-0 S 10 0 B\AP: Sࠓ -0L100`p@PC 0` P0 `6<W05#3̠10W#55 P 256U b>003<0S00S0 0-@PL  QXP0SL 10A00hP4[(10 AR 0hQꔻT -pL0PS U AT01 0S0 003 U e10E0C05 `0  C>@0C!0 B@`@ K$KP(0$  `!30$0 0(0 (0S@@0@ -LP`pP@ 0`PhP5 p0!1 0 P`0@ Q Q @P` XP` P *0 @0S@P`YP`00S 0pGS B p -P0 0p -0 0BPU`Lpڂ UP# T  0R010C 0@10 d 040 \2.R P0E00\00\0 -LMD PpU0D0 D 0Pp0 RD0< P@ O < 100Q80 * 0080S10000 !PD0  4 "*, 0S D ,pP`5 J$40  Sp 0 R,00,0 < R 8 0S 0 BS<00S<0 <0@ 0@(K -@Lp P00@ -LM0 0pǏ,0 ɯ0@*"P,` QPp 0, 0R ,0 10p00  0(K<PP0P  00  ! Z0 0P 0-L@ODa TAPU/ ` @T P /@P/ `p0S S@T 0S LPP@ 00p0S |9PU 0S \2LgPP 00, 10 eP|q -tpLpBi0S \h=iTPT@]n`00@XPC/00[UEO000\lL -X1L R/ HiDQ SZ RX@J0S i00 D0 HC/[PUhS`P@0@7~ 0PPlX Y00P100X@C/_[TV h$ 0``@0Gȼ - L,M`o<0N00Kp 0 @rK @tPP 0@ < 8 4p * K@0 @0K P2[Sh0  00p〉00[(K,000l,040 -0L@0 -A0Q (0 (0  0 0  M-LDM@ 0SPl r   p0`lRPPlP h00`08K㈥0S  0FP*MH04,"401(000@0 (0,@0 d`\pV`0h `0 \ X d` @@ `0+hKP D0X 0S`+0l0P (K 0@ 0000lL@ 00 00 |0|@| 00l00 @,@ ~ P0, K `@ 0ؼdl,~f M0-LM@,PP0 PDK0`" 0-@L0PS D00S@L0hL[ -LME Pp , 0  | 0  ' (0 @P @ DKH0 P 0@0XD0`0K00D P 0  0P  @P D0P P ` 0fP 0S6 @KD4@ PTKP jO$$ QNa HK　P&$00K3 P0= @@ @Q Y0ʗ 0S 040\S, 0R(KP p$ <`Kh@@PK0@0 d 0C`P_PF0S 0#S 0 8 404[ n 000S`K`PK`T0KXL PU`QQJd2 K P0= @@ @Q6 Y0  0S  uX0Po`0h QjxPK 0@KPP[ 44P? Q 0  0 P2 @@D@  RPP00Xe0c0=@P` ꄸ 00 RR@P00R0 0 t0 8 40N040Ja4FK 0P0 408 0S 0@0K40@xPx@ xP 4@&i\,Mb?B -40LQ < 0(   p-LM@PU% <\ Kp00`K0 @ 0 0(,0<,00S @NP P \,0S \\ 4dS 00  0S S S00   \00 \ 000 S00 0000  00000 0 00 00 000000 0-0 0 0LS@P 0aP <P WP  RP 0hL 0-LP@&P 0S>P0S0h0h0 0-LMP@)P8P 0S 0*8  0-LP@P0 >0h 0-LP@P0 P 0S S 00P 0h-  @ @@-0S@ 0C0@ <(4"4!<0  -0S0C0 <(4"4!<0  0 c0 Q0a0  R %3 a 0 0% %  0-0LS@P*00b0 .U 00 00 0-0@SLP*00b0 U 00 00 -LM0@S0C0K< 4("4 <0!  T 00 0 0-LM0@SP0C0  KT <(4"4!<0  8 -LPQFM0`,0 @] TC TR0 41 8! 0)p@S810(KOK 0< c@P! M?Kc@P8!N@TK?KS N/K⺄P8!9@, 0R(K081 4A 0p 0cP@.00<K_K<N/K81 劄p 8!+A[ Vi 0-L@PrP0kP fP  0h` -0LM $0 $K K 0-LM@PT :T 80K0! 80KP 0088 0-LM@PT :T 80K0! 80KP 0088 - LR *0R0 - LR *0R0 0-LM@PT :T 80K0! 80KP 0088 0-LM@PT :T 80K0! 80KP 0088 0-LM@PT :T 80K0! 80KP 1[088 0-LM@PT :T 80K0! 80KP 1[088 0-LM@PT :T 80K0! 80KP 1[088 0-LM@PT :T 80K0! 80KP 1[088 -LM0@K0!P00 -LM0@K0!P00 0-LM@PT :T 80K0S00! 80KP 00S0088 0R0-L@ P0PeS S S00P U00 P U  0, 00 0 0d -Lp@`PP \ 0S 0S \0S 0  -LMpPW *0$0 (  (KP KW0(KP 0$KP (0$@ @0P``0$K -LMpPW *0$0 (  (KP KW0(KP 0$KP (0$@ @0P``0$K -LM0@Sp`P S  KP R `V *V U  T F00 U 00 KPP  0d -L@P`pP @T PU * iU 0SW E00T WKPp 0 d ; -L M⠠P@8K0`px ( 0RP00P0#S  A( 0R$KͲ00i@( -L`M`\,  0 \ /00$ß, 0R(K 0|0 x0 t0 p0 l0 h0 d0 `0 /0 (K!0 0a T0c1\Tp q R |K1S q w Yp Rq w Ypw YpZKZK`,K 0S VX `V00P0#S w VV. @TB*:0V0) |KPdT!10RP5U3`V00P0#Sw 0S7 0S"*0n@Q@'*00f@WY Yh 0R  dPS R00J R*:00ZK #@= R*:00 i4G-P 0@Spp` R= $Q Q*.000W ^*0`0S%J.\ \\00W\00^: \Z0h0? 4 3 #^ #R0fY0Zh P *0S  0 Q0 SPlSPl0p4 00 P 00th -SL,M H L0 < @0 D0 80  L RL 8 D @  L0S@ D  L D D0SD @ 0S Hp8 R @0L IS, 0 00,`040  XT 0BP + SE Q D 0AS00D .W Z<0SappW .WQ \WpW0l SWw 0B>SlW a `P00bS:P.U \UPT q@nP T 0@ R0 08? 4 X0S4 80cQ<0S?#<  cAH0!c  p0S .S` 8Q (K0S 0@ R0 o|@ 00H< P*00H b80S @00@ R$ .0A Aa0ARS00A-Q S_Q\0 .Q .S \.\A Aa0ARS00A S0*S 0.S S R!0B]S,.R00S \\R R.R0S! C ]R0  0 <8 < 0 <0 Ƞ 40P 00h! ( -L"x@P`QM H JM hP -LM4K@`0IQ00 d  K00L ,P #RX  BX yd0@@`@ F@ -0LMp,`K,0K@PT MPe 0!00P XZ@`PTZ .T00X0S Z  ,K K` -LMpŸ0P,0 P@ P /00<, 0R|(K@@0:T<0 80 40 00 ' 2a -`S00LMV00Sp@ Vg$!V00/0 (! 1$1P 0S] \4 V (!0 R 0(1 R  0sCP  R$1 !0$1(! (!0R $1 0 \$1(!$Q(0U  0S (0PS(! : 0?CP (0U$Q0$100,1(1 8#0PS  0 P 1S 000^ P 00c0 !000 0 c -L M@  @4 < 0 D0 0 BP8 u 0 00尀X8p 8pP` 4 0bSE `XPڲ@TT 0 BpPU 0`㲀 XP<0LS8 @ D0ePq8 00014 00 `Pv9(Kp!  P9 ,  0BpP8@00004 fP<Q#D`DHDD8000(K  D0^ P 8 @0008 000,p9  ] P8 0008 000 K P @ D0P 8000 0SD00 00b0 -RL@1  0h͠00,1Ǡ00,1 0-LS00\00SP@ 1 \ 00hꩠ00,10裠00,1 -SL0@ hꑠ00,1Q  0RG G(G0G8G@GHGtF0 0" 00" 00" 00" 00" 00"0Q200" 00" -LM@p`@!  0, S,0K80 4 ( 0 0 R r 1S0C18K0PS U 0`=@$KlUdꔻ -LM0 0pSV  0S 0 0P60,0 K U& , R  Z `1`!@P00V0S V ,@PZ 0 00dS0 PdUP0,0 PU  U 1+#,PP`0 00`S0 (KPU B<B S@ <  ) U@1  `!`1!1>0 0f @`0 0 00jS0 PdUPPx s 0 00PUb UR:,PG @ `@U0@`` 0@T:U6P3  00b0 @@0 =0 @0f Z0 c6P, ]  P0h0,0 8 =000PF 0 @00j =0 0e `@0  =0 00P `t p-LP `V 0@f00T`0T  ,P`@`ʼ0@00pp p-<`L0PS0@S!pꔻ p-@PL ``0S0 P0S p諞P 00phꔻM -PLp`PS J0SX@`PUZX輼 0-1L @R P Q. 0 0 0c0 0000  0 P @0P &10 P$000 08#8("(00B< S 0 0 p-LlM0@8CP`Z0+0 KpKmP00: S  Q;  0  SL ( 0R  xU p-LM0@C 00   KpK K`6PP h 0 SPP P 0000C0  0iPP\ -L MpP`0S9쀟@T@0S >P 0S$K$Km> 0@P0dp h0 F00!0C 0@000 p >0S >ꔻ0 -LMpP!8 0H!08!X0 P 21CPU@ J 0S W 0S `D@PUZX W00C0 (K `D 4K;8 0,E>P Z 4@ 8 7>Z4@S00P @85xT 0080 -L MUP`@@0!0SG$q@T 0 0S6 0@P0, P , 0`00 00C8#Ƞ -LMPႠ ` `("HQ% 0 Rp#p4`P) P 0 0`8#H0S0S 0P  dp  X0,  pP,  -LpP@` 0S"0Q00 0w4W@pT? V  R 0B8S`R 00  0R0S00ڲ00000 B! 00C0C0 0 00T00 PWW800C80C800C80R B 0\R! B@-Q1P  00P  -LlM@f3?P0S10@T.0`dY**0VXS'p0WXSpGY:0gSV P@>x/00TZ! Z Z KiVP$X@00z0@0(K *QP n0S @ H-=p@a0S \0S@@@T -L @P  - L@p0 S0 Rp-0SP`P` D4%LP`\pP 0P0 Q0Y` R00B,R S-R+R0S0 C,S R-S+S0SS0SSP0@-P@000L S0!00 00C^00L ST0 0-LMPK@ 0P $"B20b0 :R 8: B;0P  31C 0:S0 P0 00 0-0L-S@P +SPP U00c00 -0LJS@3 MS 00C S00 [?P 0/S 00K0C0  0zP 0.S )0CpP 0.S (0Cfh~J0C0 0[ mG-Mp _" 2e10!0\( 0S1 S; SP` $0/O0@Ѝ43Cc" a*B-BPoP`Y ;\(2@P`3e20!0\0S0$#Bb20aPoP` PEQ 3! 2C 0$#Bb20aOpP`1 !/ b21CUc01 ``L&"!B Ϡl   B 100/0cN!bS  \@! A!0 BA`10aR0BSB\ 2p 1C01 SS Q 43Cc" aPoP`YQQ4*gfff$I -LP( <3aL1aa Q R 10bSP001bSP00 -L(MRP0 L  21C9H0 ^J 0BT Bʌ V 21CL' 0080 4 8GP4 0, R0D` @ < !< Z,0&Ϡ2l10!0X03l20!0X00&1O Ttf!6 p6h&ϠD @0nC(lF8Ld0l`pQZpjmVpG6VjF6mFVpW1,PK,5Ϡ2l10!@ 3l#20X0Xp%1pZKP P P(KSp^hZ040 80 t,pd0%Ϡ2l10!0X03l20!0X00$1W^0$Ϡ82l10!0X03l20!0X00@ğ,KAP  Sd$$0 /Po0@0S@T SUQPRZ ,00K00 P0p,S0O/Q 5GE$Y@H@`_Y,p W^30S80  4 21C" 0080  N21C 80H Q4 ^2C P H)H 0@Q0 SLH 0R9H04  0S0 0R L4Q4 0L@RP0cPPpK,@PDG{ND@D/0C!bb@ae B!a10b cP0R P0H!0Ϡ0l $ "Bb$1a `34 1CcP0, 2n10!0P3n20!0P P 000S Ppc 1 SP0 0 L$@P@QQ,?E.Qnm$Ių4d R 10bSP001bSP00 -PLU`p@ +0c0h+ 0R 0R 0R 0R 0R 0c -L@M0hK0  ! 0SdPK dPK < P`pK< P (K\K PXTP\(0T(cP??0cc(pK2'1C0cq X0 sPnP\\0fP XP,7U“2g10\!0؀ 0 3g#20 `\0` \ T7p؀!\\ XP,,7`\` )7U“2n10!p 3n#200P P &P1 0c\0 Pw\XP,h6ᓎ2g10!00 3g#20^0 ^  21C0!0 R b S\ X0 {XP\PDh ,0;R T0 v>% 0Sh oP`P ` 0`K0`p?S` p `p` p 0/ P/`_P `  a pKKpPK`EK 0 !  0b p ȀgppVp Ȁ P* -RLXM`@0<S t@ @dl@ 0S(K@>0 >S dt@ l _(6P01t@ l0 @, p pP00PUa <Uy p@ d0S,Sn,0>C00 0q03W0Sj;Q,Qg QX5%0  00@T 50%  00Q ^ Xpş @0M͆0@l0, 0P(5 a %0` B00 P Y00 P 0 0 St t ^Y m l  pTd;S 0KP\DK PV 0,SSXKPN pWKğ @0M͆0@=\0 30 h0 3l, b 0#P0l0 B3P ppp\ \ d ` (@h  0dK0ph dKX0KXʲ p \ 00B00B0h0h"Ϡ12l10!h0Q0 3l20!0h R001$#Bb20a/0 dK 0S| x0 NRL\0KS\ @Eh , |Kh d ` 0!0Ta !0!100QP0P`0Xq"10 d1  PR,00jO  1 0RcX,K@Pz͆@ ,0la  pP  P0 P@>%0 >Sp@ dU}WJ \ 00B0C0BI%L*@H*P*\*`*Q,X* -L@ qP  h -LpP`3 0S@ t|3@ 0V X0(0T=H00(0(0000f@P ph`B t - @L -L M<0 8@ L4@ D Y<0K,0 (@ 0S 08@S2 0S&\- 0 S 0QM@  D0,K @'D 0 #0 1D ($K81 0 R< K 4 00 Qsp 0<KN$0@40 0@ /0<S+*X0<S0<SN"1)<0S{70< S0Sx*- ,0R Q \|Y`X% -<1<`8!VL C 0S͆]P !0"100 !0S X @pP$P_0@0XZ]PpZ0=0 @$PpD$P00Z$000\|%H>  -tL0Sd@0 0R  Ph,0Pd\B -@L1h1l 0-8L#@PA (Q0SW$P2 $PP+P0S. \0   B,0hE KPxP 0:S  P 0,00h,UPZdd\P*L*B p-<`L@@1  @P81pl P0 0 p-8`LP@&1 @1pl -@L1rh1l -LM8 4 8K8 K @_@P(K0* 8`K0@0S@W!C T9 0@K00@P 0@ ,P 8`K0@0S@T* S1 00K@V0@K0@ P 0@ ,P 8`K0@0S@W S 0KP  0K(KSVTTS 0-LM  K00[TK0 -L,M@<K^ K -,L@, 00P h%tT -,L@, 0q0P h;tX -Lhj Q Q0!0a0PR- \1,0l00 ?\0 00R- 0bR R ?R0̑03012<000QS@-@  \0l 1<0̠ \ L ?\0 0@@\ P T  0 0-R ,0l0>-S0c012 0 00 S 200 0 3# R02 P0 0 bQ B2c0 @- @0cR#3n\0CQ0C2 d  l0p@- HXH$H%X!! a. $.ȌT2Vh`@pP1#3P1 <2TPQP3100QP3100Q#2QPP ;; ;Sq0 P0-9XpTP@ U` V( 0@0000# p-L`P@@@`@p -LPP@`p P B`B0Q40A"A`R0E0U0@ EPU0r @0P 00`04S0`P0  0  ꐽ -X1L0ps3X@@`S P S `8?SPQ QU 000@U000#? 0S`Z?45VCq00ࡣ0aS S4#0C@@PUQ @T@Pꌽ p-`LP@@!aph -L@P0, 7 `p P  0G`pe -L@pPe P eL -;PpLg45^@càU WN^a lAi^<.0n0ðVU, UPp V* f(\\0"?DE iW U0naS S6#0c``< 0S00O@`V`ꌽA-;P`f45^@s àU VNŒ^ 2 0N0AA A^<.0n0ðWU U ?1"C 0\ A<V U0nrS S 7#0spp\?DE pWp/R 5/R 1 -p!   PLP` &:::S@ W 0@ 460@ P S460 PXP -p!   PLP` &:::S@ ?P @ P0@ 000#460@ 460 W V  RXU -p!   PLP` &:::S@ ?S@ S 0@ 460@ 460 W V0 PXU0 ;p-@TTLUo Z~T 000p54 "d a3000V `pT00U0SpP |Vp落;0 S-L@ ;0S P 0045S P [45S PP;0 S- L ;0S P P0045S -45S %R 0#03P;0 S- L ;0S P P 0045S 45S R 0#03PPPO? ` H !:0-LʠʠAL@N$^?&P@)0\^.0n04.U`U00P00S R 00000\ U0 0H0\6n "30  0000 -;L0M^P( $ 堏' ^ (P=O*1@@^ `0OO0   K\0O/ $K( K,$N$ \0O/@0 P0@00 ,@ $p4 < 8p PK4B0 ^0 ?^4@^ @T@0X0@@`" Ѝ) Z 030#0Z& ` 0 `0O PO ` P`` ЍG"04C0X0 Y ZnfQ&030#Q0516!P&030#0O/@0  Q ?Q 063UP030#&@Q `V`UP&0 A030#& -顏OLMX`p P  -顏OLMX`p P  -LXMt p p`| x0 x&Jᄪ.J`pDE媪ZoO`&l` t@|`8@ 4 , @` < 0 P d^ ^P 0 0(p(K |@K0 K<0K,Z48l p0O჏8K, K40K,8@4@<0*6々/00 E cXh 8@ 4 Šh0O⨀8@ 4 h  @ < @< @0"HXH%X$H\0 #Ƞ 88#8! Ƞᑃ.,Ƞ\d  D X c.D ᑕ,$.( 40T 2VD0gh`.8C \0C2 8\0CR0CTbP0CX`SdH ZHX \@ 0 3 #Z0#033#d` `FH d` JX H ;#;S` T<h)XX&h@%X (,8 ("( 8ᐂ.#8T Ƞ,ȠL r.L0P ᐖ$".H`LR20cWxp,8C T0C2T0CRZ0C2 aP0C X@S b`ZPT03#030# 3 #```F@ `` J `00` d`:%5ʠlhp` ^ l 0O/@0pl p 0O჏00 T030"S  pl /O p -LlM  ` 0 &J,JJJ@ 倠HD `^oOP`&@px` P`8@ 4 , @P < 0`  @cT ^ x 0O8K, K40K20^ <@ xP0O@K0 K<0K0`` 40@6|0 8<0 6*(|x("('x*D0 ,XX%X8`h0 D0l |`#Ƞd@ H Ƞh`.,Ƞl& `0 ld0!$Hខ(P` <#``X0 a&8H0 \` H` j&t p` X`P h(T` `g&T\唗)L xHp(Q2Pt.!8l@|T!LP\ 0V02PPhV0*(d`X^ 2\H@` V\`XP\xp*T3#0 Y2 Y 8 S030#p p,0Q0WC)*D@tP|`x 0<@ @P 4` (K%V! 0! 00 x  0O/0X@? ς^p x 0O/ -L,M0PPp,0 `1  9@KR0! 蠟 R0!  0Ā= 0P0 0    0@npV@@, 0R(Kju00 <bupW00 UiLN]T -0L@H $0"P H h Q *0S00S0 Q -LMTp,@KP` 0    0RK i -0LobfrgRBQ Alnn  `` @`Väp"d@`FT00æ?d@D`R ?V00S X W  40W  $@0iQH -LMp \, ` *: 0 0 tpl*h: 0 | x 0 V 00\ %\z^,P \h4T h,dpDdh,Dt$0P`(, 0R(K 0So$@ T@d Ϡ0lP0 U  ^00U#3   0 P[h p-0L@0  0$RP`@) I2#8# c .@1QS P00S 0N!QR P00S\Pp80\ -L M 0`^K~`r@P x10鎠7p@PJ XT0 00Q 1p\ ,&("(30b,>0A!0 S00QuKP& 01C0 0 @0 0 (68#8# cN(. 0B 0S   00C 0(K  -LPM0d(0  @0P ,0 U U  UXh@K?  P$ K0DPCM0SJ @<0C>S񟗶t     h     X L @  4        h  \   P        D     4 (                   0$0t 0SPU$0SD3  c P0 Pp 3P6P@    t *@< 00 2P6P0   R@0x0 0Z $%Z: U0 @0 |( 0R$K0000:(00 0000,00,0,00 S,01,, 1 20$00 0~0 0{ @0( ,0 t00q00n00k00h0(0e0 00a00^0 0[0 0X0* 0( ,0P00M00J0PPUJr;PD|s00l0 R 0So 008`,i $0` ->0>0L MS`4 0  (Ko?24, !Q, p0B0c, R,c0 S*0r 0P#R R * 0000#22Y1 (",0S* px 0t0 R!p00b b0 p0x 00h0Yp ,0S0C 0Q@t0S x0IP t`1, R B0 A0t0SP Pt0S P00AU00, p0S(K0pS( 0S 0 0t ,xp00p0, U S(Ko04JIPh 400a0ym40 -04 @0  -sLP"`P *"*R@ R@  B0B Ts0STD3 R8C0 S*(3  0 ""! ttXPUV P 2@` 0 S A00C:#:30#" 01#e3! Q1(1"(@0@R!o 1S$ R000 !R 0S *l1S1100S00@@( 0b SP1:U xiR>0N@ TK: X>0N@4 0( 00b00!S 0S  |i/ic  Vii(  b R 0@@. @0N(@a 5P 80|T4pd -L`/mVp P0S0 @0T  @00S0 h0 0CR0mp<0< @80T 0S$hU ꔻ -LMX`0 0&P,  8=>0>0S 4p(K80\>0>0Sp0(VUeB0 Ss*0帢 0p#r R k* ,0000#22P~ @ 00 1@tpW x t0R% U0QZi 0 0e6RpAC0SJ ,0 e Sp00ep0<0S 0S   0|S70S=xtp0, 0eRp000S 0S  (1@P03pp{ !000v 8  x h > )  j Z > h0@P0T3pD p000p ,0RA$r=  - PL M8 P6(0:CZ*`>0N&@8 ppe Ɵ0 +PP6(Q|0PSb ( a R^*0S98:b0\p 0S(KƟ0 0(RC 0JS1p00@`V 0R 1%S@ U0 S*5 00#2 @T0N@$20!0RPp"@^@Z p 0 #2 p0p080Q0S 80Sb (0c f 058#Ƞ@^@0000!1 B("(0,R1!Q0000$ğ0c02!0QB !R 8p00Q00Sg Ze i `d # 1,kp 00Qa  PxpTß0( 00/di(  bE < p4 p4 W:370#2000< ,0 , < `00V00 u Q000,  0V 0a WI,!!q4004 P^  ,20 B0R ^ ,"   0 ^ @@Q@0`4@00@`0#4 0  a (0 c:37 '8#8!1q14jp 00 44*p@ 0P01p@  0,00P  0 00S000R0, 0``4*YQ0``v<0`Q|p   -LM@8 `7jDppTPPU4 @#0SG#0S2 m 00S0 j@j4  (K$0 T,0 R(0:CV**`>00`  Tn`>:W<0TQP0 0.pP4Bj(Qp0"S ,0S8 (00 c b  i 001 0R0C0U i4 @ 80P 0S i 00x  V!1PdP(  b , pP 0dX p`DP.PgDP$ X0P0d0iP 00 iP 00a e P`( 000H<,ꔻ`0 p -LP`TiLq0S<<.0 N. @T, D *Q#Dp,0pdS@@p <@ 8 @0 ,00@S|0<0 t@ Q0Px0640 RCPt8px p080bp0x040h0TpW'  .@P TUX 0 0CR0T 0hH(K <(h@ 00 R !0S@iXl( R @@ ^P@T0 e2@OP (QD P4D h,P@@<@ 1p@<XH <T. t @BP P(T R*q0S,,P@tia P.0Dp(PL `P L 0@R00 @ P@PbD a e@ X0p@.@4Lꔻh` d4p -L`vgp0SP @0T * @00S0 $ L0 0CRP0U VgFX0 R TIg 009PPP ꔻx` -LM PK 00%0 @# 0ST  @0S0S Q 000100M3*2G-@0 084 0<0   0 0 8M4   0 < R00 P ` p@  l0 P ` p08 40< 0 0(0$ ,$ 0 84 0<(00 ( 0$0 ,, 08 40<0 (0$ , 0 8 40<0  (0$ , Ѝ 4 0 0-8 40<80 (0 $ ,<  -LMlIS@1 08 ,0 < 9 P8$Q `8! a p81q 8A 8Q 8a    $ ! (00 ,@@ 0PP 4`` 8q88p p < @?\\lK lK<00@ R < 0!@0 0 @ 1 $0 Q! BK@p0 0041 ( 40@,001 0#1 1 c81 `0*dH,a n`0lȠp (q p,(1P,&4 #'a01 ` 0eZ0 0 ( @#1b*,1 c̠1 c<1 ,1*00 (1n00 1dLp0'P#0  #0\00 0,00 10(1 0`#0&@#1nc81 `0dH00 000 0 &#0` P#0eZ00 0 00 b*1 *lȠ0(1 p0'a#0 @# *1l̠c<p`p 1 p0` ndL`p0& #0P'#p0,0Sp0  \U00 0 $ 1 t x 倀1  1|   !P `pP  ` `p Pp Pp @ P p @ tx |0!",#<  D H! L1 @P`p娀嬠 0$L%\&l'|(*,̠. !",#0A?@P$P`(`p,pԀ0ؠ48<@q@@pG@q @?P P8A4P`0``, 0R(KP p  00@1Qp P8A4P`0`Вi -L@MTqH`K@L0K %(PTK L P TP @@m0S!P,(Kc0+0H0 D0 @0 <0 80 40 00 ,0 (0 $0  0R0KPx ;Z 00#0@(T0,@D4D4 ,?0 si  H$H jL$h  p-LM,a0SF(Q1 R!A0SP 0 cK a0 0A0^00=x 0P@0A00SpPhPl ;0,P3 @( V?0ꔻL$  H$H H$  P0-LP `k@Te00 -XL0@SPN(<U*01 R<$!U3 p ;0,( ?U0 0`S U@1@!c R `  0Pd0dS0p U0S0 0P0e0oꔻL$  H$H  h H$@-M Ѝ@-MЍ! !P: ZŒŒ#! !P: `B!,aB 0>ZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0  -L@hm+-*+@-Q:@- R (2 R R -PPPP RrPP B PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R@- RP1P P1P RrP1P  B P1P B@  R010 1  B R0q0`0q0`0q0`\0q0`0q0`0q0` R 0\6 R B0@-81, Ġ%̌T$\D#L0P  R0@ Ġ01#̌  R R B0@-81, Ƞ%ȌX$XH#H0P  R0@ Ƞ01#Ȍ  R R B0@-81, ̠%Č\$TL#D0P  R0@ ̠01#Č  R#@-PP@p0`V 010P T \ 0 S  ^ 0^\0=S P0fC10P$ -LM0 S=S  0S=S` K -- L^M⼠0Q`(0 qOoK`FppA@O?KC/MKl1 >]+* 0 0C0S2-S0!1!@-0@0 @0!00  -LMAPTpm V R0 X 0W@ P   0AV0P -LMR`  PU 0SPR U< 8 % ͆0! Q0pPP(K0 13 B1 00 0<0 8 010s0380 PU4 q 1S X!0R00S,  0S X 0SRQN 1SK 0 @ T0{ 0S00S\t@TG 00B Y > 0 1P0  @0 @, @' Y$0 S ಐR 0P |0Px  p0 Pg  (1S0C1, 0R00001p0q =W0 pU 80x03 |PJXG<4 001A  0 <30 BQ 1 11  00q ͆0! q0pq5 !D00^ 0 nP Q[ -L,Usage: %s ..., where is one of: instbin%s: %s not compiled in newfs_ext2fsmount_cd9660md5sha256sha512dfmountmount_ext2fsarchsyncnewfs_msdossttylndisklabelpaxtarfsck_ext2fscatifconfigsysctlrtsolping6datelessmoremount_nfsfdiskgrepfgrepegrepumountmount_msdosfscksignifymknodmkubootreboothaltmount_ffsdhclientcpgzipgunzipgzcatchmodchgrpchownfsck_ffsnewfsrmmtejectmkdirksh-shbioctlsleepmvexprdmesghostnamemain%s partition type is not `%s' (or use -I) -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file mke2fsilog2SSSWTWTbrdfsfsinitinit_resizeinoallociputwtfsioctl (GDINFO)%s: can't read disk label; disk type must be specified%s: block device%s: not a character-special device%s: can't figure out file system partition%s: `%c' partition is unavailable%s: `%c' partition overlaps boot program%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device where fsoptions are: Bad inode size %d (only 128 and 256 supported)sector sizesector size `%s' is not a power of 2.verbosefragment sizebytes per inodefree space %number of inodesVolume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:qs:t:v:can't open file %scan't fstat opened %s%sr%s/dev/%s: open for read%s: open for write%s: getmntinfo%s is mounted on %sLinux Ext2Unable to determine file system sizecan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing image%s: %u is not a power of 2 %s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode %s: no free inode %llu in block group %u %s: inode %llu already in use %s: inode value out of range (%llu). %s: inconsistent bitmap block size must be a power of 2, not %u fragment size must be a power of 2, not %u fragment size %u is too small, minimum is %u block size %u is too small, minimum is %u block size %u is too large, maximum is %u block size (%u) can't be different from fragment size (%u) GOOD_OLD_REV file system format doesn't support %d byte inode Filesystem size %lld < minimum size of %lld Volume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Cannot allocate I/O buffer Preposterous size %lld super-block backups (for fsck_ext2fs -b #) at: %*llu, ...%s: large_file rocompat feature is required to enable resize feature for this filesystem %s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir Error making filesystemff@fh@@f4fffȺ @@f`f ffunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs cannot be zerocbs meaningless if not doing record operationsbuffer sizes cannot be zerobuffer sizes cannot be greater than %zdseek offsets cannot be larger than %qdnonenoxferunknown status %s%s: illegal numeric valueunknown conversion %s%s: illegal conversion combinationcbsconvfilesibsifobsofskipstatusnoerrornotrunc%s: end of device%s: short write on character device%s: short write on tape devicefiles is not supported for non-tape devicesstdoutinput bufferoutput buffercase conv and -DNO_CONV%zu+%zu records in %zu+%zu records out blockblocks%zu odd length swab %s %zu truncated %s %qd bytes transferred in %lld.%03ld secs (%0.0f bytes/sec) skip reached end of inputmainiieiiii:iij jusage: mount_cd9660 [-egjR] [-o options] [-s offset] special node session number is %s: %segjo:Rs:realpath %scd9660%s: Filesystem not supported by kernel%s on %suserquotagroupquotarwautoaccesstimeatimeexecsuidrdonlyupdateneedsdoes not need-o %s: option %s a value-o %s: option not supported%s: illegal value '%s'%s ("%s") = %s %s (%s) = %s usage: %s [-bcpqrtx] [-C checklist] [-h hashfile] [-s string] [file ...] error encoding base64cannot open %sstdout: write error%s: read errorbC:ch:pqrs:txbase64hex%s doesn't support %s ,unknown algorithm "%s"SHA256SHA512usage: %s [-hiklnP] [-t type] [[file | file_system] ...] df: %qd: %s 1024-blocks 512-blocks%-*.*s %s Used Available Capacity Mounted on Filesystem%-*.*s %*lld %10lld %11lld %5.0f%% %s %7s%-*.*s %*llu %9llu %9lld %5.0f%% %7llu %7llu %5.0f%% %s %-*.*s %s Used Avail Capacity Size1K-blocks%-*.*s %s Used Avail Capacity iused ifree %%iused Mounted onempty type listonly one -t option may be specified.hiklnPt:-h and -i are incompatible with -Pretrieving information on mounted file systems%s is not a local file system%s mounted as a %s file systemffsext2fsprmountmountfsmainnfs:@ufs%s: fstab uses outdated type 'ufs' -- fix pleasemfs%s: fstab type %s != disklabel type %susage: mount [-Aadfruvw] [-t type] mount [-dfrsuvw] special | node mount [-dfruvw] [-o options] [-t type] special node -o%s,%s on %s type %.*s (%sunknown flag%s %#x, ctime=%sv3v2udptcpsofthardintrnoconnrdirplus%s%s=%dwsizersizerdirsizetimeoretransmaxgrouplistreadaheadacregmin, %s=%dacregmaxacdirminacdirmax%s%s=%lu %smsdos%s%s=%u, %s=%uuidgid%s%s=0%onowin95direxecnorripgensextattprocfsversion %dlinuxstatfs %s on %s type %.*s: %s already mountedexec: mount_%sfork%s/mount_%sexec %s for %sno mount helper program found for %sforceAadfo:rswt:uvrqnoautounknown special file or file system %s.root_devicecan't find fstab entry for %s.%s has unknown file system type./var/run/mountd.pidsignal mountdasynchronousasyncexported to the worldkerberos uid mappingNFS exportedanon uid mappingexported read-onlynoatimenoaccesstimenodevnoexecnosuidwith quotasread-onlyroot file systemsynchronoussoftdep/usr/sbinmainiieiiii:iij jusage: mount_ext2fs [-o options] special node o:specified device does not match mounted devicefilesystem not supported by kernelmount table full%s on %s: %susage: machine [-a] usage: arch [-ks] machinearmv7armOpenBSDmain}@@}@h }p}p }p }` }@ } $%s: no default %s%s: illegal %s%s: bad %susage: %s [-N] [-a FAT-size] [-B boot] [-b block-size] [-c cluster-size] [-e dirents] [-F FAT-type] [-f format] [-h heads] [-I volid] [-i info] [-k backup] [-L label] [-m media] [-n FATs] [-O OEM] [-o hidden] [-r reserved] [-S sector-size] [-s total] [-u track-size] special [disktype] %s: bad FAT typevolume ID"*+,./:;<=>?[\]|%s: bad volume label%s: bad OEM stringbytes/sectorsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorssectors/trackwarning: %s is not a character device%s: unknown standard format%s: can't figure out partition info%s: unknown disk type%s: partition is unavailablebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %u-%c is not a legal FAT%s optionblock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectorstoo many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs= bkbs=%s: can't read sector %uNO NAMEFAT%uBSD 4.4%s: can't write sector %u160180320360720120014402880 $_(oH08< DL fT \ r`؈dl: (0 8 @#H3P#X3`2h3p3x#@@, @@Ĉ̈Ԉ܈  $ ,@4@<DLT\dlt|ȉ Љ ܉ $,4<DP\hpx@@@@  Ċ Њ ܊ @@$, 4 PC$<CDC$LCT`lxċ ̋ ԋ܋@@ $,printmainoption requires an argument -- %sundefmaximum option value is %d -- %soption requires a numeric argument -- %sdiscarddsuspeofeol2lnextminquitreprintstartstopsuspflushrprntillegal gfmt1 option -- %sillegal gfmt1 option%lxcflagiflagispeedlflagoflagospeedgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d TIOCSTOPTIOCSTARTTIOCSETD%d %d rows %scols %sillegal option -- -%scbreakcolscookeddecekeverythingextproclcasenewoldostartostoprawrowssanespeedttycs5cs6cs7cs8cstopb-cstopbcread-creadparenb-parenbparodd-paroddparity-parityevenp-evenpoddp-oddppass8-pass8hupcl-hupcl-hupclocal-clocalcrtscts-crtsctsmdmbuf-mdmbufignbrk-ignbrkbrkint-brkintignpar-ignparparmrk-parmrkinpck-inpckistrip-istripinlcr-inlcrigncr-igncricrnl-icrnliuclc-iuclcixon-ixon-flowixoff-ixofftandem-tandemixany-ixanydecctlq-decctlqimaxbel-imaxbel-echoechoe-echoecrterase-crterasecrtbs-crtbsechok-echokechoke-echokecrtkill-crtkillaltwerase-altweraseiexten-iextenechonl-echonlechoctl-echoctlctlecho-ctlechoechoprt-echoprtprterase-prteraseisig-isigicanon-icanonnoflsh-noflshtostop-tostopflusho-flushopendin-pendin-crtnewcrt-newcrtnokerninfo-nokerninfokerninfo-kerninfoxcase-xcaseopost-opostlitout-litoutocrnl-ocrnlolcuc-olcuconlcr-onlcronlret-onlretonocr-onocrtabs-tabsoxtabs-oxtabsonoeot-onoeot tablet disc; slip disc; ppp disc; strip disc; nmea disc; #%d disc; ispeed %d baud; ospeed %d baud;speed %d baud; %d rows; %d columns;lflags-extprociflagsoflagscflagscchars%s = %s;%-8susage: %s [-a | -e | -g] [-f file] [operands] -aefgaef:gnot a terminalTIOCGETDTIOCGWINSZgfmt1illegal option -- %stcsetattrTIOCSWINSZlinkitusage: %s [-fhLnPs] source [target] %s [-fLPs] source ... [directory] %s/%s%s: disappeared%s and %s are identical (nothing done).FfhLnPscmplabelduid_parsegetasciilabeleditEĺmpsavehas_overlapgetuint64editor_allocspaceedit_parmsedit_parmseditor_resizeeditor @ 8 @ @H P@@ \ @h(@t %(@@  `NH@_@@d@ L|<DP\dl|ذ2n$4nHpinذ $(,4q$(\s6㿂;{vc'9O8'm:="! 5Ei[HZqv8E>}N.{7{iXiz^T ]Z|ת"4.yw'篒W;}&167M*Qd *OUwit{Uvj_ɿEr>yϒ3y?'0,&in_2YfӫJʫ\%/)*y.LJ(}qUJt3[_5Ƈ?7(>S‹dDy|H>\SCf .gTSͼY#j{^g!a:x&Q?I-7nOt{UJ^N>-=;UQTw;?h+  8)Jf_ZtúV=LU*x\\%ޟ]%')JG?x$x > aO bC{d%rsV:[ ɚZkb {W%n$9l܀!dhIuj*{IZD2 11˵j]RR hgN jW20Ȁ pqf](#SYgW~gQAWO 9MH:_c(̠IfQV-M5pag5;m ?kMQJaqVJ!sӐq/fzwnE"ӳKw;8zuz[SW ZjrfryZ<`b" #o\4Ut+Nj2;,&}C0_¸aP}؝ȫ5J=n: a?8F5͈V̈U2f`HACڼ$w&P*)f•tu&=<9;#0 :MmA*&x"PTp'okm7 Q@*U=kQh%w(DVG٠HA_ㆁ}hSEaP3Ay:_rB"2Obbg%9A#) M6Es 4/[2NiJ Yҷj.dйmЭ/mP;rqt}%_0Jb蟄4Zy)bJ! (F!0"c "6<owًH? X4 [='jW$cKb<jC>j .)hTB=Ƀ|Q͝)kԈvN8a6X7 7B:=-Am$a'>ݔ0"D]4![ 8ź}\, pUoqqo>%yC F'.!ApekK"("bܣa6$uδPslU 9&AVْ7 psXjD*%# a^H֡]_w9/Uij-[~k+sd˥IP>8fqChB03N{r,M0"ksem,LdD5daYx#64pYJv0:[8Xm%Q"lX6`qW:_PcRf5l(ۮ~fRDxx2<hS y(֠Amdirm… Z9EFy!G *S vzPpsB:&LIV9nҍpiE+o]u×<|Rsyj L"~`0RQCDSbEɖZP7`F'~uMV74܉<:FͪZwNwS|UxC*`}!#,Cqm6nLTʩuӢAn|*yT:IJl<O,u{Ќz&t9<z^0! YV=ٷ5H3Vmd]N+}>|>_Pu0c_U\5U]ay|yZ8 qZQ#j7b;+ 1|DH-moM. T1 p16NG1fJY<ހ|+m8[e*Db>!93q@Aqh|j-ŞJZdܝcz4ʚ2rTxvR1*ח`vQ陁%)95'J9EOZ;/VT\xɥi4Q;YQ'v/cX؀Z'cdz6[UA6,ӾVȘp$ ``'0u_#GXUv%dێGׁ2덂K:w.~3=bxܻv\$f=`&vHIQRܱ49 .(V-n5½c*I5x@(Y BL wfX `O:/Pqa޹W YV69x)L? rx4UF d3jkr뼇Q ;X(g:D7wWv5ӈK`4+Ʈ "YP]-f`Jz߉-k t2ƻF? A F_*W*TͧBwW`4"*}<ka̬egﺮ0x ;BTzi_}Vo3WqQ^5S7\=CxD kQzD y{<*Mi@̂B8ɶn0, \B-_0żdmgQœP &CO C2u}|:B93MR6W$p9֙Q'P`roolT3sWNizr0*Ldܰ*21y6xi%ejsL[1%і8M1.ȴt\%KK'7>5{O,ȲE1oT)? J>E2gğ\w0')y'2E&3b6dܼW e\יoHiUWg<ܵB G 9'HF5Q&P.Uj\M{~ ƿ; SY43eJCX"nQ[&KA; iT~Q%]l$68"k<>5g.PCqsSYJy9E#e3f ͹ 7ӋKl@"MӰSOvο&v 㲅01\IB&b4* gka7^gI)JIZ##C-K8i)wG`l10E};]bc9C †6>9: -M~oրDh͞H 716yrIr$>}=6M?7eWb1yA/z bQת3pW$(GQ?~ty\>,+L%0\]5L6KyJ0ʕ02x#x]\}y6VOn`ǎ B\vNt4PL/ϻuqs͘Z~VMs=vP~#0Ư RM {mo\թ5^%J0-6dkprc]@aJxBU9F`ij$c_3-ȸ;$B[4O#a[a=%2hZH?(]/[rDA?>-)/>zV;(҇TҨqiﾭ\@T0||JXH>s6,?PAM+M%%&AajLWsb~H~*׋Kwx7-/ҕi `F_Mkf&uÿhwꆚUzyϟ<2ڽC-Rusage: disklabel [-Acdtv] [-h | -p unit] disk (read) disklabel -w [-Acdnv] disk disktype [packid] (write) disklabel -e [-Acdnv] disk (edit) disklabel -E [-Acdnv] [-F|-f file] disk (simple editor) disklabel -R [-nv] disk protofile (restore) `disk' may be of the form: sd0 or /dev/rsd0%c. `disktype' is an entry from %s, see disktab(5) for more info. /etc/disktab`packid' is an identification string for the device. `protofile' is the output from the read cmd form; -R is powerful. sector size %dsectors/track %dtracks/cylinder %dcylinders/unit %dboot block size %dwarning, boot block size %% sector-size != 0super block size %dwarning, super block size %% sector-size != 0warning, number of partitions (%d) > MAXPARTITIONS (%d)warning, partition %c: size 0, but offset %llupartition %c: offset past end of unitpartition %c: partition extends past end of unitwarning, unused partition %c: size %llu offset %llu # line %d: syntax errorunknownIDEESDIline %d: warning, unknown disk type: %sbadsectvendorline %d: bad flag: %sdrivedataline %d: bad drivedata %s%d partitionsline %d: bad # of partitionsduidline %d: bad %s: %ssectors/cylindertracks/cylindercylindersrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seektotal sectorsboundstartboundendline %d: bad partition name: %sline %d: too few fieldsline %d: bad partition size: %sline %d: bad partition offset: %sline %d: warning, unknown filesystem type: %sline %d: unknown field: %sVISUALEDITOR/usr/bin/vi%s %s/bin/sh%s: No disk label on disk%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of disk%.*s|Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:nc#%u:sc#%u:su#%llu:d%d#%u\ :p%c#%llu:o%c#%llu:t%c=%s:t%c=unknown%d:b%c#%u:f%c#%u:Bootstrap doesn't leave room for disk labelioctl DIOCRLDINFOioctl DIOCGPDINFOioctl DIOCGDINFO/dev/%s%c%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx.aioctl DIOCWDINFOunknown disk type: %s %c: %16llu %16llu %c: %15.*f%c %16llu %7.7s%7d %5u %5u %4hu %19.19s# %s# %s: type: %s type: %d disk: %.*s label: %.*s duid: %02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx flags: badsect vendorbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %llu # total bytes: %.*f%cboundstart: %llu boundend: %llu drivedata: %d %hu partitions: # %16.16s %16.16s fstype [fsize bsize cpg] offset # Notes: # Up to 16 partitions are valid, named from 'a' to 'p'. Partition 'a' is # your root filesystem, 'b' is your swap, and 'c' should cover your whole # disk. Any other partition is free for any use. 'size' and 'offset' are # in 512-byte blocks. fstype should be '4.2BSD', 'swap', or 'none' or some # other values. fsize/bsize/cpg should typically be '2048 16384 16' for a # 4.2BSD filesystem (or '512 4096 16' except on alpha, sun4, ...) No changes.re-edit the label? [y]: bckmgtBCKMGTValid units are bckmgt ABEf:F:hRb:cdenp:tvwSMDMSCPold DECSCSIST506HP-IBHP-FLtype 9floppyccdvndATAPIRAIDunusedVersion6Version7SystemV4.1BSDEighth-Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSHFSADFSNTFSUDF-cTreating sectors %llu-%llu as the OpenBSD portion of the disk. You can use the 'b' command to change this. OpenBSD area: ; size: ; free: # %16.16s %16.16s fstype [fsize bsize cpg] Can't stat deviceAvailable commands: ? | h - show help n [part] - set mount point A - auto partition all space p [unit] - print partitions a [part] - add partition q - quit & save changes b - set OpenBSD boundaries R [part] - resize auto allocated partition c [part] - change partition size r - display free space D - reset label to default s [path] - save label to file d [part] - delete partition U - undo all changes e - edit drive parameters u - undo last change g [d|u] - [d]isk or [u]ser geometry w - write label to disk i - modify disklabel UID X - toggle expert mode l [unit] - print disk label header x - exit & lose changes M - disklabel(8) man page z - delete all partitions m [part] - modify partition Suffixes can be used to indicate units other than sectors: 'b' (bytes), 'k' (kilobytes), 'm' (megabytes), 'g' (gigabytes) 't' (terabytes) 'c' (cylinders), '%' (% of total disk), '&' (% of free space). Values in non-sector units are truncated to the nearest cylinder boundary.%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx.%c%s%c none swap sw %s%c %s %s rw 1 %d failed to sort partition table%s: [%s] [d]isk or [u]ser geometryEnter 'd' to use the geometry based on what the disk itself thinks it is, or 'u' to use the geometry that was found in the label.Command aborted BIOS geometry not defined. Note: user geometry is the same as disk geometry. You must enter either 'd' or 'u'. Where to mount this filesystem (ie: / /var /usr)'%c' already being mounted at '%s' Mount points must start with '/' The disklabel UID is currently: %02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx The disklabel UID, given as a 16 character hexadecimal string.Invalid UID entered. partition to deleteThe letter of the partition to delete, a - p, or '*'.Partition must be between 'a' and '%c' (excluding 'c'). Partition '%c' is not in use. partition to nameThe letter of the partition to name, a - p.You cannot name a filesystem of type %s. can't get mem sizePossible values are:"IDE", "%s"Disk typeWhat kind of disk is this? Usually SCSI, IDE, ESDI, ST506, or floppy."%s" is not a valid disk type. Valid types are: Error, partitions %c and %c overlap: Disable which one? (^D to abort) [%c %c] %s: [%llu] %lldRounding size to cylinder (%d sectors): %llu FS typeFilesystem type (usually 4.2BSD or swap)FS type (decimal)Filesystem type as a decimal number; usually 7 (4.2BSD) or 1 (swap).Invalid entry Unrecognized filesystem type '%s', treating as 'unknown' Size of ffs blocks. A multiple of the ffs fragment size.Error: block size must be at least as big as page size (%d). Error: block size must be a multiple of the fragment size (%llu). Align partition to block sizeRound the partition offset and size to multiples of bsize?Rounding offset to bsize (%llu sectors): %llu Rounding size to bsize (%llu sectors): %llu Size of ffs block fragments. A multiple of the disk sector-size.Error: fragment size must be a multiple of the disk sector size (%d) Zero fragment size implies zero block sizeSize of the partition. You may also say +/- amount for a relative change.The size must be > 0 sectors The size can't be more than %llu sectors, or the partition would extend beyond the last sector (%llu) of the OpenBSD portion of the disk. The 'b' command can change this limit. Sorry, there are only %llu sectors left partition to change sizeThe letter of the partition to change size, a - p.Partition %c is currently %llu sectors in size, and can have a maximum size of %llu sectors. Starting sector for this partition.The offset must be >= %llu and < %llu, the limits of the OpenBSD portion of the disk. The 'b' command can change these limits. The offset must be in a free area. partition to modifyThe letter of the partition to modify, a - p.No space left, you need to shrink a partition The letter of the new partition, a - p.Partition '%c' exists. Delete it first. Starting sectorThe start of the OpenBSD portion of the disk.Size ('*' for entire disk)The size of the OpenBSD portion of the disk ('*' for the entire disk).Changing device parameters for %s: What kind of disk is this? Usually SCSI, ESDI, ST506, or floppy (use ESDI for IDE).label name15 char string that describes this label, usually the disk name.The Number of sectors per track.The number of tracks per cylinder.The number of sectors per cylinder (Usually sectors/track * tracks/cylinder).number of cylindersThe total number of cylinders on the disk.The total number of sectors on the disk.You may want to increase the size of the 'c' partition.Not enough free space to shrink by %llu sectors (only %llu sectors left) partition to resizeNo such partition Cannot resize spoofed partition [+|-]new size (with unit)new size or amount to grow (+) or shrink (-) partition including unitAmount too big Partition %c shrunk to make room No room left for all partitions You need to specify a type for this disk.can't run when there is partition overlap.No 'c' partition found, adding one that spans the disk.Label editor (enter '?' for help at any prompt) unable to get default partition tableThis option is not valid when run without the -f flag. PAGER/usr/bin/lessgunzip -qc|%sunable to execute %sIn no change mode, not writing label.No label changes.Write new label?Write the modified label to disk?unable to write labelResize only implemented for auto allocated labels Free sectors: %16llu - %16llu (%16llu) Total free sectors: %llu. FilenameName of the file to save label into.Original label and mount points restored.Last change undone.EnteringExiting%s expert mode Unknown option: %c ('?' for help) /tmp/var/usr/usr/X11R6/usr/local/usr/src/usr/obj/homelfsadosntfsudfsdrzwdFLOPPYxdhdCCDVNDsvndabcdfiklnoprstuvwxBDEGHLPTUXYZ0Cannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specForward positioning operation on archive failedCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Reverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %d pad blocksUnable to backspace tape %d blocks.Failed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDUnable to truncate archive file%s: Waiting for tape drive close to complete...done. %s: unknown format, %llu bytes skipped. %s: %s vol %d, %lu files, %llu bytes read, %llu bytes written. could not pipecould not fork-dccould not exec %sFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed chdir to %sFailed stat on %sCannot write an archive on top of a directory %sUnable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Ready for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sUnable to open %s to readCannot identify format. Searching...Sorry, unable to determine archive format.Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot mix current archive format %s with %s%s: Reading archive to position at the end...Cannot chdir to %sCan't fchdir to starting directoryUser specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUnable to append when there are archive read errors.Archive read error limit (%d) reachedCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Write block size %d too large, maximium is: %dWrite block size %d is not a %d byte multipleWrite block size of %d too large, maximium is: %dWrite block size of %d is not a %d byte multipleWrite block size of %d larger than POSIX max %d, archive may not be portableUnable to allocate memory for group name cache tableUnable to allocate memory for user name cache tableUnable to allocate memory for group id cache tableUnable to allocate memory for user id cache tableFile changed size %sFile %s was modified during readFile rewind failed on: %sFailed seek on file %sFailed write to file %sFile seek on %sWARNING! Major Internal Error! GNU hack Failing!Out of memoryCould not set permissions on %sUnable to set file uid/gid of %sAccess/modification time set failed on: %sUnable to close file descriptor on %sUnable to copy %s, file would overwrite itselfUnable to remove directory %sCould not unlink %scannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCould not create: %scpioCould not access %s (stat)Unable to link file %s to itselfUnable to remove %sCould not link to %s from %sUnable to link to %s from %sA hard link to the directory %s is not allowedUnable to create %sIgnoring unterminated pathname at EOFIgnoring too-long pathname: %sCan't chdir to %snext_fileFile system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %sWARNING! These file names were not selected:Invalid file name argumentUnable to allocate memory for filenameUnable to allocate memory for file name buffer%b %e %H:%M%b %e %Y%s%s %s %s%2u %-*.*s %-*.*s %4lu, %4lu %9llu == -> %s: unknown option %c %s: %c argument missing Invalid option nameUnable to allocate space for option listInvalid options formatusage: tar {crtux}[014578befHhjLmNOoPpqsvwXZz] [blocking-factor | archive | replstr] [-C directory] [-I file] [file ...] tar {-crtux} [-014578eHhjLmNOoPpqvwXZz] [-b blocking-factor] [-C directory] [-f archive] [-I file] [-s replstr] [file ...] usage: pax [-0cdjnOvz] [-E limit] [-f archive] [-G group] [-s replstr] [-T range] [-U user] [pattern ...] pax -r [-0cDdijknOuvYZz] [-E limit] [-f archive] [-G group] [-o options] [-p string] [-s replstr] [-T range] [-U user] [pattern ...] pax -w [-0adHijLOPtuvXz] [-B bytes] [-b blocksize] [-f archive] [-G group] [-o options] [-s replstr] [-T range] [-U user] [-x format] [file ...] pax -rw [-0DdHikLlnOPtuvXYZ] [-G group] [-p string] [-s replstr] [-T range] [-U user] [file ...] directory Invalid block size %sbzip2compress/dev/rst0/dev/rst1/dev/rst4/dev/rst5/dev/rst7/dev/rst8b:cef:hjmopqruts:vwxzBC:HI:LNOPXZ014578-IUnable to open file '%s' for readProblem with file '%s'-Cwrite_opt=nodirTAPEInvalid -p string: %cUnknown -x format: %spax: Known -x formats are: Invalid write limit %sWrite limit is not a %d byte multipleError count value must be positiveab:cdf:ijklno:p:rs:tuvwx:zB:DE:G:HLOPT:U:XYZ0%s: Invalid combination of options: -%cDestination directory was not suppliedThese format options are not supported %s = %s ustarFile name %s/%s, too longWARNING! These patterns were not matched:Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Removing leading / from absolute path names in the archive ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Pattern select out of memoryPattern list inconsistentEmpty pattern stringUnable to allocate memory for pattern stringEmpty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sCPU time limit reached, cleaning up. Signal caught, cleaning up. Can't open current working directory.TMPDIR/tmp/Cannot allocate memory for temp file name.Unable to set up signal handlercan not gzip while appendingEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [[[[[cc]yy]mm]dd]HH]MM[.SS][/[c][m]]Unable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryCannot canonicalize %sUnable to store mode and times for created directory: %sUnable to allocate memory for directory timesCannot allocate space for directory access time tableCannot allocate memory for device mapping tableCannot allocate memory for interactive rename tableCannot allocate memory for hard link tableDirectory access time reset table ran out of memoryDevice map table out of memoryUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedNo interactive rename table, links may failCannot update rename tableInteractive rename table out of memoryHard link table out of memoryFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sUstar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sFile is too long for ustar %snobodyUstar header field is too small for uid %lu, using nobodyUstar header field is too small for gid %lu, using nobodyUstar header field is too small for %sTar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sInvalid extended header lengthInvalid extended header recordInvalid extended header record lengthExtended header record length %lld is out of rangeMalformed extended header recordlinkpathwrite_optnodirUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.%s: /dev/ttyFatal error, cannot open %susage: ping [-DdEefLnqRrv] [-c count] [-I ifaddr] [-i wait] [-l preload] [-p pattern] [-s packetsize] [-t ttl] [-V rtable] [-w maxwait] host patterns must be specified as hex digits%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0x%02xVr HL TOS Len ID Flg off TTL Pro cks Src Dst Data %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %s TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Echo ReplyDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set (MTU %d) frag needed and DF setSource Route FailedNetwork UnknownHost UnknownSource IsolatedDest. Net Administratively ProhibitedDest. Host Administratively ProhibitedDestination Net Unreachable for TOSDestination Host Unreachable for TOSRoute administratively prohibitedHost Precedence ViolationPrecedence CutoffDest Unreachable, Unknown Code: %d Source QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect, Unknown Code: %d(New addr: %s) Echo RequestRouter Discovery Advertisement(%d entries, lifetime %d seconds) Router Discovery SolicitationTime to live exceededFrag reassembly time exceededTime exceeded, Unknown Code: %d Parameter problem, required option absent: pointer = 0x%02x Parameter problem: pointer = 0x%02x TimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask Reply (Mask 0x%08x) Unknown ICMP type: %d --- %s ping statistics --- %ld packets transmitted, %ld packets received, %ld duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/std-dev = %d.%03d/%d.%03d/%d.%03d/%d.%03d ms packet too short (%d bytes) from %s%d bytes from %s: icmp_seq=%u ttl=%d time=%d.%03d ms (DUP!) (TRUNC!) wrong data byte #%d should be 0x%x but was 0x%x%x %d bytes from %s: LSRR: 0.0.0.0 %s (truncated route) (same route) RR: NOP unknown option %xping: sendtoping: wrote %s %d chars, ret=%d setresuidnumber of packets to transmit is %s: %sbad interface address: %sbad timing interval: %s%s: only root may use interval < 1spreload value is %s: %spacket size is %s: %sttl value is %s: %srtable value is %s: %ssetsockopt SO_RTABLEmaxwait value is %s: %sDEI:LRS:c:defi:l:np:qrs:T:t:V:vw:unknown host: %s-f and -i options are incompatibleNo audible output for flood pingsbind-R option and -D or -T, or -t to unicast destinations are incompatiblerecord route not valid to multicast destinationsping: record routesetsockopt IP_MULTICAST_LOOPsetsockopt IP_MULTICAST_TTLsetsockopt IP_MULTICAST_IFgetsockoptsetsockoptCannot set the receive buffer sizeCould only allocate a receive buffer of %d bytes (default %d)PING %s (%s): %d data bytes PING %s: %d data bytes ping: recvfrommakeentrylinkupfileerroriblockckinodemainpass2pass2checkpass5setup<DP\dl|ذ2n$4catchquitNO SPACE LEFT IN %s (EXPANDED)EXPANDUNREFDIRLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTUNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORYlost+found IS NOT A DIRECTORYREALLOCATESORRY. CANNOT CREATE lost+found DIRECTORY SORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu NAME=%s %s=%s DIRECTORY CORRUPTEDwrong type to dirscan %d lost+found%d %s I=%lluBAD STATE %d TO BLKERR cannot find inode %llu bad inode number %llu to nextinode Cannot allocate space for inode buffer bad inode number %llu to ginode blk %d < cgdmin %d; blk + cnt %d > cgsbase %d blk %d >= cgdmin %d; blk + cnt %d > cgdmax %d LARGE FILES UNSUPPORTED ON REVISION 0 FILESYSTEMSSETTING LARGE FILE INDICATOR SET LARGE FILE INDICATORTRYING TO SET FILESIZE TO %llu ON MODE %x FILE I=%llu OWNER=%u MODE=%o SIZE=%llu MTIME=%12.12s %4.4s cannot increase directory list PARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDSCLEAR (CLEARED)-%c flag requires a %s usage: %s [-dfnpy] [-b block#] [-m mode] filesystem ... Alternate super block location: %d bad mode to -m: %o ** lost+found creation mode %o b:dfm:npystarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system** Phase 1 - Check Blocks and SizesINTERNAL ERROR: dups with -p** Phase 1b - Rescan For More DUPS** Phase 2 - Check Pathnames** Phase 3 - Check Connectivity** Phase 4 - Check Reference Counts** Phase 5 - Check Cyl groups%d files, %d used, %d free %d files missing %d blocks missing The following duplicate blocks remain: %d,The following zero link count inodes remain: %llu, ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW *****EXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEEXCESSIVE DUP BLKS I=%lluuDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%lluINODE I=%llu HAS DTIME=%12.12s %4.4s (CORRECTED)bad size %llu:HOLD BAD BLOCKbad size %llu ndb %d:bad direct addr: %d bad indirect addr: %d LINK COUNT TABLE OVERFLOWINCORRECT BLOCK COUNT I=%llu (%d should be %d)UNKNOWN FILE TYPE I=%lluROOT INODE UNALLOCATEDALLOCATECANNOT ALLOCATE ROOT INODE DUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYFIXBAD STATE %d FOR ROOT INODE DIRECTORY TOO SHORTDIRECTORY %s: LENGTH %lu NOT MULTIPLE OF %dMISSING '..'BAD INODE NUMBER FOR '..'BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' BAD TYPE VALUE FOR '..'CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '..' EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEUNALLOCATEDDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORY (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%llu ZERO LENGTHBAD/DUP%u: %2x summary info for cg %d is %d, %d, %d,should be %d, %d, %d SUMMARY INFORMATIONS WRONG FOR CG #%dblk_bitmap:bbmap:BLK(S) MISSING IN BIT MAPS #%dino_bitmap:ibmap:INODE(S) MISSING IN BIT MAPS #%dsummary info bad in superblock: %d, %d should be %d, %d SUPERBLK SUMMARY INFORMATION BADstrdup failedrealloc failedmalloc failed/r%s (%s): UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat rootCan't stat %s %s is not a character device ioctl (GCINFO): %s %s: can't read disk label %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A EXT2 FILE SYSTEM (%s) BAD SUPER BLOCK: %s MAGIC NUMBER WRONGBAD LOG_BSIZEcompat 0x%08x, incompat 0x%08x, compat_ro 0x%08x INCOMPATIBLE FEATURE BITS IN SUPER BLOCKsuperblock mismatchesoffset %ld, original %ld, alternate %ld VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATECan't stat %s: %s %s is not a character deviceCan't open %s: %s ** %sNO WRITE ACCESS (NO WRITE)cannot allocate space for superblock LOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO FSCK_FFS TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ext2fs(8).USING ALTERNATE SUPERBLOCK AT %d state = %d ** F%sile system is clean; not checking ** File system is already clean IMPOSSIBLE RESERVED BLOCK COUNT=%d IN SUPERBLOCKSET TO DEFAULTWRONG FPG=%d (BPG=%d) IN SUPERBLOCKBAD SUMMARY INFORMATIONcannot alloc %u bytes for blockmap cannot alloc %u bytes for statemap cannot alloc %u bytes for typemap cannot alloc %u bytes for lncntp cannot alloc %u bytes for inphead returning to single-user after filesystem check bad file type 0%o cannot allocate buffer pool INTERNAL ERROR: GOT TO reply()%s? no %s? yes %s? [Fyn?] (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %d CANNOT %s: BLK %dProgram terminated SEEKWRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN: %ld,PARTIALLY WRITING %sZERO'ED BLOCK %d TO DISK UPDATE STANDARD SUPERBLOCKSPanic: lost %d buffers MARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEANcache missed %ld of %ld (%d%%) READTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %ld (%ld),deadlocked buffer pool %6d usage: %s [-benstuv] [file ...] benstuv1((9(9(9(9(9999,::::4 :4(:0:8:<:D:@L:,X:нh:xt: |: T.(:(.ܡ:T.l:::ԯ:(:T:::: /</,:X:;;(;4;H<;D;L;T;\;h;p;t;l9|;(;(; (;(;@(;(;ļ;;Dܻ;;;(|;4i i@/@/t9$i i/d2 ; ;`< <<<$<i0<$f#8<#@<#H<#L<$T<$\<$d<$h<%p<%x<%<%<&<&<'<'<(<(<)<)<*<*<+<+<,=,=,=-=-(=-,=.4=.@=/H=/T=0\=0h=0p=0|=1=1=2=2=2=3=3=3=4=4=4=5=5>6 >6>6 >7,>78>c@>cL>dP>d\>eH<e`>h>l>p>t>x>>>>>>>>>>>>>>>>>>? ???$?0?X?d? h? t?x?????? P? ? ?`?`?????? ?@@@$@8@H@GT@H@`@P?P?P?h@h@h@ذTp@@@@@@randommalformed link-level addressSIOCSIFLLADDRSIOCGIFXFLAGSSIOCSIFXFLAGS[#%d]SIOCG80211WPAPARMSSIOCS80211WPAPARMSSIOCGIFFLAGSSIOCSIFFLAGSSIOCIFDESTROYmedia mode %smediaopt instance %d"%.*s"0xSIOCGIFGROUPgetifgroups groups:usage: ifconfig [-AaC] [interface] [address_family] [address [dest_address]] [parameters] invalid channel %s: %sSIOCS80211CHANNELprefix %s: %sSIOCGIFMEDIA%s: no link type?only one `instance' command may be issuedmust specify `media' before `instance'media instance %s: %smtu %s: %sSIOCSIFMTUbad hexadecimal digitshexadecimal digits too longstrings too longSIOCS80211NWIDmalformed BSSID: %sSIOCS80211BSSID%s: bad value%s=%o%s=%xSIOCGETVLANSIOCSETVLANvlan tag %s: %s vlan: %d parent interface: %s SIOCG80211ALLCHANS %4s %-8s %s chanfreqproperties %4d %4d MHz passive scan%d: bad prefixleninvalid vlan tag and device specificationinvalid %s %s: %s%s not allowed for the AFvltimepltimenwid chan %u bssid %s lladdr %s %u%% %udB powersave %uMESSIBSSCF_POLLABLECF_POLLREQPRIVACYSHORT_PREAMBLEPBCCCHNL_AGILITY SPECTRUM_MGMT QOS SHORT_SLOTTIME APSDDSSSOFDMDELAYED_B_ACKIMMEDIATE_B_ACKCACHEBSSAUTHASSOCCOLLECT no permission to scanSIOCG80211ALLNODES none restoreunknown %s media mode: %sonly one `mode' command may be issuedinvalid media mode: %sunknown %s media subtype: %sonly one `media' command may be issuedmay not issue `media' after `mode' commandsmay not issue `media' after `mediaopt' commandswpagroupcipher: unknown cipher: %sstrdupunknown %s media option: %sonly one `-mediaopt' command may be issuedmay not issue both `media' and `-mediaopt'only one `mediaopt' command may be issuedmay not issue `mediaopt' after `instance'wpaciphers: unknown cipher: %spsk802.1xwpaakms: unknown akm: %swpa1wpa2wpaprotos: unknown protocol: %s ieee80211: nwid chan %u bssid %s %u%% %udB nwkey persist%d: wpakey wpaprotos %swpa2 wpaakms %s802.1x wpaciphers wpagroupcipher powersave on (%dms sleep) (auto) %ddBm%sHIDENWIDNOBRIDGEUPBROADCASTDEBUGLOOPBACKPOINTOPOINTNOTRAILERSRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTTXREADYNOINET6INET6_NOPRIVACYMPLSWOL rdomain %d metric %lu mtu %lu lladdr %s status: %s %s: no media types? media: supported media: tunnel: inet%s %s -> %s:%u vnetid %d ttl %dpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEYunsetifgroup: group names may not end in a digitunsetifgroup: group name too longSIOCDIFGROUPsetifgroup: group names may not end in a digitsetifgroup: group name too long SIOCAIFGROUPSIOCG80211NWIDwpakey: invalid pre-shared keywpakey: passphrase must be between 8 and 63 characterswpakey: nwid not setwpakey: passphrase hashing failedSIOCS80211WPAPSKinterface index is already filledgetifaddrscould not determine link local address inet6 %sSIOCGIFDSTADDR_IN6 -> %sSIOCGIFNETMASK_IN6 prefixlen %dSIOCGIFAFLAG_IN6 anycast tentative duplicated detached deprecated autoconf autoconfprivacy scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime inet %sSIOCGIFNETMASKSIOCGIFDSTADDR --> %s netmask 0x%xSIOCGIFBRDADDR broadcast %sSIOCIFCREATEinvalid carp demotion: %scarpdemoteSIOCSIFGATTRSIOCGIFGATTR carp demote count %d%s: no such interface SIOCGIFGMEMBprintgroupinterface name '%s' too longcreatedestroyinet6'%s' requires argument'%s' requires 2 argumentsSIOCDIFADDRSIOCAIFADDRarp-arpdebug-debugalias-aliasdeletenetmaskmtunwid-nwidbssid-bssidnwkey-nwkeywpa-wpawpaakmswpacipherswpagroupcipherwpaprotoswpakey-wpakey-chanbroadcastvlanvlandev-vlandevgroup-groupanycast-anycasttentative-tentativeeui64autoconfprivacy-autoconfprivacypowersavepriorityrtlabeltxpowernwflagrdomain-inet6descriptiondescrwol-wollink0-link0link1-link1link2-link2mediamediaopt-mediaoptinstanceinstlladdrinetEthernetetherFDDIIEEE802.11TDMCARPautoselectmanual10baseT10baseT/UTP10UTP10base210base2/BNC10BNC10base510base5/AUI10AUI100baseTX100TX100baseFX100FX100baseT4100T4100baseVG100VG100baseT2100T21000baseSX1000SX10baseSTPSTP10STP10baseFLFL10FL1000baseLX1000LX1000baseCX1000CX1000baseT1000T1000baseTX1000TXHomePNA1HPNA110GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10GbaseCX410GCX410GBASE-CX42500baseSX2500SX10GbaseT10GT10GBASE-T10GSFP+Cu10GCuSingle-modeSMFMulti-modeMMFCDDIFH1FH2DS2DS5DS11DS1DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72t1t1-amie1e1-g.704e1-amie1-ami-g.704t3t3-m13e3e3-g.751e3-g.832e1-g.704-crc411a11b11gfhmasterfull-duplexfdxhalf-duplexhdxflag0flag1flag2loopbackhw-loopbacklooprxpausetxpausedual-attachdasadhochostapibssibss-mastermonitorturbohdlc-crc16pppframerelay-ansiframerelay-ciscoframerelay-ituno carrierno networkbackupactivekeepalive downusegroupwep40tkipccmpwep104displayprinttimeprintlong %s: %s: %s: directory causes a cyclefts_readCOLUMNS1ACFHLRSTacdfghiklmnopqrstux%b %e %H:%M:%S %Y%*llu %*qd total %llu %s %*u %-*s %-*s %3d, %3d %*s%*qd %*s ls: %s: %s usage: %s [-1AaCcdFfgHhikLlmnopqRrSsTtux] [file ...] usage: sysctl [-n] name %s=kern.osreleasehw.machinehw.modelhw.producthw.disknameshw.ncpufoundwarnmsgrtsol_timer_updateifconfigmake_packetmainrtsol_check_timerrtsol_inputsendpacketrtsol_inputsendpacketsockopeninterface_statusinterface_upget_rdomainlladdropt_fillinterface_statusinterface_upget_llflagget_rdomaindefrouter_probedefrouter_probe:sendprobeprobe_initmultiple interfaces foundreallocprobing %s<%s> %sillegal interface state(%d) on %sstop timer for %sset timer for %s to %lld:%ldfailed to get link layer information for %sinterface %s was already configuredmemory allocation failedlink-layer address option has null length on %s. Treat as not included.memory allocation failed for %susage: rtsol [-DdF] [-O script-name] interface ... rtsol [-DdF] -a usage: rtsold [-1DdFfm] [-O script-name] interface ... rtsold [-1DdFfm] -a adDFO:adDfFm1O:kernel is configured not to accept RAskernel is configured not to accept redirectskernel is configured as a router, not a hostfailed to open a socketfailed to initialize interfacessetting rdomain %ufailed to initialize %sfailed to setup for probing routerstimer expiration on %s, state = %d%s status is changed from %d to %dNo answer after sending %d RSsthere is no timerNew timer is %lld:%08ldselect: %srecvmsg: %sfailed to get receiving interfacefailed to get receiving hop limitpacket size(%zd) is too shortinvalid icmp type(%d) from %s on %sinvalid icmp code(%d) from %s on %sinvalid RA with hop limit(%d) from %s on %sinvalid RA with non link-local source from %s on %sreceived RA from %s on an unexpected IF(%s)received RA from %s on %s, state is %dsend RS on %s, whose state is %dsendmsg on %s: %smalloc for receive msghdr failedmalloc for send msghdr failedff02::2inet_pton failed for %sIPV6_RECVPKTINFO: %sIPV6_RECVHOPLIMIT: %ssetsockopt(ICMP6_FILTER): %sunsupported link type(%d)ioctl(SIOCGIFFLAGS) on %s: %sioctl(SIOCGIFMEDIA) on %s: %sioctl(SIOCGIFFLAGS): %sioctl(SIOCSIFFLAGS): %schecking if %s is ready...socket(SOCK_DGRAM): %sgetifaddrs: %sioctl(SIOCGIFAFLAG_IN6): %sget_llflag() failed, anyway I'll try%s is ready%s is tentative%s is duplicatedget_rdomain socket: %ssysctl(ICMPV6CTL_ND6_DRLIST): %smalloc: %sdefault router list contains a non-link-local address(%s)probe a router %s on %sshutdown: %snigrouppr_iphdnsdecodesummarypr_rthdrpr_icmphpr_nodeaddrpr_packmainZRZ$Z,Z usage: ping6 [-dEefHmNnqtvWw] [-a addrtype] [-b bufsiz] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-V rtable] [hops ...] host ff02::2:0000:0000-%uVr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->\%03o --- %s ping6 statistics --- +%ld duplicates, %.1lf%% packet lossround-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms path MTU for %s is notified. (ignored) NodeInfo Supported Qtypes, compressed bitmap, raw bitmap???nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu HbH Options: Dst Options: Routing: sendmsgping6: wrote %s %d chars, ret=%d IP6HBH DSTOPT FRAG RTHDR AH ICMP6: type = %d, code = %d ESPUnknown Header(%d) No Route to DestinationDestination Administratively UnreachableDestination Unreachable Beyond ScopeDestination Unreachable, Bad Code: %d Packet too big mtu = %d Time exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option Bad code(%d) pointer = 0x%02x Listener QueryListener ReportListener DoneRouter SolicitationRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sNode Information QueryNOOPSupported qtypesDNS namenodeaddrIPv4 nodeaddrunknown qtype, subject=%s(%s), oldfqdn, no subject, subject=%sDNS label(invalid), invalidNode Information Reply, %sBad ICMP type: %drefused truncated no address %s(TTL=infty)(TTL=%u)invalid peernamefailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!)extra (%d bytes %s)refused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luinvalid socket buffer sizeMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %stoo small interval, raised to 0.01Must be superuser to preloadillegal preload value -- %s-R is not supported in this configurationinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %da:b:c:dEefHg:h:I:i:l:mnNp:qRS:s:tvV:wWtoo many intermediate hopsgetaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface namecan't initialize rthdrbad addr family of an intermediate addrcan't add an intermediate nodeUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP setsockopt(IPV6_RTHDR)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> pollrecvmsgnew path MTU (%d) is notified IPv6 addressIPv4 addressSuccessRefusedusage: %s [-aju] [-d dst] [-r seconds] [-t minutes_west] [-z output_zone] %-*s[+format] [[[[[[cc]yy]mm]dd]HH]MM[.SS]] illegal time formatUTCcannot unsetenv TZad:jr:ut:z:settimeofday%a %b %e %H:%M:%S %Z %Yspecified date is outside allowed rangeCould not get local time of dayadjtimedate set by %stoo many argumentsconversion error?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for data?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?m(%T %i of %m) .?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%tCannot allocate memoryLESSSECURE-G-L-XLESS--WARNING: terminal is not fully functionalLESS_TERMCAP_DEBUG<%s>LESS_TERMCAP_krklkukdkPkNkh@7kDLINESlicoTERMhcxndadbsgpcticdcmsomdmbvbbc|^srNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketseek error to 0ch_ungetchar overrunseek errorESC^%c*s<%X>less %s(P)+Non-match First-file EOF-ignore Keep-pos Regex-off &/Pattern not found& [Press space to continue, 'q' to quit.]There is no %s optionCommand not available(N-th) No %snext fileNo %sprevious fileNo such filemark: goto mark: Brackets: [Press 'h' for instructions.]Warning: some edit commands disabledWarning: some commands disabled"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETAESCAPELESSMETACHARS; *? '"()<>[]|&^`#\$%=~%c%s%c%s %s %sLESSCLOSELESSOPEN...skipping... Cannot seek to that file positionDetermining length of fileDon't know length of fileCannot seek to end of fileCannot seek to beginning of fileCannot seek to line number %nLESSANSIENDCHARSLESSANSIMIDCHARS0123456789;[?!"'#%()*+ Line numbers turned offCalculating line numbersInvalid mark letterMark not setUse "h" for help-" must be followed by 1 or 2 charsquotes %sTab stops and then every %d spacesless Copyright (C) 1984-2009 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less #Invalid column fractionInvalid column numberHorizontal shift %d columns.%06dHorizontal shift %s of screen widthjInvalid line fractionInvalid line numberPosition target at screen line %dPosition target at screen position %sValue is required after %sNumber is required after %s--%s-%c (--%s)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric option-%sThere is no %s option ("less --help" for help)LESS_IS_MOREBe less helpful in promptsBe helpful in promptsSearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numbersprompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linesDisplay underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file namefakeInvalid patternNo previous regular expressionPlease re-enter search patternNothing to searchmainiieiiii:iijHq jTtttot o@$t,too0t 8t@@tpp$p0pusage: %s [-23bcdilsTU] [-a maxreadahead] [-g maxgroups] [-I readdirsize] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-w writesize] [-x retrans] rhost:path node hostname too longno : or @ speccan't resolve address for host %sNFS PortmapCannot MNT RPCbad MNT RPCcan't access %s: %s-2 and -3 are mutually exclusiveillegal -a value %s: %sillegal -g value %s: %sillegal -I value %s: %sconflicting version optionsillegal -R value %s: %sillegal -r value %s: %sillegal -t value %s: %sillegal -w value %s: %sillegal -x value %s: %s23a:bcdD:g:I:iL:lo:PR:r:sTt:w:x:Ubgconndumbtimernfsv3mntudpresvportnfsv2acmainUSER_print_diskUSER_modifygetuintask_pidask_numask_cmdMBR_pcopyunused DOS FAT-12 XENIX / XENIX /usr DOS FAT-16 Extended DOSDOS > 32MB NTFS AIX fs AIX/Coherent OS/2 Bootmgr Win95 FAT-32 Win95 FAT32LDOS FAT-16 Extended LBAOPUS OS/2 hidden Compaq Diag.OS/2 hidden OS/2 hidden OS/2 hidden AST swap Willowtech ThinkPad Rec Willowsoft $NEC DOS 'Win Recovery8Theos 9Plan 9 @VENIX 286 ALin/Minux DRBLinuxSwap DRCLinux DR MQNX 4.2 Pri NQNX 4.2 Sec OQNX 4.2 Ter PDM QDM RCP/M or SysVSDM TOntrack UEZ-Drive VGolden Bow \Priam aSpeedStor cISC, HURD, *dNetWare 2.xxeNetWare 3.xxfNetWare 386 gNovell hNovell iNovell pDiskSecure uPCIX Minix (old) Minix (new) Linux swap Linux files*OS/2 hidden Linux ext. NT FAT VS NTFS VS Linux LVM Amoeba FS Amoeba BBT Mylex BSDI NotebookSaveFreeBSD OpenBSD NEXTSTEP MacOS X NetBSD MacOS X bootMacOS X HFS+BSDI filesy*BSDI swap Solaris CTOS DRDOSs FAT12DRDOSs < 32MDRDOSs >=32MHPFS DisbledCPM/C.DOS/C*Dell Maint SpeedStor SpeedStor SpeedStor BeOS/i386 EFI GPT EFI Sys SpeedStor DOS 3.3+ SecSpeedStor Xenix BBT XwriteXreinit[[s۸~EWflO)Ŗ,aO9vr:I=gv*5%C$$qL&9ɤξb+Fw 7W׷:fWWvkrU:;0tU|.{xws1E  'VYQȕ\'* \g"SNV.~qQ|~_Zh<(D?I 9Tl"h*BOE6FR,d dž>c "SMC݊_ǜE;G&/*!:+qiavbw>`$2_jOR%LqI(A^dtUɾLRYjkTY(@b\6~ou-9R2R 4۝։[5WCbi)hOF{-5Sq3b*>Lŕy_r,85@2l]<~M/I%C#2J6(#ϬEtv2նa7a) kx舃Y+ ?P_L,CƉ ϖfti ֖;_z->p0ȟ2ic5.f) حqRG"ЭZWdvC-?5~O@K|މkq})./;NWxq#n~7 JHB,i]_oϦe&QNg[{'ߞp0zѨ7>gp4OQn|\z~W(:-Y}^#׈}%}.[y+_Hw#q|xp9{x~+{%~AHH~cs28;þC%g#SZQnv}ۯѸ5 p5t:狱@_G'vvnFOg'g!L‮5sqEó?_Nh(:t_Ɨmoiloߩ(9RL4b6>% h4UCwhdFp S"k+ _ _- )>&֎Bq;c>OVхR {]#!EYy.@d~N^Vo/j|㺐n |cx,Q%[",S*bdaU E2&ף-0̨/ڝbFbp=AəB2,UB1E{dvyڗR8J4"<[EtӦgwNV 7R^n rE-ٟx ?nܼ:oo}McD<`}NfedI|x=P_*k|=Jf&oK3*P]HX6(I҄rT|K0V#tQ+Qy[HR"x&[r}ZD4̃8kϼH]FYg*Nޛ)#8av @]0sy{y{ݩFA+ys%~W/ƣwOQOd<VǥHl*{.+{&dNgHXKqy#nދć+@AS{ #܆ yN(ٷiK*=_)b \8uyj46Se7/wi&ˆs}JjQcq:F4ӼC.dz TK R.GL=(gec^ណ]jiN01%.#rC[ңv6xfKzt[je _WTVGoSյ(uU!) _`",K,568SHj- 8X;M+b kEk߶U0:^3O6&sѮ7JPH Q<\9^SZk(d"g ߹ȩ5WAɍLer^!QNS [QK7vEQZmh=kXt`A5\QUS-$?.&(ocUħ{E@rAgH f>l7\դu-LI 0>|?C|@_./ܘzm:ٳD6ʇ(NJ/El.*2'2۝T3ZspjI2_'HTbjr[ExKY>[NرR 4i &Cqy!mFFJZӄQ}Getns]UT <"Xq* G(6-pTWW{u5K̿k+ xd߁oy`xt~|:0vw8=RG&[(4v9dg/eaԋ~:sƥVLR':IAyL+C߁fkK OjS݈ l\1-] {1jh"3/+y >s̀ !A<حD*`93j,ﲳA{BVo7ԊI<)j@Tf͙ƲHŶ(Uja?|@$m>Yq_/>Ն'gW*wЈuw&fHa9V4]􍇧̃<4 h1o;ΞsQXџ!~*=]R x,ɩZi[,byudLtJ<\=9g w⮜[ SneX.tjў!99)8$u rF\2g翍? ,`w3;\ p6ᧃd2`*6qC[%ˑyOG+5U2@30usage: %s [-eiuy] [-l blocks] [-c cylinders -h heads -s sectors] [-f mbrfile] disk -i: initialize disk with virgin MBR -u: update MBR code, preserve partition table -e: edit MBRs on disk interactively -f: specify non-standard MBR template -chs: specify disk geometry -l: specify LBA block count -y: do not ask questions `disk' may be of the forms: sd0 or /dev/rsd0c. Cylinder argument %s [1..262144].Head argument %s [1..256].Sector argument %s [1..63].Block argument %s [1..%u].ieuf:c:h:s:l:yPlease specify a full geometry with [-chs].Can't get disk geometry, please use [-chs] to specify.using builtin MBRUnable to read MBRerror initializing MBROffset: %lld Enter 'help' for informationfdisk:%c%d> Invalid command '%s'. Try 'help'. Aborting changes to current MBR.Do you wish to write new MBR?Do you wish to write new MBR and partition table?Command help listShow entire OpenBSD man page for fdiskreinitRe-initialize loaded MBR (to defaults)setpidSet the identifier of a given table entryEdit current drive statseditEdit given table entryflagFlag given table entry as bootableUpdate machine code in loaded MBRSelect extended partition table entry MBRSwap two partition entriesPrint loaded MBR partition tablewriteWrite loaded MBR to diskexitExit edit of current MBR, without saving changesQuit edit of current MBR, saving current changesabortAbort program without saving current changes%s: [%u] %s is out of range: %c%s%c %s is invalid: %c%s%c %s [n] Partition id ('0' to disable) [%X - %X]: [%X] (? for help) '%s' is not a valid number. '%x' is out of range. %s [%d - %d]: [%d] %s is %s: %s. BytesSectorsKilobytesMegabytesGigabytesDisk: %s geometry: %d/%d/%d [%.0f %d-byte %s] geometry: %s is not a character device or a regular fileDIOCGPDINFOdisk too large (%llu sectors). size truncated.Signature: 0x%X Start of partition #%d after end! Starting Ending LBA Info: #: id C H S - C H S [ start: size ]-------------------------------------------------------------------------------%c%1d: %.2X %6u %3u %3u - %6u %3u %3u [%12u:%12.0f%s] %s Warning CHS values out of bounds only saving LBA valuesChoose from the following Partition id values:%02X %s %02X %s %02X %s %02X %s partition number is %s: %s. flag value is %s: %s. Partition %d marked active. Partition %d flag value set to 0x%x. %s %s Machine code updated.partition number is invalid:partition number is %s: %s %d same partition as %d, doing nothing. MBR contains more than one OpenBSD partition!Write MBR anyway?Writing MBR at offset %d. error writing MBROffset: %d Partition %d is not an extended partition. Loop to offset 0! Not selected.Selected extended partition %d New MBR at offset %d. Change disk geometry?BIOS CylindersBIOS HeadsBIOS SectorsPartition %d is disabled. Do you wish to edit in CHS mode?BIOS Starting cylinderBIOS Starting headBIOS Starting sectorBIOS Ending cylinderBIOS Ending headBIOS Ending sectorPartition offsetPartition sizeIn memory copy is initialized to:Use 'write' to update disk.(invalid file type(standard input)(fd %d)usage: %s [-abcEFGHhIiLlnoqRsUVvwx] [-A num] [-B num] [-C[num]] [-e pattern] [-f file] [--binary-files=value] [--context[=num]] [--line-buffered] [pattern] [file ...] ^\((%s[[:<:]]%s%.*s%s[[:>:]]%scontext out of rangegrep version %u.%u binarywithout-matchtextUnknown binary-files optionCan't use small fgrep with -wbinary-filesmmapline-bufferedafter-contextbefore-contextextended-regexpfixed-stringsbasic-regexpwith-filenamebyte-offsetregexpno-filenameignore-casefiles-without-matchfiles-with-matchesline-numberquietsilentrecursiveno-messagesrevert-matchword-regexpline-regexpunix-byte-offsets0123456789A:B:CEFGHILRUVabce:f:hilnoqrsuvwxyLine is too big to processBinary file %s matches usage: %s %s umount [-fv] special | nodeumount -a [-fv] [-h host] [-t type]%s: not currently mounted%s: not a directory or special device%s: unmount from %s afh:t:vmainiieiiii:iij jr@usage: mount_msdos [-9lsx] [-g gid] [-m mask] [-o options] [-u uid] special node invalid file mode: %sunknown user id: %sunknown group id: %ssl9xu:g:m:o:stat %snot an MSDOS filesystemcheckfsfsck_%snostart %s %swait %s%s/fsck_%sexec %sCan't get resource limit to max data sizeCan't get resource limit for data size-b %sInvalid option stringusage: %s [-dfnpvy] [-b block#] [-l maxparallel] [-T fstype:fsoptions] [-t fstype] [special | node ...] dvpfnyb:l:T:t:%s: unknown special file or file system.Can't open checklist file: %s/etc/fstabpass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s: Unknown pid %lddone %s: %s (%s) = %x %s: %s (%s): EXITED WITH SIGNAL %d THE FOLLOWING FILE SYSTEM%s HAD AN %s UNEXPECTED INCONSISTENCY:%s: %s (%s)%s, )c]!!\cX%`-V%`,i\1Sn6i!XfffffffffffffffffffffffffffffffmRQw }dNfev_gY&V0V$xYMuAAM pywy@so+lRJ'x/C/=M+ O$+malloc %zuuntrusted comment: invalid comment in %s; must start with '%s'comment too longmissing new line after b64 in %sinvalid b64 encoding in %sEdunsupported file %sdup failedcan't open %s for %sread from %susage: %1$s -V [-eq] [-x sigfile] -p pubkey -m message CGISVc:em:np:qs:x:must specify sigfile with - message%s.sigpath too longneed message and pubkeyfstat on %s%s must be a regular filemsg too large in %sverification failed: checked against wrong keysignature verification failedwrite to %susage: %s [-m mode] fifo_name ... usage: %s [-m mode] name b|c major minor %s [-m mode] name p node must be type 'b' or 'c'.non-numeric major number.non-numeric minor number.major or minor number too largemkfifoinvalid file mode.m:sodumpinet6_makenetandmaskgetaddrprint_rtmsgmonitorH@GT@H@`@P?P?P?h@h@h@ذTp@netname6routenamep_flagsp_rtentry0123456789abcdefUGHRBD M@dmCXLS1@2 3cPTdefaultconnectedstaticospfis-isbgpbad label: %s is %sinvalid table id: %slabel too longprefixlen is not supported with af %dprefixlen %s is %s%s: link %s; %s: inet %s; %s: inet6 %s; set_metric mtu: %s is %sset_metric expire: %s is %sking bula sez: set_metric with invalid key128internal error%s: resolved to multiple valuesmpls labels require -in or -out switch%s: not a network%s: bad address%d: bad address familybotched keyword: %susage: %s [-dnqtv] [-T tableid] command [[modifiers] args] commands: add, change, delete, exec, flush, get, monitor, show setrtable sockaddrs: locks: inits: route to: %s routing message version %d not understoodmessage length mismatch, in packet %d, returned %dRTM_GET: %s (errno %d)destination: %s mask: %s gateway: %s interface: %.*s if address: %s mpls label: %s %s priority: %u (%s) flags: label: %s use mtu expire%8llu %8u%c %8lld%c sockaddrs: [rtm_type %d out of range]: len %d, if# %d, name: %s, link: %s, flags:, metric %d, flags:, if# %d, name %s, what: arrivaldeparture, priority %d, table %u, pid: %ld, seq %d, errno %d flags: use: %8llu mtu: %8u%c expire: %8lld%cso_dstso_gateso_maskso_ifpso_ifaso_labelso_srcwriting to routing socketread from routing socketmust be root to alter routing table-mplslabel requires -inet or -inet6-in requires -mpls-out requires -mpls-out requires -push, -pop, -swap-pop requires -mpls-push requires -mpls-swap requires -mplspriority is %s: %snetmask missingnet: gateway %sentry in userouting table overflownot in tableroute-sysctl-estimateactual retrieval of interface tablesetsockopt(ROUTE_MSGFILTER)setsockopt(ROUTE_TABLEFILTER)got message of size %d on %sno such interface %sactual retrieval of routing tableExamining routing table from sysctl(address family %s) write to routing socketgot only %d for rlen %-20.20s donednqtT:vrouting table %d/dev/nulladdblackholechangecloningdstencapexpiregatewaygethopcountifaifpjumbolinkllinfolockrestmpathmplslabelnojumbonostaticpopproto1proto2pushrecvpiperejectrttrttvarsasendpipeshowssthreshxresolveRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics or flagsRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_RESOLVE: Route created by cloningRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_IFINFO: iface status changeRTM_IFANNOUNCE: iface arrival/departureRTM_DESYNC: route socket overflowPUSHLOCALPOPSWAPlink#%dillegal prefixlen%s/%d%u/%d%u.%u/%d%u.%u.%u/%d%u.%u.%u.%u/%daf %d: %s(%d) %s%-6s %-*.*s %-6u/esp/ah/ipcomp/ipip//use/require/acquire/deny/bypass/dontacq//in/out%-*s %-5u %-*.*s %-5u InternetInternet6Encap Protocol Family %d: MPLS%-18s %-5s %-18s %-5s %-5s %-22s SourcePortProtoSA(Address/Proto/Type/Direction)%-9s %-9s %-6s %-18s %-6.6s %5.5s %8.8s %5.5s %4.4s %s In labelOut labelOpGatewayFlagsRefsUseMtuPrioInterface%-*.*s %-*.*s %-6.6s %5.5s %8.8s %5.5s %4.4s %sIfaceLabel%-6.6s %5u %8llu %5u %5s %2d %-5.16ssysctl of routing tableRouting tablesspd-sysctl-estimatesysctl of spd Encap:Extra `@' characters in usernames and passwords should be encoded as %%40 KMGTPftp://http://file::/Can't allocate memory for URL decoding <>"#{}|\^~[]`receivedCan't allocate memory to parse URLurl_get: Invalid URL '%s'No `/' after host (use -o): %sNo filename after host (use -o): %sNo filename after directory (use -o): %sCan't allocate memory for proxy URL.Malformed proxy URL: %serror in base64 encodingCan't open file %sCan't open %sCan't allocate memory for transfer bufferWriting %sReading from file(unknown)Trying %s... r+Requesting %sCan't allocate memory for URL encoding%%%02x (via %s) GET %s HTTP/1.0 Proxy-Authorization: Basic %s%s %s User-Agent: OpenBSD ftpGET %s HTTP/1.0 %s%s GET /%s %s Host: HTTP/1.0Can't allocate memory.[%s]:%s %s%s Writing HTTP requestReceiving HTTP replyError retrieving file: %sToo many redirections requestedContent-Length: Location: Relative redirect not supportedCannot allocate memory for URLRedirected to %s Reading from socketRead short file. Auto-login using ftp URLs isn't supported when using $ftp_proxyImproper response from %sftp_proxyhttp_proxyCan't allocate memory for auto-fetch.Invalid URL: %sCan't connect or login to host `%s'*?[]{}NLSTRetrieving %s/%s mget file fetch aborted. http fetch aborted. Forced abort. The connection will be closed. local: %srunique: can't find unique file name. receive aborted waiting for remote to finish abort. acceptsetsockopt TOS (ignored)%c%c%c421 Service not available, remote server has closed connection. Lost control connection for abort.%cABOR No control connection for command.QUITRETRSTOUSTORPASVproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s use of scoped address can be troublesomeEPSVwrong server: return code must be 229 LPSVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u%c%c%c%d%cparse error! setsockopt (reuse address)setsockopt IP_PORTRANGE (ignored)setsockopt IPV6_PORTRANGE (ignored)listenEPRT |%d|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dlocal: %s remote: %s REST %lldnetin: %slocal: %s: %s%s: short writeWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sftpgatehttp%s: bad port number `%s'connect to address %sfdopen failed.Connected to %s. usage: %s [-o output] ftp://[user:password@]host[:port]/file[/] ... %s [-o output] http://host[:port]/file ... %s [-o output] file:file ... %s [-o output] host:/file[/] ... FTPSERVERPORTFTPMODEpassivegateunknown FTPMODE: %s. Using defaultsgate-ftpFTPSERVERNeither $FTPSERVER nor $GATE_SERVER is defined; disabling gate-ftpdumbemacssukeep alive amount is %s: %sretry amount is %s: %s46AaCc:dD:Eegik:mno:pP:r:S:s:tvVnmap: unbalanced brackets. CWD %sCWD command not recognized, trying XCWD. XCWD %scan't get cwdSkipping non-relative filename `%s' a+winternal error: unknown type %d.TYPE %s %sTYPE %susage: %s [ | Using %s mode to transfer files. %s: unknown mode. asciiebcdictenex%lld byte%s %s in %.2f seconds (%.2f %sB/s) ETA: %02d:%02d:%02d %-*.*s%s %-*.*s%s %3d%% %3d%% |%.*s%*s|************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************* %5lld %c%c %2d:%02d:%02d --:-- ETA - stalled -%02d:%02d ETAUnable to determine real path of `%s'%s: not foundunable to create temporary file: %sftpXXXXXXXXXXLISTcan't find list of remote files, oops. can't find list of remote files, oops.anonymous%s@Name (%s:%s): Name (%s): USER %sPassword:PASS %sAccount:ACCT %sLogin %s failed.Already connected to %s, use close first. gateserver not defined (shouldn't happen)PASSERVE %sConnected via pass-through server %s non-printstreamSYSTRemote system type is %s. 215 UNIX Type: L8215 TOPS20Remember to set tenex mode when transferring binary files from this machine. SIZE %sMDTM %s191Y2K warning! Fixed incorrect time-val received from server. %*s %04d%02d%02d%02d%02d%02dCan't convert %s to a time. t $ , 4 <tDLiXusage: %s [-a arch] [-e entry] [-l loadaddr] [-n name] [-o os] [-t type] infile outfile arch is one of:os is one of:%s: invalid elf, not 32 or 64 bita:e:l:n:o:t:unknown arch '%s' unknown OS '%s' unknown type '%s' alphaamd64i386m68kmipsmips64powerpcsparcsparc64superhLinuxstandalonescript%s unable to seek to section header%s: read section headersunexpected segment type %#xesymval and vaddr mismatch %lx %lx mainusage: %s [-dn%sq] dlnpqhalted (with powerdown) by %shalted by %srebooted by %s~SIGTSTP init/etc/rc/dev/consolerevokesetsidopenSIGTERM processesWARNING: some process(es) wouldn't die(can't restart init): mainiieiiii:iijr@T j(Hqrusage: mount_ffs [-o options] special node filesystem must be mounted read-only; you may need to run fsckreload59d"l|L ' GX &;o#U$L , 4 @!LPT0``nFlplllllllln]n n,08nDnTd]]0(@Pd0n l,l8<Tlllnll004PTnd]|n<<<nl n n0lHlTl`lllxlllln<<<< <$<0<<lH<X<d<p<|<<<<<<<<<<<< <<$<0<<<H<T<`<l<x<<<<<<<<<< <<$<0<<<H<T<`<l<x<<<<<<<<<<<<<n(<4<@<L<X<dl<<<<<<<<<<<<<<(<4<@<L<X<d<p<|<<<<<<<<<<<< <<$<0<<<H<T<`<l<x<<<<<<<<<<<<<< <,<8<D<P<\<h<t<<<<<<<<<<<<<<<(<4<@<L<X<d<p<|<<<<<<<<<<<< <4<@<Ln`<l<x8/etc/resolv.confCouldn't open '%s': %sCouldn't write contents to '%s': %sShort contents write to '%s' (%zd vs %zd)fchmod(fd, 0x%x) of '%s' failed (%s)fchown(fd, %d, %d) of '%s' failed (%s)warning: hostname %s contains an underscore which violates RFC 952write_file: path too long (%zu)write_file: imsg_composev: %swrite_fileInvalid option name: '%s'fcntl F_GETF: %sfcntl F_SETFL: %sUnable to clone leaseUnable to apply defaultssearch %s no memory for domainnamenameserver %s no memory for nameserver# Generated by %s dhclient no memory for courtesy lineno memory for resolv.conf contentsegresssocket errorno interface in group egress foundioctl SIOCGIFGMEMB: %sget_ifnametoo many interfaces in group egressInterface name too long: %sInterface name too longoption_as_string: bad code %udhcp option too largedaemoncannot forkchdir("/")%s [priv]no memory for priv_ibufpoll error: %simsg_read(priv_ibuf): %sCould not unlink '%s': %s%s; restarting.RESTART FAILED: '%s': %s%s; exiting bootp; %s { %s interface "%s"; fixed-address %s; next-server %s; filename server-name option %s %s; renew %w %Y/%m/%d %T UTC; rebind %w %Y/%m/%d %T UTC; expire %w %Y/%m/%d %T UTC; } offeredcannot fit offered lease into option dbcannot make offered lease into stringeffectivecannot fit effective lease into option dbcannot make effective lease into stringlease file not opencannot make lease into stringoptions do not fit in DHCPDECLINE packet.options do not fit in DHCPREQUEST packet.options do not fit in DHCPDISCOVER packet.DHCPDECLINE on %s to %s port %huNo acceptable DHCPOFFERS received.Trying recorded lease %sbound: renewal in %lld seconds.bound: immediate renewal.No working leases in persistent database - sleeping.DHCPDISCOVER on %s to %s port %hu interval %lldDHCPREQUEST on %s to %s port %hudhcpoffer: no memory to record lease.option-dhcpoffer: unknown option %dBogus data for option %sdhcpoffer: no memory for server name.Bogus server name %sdhcpoffer: no memory for filename.bound to %s -- renewal in %lld seconds.Unsatisfactory %susage: %s [-dqu] [-c file] [-i options] [-L file] [-l file] interface No memory for rtmmsg%s sa == NULL%s, not %s, added to %s%s added to %sActive address (%s) deleted; exiting%s, not %s, deleted from %s%s deleted from %s%s downLLADDR changed; restarting%s departuredno memory for errmsg'%s' is not a regular filec:di:l:L:quifi callocclient callocconfig calloc%s.%s/var/db/dhclient.leasesasprintfsetting routing table to %u: '%s'/etc/resolv.conf.tailCannot open /etc/resolv.conf.tail: %sCannot stat /etc/resolv.conf.tail: %sno memory for resolv.conf.tail contents: %sCouldn't read resolv.conf.tail: %sGot no data from resolv.conf.tailShort read of resolv.conf.tail%s: no link ... sleeping got link cannot open %s: %s_dhcpno such user: _dhcpsocketpair: %sno memory for unpriv_ibufcan't open and lock %s: %scan't open %s: %ssocket(PF_ROUTE, SOCK_RAW): %ssetsockopt(ROUTE_MSGFILTER): %ssetsockopt(ROUTE_TABLEFILTER): %s/var/empty/chrootsetresgidsetgroups/etc/dhclient.confno memory for reject address!expecting option name.too many options.expecting hex octet.string constant too long.expecting string or hexadecimal dataexpecting ':'.expecting identifier after option keyword.unknown option name.expecting string.option data buffer overflowexpecting signed 32-bit integer.expecting unsigned 32-bit integer.expecting unsigned 16-bit integer.expecting unsigned 8-bit integer.expecting identifier.truefalseexpecting boolean.Bad format %c in parse_option_param.out of memory allocating option data.expecting interface name (in quotes).wrong interface name.expecting lease declaration.expecting left brace.no memory for lease.unterminated lease declaration.Obsolete client identifier (%s) in recorded leaseexpecting a statement.unterminated interface declaration.Corrupt lease file - possible data loss!getifaddrs failedinterface %s already has the offered subnet!Can't create socketinterface_link_forceup: SIOCGIFFLAGS failed (%s)interface_link_forceup: SIOCSIFFLAGS DOWN failed (%s)interface_link_forceup: SIOCSIFFLAGS UP failed (%s)receive_packet failed on %s: %sInterface %s no longer appears valid.no space to remember ifpNo interfaces availableInterface %s: rdomain changed out from under usNo live interface to poll onpoll: %sdispatch%s; restartingsend_packet: %ssocket(SOCK_RAW): %ssetsockopt(IP_HDRINCL): %ssetsockopt(SO_RTABLE): %s/dev/bpf%dCan't find free bpf: %sCan't attach interface %s to bpf device %s: %sCan't get BPF version: %sKernel BPF version out of range - recompile dhcpd!Can't set immediate mode on bpf device: %sCan't set filter-drop mode on bpf device: %sCan't get bpf buffer length: %sCan't allocate %lu bytes for bpf input buffer.Can't install packet filter program: %sCan't install write filter program: %sCannot lock bpfcSc"'$`\\%cpretty_print_option: bad code %d%s: Excess information in format string: %s%s: no size indicator before A in format string: %s%s: garbage in format string: %s%s: expecting at least %d bytes; got %d%s: expecting only %d bytes: got %d%s: expecting %d bytes: got %d%s/%uUnexpected format code %coption %s (%d) larger than buffer.option %s has no length field.Can't allocate storage for option %s.Can't expand storage for option %s.DHCPACKDHCPOFFERDHCPNACKBOOTREPLY%s from %s (%s)no memory for info stringeof in string constantstring constant too longnumeric token larger than internal bufferappendbackoff-cutoffbootpdenyethernetfixed-addresshardwareignoreinitial-intervallink-timeoutmediumnext-serverprependrebindrenewrequireretryselect-timeoutsendserver-namesupersedetimeout%s line %d: %s%*c^ %s: msgbuf_write: %sRTM_DELETE write: %sshort RTM_DELETE write (%zd) DHCLIENT DHCLIENT %dcreating route label: %screating route label: label too long (%d vs %zd)default route socket: %sRTM_GET of default route: %sget default route read: %sno data from default route readdefault route read rtm: %ssendhup: imsg_compose: %ssendhupadd_address: imsg_compose: %sadd_addressdelete_address: imsg_compose: %sdelete_addressadd_route: imsg_compose: %sadd_routeflush_routes: imsg_compose: %sflush_routessocket open failed: %sSIOCAIFADDR failed (%s): %sSIOCDIFADDR failed (%s): %sdelete_addresses getifaddrs: %sRouting Socket open failed: %sfailed to add default route: %sroutes buf malloc:sysctl retrieval of routes:route cleanup failed - %s %s (msize=%zu)opening socket to flush routes: %ssysctl size of routes:%d bad IP checksums seen in %d packets%d udp packets in %d too long - dropped%d bad udp checksums in %d packetspadsubnet-masktime-offsetIAtime-serversien116-name-serversdomain-name-serverslog-serverscookie-serverslpr-serversimpress-serversresource-location-servershost-nameboot-sizemerit-dumpdomain-nameswap-serverroot-pathextensions-pathip-forwardingnon-local-source-routingpolicy-filterIIAmax-dgram-reassemblydefault-ip-ttlpath-mtu-aging-timeoutpath-mtu-plateau-tableSAinterface-mtuall-subnets-localbroadcast-addressperform-mask-discoverymask-supplierrouter-discoveryrouter-solicitation-addressstatic-routestrailer-encapsulationarp-cache-timeoutieee802-3-encapsulationdefault-tcp-ttltcp-keepalive-intervaltcp-keepalive-garbagenis-domainnis-serversntp-serversvendor-encapsulated-optionsnetbios-name-serversnetbios-dd-servernetbios-node-typenetbios-scopefont-serversx-display-managerdhcp-requested-addressdhcp-lease-timedhcp-option-overloaddhcp-message-typedhcp-server-identifierdhcp-parameter-request-listBAdhcp-messagedhcp-max-message-sizedhcp-renewal-timedhcp-rebinding-timedhcp-class-identifierdhcp-client-identifieroption-62option-63nisplus-domainnisplus-serverstftp-server-namebootfile-namemobile-ip-home-agentsmtp-serverpop-servernntp-serverwww-serverfinger-serverirc-serverstreettalk-serverstreettalk-directory-assistance-serveruser-classoption-78option-79option-80option-81relay-agent-informationoption-83option-84nds-serversnds-tree-namends-contextoption-88option-89option-90option-91option-92option-93option-94option-95option-96option-97option-98option-99option-100option-101option-102option-103option-104option-105option-106option-107option-108option-109option-110option-111option-112option-113option-114option-115option-116option-117option-118option-119option-120classless-static-routesCIAoption-122option-123option-124option-125option-126option-127option-128option-129option-130option-131option-132option-133option-134option-135option-136option-137option-138option-139option-140option-141option-142option-143tftp-config-fileoption-145option-146option-147option-148option-149voip-configuration-serveroption-151option-152option-153option-154option-155option-156option-157option-158option-159option-160option-161option-162option-163option-164option-165option-166option-167option-168option-169option-170option-171option-172option-173option-174option-175option-176option-177option-178option-179option-180option-181option-182option-183option-184option-185option-186option-187option-188option-189option-190option-191option-192option-193option-194option-195option-196option-197option-198option-199option-200option-201option-202option-203option-204option-205option-206option-207option-208option-209option-210option-211option-212option-213option-214option-215option-216option-217option-218option-219option-220option-221option-222option-223option-224option-225option-226option-227option-228option-229option-230option-231option-232option-233option-234option-235option-236option-237option-238option-239option-240option-241option-242option-243option-244option-245option-246option-247option-248classless-ms-static-routesoption-250option-251autoproxy-scriptoption-253option-254option-endexpecting semicolon.time string too longinvalid time string%w %Y/%m/%d %T UTC%w %Y/%m/%d %T%u %Y/%m/%d %Tunparseable time stringtime could not be representedexpecting unsigned 32-bit decimal value.expecting CIDR subnet.expecting '/'.Expecting CIDR prefix length.expecting 'ethernet'.expecting '.'.expecting decimal octet.filename must be a stringno memory for string %s.dispatch_imsg: imsg_get failure: %sbad IMSG_DELETE_ADDRESSbad IMSG_ADD_ADDRESSbad IMSG_FLUSH_ROUTESbad IMSG_ADD_ROUTEbad IMSG_HUPshort IMSG_WRITE_FILEbad IMSG_WRITE_FILE (%zu)received unknown message, code %ucannot close temp fileinvalid address/tmp/ed.XXXXXXXXXXw+cannot open temp fileline too longcannot seek temp filecannot write temp filecannot read temp fileunexpected end-of-file& no previous commandinvalid pattern delimiter\  \abfnrtv\cannot read stdincannot write filecannot open output filecannot close output filecannot read input filenewline inserted newline appended cannot open input filecannot close input fileshell access restrictedinvalid mark charactered.hup/ed.hupno current filenameinvalid filenamefilename too longno matchnumber out of rangeinvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioncrypt unavailableHOMEcrypt unavailable ? p:sx ? interrupt? warning: file modifiedscript, line %d: %s usage: %s [-] [-sx] [-p string] [file] unbalanced brackets ([])trailing backslash (\)no previous patterninfinite substitution loopnothing to undocopy_link%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).HLPRfiprthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too longusage: %s [-fip] [-R [-H | -L | -P]] source target %s [-fip] [-R [-H | -L | -P]] source ... directory lchown: %sutimes: %schown: %schmod: %schflags: %sunlink: %smknod: %smkfifo: %sreadlink: %ssymlink: %soverwrite %s? <LԖ8hؕTX\      A@!  @a`10  @`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O @@ !1Aa  0@` #+3;CScshxVusage: %s [-123456789cdf%sh%slNnOqrt%sv] [-b bits] [-o filename] [-S suffix] %*s [file ...] usage: %s [-cfh%slNnqrt%sv] [-o filename] [file ...] usage: %s [-f%shqr] [file ...] OK %4.1f%% -- replaced with %s %lld bytes in, %lld bytes out method crc date time compressed uncompressed ratio uncompressed_name%-7.7s %08x %s %10lld %10lld %4.1f%% %s %10lld %10lld %4.1f%% (totals) .-_tgztazfchown: %sfchmod: %sfchflags: %sfutimes: %scompression not supported%s: won't read compressed data from terminal%s: unrecognized file formatcrc errorzcatzipunknown program nameGZIPoption -a is ignored on this systemillegal bit count -- %s-o argument is too long-o option may only be used with a single input filemay not mix -o, -c, or -t options%s is a directory: ignored: unchanged%s not a regular file%s%s already has %s suffix -- unchanged%s: unknown suffix: ignored%s%s: name too long%s: input: %sdeflate.gz123456789ab:cdfhLlNnOo:qrS:tVvcfhLlNno:qrtVvfhqrZgzz1.2.3need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionusage: %s [-R [-H | -L | -P]] %s file ... owner[:group]usage: %s [-h] [-R [-H | -L | -P]] %s file ... %s [-h] [-R [-H | -L | -P]] :group file ... group is %s: %suser is %s: %sHLPRXfghorstuwxthe -R and -h options may not be specified together.invalid flags: %sinvalid flag: %smakeentrylinkupfileerrordirscaniblockckinodecheckfilesyspass2pass2checkpass5setup<DP\dl|ذ2n$4 @ catchinfocatchquit?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@%lld %s I=%llubad size: blk %lld, offset %lld, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock.fs_fpg %d cannot allocate memory for inode cache cannot increase directory listbad inode number %llu to nextinode %llu cannot alloc %lu bytes to extend inoinfo CG %d: BAD MAGIC NUMBER %lld files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %lld files missing %lld blocks missing %lld,conversion levelcannot do level %d conversion usage: %s [-fnpy] [-b block#] [-c level] [-m mode] filesystem ... dfpnNyYb:c:m:EXCESSIVE DUP BLKS I=%llucannot alloc %u bytes for inoinfobad direct addr: %ld bad indirect addr: %ld INCORRECT BLOCK COUNT I=%llu (%ld should be %d)too many inodes %llu cannot realloc %zu bytes to %zu for inoinfo phase 1, inode %llu/%lluphase 1b, inode %llu/%llu%s %s: LENGTH %ld NOT MULTIPLE of %d%s %s: LENGTH %ld NOT MULTIPLE OF %dphase 2, directory %d/%dphase 2, parent directory %d/%d (REMOVED)phase 3, directory %d/%ldphase 4, inode %llu/%lluDELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS UNKNOWN ROTATIONAL TABLE FORMAT %d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %ld MARKED FREE ALLOCATED FRAG %ld MARKED FREE BLK(S) MISSING IN BIT MAPSphase 5, cg %d/%d%s: NOT LABELED AS A BSD FILE SYSTEM (%s) NCG OUT OF RANGECPG OUT OF RANGENCYL LESS THAN NCG*CPGSBSIZE PREPOSTEROUSLY LARGEILLEGAL BLOCK SIZE IN SUPERBLOCKILLEGAL FRAGMENT SIZE IN SUPERBLOCKoffset %d, original %ld, alternate %ld VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN LAST ALTERNATEINFORMATION; SEE fsck_ffs(8).clean = %d UNDEFINED OPTIMIZATION IN SUPERBLOCKIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE NPSECT=%d IN SUPERBLOCK (FIXED)INCORRECT BMASK=%x IN SUPERBLOCKINCORRECT FMASK=%x IN SUPERBLOCKINCORRECT BSHIFT=%d IN SUPERBLOCKINCORRECT FSHIFT=%d IN SUPERBLOCKFormat of filesystem is too old. Must update to modern format using a version of fsck from before release 5.0 with the command ``fsck -c 2'' INCORRECT MAXFILESIZE=%llu IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%lx IN SUPERBLOCKINCORRECT QFMASK=%lx IN SUPERBLOCKINCONSISTENT CGSIZE=%d INCONSISTENT INOPB=%d INCONSISTENT NINDIR=%d cannot alloc %u bytes for cylinder group summary area cannot alloc %u bytes for inostathead cannot alloc %zu bytes for inpsort cannot alloc %zu bytes for inphead inoinfo: inumber %llu out of rangeCANNOT %s: BLK %lldWRITING %sZERO'ED BLOCK %lld TO DISK UPDATE STANDARD SUPERBLOCK %lld (%lld),   delete %d: %sinsert %d: %ssession database close: %ssession database open: %scannot get kernel security level: %scannot change kernel security level from %d to %d: %sfatal signal: %scan't parse getty for port %scan't allocate windowcan't parse window for port %sport %s changed utmp index from %d to %dcan't fork for window system on port %s: %msetsid failed (window) %mcan't exec window system '%s' for port %s: %mcan't fork for getty on port %s: %mgetty repeating too quickly on port %s, sleepingcan't exec getty '%s' for port %s: %msome processes would not die; ps axl advisedcan't open %s: %mcan't get %s for controlling terminal: %mcannot disable lid suspendcan't exec %s for %s %s: %mautobootcan't exec %s for %s: %mcan't fork for %s on %s: %mwait for %s on %s failed: %m; going to single user modeinit: %s on %s stopped, restarting %s on %s terminated abnormally, going to single user mode/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bincan't exec %s for single user: %mcan't fork single-user shell, trying againwait for single-user shell failed: %m; restartinginit: shell stopped, restarting single user shell terminated.single user shell terminated, restartinginit: %s init: already running initial setsid() failed: %mrootsetlogin() failed: %munrecognized flag '-%c'sfignoring excess argumentsusage: %s [-b block-size] [-c fragments-per-cylinder-group] [-e maxbpg] [-f frag-size] [-i bytes] [-m free-space] [-o options] [-P file] [-s size] special node usage: %s [-Nq] [-b block-size] [-c fragments-per-cylinder-group] [-e maxbpg] [-f frag-size] [-g avgfilesize] [-h avgfpdir] [-i bytes] [-m free-space] [-O filesystem-format] [-o optimization] [-S sector-size] [-s size] [-T disktype] [-t fstype] special ioctl (WDINFO)%s: can't rewrite disk labelinsane maxpartitions value %dP:T:b:c:e:f:i:m:o:s:NO:S:T:b:c:e:f:g:h:i:m:o:qs:t:%s: invalid ffs versionsector size invalid: %sblock size is %s: %sfragments per cylinder group is %s: %sblocks per file in a cylinder group is %s: %sfragment size is %s: %saverage file size is %s: %saverage files per dir is %s: %sbytes per inode is %s: %sfree space %% is %s: %s%s: unknown optimization preference: use `space' or `time'.file system size invalid: %snewfs_%s%s/newfs_%s%s not found%s: getmntinfo: %s%s: no default sector size%s: maximum file system size on the `%c' partition is %llu sectorswarning: changing optimization to space because minfree is less than %d%% setblock bad fs_frag %dclrblock bad fs_frag %disblock bad fs_frag %dwtfs: write error on block %lldrdfs: read error on block %lldcg 0: bad magic numberfirst cylinder group ran out of spaceinternal error: can't find block in cyl 0ilog2: %d is not a power of 2 fsinit: inode value %llu out of rangeinode table does not fit in cylinder grouppanic: cylinder group too big: %d > %dpreposterous size %lld, max is %dpreposterous size %lld, max is %lldblock size must be a power of 2, not %dfragment size must be a power of 2, not %dfragment size %d is too small, minimum is %lldblock size %d is too small, minimum is %dblock size %d is too large, maximum is %dblock size (%d) cannot be smaller than fragment size (%d)fragment size %d is too small, minimum with block size %d is %ddensity reduced from %d to %d bytes per inodecan't honour -c: minimum is %dfile system size %jd < minimum size of %d fragmentsreduced number of fragments per cylinder group from %d to %d to enlarge last cylinder groupcalloc failed%s: %.1fMB in %jd sectors of %lld bytes %d cylinder groups of %.2fMB, %d blocks, %d inodes each can't get physmemwarning: fsck_ffs will need %lluMB; min(MAXDSIZ,physmem) is %lluMBsuper-block backups (for fsck -b #) at:cannot allocate I/O bufferfsinit1 failedfsinit2 failed%s: initializing cg %ld/%d checkrm_overwriteusage: %s [-dfiPRr] file ... "." and ".." may not be removedremove %s? override %s%s%s/%s for %s? %s (inode %llu): not overwritten due to multiple links%s: malloc%s: is a directorydfiPRrusage: %s [-t] device usage: %s [-f device] command [count] %d: unknown tape drive type %s tape drive, residual=%d erblocksize: %d (%d) density: %d (%d) ioctl MTIOCGETf:no remote support%s: unknown command%s: illegal countbsfbsrdensityeomfsffsrofflinerewindrewofflretensionweofWriteProtectMounted76543210usage: %s [-p] [-m mode] directory ... m:p\ can not be used as a string delimiternewline can not be used as a string delimiterwhitespace after %sundefined label '%s'RE error: %sunterminated regular expressionexpected context addressunexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandfilename expectedw commandread commandbranchempty labelduplicate label '%s'substitute pattern can not be delimited by newline or backslashunterminated substitute pattern123456789\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expressionmore than one number or 'g' in substitute flagsnumber in substitute flags out of rangeno wfile specifiedbad flag in substitute command: '%c'transform pattern can not be delimited by newline or backslashunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthextra text at the end of a transform commandunused label '%s' ..."usage: sed [-aEnru] command [file ...] sed [-aEnru] [-e command] [-f command_file] [file ...] Eae:f:nrustdout: %ssed: %lu: %s: first RE may not be empty\ %03o\%d not defined in the RE\abfrtvXb XX} X|u u Xh X XV X_ XY X` 8u X{ Xh Yh YXa Y4q Y^ $Y^ U (Y0Yc_umask[ [ [L [ [ ([ 4[x <[L D[ L[ T[ `[ h[ p[ x[L [ [$ [L [ [ [ [̌ U [ 4en-a-b-c-d -e-f-G-g-h -H -k-L -n-O-o-p -r-s-S -t-u-w-x-z===!=<>-eq-ne-gt-ge-lt -le!-ef"-nt#-ot$0o|\04,e]t,]f<]cP]d`]sp]l]m]npx_modex_search_histkb_addx_bindx_emacs  ^ ^< ^| ^ _ _@ 8_ L_ `_ l_ t_@ 0\ l{ _h  _T _ ^X _ _ _ _ _| _ _, `8 `P 0`t <`P L` \`p d` t` ` `8 `X ` ` ` ` a| a( a d7 ,aH ^ Da Ta `a pa ap a adbteste_isaxd++--==!== *= /= %= += -= <<= >>= &= ^= |= <<>><=>=<>&& || */%+-&^|? , ~!():hist_initj_printܥkkkdoppromptyylexIFS= ${PS2=> } ${PS3=#? } ${PS4=+ }lmxdLwhmdcgmatchgetoptionsoaoocoopepppi(pk0pl8pX?mDpCrnPpfXp`phbhpupp|pppcrE0 sph4\vnpppppxdo_phys_pathshf_vfprintffsssss s Ts (< s ss$t^rs{]}0ssssss\` RRRRR]]<>!let||&&()str_valA ]wLw w4Le 0w $  \l?[\]`{|};|&()`+@!fileglob: substitute errorFPATH nothing to yank yank something first I-search: duplicate binding for %sPOSIX%s = %s %s = '%s' cannot bind, not a ttyauto-insert%s: no such functioninvalid return codebeginning-of-historycomplete-commandcomplete-filecompletedelete-char-backwarddelete-word-backwarddelete-char-forwarddelete-word-forwardkill-lineredrawend-of-historyeot-or-deletegoto-historymacro-stringkill-to-eolkill-regionlist-commandlist-filequoteyank-popbackward-charbeginning-of-linebackward-wordend-of-lineforward-charforward-wordnewlinedown-historynewline-and-nextno-opup-historyprev-hist-wordsearch-character-forwardsearch-character-backwardsearch-historyset-mark-commandstuffstuff-resettranspose-charsexchange-point-and-markcomplete-listexpand-filecapitalize-worddowncase-wordupcase-wordset-argcomment*+?@! substituteexpand(NULL)%Rfunny $() command: %s%s: cannot open $(<) input%s: parameter not set%S%s: bad substitutionparameter null or not set%*d) %sdbteste_error: %s (offset %d)shcomexec: %shere document missingcan't %s temporary file %s: %sherein: yylexerror writing %s: %sPS4%s%s %s: restricteddupcannot %s %s: %scould not finish (dup) redirection %s: %scoprocess already existsPS3EXECSHELL%s: %s: %sbuiltin: %s: not a builtincommand -p: restricted%s: can't find function definition file - %s%s: can't find function definition file%s: can't open function definition file %s - %s%s: function not defined by %sCFUNC %d%s: cannot execute - %s-rend of expression%s: unexpected `%s'%s: bad number `%s'%s: expression recurses on parameter `%s'%s: %s requires lvalue%s: %s applied to read only variablemissing )zero divisormissing :HISTFILE%s.%dno history (yet)%s: not in history%s: invalid rangehistory functions not available-%c%se:glnrs0,1,2,3,4,5,6,7,8,9,can't use -e, -l, -n, -r with -s (-e -)substitution failedcan't use -l, -n with -e-16%.*s cannot create temp file %s - %serror writing temporary file - %s${FCEDIT:-/bin/ed} $_cannot open temp file %serror reading temp file %s - %sno coprocess%s/shXXXXXXXXbad file descriptorfd not open for readingfd not open for writingillegal file descriptor name%s[%d]: internal error: shl_stdout not validtoo many files open in shellcan't create pipe - try again RunningDoneDone (%d)[%d] %c %5d (core dumped)%s%s %-20s %s%s%s%s%5d %-20s %s%s %s%sremove_job: job not found (%s)notifyj_async: job not startedj_async: bad nzombie (%d)zombiejobsstopped and runningYou have %s%s%s jobs j_waitj: tcsetpgrp(%d, %d) failed: %sjob not job-controlled[%d] | 1st tcsetpgrp(%d, %d) failed: %sfg: 2nd tcsetpgrp(%d, %d) failed: %scannot continue job %s: %sjw:resumejw:waitforwaitlast: no last jobwaitlast: not startedjw:waitlastexchild: XPIPEI and no last_job - pid %dfork failedcannot fork - try againchildexchild: execute() returned[%d]jw:last procj_init: getpgrp() failed: %sj_init: tcgetpgrp() failed: %sj_init: setpgid() failed: %sj_init: tcsetpgrp() failed: %swarning: won't have full job controlj_suspend: tcsetpgrp() failed: %sj_suspend: setpgid() failed: %scheck_job: job started (flags 0x%x)checkjobno such jobambiguousargument must be %job or process id%a %b %d%l:%M:%S%r~/%sPS1\$PS2missing ] no closing quote here document `%s' unclosed MAILyou have mail in $_shell: %dUse `exit' to leave ksh include: %drshrkshrpdkshpdrkshSH_VERSIONPPIDUSER$ -c requires an argumentCannot determine current working directory/etc/profile$HOME/.profile/etc/suid_profileENVtypesetKSH_VERSION-xOPTIND=1evaltypeset -i RANDOM MAILCHECK="${MAILCHECK-600}" SECONDS="${SECONDS-0}" TMOUT="${TMOUT-0}"hash=alias -ttype=whence -vstop=kill -STOPautoload=typeset -fufunctions=typeset -fhistory=fc -linteger=typeset -inohup=nohup local=typesetr=fc -e -login=exec login-tUccmailmakeprviwho |&;<>()*@#!$-? =-+?#% "#$&'()*;<>?[\`|0123456789ABCDEF%-*s%*s'\'%s%s-%c: unknown option%s%s-`%c' requires argument%-*s %sA:o;sCurrent option settings -o %s%s: bad optionparse_args: `%c'allexportbraceexpandbgnicecsh-historyemacs-usemetaerrexitgmacsignoreeofinteractivekeywordloginmarkdirsnoclobbernoglobnohupnolognounsetphysicalposixprivilegedtrackallvirawvi-show8vi-tabcompletevi-esccompletextracealnumblankcntrldigitgraphlowerpunctupperxdigitshf_flush: no fdshf_emptybuf: no fdshf_write: flags %xshf_write: nbytes %dshf_putchar: flags %xshf_putchar: no fd0123456789abcdef(null %s)shf_ungetc: flags %xshf_fillbuf: no fdshf_getchar: flags %xshf_getse: flags %xshf_read: flags %xshf_read: bsize %dshf_sopen: flags 0x%xshf_snprintf: buf %lx, bsize %dshf_reopen: missing read/writeshf_reopen: bad shf/buf/bsizeshf_fdopen: missing read/writeunmatchedsyntax error: unexpected EOF ?%dsyntax error: `%s' %s unexpectedtoo many <<'s too many redirections for%s: bad identifier %s: invalid function name thenelseelifficaseesacwhileuntildo{[[&&||;;((|&too many varssetexecsig: unset signal %d(%s)ERRError handlerEXITtimed out waiting for inputSIGwdscan: unknown char 0x%x (carrying on)%S #no-vars# #no-args# ( %T) %T| %T%;%T%s %T %S ]] select %s for %s in %;do%N%T%;done case %S in%N(%S%c%;%T%N;;%Nesac if %Tthen%N%Telif %Telse%;%T%;fi %s %T%;do{%;%T%;} %T|& %T& function %s %T%s() %Ttime %T< <<- << >> >| <> <&>&No controlling tty (open /dev/tty: %s)Can't find tty file descriptorj_ttyinit: dup of tty fd failed: %sj_ttyinit: can't set close-on-exec flag: %s%0*s%.*s%*s%.*s%s: subscript %ld out of range%s: is read onlysetstr: %s=%s: assigning to self0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789abcdefghijklmnopqrstuvwxyzOPTINDPOSIXLY_CORRECTHISTSIZEMAILCHECKMAILPATHRANDOMSECONDSTMOUTLINENOM-grabhist: bad history arrayy$%s %dfc -e ${VISUAL:-${EDITOR:-vi}} --derive_key_pkcsbio_diskinqbio_createflagsbio_parse_devlistbio_changepassbio_deleteraidbio_createraidbio_blinkbio_getvolbynamebio_alarmbio_inqstr2locatorbio_setblinkbio_setstatemainInvalid keyInvalid saltToo few rounds: %dcan't specify passphrase file during initial creation of crypto volumeinvalid passphrase filecan't stat passphrase filepassphrase file must be owned by rootpassphrase file has the wrong permissionscan't read passphrase fileinvalid passphrase lengthunable to read passphraseRe-type passphrase: Passphrases did not matchpbkdf2 failedinvalid KDF infoinvalid KDF hintKDF hint has invalid sizeunknown KDF type %dnumber of KDF rounds too low: %dDIOCINQ%s: <%s, %s, %s>, serial %s invalid flags listinvalid flag %sinvalid device listcould not open %scould not stat %stoo many devices on device listduplicate device in listNew passphrase: unknown errorBIOCDISCIPLINEOld passphrase: BIOCDELETERAIDno devices specifiednot enough memory for dev_t listunsupported raid levelnot enough disksnot exactly one partitionioctlPassphrase: BIOCCREATERAID/dev/bioCan't locate %s device via %sBIOCBLINKBIOCINQBIOCVOLinvalid alarm function: %sBIOCALARMalarm is currently %s %-11s %-10s %14s %-8s VolumeStatusSizeDevice %d%% done %u secondsScrubbingInvalidOnlineOfflineDegradedBuildingRebuildWTWB%s %u%14llu%11s %-10s %14s %-7s CRYPTO%s%s %11s %-10s %14s %-7s CONCAT%s%s %11s %-10s %14s %-7s RAID%u%s%s %s BIOCDISKFailedHot spareUnused %3u%14skey disk%u:%u.%unoenclunknown serial%11s %-10s %14s %-7s %-6s <%s> %11s %-10s %14s %-7s %-6s '%s' target not specifiedTarget %s: %sDisk %s is not in an enclosureDisk %s does not existinvalid device %sBIOCSETSTATEusage: %s [-hiqv] [-a alarm-function] [-b channel:target[.lun]] [-H channel:target[.lun]] [-R device | channel:target[.lun]] [-u channel:target[.lun]] device %s [-dhiPqsv] [-C flag[,flag,...]] [-c raidlevel] [-k keydisk] [-l special[,special,...]] [-O device | channel:target[.lun]] [-p passfile] [-R device | channel:target[.lun]] [-r rounds] device Invalid RAID levelNumber of rounds is %s: %sa:b:C:c:dH:hik:l:O:Pp:qr:R:svu:need deviceneed -c parameterneed -l parametermust use bio deviceusage: %s seconds do_movemainusage: %s [-fi] source target %s [-fi] source ... directory /bin/cp-PRp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status/bin/rm-rf%s: remove%s: set owner/group; not setting setuid/setgid%s: set owner/group%s: set mode%s: set flags%s: set timesrename %s to %scannot resolve %scannot rename a mount pointcan't remove %s%s: destination pathname too longeval5syntax error|&=<>+-*/%:()non-numeric argumentdivision by zerousage: %s [-M core] [-N system] M:N:sysctl: KERN_MSGBUFSIZEcouldn't allocate space for buffer datasysctl: KERN_MSGBUFmainusage: %s [-s] [name-of-host] sethostnamegethostname/etc/networks"(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDlɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~[/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxqg jgrn<:ORQhك[0.0.0.0127.0.0.1::::1/etc/group/etc/spwd.db/etc/pwd.db/etc/ethers%02x:%02x:%02x:%02x:%02x:%02x  0123456789ABCDEF0123456789abcdefnanNANinfINF(null)bug in vfprintf: bad base HOSTALIASES/etc/hosts;#nameserverlookupypsearchinet4ndots:RES_OPTIONSoptions LOCALDOMAINsearch lookup bind filenameserver 127.0.0.1ASR_CONFIGlookup file %d.%d.%d.%d.in-addr.arpa.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.ip6.arpa.no spacebad domain namedomain name too longbad dlen@BKMGTPE0B%lld%c%lld.%1lld%cimsg_readmsgbuf_write/dev/diskmap%s%s%s%c%s%s%shmac_sha1pkcs5_pbkdf2logout/var/run/utmplogin_protect%s: %s: %m/etc/fbtab/*%s: chmod(%s): %m%s: chown(%s): %m%s: opendir(%s): %m%o%s: bad entry: %s\\#readlabelfsnHpin%s: not a device node%s: couldn't read disklabel%s: bad filesystem type in labellogwtmp/var/log/wtmptgetentTERMCAP/usr/share/misc/termcapTERMPATH.termcap /usr/share/misc/termcapOOPS5MS7) 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-A1b62S-+ldEw}ZVǖAOIъ OM~-QJ#SpxAaU׮.7׵Y-6]]wll?AԞZ͢$ Faw$eڪ]]FD(koipvk19Z* ,  m86F߲]qTp0ek*1u4yީ%8S1bSWĔՖk1**ykʬHpo].*F6fcTT"eM©g0&):{ϼkZ> 8$,52F*sw1pHkQ6Fzw]cN̵J #pAF]#l8?1(BOgT~yUbL8^#ܖTZ1ObbSyOIV~P-{b-R4٠~^eGnHl/Su6: #jT$+e?yHf'*b#ٽЧ ?&~?$pi;FBzw[keZ~7 Sv8H 3?r$7jnԄYFܨ |OQ;օ U d S - =G\ p&Gw)` /a߫i5&LsZ<#0zMzFM8,9; :R:(q-v,.7/pXqYs3r%w+OQvrtEux܉~OK }!b|tyBxʠz{.lD~m8onlk[wjR1h58ib?mcf+aQ`צedd"fig HINSKyuJcO NZLݘMFGN@E$DD2AsX@*IBCPhTg3U>uW ַVS:R|P~Q9ZS [fYX4])\ZEo^m/_5qϱ٥s\ۼqދ!K7 kfֶԁ-b3Πjp]$^'~*I@VW<âM˟ŏ{ tDCm-@wm.B+(铜>Td"ŀǼϭ~8y$owJ1}05_K^ iϏ은BI#ƈdX܁T̓cQ: rՆ⩗ fn|xK)o%ƭ/3vUuA?)C:|sĵ@͂ Ͳ;bIUeh"׻_HS1޼^Z4eg Wb27_k%8ם(ŊO}do׸Jj3wVcXWP0qB{߭gCru&op-?'Bs ưGz>2[Ȏg; i8P/ _Y=чe:ZO?(3wwXR @hQ+ğH*0"ZOWoI}@mNП5+#*'G| AH=XX?#1jvʬ`p^Y<L~i/{kHwâ hs)aLoD~Pf7VM'(@ﰤ ہg9x+n&;f?/X)T`D1 ߨMߒ.FgTp'Hq/L0UEc?kǃh6ry7]P\@TN%s7@'>$!AxUʰ\3;Y^U~PGl!;b F2ȂpԞ(Q_V:1X: n3 m:@/)IJNv"2x+ٗ Kx.HҥfAj^y9*O]#kM`~b_R 7zFh!1߈Vc0a"j6nS Nr)Υ{t*F8#vufz`rs"WG9^EMvc΍&DAdQy/4Aڱ&S֚E biLQ<6'5P..T&q]w4.6IE? v\[YI>U!lDa>Ԫ΋ϩ7~8A]&nv|oY yKiw\¹9~$ 66nQfq>,o,IӔ 渱{I .H>C-Yn馑gQz tafw0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-1A26b+-Sdl}wEVZOAي»IˬO ~M-JQS#xpaA.U7Y-۩6˚w]]llA?Z$㧲F waރ$Ųe]]DFok(vpi91k *Z  ,8mF6]pTqke0*1¶u4%y<8syjHA}X*ݹ1SbSW§ٖծ1k**kypH]oF*.f6TTcMe"¤0g)&Ůޟ:{kZ >8,$5*F21wsHpQkzF6c]wN̵ׄJ# pȄA#]F8l1?(gOB~TUyLbˁ8#^TO1ZbbySIOP~V{-b-4R^~Ge­lHnuS/:6# $Tj?e+y䏼Hf*'˼Ѝb# &??~p$iBF;[wzek~ZS 7H8v ?3$rj7nFY |OQ; U dؓS - \G=&pGw`)/ ai5&sL <:R=Pe6^X7}o5641W0ճ2k3$k%'1&-[#bML"'{ "!$*x(+)`F(> q-q,v.Ț/7pqXsYr3w%vQO+tru՛E~xKO} |b!ytxBz{l.m~Do8nkljw[h1Ri85bcm?a+f`Qeddf"giH IKSNJuyOcN LZMݥFĚGE@ND$A2D@XsBI*CThPU3gWu>V SR:P|Q~Z9[ SYfX]4\)^oEZ_/m5qs<\kg2z &J8 좞V`a/6i\lU,zB\uHƒ=&FW A+Ox]`غ7W>9q߳!7Kk ֩fض-bѠ3pj$]^Ĝ'*~@IWVÕ<ӂMʏş{ Dt͆mC-@mw+B.(>dT"ş~Ϝ8yo$w1J}50K_ ^ϋiBۉI#dXфTQc:r Р fΫnx|)Ko%3/uUv?A)ġ:C|sд@͉ ;IbeU"hH_S1ފZ^ھ4ge ȋbW72%k_ܝ8Ŵ(}OodJֿjw3XcVPW0Bq{gǧurCo&p-?О'sB zGɠ2>[ ;g/P8i_ Y=嗇e:ϏOZw3(?RXw@ Qh+HZ"0*WOIo@}m5N#+'*GA |􏒨HX=#?X1vjʨ`^pYL'!$UxAׯ3\Y;U^GP~b;!lڇF 2p(ԐQV_:X1: 3n :m@I)/NJ2"v+x xKH.jAf^O*9y]#Mk~`bю_޶ Rz7hFм!10cV"ajحn6 SrN){t*8Fv#fu`zrϮsɛW"G9E^vMcD&dA/yQA4S&ֿ EbLil!>aDƋΪ~7A8n&]|vYoᡱ Kyi׫w¡\~9$66 Qnf>q,o,ӹI 散 I{.C>HnY-Qg̰t zfalongjmp botch. inet6_rth_reverseargument buffer overflowunknown/invalid errorno errorinvalid value for ai_flagsname or service is not knowntemporary failure in name resolutionnon-recoverable failure in name resolutionno address associated with nameai_family not supportedai_socktype not supportedservice not supported for ai_socktypeaddress family for name not supportedmemory allocation failureinvalid value for hintsresolved protocol is unknownfstabscanxxswinet_net_ptoninet_net_pton_ipv401234567890123456789abcdef/usr/src/lib/libc/net/inet_net_pton.cn >= 0 && n <= 15n >= 0 && n <= 9assertion "%s" failed: file "%s", line %d, function "%s" assertion "%s" failed: file "%s", line %d %u.%u.%u.%uSHA256EndSHA256DataSHA256FileChunk0123456789abcdefp|^Ȳ,̲Բܲ< (0Signal 0HUPINTILLTRAPABRTEMTFPEKILLBUSSEGVSYSPIPEALRMURGTSTPCONTCHLDTTINTTOUIOXCPUXFSZVTALRMPROFWINCHUSR1USR2THREĺ[:<:]][:>:]]ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ !"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789ABCDEFabcdefNULSOHSTXETXEOTENQBELalertBSbackspaceHTtabLFVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBIS4IS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoponetwothreefourfivesixseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDEL(0<LXdlx ,nosappndnosappendnoarchnoarchivednoschgnoschangenosimmutablenouappndnouappendnouchgnouchangenouimmutablenodumpnoopaqueBLOCKSIZE%s: unknown blocksizemaximum blocksize is %dG%s: minimum blocksize is 512%ld%s-blocksкԺغܺ  %m/%d/%y%Y-%m-%d%H:%M%I:%M:%S %p%H:%M:%SESTCSTMSTPSTEDTCDTMDTPDTABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/regerrorREG_0x%xREG_NOMATCHregexec() failed to matchREG_BADPATinvalid regular expressionREG_ECOLLATEinvalid collating elementREG_ECTYPEinvalid character classREG_EESCAPEREG_ESUBREGinvalid backreference numberREG_EBRACKbrackets ([ ]) not balancedREG_EPARENparentheses not balancedREG_EBRACEbraces not balancedREG_BADBRinvalid repetition count(s)REG_ERANGEinvalid character rangeREG_ESPACEREG_BADRPTrepetition-operator operand invalidREG_EMPTYempty (sub)expressionREG_ASSERT"can't happen" -- you found a bugREG_INVARGinvalid argument to regex routine*** unknown regexp error code ***/etc/ttyssecurertsctssoftcarwindowttyname_r/var/run/dev.dbPOSIX_V6_ILP32_OFFBIGPOSIX_V7_ILP32_OFFBIG-lpthreadreadpassphrasetcsetattrglob2SHA512EndSHA512DataSHA512FileChunk0123456789abcdefauthunix_createauthunix_create_defaultauth_none.c - Fatal marshalling problemauthunix_create: out of memory plt$0<Tht,@Tlplt$0<Tht,@TlHangupInterruptQuitIllegal instructionTrace/BPT trapAbort trapEMT trapFloating point exceptionKilledBus errorSegmentation faultBad system callBroken pipeAlarm clockTerminatedUrgent I/O conditionSuspended (signal)SuspendedContinuedChild exitedStopped (tty input)Stopped (tty output)I/O possibleCputime limit exceededFilesize limit exceededVirtual timer expiredProfiling timer expiredWindow size changesInformation requestUser defined signal 1User defined signal 2Thread ASTunknown option -- %coption requires an argument -- %cambiguous option -- %.*soption doesn't take an argument -- %.*soption requires an argument -- %sunknown option -- %s/etc/services,/asprintf%h %e %T clnttcp_create: out of memory `b0b1ncdtscsbpxbxfxoxtxdxgetentcgetnext%s.dbtc|:/etc/protocolsSHA1TransformSHA1Padexecvpeexeclpexecleexeclexecvp: : path too long xdr_array: out of memory 8Tp8Xp $RPC: (unknown error code)%s: %s - %s ; errno = %s; low version = %u, high version = %u; why = (unknown authentication error - %d); s1 = %u, s2 = %uRPC: SuccessRPC: Can't encode argumentsRPC: Can't decode resultRPC: Unable to sendRPC: Unable to receiveRPC: Timed outRPC: Incompatible versions of RPCRPC: Authentication errorRPC: Program unavailableRPC: Program/version mismatchRPC: Procedure unavailableRPC: Server can't decode argumentsRPC: Remote system errorRPC: Unknown hostRPC: Port mapper failureRPC: Program not registeredRPC: Failed (unspecified error)RPC: Unknown protocolAuthentication OKInvalid client credentialServer rejected credentialInvalid client verifierServer rejected verifierClient credential too weakInvalid server verifierFailed (unspecified error)perrorxdrrec_create: out of memory   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~realpathؗҜ<3#I9=D2[%Cod(hinityanMD5Pad0123456789abcdefInfinityNaNР^[Yy]^[Nn]yes646NONEUTF8 $(,048<@DHLT`h,pxĺSunMonTueWedThuFriSatSundayMondayTuesdayWednesdayThursdayFridaySaturdayJanFebMarAprMayJunJulAugSepOctNovDecJanuaryFebruaryMarchAprilJuneJulyAugustSeptemberOctoberNovemberDecemberAMPM%a %b %e %H:%M:%S %Y__stack_smash_handlerstack overflow in function %sconnectlog_r__vsyslog_r/dev/log_rsyslog%s: unknown facility/priority: %x<%d>[%ld]Error %dlibcUnknown signal: Unknown error: _catopenNLSPATH/usr/share/nls/%L/%N.cat:/usr/share/nls/%l.%c/%N.cat:/usr/share/nls/%l/%N.catLC_ALLLC_MESSAGESLANG0D\t@]0Tdt$<Lp$8Xp $DTl Dh|$8Pt8Pd$@Undefined error: 0Operation not permittedNo such file or directoryNo such processInterrupted system callInput/output errorDevice not configuredArgument list too longExec format errorBad file descriptorNo child processesResource deadlock avoidedPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkOperation not supported by deviceNot a directoryIs a directoryInvalid argumentToo many open files in systemToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksNumerical argument out of domainResult too largeResource temporarily unavailableOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not availableProtocol not supportedSocket type not supportedOperation not supportedProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceOperation timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downNo route to hostDirectory not emptyToo many processesToo many usersDisk quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticatorIPsec processing failureAttribute not foundIllegal byte sequenceNo medium foundWrong medium typeValue too large to be stored in data typeOperation canceledIdentifier removedNo message of desired typeNot supportedplt$0<Tht,@Tlvsnprintf !#&(*-/14LABCDEF7yACnF?O8M20HwZ?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ inet_pton01234567890123456789ABCDEF0123456789abcdefT""too small ((((( AAAAAABBBBBB   !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~%$sniglet^&isatty__put_page%s/_hash.XXXXXXHASH: Out of overflow pages. Increase page size tzloadmnGMT/etc/localtime/usr/share/zoneinfoposixrules,M4.1.0,M10.5.0abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789 :+-._Local time zone must be set--see zic manual pageasctime3JanFebMarAprMayJunJulAugSepOctNovDecSunMonTueWedThuFriSat??? ??? ?? ??:??:?? ???? %.3s %.3s%3d %2.2d:%2.2d:%2.2d %-4s %.3s %.3s%3d %2.2d:%2.2d:%2.2d %s _conv_fmt $(,048<@DHLT`h,pxĺZ-0%2d%03d%e-%b-%Y%04d%a %b %e %T %Ywrterrormalloc_initmalloc() warning: unknown char in MALLOC_OPTIONS recursive callregions_total not 2^xinternal struct corruptmunmap/etc/malloc.confMALLOC_OPTIONSmalloc init mmap failedmunmap roundmalloc cache underflowmalloc free slot lostmalloc cache overflowbogus pointer (double free?)bogus pointerguard sizemprotectchunk info corruptedmodified chunk-pointerchunk is already free in free():free() called before allocationmap roundmalloc cachepp & bits in posix_memalign():mapalign bad alignmentmapalign round in calloc(): in realloc(): in malloc():chacha_encrypt_bytes_rs_stirexpand 32-byte kexpand 16-byte ksnprintf|Tt4TpTTTTTTTTTTH9TLYT_UU1LULU8U0$U,U4UBUCUdU`xU`xU`xU,V,V,VPԣ Vt $V  (VL ,VL 4V 0Z > C @B>@|4?@ԆB@ȇ@ЇdBԇA܇?lADA@/tmp/EdDk.aXXXXXXXXXXذ $(,4<DP\dl|ذ2n$4 U(jjhX|P(ľHLTX|d8.? ɚ;0  ...$<i@?D?H?L?P?/P/p/`//t222P@z.BdBdBd(Bd4BdDB.dA"" e j    ky ( JKYdu f    bv z!w" (F2R r u'g <<p%[)]*())* * ){{}}{}(())()[[]][]#$G>> P30123456789.=:f/?/*?*n+n,N-N.&7m'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !+ Hh VqQ:q:QZZ    l h b  w  i x X      0  $  k  j  is not a regular file (use -f to see it) is a directory~~aЄ܅fffbЄ@>g gBЄ@ghgcЄgggdЄAȅgheЄth8hLhfЄlhhFЄ|hhgЄhiiiijЄAj jJЄ!0jPjKЄЅhjjLЄjjmЄjjknЄ"k,k@kpЄH@PЄ?`kqЄllkkkrЄ"̅kklsЄ!\ltlSЄ!ąlluЄ"lllVЄL>wЄ"m8mlmxЄ(<mmXЄA؅mmyЄnnzЄԅ@nXn"Є;xn~Є!nn?Є;#Єh@nnЄAnnЄo4oЄXo|oo... (interrupt to abort) (press RETURN)[[D\444 Ȏмظ11"t €u6Uu|agPtPS[X!Using drive X, partition YMBR on floppy or old BIOS Read error No O/S No active partition OxUbđ0<ؑ40ؽ8xdH j,̒(<ļt88\(d< @Dw( @4ܜbAB\C`gD$E4FDGTHUd7Vadb@cpefxhiLlnĝq̝qԝrsvwxurrTXdl9txi d    D?T@d[x\\]^^̷_ط_`{{|$}0}D~LGMTܻ,8Ddp  Լ  ` ,8\hpdppppq@8hq:qq..0/.?Ȃlذ $(,4<DP\dl|ذ2n$4HPP @fkh455RuneCT10NONEBBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~Tpppppq8q :@qqdxz${X||,{|~t}d}l \Lp|pU VxUU- pU VxUU. dpU VxUU/̼̼|t0H$xTt$$X\$XXL(F P$T$S.shstrtab.init.text.fini.rodata.openbsd.randomdata.data.eh_frame.jcr.gotpad0.got.ctors.dtors.gotpad1.bss.stack.arm.atpcs.note.openbsd.ident ppS$T$%ii9iiS?IN=W=(\=Ƚc=нj=spxTT . ..chowndhclientm disklabeldmesgfdiskfsckn fsck_ext2fsfsck_ffsmifconfigminitnmknodmount mount_cd9660K mount_ext2fsK mount_ffs mount_msdos mount_nfsnewfs newfs_msdos newfs_ext2fsKpingnping6reboothaltnroutertsolumountsysctlbioctln6 ugen7 ulpt0 ulpt1 uhid0 uhid1 uhid2 uhid3 urio0 usb0 R usb1 usb2 usb3 usb4 usb5 usb6 usb7 ;; ttyU[0-9a-zA-Z]) U=${i#ttyU*} o=$(alph2d $U) M ttyU$U c 68 $o 660 dialer uucp M cuaU$U c 68 $(($o+128)) 660 dialer uucp ;; wsmux|wsmouse|wskbd) M wsmouse c 63 0 600 M wskbd c 63 1 600 ;; wsmouse[0-9]*) M wsmouse$U c 62 $U 600 ;; wskbd[0-9]*) M wskbd$U c 61 $U 600 ;; wscons) R wsmouse0 wsmouse1 wsmouse2 wsmouse3 wskbd0 wskbd1 wskbd2 R wskbd3 wsmux ttyCcfg ttyC0 ttyC1 ttyC2 ttyC3 ttyC4 ttyC5 R ttyC6 ttyC7 ttyC8 ttyC9 ttyCa ttyCb ;; tty[C-J]*) U=${i##tty[C-J]} case $i in ttyC*) n=C m=0;; ttyD*) n=D m=256;; ttyE*) n=E m=512;; ttyF*) n=F m=768;; ttyG*) n=G m=1024;; ttyH*) n=H m=1280;; ttyI*) n=I m=1536;; ttyJ*) n=J m=1792;; esac case $U in [0-9a-f]) M tty$n$U c 60 $((16#$U+$m)) 600;; cfg) M tty${n}cfg c 60 $((255+$m)) 600;; *) echo bad unit $U for $i; exit 1;; esac ;; pty*) if [ $U -gt 15 ]; then echo bad unit for pty in: $i continue fi set -A letters p q r s t u v w x y z P Q R S T set -A suffixes 0 1 2 3 4 5 6 7 8 9 a b c d e f g h i j k l m n o p q \ r s t u v w x y z A B C D E F G H I J K L M N O P Q R S T U V W X \ Y Z name=${letters[$U]} n=0 while [ $n -lt 62 ] do nam=$name${suffixes[$n]} off=$(($U*62)) M tty$nam c 4 $(($off+$n)) M pty$nam c 5 $(($off+$n)) n=$(($n+1)) done ;; ptm) M ptm c 98 0 666 ;; tty[0-7][0-9a-f]) U=${i#tty*} o=$(h2d $U) M tty$U c 12 $o 660 dialer uucp M cua$U c 12 $(($o+128)) 660 dialer uucp ;; st*) n=$(($U*16)) for pre in " " n e en do M ${pre}st$U b 25 $n 660 operator M ${pre}rst$U c 25 $n 660 operator n=$(($n+1)) done ;; vnd*) dodisk vnd $U 19 19 $U 0 ;; rd*) dodisk2 rd $U 18 18 $U 0 ;; ch*) M ch$U c 27 $U 660 operator ;; cd*) dodisk2 cd $U 26 26 $U 0 ;; local) test -s $T.local && sh $T.local ;; all) R gpio0 gpio1 gpio2 gpio3 gpio4 gpio5 gpio6 gpio7 gpio8 R bthub0 bthub1 bthub2 vnd0 vnd1 vnd2 vnd3 sd0 sd1 sd2 sd3 sd4 R sd5 sd6 sd7 sd8 sd9 cd0 cd1 rd0 tun0 tun1 tun2 tun3 bio bpf0 R bpf1 bpf2 bpf3 bpf4 bpf5 bpf6 bpf7 bpf8 bpf9 pty0 diskmap R vscsi0 ch0 fuse pppx hotplug ptm local wscons pci0 pci1 pci2 R pci3 uall rmidi0 rmidi1 rmidi2 rmidi3 rmidi4 rmidi5 rmidi6 R rmidi7 tuner0 radio0 video0 video1 uk0 random lkm tty00 R tty01 tty02 tty03 tty04 tty05 tty06 tty07 tty08 tty09 tty0a R tty0b apm crypto pf systrace wd0 wd1 wd2 wd3 std st0 st1 fd ;; wd*|sd*) case $i in wd*) dodisk wd $U 16 16 $U 0;; sd*) dodisk sd $U 24 24 $U 0;; esac ;; *) echo $i: unknown device ;; esac done } R "$@" { echo -n ${RMlist[*]} echo -n ${mklist[*]} echo -n ${MKlist[*]} echo -n ${whlist[*]} echo ${oplist[*]} } | if [ "$eo" = "echo" ]; then cat else sh fi #!/bin/sh - PATH=/sbin:/usr/sbin:/bin:/usr/bin T=$0 [ "$eo" ] || eo= hex() { case $1 in [0-9]) echo -n $1;; 10) echo -n a;; 11) echo -n b;; 12) echo -n c;; 13) echo -n d;; 14) echo -n e;; 15) echo -n f;; esac } alph2d() { local t="$1" local p="0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ" local sub=${p%${t}*} echo ${#sub} } h2d() { local s="$1" local f=${s%*[0-9a-f]} n=${s#[0-9a-f]*} echo $(($(_h2d $f)*16+ $(_h2d $n) )) } _h2d() { case $1 in [0-9]) echo -n $1;; a) echo -n 10;; b) echo -n 11;; c) echo -n 12;; d) echo -n 13;; e) echo -n 14;; f) echo -n 15;; esac } unt() { arg="$1" tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" while [ "$tmp" != "$arg" ] do arg=$tmp tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" done echo $arg } dodisk() { [ "$DEBUG" ] && set -x n=$(($((${5}*${7:-16}))+${6})) count=0 [ 0$7 -ne 8 ] && l="i j k l m n o p" for d in a b c d e f g h $l do M $1$2$d b $3 $(($n+$count)) 640 operator M r$1$2$d c $4 $(($n+$count)) 640 operator let count=count+1 done } dodisk2() { n=$(($(($5*${7:-16}))+$6)) M $1$2a b $3 $n 640 operator M r$1$2a c $4 $n 640 operator n=$(($n+2)) M $1$2c b $3 $n 640 operator M r$1$2c c $4 $n 640 operator } RMlist[0]="rm -f" mkl() { mklist[${#mklist[*]}]=";mknod -m $1 $2 $3 $4 $5" } M() { RMlist[${#RMlist[*]}]=$1 mkl ${5-666} $1 $2 $3 $4 G=${6:-wheel} [ "$7" ] && { MKlist[${#MKlist[*]}]="&& chown $7:$G $1" } || { case $G in wheel) [ ${#whlist[*]} = 0 ] && whlist[0]="&& chgrp wheel" whlist[${#whlist[*]}]="$1" ;; operator) [ ${#oplist[*]} = 0 ] && oplist[0]="&& chgrp operator" oplist[${#oplist[*]}]="$1" ;; *) MKlist[${#MKlist[*]}]="&& chgrp $G $1"; esac } return 0 } R() { [ "$DEBUG" ] && set -x for i in "$@" do U=`unt $i` [ "$U" ] || U=0 case $i in ramdisk) R std bpf0 wd0 wd1 sd0 tty00 rd0 wsmouse R st0 ttyC0 wskbd0 apm bio diskmap random ;; std) M console c 0 0 600 M tty c 1 0 M mem c 2 0 640 kmem M kmem c 2 1 640 kmem M null c 2 2 M zero c 2 12 M stdin c 7 0 M stdout c 7 1 M stderr c 7 2 M ksyms c 8 0 640 kmem M klog c 6 0 600 ;; vscsi*) M vscsi$U c 100 $U 600 ;; video*) M video$U c 38 $U MKlist[${#MKlist[*]}]=";[ -e video ] || ln -s video$U video" ;; tuner*) M tuner$U c 75 $(($(($U*2))+16)) 644 ;; systrace) M systrace c 50 0 644 ;; uk*) M uk$U c 28 $U 640 operator ;; tun*) M tun$U c 33 $U 600 ;; rmidi*) M rmidi$U c 57 $U 666 ;; *random) n=0 for pre in " " s u a do M ${pre}random c 40 $n 644 n=$(($n+1)) done ;; radio*) M radio$U c 97 $U MKlist[${#MKlist[*]}]=";[ -e radio ] || ln -s radio$U radio" ;; pppx*) M pppx$U c 103 $U 600 ;; pf*) M pf c 46 0 600 ;; pci*) M pci$U c 88 $U 600 MKlist[${#MKlist[*]}]=";[ -h pci ] || ln -sf pci0 pci" ;; lkm) M lkm c 35 0 640 _lkm ;; hotplug) M hotplug c 37 $U 400 ;; gpio*) M gpio$U c 13 $U 600 ;; fuse) M fuse$U c 77 $U 600 ;; fd) RMlist[${#RMlist[*]}]=";mkdir -p fd;rm -f" n=0 while [ $n -lt 64 ];do M fd/$n c 7 $n;n=$(($n+1));done MKlist[${#MKlist[*]}]=";chmod 555 fd" ;; diskmap) M diskmap c 102 0 640 operator ;; crypto) M crypto c 47 0 ;; bthub*) M bthub$U c 101 $U ;; bpf*) M bpf$U c 22 $U 600 ;; bktr*) M bktr$U c 75 $U 644 ;; bio) M bio c 52 0 600 ;; audio*) M sound$U c 36 $U M mixer$U c 36 $(($U+16)) M audio$U c 36 $(($U+128)) M audioctl$U c 36 $(($U+192)) MKlist[${#MKlist[*]}]=";[ -e audio ] || ln -s audio$U audio" MKlist[${#MKlist[*]}]=";[ -e mixer ] || ln -s mixer$U mixer" MKlist[${#MKlist[*]}]=";[ -e sound ] || ln -s sound$U sound" MKlist[${#MKlist[*]}]=";[ -e audioctl ] || ln -s audioctl$U audioctl" ;; apm*) M apm c 34 0 644 M apmctl c 34 8 644 ;; usb*) [ "$i" = "usb" ] && u= || u=$U M usb$u c 64 $U 660 ;; urio*) M urio$U c 67 $U 660 ;; ulpt*) M ulpt$U c 66 $U 660 ;; uhid*) M uhid$U c 65 $U 660 ;; ugen*) n=$(($U*16)) for j in 0{0,1,2,3,4,5,6,7,8,9} 1{0,1,2,3,4,5} do M ugen$U.$j c 70 $(($n+10#$j)) 660 done ;; uall) R ttyU0 ttyU1 ttyU2 ttyU3 ugen0 ugen1 ugen2 ugen3 ugen4 ugen5 R uge . ..MAKEDEVconsole  tty  mem kmem`o null`o zero`ostdinostdoutstderrksymsoklog`obpf0`owd0a`orwd0aowd0b`orwd0bowd0caorwd0cowd0daorwd0dowd0eaorwd0eowd0faorwd0fo wd0gao!rwd0go"wd0hao#rwd0ho$wd0iao%rwd0io&wd0jao'rwd0jo(wd0kbo)rwd0ko*wd0lbo+rwd0lo,wd0mbo-rwd0mo.wd0nbo/rwd0no0wd0obo1rwd0oo2wd0pbo3rwd0po4wd1abo5rwd1ao6wd1bbo7rwd1bo8wd1cco9rwd1co:wd1dco;rwd1do<wd1eco=rwd1eo>wd1fco?rwd1fo@wd1gcoArwd1goBwd1hcoCrwd1hoDwd1icoErwd1ioFwd1jcoGrwd1joHwd1kdoIrwd1koJwd1ldoKrwd1loLwd1mdoMrwd1moNwd1ndoOrwd1noPwd1odoQrwd1ooRwd1pdoSrwd1poTsd0adoUrsd0aoVsd0bdoWrsd0boXsd0ceoYrsd0coZsd0deo[rsd0do\sd0eeo]rsd0eo^sd0feo_rsd0fo`sd0geoarsd0gobsd0heocrsd0hodsd0ieoersd0iofsd0jeogrsd0johsd0kfoirsd0kojsd0lfokrsd0lolsd0mfomrsd0monsd0nfoorsd0nopsd0ofoqrsd0oorsd0pfosrsd0pottty00oucua00ovrd0afowrrd0aoxrd0cgoyrrd0cozwsmouse{wskbdo| st0}rst0go~nst0gonrst0oπest0goρerst0oςenst0oσenrst0τttyC0oυwskbd0 apmapmctlЈ biodiskmaprandomЋsrandomurandomarandomition on the disk. $(fdisk ${_disk}) __EOT fdisk -e ${_disk} [[ -n $(fdisk $_disk | grep ' A6 ') ]] && return echo No OpenBSD partition in MBR, try again. ;; o*|O*) return ;; esac done } md_prep_disklabel() { local _disk=$1 _f _op md_prep_fdisk $_disk _f=/tmp/fstab.$_disk if [[ $_disk == $ROOTDISK ]]; then while :; do echo "The auto-allocated layout for $_disk is:" disklabel -h -A $_disk | egrep "^# |^ [a-p]:" ask "Use (A)uto layout, (E)dit auto layout, or create (C)ustom layout?" a case $resp in a*|A*) _op=-w ;; e*|E*) _op=-E ;; c*|C*) break ;; *) continue ;; esac disklabel $FSTABFLAG $_f $_op -A $_disk return done fi cat <<__EOT You will now create an OpenBSD disklabel inside the OpenBSD MBR partition. The disklabel defines how OpenBSD splits up the MBR partition into OpenBSD partitions in which filesystems and swap space are created. You must provide each filesystem's mountpoint in this program. The offsets used in the disklabel are ABSOLUTE, i.e. relative to the start of the disk, NOT the start of the OpenBSD MBR partition. __EOT disklabel $FSTABFLAG $_f -E $_disk } md_congrats() { } md_consoleinfo() { } dmesg | grep "^omap0 at mainbus0:" >/dev/null if [[ $? == 0 ]]; then MDPLAT=OMAP LOADADDR=0x82800000 fi dmesg | grep "^imx0 at mainbus0:" >/dev/null if [[ $? == 0 ]]; then MDPLAT=IMX LOADADDR=0x18800000 fi dmesg | grep "^sunxi0 at mainbus0:" >/dev/null if [[ $? == 0 ]]; then MDPLAT=SUNXI LOADADDR=0x40200000 fi MDSETS="bsd.${MDPLAT} bsd.rd.${MDPLAT} bsd.${MDPLAT}.umg bsd.rd.${MDPLAT}.umg" SANESETS="bsd.${MDPLAT}" DEFAULTSETS=${MDSETS} NEWFSARGS_msdos="-F 16 -L boot" NEWFSARGS_ext2fs="-v boot" md_installboot() { local _disk=$1 mount /dev/${_disk}i /mnt/mnt BEAGLE=$(scan_dmesg '/^omap0 at mainbus0: \(BeagleBoard\).*/s//\1/p') BEAGLEBONE=$(scan_dmesg '/^omap0 at mainbus0: \(BeagleBone\).*/s//\1/p') PANDA=$(scan_dmesg '/^omap0 at mainbus0: \(PandaBoard\)/s//\1/p') IMX=$(scan_dmesg '/^imx0 at mainbus0: \(i.MX6.*\)/s//IMX/p') SUNXI=$(scan_dmesg '/^sunxi0 at mainbus0: \(A.*\)/s//SUNXI/p') if [[ -f /mnt/bsd.${MDPLAT} ]]; then mv /mnt/bsd.${MDPLAT} /mnt/bsd fi if [[ -f /mnt/bsd.${MDPLAT}.umg ]]; then mv /mnt/bsd.${MDPLAT}.umg /mnt/mnt/bsd.umg fi if [[ -f /mnt/bsd.mp.${MDPLAT} ]]; then mv /mnt/bsd.mp.${MDPLAT} /mnt/bsd.mp fi if [[ -f /mnt/bsd.rd.${MDPLAT} ]]; then mv /mnt/bsd.rd.${MDPLAT} /mnt/bsd.rd fi if [[ -f /mnt/bsd.rd.${MDPLAT}.umg ]]; then mv /mnt/bsd.rd.${MDPLAT}.umg /mnt/mnt/bsdrd.umg fi tar -C /mnt/ -xf /usr/mdec/u-boots.tgz if [[ ${MDPLAT} == "OMAP" ]]; then if [[ -n $BEAGLE ]]; then cp /mnt/usr/mdec/beagle/{mlo,u-boot.bin} /mnt/mnt/ elif [[ -n $BEAGLEBONE ]]; then cp /mnt/usr/mdec/am335x/{mlo,u-boot.img} /mnt/mnt/ elif [[ -n $PANDA ]]; then cp /mnt/usr/mdec/panda/{mlo,u-boot.bin} /mnt/mnt/ fi cat > /mnt/mnt/uenv.txt<<__EOT bootcmd=mmc rescan ; setenv loadaddr ${LOADADDR}; setenv bootargs sd0i:/bsd.umg ; fatload mmc \${mmcdev} \${loadaddr} bsd.umg ; bootm \${loadaddr} ; uenvcmd=boot __EOT elif [[ ${MDPLAT} == "IMX" ]]; then cat > /tmp/6x_bootscript.scr<<__EOT ; setenv loadaddr ${LOADADDR} ; setenv bootargs sd0i:/bsd.umg ; for dtype in sata mmc ; do for disk in 0 1 ; do \${dtype} dev \${disk} ; for fs in fat ext2 ; do if \${fs}load \${dtype} \${disk}:1 \${loadaddr} bsd.umg ; then bootm \${loadaddr} ; fi ; done; done; done; echo; echo failed to load bsd.umg __EOT mkuboot -t script -a arm -o linux /tmp/6x_bootscript.scr /mnt/mnt/6x_bootscript elif [[ ${MDPLAT} == "SUNXI" ]]; then cat > /mnt/mnt/uenv.txt<<__EOT bootargs=sd0i:/bsd mmcboot=mmc rescan ; fatload mmc 0 ${LOADADDR} bsd.umg && bootm ${LOADADDR}; uenvcmd=run mmcboot; __EOT cp /mnt/usr/mdec/sunxi/{sunxi-spl,u-boot}.bin /mnt/mnt/ fi } md_prep_fdisk() { local _disk=$1 _q _d local bootparttype="C" local bootfstype="msdos" local newfs_args=${NEWFSARGS_msdos} IMX=$(scan_dmesg '/^imx0 at mainbus0: \(i.MX6.*\)/s//IMX/p') if [[ -n $IMX ]]; then bootparttype="83" bootfstype="ext2fs" newfs_args=${NEWFSARGS_ext2fs} fi while :; do _d=whole if [[ -n $(fdisk $_disk | grep 'Signature: 0xAA55') ]]; then fdisk $_disk else echo "MBR has invalid signature; not showing it." fi ask "Use (W)hole disk$_q or (E)dit the MBR?" "$_d" case $resp in w*|W*) echo -n "Creating a ${bootfstype} partition and an OpenBSD partition for rest of $_disk..." fdisk -e ${_disk} <<__EOT >/dev/null reinit e 0 ${bootparttype} n 64 32768 f 0 e 3 A6 n 32832 write quit __EOT echo "done." disklabel $_disk 2>/dev/null | grep -q "^ i:" || disklabel -w -d $_disk newfs -t ${bootfstype} ${newfs_args} ${_disk}i return ;; e*|E*) cat <<__EOT You will now create one MBR partition to contain your OpenBSD data and one MBR partition on which kernels are located which are loaded by U-Boot. Neither partition will overlap any other partition. The OpenBSD MBR partition will have an id of 'A6' and the boot MBR partition will have an id of '${bootparttype}' (${bootfstype}). The boot partition will be at least 16MB and be the first 'MSDOS' part#!/bin/ksh MODE=install . install.sub DISK= DISKS_DONE= _DKDEVS=$(get_dkdevs) _fsent= rm -f /tmp/fstab* ask_yn "Use DUIDs rather than device names in fstab?" yes [[ $resp == y ]] && FSTABFLAG=-F while :; do DISKS_DONE=$(addel "$DISK" $DISKS_DONE) _DKDEVS=$(rmel "$DISK" $_DKDEVS) if isin $ROOTDISK $_DKDEVS; then resp=$ROOTDISK rm -f /tmp/fstab else ask_which "disk" "do you wish to initialize" \ '$(l=$(get_dkdevs); for a in $DISKS_DONE; do l=$(rmel $a $l); done; bsort $l)' \ done [[ $resp == done ]] && break fi DISK=$resp makedev $DISK || continue rm -f /tmp/*.$DISK md_prep_disklabel $DISK || { DISK= ; continue ; } grep -qs " / ffs " /tmp/fstab.$ROOTDISK || { DISK= ; echo "'/' must be configured!" ; continue ; } if [[ -f /tmp/fstab.$DISK ]]; then while read _pp _mp _rest; do if [[ $_mp == none ]]; then echo "$_pp $_mp $_rest" >>/tmp/fstab continue fi [[ /tmp/fstab.$DISK == $(grep -l " $_mp " /tmp/fstab.*) ]] || { _rest=$DISK ; DISK= ; break ; } done /etc/fstab rm /tmp/fstab.$_rest set -- $(grep -h " $_mp " /tmp/fstab.*[0-9]) echo "$_pp and $1 can't both be mounted at $_mp." continue fi while read _pp _mp _fstype _rest; do [[ $_fstype == ffs ]] || continue _OPT= [[ $_mp == / ]] && _OPT=$MDROOTFSOPT newfs -q $_OPT ${_pp##/dev/} _fsent="$_fsent $_mp!$_pp" done >/tmp/fstab munge_fstab mount_fs "-o async" feed_random install_sets if [[ -z $TZ ]]; then (cd /mnt/usr/share/zoneinfo ls -1dF $(tar cvf /dev/null [A-Za-y]*) >/mnt/tmp/tzlist ) echo set_timezone /mnt/tmp/tzlist rm -f /mnt/tmp/tzlist fi if _time=$(ftp_time) && _now=$(date +%s) && (( _now - _time > 120 || _time - _now > 120 )); then _tz=/mnt/usr/share/zoneinfo/$TZ ask_yn "Time appears wrong. Set to '$(TZ=$_tz date -r "$(ftp_time)")'?" yes if [[ $resp == y ]]; then date $(date -r "$(ftp_time)" "+%Y%m%d%H%M.%S") >/dev/null fi fi if [[ -s $SERVERLISTALL ]]; then _i= [[ -n $installedfrom ]] && _i="install=$installedfrom" [[ -n $TZ ]] && _i="$_i&TZ=$TZ" [[ -n $method ]] && _i="$_i&method=$method" [[ -n $_i ]] && ftp -Vao - \ "http://129.128.5.191/cgi-bin/ftpinstall.cgi?$_i" >/dev/null 2>&1 & fi sed "/^console.*on.*secure.*$/s/std\.[0-9]*/std.$(stty speed /tmp/ttys mv /tmp/ttys /mnt/etc/ttys echo -n "Saving configuration files..." (cd /var/db; [[ -f dhclient.leases ]] && mv dhclient.leases /mnt/var/db/. ) hostname >/tmp/myname if [[ -f /tmp/hosts ]]; then _dn=$(get_fqdn) while read _addr _hn _aliases; do if [[ -n $_aliases || $_hn != ${_hn%%.*} || -z $_dn ]]; then echo "$_addr\t$_hn $_aliases" else echo "$_addr\t$_hn.$_dn $_hn" fi done >/mnt/etc/hosts rm /tmp/hosts fi _f=dhclient.conf [[ -f /tmp/$_f ]] && { cat /tmp/$_f >>/mnt/etc/$_f ; rm /tmp/$_f ; } (cd /tmp; for _f in fstab hostname* kbdtype my* ttys *.conf *.tail; do [[ -f $_f && -s $_f ]] && mv $_f /mnt/etc/. done) apply if [[ -n $user ]]; then _encr=$(encr_pwd "$userpass") _home=/home/$user uline="${user}:${_encr}:1000:1000:staff:0:0:${username}:$_home:/bin/ksh" echo "$uline" >> /mnt/etc/master.passwd echo "${user}:*:1000:" >> /mnt/etc/group echo ${user} > /mnt/root/.forward _home=/mnt$_home mkdir -p $_home (cd /mnt/etc/skel; cp -pR . $_home) (umask 077 && sed "s,^To: root\$,To: ${username} <${user}>," \ /mnt/var/mail/root > /mnt/var/mail/$user ) chown -R 1000:1000 $_home /mnt/var/mail/$user echo "1,s@wheel:.:0:root\$@wheel:\*:0:root,${user}@ w q" | ed /mnt/etc/group 2>/dev/null [[ -n "$userkey" ]] && print -r -- "$userkey" >> $_home/.ssh/authorized_keys fi if [[ -n "$_rootpass" ]]; then _encr=$(encr_pwd "$_rootpass") echo "1,s@^root::@root:${_encr}:@ w q" | ed /mnt/etc/master.passwd 2>/dev/null fi /mnt/usr/sbin/pwd_mkdb -p -d /mnt/etc /etc/master.passwd [[ -n "$rootkey" ]] && ( umask 077 mkdir /mnt/root/.ssh print -r -- "$rootkey" >> /mnt/root/.ssh/authorized_keys ) if grep -qs '^rtsol' /mnt/etc/hostname.*; then sed -e "/^#\(net\.inet6\.ip6\.accept_rtadv\)/s//\1/" \ -e "/^#\(net\.inet6\.icmp6\.rediraccept\)/s//\1/" \ /mnt/etc/sysctl.conf >/tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf fi finish_up nt $_ifdev _lf=/var/db/dhclient.leases.$_ifdev _server=$(sed "/^ *next-server /!d;s///;s/;$//;q" $_lf) _mode=$(sed -E '/^ *filename "auto_(install|upgrade)";$/!d;s//\1/;q' \ $_lf) _mac=$(ifconfig $_ifdev | sed 's/.*lladdr \(.*\)/\1/p;d') hostname "$(sed -E '/^ *option host-name "(.*)";$/!d;s//\1/;q' $_lf)" if [[ -z $_server ]]; then echo "Could not determine next-server." elif [[ -z $_mode ]]; then echo "Could not determine auto mode." else for _f in {$_mac-,}$_mode; do ftp -o "/$_mode.conf" "http://$_server/$_f.conf" && action=$_mode && return 0 done fi return 1 } if ! $auto; then cat <<__EOT At any prompt except password prompts you can escape to a shell by typing '!'. Default answers are shown in []'s and are selected by pressing RETURN. You can exit this program at any time by pressing Control-C, but this can leave your system in an inconsistent state. __EOT elif [[ -z $respfile ]]; then if ! get_responsefile; then echo "No response file found; non-interactive mode aborted." exit 1 fi rm -f /ai.done echo "Performing non-interactive $action..." /$action -af /$action.conf 2>&1 >$_lf chmod 600 $_lf _lf=${_lf#/mnt} cat <<__EOT >>/mnt/etc/rc.firsttime ( /usr/bin/mail -s '$(hostname) $action log' root < $_lf && rm $_lf ) >/dev/null 2>&1 & __EOT exec reboot else echo "failed; check /ai.log" exit 1 fi else cp $respfile /ai.conf || exit fi set_term if [[ $MODE == install ]]; then ask_until "System hostname? (short form, e.g. 'foo')" "$(hostname -s)" [[ ${resp%%.*} != $(hostname -s) ]] && hostname $resp THESETS="$THESETS site$VERSION-$(hostname -s).tgz" echo donetconfig ((nifs != 0)) && startftplist echo while :; do askpassword "Password for root account?" _rootpass="$_password" [[ -n "$_password" ]] && break echo "The root password must be set." done rootkey= $auto && ask "Public ssh key for root account?" none && [[ $resp != none ]] && rootkey=$resp questions user_setup set_timezone /var/tzlist echo fi diskinfo() { local _d for _d; do makedev $_d echo -n "$_d: " disklabel -dpg $_d 2>/dev/null | sed -e '/^label: /{s,,,;s/ *$//;s/^$//;H;d;}' \ -e '/.*# total bytes: \(.*\)/{s//(\1)/;H;}' \ -e '$!d;x;s/\n/ /' rm -f /dev/{r,}$_d? done } while :; do echo "Available disks are: $(get_dkdevs | sed 's/^$/none/')." _ask "Which disk is the root disk? ('?' for details)" \ $(get_dkdevs | sed 's/ .*//') || continue case $resp in "?") diskinfo $(get_dkdevs);; '') ;; *) isin "$resp" $(get_dkdevs) && break echo "no such disk";; esac done makedev $resp || exit ROOTDISK=$resp ROOTDEV=${ROOTDISK}a SWAPDEV=${ROOTDISK}b usage() { echo "usage: ${0##*/} [-a] [-f filename]" >&2 exit 1 } auto=false respfile= while getopts "af:" opt; do case $opt in a) auto=true;; f) respfile=$OPTARG;; *) usage;; esac done shift $((OPTIND-1)) [ $# = 0 ] || usage . install.md set_term() { local _layouts export TERM=${TERM:-${MDTERM:-vt220}} if [[ -n $CONSOLE ]]; then ask "Terminal type?" $TERM export TERM=$resp else [[ -x /sbin/kbd ]] || return _layouts=$(bsort $(kbd -l | egrep -v "^(user|tables|encoding)")) while :; do ask "Choose your keyboard layout ('?' or 'L' for list)" "default" case $resp in "?"|L|l) echo "Available layouts: $_layouts";; default) return;; *) kbd $resp && { echo $resp >/tmp/kbdtype; return; };; esac done fi } stripcom () { local _l [[ -f $1 ]] || return set -o noglob while read _l; do [[ -n ${_l%%#*} ]] && echo $_l done <$1 set +o noglob } quote() ( for a; do alias Q=$a; a=$(alias Q); print -rn -- " ${a#Q=}" done | sed '1s/ //' echo ) tmpdir() { local _i=1 _dir until _dir="${1?}.$_i.$RANDOM" && mkdir -- "$_dir" 2>/dev/null; do ((++_i < 10000)) || return 1 done echo "$_dir" } scan_dmesg() { bsort $(sed -n "$1" /var/run/dmesg.boot) } scan_disknames() { local IFS=, bsort $(for _n in $(sysctl -n hw.disknames); do echo "${_n%%:*} "; done | sed -n "$1") } get_dkdevs () { echo $(scan_disknames "${MDDKDEVS:-/^[sw]d[0-9][0-9]* /s/ .*//p}") } get_cddevs () { echo $(scan_disknames "${MDCDDEVS:-/^cd[0-9][0-9]* /s/ .*//p}") } get_ifdevs() { ifconfig "$@" 2>/dev/null | egrep -v '^[[:space:]]|(bridge|enc|gif|gre|lo|pflog|pfsync|ppp|sl|tun)[[:digit:]]+:' | sed -n 's/^\(.*\):.*/\1/p' } get_drive() { ask_which "$1" "contains the $MODE media" "$2" "$3" [[ $resp == done ]] && return 1 makedev $resp || return 1 return 0 } mount_mnt2() { local _dev=$1 _opts _file=/tmp/parts.$1 _parts disklabel $_dev 2>/dev/null | sed -En '/swap|unused/d;/^ [a-p]: /p' >$_file _parts=$(sed 's/^ \(.\): .*/\1/' $_file) set -- $_parts (($# == 0)) && { echo "No filesystems found on $_dev."; return 1; } if isin "c" $_parts; then resp=c elif (($# == 1)); then resp=$1 else cat $_file ask_which "$_dev partition" "has the $MODE sets" \ '$(disklabel '$_dev' 2>/dev/null | sed -En '\''/swap|unused/d;/^ ([a-p]): .*/s//\1/p'\'')' [[ $resp == done ]] && return 1 fi grep -q "^ $resp: .*MSDOS" $_file && _opts="-s" mount -o ro,$_opts /dev/$_dev$resp /mnt2 } askpass() { stty -echo IFS= read -r resp?"$1 " stty echo echo } rm -df /tmp/lock lock() { while ! mkdir /tmp/lock 2>/dev/null && sleep .1; do done } unlock() { rm -d /tmp/lock 2>/dev/null } retrap() { trap 'kill -KILL $cppid 2>/dev/null; echo; stty echo; exit 0' \ INT EXIT TERM } rm -f /tmp/update if ! $auto; then ( while :; do lock if test -e /tmp/update && [[ "`dmesg`" != "`cat /tmp/update`" ]]; then dmesg >/tmp/update kill -TERM 2>/dev/null $$ || exit 1 fi unlock sleep .5 done ) |& cppid=$! retrap fi _ask() { local _q=$1 _def=$2 _int _redo=0 _pid lock; dmesg >/tmp/update; unlock echo -n "${_q:+$_q }${_def:+[$_def] }" _autorespond "$_q" "$_def" && echo "$resp" && return trap "_int=1" INT trap "_redo=1" TERM read resp lock; rm /tmp/update; unlock if ((_redo)); then stty raw stty -raw else case $resp in !) echo "Type 'exit' to return to install." sh _redo=1 ;; !*) eval "${resp#?}" _redo=1 ;; esac fi retrap ((_int)) && kill -INT $$ : ${resp:=$_def} return $_redo } _autorespond() { typeset -l _q=$1 _key local _def=$2 _l _val [[ -f $respfile ]] || return mv /ai.conf /ai.conf.tmp while IFS=' ' read -r _l; do [[ $_l == [!#=]*=?* ]] || continue _key=${_l%%*([[:blank:]])=*} _val=${_l##*([!=])=*([[:blank:]])} [[ $_q == @(|*[[:blank:]])"$_key"@([[:blank:]?]*|) ]] && resp=$_val && cat && return print -r " $_l" done /ai.conf [[ -n $_def ]] && resp=$_def && return echo "\nQuestion has no answer in response file." exit 1 } ask() { while ! _ask "$1" "$2"; do done } askpassword() { local _q=$1 if $auto; then echo -n "$_q " _autorespond "$_q" echo '' _password=$resp return fi while :; do askpass "$_q (will not echo)" _password=$resp askpass "$_q (again)" [[ $resp == "$_password" ]] && break echo "Passwords do not match, try again." done } encr_pwd() { local _p=$1 if [[ -z $_p ]]; then echo '*' elif [[ $_p == \$2?\$[0-9][0-9]\$* && ${#_p} > 40 || $_p == '*************' ]]; then echo "$_p" else /mnt/usr/bin/encrypt -b 8 -- "$_p" fi } user_setup() { local _q="Setup a user? (enter a lower-case loginname, or 'no')" while :; do ask "$_q" no case $resp in n|no) return;; y|yes) _q="No really, what is the lower-case loginname, or 'no'?" continue;; root|daemon|operator|bin|smmsp|popa3d) ;; sshd|uucp|www|named|proxy|nobody|ftp) ;; [a-z]*([a-z0-9_])) ((${#resp} <= 31)) && break;; esac echo "$resp is not a useable loginname." done user=$resp while :; do ask "Full name for user $user?" $user case $resp in *[:\&,]*) echo "':', '&' or ',' are not allowed.";; *) ((${#resp} <= 100)) && break echo "Too long.";; esac done username=$resp askpassword "Password for user $user?" userpass=$_password userkey= $auto && ask "Public ssh key for user $user" none && [[ $resp != none ]] && userkey=$resp if [[ $sshd == y ]]; then ask_yn "Since you set up a user, disable sshd(8) logins to root?" yes sshd_disableroot=$resp fi } function ask_until { resp= while true; do ask "$1" "$2" [[ -n $resp ]] && break echo "A response is required." $auto && exit 1 done } ask_yn() { local _q=$1 _a=${2:-no} typeset -l _resp while :; do ask "$_q" "$_a" _resp=$resp case $_resp in y|yes) resp=y; return 0;; n|no) resp=n; return 1;; esac echo "'$resp' is not a valid choice." $auto && exit 1 done } ask_which() { local _name=$1 _query=$2 _list=$3 _def=$4 _dynlist _dyndef _key _q _key=$(echo "$_name" | sed 's/[^[:alnum:]]/_/g') while :; do eval "_dynlist=\"$_list\"" eval "_dyndef=\"$_def\"" set -o noglob set -- $_dyndef; _dyndef="$1" set -- $_dynlist; _dynlist="$*" set +o noglob (($# < 1)) && resp=done && return : ${_dyndef:=$1} echo "Available ${_name}s are: $_dynlist." _q="Which $_name $_query?" echo -n "$_q (or 'done') ${_dyndef:+[$_dyndef] }" _autorespond "$_q" "${_dyndef-done}" && echo "$resp" \ || _ask || continue [[ -z $resp ]] && resp="$_dyndef" isin "$resp" $_dynlist done && break echo "'$resp' is not a valid choice." $auto && [[ -n $respfile ]] && exit 1 done } isin() { local _a=$1 _b shift for _b; do [[ $_a == $_b ]] && return 0 done return 1 } addel() { local _a=$1 shift echo -n "$*" isin "$_a" $* || echo -n " $_a" } rmel() { local _a=$1 _b shift for _b; do [[ $_a != $_b ]] && echo -n "$_b " done } bsort() { local _l _a=$1 _b (($# > 0)) || return shift for _b; do if [[ $_a != $_b ]]; then if [[ $_a > $_b ]]; then _l="$_a $_l"; _a=$_b else _l="$_b $_l" fi fi done echo -n "$_a " bsort $_l } showcols() { local _l _cdir=/tmp/cdir set -A _clist mkdir -p $_cdir rm -rf -- $_cdir/* while read _l; do [ "$_l" ] || continue mkdir -p /tmp/cdir/"$_l" _clist[${#_clist[*]}]="$_l" done (cd $_cdir; ls -Cdf "${_clist[@]}") rm -rf -- $_cdir } makedev() { [[ -z $(cd /dev && sh MAKEDEV "$@" 2>&1) ]] } addhostent() { local _addr=$1 _name=$2 _delim="." [[ -z $_addr || -z $_name ]] && return [[ $_addr == *:* ]] && _delim=":" sed "/^[0-9a-fA-F]*[$_delim].*[ ]$_name\$/d" /tmp/hosts \ >/tmp/hosts.new 2>/dev/null mv /tmp/hosts.new /tmp/hosts echo "$_addr $_name" >>/tmp/hosts } select_sets() { local _avail=$1 _selected=$2 _f _action _col=$COLUMNS local _comp=comp${VERSION}.tgz _xbase=xbase${VERSION}.tgz let COLUMNS=_col-8 cat <<__EOT Select sets by entering a set name, a file name pattern or 'all'. De-select sets by prepending a '-' to the set name, file name pattern or 'all'. Selected sets are labelled '[X]'. __EOT while :; do for _f in $_avail; do isin $_f $_selected && echo "[X] $_f" || echo "[ ] $_f" done | showcols | sed 's/^/ /' ask "Set name(s)? (or 'abort' or 'done')" done set -o noglob for resp in $resp; do case $resp in abort) _selected=; break 2;; done) break 2;; -*) _action=rmel;; *) _action=addel;; esac resp=${resp#[+-]} [[ $resp = all ]] && resp=* for _f in $_avail; do [[ $_f = $resp ]] && _selected=$($_action $_f $_selected) done done if isin $_xbase $_selected && ! isin $_comp $_selected && isin $_comp $_avail; then _selected=$(addel $_comp $_selected) echo "The xbase set requires the comp set, so adding it back in." fi done set +o noglob COLUMNS=$_col resp=$_selected } configure_ifs() { local _first _ifdevs _ifs _name _hn _vl=0 _vd _vi _p _tags while :; do _vd=$(ifconfig vlan$_vl 2>&1) [[ $_vd == @(*no such interface*) ]] && break [[ $_vd == @(vlan$_vl: flags=0<>*) ]] && break ((_vl++)) done _vd= ifconfig lo0 inet 127.0.0.1/8 while :; do ifconfig vlan$_vl create >/dev/null 2>&1 ask_which "network interface" "do you wish to configure" \ '$(get_ifdevs)' \ ${_p:-'$( (get_ifdevs netboot; get_ifdevs) | sed q )'} [[ $resp == done ]] && break _ifs=$resp _hn=/tmp/hostname.$_ifs rm -f $_hn if [[ $_ifs == vlan[0-9]* ]]; then _vi=$(ifconfig $_ifs 2>/dev/null | sed -n 's/vlan: \([0-9]*\).*/\1/p') _tags=$(ifconfig vlan 2>/dev/null | sed -n 's/vlan: \([0-9]*\).*/\1/p') [[ -n $_tags ]] && _tags=$(rmel "$_vi" $_tags) if [[ -z $_vi ]]; then _vi=0 while ((++_vi < 4096)); do ! isin "$_vi" $_tags && break done fi _ifdevs=$(get_ifdevs) set -- $_ifdevs while [[ $1 == vlan[0-9]* ]]; do shift done ask "Which interface:tag should $_ifs be on?" "${_vd:=$1}:$_vi" _vd=${resp%%:*} _vi=${resp##*:} if ! (isin "$_vd" $_ifdevs && [[ $_vd != vlan[0-9]* ]]); then echo "Invalid interface choice '$_vd'" _vd= continue fi if ((_vi < 1 || _vi > 4095)) || isin "$_vi" $_tags; then echo "Invalid or in-use vlan tag '$_vi'" continue fi grep -qs "^up" /tmp/hostname.$_vd || echo "up" >>/tmp/hostname.$_vd chmod 640 /tmp/hostname.$_vd ifconfig $_vd up ifconfig $_ifs destroy >/dev/null 2>&1 ifconfig $_ifs vlan $_vi vlandev $_vd echo "vlan $_vi vlandev $_vd" >>$_hn [[ ${_ifs##vlan} == $_vl ]] && ((_vl++)) fi ifconfig $_ifs 2>/dev/null | grep -q "^[[:space:]]*ieee80211:" && ieee80211_config $_ifs $_hn resp=$(hostname -s) [[ -n $_first && $_first != $_ifs ]] && ask "Symbolic (host) name for $_ifs?" $resp _name=$resp v4_config $_ifs $_name $_hn v6_config $_ifs $_name $_hn if [[ -f $_hn ]]; then chmod 640 $_hn ((nifs++)) : ${_first:=$_ifs} _p=done fi done } v4_info() { ifconfig $1 inet | sed -n ' 1s/.*/dev/null /sbin/dhclient "$@" } dhcp_request() { local _ifs=$1 _hn=$2 echo "lookup file bind" >/etc/resolv.conf.tail if [[ -n $_hn ]]; then _hn="send host-name \"$_hn\";" echo "Issuing hostname-associated DHCP request for $_ifs." else echo "Issuing free-roaming DHCP request for $_ifs." fi cat >/etc/dhclient.conf <<__EOT initial-interval 1; $_hn request subnet-mask, broadcast-address, routers, domain-name, domain-name-servers, host-name; __EOT ifconfig $_ifs group dhcp >/dev/null 2>&1 dhclient $_ifs set -- $(v4_info $_ifs) if [[ $1 == UP && -n $2 ]]; then mv /etc/dhclient.conf /tmp/dhclient.conf mv /etc/resolv.conf.tail /tmp/resolv.conf.tail return 0 fi ifconfig $_ifs delete down -group dhcp 2>/dev/null rm /etc/dhclient.conf /etc/resolv.conf.tail return 1 } hextodec() { local _d _b for _b in $(echo ${1#0x} | sed 's/\(..\)/\1 /g'); do _d=$_d.$((0x$_b)) done echo ${_d#.} } ieee80211_scan() { [[ -f $WLANLIST ]] || ifconfig $1 scan | sed -n 's/^ nwid \([^"]\)/\1/p' >$WLANLIST cat $WLANLIST } ieee80211_config() { local _ifs=$1 _hn=$2 _prompt _nwid _haswpa=0 _err ifconfig $_ifs -nwid -nwkey ifconfig $_ifs -wpa 2>/dev/null && _haswpa=1 rm -f $WLANLIST while [[ -z $_nwid ]]; do ask_until "Access point? (ESSID, 'any', list# or '?')" "any" case "$resp" in +([0-9])) _nwid=$(ieee80211_scan $_ifs | sed -n "${resp}s/ .*//p") [[ -z $_nwid ]] && echo "There is no line $resp." ;; \?) ieee80211_scan $_ifs | sed -n 's/^\([^ ]*\) chan .* bssid \([^ ]*\) .*$/ \1 (\2)/p' | less -XEN ;; *) _nwid=$resp;; esac done if [[ $_nwid != any ]]; then ifconfig $_ifs nwid "$_nwid" quote nwid "$_nwid" >>$_hn _prompt="Security protocol? (O)pen, (W)EP" ((_haswpa == 1)) && _prompt="$_prompt, WPA-(P)SK" while :; do ask_until "$_prompt" "O" case "$_haswpa-$resp" in ?-[Oo]) break ;; ?-[Ww]) ask_until "WEP key? (will echo)" if _err=$(ifconfig $_ifs nwkey "$resp" 2>&1) && [[ -z $_err ]]; then quote nwkey "$resp" >>$_hn break fi echo "$_err" ;; 1-[Pp]) ask_until "WPA passphrase? (will echo)" if ifconfig $_ifs wpakey "$resp"; then quote wpakey "$resp" >>$_hn break fi ;; *) echo "'$resp' is not a valid choice." ;; esac done fi } v4_config() { local _ifs=$1 _name=$2 _hn=$3 _prompt _addr _mask if ifconfig $_ifs | grep -q 'groups:.* dhcp'; then _addr=dhcp else set -- $(v4_info $_ifs) if [[ -n $2 ]]; then _addr=$2; _mask=$(hextodec $3) ifconfig $_ifs inet $_addr delete fi fi if [[ -x /sbin/dhclient ]]; then _prompt="or 'dhcp' " ifconfig dhcp >/dev/null 2>&1 || _addr=dhcp fi _prompt="IPv4 address for $_ifs? (${_prompt}or 'none')" ask_until "$_prompt" "$_addr" case $resp in none) ;; dhcp) if [[ ! -x /sbin/dhclient ]]; then echo "DHCP not possible - no /sbin/dhclient." elif dhcp_request $_ifs "$_name" || dhcp_request $_ifs; then echo "dhcp" >>$_hn fi ;; *) _addr=$resp ask_until "Netmask?" "${_mask:=255.255.255.0}" ifconfig $_ifs -group dhcp >/dev/null 2>&1 if ifconfig $_ifs inet $_addr netmask $resp up; then addhostent "$_addr" "$_name" echo "inet $_addr $resp" >>$_hn fi ;; esac } v6_config() { local _ifs=$1 _name=$2 _hn=$3 _addr _prefixlen _prompt ifconfig lo0 inet6 >/dev/null 2>&1 || return set -- $(v6_info $_ifs) [[ -n $2 ]] && { _addr=$2; _prefixlen=$3; } [[ -x /sbin/rtsol ]] && _prompt="or 'rtsol' " _prompt="IPv6 address for $_ifs? (${_prompt}or 'none')" ask_until "$_prompt" "${_addr:-none}" case $resp in none) return ;; rtsol) [[ ! -x /sbin/rtsol ]] && { echo "No /sbin/rtsol."; return; } ifconfig $_ifs up if rtsol -F $_ifs; then echo "up\nrtsol" >>$_hn fi return ;; esac _addr=$resp ask_until "IPv6 prefix length for $_ifs?" "${_prefixlen:=64}" ifconfig $_ifs inet6 $_addr prefixlen $resp up || return echo "inet6 $_addr $resp" >>$_hn addhostent "$_addr" "$_name" v6_defroute $_ifs } v4_defroute() { local _dr _prompt=" or 'none'" [[ -n $(ifconfig | sed -n '/[ ]inet .* broadcast /p') ]] || return [[ -f /tmp/dhclient.conf && $nifs == 1 ]] && return [[ -x /sbin/dhclient ]] && _prompt=", 'dhcp'$_prompt" _prompt="Default IPv4 route? (IPv4 address$_prompt)" _dr=$(route -n show -inet | sed -n '/^default */{s///; s/ .*//; p;}') [[ -f /tmp/dhclient.conf ]] && _dr=dhcp while :; do ask_until "$_prompt" "$_dr" [[ $resp == @(none|dhcp) ]] && break route delete -inet default >/dev/null 2>&1 route -n add -inet -host default "$resp" && { echo "$resp" >/tmp/mygate; break; } route -n add -inet -host default $_dr >/dev/null 2>&1 done } v6_defroute() { local _if=$1 _resp _routers route -n show -inet6 | egrep -q '^default[[:space:]]' && return _routers=$(bsort $(ping6 -n -c 2 ff02::2%$_if 2>/dev/null | sed -n '/bytes from/{s/^.*from //;s/,.*$//;p;}' | sed -n 'G;s/\n/&&/;/^\(.*\n\).*\n\1/d;h;P')) local PS3="IPv6 default router? (${_routers:+list #, }IPv6 address or 'none'): " select _resp in $_routers; do [[ ${_resp:=$REPLY} == *:* ]] && break [[ $_resp == none ]] && return done route -n add -inet6 -host default "$_resp" && echo "$_resp" >>/tmp/mygate } enable_network() { local _f _gw for _f in dhclient.conf resolv.conf resolv.conf.tail; do if [ -f /mnt/etc/$_f ]; then cp /mnt/etc/$_f /etc/$_f fi done ifconfig lo0 inet 127.0.0.1/8 for hn in /mnt/etc/hostname.*; do ((nifs++)) if=${hn#/mnt/etc/hostname.} (ifconfig $if||ifconfig $if create) >/dev/null 2>&1 || continue while :; do if [ "$cmd2" ]; then set -- $cmd2 af=$1 name=$2 mask=$3 bcaddr=$4 ext1=$5 cmd2= i=1 while [ i -lt 6 -a -n "$1" ]; do shift; let i=i+1; done ext2="$@" else read af name mask bcaddr ext1 ext2 || break fi case "$af" in "#"*|"!"*|"bridge"|"") continue ;; "dhcp") [ "$name" = "NONE" ] && name= [ "$mask" = "NONE" ] && mask= [ "$bcaddr" = "NONE" ] && bcaddr= dhcpif="$dhcpif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 down" if [[ -x /sbin/dhclient ]]; then cmd="$cmd; dhclient $if" else cmd="$cmd; echo /sbin/dhclient missing - skipping dhcp request." fi ;; "rtsol") rtsolif="$rtsolif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" ;; *) read dt dtaddr if [ "$name" = "alias" ]; then alias=$name name=$mask mask=$bcaddr bcaddr=$ext1 ext1=$ext2 ext2= else alias= fi cmd="ifconfig $if $af $alias $name" case "$dt" in dest) cmd="$cmd $dtaddr" ;; *) cmd2="$dt $dtaddr" ;; esac case $af in inet) if [ ! -n "$name" ]; then echo "/etc/hostname.$if: inet alone is invalid" return fi [ "$mask" ] && cmd="$cmd netmask $mask" if [ "$bcaddr" -a X"$bcaddr" != "XNONE" ]; then cmd="$cmd broadcast $bcaddr" fi [ "$alias" ] && rtcmd=";route -qn add -host $name 127.0.0.1" ;; inet6) if [ ! -n "$name" ]; then echo "/etc/hostname.$if: inet6 alone is invalid" return fi [ "$mask" ] && cmd="$cmd prefixlen $mask" cmd="$cmd $bcaddr" ;; *) cmd="$cmd $mask $bcaddr" ;; esac cmd="$cmd $ext1 $ext2$rtcmd" rtcmd= ;; esac eval "$cmd" done /dev/null 2>&1 route -qn add -host default $_gw && break done [[ -z $rtsolif ]] && stripcom /mnt/etc/mygate | while read _gw; do [[ $_gw == !(*:*) ]] && continue route -qn delete -inet6 default >/dev/null 2>&1 route -qn add -host -inet6 default $_gw && break done route -qn add -net 127 127.0.0.1 -reject >/dev/null } install_files() { local _src=$1 _files=$2 _f _sets _get_sets _n _col=$COLUMNS \ _tmpfs _tmpsrc _cfile _fsrc _unver _t _issue _srclocal _size for _f in $THESETS; do isin $_f $_files || continue; _sets=$(addel $_f $_sets) if [[ -z $DISPLAY && ! -d /mnt/etc/X11 ]]; then isin ${_f%${VERSION}.tgz} xbase xetc xshare xfont xserv && continue fi isin $_f $DEFAULTSETS "site$VERSION-$(hostname -s).tgz" && _get_sets=$(addel $_f $_get_sets) done if [[ -z $_sets ]]; then echo -n "Looked at " echo $_src | sed 's/\(^ftp:\/\/[^/]*\)\(:[^/]*\)\(@.*\)/\1\3/' echo "and found no $OBSD sets. The set names looked for were:" let COLUMNS=_col-8 for _n in $THESETS; do echo $_n; done | showcols | sed 's/^/ /' COLUMNS=$_col $auto && exit 1 echo return fi isin INSTALL.$ARCH $_files || ask_yn "INSTALL.$ARCH not found. Use sets found here anyway?" || return select_sets "$_sets" "$_get_sets" [[ -n $resp ]] || return _get_sets=$resp _get_sets=$(for s in $THESETS; do isin $s $_get_sets && echo $s; done) _size=$( ( [[ $_src == file://* ]] && ls -lT "${_src#file://}" || ftp -V -o - "$_src/index.txt" 2>/dev/null ) | ( sum=0 while read x x x x s x x x f2 f && : ${f:=$f2}; do isin $f $_get_sets && let sum+=s done; echo $sum ) ) _size=$((${_size:-536870912} / 1024)) _unver=$_get_sets for _issue in ''; do ! isin SHA256.sig $_files && _issue="Directory does not contain SHA256.sig" && break _tmpfs=$( ( for fs in /mnt/{{,var/}tmp,home,usr{/local,}}; do df -k $fs 2>/dev/null | grep " $fs\$" done df -k ) | ( while read a a a a m m; do [[ $m == /mnt/@(@(|var/)tmp|home|usr/@(src,obj,xobj))@(|/*) ]] && ((a > _size + 10240)) && echo $m && exit [[ $m == /mnt@(|/*) ]] && ((a > _size * 4)) && echo $m && exit done ) ) if [[ -d $_tmpfs ]]; then ! _tmpsrc=$(tmpdir "$_tmpfs/sets") && _issue="Cannot create prefetch area" && break else _issue="Cannot determine prefetch area" && break fi _cfile=$_tmpsrc/SHA256 _srclocal=false _t=Get/Verify [[ $_src == file://* ]] && _srclocal=true _t='Verifying ' ! ftp -D "$_t" -Vmo "$_cfile.sig" "$_src/SHA256.sig" && _issue="Cannot fetch SHA256.sig" && break ! signify -Vep /etc/signify/openbsd-${VERSION}-base.pub \ -x "$_cfile.sig" -m "$_cfile" && _issue="Signature check of SHA256.sig failed" && break for _f in $_get_sets; do rm -f "$_tmpsrc/h" "$_tmpsrc/fail" ( ftp -D "$_t" -Vmo - "$_src/$_f" || >"$_tmpsrc/fail" ) | ( $_srclocal && sha256 >$_tmpsrc/h || sha256 -ph "$_tmpsrc/h" >"$_tmpsrc/$_f" ) if [[ -f $_tmpsrc/fail ]]; then rm -f "$_tmpsrc/$_f" if ! ask_yn "Fetching of $_f failed. Continue anyway?"; then [[ -d $_tmpsrc ]] && rm -rf "$_tmpsrc" $auto && exit 1 return fi continue fi if fgrep -qx "SHA256 ($_f) = $(<$_tmpsrc/h)" "$_cfile"; then _unver=$(rmel $_f $_unver) else if ! ask_yn "Checksum test for $_f failed. Continue anyway?"; then [[ -d $_tmpsrc ]] && rm -rf "$_tmpsrc" $auto && exit 1 return fi fi done done [[ -n $_unver ]] && : ${_issue:="Unverified sets:" ${_unver% }} if [[ -n $_issue ]] && ! ask_yn "$_issue. Continue without verification?"; then [[ -d $_tmpsrc ]] && rm -rf "$_tmpsrc" $auto && exit 1 return fi for _f in $_get_sets; do _fsrc="$_src/$_f" [[ -f $_tmpsrc/$_f ]] && _fsrc="file://$_tmpsrc/$_f" case $_fsrc in *.tgz) ftp -D Installing -Vmo - "$_fsrc" | tar -zxphf - -C /mnt;; *) ftp -D Installing -Vmo "/mnt/$_f" "$_fsrc";; esac if (($?)); then if ! ask_yn "Installation of $_f failed. Continue anyway?"; then [[ -d $_tmpsrc ]] && rm -rf "$_tmpsrc" $auto && exit 1 return fi else DEFAULTSETS=$(rmel $_f $DEFAULTSETS) GOTSETS="$GOTSETS $_f" fi [[ -d $_tmpsrc ]] && rm -f "$_tmpsrc/$_f" done [[ -d $_tmpsrc ]] && rm -rf "$_tmpsrc" } encode_for_url() { echo "$1" | sed " s/%/%25/g s/ /%20/g s/!/%21/g s/\"/%22/g s/#/%23/g s/\\\$/%24/g s/&/%26/g s/'/%27/g s/(/%28/g s/)/%29/g s/\*/%2a/g s/+/%2b/g s/,/%2c/g s/-/%2d/g s/\./%2e/g s/\//%2f/g s/:/%3a/g s/;/%3b/g s//%3e/g s/?/%3f/g s/@/%40/g s/\[/%5b/g s/\\\\/%5c/g s/]/%5d/g s/\^/%5e/g s/_/%5f/g s/\`/%60/g s/{/%7b/g s/|/%7c/g s/}/%7d/g s/~/%7e/g " } ftp_error() { if [[ -n $(echo "$2" | grep "$1") ]]; then echo $1 return 0 fi return 1 } startftplist() { ((nifs < 1)) && return set -m ( ftp -Vao - "http://129.128.5.191/cgi-bin/ftplist.cgi?path=$FTPSETDIR" \ 2>/tmp/ftplisterr >$SERVERLISTALL echo -n $SECONDS >$SERVERLISTSEC feed_random ) & ftppid=$! set +m (sleep 12; kill -INT -$ftppid >/dev/null 2>&1) & } waitftplist() { wait "$ftppid" 2>/dev/null } ftp_time() { local _ftplist_sec=$(cat $SERVERLISTSEC 2>/dev/null) local _time=$(sed '/^TIME=\([0-9]*\)$/!d;s//\1/;q' $SERVERLISTALL 2>/dev/null) [[ -n $_ftplist_sec && -n $_time ]] && echo $((_time + SECONDS - _ftplist_sec)) } install_url() { local _url_type=$1 _file_list _url_base _prompt _passwd _mirror eval local _server_ip=\$_${_url_type}_server_ip \ _server_dir=\$_${_url_type}_server_dir waitftplist ask "HTTP/FTP proxy URL? (e.g. 'http://proxy:8080', or 'none')" \ "${ftp_proxy:-none}" unset ftp_proxy http_proxy [[ $resp == none ]] || export ftp_proxy=$resp http_proxy=$resp if [[ -s $SERVERLISTALL ]]; then _prompt="Server? (hostname, list#, 'done' or '?')" sed -n "s,^${_url_type}://"'\([[A-Za-z0-9\:_][]A-Za-z0-9:._-]*\),\1,p' \ $SERVERLISTALL >$SERVERLIST set -- $(sed q $SERVERLIST) _server_ip=${1%%/*} else echo "(Was not able to get ftplist from ftp.openbsd.org, but that is OK)" _prompt="Server? (hostname or 'done')" fi while :; do ask_until "$_prompt" "$_server_ip" case $resp in done) return;; "?") [[ -s $SERVERLIST ]] || continue less -XEN < $SERVERLIST ;; +([0-9])) [[ -s $SERVERLIST ]] || continue set -- $(sed -n "${resp}p" $SERVERLIST) (($# < 1)) && { echo "There is no line $resp."; continue; } _server_ip=${1%%/*} ;; +([A-Za-z0-9\:.\[\]_-])) _server_ip=$resp break ;; *) echo "'$resp' is not a valid hostname." ;; esac done eval _${_url_type}_server_ip=$_server_ip set -- $(sed "/^$_server_ip/x;\$!d;x" $SERVERLIST 2>/dev/null) resp=${1#*/} [[ $resp == "$1" ]] && resp= if (($# > 1)); then resp=$resp/$FTPSETDIR _mirror=yes fi ask_until "Server directory?" "${resp:-pub/OpenBSD/$FTPSETDIR}" _server_dir=$resp eval _${_url_type}_server_dir=$_server_dir if [[ $_url_type == ftp ]]; then IFS= ask_until "Login?" "${_ftp_server_login:=anonymous}" _ftp_server_login=$resp if [[ $_ftp_server_login == @(anonymous|ftp) ]]; then _passwd=root@`hostname` else resp= while [[ -z $resp ]]; do askpass "Password? (will not echo)" done _passwd=$resp fi fi _url_base=$_url_type:// if [[ $_url_type == ftp && $_ftp_server_login != anonymous ]]; then _url_base=$_url_base$(encode_for_url "$_ftp_server_login"):$(encode_for_url "$_passwd")@ fi _url_base=$_url_base$_server_ip/$_server_dir if [[ $_url_type == ftp && -z $ftp_proxy ]]; then _file_list=$(ftp -V "$_url_base/") ftp_error "Login failed." "$_file_list" && return ftp_error "No such file or directory." "$_file_list" && return else _file_list=$(ftp -Vo - "$_url_base/index.txt" | sed 's/^.* //' | sed 's/ //') fi install_files "$_url_base" "$_file_list" installedfrom=$_url_type://$_server_ip/$_server_dir if [[ -n $_mirror ]]; then PACKAGE_PATH=$(print -r -- "$installedfrom" | sed -E "/\/(snapshots|[0-9]\.[0-9])\/($ARCH)\/*$/!d s!!/\1/packages/$(arch -s)/!;q") else PACKAGE_PATH= fi } install_mounted_fs() { local _dir while :; do ask_until "Pathname to the sets? (or 'done')" "$SETDIR" [[ $resp == done ]] && return [[ -d /mnt2/$resp ]] && { _dir=/mnt2/$resp; break; } [[ -d /mnt/$resp ]] && { _dir=/mnt/$resp; break; } [[ -d /$resp ]] && { _dir=/$resp; break; } echo "The directory '$resp' does not exist." done install_files "file://$_dir" "$(ls $_dir/)" } install_cdrom() { get_drive "CD-ROM" '$(get_cddevs)' || return mount_mnt2 $resp || return install_mounted_fs } install_disk() { ask_yn "Is the disk partition already mounted?" if [[ $resp == n ]]; then get_drive "disk" '$(bsort $(get_dkdevs))' \ '$(bsort $(rmel $ROOTDISK $(get_dkdevs)))' || return mount_mnt2 $resp || return fi install_mounted_fs } install_nfs() { local _tcp ask_until "Server IP address or hostname?" "$NFS_ADDR" NFS_ADDR=$resp ask_until "Filesystem on server to mount?" "$NFS_PATH" NFS_PATH=$resp ask_yn "Use TCP transport? (requires TCP-capable NFS server)" [[ $resp == y ]] && _tcp=-T mount_nfs $_tcp -o ro -R 5 $NFS_ADDR:$NFS_PATH /mnt2 || return install_mounted_fs } install_tape() { local _z _bs get_drive "tape drive" '$MTDEVS' || return export TAPE=/dev/nr$resp if [[ ! -c $TAPE ]]; then echo "$TAPE is not a character special file." return fi echo -n "Rewinding $TAPE (mt rewind)..." mt rewind || return echo "done." while :; do ask_until "Skip how many files? (or 'done')" 0 [[ $resp == done ]] && return [[ $resp == +([0-9]) ]] || continue if (($resp > 0)); then echo -n "Skipping $resp file(s)..." mt fsf $resp || return echo "done." elif [[ -n $_bs ]]; then mt bsf; mt fsf fi unset _z ask_yn "Is the file gzipped?" yes [[ $resp == y ]] && _z=z [[ $_z == z ]] || _bs=10240 ask_until "Blocksize for this file?" "${_bs:-8k}" [[ $resp == done ]] && return _bs=$resp dd if=$TAPE bs=$_bs | tar ${_z}xvphf - -C /mnt || return done } set_timezone() { local _zonefile=$1 _zonepath _zsed _tz _zoneroot=/usr/share/zoneinfo [[ ! -f $_zonefile ]] && return [[ -n $TZ ]] && return if [[ -h /mnt/etc/localtime ]]; then TZ=$(ls -l /mnt/etc/localtime 2>/dev/null) TZ=${TZ#*${_zoneroot#/mnt}/} fi waitftplist if [[ -s $SERVERLISTALL ]]; then _tz=$(sed -n '/^TZ=/s/TZ=//p' <$SERVERLISTALL) [[ -n $_tz ]] && isin "$_tz" `cat $_zonefile` && TZ=$_tz fi [[ $_zonefile = /var/tzlist && -z $TZ ]] && return while :; do ask "What timezone are you in? ('?' for list)" "$TZ" _zonepath=${resp%%*(/)} case $_zonepath in "") continue;; "?") grep -v /. $_zonefile | showcols continue;; esac while isin "$_zonepath/" $(cat $_zonefile); do ask "What sub-timezone of '$_zonepath' are you in? ('?' for list)" _zsed=$(echo $_zonepath/ | sed 's,/,\\/,g') resp=${resp%%*(/)} case $resp in "") ;; "?") sed -n "/^$_zsed/{s/$_zsed//;/\/./!p;}" $_zonefile | showcols;; *) _zonepath=$_zonepath/$resp;; esac done if isin "$_zonepath" $(cat $_zonefile); then TZ=${_zonepath#$_zoneroot} return fi echo -n "'${_zonepath}'" echo " is not a valid timezone on this system." done } sane_install() { local _q=$1 _s for _s in $SANESETS; do isin $_s $DEFAULTSETS || continue [[ -z $_q ]] && ask_yn "Are you *SURE* your $MODE is complete without '$_s'?" || return done } install_sets() { local _d _locs="disk ftp http" echo [[ -s $SERVERLISTALL ]] && _d=$(sed -n '/^method=/s/method=//p' $SERVERLISTALL) ifconfig netboot >/dev/null 2>&1 && : ${_d:=http} [[ -n $(get_cddevs) ]] && { _locs="cd $_locs"; : ${_d:=cd}; } [[ -x /sbin/mount_nfs ]] && _locs="$_locs nfs" [[ -n $MTDEVS && -x /bin/mt ]] && _locs="$_locs tape" : ${_d:=http} if ! isin "$_d" $_locs; then for a in http ftp cd nfs tape disk; do isin $a $_locs && _d=$a && break done fi echo "Let's $MODE the sets!" while :; do umount -f /mnt2 >/dev/null 2>&1 [[ -n $method ]] && _d=$method sane_install quiet && _d=done ask "Location of sets? ($_locs or 'done')" "$_d" case $resp in done) sane_install && return;; c*|C*) isin cd $_locs && install_cdrom && method=cd;; d*|D*) install_disk && method=disk;; f*|F*) isin ftp $_locs && install_url ftp && method=ftp;; h*|H*) isin http $_locs && install_url http && method=http;; n*|N*) isin nfs $_locs && install_nfs && method=nfs;; t*|T*) isin tape $_locs && install_tape && method=tape;; esac $auto && break done } update_firmware() { echo "/usr/sbin/fw_update -v" >>/mnt/etc/rc.firsttime } munge_fstab() { local _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do [[ $_dev == @(/dev/vnd*|\#*) || $_fstype == nfs || ! -f /sbin/mount_$_fstype || $_opt == *noauto* || $_opt == *xx* ]] && continue _opt=$(echo $_opt | sed 's/softdep//') [[ $_fstype == ffs ]] && _opt=$(echo $_opt | sed 's/ro/rw/') [[ $_fstype == ffs ]] || _opt=$(echo $_opt | sed 's/rw/ro/') echo $_dev /mnt${_mp%/} $_fstype $_opt $_rest done /etc/fstab if [ ! -s /etc/fstab ]; then echo "Unable to create valid /etc/fstab." exit fi } mount_fs() { local _async=$1 _dev _mp _fstype _opt _rest _msg _fail while read _dev _mp _fstype _opt _rest; do [ "$_mp" = "/mnt" ] || mkdir -p $_mp _msg=$(mount -v -t $_fstype $_async -o $_opt $_dev $_mp) || _fail="$_fail\n$_mp ($_dev)" echo $_msg | sed 's/, ctime=[^,)]*//' done 0)) || continue echo -n "fsck -${_f}p $_dev..." if ! fsck -${_f}p $_dev >/dev/null 2>&1; then echo "FAILED. You must fsck $_dev manually." _fail=y else echo "OK." fi done /tmp/resolv.conf for _ns in $resp; do echo "nameserver $_ns" >>/tmp/resolv.conf done cp /tmp/resolv.conf /tmp/resolv.conf.shadow fi } populateusrlocal() { if [ -f /mnt/etc/mtree/BSD.local.dist ]; then /mnt/usr/sbin/chroot /mnt /usr/sbin/mtree -Uedqn -p /usr/local -f /etc/mtree/BSD.local.dist >/dev/null fi } apply() { if [[ $sshd == n ]]; then echo "sshd_flags=NO # disabled during install" \ >>/mnt/etc/rc.conf.local fi if [[ $sshd_disableroot == y ]]; then sed "/^#\(PermitRootLogin\) yes/s//\1 no/" \ < /mnt/etc/ssh/sshd_config >/tmp/sshd_config cp /tmp/sshd_config /mnt/etc/ssh/sshd_config fi if [[ $ntpd == y ]]; then echo "ntpd_flags= # enabled during install" \ >>/mnt/etc/rc.conf.local if [[ $ntpd_server != default ]]; then set -- $ntpd_server sed "s/^servers /#&/;/#server /a\\ servers $1 " /mnt/etc/ntpd.conf >/tmp/ntpd.conf cp /tmp/ntpd.conf /mnt/etc/ntpd.conf fi fi if [[ $x11 == y ]]; then sed "/^#\(machdep\.allowaperture=${MDXAPERTURE}\)/s//\1 /" \ /mnt/etc/sysctl.conf >/tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf fi if [[ $xdm == y && -x /mnt/usr/X11R6/bin/xdm ]]; then echo "xdm_flags= # enabled during install" \ >>/mnt/etc/rc.conf.local fi if [[ $defcons == y ]]; then cp /mnt/etc/ttys /tmp/ttys sed -e "/^$CTTY/s/std.9600/std.${CSPEED}/" \ -e "/^$CTTY/s/unknown/vt220 /" \ -e "/$CTTY/s/off.*/on secure/" /tmp/ttys >/mnt/etc/ttys [[ -n $CPROM ]] && echo "stty $CPROM $CSPEED\nset tty $CPROM" >>/mnt/etc/boot.conf fi ln -sf /usr/share/zoneinfo/$TZ /mnt/etc/localtime } questions() { local _d _xdmask=y _def ask_yn "Start sshd(8) by default?" yes sshd=$resp ask_yn "Start ntpd(8) by default?" ntpd=$resp if [[ $resp == y ]]; then ask "NTP server? (hostname or 'default')" default ntpd_server=$resp fi def=no [[ -n $DISPLAY ]] && def=yes if [[ -n $MDXAPERTURE ]]; then ask_yn "Do you expect to run the X Window System?" $def x11=$resp _xdmask=$resp fi if [[ -n $MDXDM && $_xdmask == y ]]; then ask_yn "Do you want the X Window System to be started by xdm(1)?" xdm=$resp fi if [[ -n $CDEV ]]; then _d=${CPROM:-$CDEV} ask_yn "Change the default console to $_d?" defcons=$resp if [[ $resp == y ]]; then ask_which "speed" "should $_d use" \ "9600 19200 38400 57600 115200" $CSPEED case $resp in done) defcons=n;; *) CSPEED=$resp;; esac fi fi } upgrade_to64time_t() { /mnt/usr/sbin/pwd_mkdb -d /mnt/etc master.passwd >/mnt/var/log/lastlog >/mnt/var/run/utmp } feed_random() { { (dmesg; cat $SERVERLISTALL /*.conf; sysctl; route -n show; df; ifconfig -A; hostname) >/dev/random 2>&1 dd if=/mnt/var/db/host.random of=/dev/random bs=65536 count=1 } >/dev/null 2>&1 } store_random() { { dd if=/dev/random of=/mnt/var/db/host.random bs=65536 count=1 dd if=/dev/random of=/mnt/etc/random.seed bs=512 count=1 chmod 600 /mnt/var/db/host.random /mnt/etc/random.seed } >/dev/null 2>&1 } finish_up() { local _dev _mp _fstype _rest if [[ -x /mnt/sbin/swapctl ]]; then /mnt/sbin/swapctl -a /dev/$SWAPDEV >/dev/null 2>&1 while read _dev _mp _fstype _rest; do [[ $_fstype == swap ]] && /mnt/sbin/swapctl -a $_dev >/dev/null 2>&1 done $/\1/p') md_installboot $ROOTDISK if [[ -f /mnt/bsd.mp ]] && ((NCPU > 1)); then echo "Multiprocessor machine; using bsd.mp instead of bsd." mv /mnt/bsd /mnt/bsd.sp 2>/dev/null mv /mnt/bsd.mp /mnt/bsd fi update_firmware upgrade_to64time_t store_random cat <<__EOT CONGRATULATIONS! Your OpenBSD $MODE has been successfully completed! To boot the new system, enter 'reboot' at the command prompt. __EOT [[ $MODE == install ]] && cat <<__EOT When you login to your new system the first time, please read your mail using the 'mail' command. __EOT md_congrats [[ "$MODE" == upgrade ]] && \ echo "After rebooting, run sysmerge(8) to update your system configuration." $auto && >/ai.done } ROOTDISK= ROOTDEV= PACKAGE_PATH= SM_ARGS= SM_ARGSX= SETDIR="$VNAME/$ARCH" FTPDIR="pub/OpenBSD/$VNAME" SERVERLISTALL=/tmp/serverlistall SERVERLISTSEC=/tmp/serverlistsec SERVERLIST=/tmp/serverlist WLANLIST=/tmp/wlanlist FSTABFLAG=-f for _opt in d f l m n p s; do ulimit -$_opt unlimited done dmesg | sed -n '/^OpenBSD /h;/^OpenBSD /!H;${g;p;}' >/var/run/dmesg.boot FTPSETDIR=$SETDIR set -- $(scan_dmesg "/^OpenBSD $VNAME\([^ ]*\).*$/s//\1/p") [[ $1 == -!(stable) ]] && FTPSETDIR=snapshots/$ARCH MTDEVS=$(scan_dmesg "${MDMTDEVS:-/^[cms]t[0-9][0-9]* /s/ .*//p}") nifs=0 DISPLAY=$(scan_dmesg '/^wsdisplay[0-9]* /s/ .*//p') CONSOLE=$(scan_dmesg '/^\([^ ]*\).*: console$/s//\1/p') CONSOLE=${CONSOLE% } [[ -n $CONSOLE ]] && CSPEED=$(stty speed /dev/null 2>&1 for _ifs in $(get_ifdevs dhcp); do set -- $(v4_info $_ifs) [[ $1 == UP && -n $2 ]] && continue ifconfig $_ifs delete down -group dhcp 2>/dev/null done get_responsefile() { local _f _ifdev _mac _mode _server _lf [[ -x /sbin/dhclient ]] || return _ifdev=$(get_ifdevs netboot) if [[ -z $_ifdev ]]; then set -- $(get_ifdevs) (($#)) || return if (($# == 1)); then _ifdev=$1 else while :; do ask_which "network interface" \ "should be used for the initial DHCP request" \ "$*" isin "$resp" $* && _ifdev=$resp && break done fi fi [[ -n $_ifdev ]] || return dhclie 08xvS <  vS x vS x@@<@TU wS0(wSAvSvSvvSvxPK6AvS vS vSuHyngAvSvS6vS6zFAvS6,wS}wS}{ݫ GAvSb/vSMvSM|b+AvS,5vS {vS {}AvS+vS+vSk~΋9zvS]MvSvS!h2hvS6vS8vS8!+vS6+mvS$vSE",P0sAvS6 vSx+vSx+ Pw{gvS* vSx+vSE",)vS?8vS}>ivS}>i4lvSKovS *_vS *_hstvS# vS# vS# /tmp/fstab.shadows,vScFvScFvScF/tmp/resolv.conf.shadow- vSvvSvvSv/tmp/hostsHvS {wSs(wSs((RwS}wSΤwSΤ08@HPX`hpxxYJ56<_Lkٜ.}Py݄}6#Ԍ_mDY P+,)9 Rmҗ8v5\$t>SB|JPSD'0-oZ995AsW8AhyF9 ~osHI:/ZNv]<hn]c n9M_BXrmhwʫ _ij!BC[R3(]zSKDE[_vX+5gECLd7ȓ܎a*yQJm6k=#kGSk_]hMm_edȪls{Kːj.SoآdKI/WO8Eif aآLKz.qv>v>RzPysUɍQP-8~\yPwG<q0;t*36h G;Z5p!jfk2U^g!8 GCG,9y^VOnaz6jnF_@:F1];W5 kJ"K1ϩ-G{K;TIghL1X9%v:4ŷU»z&Zm0!! U+EdR$NwZX `0RCɒP}w+R3gvX=\@~'N*WuSox71W"8il"f r0D Es%l[ƏeJzReʯN)A}V`&t@WhMk lrԝ\IGoY `)pꂈ:Qsjzgw . .. pppfirmwaresignifygroup  protocols=dK passwdtmp spwd.db  services@=asswd.orig pwd.db fstab resolv.conf hosts ... . ..openbsd-55-base.pub . .. u-boots.tgz . ..mkuboot . ..termcap ...untrusted comment: openbsd 5.5 base public key RWRGy8gxk9N9314J0gh9U02lA7s8i6ITajJiNgxQOndvXvM5ZPX+nQ9h wheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root bin:*:7: news:*:8: wsrc:*:9: users:*:10: auth:*:11: games:*:13: staff:*:20:root smmsp:*:25: sshd:*:27: _portmap:*:28: _identd:*:29: _rstatd:*:30: guest:*:31:root _rusersd:*:32: _fingerd:*:33: _sshagnt:*:34: _x11:*:35: utmp:*:45: _lkm:*:61: _spamd:*:62: _radius:*:63: _token:*:64: _shadow:*:65: crontab:*:66: www:*:67: _isakmpd:*:68: network:*:69: named:*:70: proxy:*:71: authpf:*:72: _syslogd:*:73: _pflogd:*:74: _bgpd:*:75: _tcpdump:*:76: _dhcp:*:77: _mopd:*:78: _tftpd:*:79: _rbootd:*:80: _ppp:*:82: _ntp:*:83: _ftp:*:84: _ospfd:*:85: _hostapd:*:86: _dvmrpd:*:87: _ripd:*:88: _relayd:*:89: _ospf6d:*:90: _snmpd:*:91: _rtadvd:*:92: _ypldap:*:93: _smtpd:*:95: _rwalld:*:96: _nsd:*:97: _ldpd:*:98: _sndio:*:99: _ldapd:*:100: _iked:*:101: _iscsid:*:102: dialer:*:117: nogroup:*:32766: nobody:*:32767: root:*:0:0:Charlie &:/root:/bin/ksh daemon:*:1:1:The devil himself:/root:/sbin/nologin operator:*:2:5:System &:/operator:/sbin/nologin bin:*:3:7:Binaries Commands and Source:/:/sbin/nologin uucp:*:66:1:UNIX-to-UNIX Copy:/var/spool/uucppublic:/usr/libexec/uucp/uucico _dhcp:*:77:77:DHCP programs:/var/empty:/sbin/nologin nobody:*:32767:32767:Unprivileged user for NFS:/nonexistent:/sbin/nologin ip 0 IP icmp 1 ICMP tcp 6 TCP udp 17 UDP ftp-data 20/tcp ftp 21/tcp domain 53/tcp nameserver domain 53/udp nameserver www 80/tcp http nfsd 2049/udp nfs nfsd 2049/tcp nfs bin*Binaries Commands and Source//sbin/nologin1binrdrrootdaemonCharlie &/root/bin/ksh2rootdaemonCharlie &/root/bin/ksh3MHdaemon*The devil himself/root/sbin/nologin2daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user for NFS/nonexistent/sbin/nologin1nobody f]\W operator*System &/operator/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Boperator*System &/operator/sbin/nologin3operator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/ksh1rootA<bin*Binaries Commands and Source//sbin/nologin2bin*Binaries Commands and Source//sbin/nologin3uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucpD6Duucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2_dhcp*MMDHCP programs/var/empty/sbin/nologin1_dhcp^P^_dhcp*MMDHCP programs/var/empty/sbin/nologin2_dhcp*MMDHCP programs/var/empty/sbin/nologin3M@2@nobody*Unprivileged user for NFS/nonexistent/sbin/nologin2nobody*Unprivileged user for NFS/nonexistent/sbin/nologin3a  n}bin*Binaries Commands and Source//sbin/nologin1binpbprootdaemonCharlie &/root/bin/kshs2rootdaemonCharlie &/root/bin/kshs3MHdaemon*The devil himself/root/sbin/nologin2daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user for NFS/nonexistent/sbin/nologin1nobody e\[V  operator*System &/operator/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Boperator*System &/operator/sbin/nologin3operator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/ksh1rootA<bin*Binaries Commands and Source//sbin/nologin2bin*Binaries Commands and Source//sbin/nologin3uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucpD6Duucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2_dhcp*MMDHCP programs/var/empty/sbin/nologin1_dhcp^P^_dhcp*MMDHCP programs/var/empty/sbin/nologin2_dhcp*MMDHCP programs/var/empty/sbin/nologin3M@2@nobody*Unprivileged user for NFS/nonexistent/sbin/nologin2nobody*Unprivileged user for NFS/nonexistent/sbin/nologin3a  n} dumb|80-column dumb tty:\ :am:\ :co#80:\ :bl=^G:cr=^M:do=^J:sf=^J: vt100|vt100-am|dec vt100 (w/advanced video):\ :5i:am:bs:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :@8=\EOM:DO=\E[%dB:K1=\EOq:K2=\EOr:K3=\EOs:K4=\EOp:K5=\EOn:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:as=^N:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:do=^J:\ :eA=\E(B\E)0:ho=\E[H:k0=\EOy:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\EOt:k6=\EOu:k7=\EOv:k8=\EOl:k9=\EOw:k;=\EOx:\ :kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:l1=pf1:l2=pf2:l3=pf3:l4=pf4:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[0m:mr=\E[7m:nd=\E[C:pf=\E[4i:po=\E[5i:\ :ps=\E[0i:rc=\E8:rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :..sa=\E[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t\016%e\017%;$<2>:\ :sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: vt220|vt200|dec vt220:\ :5i:am:bs:mi:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :%0=\E[29~:%1=\E[28~:*6=\E[4~:@0=\E[1~:AL=\E[%dL:\ :DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:F1=\E[23~:F2=\E[24~:\ :F3=\E[25~:F4=\E[26~:F7=\E[31~:F8=\E[32~:F9=\E[33~:\ :FA=\E[34~:IC=\E[%d@:LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:\ :SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:eA=\E)0:ec=\E[%dX:ei=\E[4l:\ :ho=\E[H:if=/usr/share/tabset/vt100:im=\E[4h:\ :is=\E[?7h\E[>\E[?1h\E F\E[?4l:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k6=\E[17~:k7=\E[18~:k8=\E[19~:k9=\E[20~:\ :k;=\E[21~:kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=^H:kd=\E[B:\ :kl=\E[D:kr=\E[C:ku=\E[A:l1=pf1:l2=pf2:l3=pf3:l4=pf4:le=^H:\ :mb=\E[5m:md=\E[1m:me=\E[0m:mr=\E[7m:nd=\E[C:nw=\EE:\ :pf=\E[4i:po=\E[5i:ps=\E[i:r1=\E[?3l:rc=\E8:sc=\E7:\ :se=\E[27m:sf=\ED:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[24m:\ :up=\E[A:us=\E[4m:vb=\E[?5h\E[?5l: usr/mdec004075500000000000000000000000001227010433600114015ustar00rootwheelusr/mdec/am335x004075500000000000000000000000001220553173000124215ustar00rootwheelusr/mdec/am335x/u-boot.img010075500000000000000000013440241220553173000144130ustar00rootwheel'Vp4Qr64ԀjXU-Boot 2013.04-dirty for am335x ` xV4lElEi 1)  X`OV! d0 P:l\ X00 pW W !   R:/lE$$ //    TOР iHM|! H4P  MOЍHM! H4P  OР iHM<" H4P  tOР iHM" H4P  OР iHM" H4P  4OР iHM\# H4P  OР iHM# H4P  0 /D0P/D/ 00@P/  00@/ @-P@`p00000000 0 0000Vlp@`0t}p@vp@-2\@00  <0 00 P 0PxPb#`0p@lE % 0S \0 +1 D     01    /(%  801     $  (  ,  T /(%000, 01 , /(% L00 (  ,  P \ $ ` ( 4 8 /(%\0 0( 4@Xl pRR/(%0 DH/D@-@P8  800/0P(&'  '(&/D0P &'  ' &/D@-@@ 0sP @0s/@-$@$ 0P $@G@GP/3 8 0s/00@-  @@ P PPP 4P  9904@@000040 0$0  (  ( R/4p@- , @@@l$ @ T\40,000$4 Q  hP @ ```#\` V99;0P@ @h00@000t3\Q  @@@<#p@ T99900002pQ |  R0`  2` Rd  d0S 0 p2 R  0SH 1 42 !R  2 R       R0  1 R R00  p10 R@  @0SH <0 41< R  0S  0 0 R  0S 0 0 R  0S H0 0H R   \0 L  D0L R   R0   Rp&p@-P`XT`@P`\TP`@XT`P`\ QT3 P `@XT`P `\TP `@XT `P`\Q T@PHDP@PLD@PHDP@PLD@ ȠČ@ ĐȌĀp   "N Q:pppE,0    0 /pE$0     /pE 0 HpEN-000P :"  BR$@0``v @@  P b@V@T*Q* P@^@T*Q*_0S@-pB@P`  LL@D3@0f@  ,$ 30fP6O@T:YYZ0????////@-@/@-@@-0?????//0 0 "0b0>?0S:0?@-0?????/8@-P@?00 0#0?8@/@-bP/@-"@B@-@@T \ ПP-`0@@ R 8 RP ( 0 /O-p`@0@0@0 //D 0?2/D8@-,0@@@+ P8 <@8H@-;4 <0< S0b0000PH@-,0<  b H@-@d@-/D-`P@ vp S n Ppgp@-P@`       00000000SplПM DИ堀H H4,, P 52:++4`0@lEiIP//@-1pe18Z脀@-  1&@Z@-  @(GZ/////////  800//@-@0   0  lDt@2lp1pdm1m8O:@2>D 4($(\1ALPtE$PZXZ`ZiZ@-N1qZD- (00<0@P p(P@5/P PU8@)  A@b$HH@< @bN@(D B`BpB@` 00P01@ 80 04@Dp@cH@D LZZ@07@-@0`P`0'P  D1K40Gp0Sl 00 5/>ZZZ0 A 0  a/p@-@ M'p0S. Pl 0Idh x00 at0MIPl IPPl;l0PP 0  00<l)=lt0x V;K40MP$P0 0010 0` R R 00 Ps0 10 0 dQ hP Xa 00,@ 00 ЍpZZATxE ATATBTp@-0P@@` nP =pf8pp@-$,0\ $00(00,00(o[0@  /T//@-h;[0@-M@ 00<8 0,0@P0400($ 000 00 00  000z Z c0C0vVUnN/@0TP  @0 1400/Ѝ0d%N[[[[\^ـ'\@-@ /F\@-@ /]\@-@ /q\@-@ /\@-@ /\@-@ /}\@-@ /zu\@-/P l"]//]M00000cSЍ///0//3@?6CD- zP!j@ @T:D@-P`qA$J@ 10# T:@-O:?@-O:?P/@-O@T@ T0?0?O@OO0?@-O@+OP/0 /^@-MP@q `P  .T  +@%P  ..%.|.xp4hH`@XDЍ^^+^7^A^J^R^e^o^w^^^^^^^^^^@-03/Rp@-P@  `8.E @@.@p_;_8@-@/EPE 28@8@-@.]FPPxth. l02/RdEPT EHY.&EP8 4R.8O.8``#`V':`O`g```@-@4% I` @-`@C.\H4/` @-`@6.OH4/`R@-`p@P80@ PP@U$N-0?"0pS p 0 D 0S YP@@; TP/`@ 0PV0@0`% V0@D$@PPP`@4-G 04/ЍZـ)aF-p0,`(@4P0 EZ Z-TT`-- 8 `D000-- 0P -80S G0`00x -dDs-G& T#2P 0Sraa`aaaN-`lC. p5P3V<3@ @mG>ETP@P*EP\E- 22/戰R .-#TGCP$-JGD[ -CPt#- h-8GQ P-1G.G 2R RR R P T0C @ P 2/T ,ꘑ@ 0@D0G P,kGTAT0S|B DPh<0@]0 \  ^ 1L1XDQ S0`#PX`SS SR@d00 h000DP l0 0p0 00EP |, l 0 HP PЍE!b$(bV'=`R`g```Zbybbbbc$cIc/N-R(MP0p`0  00:SS #S  *P{ @T  F0M3 RRO,i ^ T#q? T! T0 T@TF TN T8LSHX00\00]00$0 000^@PX$  aRx0dh 0t0 aD@Pt"x~BlDlp D@ 7/@Pu  \27/@Phj@ 827/@Pc D+m 27/X@z  0oPrAJX0H0\00]000 000Pp pD0S "0S+|+pE  0pY }2A X a]0SY n"P @P0T!(`0F3?3/@!E^ 0[ Y Ph@^B^ x+E  0;/E  0@(ЍEmc%cccccdHddddds@-PT`5"P<a@P000`@B+ 0|dd$d@-&+eD-MPp.`@U00p0 pp P.0 p ct0 0x000BP |000 00ODP T*|It 0  0Fݍ$$cIcF-I딠`*@4 4pD|Pt.I.0O0R .0S0* 0S< *P U *@TSff$󪄀R@-`@*ڴ!P*$ pP jZPV `PZL *P37Z+:gD&Ggug䄀N-hMP )`DU)Dy*DUD @+pyDUp  0VP+0,PjD $0l0 D00 0F*0 `0QB V[R)`p@0`L0'tʟt: R R`!   D  0@ m0 V ]R0]Q jy@``3000Vp@00@hY PJ0@ aP>\ BgSU00@?U0sS옟 p@P)0nS sS9U7Y` D"P0nS` ` S0@nS T@8  P  P@0S0sSg 0$@T`B00vSPP%T4 4.FP T40 pPU \laS4P  sSy04 |4ylS q lSpSRp pU U @ئ@f PPT  0PU`  &@t&F 0@SYEFHFFFFFF> T0 %P0d%\ %@T?%2PDU@7d%U@0  P1x 0PP.T$<d%T$d% b%d%TTP P}P~%4U y@Pq|@Pjd0hSBCL0P1r%045_1 k%01f%0  1a%01\%Y%01T%U01M%U 0 1F%U0$1?%29%|7%t U@P 200 8FpP  @P 02 0|1O .pPO00pS"APp`$$ (0@Px3,0lP$ 0(00 0$UHaS  @P,1 0@P4dS *0@P$$,0cSUU@@UP   P @\`/ 0>/@  @P0R1`ЍFIrgrrr"s%sXsssNFssـ tt-t8 Iꄀt0rZ Lt0䄀Tt[ pt2tvt}tzttt.[sttttuu0uGuUuluuuuuuuuv;vUvtv|s@-@-OR@-@0iS cS9sS tS4```` @P&yWP $V/WWP VP VPWPpP34W 0 $\Wyyy@-$$  `0 0"0 .R00@/R 0S/R@-P@pB, `2"P  0{D{y$\RF-@M8  pPPp  @ E` "0 0 0V PP@(` 0eST $u""ЍJ{{\RF-p@   ` {PP ЍF  zp `f@ @ 0WP ,:"  Q0 Ѝi{RF-`M@,  pCPP  P1#VO  @y` 0uVP !Ѝ {RN- `1@ pP`!  @U  ppPPP`!@ 0@VP ! T1! T!!b<PYP  %T  T0 3?0|0Z @ 0VP T!YPZ0 pP`ЍJ{{{{{{QzR@-V@H! @,~!V@P w!{{{//᠆ 0P/᠆R@-@H`! @,W!@P P!||9|@-@ *R T T T  A0N-p@P`f렑] BPV[ZRVp(0*S u@0*S mPWAYYYYYYp3P P"@W$ Z0Z 2$2000#,  0(2* 0P $ @0, 0@ 0 0P  U UgPtT:d \J,,2SeP p $P 0 UpPȤ0,2"0 $ [ 0 Pd0=Q5  00P0,`00 Pfpn pW 2 R R 0 S3P*'     G P3  L$$0PS D P{ RB` P 0 ``PPPT0 S@P PU0 LC #8,  XuP LO10a 000"  P,PU) 0 p  P W 1W) 0P PPS 8Q0 R RX,000 013@ P @ @0@'P 000 0 @P $ P:  P)%Pp S 0SCލ@KЋ9׋9VvlMҌ=RD-P`M@`P x u r A*`P:g 6$4P Ud@$ Y0 R Rxp d0}\{P 0 H000 0oPU@TS0ScCP P 00 R ßR  3 0EB@<|=x,0*l(0ESlT PP  0P2  RP P PURp OppKppp`Pv`>P`v`?V{tŸQ 0 ` %  Pt@Tq 0` PP 1 Q PP@U@@JPUPPCUP@ 0P:P@`VP5*1 U ` P P  0 0R0  B ` 0 0000V0C0 8 XP |x`ЍaЋi9󍄀@K?[r̎؎掄񎄀#ـCO0@-M@PP"TʈG 0pPd0  00 R <R80 ,0*Ѝ0Ώ@K鏄8@-@PH0 R<80PP8 @82F%N- MP@.p@,`P \ P LP <P 04   `0 0&0`0@vYP 6++7+)P9+) 093?@00+ @@  0UYP 8+P@9:+00 @@K Ѝ軐ŐȐ琄h$RD-MP@4R ``0S 00S& P# 0P000S bLU>ʁ4 0   d!!!  Q4PEs+U%Th,d3P `*P P`p  P` p4H+"5D+U5>+6:+ PHP 0SD67*+0  00Ѝ2F)4K8@-@00$|PdQh \"%PH@80,8@2FhmБݑN- `@P@\ 0p|p3W pYP)  0P"00 R|  0 L 0## UT:0@RP0 @@Ѝ쑄2FF-PMP`0@4p  0 0 ## "p 0P.Y   @0S 00S \ RhFXPD 0## QP06 @Ѝ2F2ZeqN-M `P:Y`0L0P@  @V@<0P (*P  : 0S @vpPY L0S  XLL0Sy 0S (|Pp PL@ 0% x4 1/P < %% 0%%SR: PY `p P l`p`3ppp30 \0 D p P0 TP0 <P300Y-`0 0 jh0L 0X0P7@L p2$ ?%@`'&匰'D0SWO2yPJ- P tE@pU\7\P@TH@ dPY  /pX\ KV6F&p @p p `@VPP 0吰  0c p0` P00L000 01/P 8MK@Kp@'r"Y  0    $ (,0@Zt@4p媡p 0 @ W@@$ PYL P  尰 `4pp@p3Wd ;3.2&@P. PP*h0 0X `0PY T 0S T00S  &R0P P`0I0 h0 0X0P`0TPP0W%P@MP 0HP  CP Upp"U-P@ 00WP0@嬠0P%L1/4U. Eᐰ' I 000W  00L00P1/P  0< < 0 @ PY  1WP! \<10P< <@@-@+hϿPY_ pP@ |0` 1/P  @  Y 孿P@@00<Ѝ荒%Ї2F=ǒђגݒ蒄ޒM (GY㒄Lmܔ2Őᔄ&&9AlF-p$Ml`P@7P  H2U U U PzY1  1 O@@'fP='PPP@6'\Q3'|1P h`1P LD0S 84 R ($1P 1P 0P 0P  R UQ@& <0R&k@PRT&$Ѝ`Z$ AIAI񕄀AI8`I_I @I^AI|`Ix`I$X`I+GDA>R@-@@0P P  0iI2U@-@`0@DfQ`QT\ pP  -Q  (}PP@DTP ,$0@-@P,M0 0 0(0000@ 090SP `9 P@ @0@4兺PP { P& ,Ѝ0,$R@-@  -Q  aR@D0T pP`PP HPD  P(P `V×䗄R@-P@pB, `H P  0 j [ 1dP g 6 d` 0U<  ӽ00S`3 00S/ P $0+SPpp$ R0! RW  RB b00x  QA  nU U68@fdT :T+PEWU`ȀhȀpȀxȀȀȀ @>T t5:PTd`HL8@,ߡGchnwȢ}⢄բ󢄀BF-@PSp` 0(0 PpS$&R 0(P (P0CP0SDY0  C,$W 000` p|pp00p!!0S S  1`0P H00 (0(PHPt6S` (P `6VAYa+ Q@-M ?@0 0K 0P\:% PS DO@M G0S B=p&a` `  /00S S S!000SLp 0W1Z$ЍNxUGـb죄tq鄀ݢ%/=7@-@!P=10s#4 !P ( H0(PHP1S x!Md!P!DC?0B/ s #4>LivǤRD-P M@= µPP"%P  嵵P %,4$ 娵`P4"40S|  p噵`Pd@c$PP $Q : K@ T `P0U@#PP 1S]@ T P᪹pA#@P 0S P Ut41S: @HPm* $@P$U@PW*`P 0S U@  .P iD*0Pz 0S .mTk P&@b0SlgU K p F PA @0* 0`UwL$8@-@QP PP 0/P8`0UA U8\ ,\0(  8\  \ $ \0 88S݀-@-"M/( 夷@c"ލ@Ѝ/P@-01,03/SP@-01(03/SP@- 1 03/SP@- 1$03/S-0@-"M#.@, iP"ލ0@ Ѝ/P/0 cP/0 c R/0 c @-R0 00$03/@|cS-@-"M@T /( *@"ލ@Ѝ/@-0@"M T @"ލ8@-@P@T 80S P P8M 0 /M0/M0  /M-Ѝ/@-@P0 @-@P T P @@-`P@pᨱP 壱P t坱P T :T 4u0j  /@-Q0@QxJpUhDQX?DJD9(0Q0@2@=īS̫髄񫄀p@-n@P0 44 C UP T@TU0ST {xU s4P@0`@ T   p$SX0Pp@- P`@ bDZ $0T: T@ppN 岱Np@-@0```^P^PZE U00Pep 0 cR  a4 p0`e``0 Pe Pp Np@-@Pp0D R `QP 0a   0 4Rp814p@P @P0d @T P P@ @@P @AP\00   P p R *!@B! 0,Q"8Q[ TQ"nUQwTQ"|~`@ P  A Q R:  0 0p NrF-5 R0SP @T@~T*@!x51 P0P 6 0 0H$! R$#8 R[ TR$&n UR'w T5R$)| ~ 41 d\ B \ 0 0 0    P tPPQ 00d\ 0 @0@0 PP \PP0 S *1P`C̅ 00 ,Ġ\#à8\[ T\#ƠnU\ǠwT\#ɠ|~xcQQ 0LP̃0Q  S: 0 0 B13 SK 0  R`p ! d\0 @@ "00    \ 0   0 0 P`p    A BQ 0SS   0!` 0dSbʬ1 4p4pszpp~p pPK P*h1VFX1 UT!  0 ppp2 pTi  00cPp0g~p~ppp' 0e  0ppVPp Z0  0 J 0Z00 0  ` 08S80< SD <0@00000dS$ 0@@0N @-p0`PWP@&P%  0@0V `s`R`V  B$RR0 R0000$R0 00000   L@ D-@QTDIT @Z @pP PGQ `D0d```F0eS0`Pe00e 0    00PPP000jS 0000  N-@Q@%TN pPWD`ppVd$0S      S   \4 g00pp\ `0 0 0PS Pel S80[e 0 0  F$RR 00R00@ 00 0$R0 0@00000@0 0      ᫮"0 g @000pp[- 0 0 0 0  F$RR0R00@ 0 0$R 0 0@0000@0000000q `(Y* 0 0  F$RR0R00@ 0 0$R 0 0@0000@0000000 `7B(PP" 0 E00R00`(  F$RR0 0R 0000 0$R  0 0 0000000  @h0g S  p 0p    W  ` 000@ P/0 @/@/P0$ <0  404$0Q0@// NF-PP6 ,`P P. @P P0ᠬ'pV# @P  ᝬ佪PẪpP 9/PP PVP P@:PPF-pR`PU PU 0S- @ậ0P) @ᴬ0 s R @0 S T ,R:S,S: S8 0S ᚭP ᗬT" !* @@T0 S :SP0@0 R \忬PPdwP (g'00/8@-P(@(( GD8\,$4D-(M0(0@0`@@0 @0S V 6P `P` ePʡPP @ TpEW  0 (Ѝ,$85pN-R0@2 Q`P@Z  0KS{dL0  00( 0 0 R\ Sa00S^00XSR Y0yS1S tS YS TS 0S nS fS NS FS=0SB 9p 0 0\- W  .RR&pW)p0 0W  S 0R XR \  :RRp\0 0+0 &Z :Z! 0 0 @ X@ P@T m ၩP 8 0 (`Ѝـ85 `}  $ /"'N-M⠰@Pp`V018#00xh 1/0P  P2   D1/P0P@U T:UЍ2F@-M|M ȍ(x0`wP &(0"0@?Ppp `0@@WP0 000 Ꮱ|x2=P h&@P PH|Ѝ؍,$X5Ү:Iݮ2FN-@ MT#T018#p0`| P0xd 1/0P     4J>P0`p8 VW:V Ѝ2F@-M@M&?@?@P +b@Ѝ؍ //@-p@]4!4\\0 (!\0 !\0 !\0 !\0 !\0 1\ 0\ 0\ \ $\ (\ ,\ 0\ 4\ 8\ <\ @\ D\ H\ L\ P\ T\ X0\ \0\ `0\ d0\ h0\ l0倀܀݀8݀`݀݀ ݀0Դ0𷃀h(,N-@Pp`P9 @\*0`p ``<Ͽ `0S*0 00ؠ3? R*[Z :`p[Z* PЍ@-PRp`@ 0P 做P003?0T0 tP003?0, @-0fP 0PF-(@ P 0p`P1@0S* ! p `pZ $0J'('D LP@AJ6o ap@-P`@iPp 0%P 0pG-`P $pU@PW  0G 0P@N-` MP8@P:pVVZpp@P  0!SRნp Wp 0f 0TP @"+ 0řP P p6o`'`t 0`呜P @T `@ 0: 停@P  Ѝ8@PcD-Pၗ`Pϝ.ę@P  @P`pP t 0qP P @ 0>`PЯ89௄Z7@-P@*P  0 Ѝ0@ Ѝ0,@-3Ͽ0#ЍN-P@`p(40Y 00  0,0  0P p 0"p@-$>, ( ЍN-`Pp(,Z  0˛ 0P Yp@@-3Ͽ0#ЍN-SpM@`(,  0Pw곖PP mP !NPPc^00!|1偛PPp lNh.`p)0G1 00@1$0000P((1g  0  0L kR, $0 0 0 0C kR0PZ0od 00`2PPP@ ,pЍU`51[e۰簄,@- a  0cN-8Mp (|00040eP8`0 ⮪  0PP T  ϩpT  @0S@PU00 d 0P0P0 D 0 (4`(PF,@P8Ѝw5 .(D-`PM, p 0@ 0UTup W V0 AM1@2/@@N @@c4?00@09PЍ 2/ k8@-P@P8Mޗ 8@ N-PM`pPᚘ@Pd, 00@TpD-@2oP`$0P0 pᐙPP  0 `凙Ѝb\p@-P`ᰖ@P@ Pך ppj0@-@QMP4R-8\ 0 0L@xd h0 T0 0(@Ѝ0脱p@-@`Pၖ 0p@N-0`C9pP"nP  p ` 0&PLx   UT  0jЍ跱󱄀#s@-0d `PP 0S@4O @8 0 P !V|UD-p@W 堧 P囧8 ћ  B`40)W ㈧`脲 000R0/0 R0/0/0/@ 0S/LNꩲRN-`p@P-0A P @"@T|0 PT P[y( @PULN䗄@-Pò@-    N-P@`10 P @\ \ ` `P PpP0p0 00Wp``@TЍ@-DPjò0p@-SP@  R0S 000`0 0   0 p8@-@P0 PP 0P8F-P0@pS0S0S $g0S 0W0 ` V:\R00S`P RPP a 0 !0\R0  Spp 0So R]Hc 0PsT$P/@0     0_S = Sr//NF-@0S`L000pS|| pt0010 pPqp0Zq S(q1S-)p S ܠ yv  P* q 0 ! 0 q 1q0S 1  !`lP``P YP 000S PP 00ᲄQXOLNp@-` @R Pd e PA0S  `0 00ppR8@-@P8@ P \P 8겄8@-PP80`@$SA0 ?S8<4#8͠P8@TLNJ䄀F-0!0U `@P |K=ʠ`1Ppp@AᥠPC @T:Z00S + 0S {&Z0S00Ѡ@̠P0 @ @@TP@@ @ )PP\P NﲄLN2N-@ P` Z pkP  @` V : PpP P000-SP =S P  +SP00 P /P R  5P  0-P X 0 5 1Y P PW:00U 0S pp pU R@   ᢟ᚟`P00 ޟPtU P0 @P ʟPT ЍHp@-`Pp0AសP @Tp\p@}P0S00p@0Q 0S LN2p@-@PM`/ 0S, ㏟P 0S ᕟP7D|00p0P 000 0@ @0@ 000000 0@@Ѝp虳`DN-00MP$ R| `R v  @T<7AQ  R RR  R 6 !`0S0 ,0p0`00$0 0 000CS *PQP@ TppW p @pWpT0q0T p ,Q00Skpqp3jTppWuT~0S Q[00ZU 000 0$$00(0 :g, S) ͞0Pi ՞0 0( m y  သ $!p  00S0 R P 0 0$ 000  00Z $0  @p0 P 0 0  T TQ T 0R000S #SaP [ qPZ2 Wp0p=`=PX0`S00V Kp0P`v >00Z 0 0C 03p p0 Q0P R@ 400P 0R p `(   (0HW`p 婝 ᥝ0Y( pYߝ0  1414c ;ÝP 0 < 1`v 00f`43. 0,043 RT#,  T  V 0SS 0S @ @p @0 @p`0SPPUZ`0ЍLN)}NY[PON-8M@ x pP4$P`Pz(P0P,PLV $< ,P8 $68300` 80 S 0050S[ U` 03/`[ 0KS0S E[PA U[  U0S(0S3&U "U U#U $U,;U 'Us\U |U 0S 0S 03/03/ Pp# v   03/03/`p00 0  03/p0P0_P?P {P$0  ol if 03/]_0  03/U 03/}Pp}PE000S C 03/'Pp20000s030/&V" 03/ |V 03/000Sl  03/Ppq_ 03/pP^1 !O p @w 9 D1`R`'4pw1a,0S 0&0S00 000u  p 03/#,`V,0 P!P,0S 8ЍNLNlӳ@-,00$0000 000 AЍl8@-  ڝp051P0 0 W#S 0 *㬘 *㴘0SG m l L 8mH6UUU갶ض`@-pMPʼn@P` 0ӊP!,  @TЍN-`@P៉P@@<pZP  _0s TS* 6`P >* 0(`$}5?? 0 }? p  ,P PUD@@PƾP9LUη`@-Q p$`@K  @|P P:5;P IP |u0Sp 0Sd@PP L D0 3?TU2/@ ST15:@r^L*W DP( "0S $L 0P @@׈P 02/Rl0@3?0000g`=Y`n踄D9D-p0QP@ S`A00C00 Sʀ0P S0000UU0: 00C000C088/D-@PM0P`0 `@`p0 S S S4 S <S  S7S S2&0@0eJ00F 00C00S0@00S ` 0@0S0 S0S ` 0r@0 Spp Wh0p0000 0 p 0dp000SЍ88 ~Q@-@ 0 S S S !@0S S S001G@T0qp@-`@ vP (00p@PPpD-P@  ̛@Pt`) T Ps@DβPP P@z ²PX0%T00S U T&15`?bR@-`P@pPP4 eP@T䗄@-0M!  AA @ A\PAp`P`V" P@   RL: B q QaA a `W p@ P Q\ B:\:Ѝ@-q( s 0⾄ 7@-P@P , 0=P0/S   0/Pd 0   0$P 80   d >$$P U P e,00}? 006S  0)06,U ,U \L , PUZ0 0 00S 0 0Ѝ-8s@-0% @0`$0S  jS PU0S `SP 0S0SS 1S1S S|„N-MpMGP@?P`` @ 0S  R  p !LMQPZ06,0 3/R 0S0SSJ ό000 儠20@00 00 R0  0 z 0S06 B0S$R"S S W L@ M\d Q p V L@ MK„5Ä@- `@`@Ppz0@002A00D0000 00003/p%N-RMPp` 1p`p@6)/PV 1 \R Ep0㓶&QQ; Q9 <0 0 8< 4 00 8< 4 000 0CS$,4<< a 0 ,0 S0r0L0,Y RQ QQ Q  R RR Y  0pP 0 0 fR 0 SKȄȄGɄNɄUɄ^ɄgɄ H- 0` ?0?0@0M?@?@0F0p@-PP P P p@.`@ ?P0?p<ু/00?p px>F.81˄@-\MXP@p,pT%H`᪀P 0p 8<(0:t唀P0 `厀P0003D冀P)0p ̈́ `ƄPpP P bP  0L%080 0<00@0 ?00SS  囄 D唄HL0P0D0T0@0X0000\ЍY˄˄钄˄˄ 9˄dL-$M`@DQ@0p0< أ@P@P$ 0 R0^ pWp"\p  0pP  0pPX P @@H p0R 0c0$Ѝ%2F ̄9Lm㒄"̄0@-P@@ +91˄0@-P@@ A91˄@-DM@P0@,04%XIT`pP000  D@  88@%̄̄@-@PX0"01 R 4!@DO?0N?@%@-@P <0"01 R4!@D4A@%D-`Px0R`@q1 RZ e?>& < 8 1R4!f4a@%̄̄@-oP/@-,@02s0S 2$8@-P O0"0 X0p  pPT @T*0qs80 "8$̄p@-O``0p<0SP PὝPJPP40Q0A0:s0  0 P *0 !0)o䠟*D 0@9s0`V0`j0 uP+0[0wp[0z0)*0 "uU0 "0i00A00蠆@3̈́;̈́ $[̈́p@-`Q0:s0P@7DP0@I0j `0*^P  0 *r  0*(0s0S X0 0" @b@0 0 "p$RN-`p00Sr@j`y`0 0S$ PM Pzh1 jX   PP1  P\ 0  j P    P  q" t0P 0"\  U D @@00TЍÿ́̈́$̈́RF-p`!4@(P0:\ 3tP0q 00j@d00`P   T0ק0ֵ 90@`⸒P@T@7 0 0"@̈́̈́$&΄T΄P@-L@0@  P8 8  @T eu΄$HHD0/$ 0@-R@ 0P0S 3/P@-@0S 3/P 0 R 0S000N-0M 0 0P0@M0p`S( PE \ 0, 0M $ 0 W}00  P  RrP0$S 0^ 0$Ss R , )}U\` 0S PPQ`P 00 \ R^&0 $ ,0 0  R  R0, \$\: B R | r      P8& P  R  Z( ɷ ႑ P  R    R(ɷ PPU 0 Z (RP  R   0 SQPPj Kl9|90@-@T P@@€ 0 000 /7@-P @R|PcP PX0P P*6 40PPa 0P>9%g%@-@P @(:j{PP@-13/@-@`P  |1 3/Ѝp@-@ M|   @P}| Ѝ-4M,0  100000 004Ѝp@- M 0`000PP0O 88 0 P  < S T D00S 8PUJf|@T* Ѝp@΄΄@- M$ 0@000P Ѝ/@-@P 1S 3//4 @-0SP .F΄N-(Mp@PPW P QQF 0 e00$ 0C<0e Y!@0S0B 0 00Q #  $!(`P  0`P   &001000`P HGV  P?P PU:P(Ѝ΄:τN-8Mp@PpQ0 !  $0P`$Q VP1 Z U 001@0 SP0 0 0$0000P P0 U ! $PDPP0`V ᓐ)8ЍLτxττN-PR0M`M @P Q PB0 !   0~Pp$ W1[ 001@0S`00000000bP[ 0100TP <  \0 pW `*0ЍLττ@-@0P 0 0 @@-@P1S 3/8< Q! QH%H5N-ZMMP0hIZ  0 00T0\ X0 PPG p`BzP +Z΍0 T088\00X0PP200`0#888Z T 0X0 8 8\0P U0`d ^h0l`d h0lQ^ |\dlt($ A0A RH@0P D@@Q@ ? #88 R #!  ⯘ T$1#)<00P  S<0+ 000000YO@?@ T7Z΍ 0X0T88\0rP A SB: P0S0 84 0 < *&!:S R00CS`ÁhÁpÁÁxÁÁ864606,6(6000Sh00S%20 9000S 0000P  +0L0Z70p00 0#ptpPZ`?`30tp0px p$ 0$`0,0(0P pW03?X0S Q2/\  $:Q$ $$0 0 L0<L04RH op`Ⱔ?`Z.0 4`0004 40@0@00<080PO03? 03?%pWP00S4Z΍  00D 3D`0@0P00L0H0P*03?4SL0"  L A S:o `?`P  pP  P0S L000L0PPP L000 L0o0`?`0'  bZ΍70 T0 8@X@8\0SPZ0T X@0 0\0FP0 D0@-`@PpP $ 01/@-@4` Pp>ApBJ߄e߄@1 @-@ 0, "` + R!0S   Rե0P0 P00|`0( P: SP00P0d0L0]rd0   1?C0<000800400000,004FlEv߄L=H4>ApB>@-$@` Tp P0000 P T 0 0 0 Ѝ@ Ѝ@-0000@- l 00Ѝ@-@-P@p` 0 00P= @-@MPpQ` 7X 0p0$8 0 $4 00 00 @ЍD-MPp` l00 0+ @Pr@ 0! P0 00 0 0@@ rP:@Ѝ 0D-`p@ovQ0 jvQ+ PP( W 0'0 0 $8 0$400@e@0P0  hP P T:PP PЍN- M @P 0g `P> v p%v 00l P) e0g\ 1!00S [! *400PP 0 P }P P p UP W:``  Ѝ@-M @0P  0 a P}YЍs@-PP@N3 P 0`P%  P@P:7&!  @X)L N@ NQ0S|߄߄߄ )ـD-P`p@P  V(000p00 0dHJI@-@@?@- 0h0 @\ 0 S< 0:0080$0PCP0 48<00/P048 < ! /0@-PM@ 0 @ 0T@Ѝ00@-PM@  0  @ 0T@Ѝ0X@-\ @<S<0X@ 0  00S 0 0 0P00 0@-\ @STPPR00B 0 R  00 0X00X000@-<0H H D403/@-`0P #d@p V@T:00Sp0XQd@j P` V@T*@m0Pp4F@-`0P d@p rV@T:00SX1Qd@j`T0 P` _V@T :00S֢ Ӣ4FN-`PȐȰ$pZ @ 0,@ S@R@dSI 0T T 0S ` 0 0P姢0@ @P0 ##U 00 00 4F7@-<@ oi 5\P 0P>0D-p0P<@ 00 Sod`P `V :p 0 P$Sm  04FD-M`p@P p0 (0`0# 030 RPUP @ 0T@ЍN-`0P00 0@P A0 22p000S( l 0T100#a0`102@PB@P  Ѝ=F-M<@0D0  P0ßp`L  @ @2@P  00  0S(n,̎0 10 0 10LPPP @0rᠢcPP,0 $p `0   040@0 SP0 90P 0b`0 E#RyT0 S0S <0 X\STH0p".d &.0h  l0SH0, =x SH0p.d .0h  l0SH0,=x H |000<0S>">@@  0 P0P0\`0tp @@  0 P 5YP(PUЍ2Tv"3_I ᄀD-p`@%PP{  @P PP^|1 T040Dp@0 00L000H000P00* 0  Z0tR000<@ 00,00$00(0ep/0p`S0,0000Wj`  0@00< ; ;S s04 000M?M @ @ @ @  40,ᄀ@-@p `PP  ᄀ@-00S 3/@-00S 3/@-@-0 0S 3/@-@04 ,?<100rl 0  00 0  0 /N- 0P@2#,p 0 2"4 2#000`I0`FV 0##0ޚ !"(     "8 \ 0 1#(00 0P1!4P1#000v-㄀N-  0@ P2#,` 0 2"4 2#000 0  2"080 E %@P 0##0僚# py)(  S py)4y)0 p圗)8 0S f-㄀N- 0P@2#,` 00 0 2"4 2#000p/@P 0##0 0 2#(00 0 !"80 @P 2#0 0 2#(00 0  2#800 0 \ 0 P1!4P1#000 0Y-㄀㄀p@-@`P9Q" 0!",` !!4!#000f9p4 0 1!41#000p``@@ Pp@fV 0p@T  0p@p///N-p@Pԑ @Dg0Sj``g 0eSc0-S  V0$R0s0) V3!-KP V V0sS J0bSsSE K0P0 C R RnStS5@S/Q,: S'  Q# 000C S O0000S 00V1@S@0000 0R@ @ @D4F0 0C 0 0C R0 /4FRD-p`B@ PU L`e@QgSR@-@  B P P 00000<<0Q@-@ 00000#40P0SC PUP0" P  0`#V? P&`V?#0`r V? pP "$ Qq R00pJ`~Pp1~p# `K0W00 S0r0Q #$0 0CQ1  0 0C \/ 0p@-P(@`4@D$0S 3/<`4@4@D 04 (0R0 0p0@-@@ 0\ P\ S0S0/@-@ 0S 000S3/4F8@-@ 0S(P \000S ,0S 3/4P 04PE4 (0R3/00084F8@-l0@00S 3/ 0S(P 000800S 3/4P 04PE4 (0R4F1S0101/@-@ 003/ 0@ 8@-hrP@0 0S 3/000018 8@-hrP@0 0S 3/000018@-D0D00@-00S 3/x0N-(`&Pedp`=f+? Z18 ?[ paJW0@000@000[ [ 0 0 DJZ 000000 0 0 0 @e+ P Y 000W0@0@0s00#$ 9$0Dp@-@PT `&n/A!Q4S\CpQQ \  V`#tA`Dp@7 p^p@T T䄀䄀D@-@0S00[ Y@V@-`P@p1S"@P3 T0S䁂䁂TܖLHD000@S@00&4F/䄀,䄀2䄀5䄀@-P`p@@0S PPF-pP `V! #0崖M D 0 0`S` 4A3/ Q 0 0`S` 3/0$@Th000S 3/0S ؗ0 03/ї 000}8䄀8D4Fp@-P8ř@PB $0P@$0(0003/P`0 @0 R(  0 @:0`0,000S 3/0 03/`PX0 00S0`0010 `m `p|4FN-`崠Pp@z 00 0 70:00`0`  BR񟗎|ЊDS$$B\ 񟗁괅D䅂DlW@@ "H@ 001000000000R0 0 W@1 @#r0 t@$[| S+[F[1 > T;` 000000000<<00S00 R @Pi>d0? ([  R  l@PU0d44I4 R @fTt00H@D I R@W@1@!(D8 ,AH000P $@ @DP 0(P 0044J4 R @ @D 0S00S RS p40P0$` 0&  0[P&P(@  0NPP4@4@D  0@P 40 S ` `F 0Sp@W@1S 0S T0$7 R J R@-@ 0 4P!  R A \  !<"<  R 01S; qpp+Rp 0 $ Q 0S D/@0SQU 0 UY#P P  0SeXn/\ P0 R1SP 1S01TP1SO !L L! T 090D@ PR? s,200@00) g@Q ,:Q0TP 000P 0;D0@ ! !hT 0001PeQ Ѝ@-@p !@RAPP @` >@00@Q0p@-@`@`YPpP PpD00PP D00TP 0000P 嵌 pp(6F-@MpP婎`Pu 1P010110`R 000 1SL@PSt@ A@(㎎P @I0t0000103/@T#@T 0$4+ H@(Ox@ 4@ P<@P @0T@(0 \@݌P@ HP?0$$!$1*B wq@0t0019 7@51 0` `012/110X `#@P 0 D`0x00t00p00l0(0h00d0$0@)PP  PЍ(64F}䄀ـ䄀a䄀䄀䄀䄀D7T@\~~8@-@0T,0Pᚊ@<P8@B$<P8@+8䄀䄀䄀0/4F8@-@<P tPt\<i<`$Q@P H<P  88@c, ^8䄀4FVD(6儀 儀_D$儀L70L  BR L P    L / 0L 0$0/@- R R@L@@- R R 0L0@-Q 0L0@-@0S S 0L00T0 0L0@- Q Q Q 0L0P 0L0I /H0S0H0/ @- P`@`Pp  0S"$!RV|P P <L `01 0h|5F_I4Ek愀儀@-`T@0S 40S < L400)0I5F_I愀儀>EN-P $0`岠p  R˂˂̂̂̂̂Ȃ̂(˂(ʂD˂0S*0KS,ɂdɂʂ̂̂DɂdɂWx@@ Wd@ @ 80{Hz SP0r0-![0#Z*RZS0S 2 CT02,,0@Pťz @Pt@W@10S0Z :Z@000\P@ Z 00Sc d3/`2@0@0S 3/00C S!1!X010! 0 @㝄C0S0   T RQ RN SL  S 00@@) !R> ;  WZ8S6 1@0 R/ , Z*S( @P#  V700 @TT@0 Vq3 0 0 0003/@P0 0^@@Ѝ 8878T89愀DVz愀愀TE係$@-`Ppd6U@ PPE"P1 700Pp@-,)+  zP z zP z dlA56P \A)8 P )6P 0E)(1<P P402000000S 3/zP Oz (:KPQ` ݃P [)HzQP @0 @4@ppC愀儀愀5F 焀5F焀5F*焀f焀dE8焀焀F-PMx5h5P  ( XQ <4 8,! O$DC`P 4 0>$`-pP p P 0000001#100S30d8t#3/T3 dC-!B6!#!`p5!  / &  0800000 58 6 N0 L:P2 "08 h<0003/P ^ \20X20 P 003/PO@00 0 03/FA 0P001000 0ق8 0͂ 0‚|P^00<08 P/P P墂,9 00噂;!@0` (10 )1%0$10%1]0&1[0'192 TQ00x, 08u ЍM䄀75FqE焀儀&脀5FR脀k脀M6F 脀脀脀脀<‚脀脀鄀TE&鄀-鄀8@- <@<P'001(01$0 1 0$1G85Fb鄀<͂|ȂƂ8@-P@P80000$0< @5#8 8400 87F8@-0<0:08 @T=  00c  @T5 00c 0b' 0S0#' @T0% @T0 @T p2 0S   @320,2 @T 400 @}82@,2S@@ @2@ 0 000000!00S 3/VP[ 0`P B  `` ` ` ``daQ \!QL!B@($ ,   Q/P$ 0!@@ @ P 0"! ($ @ @, < 00S0S: H0 7F E0 R0/7FP0< Ӓ0 00/7FQS P 00$ 0//7FR P0(, //7FP 0 /7F8@-, @P20 0 , 0 $ 0 0 0 0 P8< \0p@-`4P4@ 0S@Pp7FQ <0\0440 \   /0 S//7F@-@P 40< 4#   P7F@- ( $  ,R @ HD @ L@T  ($   ,}2@J@$0  4 4 8 /7F/1 ` 0/N-\3LĠ PPAL PaLPP [pEPEwuPw匠 Z5P  [.  Z%"Z :ZbP f cP f bP f cP f  - @URwY0@-(Q!A 00T0s0 0 0 Q@0@@\0s00000R00@-(Q!A 00T0s0 0 0 QP@0P\0s0000R01 @-5A{ 00F8@-A`0= 00s000 0 _00=0-=`0Rs0P RP0S=0=00S 3/`P80@-@ 0S 3/00S3/1D-@`` !v`R  - - !-  r  w?  8 '1PpzP  Zw B C PpUw?`Ppv`P  Vw PpUN-`PMp } PI@Pw >11n?1 1=11= >C= 0]1101 0S{0 X'5}50B0@ Sq 0=0= 0=0!00S: 3/PP71S+ 0 0S 3/R0q<`00P`4uP/ </= 0==03= </=0= <l|/=0= <Pt/<0HH y}0V0=0,T=0 =l}Tg?$| \0  \%40 00V}/@00 0010ĭ= Z =PU`$3r R邀肀肀肀肀肀`LS `8S `0S`(S` SS`r/ } #0㼰 0 STI!~0 {PI= PyY1Z- 0 0l 0C"   | Ա`Q&0!1S# P# C" Y{/ , ̠ p OPP!0s0- RP1  pB# q=R1Q01=0CS0=ą]kPP=0Cs0S 1 T100|P00S 3/P}|}@PЍ}鄀EF鄀鄀鄀鄀鄀鄀鄀WFsƄꄀـƺ*ꄀ2ꄀt9999:9Pꄀ>;hꄀꄀF鄀ꄀꄀ-1 (8 !< //8@-@Q!1+! R 0S 3/$0 1&1 $88킀@-10S 3/p@-!Q0@T88#80w/t000@4`  Va4`S1, @@P@TVp0$0pPQF-4P$ (@U,p0nPP-P` VP> ĭZڡZեFFUPFuPSppW p W㶠p.p.pzW qUPfv``F#!%r  -H -\) 'W㸠p.p.pzWqUPfv``F@Ō |R/   - R R    0480E0D04 $0R0 . R( ,!p//( 0,@-@!#!1|.Q qU;//0P10@//0PS#Q 30@;Q r @   /F-p'@`PH -V<0{,`(P$p.<0@0 0S Z00|0 tD2V   @01P00MZ111400=-^P P0 oń/ـꄀFlF@- 90@#Q004 R- `Rv`-@$ p$ pbQpp$ `wp`$0p$p`|@-@@~P00,00@908@-@EP,0(00(0,0 0ss0 E0003/EP8PQ0@- 0P <(0LS (0(0C(@TS(0g \E@F-P90@0z_Pq0S㶠0PxP40zcS  $0` Sv` * c V1$ yD$0 $嶠$ 0R 3S F8@-, @(02! .1PP" "0 0== 0S, 1S , 01S t 0`Pv`=S=0=00S 3/pFWF/@-0P$30@0P00@7 @ @b///1@-@`  ` 0==S 0S 7 3/=0=8@-@Q-`0Rs0 0`00- 00==0=0 --= ="-8///PQ@- (0<@<P! P7 L0 q -  0D-PTBqT(T0{$`( `c@V@`# vq00v`@V0$ S0Tm0 =嶠(D0S00 00!0PQ@-@@; (0rQ40$@ .8

V1  ( P 03/00) P5 03/`10V 00$0 0S0  &0S@ @ 0SP 0P00 00[u@T @TNRu%0S NL 0SN-P B{!Ta 0 @T@D@001qz} r R{ |  0s0q00T 00^.$shSU S  S% S5,0( c Z 1 { QJ0305,02, S-(0[%:)0 Q% R01ŵ !0, ( bZ!zQ 0 ,0 ,#}sS 1S0 0 0`0(0S B0 !001 00F0T0TG섀*G1섀N-鼰+ {$`VP 0 PUPEP 0U1@0t@[ CCpwpW 70! 000 R :(S@ \0 c00sq Wp\ 0p ,00ЍN "B R@1 t 0@00pmpBM $@ 0HH0@@ 0!/ ЍN-P%Ա`{_ 0S@ @T@D@pTwp0 0@ r R 8 & R  "/R-0S*1nS !S" S  P @  l@pLt̄l  !10!(R B NpEp mu 0s0M  sr ps&wpjrpp (0 js0 S J , \, ^0s000S 0ss0 \x0305qs0Ys0 / ]0 000!0Zs0L0l00Z0 sr 00N1 ?0E001Sj0F0  0 L섀>GN-P`0Mp=S =  0 Z  0 `0 000 p0 %002 % &R ( \ - 00'0 00 S4"0 2 R0 R@00\ 0 \0  00S0S030S0#!0=$ 0$6S 0#01 0 0S0S0 $$6S(P 0s0S#$00S rr  R(0 B( \q>{t -?,  9Q $Z2 S/ Q㺢岱k[ Z$ڼ(b#Q lh{? Q $y\YY{ : Z  0, Rp\`9Q=& n?["  R  ! 000` {\@)  K%`$`"4Ct@P S02) \ 0r 0 0Y` 0 #r0Ѝ 0&!&, &/N-@ңP`pB07Fhp@-@h T`PP?SLppP 13/ 06SPUPPp7F{섀@-00 @0 0$6S0X00Ѝ@7F@-@0 0Ѝ@@-0000 0 0|Ѝ8@-@\P8p\0A?3` 0S8` @  X \ T 800Cc00 P  0 P 0 1 >3 0S  00eB1C R@ p  0S0Ps(3 p c0W Nn#@0000}p0 \ pb`0 P 2 0PG `0:0db 0S@0Zp0 [ T2$2 p b0W n1@  =p  0 S 0 p +>Aa00 P 0 uP0 1:0lQDA[ @p  `WV` 1 p `0W @m0@ @ @o =[ p =@`   R >0  .P 0 1 >(00 HAlm8Fw턀h;턀턀턀QJ@-@P Q }00P om0 @P gm00 0`0 T@ P \m0 0 040 (@PQm00 00 8Fh;N-MP, 00 S ` 4P $0KAPy [Rs 0( ~?M 0 3Peڌ@Vo @T\ 0 $00[ 0[S S pSpS pP& 000: S S  Spp0 ,0RS Z P&0 p@& R  $ P4 l W W Wxplhqk` mkl((2[`0Vy:KN-MP@(0 0 P $0 M / 0@ /R R 00 @/fpP0  Cp0 /R $0S |m K$0K`2#Pe pc $0SR! 00 0S dF 0S  @ , n, @T BP@ <R, 0 H0P,0 2l,0@0  1T 0/S)t0`` K$0KqlYW 0S 0( 0$00K8F@-@00X0 P 0LP TPT0S8F0@-  Q   0P  0S 0< 0  P08F8@-WP@mW/@6T&  08P #S?RL0 S50 0P@TXQ P 00@8$Ajk0888F8@-@80P  4000}DP88FN-@ PM`PPE0T U:j^PtQUx Z??  ` 01 HP  0R 0SPEuPU pBPᨐ PE  Up @D |P0@ 0  0S  S00  Q @9F`9Fp@-@P1,``PP p@ePP <0 S" S/08`PPp1\!M 0@Qp8G@8H9N-*Mp P` $ D {P P` 9Rl`T  T D R*h900* R H0P9H@H9p0$,X0k00d,9P@v``m00C#X0 rC)q06X0\0gP@ D0 S*.8(P _ P@@ *>@02DiX0*.PcH86<(*08 0@((^P dL`V| ~ w @u Y'`0 V!#rV> Rj`F v`[:L'@PD0 S?2P@dT 7 '*7 '0@PG7 S 0 R@`Fv`V C`F `F SV K JP0@ 0*.0 !C1S! S01V@ 6*&f0 Fo0@d@5 @0cS0S4 R~P yP 5* @%0 bRd FT!L45*.*0(%PH:$@?P 5@A4P2D0 S$ ?P!+D0@⺡ Sp 1 `P ` aP@;P  { [@-`P$4*$0,D `@\@ @C0@ 00 Q -  0RP $  Q0 Q 0 Q 0q3#  `A`AR  B `A`AR B `A`ARQ { @08b 0B<** i0Re$2 K @D@{0k0@! @!1[@!1** c10RL@@P@`TWc8@ @`P pMc.\1 @D0 SA$8p1 0 0,1@ @0*@P`5c@W`P 0* *0@,`P cP@ldVP@g@dY: c`@ 0@P*ލ8G8F9H9G? @9F`9F@8H_t񄀍񄀦 xH-? ? @@ M0?P?P0P  ;Ph `P 006D PR( P `Kx8F򄀽ȄȄx0 0@-TM P @὎P T H b 0@ @00,@L@0 TЍ08FN-M@(D d ,0P"d0 SP΍`t* ̰ h h X*hp !' T<*uPP pp`(* U  fb@{ S`Gx`  0`G3` x`@0|0eP`  0/S\S@@ '1Sʝ\P 0HC> 0  /S\S  ʝɟȟ0ʍP@U `$~d0( S8fPH00 0VSe  0 V 0  RZ@X V` ,(0 P0V %0SA  &Sʝ\  0g\ P+ ʝ\0V0 S! d/ aS H 0aP P\ 0R $ `$7 @F$\:d0P Sf0Ul `6Pp @Rx 00 'p0Up 0cP S030#SR ʝ\  _a@kP 0 00 /S\S ʝ\X SUʝ\00 SM p0d t5` R `%P0PXP%(50`0%~P$Ek000SY   RS@Q `$0 W 0` '0S; l )0SWW  D`RW P @ + 4W 0 `4/ `40S 4 0` 4P P @ \( $$$D3(#$0 \:`'PP(`d0 S?2Pl:0,ʝ\00S/H0E @P \$d2 Q`(Q 0CPX\᳠1*,\ (V`! P @ `PPd0 S20P* @( T@jp\`d@% V@1 @!`0 P E`@Q`d@g 3VI `PP@d0 S?2P:* p0@SP/d0 S2 0P)* pPW`:  0oP@`  0fP`@`gP_d0 S2 0P* p`@a pލ8F/ـ9Hbt򄀂9G @9F@-0 04@-pMA0S- _000CS^^^^^__^ t@_0_0 @P l_  P& @+@_pЍ8FDŽ DŽТDŽDŽDŽdфՄ0 @-@`Pp j_00 00 8@- Pp@ P_8/p@-@P`E_ p@8 0P/XGp@-0/S\S10/S\S !f RC 0A/R\R   ``P .Q Q \Q/Q /Q\Q @.T S\Q/Q\  0L/Q\Q  B PR 0T R/    / @ 0Q dQ00Q\ 0\/S\SL /Q\Q/\\\ ps;u;t;8@-0$@2PPR8t;0䄀l 0@-MBtT^/Q\Q 4 0 $"" 2/ۍt;DlLGp@-Pt M0`Bt\^/P\P < 0( ,"" 03?/@-@P`pP03?@„2 3?2/ 0 3?2/ @-1 @b\s@-P4`@ P 0 | D-`@T pPP,0p/S# /; P dP  @P0/S S / $  P@@0jPP0S P8@-P@  8@N-pjPPB[P`@-P:@gr/PJZ@D   PP(  P @/  @ V RT0@D0 ` V  V RvvP PPЍF-p@P#T ` P&0SPQZ0T  Q00Q0Sqq @- 0P p@-P@ Pp B0p@F-Pp(`@P   0P R@0S  N PP0Asp@-P`@P P  -P@@pD-p0t @PP 6 `  P  A P PeP@PT@-Pp`s@P  p P  P@@03?'S0<Ͽ\ : 03? S: 2/00R#3//D-@P(p(1`  3 10  172/p6o$`: 0 3?,#,8$#4 0p@-R @ 4O<Ͽ @ T `PbP6oU a bv pppp@-@P`Pp$ 0e2/ 2/$ 2/03? 0pp@-P`"2@Pp0Pe `R3?6o0P3?5_0 PpN-@:`P@ pl 7 p1y PPg  <Ͽ 01 PP  0 P  3? 0Pg3? 0 U`0( 01` 0 `P( 5_;0$P p@-@PP`6oV $ 2/PV40 P PpN-P(,p P ` 06o`Bo P;9: 7p A-@p`7PP oV 0AOPD-p`P@P `P@     00 @P q F-M`p0P@P&  0 @P  0  0@P05/  t00  0@T  > ЍF-MPp0@O`P'  0P   0 0`P0:  00  0`P  Ѝ@-Pp`@P0 0P@ 0 0 @N-P@`P2 0P*q)p P @Ppp; 0 mP4 0@ p  40p@-P`@  0p@p@-P@ P  P d01p@9pN-Pp@+7`P^V 2/R2$ 2/ `)  0G0 P R`E 0 0P  `P640 0:3?$0. (2/ Z& U*pT*  Qp  0 S P0:0402003?,#,8$#40`Ѝ 8@-@;PP$03? "u 02/3?03?08P p ,0`$0P////dG) 02/R//$0 3?@-<Ͽ @2/ b4O d* Q01$'Q8@-@P  805_P04 P02020088/F-@` $pP$03?S0<ϿP3?U 6o9: 7`5_p P@-0 @-p`P@P P $  ~ @8@-P@PP@408N-@ ppP9 `<Ͽ 6o P fPPi0$ PfPc02/1 Q*  0A 003? 0U  HP 45_0 P7?0 * @-@/PP92P2 40p 01$`2/3?b6o`( 6? 0 P 03?p 0p3? 2/03?0p P0SP 03?`06o`0P @-@0 P 0R@-0^0P # S:7@-@0P0$ 0QS>p@-`P@P  @el3@0P:@p04@- @ #D$@@4$s0RGp@- R 0 R!q ! P`A"!@ 1 p01 #p01 #p01 #p01 #\ 1U0p$P 0S "r ! "pI@-0@-@   0!E 0,Q/M@-  @U&@ZN-`p< &@P0 0 0S 0  KY 0U( &P0` 0 Kcq'& & P` `@@ UV 0T( ЍNTЍO N-XM`xP@@S@3&PUR-&PMX TUp1p! 0T ! T  r  r   T00S  0T0 0 S:PEW0:.  0SX`g DBT0T0TP ꄰ0 0VXЍ{YNN-`@PW 303 :% 0 `V p@PZUT# 2\WV:`Vp 0Pd@` UVN-P0@M`p$00 `(0<0d@P )T0`0d0p Pp  YdT  0rcpd `f`@Ѝ茌%+N@-\    @ Č @T @T\: Sl 0p@-@P`UU 00 00 000pD-@p`PQ P@PUp@-`Q0  p0S@ @PPS: %Q %Q0@0Vpp:I@-@Pd0    `0STTPPp0UT00:ID-P@p`0 0S P 0@@@0 0zPP@0U:0 :IF-@p`g@P0 0S  <P0PPP@P0T:0 :IN- M DP H@p :0 0S*m$0Q `V v  V9P4@\+W) \  L0 Q 0 7@$ pW   0=\C0#{T$Pp Ip Qp R \R Q  R0`S00KT:IN-8MPPp`A 00M080 2   @ R@P2     W 8 0S X0S ` @<` @ P @P R`@0 S S #S `0S`^ S`0S=S S R S S R=S000W0 =8 P7 00 ` 0\R R`  R W ` R0( 000K K,@ (@ Z00@S 8 @ @P | OP<0V*0S `Q8@ P  ^P$$9P`VK:I B@-P`@p  0S@6/P 0T@-@@0/PP@-P@p!`!UQ`g`00  /N@-@(P 0@80S *000C NN-@T PU 0p c` PUVQ V `Q`UpbqPPPaPPPSP`DS*qp⇑qpp pY. p Z )    \0:`'U$T01 3 Q5`F25 5`"'a  %*V0@@Q5 5 !0 pp10/0 0 0 X0\0P T0/0PN-PPp @ ` @cp@H`D@@UV \  \' V`{ `Tp{ pXI     Z:PVPPW T0 bT P0 ecTN>P:0@-0 @ PPQ *T: S0 S1#00N-pP `PGp iq1@T+:S@ Z&* @T@e@e  00P PE i  P@ AT:@e@ Z  T RKpG[Ѝp@-P@`P Nps0@-0P X \@Q:  BQ0 S//s@-@P `PT  TpT @0S@`V5|RQN-P.A@@@T: p``d0 0 ;/ 0Pp W: QV*e@PSR@-0 dP@`0\ S \ pp | 0s0\@R cN 0 R 0/0S/\0/ 0S\0/R@-@@0S0R00@T@0 lR0|/@-0@lT0 S|qR 0R0/0 0Q`/8@-@PuP00C R8T80S `/0\8@-PP@sO@P w8@-0\ @T\  A0@- S@T0SAp@-@P`h0@TP 0P@@S0P P 0S00p:I8@-P@T P  8P/0S 0 CCSQ/0 SR//@- Ąq@00S0@cT  00S00S/Q@-00 0c\0 0@@0SQ/P00S/0b0 R*/0@-0P@0 T0S0 0S/P/D-Pp`P @ @DP T PdP q0\/P/@-}_@H@` p(V  P @B p@-@`TP1P!@Tp耖@-@@DT@-QQb!6 @ @ q$!@ Ua0PQe0PP  l10Q1c0000wN-` fР0! S R: : @P0  n! [[+&0 0+ 0 ᓾk0傱   j 0!a0 b00  ~蟆p@-Q`@`P60  PE0R00SR P0`RpN-XM@Pxp@|` W P R r0`F-`F+`F Y W`F`F 000 W WG r|  A 0 >k0[ 00`c    RZ/`F@`bZY W0 @X  @  0 RZ/`F@`b 0 0C[ 00SZ[ 0  0SZVXЍON-PMpP}%S:@p0+S  S #S -S 0S @@@@@@0C \` 6&0`F00C P *S``0V`f@ 0.S000@ \ p *0J00A \*P0Z  hP LQ ZQ zQ tQplQplPpL0nS cS %S XSdS iSsS oS pSuS xS0 0`FV0   `FVʚ@ 0 0MS ISo iS mSj@@(0 ,@:0[ R R00F@@06S$ (0 @: 0[, , R R004S@@"($   b00S*[.00[00@@@( 0 v0 @!@` @H 04Pp0T0 F0 ` ?0= @ @%000SP0pGP. LQ 0  lQ  0ZS 0tQ  hQ0Sq q S ?A @P p0S~ 0bPЍONp@-00S 0x\@ D0 R R ``0 P0@DQ p00C 0Cs070CS:PpN@-00@pP`P 0S R 0d0V R@--\`@@-@0 KR GRMR kR iR BR000N-00Q x\@ D 'R $R 【`pꐢ +  @PDS0D D7D{7K_ @UT:N@-@0 KR GRMR kR    iR BR000-@-  @ Ѝ/-@-H H3 0꠆@-p@-0D@P0@@ `0F PPp :IImJN-HM0@ C :S000C0 0,@ 0a8@,BT@0C B D$ @D( <@X@, 0PD4`@D4LpFP8< @@,@ P@0`pD@RP@DB @ @ ꔓP$P@  $@'  PPr%<UP EL8(P  ( k$r , \(0 Ō `0 Ǽ0  k"9j@a@ DajA!H jJ*L0DH,LQ@  C" RB $P Br $@R SV (000S8 R [PPkA`Q <\Q |P P:QpaAl[ 8P PQ,@09[,P PC Q PA Pw@Y㰠0 10pЍM0?`0P0`0 0[ K0ePU 0Sv  &$ 0  < <`&d=`P0`00+ [ K ePU @`R`<` < <`&d=`` 0S P000 % @ [ p1p!W 0S P 0 bQ  b $0    @0 gpg@p@0S0@0000+" [ p pR Q @0 S702@05\ W:0    \ g z 0S 0@0000*" [n p pR $Q @0( S702@05\ W:0    j\ g M 0S$ 00   0[A K0ePU1V:%P` 0S$,  0  ?4[$ K0ePU&,&4,<l0d`4``P 00 0Sp0 p8`l0pL0 0T0T00/>0l0P7*0h000`pd0 p0(0xTpL wpG0S[! 0K ePP[ K ePU:6cPc0hOP [ K ePU:Q6cPc1 0  &a6PE&P [ K ePU:6c  a[ K ePU:6c  cc0P(pQ (5000 hh7 R*h( Q:0S lp/΄S>l0pL0 0 T0T00P4`l08P00X0X00d PX4{00p1[W p $8`mPO!= Sh\l pL@00p0V0S 07[] K0ePU$p0 g0R0000 0S b Y40S&4&,<004 S 1p00$p0WP`$000S 0S 0[ K0ePU0V 10007P`0000pp(0pS p8`00 8@@I8:IAIAIAI@-\@0SI T&3 bRX60X6 S f>0X6@\T@8:IRN-M@` a>k0?s0Sf0?s0 SapW^PU[t0SW   =0 RN0?s0S SG (`u,  0@ 0#      0 H'0 pR"  P0UP  G0 `PP0S "2L0 hp N< `;< R R RYЍ@IcScAI=@IAI@I_I@I AI3N- MaP㨑 P%<@%q+x30@0P 0 a P!p $ ( , P! 0 P! 4 P! 08    0B0 8< p0tp  P0 pC D0PND <0 0 Ѝ@IAIH@I= AIx郀@-,00 S ;@@z@I\v/@-L2H @Q P(PP@^1@Is@-@`PT  pT @0S@PU|@-@[20  0 0 0 0  @-M@ &1Ѝ@-@8Q4 M0    Ѝp@-`P` \\09;XwT0@TP@ DP 4@0Tp}Y@I,0 0R 8Q 40S0/@I00S8/@I@-,M@`P  %P `l P   P <:4:0 :  0  0 0 0 0  00S-0U 1P0  0 0 0 0  d0Up\ 0C8:003/,ЍY%8@-@TP R0@@04Q4@040080008@I@-00S   4Q Q4S4P S 40S00 $0R @I@-@t1@  eTUX+1P L %D1D!S  P0 (!R P ,:`@TP:?>T.P1pA7T80S ::W &P@9 9P 9x8 P h94@P0TN 9@I AI UvB@- @P,03/0  @I,0 @-@P $T`0 @@ 0S$0 T h  \ p@Pp`I[@It=D@ @-l00l0S(2@2}@2`I\Ds@-0AQh010P0p0X00S10S( #, s S4XX2 :`P  PXXx(AXXP`0XPQ0@A 2P 20S 00S  0R n20@X` h2Q b20 40X2}|,0 l\ /T  lЍp@`I AIAI@I)AIAIh_Iـ$DT_I@-O 0 @ID-P`@"2j 0 +0@0 @ppl; 0 c000` a?a1 TD0p@0,0DG0iIAI<:IAI@ID:I@I@IF-p0@`S S,   0 0R0  + P PP P FPQ 0iI@I@Id1s@-PX!00C@SF<<<0PavPoPk  0 P@d;08#$40@<|0<0H@ <\0<0?@@0@0|AI8iI8@-T@TP0 00S<<q08@Z0^0(0S88@8iI=xs@-|A'P  d2`8'TBP  Q*4G0$2/ $R$2$B`0V02 0S( #, s S4h `)0:W`P ` 00lQdAl0h0d 0\0S P1 R 00 S ,/(A /  /Q  /0!4 @/0`P//00 00E0`0E `<0Ѝp@= AIAI8iI@IAIAIh_ID>P00* H 04 RU%H 4 R/PDs@-+cPcP @PPP 0cP pZ/h`0S P 0cPQ 4X/0G/0(  0|蠆T8>U30@-MLP @-4 @ %  %@%Ѝ08>+61s@-`0&46S0S #=yG 焀 @-.// Q/#:P ?o/o C02 P@  !P@ !!P!@ #!!P@ !!P#2!///o b0/P[Q @-@A/Q0  aB Q 00`BS /ooB  S0C !S0C !!S!1C "!S1C !S""!\`B/<`B/3//o b\3`B/PQ @-@A/ 0R b0A1Q A1/ 0R b0AQQ AQ/ 0R bAQ0A/@-mLM DG DGD%pDHHH\\\] ]]]]&]-]4]<]D]L]T]\]d]l]s]z]]]]]]]]]]]]]<%($p$do_dfu}r},}}!}$}(}+}.}2}5}9}raw_accessdo_env_importdo_env_exportU-Boot 2013.04-dirty (Apr 20 2013 - 08:30:43), bootcmd=gpio set 53; i2c mw 0x24 1 0x3e; run findfdt; mmc dev 0; if mmc rescan ; then echo micro SD card found;setenv mmcdev 0;else echo No micro SD card found, setting mmcdev to 1;setenv mmcdev 1;fi;setenv bootpart ${mmcdev}:2;mmc dev ${mmcdev}; if mmc rescan; then gpio set 54; echo SD/MMC found on device ${mmcdev};if run loadbootenv; then echo Loaded environment from ${bootenv};run importbootenv;fi;if test -n $uenvcmd; then echo Running uenvcmd ...;run uenvcmd;fi;gpio set 55; if run loaduimage; then gpio set 56; run loadfdt;run mmcboot;fi;fi;bootdelay=1baudrate=115200arch=armcpu=armv7board=am335xboard_name=am335xvendor=tisoc=am33xxloadaddr=0x80200000kloadaddr=0x80007fc0fdtaddr=0x80F80000fdt_high=0xffffffffrdaddr=0x81000000bootdir=/bootbootfile=uImagefdtfile=am335x-boneblack.dtbconsole=ttyO0,115200n8optargs=mtdids=nand0=omap2-nand.0mtdparts=mtdparts=omap2-nand.0:128k(SPL),128k(SPL.backup1),128k(SPL.backup2),128k(SPL.backup3),1920k(u-boot),128k(u-boot-env),5m(kernel),-(rootfs)dfu_alt_info_mmc=boot part 0 1;rootfs part 0 2;MLO fat 0 1;MLO.raw mmc 100 100;u-boot.img.raw mmc 300 3C0;u-boot.img fat 0 1;uEnv.txt fat 0 1dfu_alt_info_emmc=rawemmc mmc 0 3751936dfu_alt_info_nand=SPL part 0 1;SPL.backup1 part 0 2;SPL.backup2 part 0 3;SPL.backup3 part 0 4;u-boot part 0 5;kernel part 0 7;rootfs part 0 8mmcdev=0mmcroot=/dev/mmcblk0p2 rommcrootfstype=ext4 rootwaitbootpart=0:2nandroot=ubi0:rootfs rw ubi.mtd=7,2048nandrootfstype=ubifs rootwait=1nandsrcaddr=0x280000nandimgsize=0x500000rootpath=/export/rootfsnfsopts=nolockstatic_ip=${ipaddr}:${serverip}:${gatewayip}:${netmask}:${hostname}::offramroot=/dev/ram0 rw ramdisk_size=65536 initrd=${rdaddr},64Mramrootfstype=ext2mmcargs=setenv bootargs console=${console} ${optargs} root=${mmcroot} rootfstype=${mmcrootfstype}nandargs=setenv bootargs console=${console} ${optargs} root=${nandroot} rootfstype=${nandrootfstype}spiroot=/dev/mtdblock4 rwspirootfstype=jffs2spisrcaddr=0xe0000spiimgsize=0x362000spibusno=0spiargs=setenv bootargs console=${console} ${optargs} root=${spiroot} rootfstype=${spirootfstype}netargs=setenv bootargs console=${console} ${optargs} root=/dev/nfs nfsroot=${serverip}:${rootpath},${nfsopts} rw ip=dhcpbootenv=uEnv.txtloadbootenv=load mmc ${mmcdev} ${loadaddr} ${bootenv}importbootenv=echo Importing environment from mmc ...; env import -t $loadaddr $filesizeramargs=setenv bootargs console=${console} ${optargs} root=${ramroot} rootfstype=${ramrootfstype}loadramdisk=load mmc ${mmcdev} ${rdaddr} ramdisk.gzloaduimage=load mmc ${bootpart} ${kloadaddr} ${bootdir}/${bootfile}loadfdt=load mmc ${bootpart} ${fdtaddr} ${bootdir}/${fdtfile}mmcboot=echo Booting from mmc ...; run mmcargs; bootm ${kloadaddr} - ${fdtaddr}nandboot=echo Booting from nand ...; run nandargs; nand read ${loadaddr} ${nandsrcaddr} ${nandimgsize}; bootm ${loadaddr}spiboot=echo Booting from spi ...; run spiargs; sf probe ${spibusno}:0; sf read ${loadaddr} ${spisrcaddr} ${spiimgsize}; bootm ${loadaddr}netboot=echo Booting from network ...; setenv autoload no; dhcp; tftp ${loadaddr} ${bootfile}; tftp ${fdtaddr} ${fdtfile}; run netargs; bootm ${loadaddr} - ${fdtaddr}ramboot=echo Booting from ramdisk ...; run ramargs; bootm ${loadaddr} ${rdaddr} ${fdtaddr}findfdt=if test $board_name = A335BONE; then setenv fdtfile am335x-bone.dtb; fi; if test $board_name = A335BNLT; then setenv fdtfile am335x-boneblack.dtb; fi; if test $board_name = A33515BB; then setenv fdtfile am335x-evm.dtb; fi; if test $board_name = A335X_SK; then setenv fdtfile am335x-evmsk.dtb; fiset_default_envenv_importsdxbimaroc8(Hsaveenvfdt_fixup_memory_banksethaddr__of_translate_addressƹ̹ҹٹไ乄󹄀 ــ!'-1;5?D INS^insz ӡ ú ɺѺ޺纄𺄀 ــ $j6GPYary лٻ󻄀 "9Bf[iip{ ــҼ׼缄켄ــ  miiphy_register( w ń0ńCńSń]ńińsńńCźdfu_writedfu_readdfu_fill_entityʄʄʄʄȄʄʄʄmmc_file_opdfu_read_medium_mmcdfu_write_medium_mmcdfu_fill_entity_mmcnand_block_opdfu_write_medium_nanddfu_read_medium_nanddfu_fill_entity_nandg΄l΄j΄i΄1234567890-= qwertyuiop[] asdfghjkl;'`\zxcvbnm,./ 789-456+1230. #(-27<FP'@Bmmc_set_iosmmc_reset_controller_fsmmmc_send_cmdmmc_read_datammc_write_datammc_init_streammmc_init_setupverify_bbt_descrcreate_bbtԄԄԄԄԄ ԄԄ,ԄԄՄ Մ3@ Մs@6ՄC@MՄS@dՄ5 @zՄu @ՄE @ՄU @Մ6@@Մv@@ՄF@@քV@@քx@ք9@/քy@Fքr@FքI@^քt@^քY@vքq@Մ@Մ@Մ@Մ@Մ@Մ@ք@ք@ք/ք/քFք^քFքքvքքքքքׄׄ2ׄGׄ\ׄrׄׄׄׄׄׄׄ؄؄4؄ I؄ ^؄ t؄ ؄@؄:@؄*@؄J@؄؄<ل,'لL>لTل>jل.لN0ք@UVY ZZ YVUe03f2.Qp:Yxʱ -No0 P%@Fpg`ڳ=^"25BRwbVr˥nO, 4$ftGd$TDۧ_~<&6WfvvF4VLm/ș鉊DXeHx'h8(}\?؛uJTZ7jz *:.lMͪɍ&|ld\EL<, >]|ߛُn6~UNt^.>0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z- $-6?HAZSle~w =4/&QXCJu|gn2; ) zsha^WLE+"90cjqxGNU\dmv@IR[,%>7}tofYPKB5<'. V_DMr{`i :3(!OF]Tkbyp#*18AHSZelw~ -$?6XQJC|ung 4=&/szahW^EL;2)  jcxqNG\U"+09%,7>mdvI@[R<5.' t}foPYBK 3:!(_VMD{ri`*#81FOT]bkpy(((((AAAAAABBBBBBEPTGMK0123456789ABCDEF0123456789abcdef #+3;CScs@@ !1Aa  0@``Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     ــv7_dcache_inval_rangeext4fs_devreadeth_get_dev_by_nameERROR: %s - start address is not aligned - 0x%08x ERROR: %s - stop address is not aligned - 0x%08x I2C: %s baudrateNAND: MMC: loadaddrNet: ### ERROR ### Please RESET the board ### fdtcontroladdrDRAM: machidUsing machid 0x%lx from environment Starting kernel ... bootargsFDT creation failed! hanging...Bad Linux ARM zImage magic! Resetting CPU ... pc : [<%08lx>] lr : [<%08lx>] sp : %08lx ip : %08lx fp : %08lx r10: %08lx r9 : %08lx r8 : %08lx r7 : %08lx r6 : %08lx r5 : %08lx r4 : %08lx r3 : %08lx r2 : %08lx r1 : %08lx r0 : %08lx Flags: %c%c%c%c IRQs %s FIQs %s Mode %s%s undefined instruction software interrupt prefetch abort data abort MAYBE you should read doc/README.arm-unaligned-accesses not used fast interrupt request USER_26FIQ_26IRQ_26SVC_26UK4_26UK5_26UK6_26UK7_26UK8_26UK9_26UK10_26UK11_26UK12_26UK13_26UK14_26UK15_26USER_32FIQ_32IRQ_32SVC_32UK4_32UK5_32UK6_32ABT_32UK8_32UK9_32UK10_32UND_32UK12_32UK13_32UK14_32SYS_32resetting ... WARNING: Caches not enabled %-12s= 0x%08lX (not set)arch_numberboot_paramsDRAM bank-> start-> sizeeth%dname = %s eth%iaddrethaddr%-12s= %s current eth = %s ipaddrip_addr = %s baudrate = %u bps TLB addrrelocaddrreloc offirq_spsp start bdinfoprint Board Info structure## Starting application at 0x%08lX ... ## Application terminated, rc = 0x%lX resetPerform RESET of the CPUgostart application at address 'addr'addr [arg ...] - start application at address 'addr' passing 'arg' as arguments ## Checking Image at %08lx ... Legacy image found Bad Magic Number Bad Header Checksum Verifying Checksum ... Bad Data CRC OK Unknown image format! bootcmd## Transferring control to Plan 9 (at address %08lx) ... ## Transferring control to RTEMS (at address %08lx) ... ## Transferring control to NetBSD stage-2 loader (at address %08lx) ... XIP %s ... Loading %s ... Uncompressing %s ... GUNZIP: uncompress, out-of-mem or overwrite error - must RESET board to recover Unimplemented compression type %d verify## Booting kernel from Legacy Image at %08lx ... Unsupported Architecture 0x%x Wrong Image Type for %s command Wrong Image Format for %s command ERROR: can't get kernel image! ERROR: unknown image format type! Could not find kernel entry point! Ramdisk image is corrupt or invalid Could not find a valid device tree Trying to execute a command out of order initrd_startinitrd_endcmdline subcommand not supported bdt subcommand not supported prep subcommand not supported WARNING: legacy format multi component image overwritten ERROR: new format image overwritten - must RESET the board to recover autostartnofilesizeERROR: booting os '%s' (%d) is not supported yesAutomatic boot of image at addr 0x%08lX ... Your platform's zImage format isn't supported yet! bootzboot Linux zImage image from memoryiminfoprint header information for application imageaddr [addr ...] - print header information for application image starting at address 'addr' in memory; this includes verification of the image contents (magic number, header and payload checksums)bootdboot default, i.e., run 'bootcmd'bootmboot application image from memoryloadosramdiskcmdlinebdtprepList of available devices: %-8s %08x %c%c%c coninfoprint console devices and informationdfu_alt_info%s: "dfu_alt_info" env variable not defined! listDevice Firmware Upgrade [list] - device firmware upgrade on a device attached to interface [list] - list available alt settings Loading from %s device %d, partition %d: Name: %.32s Type: %.32s ** Read error on %d:%d ** Bad Header Checksum ** ** Unknown image type \cecho args to console[args..] - echo args to console; \c suppresses newline EEPROM @0x%lX %s: addr %08lx off %04lx count %ld ... eepromEEPROM sub-systemread devaddr addr off cnt eeprom write devaddr addr off cnt - read/write `cnt' bytes from `devaddr` EEPROM at offset `off'exitexit scriptext2loadload binary file from a Ext2 filesystem [addr] [filename] [bytes] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from ext2 filesystem. All numeric parameters are assumed to be hex.ext2lslist files in a directory (default /) [directory] - list files from 'dev' on 'interface' in a 'directory'ext4loadload binary file from a Ext4 filesystem [addr] [filename] [bytes] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from ext4 filesystem. All numeric parameters are assumed to be hex.ext4ls ** Unable to use %s %d:%d for fatwrite ** ** Unable to write "%s" from %s %d:%d ** %ld bytes written usage: fatinfo [] ** Unable to use %s %d:%d for fatinfo ** fatwritewrite file into a dos filesystem - write file 'filename' from the address 'addr' in RAM to 'dev' on 'interface'fatinfoprint information about filesystem [] - print information about filesystem from 'dev' on 'interface'fatls [] [directory] - list files from 'dev' on 'interface' in a 'directory'fatloadload binary file from a dos filesystem [] [bytes [pos]] - Load binary file 'filename' from 'dev' on 'interface' to address 'addr' from dos filesystem. 'pos' gives the file position to start loading from. If 'pos' is omitted, 0 is used. 'pos' requires 'bytes'. 'bytes' gives the size to load. If 'bytes' is 0 or omitted, the load stops on end of file. If either 'pos' or 'bytes' are not aligned to ARCH_DMA_MINALIGN then a misaligned buffer warning will be printed and performance will suffer for the load. All numeric parameters are assumed to be hex.The address of the fdt is invalid (NULL). libfdt fdt_check_header(): %s - too old, fdt %d < %d - too new, fdt %d > %d", "* 0x%p [0x%08x]<0x%08x%s[%02x%sfdtaddr/* NULL pointer error */The address of the fdt is %p New length %d < existing length %d, ignoring. libfdt fdt_open_into(): %s No FDT memory address configured. Please configure the FDT address via "fdt addr

" command. Aborting! moNew length 0x%X < existing length 0x%X, aborting. mklibfdt fdt_path_offset() returned %s libfdt fdt_add_subnode(): %s Sorry, I could not convert "%s" Unexpected character '%c' libfdt fdt_setprop(): %s libfdt node not found 0x%08Xerror: unprintable value 0x%plibfdt fdt_getprop(): %s %s%s { Nested too deep, aborting. %s}; %s%s; %s%s = %s/* NOP */ Unknown tag 0x%08X libfdt fdt_delprop(): %s libfdt fdt_del_node(): %s magic: 0x%x totalsize: 0x%x (%d) off_dt_struct: 0x%x off_dt_strings: 0x%x off_mem_rsvmap: 0x%x version: %d last_comp_version: %d boot_cpuid_phys: 0x%x size_dt_strings: 0x%x size_dt_struct: 0x%x number mem_rsv: 0x%x boorsindex start size ------------------------------------------------ libfdt fdt_get_mem_rsv(): %s %x %08x%08x %08x%08x libfdt fdt_add_mem_rsv(): %s libfdt fdt_del_mem_rsv(): %s flattened device tree utility commands [ [directory]] - List files in directory 'directory' of partition 'part' on device type 'interface' instance 'dev'.load binary file from a filesystem [ [ [ [bytes [pos]]]]] - Load binary file 'filename' from partition 'part' on device type 'interface' instance 'dev' to address 'addr' in memory. 'bytes' gives the size to load in bytes. If 'bytes' is 0 or omitted, the file is read until the end. 'pos' gives the file byte position to start reading from. If 'pos' is 0 or omitted, the file is read from the start. All numeric parameters are assumed to be decimal, unless specified otherwise using a leading "0x".cmd_gpiogpio: requesting pin %u failed gpio: pin %s (gpio %i) value is %lu input/set/clear/toggle gpio pins - input/set/clear/toggle the specified pin?alias for 'help'helpprint command description/usage - print brief description of all commands help command ... - print detailed usage of 'command'Error writing the chip. Error reading the chip. Valid chip addresses: %02X%04x: %02xCRC32 for %08lx ... %08lx ==> Error writing to the chip. %08lx: Error reading the chip, %02lx %04lx %08lx ? Current bus is %d Setting bus to %d Failure changing bus number (%d) Current bus speed=%d Setting bus speed to %d Hz Failure changing bus speed (%d) i2cI2C sub-systemcrc32devloopmmmwnmprobeUnknown operator '%s' Invalid data width specifier itestreturn true/false on integer compare[.b, .w, .l, .s] [*]value1 [*]value2-lt-gt-eq==-ne!=<>-ge>=-le<=## Total Size = 0x%08x = %d Bytes ## First Load Addr = 0x%08lX ## Last Load Addr = 0x%08lX ## Total Size = 0x%08lX = %ld Bytes loads_echo## Ready for S-Record download ... ## S-Record download aborted ## Start Addr = 0x%08lX ## Switch baudrate to %d bps and press ENTER ... loady## Ready for binary (ymodem) download to 0x%08lX at %d bps... ## Ready for binary (kermit) download to 0x%08lX at %d bps... ## Binary (kermit) download aborted ## Switch baudrate to %d bps and press ESC ... load binary file over serial line (ymodem mode)[ off ] [ baud ] - load binary file over serial line with offset 'off' and baudrate 'baud'loadbload binary file over serial line (kermit mode)loadsload S-Record file over serial line[ off ] - load S-Record file over serial line with offset 'off'Base Address: 0x%08lx Testing %08x ... %08x: Iteration: %6d Pattern %08lX Writing...%12sReading... Mem error @ 0x%08X: found %08lX, expected %08lX Tested %d iteration(s) with %lu errors. bytehalfword%s at 0x%08lx (%#0*lx) != %s at 0x%08lx (%#0*lx) Total of %ld %s(s) were the same Zero length ??? %08x %04xmtestsimple RAM read/write test[start [end [pattern [iterations]]]]infinite loop on address range[.b, .w, .l] address number_of_objectsbaseprint or set address offset - print address offset for memory commands base off - set address offset for memory commands to 'off'checksum calculationaddress count [addr] - compute CRC32 checksum [save at addr]cmpmemory compare[.b, .w, .l] addr1 addr2 countmemory copy[.b, .w, .l] source target countmemory write (fill)[.b, .w, .l] address value [count]memory modify (constant address)[.b, .w, .l] addressmemory modify (auto-incrementing address)memory display[.b, .w, .l] address [# of objects]sleepdelay execution for some timeN - delay execution for N seconds (N is _decimal_ !!!)OKERRORNo MMC device available rescanno mmc device at slot %x get mmc type error! #part_num shouldn't be larger than %d Card doesn't support part_switch switch to partions #%d, %s mmc%d is current device mmc%d(part %d) is current device erase MMC %s: dev # %d, block # %d, count %d ... Error: card is write protected! %d blocks %s: %s YesNoDevice: %s Manufacturer ID: %x OEM: %x Name: %c%c%c%c%c Tran Speed: %d Rd Block Len: %d %s version %d.%d High Capacity: %s Capacity: Bus Width: %d-bit mmcMMC sub systemread addr blk# cnt mmc write addr blk# cnt mmc erase blk# cnt mmc rescan mmc part - lists available partition on current mmc device mmc dev [dev] [part] - show or set current mmc device [partition] mmc list - lists available devicesmmcinfodisplay MMC info- display info of the current MMC devicenoronenand%s%dDevice %s not found! invalid partition number %d for device %s%d (%s) %ug%um%ukmtddevnummtddevname%s%d,%dcannot add second partition at offset 0 %s: offset %08x beyond flash size %08x %s%d: partition (%s) size too big %s: partitioning exceeds flash size %s%d: partition (%s) start offsetalignment incorrect %s%d: partition (%s) size alignment incorrect %s%d: partition (%s) start offset alignment incorrect mtdparts=mtdpartsinvalid mtd device '%.*s' partition size too small (%lx) no closing ) found in partition name empty partition name no partitions allowed after a fill-up partition unexpected character '%c' at the end of partition out of memory 0x%08lx@0x%08lxno partitions for device %s%d (%s) unexpected character '%c' at the end of device incorrect device type in %s incorrect device number in %s no partition number specified unexpected trailing character '%c' no such device %s%d no such partition nand0=omap2-nand.0mtdidsmtdids too long (> %d) mtdparts variable not set, see 'help mtdparts' mtdparts too long (> %d) mtdids: incorrect mtdids: no identifier device id %s%d redefined, please correct mtdids variable could not initialise device list mtdparts variable doesn't start with 'mtdparts=' device %s%d redefined, please correct mtdparts variable mtdparts_init: no valid partitions defaultmtdparts=omap2-nand.0:128k(SPL),128k(SPL.backup1),128k(SPL.backup2),128k(SPL.backup3),1920k(u-boot),128k(u-boot-env),5m(kernel),-(rootfs)delall device %s%d <%s>, # parts = %d #: name size offset mask_flags %2d: %-20s0x%08x 0x%08x %d no partitions defined active partition: %s%d,%d - (%s) 0x%08x @ 0x%08x could not get current partition info defaults: mtdids : %s mtdparts: addno such device %s defined in mtdids variable too long partition description %s:%s(%s)%sgenerated mtdparts too long, resetting to null delcurrent partition deleted, resetting current to 0 partition %s not found no partition id specified partition changed to %s%d,%d define flash/nand partitionschpartchange active partitionpart-id - change active partition (e.g. part-id = nand0,1)No such device Device %d: %s... is now current device .jffs2.e.iUnknown nand load suffix '%s' Loading from %s, offset 0x%lx ** Read error Not a NAND device bootdevice ** No boot device ** ** Device %d not available %dx %s, sector size %u KiB Page size %8d b OOB size %8d b Erase size %8d b nand_writesizenand_oobsizenand_erasesizenot a NAND device Offset exceeds device limit '%s' is not a number Size exceeds partition or device limit device %d whole chip offset 0x%llx, size 0x%llx quietdump no devices available Device %d bad blocks: %08llx scrubclean-y.spread.part.chip NAND %s: Warning: scrub option will erase all factory set bad blocks! There is no reliable way to recover them. Use this command only for testing purposes if you are sure of what you are doing! Really scrub this NAND flash? scrub aborted .oobNo memory for page buffer Error (%d) reading page %08lx Page %08lx dump: %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x OOB: %02x %02x %02x %02x %02x %02x %02x %02x .raw%s: error at offset %llx, ret %d Unknown nand command suffix '%s'. %zu bytes %s: %s markbadblock 0x%08lx NOT marked as bad! ERROR %d block 0x%08lx successfully marked as bad biterrnbootboot from NAND device[partition] | [[[loadAddr] dev] offset]NAND sub-systemgatewayipnetmaskhostnamerootpathserveripdnsipdnsip2domainping failed; host %s is not alive host %s is alive pingsend ICMP ECHO_REQUEST to network hostpingAddressnfsboot image via network using NFS protocol[loadAddress] [[hostIPaddr:]bootfilename]dhcpboot image via network using DHCP/TFTP protocoltftpbootboot image via network using TFTP protocolbootpboot image via network using BOOTP/TFTP protocol%s=%s ## Error: cannot export environment Environment size: %d/%ld bytes ## Error: "%s" not defined ## Warning: defaulting to text format ## Info: input data size = %zu = 0x%zX ## Error: bad CRC, import failed ERROR: Environment import failed: errno = %d at %s:%d/%s() cmd_nvedit.c## %s: only one of "-b", "-c" or "-t" allowed ## Warning: Input data exceeds %d bytes - truncated ## Resetting to default environment Saving Environment to %s... ## Error: illegal character '='in variable name "%s" ## Can't malloc %d bytes ## Error inserting "%s" variable, errno=%d Please enter '%s': setenvERROR: Cannot export environment: errno = %d at %s:%d/%s() %zXenv_buf [%d bytes] too small for value of "%s" edit: runrun commands in an environment variablevar [...] - run the commands in the environment variable(s) 'var'askenvget environment variables from stdinname [message] [size] - get environment variable 'name' from stdin (max 'size' chars)set environment variables[-f] name value ... - [forcibly] set environment variable 'name' to 'value ...' setenv [-f] name - [forcibly] delete environment variable 'name'printenvprint environment variables[-a] - print [all] values of all environment variables printenv name ... - print value of environment variable 'name'editenvedit environment variablename - edit environment variable 'name'environment handling commandssaveenvsave environment variables to persistent storagedeleteeditexportimportprintsavemallocFailed to initialize SPI flash at %u:%u No SPI flash selected. Please run `sf probe' updateERROR: attempting %s past flash size (%#x) Failed to map physical memory Updating, %zu%% %lu B/sSPI flash failed in %s step %zu bytes written, %zu bytes skipped in %ld.%lds, speed %ld B/s SPI flash %s failed sfSPI flash sub-systemprobe [[bus:]cs] [hz] [mode] - init flash device on given SPI bus and chip select sf read addr offset len - read `len' bytes starting at `offset' to memory at `addr' sf write addr offset len - write `len' bytes from memory at `addr' to flash at `offset' sf erase offset [+]len - erase `len' bytes from `offset' `+len' round up `len' to block size sf update addr offset len - erase and write `len' bytes from memory at `addr' to flash at `offset'Bad magic number Bad header crc Bad data crc Bad image type Empty Script Wrong image format for "source" command ## Executing script at %08lx sourcerun script from memory-o-a-z-ntruedo nothing, successfullyfalsedo nothing, unsuccessfullyminimal test like /bin/sh[args..]See InterfaceAudioCommunicationHuman InterfacePrinterMass StorageHubCDC DataVendor specificusbHuman Interface, Subclass: NoneBoot KeyboardMousereservedMass Storage, RBC SFF-8020i (ATAPI)QIC-157 (Tape)UFISFF-8070Transp. SCSICommand/BulkCommand/Bulk/IntBulk only480 Mb/s1.5 Mb/s12 Mb/s+- %s (%s, %dmA) %s %s %s %s String: "%s"Self Powered Bus Powered Remote Wakeup InOut Configuration: %d - Interfaces: %d %s%s%dmA Interface: %d - Alternate Setting %d, Endpoints: %d - Class - - Endpoint %d %s IsochronousInterrupt MaxPacket %d Interval %dms%d: %s, USB Revision %x.%x - %s %s %s - Class: - Class: (from Interface) %s - PacketSize: %d Configurations: %d - Vendor: 0x%04x Product 0x%04x Version %d.%d (Re)start USB... stopstopping USB.. USB is stopped. Please issue 'usb start' first. treeUSB device tree: infconfig for device %d *** No device available *** stor no USB devices available no current device selected USB read: device %d block # %ld, count %ld ... %ld blocks read: %s USB write: device %d block # %ld, count %ld ... %ld blocks write: %s USB device %d: unknown device Device %d: usbbootboot from USB deviceloadAddr dev:partUSB sub-systemstart - start (scan) USB controller usb reset - reset (rescan) USB controller usb stop [f] - stop USB [f]=force stop usb tree - show USB device tree usb info [dev] - show available USB devices usb storage - show details of USB storage devices usb dev [dev] - show or set current USB storage device usb part [dev] - print partition table of one or all USB storage devices usb read addr blk# cnt - read `cnt' blocks starting at block `blk#' to memory address `addr' usb write addr blk# cnt - write `cnt' blocks starting at block `blk#' from memory address `addr' %s arm-angstrom-linux-gnueabi-gcc (Linaro GCC 4.7-2013.02-01) 4.7.3 20130205 (prerelease) GNU ld (GNU Binutils) 2.22 print monitor, compiler and linker version## Copying part %d from legacy image at %08lx ... Must specify load address for %s command with compressed image Bad Image Part Invalid image type for imxtract Loading part %d ... Uncompressing part %d ... GUNZIP ERROR - image not loaded fileaddrimxtractextract a part of a multi-image%s - %s Usage: %s - No additional help available. %-*s- %s Unknown command '%s' - try 'help' without arguments for list of all known commands Unknown command '%s' - try 'help' 'bootd' recursion detected stdoutstderrIn: No input devices available! Out: No output devices available! Err: No error devices available! .callbacks:callbacks,.flags:flags,baudrate:baudrate,bootfile:bootfile,loadaddr:loadaddr,stdin:console,stdout:console,stderr:console,.callbacks*** Warning - %s, using default environment Using default environment env_common.c!bad CRCERROR: Cannot import environment: errno = %d at %s:%d/%s() !import failedethaddr:ma,## Warning: Unknown environment variable type '%c' ## Warning: Unknown environment variable access method '%c' Warning: Non-standard access flags. (0x%x) .flags## Error: flags type check failure for "%s" <= "%s" (type: %c) ## Error: Can't delete "%s" ## Error: Can't overwrite "%s" oldval: %s defval: %s ## Error: Can't create "%s" env_nand.cErasing Nand... Writing to Nand... FAILED! !readenv() failed#address-cells#size-cells/chosenfdt_initrd: %s linux,initrd-startWARNING: could not set linux,initrd-start %s. linux,initrd-endWARNING: could not set linux,initrd-end %s. fdt_chosen: %s WARNING: could not create /chosen %s. WARNING: could not set bootargs %s. Unable to update property %s:%s, err=%s %s: num banks %d exceeds hardcoded limit %d. Recompile with higher MEMORY_BANKS_MAX? /memoryWARNING: could not create /memory: %s. device_typeWARNING: could not set %s %s. reg/aliasesethernet%deth%daddrlocal-mac-address%s: Bad cell count for %s rangeslinux,phandleCan't set phandle %u: %s okaydisabledfailfail-%dInvalid fdt status: %x Warning: device tree alias '%s' points to invalid node %s. Warning: device tree node '%s' has no address. Warning: U-Boot configured device %s at address %llx, but the device tree has it address %llx. CRC32 for %08lx ... %08lx ==> %08lx syntax error ** Abort ERROR : memory not allocated U-Boot# *?[\ERROR: There is a global environment variable with the same name. %s: readonly variable%s=%sHUSH_NO_EVALUnknown command '%s' - try 'help' or use 'run' command IFS \$'";&|#;$&|exit not allowed from main input shell. HUSH_VERSION0.01showvarprint local hushshell variables - print values of all hushshell variables showvar name ... - print value of hushshell variable 'name'thenelifelsefiforwhileuntildodoneERROR: - must RESET the board to recover. bootm_lowbootm_sizebootm_mapsize%d Bytes = Unknown OSUnknown ArchitectureUnknown ImageUnknown Compression%sImage Name: %.*s %sImage Type: %s %s %s (%s) %sData Size: %sLoad Address: %08x %sEntry Point: %08x %sContents: %s Image %d: %s Offset = 0x%08lx ## Loading init Ramdisk from Legacy Image at %08lx ... No Linux %s Ramdisk Image Wrong Ramdisk Image Format ## Loading init Ramdisk from multi component Legacy Image at %08lx ... initrd_highramdisk - allocation error Loading Ramdisk to %08lx, end %08lx ... reserving fdt memory region: addr=%llx size=%llx image is not a fdtfdt_highFailed using fdt_high value for Device Treedevice tree - allocation error Using Device Tree in place at %p, end %p Loading Device Tree to %p, end %p ... fdt move failed## Flattened Device Tree from Legacy Image at %08lx fdt header checksum invalidfdt checksum invaliduImage is not a fdtuImage is compresseduImage data is not a fdtfdt overwritten## Flattened Device Tree blob at %08lx ERROR: Did not find a cmdline Flattened Device Tree Booting using the fdt blob at 0x%p ## Flattened Device Tree from multi component Image at %08lX Booting using the fdt at 0x%p fdt size != image sizeInvalid OSlinuxLinuxnetbsdNetBSDoseEnea OSEplan9Plan 9rtemsRTEMSu-bootU-BootInvalid ARCHalphaAlphaarmARMIntel x86ia64IA64m68kM68KmicroblazeMicroBlazemipsMIPSmips64MIPS 64 Bitnios2NIOS IIpowerpcPowerPCppcs390IBM S390SuperHsparcSPARCsparc64SPARC 64 BitblackfinBlackfinavr32AVR32nds32NDS32or1kOpenRISC 1000aisimageDavinci AIS imageFilesystem ImagefirmwareFirmwareflat_dtFlat Device TreekernelKernel Imagekernel_noloadKernel Image (no loading done)kwbimageKirkwood Boot ImageimximageFreescale i.MX Boot ImageInvalid ImagemultiMulti-File ImageomapimageTI OMAP SPL With GP CHpblimageFreescale PBL Boot ImageRAMDisk ImageScriptstandaloneStandalone ProgramublimageDavinci UBL imagenoneuncompressedbzip2bzip2 compressedgzipgzip compressedlzmalzma compressedlzolzo compressed ** Too many args (max. %d) ** verbootdelayHit any key to stop autoboot: %2d %2d NULL device name! BUG: failure at %s:%d/%s()! miiphyutil.cBUG!miiphy_register: non unique device name '%s' miiphy_register: cannot allocate memory for '%s' mdio_register: non unique device name '%s' %s: %d - %s <--> %s No such device: %s %s is not a known ethernet MII devices: '%s' Current device: '%s' PHY extended status read failed, assuming no 1000BASE-X 1000BASE-X PHY AN duplexPHY 1000BT statusPHY duplex read failed, assuming half duplex PHY speedPHY AN speed read failed, assuming 10BASE-T serialfailed to stop USB controller %d unable to get descriptor, error %lX config descriptor too short (expected %i, got %i) usb_get_configuration_no: failed to get descriptor - too long: %d selecting invalid interface %dERROR, too many USB Devices, max=%d usb_new_device:cannot locate device's port. Couldn't reset port %i USB device not accepting new address (error=%lX) unable to get device descriptor (error=%d) USB device descriptor short read (expected %i, got %i) usb_new_device: Cannot read configuration, skipping device %04x:%04x ERROR: NOT USB_CONFIG_DESC %x failed to set default configuration len %d, status %lX USB%d: scanning bus %d for devices... %d USB Device(s) found No USB Device found lowlevel init failed USB error: all controllers failed lowlevel init cannot reset port %i!? ERROR: USB_MAX_HUB (%d) reached Did not get interrupt on CBI cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X (NOT READY) cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X No storage devices, perhaps not 'usb start'ed..? USB Storage Transport unknown / not yet implemented Sorry, protocol %d not yet supported. error in inquiry Device NOT ready Request Sense returned %02X %02X %02X READ_CAP ERROR scanning usb for storage devices... max USB Storage Device reached: %d stopping %d Storage Device(s) found CksumxyzModem - %s mode, %d(SOH)/%d(STX)/%d(CAN) packets, %d retries Unknown errorBlock sequence errorCRC/checksum errorInvalid framingCancelledEnd of fileTimed outSorry, zModem not available yetCan't access file(%d:%d) Vendor: %s Prod.: %s Rev: %s Model: %s Firm: %s Ser#: %s Vendor: %s Rev: %s Prod: %s device type DOC device type unknown Unhandled device type: %i Type: Removable Hard DiskCD ROMOptical DeviceTape# %02X # Capacity: %ld.%ld MB = %ld.%ld GB (%ld x %ld) Capacity: not available Partition Map for IDESATAATAPIUSBDOCUNKNOWN device %d -- Partition Type: %s DOS## Unknown partition table ** Bad device specification %s %s ** ** Bad device %s %s ** Sandbox host** No device specified ** auto** Bad partition specification %s %s ** ** Bad device size - %s %s ** ** No partition table - %s %s ** Whole Disk** Invalid partition %d ** ** No valid partitions found ** ** Invalid partition type "%.32s" (expect "U-Boot") FATFAT32 Extd Boot** Can't read partition table on %d:%d ** bad MBR sector signature 0x%02x%02x %3d %-10d %-10d %08x-%02x %02x%s%s hd%c%dsd%c%dusbd%c%ddocd%c%dxx%c%dPart Start Sector Num Sectors UUID Type %s: Wrong sequence number! [%d] [%d] %s: Wrong size! [%d] [%d] - %d DFU complete CRC32: 0x%08x %s: Failed to fill buffer UPLOAD ... done Ctrl+C to exit ... ;%s: Device %s not (yet) supported! DFU alt settings list: dev: %s alt: %d name: %s layout: %s eMMCOneNANDRAW_ADDREXT2EXT3EXT4Request would exceed designated area! mmc %s %p %x %xfat%s mmc %d:%d 0x%x %s %lxext4%s mmc %d:%d 0x%x /%s%s: Layout (%s) not (yet) supported! dfu: Read error! dfu: Wrong file size! fatext4%s: could not find mmc device #%d! %s: could not find partition #%d on mmc device #%d! %s: Memory layout (%s) not supported! %s: invalid nand device %s: nand_%s_skip_bad call failed at %llx! using id '%s' Could not locate '%s' ERROR : check_gpio: invalid GPIO %d omap3-gpio unknown bank method %s %d omap_gpio.ctimed out in wait_for_bb: I2C_STAT=%x timed out in wait_for_pin: I2C_STAT=%x Error : I2C unsupported speed %d Error : I2C initializing clock ERROR: Timeout in soft-reset I2C read: addr len %d not supported I2C read: address out of range I2C read: I/O error I2C write: addr len %d not supported I2C write: address 0x%x + 0x%x out of range i2c error waiting for data ACK (status=0x%x) i2c bus not ready for Tx (i=%d) Bad bus: %d Status Error: 0x%08X Timeout waiting card ready MMC Device %d not found Caution! Your devices Erase group is 0x%x The erase range would be change to 0x%lx~0x%lx mmc erase failed MMC: block number 0x%lx exceeds max(0x%lx) mmc write failed mmc fail to send stop cmd Man %06x Snr %04x%04x%c%c%c%c%c%cMMC: no card present Card did not respond to voltage select! %s: %d%s: timedout waiting for ics! %s: timedout waiting for sysctl %x to clear %s: timedout waiting on cmd inhibit to clear %s: timedout waiting for STAT (%x) to clear %s : timeout: No status update %s: timedout waiting for status! %s: timedout waiting for cc! %s: timedout waiting for cc2! %s: timedout waiting for softresetall! OMAP SD/MMCmmc_cdmmc_wpU-Boot BUG at %s:%d! mtdcore.cRemoving MTD device #%d (%s) with use count %d nand%d%lu MiB nand_bbt: Error reading bad block table nand_bbt: ECC error while reading bad block table nand_read_bbt: Reserved block at 0x%012llx No space left to write bad block table nand_bbt: Error reading block for writing the bad block table nand_bbt: ECC error while reading block for writing bad block table Bad block table written to 0x%012llx, version 0x%02X nand_bbt: Error while writing bad block table %d nand_bbt.ccreate_bbt(): chipnr (%d) > available chips (%d) Bad block table not found for chip %d nand_update_bbt: Out of memory nand_scan_bbt: Out of memory nand_bbt: Can't scan flash and build the RAM-based BBT nand_bbt: Out of memory Bad block table at page %d, version 0x%02X nand_create_default_bbt_descr: Out of memory ToshibaSamsungFujitsuNationalRenesasST MicroHynixMicronAMDUnknownNAND 16MiB 1,8V 8-bitNAND 16MiB 3,3V 8-bitNAND 16MiB 1,8V 16-bitNAND 16MiB 3,3V 16-bitNAND 32MiB 1,8V 8-bitNAND 32MiB 3,3V 8-bitNAND 32MiB 1,8V 16-bitNAND 32MiB 3,3V 16-bitNAND 64MiB 1,8V 8-bitNAND 64MiB 3,3V 8-bitNAND 64MiB 1,8V 16-bitNAND 64MiB 3,3V 16-bitNAND 128MiB 1,8V 8-bitNAND 128MiB 3,3V 8-bitNAND 128MiB 1,8V 16-bitNAND 128MiB 3,3V 16-bitNAND 256MiB 3,3V 8-bitNAND 256MiB 1,8V 8-bitNAND 256MiB 1,8V 16-bitNAND 256MiB 3,3V 16-bitNAND 512MiB 1,8V 8-bitNAND 512MiB 3,3V 8-bitNAND 512MiB 1,8V 16-bitNAND 512MiB 3,3V 16-bitNAND 1GiB 1,8V 8-bitNAND 1GiB 3,3V 8-bitNAND 1GiB 1,8V 16-bitNAND 1GiB 3,3V 16-bitNAND 2GiB 1,8V 8-bitNAND 2GiB 3,3V 8-bitNAND 2GiB 1,8V 16-bitNAND 2GiB 3,3V 16-bitNAND 4GiB 1,8V 8-bitNAND 4GiB 3,3V 8-bitNAND 4GiB 1,8V 16-bitNAND 4GiB 3,3V 16-bitNAND 8GiB 1,8V 8-bitNAND 8GiB 3,3V 8-bitNAND 8GiB 1,8V 16-bitNAND 8GiB 3,3V 16-bitNAND 16GiB 1,8V 8-bitNAND 16GiB 3,3V 8-bitNAND 16GiB 1,8V 16-bitNAND 16GiB 3,3V 16-bitNAND 32GiB 1,8V 8-bitNAND 32GiB 3,3V 8-bitNAND 32GiB 1,8V 16-bitNAND 32GiB 3,3V 16-bitNAND 64GiB 1,8V 8-bitNAND 64GiB 3,3V 8-bitNAND 64GiB 1,8V 16-bitNAND 64GiB 3,3V 16-bitAttempt to erase non block-aligned data Skipping bad block at 0x%08llx %s: MTD get bad block failed: %d %s: MTD Erase failure: %d %s: MTD writeoob failure: %d Erasing at 0x%llx -- %3d%% complete. Cleanmarker written at 0x%llx.Attempt to write non page-aligned data Attempt to write outside the flash area Size of write exceeds partition or device limit NAND write to offset %llx failed %d Skip bad block 0x%08llx Attempt to read non page-aligned data Attempt to read outside the flash area Size of read exceeds partition or device limit NAND read from offset %llx failed %d Skipping bad block 0x%08llx Timeout!nand_base.cnand_do_write_ops: Device is write protected %s: attempt to erase a bad block at page 0x%08x %s: second ID read did not match %02x,%02x against %02x,%02x NAND device: Manufacturer ID: 0x%02x, Chip ID: 0x%02x (%s %s) NAND bus width %d instead %d bit No NAND device found!!! No oob scheme defined for oobsize %d No ECC functions supplied; Hardware ECC not possible %d byte HW ECC not possible on %d byte page size, fallback to SW ECC CONFIG_MTD_ECC_BCH not enabled NAND_ECC_NONE selected by board driver. This is not recommended !! Invalid NAND_ECC_MODE %d Invalid ecc parameters Error: Unrecognized Mode[%d]! ECC: uncorrectable. Error: Ecc is wrong Error: Bad compare! failed Error: Can't switch ecc, no devices available 1-bit hamming HW ECC selected 8-bit BCH HW ECC selected SW ECC selected NAND: Unable to find NAND settings in GPMC Configuration - quitting SF: Failed to set up slave SF: Unsupported manufacturer %02x , mapped at %pSF: Detected %s with page size , total W25X40W25X16W25X32W25X64W25Q80BLW25Q16W25Q32W25Q64W25Q128W25Q80W25Q32DWW25Q64DWwait_for_user_access Timeout fullhalflink up on port %d, speed %d, %s duplex link down on port %d cpdma_process timeout error %d submitting rx desc cpswFailed to allocate PHY device for %s:%d Phy not found %s Waiting for PHY auto negotiation to complete TIMEOUT ! user interrupt! done PHY reset timed out %s:%d is connected to %s. Reconnecting to %s Could not get PHY for %s: addr %d Generic PHYSMSC LAN8710/LAN8720SMSC LAN911x Internal PHYSMSC LAN8700Cannot find console ## Baudrate %d bps not supported ## Baudrate may not be deleted SPI error: unsupported bus %i. Supported busses 0 - 3 SPI error: unsupported chip select %i on bus %i SPI error: unsupported frequency %i Hz. Max frequency is 48 Mhz SPI error: unsupported SPI mode %i SPI error: malloc of SPI structure failed SPI TXS timed out, status=0x%08x SPI RXS timed out, status=0x%08x WARNING in %s line %d f_mass_storage.c | / - \composite.c, H%c=%umusb-hdrccomposite%-8s%-16s%04xUnknown x%02xunable to find file size: %s file too small: %s Linux File-Store GadgetMass Storage FunctionGADGET DRIVER: %s usb_dnl_dfuusb_dnl_ums%s: unknown command: %s %s: failed!, error: %d usb_dnloadDOWNLOAD ... OK Ctrl+C to exit ... ERROR: No memory to alloc RNDIS packet at %s:%d/%s() ether.ctimeout sending packets to usb ethernet ERROR: %s: rndis parse error %d at %s:%d/%s() USB RNDIS network up! ERROR: can't alloc requests at %s:%d/%s() ERROR: received NULL ptr at %s:%d/%s() ERROR: rx submit --> %d at %s:%d/%s() ERROR: dev->rx_req invalid at %s:%d/%s() RNDISCDC Ethernet%s speed config #%d: %d mA, %s, using %s de:ad:be:af:00:00usbnet_devaddrusbnet_hostaddrERROR: Need valid 'usbnet_devaddr' to be set at %s:%d/%s() ERROR: Need valid 'usbnet_hostaddr' to be set at %s:%d/%s() cdc_connect_timeoutERROR: The remote end did not respond in time. at %s:%d/%s() ERROR: can't autoconfigure on %s at %s:%d/%s() ERROR: can't run RNDIS on %s at %s:%d/%s() %02X%02X%02X%02X%02X%02XERROR: can't init RNDIS, %d at %s:%d/%s() using %s, OUT %s IN %s%s%s STATUS HOST MAC %02x:%02x:%02x:%02x:%02x:%02x RNDIS ready ERROR: %s failed, status = %d at %s:%d/%s() RNDIS/%sU-bootERROR: controller '%s' not recognized at %s:%d/%s() usb_etherEthernet DataRNDIS Communications ControlUTMI-16UTMI-8OTGmusb_core.c, dyn FIFOs, HB-ISO Rx, HB-ISO Tx, SoftConn%s: ConfigData=0x%02x (%s) %s: kernel must blacklist external hubs %d.%d%s%s: %sHDRC RTL version %s %s %s: setup fifo_mode %d %s: %d/%d max ep, %d/%d memory USB %s mode controller at %p using %s, IRQ %d PIOmusb_init_controller failed with status %d HostPeripheralep%d%s%s %d: SetupEnd came in a wrong ep0stage %s %s %d: SETUP packet len %d != 8 ? %s: peripheral reset irq lost! musb_gadget_ep0.cidlesetupin/statusout/statuswaitCould not flush host TX%d fifo: csr: %04x %s %d: rx%d, packet/%d ready? %s %d: broken !rx_reinit, ep%d csr %04x %s %d: no URB for end 0 %s %d: bogus ep0 stage %d %s %d: Rx interrupt with no errors or packet! Failed to enqueue URB to controller MUSB host is not registered bad parameter. Controller uninitialized gadget_start failed with %d bind failed with %d ** Can not find directory. ** ** Cannot support non-zero offset ** ** File not found %s ** Extent Error ** SI ext2fs read block (indir 1)malloc failed. ** ** SI ext2fs read block (indir 1):malloc failed. ** ** SI ext2fs read block (indir 1)failed. ** ** DI ext2fs read block (indir 2 1)malloc failed. ** ** DI ext2fs read block (indir 2 1)failed. ** ** DI ext2fs read block (indir 2 2)malloc failed. ** ** DI ext2fs read block (indir 2 2)failed. ** ** TI ext2fs read block (indir 2 1)malloc failed. ** ** TI ext2fs read block (indir 2 1)failed. ** ** TI ext2fs read block (indir 2 2)malloc failed. ** ** TI ext2fs read block (indir 2 2)failed. ** invalid extent block < ? > %10d %s Failed to mount ext2 filesystem... %s read outside partition %d ** Invalid Block Device Descriptor (NULL) ** ext2fs_devread() read error ** ** %s read error - block * %s read error - last part error: overflow occurs FAT32 FAT12 FAT16 FAT: Misaligned buffer address (%p) Invalid FAT entry error: wrinting directory entry Error: reading directory block Error: %ld overflow Error: writing contents Error: flush fat buffer Error: writing directory entry Error: finding empty cluster Error: clearing FAT entries U** Partition %d not valid on device %d ** Error: FAT sector size mismatch (fs=%hu, dev=%lu) %s%c %8ld %s%c %d file(s), %d dir(s) Error reading cluster No current device Interface: Device %d: No valid FAT fs found Filesystem: %s "%s" reading %s ** Unable to read file %s ** writing %s Can't list files without a filesystem! %s/%sCan't load file without a filesystem! ** Unrecognized filesystem type ** bootfile** No boot file defined ** %d bytes read in %lu ms (compatibleFDT_ERR_NOTFOUNDFDT_ERR_EXISTSFDT_ERR_NOSPACEFDT_ERR_BADOFFSETFDT_ERR_BADPATHFDT_ERR_BADSTATEFDT_ERR_TRUNCATEDFDT_ERR_BADMAGICFDT_ERR_BADVERSIONFDT_ERR_BADSTRUCTUREFDT_ERR_BADLAYOUT%llu Bytes%s%lu.%ld %ciB%s %0*x %s 1.2.3Error: inflateInit2() returned %d Error: inflate() returned %d Error: Bad gzipped data Error: gunzip out of data in header Env export buffer too small: %zu, but need %zu himport_r: can't insert "%s=%s" into hash table WARNING: '%s' neither in running nor in imported env! WARNING: '%s' not in imported env, deleting it! ERROR: Failed to allocate 0x%lx bytes below 0x%lx. .%03ld%s:%u: %s: Assertion `%s' failed.invalid distance too far backinvalid distance codeinvalid literal/length codeincorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid literal/lengths setinvalid distances setincorrect data checkincorrect length checkneed dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible version## Warning: gatewayip needed but not set ARP Retry count exceeded; starting again bad length %d < %d *** WARNING: %s is too long (%d - max: %d) - truncated Host NameRoot PathOpt Boot File*** WARNING: using vendor optional boot file *** Unhandled DHCP Option in OFFER/ACK: %d DHCP client bound to address %pI4 DHCP: INVALID STATE BOOTP broadcast %d Retry count exceeded; starting again ethact%pM%s%daddr%saddreth.ceth%dmacskipethmacskip Warning: %s MAC addresses don't match: Address in SROM is %pM Address in environment is %pM Warning: %s using MAC address from net device Board Net Initialization Failed CPU Net Initialization Failed Net Initialization Skipped ethprime [PRIME] Warning: eth device name has a space! eth Warning: failed to set MAC address ethrotateunknownautoloadNFSnetretryonce ICMP Host Redirect to %pI4 %d.%d.%d.%dnvlan*** ERROR: ping address not given *** ERROR: `serverip' not set *** ERROR: `ipaddr' not set *** ERROR: No ethernet found. *** ERROR: `ethaddr' not set *** ERROR: `eth%daddr' not set Abort Bytes transferred = %ld (%lx hex) *** ERROR: Cannot mount *** ERROR: Cannot umount done *** ERROR: File lookup fail *** ERROR: Symlink fail T /nfsroot/%02X%02X%02X%02X.img*** Warning: no boot file name; using '%s' Using %s device File transfer via NFS from server %pI4; our IP address is %pI4; sending through gateway %pI4 Filename '%s/%s'. Size is 0x%x Bytes = Load address: 0x%lx Loading: *octetblksize%c%d%cFile too largeFile has bad magicblksize TFTP error: First block is not block 1 (%ld) Starting again TFTP error: '%s' (%d) Not retrying... %s; starting again Retry count exceededtftpblocksizetftptimeoutTFTP timeout (%ld ms) too low, set minimum = 1000 ms TFTP %s server %pI4; our IP address is %pI4fromFilename '%s'.Load address: 0x%lx A33515BB1.5Could not probe the EEPROM; something fundamentally wrong on the I2C bus. Could not read the EEPROM; something fundamentally wrong on the I2C bus. Incorrect magic number (0x%x) in EEPROM Could not get board ID. board_nameboard_rev not set. Validating first E-fuse MAC A335BONEError %d registering CPSW switch A335X_SKError %d registering USB_ETHER raise: Signal # %d caught   D2DD;2tD; DDDDx@0j߀PD^ــfــfــــfــf ــf@ــ_ــ[addr [initrd[:size]] [fdt]] - boot Linux zImage stored in memory The argument 'initrd' is optional and specifies the address of the initrd in memory. The optional argument ':size' allows specifying the size of RAW initrd. When booting a Linux kernel which requires a flat device-tree a third argument is required which is the address of the device-tree blob. To boot that kernel without an initrd image, use a '-' for the second argument. If you do not pass a third a bd_info struct will be passed instead [addr [arg ...]] - boot application image stored in memory passing arguments 'arg ...'; when booting a Linux kernel, 'arg' can be the address of an initrd image When booting a Linux kernel which requires a flat device-tree a third argument is required which is the address of the device-tree blob. To boot that kernel without an initrd image, use a '-' for the second argument. If you do not pass a third a bd_info struct will be passed instead Sub-commands to do part of the bootm sequence. The sub-commands must be issued in the order below (it's ok to not issue all sub-commands): start [addr [arg ...]] loados - load OS image ramdisk - relocate initrd, set env initrd_start/initrd_end fdt - relocate flat device tree cmdline - OS specific command line processing/setup bdt - OS specific bd_t processing prep - OS specific prep before relocation or go go - start OS/ addr [] - Set the fdt location to fdt move - Copy the fdt to and make it active fdt resize - Resize fdt to size + padding to 4k addr fdt print [] - Recursive print starting at fdt list [] - Print one level starting at fdt get value - Get and store in fdt get name - Get name of node and store in fdt get addr - Get start address of and store in fdt get size [] - Get size of [] or num nodes and store in fdt set [] - Set [to ] fdt mknode - Create a new node after fdt rm [] - Delete the node or fdt header - Display header info fdt bootcpu - Set boot cpuid fdt memory - Add/Update memory node fdt rsvmem print - Show current mem reserves fdt rsvmem add - Add a mem reserve fdt rsvmem delete - Delete a mem reserves fdt chosen [ ] - Add/update the /chosen branch in the tree / - initrd start/end addr NOTE: Dereference aliases by omiting the leading '/', e.g. fdt print ethernet0.m|Rــs|\Wــw|Tــ`Pــ||TWــ|Nــ|LWــ|LPــ㒄OــLmSــb_NــMWــcrc32 chip address[.0, .1, .2] count - compute CRC32 checksum i2c dev [dev] - show or set current I2C bus i2c loop chip address[.0, .1, .2] [# of objects] - looping read of device i2c md chip address[.0, .1, .2] [# of objects] - read from I2C device i2c mm chip address[.0, .1, .2] - write to I2C device (auto-incrementing) i2c mw chip address[.0, .1, .2] value [count] - write to I2C device (fill) i2c nm chip address[.0, .1, .2] - write to I2C device (constant address) i2c probe [address] - test for and show device(s) on the I2C bus i2c read chip address[.0, .1, .2] length memaddress - read to memory i2c write memaddress chip address[.0, .1, .2] length - write memory to i2c i2c reset - re-init the I2C Controller i2c speed [speed] - show or set I2C bus speed@ - list partition table mtdparts delall - delete all partitions mtdparts del part-id - delete partition (e.g. part-id = nand0,1) mtdparts add [@] [] [ro] - add partition mtdparts default - reset partition table to defaults ----- this command uses three environment variables: 'partition' - keeps current partition identifier partition := := ,part_num 'mtdids' - linux kernel mtd device id <-> u-boot device id mapping mtdids=[,,...] := = := 'nand'|'nor'|'onenand' := mtd device number, 0... := unique device tag used by linux kernel to find mtd device (mtd->name) 'mtdparts' - partition list mtdparts=mtdparts=[;...] := :[,...] := unique device tag used by linux kernel to find mtd device (mtd->name) := [@][][] := standard linux memsize OR '-' to denote all remaining space := partition start offset within the device := '(' NAME ')' := when set to 'ro' makes partition read-only (not used, passed to kernel)info - show available NAND devices nand device [dev] - show or set current device nand read - addr off|partition size nand write - addr off|partition size read/write 'size' bytes starting at offset 'off' to/from memory address 'addr', skipping bad blocks. nand read.raw - addr off|partition [count] nand write.raw - addr off|partition [count] Use read.raw/write.raw to avoid ECC and access the flash as-is. nand erase[.spread] [clean] off size - erase 'size' bytes from offset 'off' With '.spread', erase enough for given file size, otherwise, 'size' includes skipped bad blocks. nand erase.part [clean] partition - erase entire mtd partition' nand erase.chip [clean] - erase entire chip' nand bad - show bad blocks nand dump[.oob] off - dump page nand scrub [-y] off size | scrub.part partition | scrub.chip really clean NAND erasing bad blocks (UNSAFE) nand markbad off [...] - mark bad block(s) at offset (UNSAFE) nand biterr off - make a bit error at offset (UNSAFE)@tــaــc@ــjــoــv<ــ}@ــp@JــTــO@Xــask name [message] [size] - ask for environment variable env default [-f] -a - [forcibly] reset default environment env default [-f] var [...] - [forcibly] reset variable(s) to their default values env delete [-f] var [...] - [forcibly] delete variable(s) env edit name - edit environment variable env export [-t | -b | -c] [-s size] addr [var ...] - export environment env import [-d] [-t | -b | -c] addr [size] - import environment env print [-a | name ...] - print environment env run var [...] - run commands in an environment variable env save - save environment env set [-f] name [arg ...] [addr] - run script starting at addr - A valid image header must be presentaddr part [dest] - extract from legacy image at and copy to   ( ( 0 0 8 8 @ @ H H P P X X ` ` h h p p x x !!!!!!!! ! !(!(!0!0!8!8!@!@!H!H!P!P!X!X!`!`!h!h!p!p!x!x!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!"""""""" " "("("0"0"8"8"@"@"H"H"P"P"X"X"`"`"h"h"p"p"x"x"""""""""""""""""""""""""""""""""######## # #(#(#0#0#8#8#@#@#H#H#P#P#X#X#`#`#h#h#p#p#x#x#################################$$$$$$0ʄa,8   /   $$D!@#$%^&*()_+ QWERTYUIOP{} ASDFGHJKL:"~|ZXCVBNM<>? 789-456+1230. 13457890=    ;'~ <>?789-456+1230.  & & &@&@&Bbt01tbBqq()*+,-./0123456789:;<=>?&0PQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~N  28  !"#$%&'()*+,-./0123456789: ℀,a cx\|4|4,℀X_fx\A℀X_fx\[℀X_fx\eserial0lTnmmllmeserial1l\nmnmtmeserial2`ldnm nm|meserial3@llnmnmmeserial4 ltnmnmmeserial5l|nm$n mm{DD<儀||T} P716C67(6:6nDl7d6t7䙂~ 47|7 L6  77D7 7  Dς,ȂÂp9zEEEEE7E77  p9 p9p9zEEEEE7E77%  09Ethernet Gadget`7F9 5Fl鄀@6F 愀z鄀     @  @  @               @t삀삀L삀p삀/Q_(`d`<"!l",c ddd  JJ  =⚄@t隄KfPl^@!^ـ(鄀L$sfـmfL$sfـf@+f`f͖8e@0>e$P+C1j5D g2gـ`kcom|lۂ䄀@2zgg͖}@5hhƜCi7Ji\i.@ୀ i8iـi8i!jj9jkk09kkl9jk@T€m@:n*nn:n on:jnImH9Rmsm=v[ _@"__yLyziz@MnzzZ|8N^|\be@$ieeԀª|Z||i|LPwsw`o _ .f~`?ow| i$jhLjv`l'6||>>>>A AAhBlBC,D4DEEEEEEEEEEEEEEEEG G$G(G,G0G4G8G >8>P>h>>>>>>>?(?@?X?p??????@@0@H@`@x@@@@@@A A8APAhAAAAAACCCCCCCCCCCCDDDDDDDDDLEPEdFhFlFpFtFxF|FFFFFFFFFFFFFFFFFFFFFFFFLGPGTGhGlGpGtGxGGGGGGGdYhYlYpYtYxY|YYYY8<@Hhlpx $(,<@DTX\lpt8DHLP\`dhtx|  $(48<@LPT$048<HLPT`dhlx|  $ ( , 0 4 8 < @ D H L P T X \ ` d h l p t x |                                 !!! !!!!! !$!(!,!0!4!8!,>>>>>>>>>>>>>>>>>>??? ??? ?$?0?4?8?Dž5$Džusr/mdec/am335x/mlo010075500000000000000000003031001220553173000132070ustar00rootwheel@ CHSETTINGS8/@ /@$/@(/@,/@0/@4/@8/@xV4/@?8.?8 r1) d D //   /@ @-P@`p00=000000 0 0000Vlp@`0t}p@)p@-2\@00  <0 00 P 0PxP#`0p@80@ 0S \0 +1 D     01    / 90@@y0@ 801     $  (  ,  T / 90@000, 01 , / 90@ H01 (  ,  P \ $ ` ( 4 8 /90@X0 0( 4@Xl pRR/80@0 DH/DF-`p$@ P{ U00@000000000  4 3Fa90@D0P(&'  '(&/D0P &'  ' &/D@-  4 4y0@@Gy0@\y0@@Gly0@P/3 8 0s/00@-  @@ P PPP 4P  9904@@000040 0y0@$0  ( ( R/y0@4p@- , @@@|$ @ Tl40,00044 Q  hP @ ```#\` V99;0P@ @h00@0003\Q  @@@L#p@ T99900000p0S2,0| 2  2 R`  ` R2d d R2 Rt2  `2 R ! !R02 0S" 00000000S 00 R101 R10  t10 R@ @0SL <0 81< R R1 R0  0 R 0S 0 0 RH  H0S| 0h0 L L RD0 R 0  Rpy0@&y0@y0@y0@p@-P`XT`@P`\TP`@XT`P`\ QT3 P `@XT`P `\TP `@XT `P`\Q T@PHDP@PLD@PHDP@PLD@ ȠČ@ ĐȌĀp   "N Q:pp,0    0 /$0     / 0 H ПP-`0@@-pB@P`  LL@D@0f@  ,$0fP6O@T:?0@?0@?0@//0 0 "0b0>?0S:0?/8@-P@?00 0#0?8@P/t Rl RP \ L0 R R   ,0 0 /O-p`@0@0@y0@y0@0 //D8@-,0@@@+ P8 <H@8H@-;H4 <0< S0b0000PH@-,0<H  b H@-@d0/y0@0/y0@@-g@6T0@-0 S S S 00  00y0@ПM `0@@-$0Р   `:I `0@2x0@/@-P :|B0@}0@{0@0@-@MPp =:PM PX 6:P&5 P @ 050 02P@0@Dt@0S 0S,T+& :P 9PpX|t 9P d0< Ѝ0B0@B0@|0@|0@|0@Tz0@z0@,z0@B0@{0@||0@B0@{0@{0@B0@B0@/s@-P P e@PPP 0 P `XT`0S P 0 PQ T|'C0@y0@rC0@U3C0@@- 449P( $9PC0@y0@y0@C0@@-1* H 14 RU%H 4 Ryl1l!l h!p H T +X1T  T H!X T004T0 ( P   [9PV *  O9P0/ 00 A9@P 0 0000P 0/| x0t0p  0d0PDD Dx0@C0@y0@B0@y0@ D0@}0@:0@:0@B0@8~0@|90@90@}0@:0@@90@90@90@L:0@D17@-0&468S0S #D+D0@3D0@B0@y0@T}0@4}0@cD0@B0@C0@F-`,M@@`FfR_ RVP=8P0 -R D"<1V  0Sp =7p3;p8W >`PA  '0L R QCS C00l0(P@`@0 50S400 ,ЍD0@~0@0@D0@ D0@0/~0@@-P000 00 Q 0S qЍE0@@-M@ ;Ѝ E0@PD-@P`0U@=S pt`Z 0Sl=PN-pP`㬐" T`$@ZPP @e`MP T`eV  000Ds<P @E0@0@-@(M   P (000 0F5P` P`(Ѝ蠂0@P@-01,03/\P@-01(03/\P@- 1 03/\P/0 |P/0 x R/0 s @-R0 00$03/@l\-@-"M@T /( ;@"ލ@Ѝ/@-0@"M T :@"ލH0@-@T 0S P P 0 8@-PT0 P@ b`7400T:(00T0@88LD E7LDp@-P0```N@N@JD T00Pdp0 cRH  a8p0`d``0 @d@p~0@0@p@-@Pp0DR `QP 0a   010Rp81p@P @P0d @T P P@ @@P @AP\00   P p R *!@B! 0,Q"8Q[ TQ"nUQwTQ"|~`@ P  A Q R:  0 0p~0@0@HF-50S50SP @T@~T*@!51 P0P 6 0 0H$! R$#8 R[ TR$&n UR'w T5R$)| ~ 41 d\ B \ 0 0 0   # P PPQ 00d\ 0 @0@0 PP \PP0 S *1P`C̅ 00 ,Ġ\#à8\[ T\#ƠnU\ǠwT\#ɠ|~cQQ 0LP̃0Q  S: 0 0 B13 SK 0  R`p ! d\0 @@ "00    \ 0   0 0 P`p    A BQ 0SS   01` 0dSf1 p1p0szpp~ppPN P*x1VIx1 U  T1 pp0p3DpPi  00cPp0g~p~ppp( 0e  0ppVPp Z0  0 J 0Z00 0  x0x 0S0h S0D00000dS( 0@@0LD~0@H0@@-p0`PwWP@&P%  0@0V `s`R`V  B$RR0 R0000$R0 00000   4@~0@D-@QTD>T @Z 5pP PGBQ `D0d```F0eS0`Pe00e 0    00PPP000jS 0000yF-pR`PU PU 0S- @40P) @B40 s R @0 S T ,R:S,S: S8 0S 4P %4T" !* @@T0 S :SP0@0 R \,4PPd4P K43T0@F-`AM@ P4U P! P p3P `@P\ d@ʡ 3@P P UpDW00AߍE0@E0@80@80@ 0/$ 0R 00/T0@@- $0S 0/T0@@-P 1PyP YP tP T0Ps8@-$P@  $ $P@8@-@P 0!St@@\0@0/0DD:2P8088 0400  ?F0@mF0@0@T0@V0@F0@F0@ $P8Pp@- 0\ X\H@ `P` DRp\ PPpo0@p@-@%3Pp,`3PP fp pV0@F0@p@-@3P 4`2PP fpppV0@G0@7@-@P000000Ph P P2P P01P P>pG0@D0@wG0@;0@N-R0@2 Q`P@Z  0KS{3/@3/@3/@X4/@4/@@5/@0 l 00( 0d 0 R\ Sa00S^00XSR Y0yS1S tS YS TS 0S nS fS NS FS=0SB 9p 0 5 0\- W  .RR&pW)p0  0W  S 0R XR \  :RRp\0 0+0 &Z :Z! 0 0 @ X@ P@T 1P 8 0 (Ѝ'w0@V0@G0@G0@H0@G0@H0@/ $/T0@p@-PPD0@` 8@1P @T@pTQ0@0 000 /TP@-@P  2@@8@-@P ,0PS 00S P <W 40 0@@ 0S@88Q0@TP@-@P 0 9PQ0@8@-@@PP x1P8P08P 0P/Ps@-@P` P `00 QQ; Q9 <0 0 8< 4 00 8< 4 000 0CSF/@F/@F/@F/@F/@F/@F/@F/@ a 01,10 S0r0L0,Y RQ QQ Q  R RR Y  0pP 0 0 fR 0 SKZ0@Z0@E[0@L[0@S[0@\[0@e[0@M0@H- 0` ?0?0@0M?@?@0& < 8 1R4!f4a<90@[0@[0@@-P@-,@02s0S 2-Ԃ0@8@-P O0"0- X0p  pPT @T*0qu80 "8Ԃ0@[0@p@-O``h-0p<0S0#h@PPZ.?P30l0ph 0P($0 0,P Z03?X0S Q2/\  $:Q$ $$0 0 L0<L04RF _P⌔?PZ0, 000d4,P0@08004000PN03? 03?$ZP00S3Z 

 @ P ᪠嫠#'4"0s 07)t0p SSs{#< )x0S*S8)ipZލL;0@;0@) ;0@@x}4;0@@;0@uy_0@_0@t0@00`0  00D01@01<01$1S?$1(0 0 /0@[/@XZ/@X/@D- M@XP4* 40S 13/ PPDPRN P,002 0S00 000P0S`200Xb_ 70 000uP1)0000P0  ,000 S aP%0SUbPU*_10 R@PD@ 00 ]- p- 00l P) e0g\ 1!00S [! *400PP 0 P }P P p UP W:` Ѝs@-kPP@3P 0`P%  I@Pwtc@XfL Y@ UQ0S|d0@d0@d0@n0@d0@ e0@'w0@D-P`pi@P  (000p00 0~/@$/@(/@@- 0h0 @\ 0 S< 0:0080$0P<0@P0 48<00/P048 < ! /0@-PM@ 0 @ 0T@Ѝ00@-PM@  0  @ 0T@Ѝ0X@-\ @<S<0X@ 0  00S 0 0 0P00 0@-\ @STPPR00B 0 R  00 0X00X000@-<0H H D403/@-`0P #d@p i@T:00Sp0XQd@j P` X@T*@Tm0PpF4 pe0@@-`0P d@p 8@T:00SX1Qd@j`T0 P` %@T :00S 4 pe0@N-`PȐȰ$pZ @ 0,@ S@R@dSI 0T T 0S ` 0 0P0@ @P0 ##U 00 00 e0@e0@e0@e0@4 7@-<@ h& 5\P 0P>0D-p0P<@ 00 Sd`P `V :p 0 P$m  04 e0@D-M`p@P p0 (0`0# 030 RFP @ 0T@ЍN-`0P00 0@P A0 22p000S( l 0T100#a0`102@PB@P  Ѝ00@F-M<@0D0  P0ßp`L  @ @2@P  00  0S(n,̎0 10 0 10LPPP @0rᠢcPP,0 $p `0   040@0 SP0 90P 0b`0 E#RyT0 S0S <0 X\SH0p".d &.0h  l0H0, =x H0p.d .0h  l0H0,=x H |000<0S>">@@  0 P0P0\`0tp @@  0 P 5YP(&PUЍ2Tv"3e0@D-p`@PP{ @P P!P^|1 T040Dp@0 00L000H000P00* 0  Z0000<@ 00,00$00(0y"pM0p`0,0000H`  0@00< ; ;S s04 000M?M @ @ @ @  40,f0@@-@p `PP  .f0@@-00S 3/@-00S 3/@-@-@04 ,?<100sl 0  00 0  0 /N- 0P@2#,p 0 2"4 2#000`J0`FV 0##0l !"(     "8 \ 0 1#(00 0P1!4P1#000v-ah0@N-  0@ P2#,` 0 2"4 2#000 0  2"080 E %@P 0##0# py)(  S py)4y)0 p圗)8 0S f-h0@N- 0P@2#,` 00 0 2"4 2#000p/@P 0##0 0 2#(00 0 !"80 @P 2#0 0 2#(00 0  2#800 0 \ 0 P1!4P1#000 0Z-ah0@h0@p@-@`P9Q" 0!",` !!4!#000f:p5 0 1!41#000p``@@ Pp@fV 0p@T  0p@p1 ` 0/N-\3LĠ PPAL PaLPP [pEPEwuPw匠 Z5P  [.  Z%"Z :ZbP f cP f bP f cP f  - @URwY0@-(Q!A 00T0s0 0 0 Q@0@@\0s00000R00@-(Q!A 00T0s0 0 0 QP@0P\0s0000R01 @-5A{ 00h0@1D-@`` !v`R  - - !-  r  w?  1PpzP  Zw A PpUw?`Ppv`P  Vw k PpUN-`PMp z P@Pt >11n?1 1=11= >C= 0]1101 0S{0 X'5|0B0@ Sq 0=0= 0=0!00S7 3/PP41S( 0 0S 3/0q<`00P`4uP <= 0==03= <|=0= <`=0= <D<0<< 0V0=0 T=0=Tg?#| \0  \%0 00w/@00 0010ĭ= X =PU`"t3 Rꄯ/@ ĭZڡZեFFUPFuPSppW p W㶠p.p.pzW qUPfv``F#!%r  -H -\) 'W㸠p.p.pzWqUPfv``F@Ō |R/   - R R    0480E0D04 $0R0 . R( ,!p//( 0,@-@!#!1|.Q qU;//0P10@//0PS#Q 30@;Q r @   /F-p'@`PH V<0{,`(P$p.<0@0 0S Z00|0 tHV   @01P00MZ111400=-^P P0 S0@S0@'w0@Vj0@H=0@=0@@- 90@#Q004 R- `Rv`-@$ p$ pbQpp$ `wp` $0p$p`y@-@@P00,00@908@-@EP,0(00(0,0 0ss0 E0003/EP8PQ0@- 0P <(0LS (0(0C(@TS(0g \E@F-P90@0z_Pq0S㶠0PxP40zcS  $0` Sv` * c V1$ yD$0 $嶠$ 0R 3S F8@-, @(02! .1PP" "0 0== 0S, 1S , 01S t 0`Pv`=S=0=00S 3/p,=0@h0@///PQ@- (0<@<P! P7 L0 q -  0D-PTBqT(T0{$`( `c@V@`# v00v`@V0$ S0Tm0 =嶠(D0S00 00!0PQ@-@@; (0rQ40$@ .8

V1  ( P 03/00) P5 03/`10V 00$0 0S0  &0S/@/@/@/@0SP 0P00 00 @T @TN%0S NL 0SN-P B{!Ta 0 @T@D@001qz} r R{ |  0s0q00T 00^.$/hSU S  S% S5,0( c Z 1 { QJ0305f,02, S-(0[%:)0 Q% R01ŵ !0, ( bZ!zQ 0 ,0 ,#S 1S0 0 0`0(0S B0 !001 00F0T0Tl0@k0@l0@k0@N-鼰+ {$`VP 0 PUPEP 0U1@0t@[ CCpwpW 70! 000 R :(S@ \0 c00sq Wp\ 0p ,00ЍN "B R@1 t 0@00pmpBM $@ 0HH0@@ 0!/ ЍN-P%Ա`{_ 0S@ @T@D@pTwp0 0@ r R 8 & R  "/R-0S*1nS !S" S  P @  l@pLt̄l  !10!(R B NpEp mu 0s0M  sr ps&wppp (0 js0 S J , \, ^0s000S 0ss0 \x0305q0Ys0 / ]0 000!0Zs0L0l00Z0 sr 00N1 ?0E001Sj0F0  0 k0@l0@@-0S S@@>< @ $  0s00@0S/o0@0D p@-`P\ `@T  4/pp   /S\S`/0S/@-@0pS S SI1`Faa`aa0PPvf  \cP*P0S S S"00``V0! V V0P0p  0"4  00pSp0  0pSp/D-p@ w000P0 ߠ0 `.00 eP`0 0S  S00D:@-`1p@0S@9@`PP  3P@*@ 81 S@`$` 000-0` Sl P@@P P 0 8 P00@ m0@m0@m0@N-MQ@`P1 !)?! ? p? F $!!M??/  0 0 P- !1 @`c!V*Р  p P @`bV ! p ? ? F !!M?P?P P Р РK"m0@00@-@ @ @T 0 S0P@P@PU 0@ S@000\0000Q 000F-QPp1P0 U(` #   @U7 RPE @uPT:JoP0 S?2P>1 <P  0R 0SPEuPU pBPᨐ PE  Up @D |P0@ 0  0S  S00  QGm0@ xH-0P @?0?0@0M?P?P Pl `P 006H PR, P `Kx  =n0@Z0@Z0@x0 0@-TM P @P T H  0@ @00,@L@0 TЍ0 @n0@N-M@(D d ,0TP"d0 SP΍`t* ̰ h h X*hp !' T<*uPP pp`(* U  @{ S`Gx`  0`G@` x`@0|0P`  0/S\S@@ C1Sʝ\\P 0HC> 0  /S\S  ʝɟȟ0ʍP@U `$~d0( S8PH00 0VSe  0 V 0  RZ@X V` ,(0 P0V %0SA  &Sʝ\  0g\ P+ ^ʝ\0V0 S! d/ S H 0NP IP\ 0R $ `$7 @F$\:d0P Sf0Ul `6Pp @Rx 00 'p0Up 0cP S030#SR ʝ\  @k|P 0 00 /S\S ʝ\X SUʝ\00 SM p0d t5` R `%P0PXP%(50`0%4P$Ek000SY   RS@Q `$0 W 0` '0S; l )0SWW  DHRpW P @ + 4zW 0 `4/ /40S 4 0% 4mP hP @ \( $$$D3(#$0 \:`PP(d0 S?2Pl:0,ʝ\00S/H0E @P \$d2 Q`(Q 0CPX\᳠1*,\ (V`! P @ `PPd0 S20P* @( T@jp\`d@% V@1 @!`0 \P @Q`d@g ZVI `hPP@d0 S?2P:* pY0@SP/d0 S2 0P)* pPW`:  0%P@`  0P`@3`gPXd0 S2 0P* p` pލ kn0@'w0@ n0@n0@n0@ Gm0@ n0@@-@`Pp '00 0-Ro0@0 04@- @ #D$@@4$s0R=0@N-`p< @P0 0 0S 0  KY 0( P0` 0 Kcq'  P` `@@ V 0( ЍNЍq0@p0@p0@p0@p0@N-`@PW 303 :: 0 `V p@PZUT# 2\WV:`Vp 0Pd@` p@-@P` 00 00 000pD-@p`PQ P@PUp@-`Q0  p0S@ @PPS:Q Q0@0pp @-@Pd0    `0SPPp0U00 N- M DP H@p y0 0S*0Q `V v  V95P4@\+W) \  L0 k0[ 00`c    RZ/`F@`bZY W0 @X  @  0 RZ/`F@`b 0 0C[ 00SZ[ 0  0SZVXЍq0@N-PMpPs%S0@p0+S  S #S -S 0S @@@@@@0C \` 6&0`F00C P *S``0V`f@ 0.S000@ \ p *0J00A \*P0Z  hP LQ ZQ zQ tQplQplPpL0nS cS %S XSdS iSsS oS pSuS xS0 0`FV0   `FVʐ@ 0 0 MS ISfiS mSa@@(0@: 0^, QQ @@06S(0@: 0[, , Q Q004S@@"($     l00S*[.00[00@@@( 0! v0 @!@` @H0>Pp0T0 F0 ` ?0= @ @%000SP0pGP. LQ 0  lQ  0ZS 0tQ  hQ0Sq q S ?A @P p0S 0bPЍq0@o0@p@-00S 0x\@ D0 R R ``0 P0@DQ p00C 0Cs070CS:Ppo0@@--\`@@-@-  : @ Ѝ/-@-  0꠆0 00( 0$ 0 00 ? /0    / N-0ᤠ(0`p,@ P`  p`T_0 0!Y  U !P 00@Tp@-X XPX`0#D@ <00S0h00  p@  q0@h0@-0SP0#aQ<@  R(E00@`@   q0@RN-M@` >n0?s0Si0?s0 SdpWaPU^0SZ   0 RQ0?s0S SJ (`|,  0@ 0     0 H*00S&  0P0U0P  S0 ``Px11(w0@ x0@T0@p0@,0@.w0@l12.Qp:Yxʱ -No0 P%@Fpg`ڳ=^"25BRwbVr˥nO, 4$ftGd$TDۧ_~<&6WfvvF4VLm/ș鉊DXeHx'h8(}\?؛uJTZ7jz *:.lMͪɍ&|ld\EL<, >]|ߛُn6~UNt^.>v7_dcache_inval_rangeERROR: %s - start address is not aligned - 0x%08x ERROR: %s - stop address is not aligned - 0x%08x Resetting CPU ... offpc : [<%08lx>] lr : [<%08lx>] sp : %08lx ip : %08lx fp : %08lx r10: %08lx r9 : %08lx r8 : %08lx r7 : %08lx r6 : %08lx r5 : %08lx r4 : %08lx r3 : %08lx r2 : %08lx r1 : %08lx r0 : %08lx Flags: %c%c%c%c IRQs %s FIQs %s Mode %s%s undefined instruction software interrupt prefetch abort data abort MAYBE you should read doc/README.arm-unaligned-accesses not used fast interrupt request USER_26FIQ_26IRQ_26SVC_26UK4_26UK5_26UK6_26UK7_26UK8_26UK9_26UK10_26UK11_26UK12_26UK13_26UK14_26UK15_26USER_32FIQ_32IRQ_32SVC_32UK4_32UK5_32UK6_32ABT_32UK8_32UK9_32UK10_32UND_32UK12_32UK13_32UK14_32SYS_32resetting ... WARNING: Caches not enabled A335BONESKU#01SKU#02A335X_SKA335BNLTUnknown board, assuming Beaglebone LT/Black.Could not probe the EEPROM; something fundamentally wrong on the I2C bus. Could not read the EEPROM; something fundamentally wrong on the I2C bus. Incorrect magic number (0x%x) in EEPROM A33515BB1.5Could not get board ID. ddr_vtt_enboard_nameboard_revethaddr not set. Validating first E-fuse MAC Error %d registering CPSW switch ## Error: illegal character '='in variable name "%s" ## Can't malloc %d bytes ## Error inserting "%s" variable, errno=%d setenv%lxenv_buf [%d bytes] too small for value of "%s" In: No input devices available! Out: No output devices available! Err: No error devices available! .callbacks.callbacks:callbacks,.flags:flags,baudrate:baudrate,bootfile:bootfile,loadaddr:loadaddr,stdin:console,stdout:console,stderr:console,*** Warning - %s, using default environment Using default environment ERROR: Environment import failed: errno = %d at %s:%d/%s() env_common.c## Warning: Unknown environment variable type '%c' ## Warning: Unknown environment variable access method '%c' Warning: Non-standard access flags. (0x%x) .flagsethaddr:ma,## Error: flags type check failure for "%s" <= "%s" (type: %c) ## Error: Can't delete "%s" ## Error: Can't overwrite "%s" oldval: %s defval: %s ## Error: Can't create "%s" ERROR: - must RESET the board to recover. bootm_lowbootm_sizebootm_mapsize%d Bytes = Unknown OSUnknown ArchitectureUnknown ImageUnknown Compression%sImage Name: %.*s %sImage Type: %s %s %s (%s) %sData Size: %sLoad Address: %08x %sEntry Point: %08x %sContents: %s Image %d: %s Offset = 0x%08lx CPU-## Loading init Ramdisk from Legacy Image at %08lx ... Bad Magic Number Bad Header Checksum Verifying Checksum ... Bad Data CRC OK No Linux %s Ramdisk Image Wrong Ramdisk Image Format ## Loading init Ramdisk from multi component Legacy Image at %08lx ... initrd_highramdisk - allocation error Loading Ramdisk to %08lx, end %08lx ... reserving fdt memory region: addr=%llx size=%llx image is not a fdtfdt_highFailed using fdt_high value for Device Treedevice tree - allocation error Using Device Tree in place at %p, end %p Loading Device Tree to %p, end %p ... fdt move failed## Flattened Device Tree from Legacy Image at %08lx fdt header checksum invalidfdt checksum invaliduImage is not a fdtuImage is compresseduImage data is not a fdtfdt overwritten## Flattened Device Tree blob at %08lx ERROR: Did not find a cmdline Flattened Device Tree Booting using the fdt blob at 0x%p ## Flattened Device Tree from multi component Image at %08lX Booting using the fdt at 0x%p fdt size != image sizeInvalid OSlinuxLinuxnetbsdNetBSDoseEnea OSEplan9Plan 9rtemsRTEMSu-bootU-BootInvalid ARCHalphaAlphaarmARMIntel x86ia64IA64m68kM68KmicroblazeMicroBlazemipsMIPSmips64MIPS 64 Bitnios2NIOS IIpowerpcPowerPCppcs390IBM S390shSuperHsparcSPARCsparc64SPARC 64 BitblackfinBlackfinavr32AVR32nds32NDS32or1kOpenRISC 1000aisimageDavinci AIS imagefilesystemFilesystem ImagefirmwareFirmwareflat_dtFlat Device TreekernelKernel Imagekernel_noloadKernel Image (no loading done)kwbimageKirkwood Boot ImageimximageFreescale i.MX Boot ImageInvalid ImagemultiMulti-File ImageomapimageTI OMAP SPL With GP CHpblimageFreescale PBL Boot ImageramdiskRAMDisk ImagescriptScriptstandaloneStandalone ProgramublimageDavinci UBL imagenoneuncompressedbzip2bzip2 compressedgzipgzip compressedlzmalzma compressedlzolzo compressedNULL device name! BUG: failure at %s:%d/%s()! miiphyutil.cBUG!miiphy_register: non unique device name '%s' miiphy_register: cannot allocate memory for '%s' mdio_register: non unique device name '%s' %s: %d - %s <--> %s No such device: %s %s is not a known ethernet MII devices: '%s' Current device: '%s' PHY extended status read failed, assuming no 1000BASE-X 1000BASE-X PHY AN duplexPHY 1000BT statusPHY duplex read failed, assuming half duplex PHY speedPHY AN speed read failed, assuming 10BASE-T serialstdinstdoutstderrCRCCksumxyzModem - %s mode, %d(SOH)/%d(STX)/%d(CAN) packets, %d retries Unknown errorBlock sequence errorCRC/checksum errorInvalid framingCancelledEnd of fileTimed outSorry, zModem not available yetCan't access file, bootcmd=gpio set 53; i2c mw 0x24 1 0x3e; run findfdt; mmc dev 0; if mmc rescan ; then echo micro SD card found;setenv mmcdev 0;else echo No micro SD card found, setting mmcdev to 1;setenv mmcdev 1;fi;setenv bootpart ${mmcdev}:2;mmc dev ${mmcdev}; if mmc rescan; then gpio set 54; echo SD/MMC found on device ${mmcdev};if run loadbootenv; then echo Loaded environment from ${bootenv};run importbootenv;fi;if test -n $uenvcmd; then echo Running uenvcmd ...;run uenvcmd;fi;gpio set 55; if run loaduimage; then gpio set 56; run loadfdt;run mmcboot;fi;fi;bootdelay=1baudrate=115200arch=armcpu=armv7board=am335xboard_name=am335xvendor=tisoc=am33xxset_default_envarocsdxbim### ERROR ### Please RESET the board ### U-Boot SPL 2013.04-dirty (Apr 20 2013 - 08:30:43) spl: ymodem err - %s Loaded %d bytes autoloadyesNo Ethernet devices found ethactProblem booting with BOOTP (%d:%d) Vendor: %s Prod.: %s Rev: %s Model: %s Firm: %s Ser#: %s Vendor: %s Rev: %s Prod: %s device type DOC device type unknown Unhandled device type: %i Type: Removable Hard DiskCD ROMOptical DeviceTape# %02X # Capacity: %ld.%ld MB = %ld.%ld GB (%ld x %ld) Capacity: not available Partition Map for IDESATASCSIATAPIUSBDOCUNKNOWN device %d -- Partition Type: %s DOS## Unknown partition table ** Bad device specification %s %s ** ** Bad device %s %s ** Sandbox hostbootdevice** No device specified ** auto** Bad partition specification %s %s ** ** Bad device size - %s %s ** ** No partition table - %s %s ** Whole Disk** Invalid partition %d ** ** No valid partitions found ** ** Invalid partition type "%.32s" (expect "U-Boot") usbmmcFATFAT32 Extd Boot** Can't read partition table on %d:%d ** bad MBR sector signature 0x%02x%02x %3d %-10d %-10d %08x-%02x %02x%s%s hd%c%dsd%c%dusbd%c%ddocd%c%dxx%c%dPart Start Sector Num Sectors UUID Type ERROR : check_gpio: invalid GPIO %d omap3-gpio unknown bank method %s %d omap_gpio.ctimed out in wait_for_bb: I2C_STAT=%x timed out in wait_for_pin: I2C_STAT=%x Error : I2C unsupported speed %d Error : I2C initializing clock ERROR: Timeout in soft-reset I2C read: addr len %d not supported I2C read: address out of range I2C read: I/O error I2C write: addr len %d not supported I2C write: address 0x%x + 0x%x out of range i2c error waiting for data ACK (status=0x%x) i2c bus not ready for Tx (i=%d) Bad bus: %d spl: mmc device not found!! spl: mmc init failed: err - %d spl: mmc blk read err - %d spl: fat register err - %d u-boot.imgspl: error reading image %s, err - %d spl: wrong MMC boot mode Status Error: 0x%08X Timeout waiting card ready MMC Device %d not found Caution! Your devices Erase group is 0x%x The erase range would be change to 0x%lx~0x%lx mmc erase failed MMC: block number 0x%lx exceeds max(0x%lx) mmc write failed mmc fail to send stop cmd Man %06x Snr %04x%04x%c%c%c%c%c%cMMC: no card present Card did not respond to voltage select! %s: %d%c %s: timedout waiting for ics! %s: timedout waiting for sysctl %x to clear %s: timedout waiting on cmd inhibit to clear %s: timedout waiting for STAT (%x) to clear %s : timeout: No status update %s: timedout waiting for status! %s: timedout waiting for cc! %s: timedout waiting for cc2! %s: timedout waiting for softresetall! OMAP SD/MMCmmc_cdmmc_wpmmc_read_datammc_reset_controller_fsmmmc_send_cmdmmc_init_streammmc_set_iosmmc_write_datammc_init_setupTimeout!nand_base.cnand_do_write_ops: Device is write protected %s: attempt to erase a bad block at page 0x%08x %s: second ID read did not match %02x,%02x against %02x,%02x NAND device: Manufacturer ID: 0x%02x, Chip ID: 0x%02x (%s %s) NAND bus width %d instead %d bit No NAND device found!!! No oob scheme defined for oobsize %d No ECC functions supplied; Hardware ECC not possible %d byte HW ECC not possible on %d byte page size, fallback to SW ECC CONFIG_MTD_ECC_BCH not enabled NAND_ECC_NONE selected by board driver. This is not recommended !! Invalid NAND_ECC_MODE %d Invalid ecc parameters ECC: uncorrectable. NAND: Unable to find NAND settings in GPMC Configuration - quitting  SPI probe failed. SF: Failed to set up slave SF: Unsupported manufacturer %02x , mapped at %pSF: Detected %s with page size , total W25X40W25X16W25X32W25X64W25Q80BLW25Q16W25Q32W25Q64W25Q128W25Q80W25Q32DWW25Q64DWwait_for_user_access Timeout fullhalflink up on port %d, speed %d, %s duplex link down on port %d cpdma_process timeout error %d submitting rx desc cpswFailed to allocate PHY device for %s:%d Phy not found %s Waiting for PHY auto negotiation to complete TIMEOUT ! user interrupt! done PHY reset timed out %s:%d is connected to %s. Reconnecting to %s Could not get PHY for %s: addr %d Generic PHYSMSC LAN8710/LAN8720SMSC LAN911x Internal PHYSMSC LAN8700Cannot find console SPI error: unsupported bus %i. Supported busses 0 - 3 SPI error: unsupported chip select %i on bus %i SPI error: unsupported frequency %i Hz. Max frequency is 48 Mhz SPI error: unsupported SPI mode %i SPI error: malloc of SPI structure failed SPI TXS timed out, status=0x%08x SPI RXS timed out, status=0x%08x musb-hdrc~~allocate_instanceUTMI-16UTMI-8OTGmusb_core.c, dyn FIFOs, HB-ISO Rx, HB-ISO Tx, SoftConn%s: ConfigData=0x%02x (%s) %s: kernel must blacklist external hubs %d.%d%s%s: %sHDRC RTL version %s %s %s: setup fifo_mode %d %s: %d/%d max ep, %d/%d memory USB %s mode controller at %p using %s, IRQ %d PIOmusb_init_controller failed with status %d HostPeripheralep%d%s?%s %d: SetupEnd came in a wrong ep0stage %s %s %d: SETUP packet len %d != 8 ? %s: peripheral reset irq lost! WARNING in %s line %d musb_gadget_ep0.cidlesetupin/statusout/statuswaitCould not flush host TX%d fifo: csr: %04x %s %d: rx%d, packet/%d ready? %s %d: broken !rx_reinit, ep%d csr %04x %s %d: no URB for end 0 %s %d: bogus ep0 stage %d %s %d: Rx interrupt with no errors or packet! Failed to enqueue URB to controller MUSB host is not registered bad parameter. Controller uninitialized gadget_start failed with %d bind failed with %d musb_g_ep0_irqmusb_h_ep0_continuemusb_host_rxmusb_h_ep0_irqmusb_ep_programmusb_rx_reiniterror: overflow occurs FAT32 FAT12 FAT16 FAT: Misaligned buffer address (%p) Invalid FAT entry error: wrinting directory entry Error: reading directory block Error: %ld overflow Error: writing contents Error: flush fat buffer Error: writing directory entry Error: finding empty cluster Error: clearing FAT entries U** Partition %d not valid on device %d ** Error: FAT sector size mismatch (fs=%hu, dev=%lu) %s%c %8ld %s%c %d file(s), %d dir(s) Error reading cluster No current device Interface: Unknown Device %d: No valid FAT fs found Filesystem: %s "%s" reading %s ** Unable to read file %s ** writing %s (((((AAAAAABBBBBB %s %llu Bytes%s%lu.%ld %ciB%s%08lx: %0*x %s himport_r: can't insert "%s=%s" into hash table WARNING: '%s' neither in running nor in imported env! WARNING: '%s' not in imported env, deleting it! %s:%u: %s: Assertion `%s' failed.EPTGMK0123456789ABCDEF0123456789abcdef## Warning: gatewayip needed but not set ARP Retry count exceeded; starting again bad length %d < %d bootfile*** WARNING: %s is too long (%d - max: %d) - truncated Host NameRoot PathNIS Domain NameBOOTP broadcast %d AM335x U-Boot SPL Retry count exceeded; starting again %pM%s%daddr%saddreth.ceth%dmacskipethmacskip Warning: %s MAC addresses don't match: Address in SROM is %pM Address in environment is %pM Warning: %s using MAC address from net device Board Net Initialization Failed CPU Net Initialization Failed Net Initialization Skipped ethprime, [PRIME] Warning: eth device name has a space! eth Warning: failed to set MAC address ethrotatenounknownnetretryonce ICMP Host Redirect to %pI4 %d.%d.%d.%dipaddrgatewayipnetmaskserveripnvlan*** ERROR: `serverip' not set *** ERROR: `ipaddr' not set *** ERROR: No ethernet found. *** ERROR: `ethaddr' not set *** ERROR: `eth%daddr' not set Abort Bytes transferred = %ld (%lx hex) filesizefileaddr/ *** ERROR: Cannot mount *** ERROR: Cannot umount done *** ERROR: File lookup fail *** ERROR: Symlink fail T /nfsroot/%02X%02X%02X%02X.img*** Warning: no boot file name; using '%s' Using %s device File transfer via NFS from server %pI4; our IP address is %pI4; sending through gateway %pI4 Filename '%s/%s'. Size is 0x%x Bytes = Load address: 0x%lx Loading: *octetblksize%c%d%cFile too largeFile has bad magicblksize TFTP error: First block is not block 1 (%ld) Starting again /s TFTP error: '%s' (%d) Not retrying... %s; starting again Retry count exceededtftpblocksizetftptimeoutTFTP timeout (%ld ms) too low, set minimum = 1000 ms TFTP %s server %pI4; our IP address is %pI4fromFilename '%s'.Load address: 0x%lx D h/@2Dy0@\y0@$0@/@2Dy0@y0@$0@DDDDP T 0X \ 0000 00000p0t7| 111122|77    $ ( , 0 4 8 < @ H 0L  ` `d 0000 0 0` 5  "  $ ( , 0 "4 "8 "< "@ "H 0L 0000 0 0 $X b\ b0000 0 0 $` 5p 0t   JJ  4}0@/@Ja; 3&PKPKa; Q&PKP2Sa0 Ԫ k&PKP~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@~0@0@0@0@0@0@0@0@0@ 0@ 0@(0@(0@00@00@80@80@@0@@0@H0@H0@P0@P0@X0@X0@`0@`0@h0@h0@p0@p0@x0@x0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@ 0@ 0@(0@(0@00@00@80@80@@0@@0@H0@H0@P0@P0@X0@X0@`0@`0@h0@h0@p0@p0@x0@x0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@Ȁ0@Ȁ0@Ѐ0@Ѐ0@؀0@؀0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@ 0@ 0@(0@(0@00@00@80@80@@0@@0@H0@H0@P0@P0@X0@X0@`0@`0@h0@h0@p0@p0@x0@x0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@ȁ0@ȁ0@Ё0@Ё0@؁0@؁0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@ 0@ 0@(0@(0@00@00@80@80@@0@@0@H0@H0@P0@P0@X0@X0@`0@`0@h0@h0@p0@p0@x0@x0@0@0@0@0@$3/@D8  !"#$%&'()*+,-./0123456789:<0@<0@g0@(/@/@p/@>g0@T/@L/@p/@g0@T/@L/@p/@$g0@T/@L/@p/@eserial0/@/@D/@`/@/@ /@/@`/@Ȳ/@/@    @  @  @               @usr/mdec/beagle004075500000000000000000000000001220553173000126205ustar00rootwheelusr/mdec/beagle/mlo010075500000000000000000000000271220553173000134100ustar00rootwheelMLO-beagleboard-2011.12usr/mdec/beagle/u-boot.img010075500000000000000000000000411220553173000145750ustar00rootwheelu-boot-beagleboard-2011.12-r8.imgusr/mdec/panda004075500000000000000000000000001220553173000124645ustar00rootwheelusr/mdec/panda/mlo010075500000000000000000001025441220553173000132630ustar00rootwheel@ CHSETTINGS\00@00@00@00@00@00@00@00@xV4耀C\8C\ `)%2П@P`РOP h0 P: PO ,   F 0@P/@- @L@-@@T \  00{0J Rʔ RP  t0 R R  0S  0S  <0 ,0 /ПP-sO-p`00@0@ 0@0@8@-,0@@+  PK0 @8, H@-K=4 (0( S0000b0P H@-,0(Kn0 0 b 0  H@-@d0/ 0@0/0@@-0@QQ0@S/,0@-0 <!"( #4-ܜ0@0@ 0  4Q /᪪H@1J@1JUU@->Z'N 0  0@@-808 0DAt&"*" S@NPN00  0Sb("(RR /@B0@@-@ 0PN@Bң0@400 ,0R $ $0 @//ܜ0@0D0@ 0@-00@@-D}A D`@000 0 0P@ꬡ0@:0@B0@ ? | @-Q@p:CbC `3440D0D 0 00P$@ܜ0@0D,t10@:0@B0@D-0pJL0P00008`pn0=#8< 0`1.80P,>000YDVꬡ0@@B<0@0 00@-0@0zP @@B[0@A- p@P`0 0 0#R0 R  T0$z|0 0 00 0V000rVA&l0@-0 `00S *T0@` 24 2 24 2l05l0o0 `@ܜ0@0@h00S,;@@HHPPPP000/ᬡ0@8@-@PPE@T0 0P B8謡0@:0D-@P`00Sp R0Z000 pWPP0Z000 PU0 P0S R\1A-0 P1R H1HA0@ 0 1D"1@ >0Y @C0`000  pT0 0A0 L`dl `0<000 0000    A6ܜ0@`D0@870@B 0t0p@- l0@_PPQH`@`` 0P00@0}20P0#0@00P0@` QPP0@0pܜ0@0D`0;`0/ 00000$00,000 |0R080h080)0000P0 P,0 P00PSQP1 3/PP) 0S`V* Vڄ00 R0C00P0  :0 000  1 3/PP  0T000@008P$Ѝ D- M@p pp  1 3/PP CD a P0 0, 0  200 0 10p 1 3/PP&' 0SV`V*P0  :000(P 1 3/PP 800 0T000@008P Ѝ'-04M000000,0 (0, $0 1 3/4Ѝ0@-($M$4 0 1 @3/P$Ѝ0p@-P 0+@L0"M0|0QPPP 0`P P0S L000L0"ލp?-4M!"0080 0@0,00(0$0 1 3/4ЍF-P Mp'`P+@p`LPf70:88ᨐ0嬠 1 3/PPX30㬠:PP00000p1  3/PP ZC J(X$*, R\0 :R 0 00L ,L 0 Rp " 0`P pW*   0`{PPPL00L0PЍ @-13/D0p@-S(@ S ,0 0,0 ,0 0,0(10,0 0,0(10(1H`VP  P PP,1808,1,1<00[%X,QcP`eP((p@, ,10,1pظ0@0@< 8Q 1@- RH %H513/N-P0GMM 0 0+5 0T4X$l$1E@3//`PE> p uP +88X40T4l$1E3/`Pn00+%(ˍ 050T48 8X4l$1E3/`BVUh\l0`$d4P`d h0! P \l0@.;#5"0 9000000 CP`P L000 L0pԐ԰*  " 878PX4lTT1E 3/P ;%0X4TTld1E 3/P|0D013/L0;0 P)W1 D 3/#!D 3/ ~P 0R 0R 0R  0R  XPL0pLp pW*L0$ P 0tčPPp5 tTpGp4x0p 0 4"$ t0p ##x#< x ": S(12P8* PU:Pk 0P@e  0P``  0P ( P`p: S`02P@e00 P1:H` +ݍ0@߬0@0@0@0@0@p@-@P ` 0p@dꡭ0@N-0Q`p 0 0 @T P`pZWV# 2\UT:@TP 0` pf` 0 R /0  b S @ /0 0c0\  BR00 @@ 0$ ? 0 ` 8 p p%000S@D, 0* LQ  `  lQ`  ` ZQzQ0 tQ hQ(" 0(B(0 ? P p @0S{0  aXЍĮ0@0@-@-   f @ Ѝ/@-c0@JpG$B@BOFB(pB(pAB(ApB(poB(`oB(`AoB(A`oB(`_B(P_B(PA_B(AP_B(POB(@OB(@AOB(A@OB(@?B(0?B(0A?B(A0?B(0/B( /B( A/B(A /B( B(B(AB(AB(B(B(AB(AB(FpG  pG pGO0&)-@@pG@ @F :@CRBcF@CpG@@F :@CRBcF@CpGOTd dH2 Phb 7 ?ñ2 Гh"R 5 C2 PhX00@(EJ0EJ8EJ@EJHEJPEJXEJ`EJhEJpEJxEJEJEJPJ(J0J@JHJJJJJJ J(J`J@JHJXJxx0J0x0J J(J J JXJГJ   0J8J J8x0J`JhJpJxJJ@]Y$I2X }, }JJDJJJEJJJJJJJJJ  k }  }  k }  }@   @ (       k }  } { {}  } ^ ~"@x0J(J0J8J0x0JPJAJP 2 @ J J(J DJ(J J(J@J8JhJZJL^@BDFHJLN"$&(*,.0@BDF #(-27<FP'@BHERROR : check_gpio: invalid GPIO %d omap3-gpio unknown bank method %s %d gpio.cOMAP%x ES%x.%xCPU : %s Clock enable failed for 0x%p idlest 0x%x DPLL locking failed for %p Scaling voltage failed for vdd_mpu from TPS Scaling voltage failed for 0x%x FREQ UPDATE procedure failed!!Bypassing DPLL failed %p SDRAM: identified size not same as expected size identified: %x expected: %x ### ERROR ### Please RESET the board ### mkimage signature not found - ih_magic = %x Assuming u-boot.bin .. U-BootSPL: Un-supported Boot Device - %d!!! Unsupported OS image.. Jumping nevertheless.. U-Boot SPL %s (%s - %s) U-Boot 2011.12Apr 02 201218:13:04Texas Instruments %s Revision detection unimplementedu-boot.imgu-boot.binspl: mmc device not found!! spl: mmc init failed: err - %d spl: mmc blk read err - %d spl: fat register err - %d spl: error reading image %s, err - %d spl: wrong MMC boot mode (%d:%d) Vendor: %s Prod.: %s Rev: %s Model: %s Firm: %s Ser#: %s Vendor: %s Rev: %s Prod: %s device type DOC device type unknown Unhandled device type: %i Type: Removable Hard DiskCD ROMOptical DeviceTape# %02X # Capacity: %ld.%ld MB = %ld.%ld GB (%ld x %ld) Capacity: not available Partition Map for IDESATASCSIATAPIUSBDOCUNKNOWN device %d -- Partition Type: %s DOS## Unknown partition table usbmmc** Can't read partition table on %d:%d ** bad MBR sector signature 0x%02x%02x hd%c%dsd%c%dusbd%c%ddocd%c%dxx%c%d ExtdFATFAT32%5d %10d %10d %2x%s 1 0 %10ld %2x Partition Start Sector Num Sectors Type Status Error: 0x%08X Timeout waiting card ready MMC Device %d not found Caution! Your devices Erase group is 0x%x The erase range would be change to 0x%lx~0x%lx mmc erase failed MMC: block number 0x%lx exceeds max(0x%lx) mmc write failed mmc fail to send stop cmd Man %06x Snr %08x%c%c%c%c%c%d.%dCard did not respond to voltage select! %s: %d%c %s: timedout waiting for ics! %s: timedout waiting for cmddis! %s: timedout waiting for stat! %s : timeout: No status update %s: timedout waiting for status! %s: timedout waiting for cc! %s: timedout waiting for cc2! %s: timedout waiting for softresetall! OMAP SD/MMCmmc_set_iosmmc_write_datammc_init_streammmc_read_datammc_init_setupmmc_send_cmdFAT32 FAT12 FAT16 Invalid FAT entry ** Can't read from device %d ** ** Partition %d not valid on device %d ** %s%c %8ld %s%c %d file(s), %d dir(s) Error reading cluster No current device Interface: Unknown Device %d: No valid FAT fs found Partition %d: Filesystem: %s "%s" reading %s (((((AAAAAABBBBBB0123456789ABCDEF(null)%s:%u: %s: Assertion `%s' failed.0123456789abcdefraise: Signal # %d caught į0@į0@̯0@̯0@ԯ0@ԯ0@ܯ0@ܯ0@0@0@0@0@0@0@0@0@0@0@ 0@ 0@0@0@0@0@$0@$0@,0@,0@40@40@<0@<0@D0@D0@L0@L0@T0@T0@\0@\0@d0@d0@l0@l0@t0@t0@|0@|0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@İ0@İ0@̰0@̰0@԰0@԰0@ܰ0@ܰ0@0@0@0@0@0@0@0@0@0@0@ 0@ 0@0@0@0@0@$0@$0@,0@,0@40@40@<0@<0@D0@D0@L0@L0@T0@T0@\0@\0@d0@d0@l0@l0@t0@t0@|0@|0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@ı0@ı0@̱0@̱0@Ա0@Ա0@ܱ0@ܱ0@0@0@0@0@0@0@0@0@0@0@ 0@ 0@0@0@0@0@$0@$0@,0@,0@40@40@<0@<0@D0@D0@L0@L0@T0@T0@\0@\0@d0@d0@l0@l0@t0@t0@|0@|0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@IJ0@IJ0@̲0@̲0@Բ0@Բ0@ܲ0@ܲ0@0@0@0@0@0@0@0@0@0@0@ 0@ 0@0@0@0@0@$0@$0@,0@,0@40@40@<0@<0@D0@D0@L0@L0@T0@T0@\0@\0@d0@d0@l0@l0@t0@t0@|0@|0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@usr/mdec/panda/u-boot.bin010075500000000000000000007444141220553173000144600ustar00rootwheel` 耀@xV4llȑ  L)  HUӟ@P`РOP& |0 P:Fl\ X00 pW W !   R:lLL@ PeO     OР iHM! H4P 6 MOЍHM<" H4P ' tOР iHM" H4P  OР iHM" H4P 4OР iHM\# H4P OР iHM# H4P OР iHM$ H4P 耀0@//////0????////////@-5GP/@- @L@-@@T \  00{0JP R H RP 8 ,0 /ПP-;O-p`00@0@Y8@-,0@@+  PK0 @8, H@-K=4 (0( S0000b0P H@-,0(KΧ0 0 b 0  H@-@d@-/D-P@` ᱧ Sp ᩧ Ppᢧp@-P@`       00000000Sp0P/4R 4/P@-Qy-d0PR e?>/ e-ꀯp@-@PPp00 p@ꈬ@-@PP0"01 R @D4!N?O?0般@-@P$00 般p@-@`P<0R0@Q  pp般@-P/@-0@QQ0@S/,0@-0 <!"( #4Ӑ脬ꀶ40S/ 0  4Q /᪪H@1J@1JUU@-,0 001s0g끦@Y@-808 0DAt&"*" S@NPN@-@8@- 0,//-0 Y @ 8v0`000 pᒤ0 0A0 `dl `0<000 00@0    S PA8ꄬ`D(870@B 0p/t0p@- l0@_PPQH`@`` 0P00@0}0P0#0@00P0@` QPP0@0p脬0DP MP//`0;`0/ 00000$00,000 |0R080h080@-  '8&@-  @-/////////  800/@-0@000 0 AD('Z4-|@뉅Cx-N(-\@ LDrP 8 g0'>P l6>]ENꀔW@-'_ꀀ@-x 00<0P @fP@7/P pW8@AID$HHL@< @bN@gDPF F @P 0`F00\]' L H04@00cD`x H0Ն 0@L耉ꀰY뀘)@@- K'l@0  0A  ah@- 0 00$lATN-P MT@`ZZp0P  Lj`'X=p `R/ pl ;dh x00 at0l;PPil ;PPclS.0 0 0 0lP P/l/tx 0l-l F 000  00 1 0W 00000  R R  吅p  60 10d R hP hp0 bP 00@0@0@@O :/P ЍAT$lAT ATBT/,~&M00000cSЍ//@-O:?@-O:?? ////8018<0C0 R S 0 / $H0'$H|'$H'$H 0 P: 0 /'$H0'$H8@-@P  PP7&@@  80/&P,0@ @T:0 8L;p'$H0'$H@ 0 /T//@-mp@-M@ ㆅ00<0,08 040@P&($ 0%00 0%0 0 0%z Z c0C0bvVVdnN%@0TT  @018 0,%ЍplꀀI5RwꀍY@-@%@x@-@%@@-@%@@-@%@@-@%@@-@%|@v@-@%s@m@-u%hdLP@-@ p% l% h% d% `%ۃP  U%R%O%L `K%4 PG%xH @C%l@ 0?%`D ;%T 7%Ѝ!)4H^gq{ꀂꀌ@-03/Rp@-@p@" P⽆`,%D @P@ %p<, <4 /@-3PꀀPP@-`@$);4/ꀀPPN-Pp@?`"0S`0 70S`U 啃 Y & 0 0p 0-}[0DiP<`@4$: 04/Ѝꀍ@- 00csV'8@-@$N8PP|u$Pl 7PXj$7He$ 7P8 4^$P(Z$P81Ri~ꀖꀱRA-@pP`80A `PPV]>N-p0,`(@4P80j7V V)T T``($`$$  8.7000$$0 }`P000 $Y I:$dL#Y 8:v3 T#P 0SiN-C p.`3|6⪀6P6 ⭀}W<3@ l@:7TP@P7P\#P㈠##9+6P#96Z #/6Pt# h#9Q P#9P/90S SS S P T0"6 @0 P0&Tc#꘡@ 0@D09S#k9 PTAT0Sx 7Pd]0\0^ @00L06D0XS(#4,Z`# *P0X00`0ZZ ZY@d00h00 06Pl00p00  0C8Pdlf0 HP Ѝ(l뀌]뀓lꀁꀖꀴ(Hkꀏꀴ/F-`4M@P0 pE P Y  E 0i PvA0 S"00^ 1YaD Y Y7 Y`@YL YT YY>X0H0\00]00,0 000bPPJX,  aDdh x00 at06PP:t rIx kB+l17lp Q7  06/PP   06/PPx   06/PP T_"Es  06/P4ЍY(l@^N-R@MP0p`<08 800:SS #S   0G  0EPxA>X0H0\00]00<0 000Pp pD0S "0Sx!p!pE8  0{p[ 8$< X a]0 @S[ P 區pP 0T )`0F3/!8^ 0AT [ `@^4^ l!7  04/7  0+@Ѝ(l}ꀷ s@-PT`_0P @B@P 000`@! 0@|F]JF-b=Pv!p@删4 4`D.I.0O0R \.0S0m!0S< f! Y M!@TB@b^ꀘ$D-p@`VP \PP0cSPp /!P`VW %!R@-0 ڂ0cN- BpM@R&999:耄P  \P  㸂P  㰂 P媂{U l 埂pJP  gl0S` :S   l僂`P   KP\@ L }P <  00 0`  0 iP iP 0 KiP Y Y 1 i P  0` ZiXil0 d ` `hT`?pЍEN$A^3cꀈꀨ]RD-@P; pIP V 0S` :S B ! `T  @d@uiP\ ?iPL 03 h@P (, hh#UꀈꀨQR@-Pʰ ( `IpP 0S :S d 媁@@kP  0^n# RD-@P@0 ㉁pnIP 0S :S @ s`` XkP  0<T ,znP@ 5#hUꀑF-RM@P@  Gp,IP>0S :S 1`` kP  0y T     0np@ 0L`_<[8 <,Ѝ#= <, <4 /8@-@PU;8nPP$ #bu0 u0Pt %00T@PP <8,888Xm뀦)G-`QP00SS0XRSM R 0C R  SRS> @ )T}@@}PTG0V`FaFp堐{ T @Ttp@FPp TD P @T<G@2"$ꀍQW&ꀺ-/y@-$0 wNЍXm6N-R0M`@p0aS-R9P 8;8 " -P T   :@PT * ] tPP t R }P2T  hZP  T`0p  0@pT * &sI sPP`o Kt U |PPT\ڔI `pPC sPW3tx =0sSTF0T0 0 0i 0,0 D<R'00p@0'`Q`1,0  ,00eS0,0,0 R @,P>Q V>Q%[R&00`@0&pxPp,,0 S SP1,0 0D  V@ U,00]S,0]QPg@,h|,|P0 U ` @,0p@xWoP@0 =rPsll CPrPlSpSUP PT T` @(g@즟uopPscT  $0/o$PpU NI$?DmD `( )m0@SZpIII耤J耸J耸J耸J耸JJ lnT0 4&P0(\$&$d @T@ B@DT:dT@3 lpmP$*s#Tl dxTL d\ $L @dT0T(pP%P#  {P TnPrT qPP rHrPPr0hSLC`YPVP0P 80I$0 C0=04{U0,sU 0 $kU0$c2Smx][h {PP }200 zP ]~ @P W~<2 0$ zPPP00pS"am@$" 0lpPHrtg000X0 0 PUWaS ~ ~81 0[p@PE!rdS8 }0kp@P5r00cSTTPPT@  x}@ s}Pl`# 0"  nzPP00$L0ЍXmWuꀤ\m=2^yZ>)>ZUꀭꀵꀓ}2">Mdzꀑꀨꀶ)wR-0K}ꀜꀶvRA-P A0iS cSsS tS```` }@PBPP LVP V VPPpP3 01&ꀬ@-$$ `0A 0m۶<, <4 /0 .R00@/R 0S//RA-@`P8 p_P  E0H 뀈Q W SPMRA-@`P8 p P  E0P`V0/,\N-@ M`=Pm P,(3 @3000cimP mP mP V`QP0S mpP pt2 Y pWX, PLnE<n PV0Si`p`3r0p 0mp 0W 0 pP   0 R QS@1 0@p0 0h0S01 (ENꀔR  @-<0Q0  0S ЍN-P8M@0 ` p$cQ bQ(sQ tQ#R aR_` @T  0o 0pRP ` Q@DT -RI B HmV@DP 4 00 i P'000 04`[0000 00`0h@P000 0 [ x @-@M@ L0 0  00ygPX PXЍ 7iPP; Q =  t -0S P P 0 0P Q HXT R  0Ѝ0w뀷-< gu뀠R@-P2@PQR@ M kPd ` @P  P5iPP P3_ , G$P pWQ* h$P& p $ Uw `0FSK`V1 D0$`Pp I$p$W뀸뀸D-R M@ ^PY  PkPTt@P PCTP@PD@P! 4h R ^ g -:S  000 0S0Pʼ0@ <"<4("$Pm`p PpfV `) T%  Ѝ<P 72lk;@S<, <4 /@-@`PP!0P|P&V P 0S @PP@p| `V @P  jh`WP PꀙV'K]m{뀋R@-A aj@@//RN-`B@KgPP@`Fp@gP ;gP 6gP 0gP V'gP YhgPAgp3DgP7gPUUW gPfp3fPfP}fPfP_|fPf렯iXfP   j  j 0`sWfP   j  jZFfP   i  iZ4fP  i iZ"LfP   i  iZ|fP  i  iZUUW P`iV A[ z3z3 OfPP !P pSLORU뀷뀶뀺$ꀫ뀲뀣뀧뀼N-RhM R REA (i@< i@ P| d i`+PP 0SP``0S4Yd0S :S F dhpp |1P  De$ e00< 0%=01D  eP  ePt D00 $0X` 07@-1@S<!a0P0 #4dP(dPHdP ( H01S |!hh!8T!HC?0B/ $#4>Khu)뀀뀟7@-@Px0ll @  0\00T0 0L0S <, Ѝ0@ Ѝ0!뀍7뀥)p@-@P` PL 80Sp(`p@Ui뀕)뀣@-0  @t00Sd S\ STTz0Hu00S0n(@k뀮뀲)G-@}`P|Gp J%1YP|`1UG?)F-@P dp4` 0(0Pp S$%R0R\ \0C\0S8 Y 0  C W 0 0p|p p0 0!60 pS  S 10 cP(cPHcP H00 (0p5S  (P `5ZQW" &6N@- M@ d l ЍRD-`p ScP  McP  |?&Py+dD=L 9c@P< 040S(   *c@Pr# c@P"V u#PP 8@ T f`Sb#PP 0S @ TlF` bPD'D bP#V`p'@P 0S W` 'h.p e'0P 0S [.V3bP$`R0S)V e e` e@ 0<'` 0 [;QpPS 0 G00R .  I$R&R0000R00$R0    0 00Z @ 0fS  ` `0    |   000ppT]P/0@  @/@/PD0  <04,0Q0@///T]u 0R00/Ḵ@- 0S 0 /Ḵ@-P 0!S\T0LLL 0VP<0<0808 0  %%M`PkMf000!1eL`PM W|`  F!@  @!D 8p  p4P H PL@ 0 08@@8 , ( P,K P rPJ@DT 4 00 @D4 , ( P,K P rPJ@DTH0pP<WL@0X 0P L`P`zM8 $GK 뀀'뀙ꀈ'뀰'뀼'H&W&'@- !  0_N-8Mp V0007IP`,37 [  0HPP! T 4 XT 4@0S@PU00 d 0P00 H 0P 4Z` @PPF8Ѝ''(''p@-@PM/ GP` 0G 0QPNKPU ` :#:A]P``^PPc0 P0KPЍpp@-@P p@KLp@-P@HPp,LH p@K'N-@M`@0_IpP~ R< 80``P Pp0Z.p``)@TPp@-Pz)0p@-SP@  R0S 000`0 0   0 pp@-0`@S Pd00egP0S `0 00pRp@-@P ,YRP \Ppp@)8@-PP 0p@$S 0?S 8P4"_W8@RP8@T88Lv뀝)N-@`p* U j `r @ QPRUp  `P`P R PV@ Q00` QPPV QA @ Q PP QPT F-!0p0[ QP@P x CQ=QP``P1@@QP @TAQPW10Sp@/ + 0S &W0S00Q@QP t0Q@p @@T@@@uP2ꀠ)Lv)p@-PP0@pIQP @TpT0` 0S Dp@`0S00p@Lv)@-    8@-@P0 P 0PP8F-頡P@pQP`V0 %  p WWpp x 0 00SD pp pppT 0S  0R3 S 0 00R00 0 000  0   F 0R00 0 pW|aF-0@SP`P0S J0S 0 {P @r0\R00S RpP+ PzP 0 q 10\R0  S R00 0R00 0S ) 080S/Lv@-LPH@PD08,883P0(8@)Lv)뀄x**p@-@PM`/ 0S, .PP 0S 4PPOO|00t0P 000 0@ @0080@ 000 0@@Ѝp)pTN-@8Mp#0 C zC 0q0 PUS7PR 0 S 00SS 0 S A87  pW 0$pppP p`pp  BR 07P0Q@pWPPU PPUPG |PG 0u0$Q  RPqP3 0 ~GpP(W{0S VZ00Yk 000 0O "  `, 04p3F& S# gOpP@k oO@p,0` O,O  #O1 0@P0S 0Z 0P00004p @ `0Y 0P 0 0 ` 00P 0 0  W W[  W0[000S #S PP 0S @ ;P Z@. Y+ O=NP M0 0 0Z A0 P 0 1Y 0 0C 0, 1   0P 0 0 Q5  P,`m`N 0ZP UNRNN0V  0S0,`N 006141;gNP0x .P0` O L1P R 0 jR "0 00 0:/0S 00iz0 0j42"0Z 042( $W R W$# WZ 0SS0 0 0PQ@@TI 8ЍLv뀷QW *C*@*N-0M@` NuP` K0S  005 080S Z 03/[ 0KS(0S [   P Z  Z(0S 0S. [ &Z #Z $Z/ "Z;Z 'Z\Z |Z 0S (0S 03/03/ Pp#( )y ( " 03/03/00 0   03/ 03/0000_P0S 0?P {P .0     03/S 0  03/ 03/}Pp}P;9 0,00S8  03/'Ppp&#0,0(00s03(0 J  D&Y 03/   9|Y 03/ T 03/p\1  (Fl1  M   P u0 S,< 1PRP$P,%u00S ) 0R 0,000S00,(0 S ,$z  U0ЍY0S 2ꀂ*Lv|耇*뀰*@-000(0000 000 lЍ|8@- 0DPp@-@MP``P | ph \ P H P 4r,e00܍p(4뀨')474@-0SS G3/@-@P P'PQp@-@Pp 0SP _|P0S00pp@@-@P`Pt dPPpP  DPQ 0 P @@ 0  'D-@P`pP 0T0 `P CP@*p@000@-@P , !P '00@  R/a0@SW@/A0@S7@/8@-@PP8P8N-@PSSp 0pS`V ` pP~00F Sx+++,逐-,逐-$,4,D, @ ` @ ` @ ` @ ` `  @ ` @ ` @ `  RpH<,!C<#J$#J%#J<P:pP3040pP*0p400P0 40 pP sP  pP0UfP P```@/8@-pP@`4P 4@EBP PU@@8@-PP@ <5@P < xC |B8@-P (048 840408 -t0DM4 4 8 d< 2CL SB10<0$040(00000,0,0DЍ뀠%뀔逤逬逴|02#0@-P> 0*A4+! !0|00.  S00@-@C@DT 0P/   (%L0p 3/L뀟%D-0`PVrBZ! 0$4p0,Ġ1'tp@5`0 0( 0g%V 5`FSV5SE @LXS8@-@ŀC%P5PESU%0P 88|/@-p`@  iP 1U@|`1TPN- 0@S` \R B0Q10p|>0S S30 S G 01 pjB0%10&1J#&! &! %!p%J 0QB00>0  $ "$ 0S 0PE0 R;4@-h0 w`p1M4P $K/  0@P PP0wVt0p00 Vh`l` @ 0ppЍ@-$(M"(@h 08#8 0d00  0Ѝ@-@p `0P`P PLd@` 0 4 S0 0[4뀀4@-0d 0 0 00 0Ѝ0@-MA0 Q|U|#&1S0Sl*h0("(1 4 ! }/  0Ѝ04@-h 0M!!$d0  @00 0tPlpЍ@-h("(0  Č! d   !0YЍ@-4h8@M#800!0 0d00  !0@Ѝ@-48M#8@h0 00$08#8! 0d00  =0#Ѝ@-48M#8@h0 00$08#8! 0d00  0ЍN-M⸓@`pPdh0 104 0 PPUЍ@-P!h  p@P00 0P00 0P0S0S 0T   \0RS00PP2@-RSpMP`@000 Q. 0Q  0P%0S" 045 0PpG 0? S *PUPP 0P  ߍ 0q0/HLp@-< Q`T0@L 0@0%<%@%D%H%L%P%T%X%8% (>H >Q  0"Q ( 0Q H 0Qߍ8565o5뀛55 6s@-P` @P/0 00 !(%R  t P\h'0 0<0a0($E U&P  c|86N-M@PPy @ *Pr $Pl [> 040#40 />  +>0 0S   0 0S  05`P=Kp3`/hP*<ⶠᴰ n  0 S(5S _      p5Wߍp@-`P@`P =`M@ T8@0<9P p@\<p@X`H$DP6e6D-\p\@P`T@Z=0000h0 14 D P z/ !0 PHd) h0 104 = h0 104 =(ЍpN-@P ` =R02 p0SpT00t3/P XX<00R0Sp2000T000X3/dX`VhNN-PR(M` @2p :#p@PP 0 R @ TPpp㐺*0AR0P  0UPg$P&800&4[0 X&,00%XP 0$ Tq0ŚT00X0 <R0( 200  00  0`PS00  3/P X0Ś 0k<00R0S2000 T0X 00 3/ 0 RX0 PPk[T0 `  P_pP(ЍhN6N-PR(M` @2p :#p@PP 0 R @ TPp:p㐺*0AR0P  0Pg$P&800&4[0 X&,00%XP 0$ Tq0ŚT00X0 ;R0* 200  00  0`PS00  3/P X0Ś 0;00R0S2000 T0X 00 3/ 0 RX0 PPk[T0 `  PpP(ЍhN60"P0p 0 /hN/p@-TP2S@Ð` 87p` @2Tp,phNL70@- @0S 4MR%PhPQT ] Wh `RT {;,00}?0 04Ѝ0USBChNN-D"00M!0R3`@0 h 0倠 0h 0 0僧0 0j}_h0 14   DS !0 P8P UW h0 140UMTpWJ X m$$ `[ P,0}/0 0 @ 5S  ` 0,0U0, U V `F,0PU pW ` ` `05  Br  0Ѝs@-% 00@$0 P joP `FvP dB00 0S0SS P 10C8#8S 1 |37뀤F-`M@Ppp) 0Spa 1#40101SPW Y05,03/J P0SSF  M:R02 00 0\00`0 0[0 0SY05$ 0SP S S  V T d`W  ЍR7뀏7@-h0 14 } 0 ЍN-1 MP@᪑iP` 0h  Ġ`- ``g00T0 S p Ywp  }/ X P 059 W  P2pp}?0 0p' 05  PP d0R\0" 0 BR 0S T QS ЍUSBShND-aPV@y|p'!1Su"1S`q So4 l9`P`"1 0#1S 0 :PS x100t1,0|0 G/ T100P1LK00S00P 0ĵ 0ĥ00S00 00 %0 Q P- `V+ `V( 0S `V" QQ Q  0S % R % h  t40$5E``QxFS逐E77tEN-bp?X00@ 0 0R0ء 8R020$00T0 0S000 3/P YYxvRb2 RM L0 0- 8 A8P V8 PQPZPP  0R P `++0  X08P% 8R0200T00S000x3/P PUPPP `PV -=0%=C0hN86.8N-@ M,h8T yA堡q`p Z80H`0PVP 0 0`dpp@XAXRP? "4`㖒"P/ rG"`h0104`$    }/ 0 G40P`œ'p   !P202Z2SQ\P U<@82S Ѝ0Q>8N(H逐JhN0Sj8뀗8p@-P@<`{8@qPTlPp`p蠆@-@0P4T@-PB04S ]004P,bp0PB! 0PS SS S404j 40 4f$4p0W$4[U1X+8S0tPM p0wPS;0404 0P=  0 P4aU0P/ (4S 0|P& @ $40"S (4S  50 $ 44P  08#8RD 0 $R@(0LP 4T쀐=X>X?XP@-TH0H  P@ @  <0A T,E>bH HHpX쀠0 /pX<, <4 //@-13/p@- 0 M000P0P 8@80001  3/`P 0  12 @00S 4?`@T*T7` Ѝp@R>h>-0$M0 00 1 3/$Ѝ8 @-0\0S X쀄>N- MP`@PpO pLQLQ 0 g00 0Cp7@ 0gZ!R0C   0 (R#   0 00 1 $!3/ P1 3/ P &0010v101 3/P  pW: Ѝ>>N-0M@P`P@S wPNq [ p1Z  :W000@0 S0(p00000P,00$01  3/PP ~P0 00W00S 0000PP1  3/P Pe@ W[0 ) P@0Ѝ ?8?J?@-S4MP000@0pS0 000 ,00$0p(P1  @3/`PU 0000``1  3/P !4ЍJ?F-@R`p PP@ Qd P Z 1 0 PZ0 `p'@ ?@-@ M0 1    3/@P}0 Ѝ@-Dq$M@o70 000  1 3/PP>)0000P0 P,0 P00PSQP1 3/PP)0 0S`V* Vڄ00 R0C00P0  :0 000  1 3/PP  0T000@008P$Ѝ D- M@p pp  1 3/PP C\0 a P0 0, 0  200 0 10p 1 3/PP&?0 0SV`V*P0  :000(P 1 3/PP 800 0T000@008P Ѝ'-04M000000,0 (0, $0 1 3/4Ѝ0@-($M$4 0 1 @3/P$Ѝ0p@-P 0+@L0"M0|0QPPP 0`P P0S L000L0"ލp?@-@0P 00 0@-4M!"0080 0@0,00(0$0 1 3/4ЍF-P Mp'`P+@p`LPf70:88ᨐ0嬠 1 3/PPX30㬠:PP00000p1  3/PP ZC JX*, R\0 :R 0 00L ,L 0 Rp " 0`P pW*   0`{PPPL00L0PЍ @-13/< 8Q 1@- RH %H513/@-D13/N-P0GMM 0 0+5 0T4X$l$1E@3//`PE> p {.P +88X40T4l$1E3/`Pn00+%(ˍ 050T48 8X4l$1E3/`tVUh\l0`$d4P`d h0! P L,4.;#5"0 9000000 *P`P L000 L0pԐ԰*  " 878PX4lTT1E 3/P ;%0X4TTld1E 3/P|0D013/L0;0 P)W1 D 3/#!D 3/ P 0R 0R 0R  0R  s-PL0pLp pW*L0  P 0tčPPpGtTpG+p4x0p 0 4"$|1t0p ##t#0Ie 00rP@A뀨a!A@-0 H0lI" hP d"@PP0TH IO00 00T@@T Z9A뀷 QA @- HBH! @=@-0@0d! H5 H) H+@-00@ @| 00  @ A 000| 000 00   A  0/0  /@-@A0 / @-C耍[@-H Pp@-@ P`A p@ A08@-P@P8@- 0@0@@-@0@D@p@-@`P0P (Up(0Sp@-0@ S S !S "S (0 0bp@-0`00@T`\Pd"@ TpZZAQؙؙ  0!//ZF-h1QUU r/㲠[/BT`0` R@@@D 00cS\㚐 8@PTpI@\P0Px000P\0S# 0R*T P"QU p\0Pz* cR !R \ P 0 0 00S6 P PPPZ[쀔\N-xjtDP@s'P` T0`DT y(`01(R$4P5'4, !< !XC !T [UN r?80 0 nu|NYT[U\ r?800"LC: s7 A @3` ]$20@2Ab$0(RV2Wb Py?,Rt_ub0 0R_"b4R(PRb8rRb"0S ($ @4P84 0S `  0 0 0 0  0T0T0SP@ P @* P@ P@80SJ<=L0% L0 P@8 P*@l P@l P@ P @" , P}@ Pw@ Pq@ Pk@G PeT"@, |P^@P PX@,pPR@ PL @(  aPRB< <@h P7 @)h MP/P  P @E @AP @ P ;@aP< pU#2PUW W U Ѝ4 K`0V00 %P0:P0< 9hx0< c< vP0< Z< m 0 '?BB뀡0BPBB 0 (/ `@-BϠ`@P0(!(pWpWX "|0D`@P0"!GoH #!I 0P00S0SEĵFĥ0 0S00G00`J0 F?R +P EPFPGPE 8@-@RP T 8DD 3'@08P 080$000(0,0,0(00088 `CC@Х\00 PP/00//bhR#/! / S/@-P@0T/0R*0 0 P//@-P@T0T0@-@P 0T 0@-@P 0T0N-(`Pp,@0 S @@ 0P (0@s/@-P @T R$0Q 0 0 0 0LLL 30 00$0 4(0 ,a/Ѝ@$ЍC뀴{ZC뀁xCP/P/ 00 0/0P P/P//@-P@@-@P QP/ 0 0/p@-PK`@PHH K?D K/!,00<00`P00p5Cp@-@Pp@PUpX0T  Q0T X0p 0T08`0P@P00CP0@@0Sp@p@-@T@HC0P@- P/3AP*xضж退逜途逜逤逸жض$(P (P (\  P0j/05A˾00 4S S SCS S S< .10*0*000* j?" 00010PP㠠꜠P0 4WpWpZW  u0505YH h#c$ H뀑ctc뀥78@-t7 POHA000001fP$TAB]` 0@1 :D10L1P1T1?0X11P1@P  : 0 400#40 0 $  "$ `@1  @  @ 0x1@!( !888 h쀐H뀫HtcH!Ϡ\@->N-!oV@ p 8P失!TP UU` pNJ pN' h!8@-@ 1問 0㐏 0㋏ 0冏P00P0 0C/@ 0<000@008 0@0 0<ӏP|0<͏Pd壽8<SL0L 0 08 08XJГJhJJ JH@J HLJii8@-㩏P0  @00៏Ptum80 0T '0D "04 ( 08@J J(IJhJГJXJ0  @ 0< /lj0   0< /lj0  0< /lj80 R $ 0S0  /ilj@-Qa0A T0 pS*pcW0SH Wp 0T pTp 0 0W0 # 30t`: S(12P8* PU:Pk 0P@e  0P``  0P 幱 P`p: S`02P@e00 P1:H奱` ݲ+ݍj k퀀L뀒L뀠Lj k!L뀹L@-ApM0S- 刱000CS@PX`hpxH |@i0eDl @P t[ K `X0XV `0k@[@MpЍjLL:::A;@LLMcM 0p@-@P `0 0p@ BM 0P/8@-0/S\S10/S\S !g R Q0A/R\R    P.Q Q\Q/Q /\\\ @.T S\\/\Q 0/\\\A  B PR0T 0R/0000"/P@ 0eQ Q\ 0\/S\SL /Q\Q/\\\ 8ccc8@-(@02PPR8cU@-h MB0tT厰/Q\Q 0i 0$ 2## 2/ۍcNMvMp@-@t Mb0vP\k/Q\Q 8F $0, 2## 8@-@ P8D-P@`pP 8@-P@@08N-`@PPp' &S  P  P 0S @ P0@S   @0TSSp@-@`P 0 p@@-@P`\pjP PV z V@-@P@Z@-@P@Rp@-P@`PV@ 'V@ @pN- p@ `P ;5 P   P  PWP``PU@-@p`P 0 p@-P p@-@ P`P T  pp@-@p`P 0 p7@-X 0P@0P  R 0( 0P  R>7(1(s@-P,`@ P 0|'F-@ PpP+0P/S `# / P``  jPp p0/S S / P`` 0ipP0Sp@-@P  p@N-@Z`PBY? `pP+SPE/Q0CJZ0 P `) 0 S 0P/00P W 0 SUPE00 p W00W0S w`w` ``ЍF-P@ P#Tp' `0S`QZ0T  P00P0Spq @- 0P p@-P@ Pp B0p@F-(`Pp P  0P 0S P  BP@ 0Asp@- @P P P  &P` pD-@0t P`P  p v P  P `f`P`UM@-Pp`g@P   p P  P@@<, <4 /D-@P'PpPP`: `PP :` V#3@-@@-@$@-@ @-@ 8@-@ P 8@-@8@-@P88@-@P88@-@P00@8D-P@p(` ( 30   v`p r   iDF-P@`UpZ W 0e0S f  e @-@P`pP $>Pej 8k@-P`"2@pP (PeRM !T40/p@-@ePPP` P $  P PV ppL-`@PLP 0P@ HD pA-P`4p@P aV@ 0AD-`P@P  `P@ #  0 p  0hP@ N- M@p0@P e 0`PP  0  0EPPG uJLPPL 0 0{  pP00 0p m0 0pP 0 p`0  n piW0`0 0PP40D APU  N P Ѝ@-Pp`@P 0r P@   0 @N-@P`P4 0P,p*p Pp @PHP 0P @40    P40p@-@`P@ 0 p@A-`P@PpP e0At@N-P@p`P\9P`*$   $ P 0S`E   P P`5h , |( W$ 0 UT1*  Q  0  @00<20UT`Ѝ p@-@0PP`$C 0"}pP4/0/ p$0`0P/ /MMM<, <4 /@- 0P/@-@ 8@-@P8D-@$`Pp ` * pgp`V$D@-@@-@8@-@P00@8@-@'Q8@-@P L404020088/L-@PP$~PPy`puVP p  @-0 D-`P\@P pkP@ 40 ~8@-PG@PYP40@8N-@ 6`P?+ (Pip  PPPj $ 00 pPg0P: @  U  @P 40  (`ЍD-@PP>PP8 40 p`$ g` "pP p p ^ P0SP  @-@05 P 0R@-00P#  S:7@-0@P0$ ~0QS>p@-`P@P  @e@30P:@p8@-P0@(ܩP P8@-@G a0@-R1@   @\T:  ` p@-0 @`\UP2P5:PPUP@T: p0 B,R/,0@- ,@ D$@@$ R,R \p@-0 0 R , 0P"!C@|`@D `a &`a &`a &`a &TU!p$00S  ,p,@-@-  u8&F-`p<@ " 0  Z Z @D 0U ЍP " 00 0@ as' Dy" o" P@P @@83T (.  ЍF(,ꀟN뀬N뀰N뀵NN-PMpPp@S@@!PU= P8  UP! `T  0! T     `V:`    .`V P 0 D CHۦPpe00WPЍꀽN2N㈨N-@0@M$00(0Pp <0`d` P 嬦00f0Pp Pp [`噦 0 c  fq p PeP @Ѝ##NNN@-\   @ Č  @T @T\: TO+O 0p@-`Q0 p0S@@PPS* Q Q 0@0 `Pppj@-@P P`T0 0p0SQO` P0VH00jD-p `@P0 0SP00P 0```p `0W:0 jF-P@pP ` 0 R  }P0```P `0U:0 jN-M   p8@yJ 0Z" Q``  P 0UP g uU # 5PQ R 0 0廦`l0 ` 00S1 Pq0 lAP U0Pi0iPU/  0 R% PQ R 0 0偦`20 ` 00S P070 20 0S0S & 0R  00! \ P0``0`P0S 0S 0P00PP0 PPЍj0@-M  0@ 09PPP0   0"0 0  000Ѝ0jN-M@0R100MPp$ ( ` ` ,@ C U  @0S90 `0 [P0  0Z `0 `0 0#R00S$ 01g 0W`  ^S \S0S 0Y $1$,@_ 0T @ T*m 0 4( PU  $ 0=\"ጧ(0PP PP PP \PQPp0S00K$POjN-PP M@`p2   P1   x  @00S 0S ` @ ` @ P P ;[@0 S S` #S `0SD SA0`S=S S S R S R =S00 `00%000 `\R R`  0 R R00@P0 0[ <季 ` 0V*0S ߤ ЍjON-\ PU d @0p` PUVX V `Q@`V@pbqAPPPaPPP S:P@LS"*`↡ 剡牑q  Z W a ! 0S :@U\01 P3QP5P5@D2 P5@"'A  %*T0Q5 5Ѝ0/0 0 0 X0\0P T0/F-@Pp`0PXP\0`0\U@T:T1 aPy Pl`y ` @ApG000 0Z@:PpU @ A0  b V A0 b !APd  lF9P50@-0 @ PPQ*T*0 S:00N-pP0 00bG p@q0P6`V0:Y ``d Z** `Y `d`d`p  P @D l  P` aV:`d`Z  V R0 pKpG[`Ѝp@-P@`P hpO0@-P0 @X \@@@DQ@@Q@3T0 S://@-P@p`lUQ`g`s@-@P `PT  TT @0S@`V % LX%|N-RQP@ 0`7ApppW: e0g  @ 0P    xs @ pPP  Ap4 jr88 ( Q  R P Pa< `岠Z`,`Ŋ `Ӻ,,`af$ ff(@$D2f 0,<0岠0(@0((0D \D` 0P`@ `  V@ PF TX 0`@ T4  P Q PaeAh `lVP` \: `e ` 8`  Z``V:`$Q` q `` `fFa`tQ 4  Pp  @2  a岐DP@   < @`PR ЍRꀯP/0S  4   S  ( , 0 8 < lPL//Rp@-@P3 1R<S00-P- 0 0S(0 $0 S0 $0 0(3/P U0Pe0E20/U0P0ES$0( 3/000$P40p@pppNꀔN0%0 @-@P  R $0S 4Q ( 3/($0 3/D-RX@p h%X 0P2U\EPE`VlF`FQ RN0pGP`W`2U\ETPEV}GV=0pG00 P `P `P `P `P `P `P `P `P `P `P `P `P `P `P @`TP``PP`D W0W 1ERpGPR`PR`P R`P R`P R`P R`P R`PR`PR`PR`PR`PR`PR`PR`PR`P`W  @0 0CP`S(}Py`N-PHM< @T   Y0S00 S 0 8`q R%&b$ PPE>f  0 0  P4 `Wc  pGePU0S` >F =C 0S&$    D`&dE`D 0P0` 0W<  pGePU 0S`0  &4D`E0&8&lF0G`D 0P0` 0W  pGePU 0S  &$ 0  D`&dE`D n0P0`0+ W pGePU @`R`<` D`&dE`D M` 0S P000 ) @ W010!S Q P  b\ b 0%0    0 0@ pc0c@0@0S0@000 +$ W 0 Q0 P @ R7 2@ 5\S:    00\pc  0S 0@000 *$ Wt 0 Q0 $P @ (R7 2@ 5\S:    00\pc Q 0S$ 00   0WE pGePU1V9*P` 0S$ ,  0  4W(  pGePU&,&4,<l040`40 00P 0S  p8`l0L00T0T00/>0l0p P5. 0h 0d `00$0uT03L0C(0 (00SW$ 0pGePPW pGePU:6cPc0hLPW pGePU:Q6cPc/  06 &aPE$PW pGePU:6c  a W pGePU:6c  ccP0$ Q3000 h R7hh$Q:0S S>l0L0 0T0/΄T0l$` $0p Pd3l0`P00X0X08$0d P$3003W[ p 8`E0C0 MH0$@lk$ . H UeUUV.V]KVjV뀈VkV'$ꀹVV ]$p1s@-Pd!0@0CSI긚P|ꀠPPꀸ<0P TPaLIP P 0 P@d;008#,#48#80@<0<0l"@ <0<0L@@0@,|kVeW뀬NVVW뀎p@-T@TP0 0S0<<zp@"0l(0Spp@~e/WWDWA-`2@ PQ R 0V R RUp0PE#$48#8Sx S S42 `@ ` r P `@V:A?U0#DDH$H1T@  @ ! ( D Q#lQ`H1 RR R  Q `  =`0 S@0 000 0C## PE `Z0 R`50U(ʇ 0#$$("(ʇ0#$48#80CSP嶇 D0 <寇AaeGW뀊OWSW]W뀙W뀱W4kWs@-thzP  \2X_zPHB  Q*,呇2/ b2PB0U02! !4!0^ Pq:0PP P- 00XA`W\H1X RP0S D10S !  0R A A*;Q 5  0*P|@0000`E00`=Y` |h<0Ѝp@WeWW뀔lkX'X뀨VXSX뀌kkX뀌X뀲X뀍]XXꀈꀎ@-YY@P>xY@P>hچYYnY>Y>iY>fY@P`Y@X@-6VY>SYY>@Y@-:] 0  -4M(Z*( +)0,- yPx4ЍY @-00 |0R KY,YP`0#( (,##  ((,(0 0! !脬0D0J0J@-DD WY 88SY400 ,0R  @HYJ 1Jꀄ`Dh@-d  HIBJHCBB@B#OF@(s@(sA@(As@(so@(co@(cAo@(Aco@(c_@(S_@(SA_@(AS_@(SO@(CO@(CAO@(ACO@(C?@(3?@(3A?@(A3?@(3/@(#/@(#A/@(A#/@(#@(@(A@(A@(@(@(A@(A@(H@BpGH@BpG8 Op@pG#H@BpG(ȿo@O@&)-@@pG@ @F :@CRBcF@CpG@@F :@CRBcF@CpGO>"R 5 C2 PhX dH2 Phb 7 ?ñ2 ГhTdY * Zh F2@-* Zh F2* Zh F200@1JPHpHHHH2X }, }  k }  } } ^ ~" { {}   k }  }  k }  }@   @ (        P 2 @JJJJ0J8J J8x0J`JhJpJxJJ@x0J(J0J8J0x0JPJ`JJJJJJJJJDJJJEJJJJJ J J(J DJ(J J(J@J8JhJ(EJ0EJ8EJ@EJHEJPEJXEJ`EJhEJpEJxEJEJEJPJ(J0J@JHJJJJJJ J(J`J@JHJXJxx0J0x0J J(J J JXJГJAJ@]Y$Iv7_outer_cache_inval_range $H !(08@HPX`gnu|ꀃꀊꀑꀘꀟꀧꀮꀶꀾ*d!d*耣$do_env_import%Kdo_env_export W  $+ 5< C U-Boot 2011.12 (Apr 02 2012 - 18:13:04)bootcmd=if mmc rescan ${mmcdev}; then if run loadbootenv; then echo Loaded environment from ${bootenv};run importbootenv;if test -n $uenvcmd; then echo Running uenvcmd ...;run uenvcmd;fi;elif run loadbootscript; then echo Loaded script from ${bootscr};run bootscript; else if run loaduimage; then run mmcboot; fi; fi; fi; if usb start; then set autoload no; bootp; pxe get;pxe boot;fibootdelay=3baudrate=115200preboot=echo checking for ${preenv};if mmc rescan ${mmcdev}; then if run loadpreenv; then echo Loaded environment from ${preenv};run importpreenv;if test -n $preenvcmd; then echo Running preenvcmd ...;run preenvcmd;fi;fi; fi; loadaddr=0x82000000console=ttyO2,115200n8usbtty=cdc_acmvram=16Mmmcdev=0mmcroot=/dev/mmcblk0p2 rwmmcrootfstype=ext3 rootwaitmmcargs=setenv bootargs console=${console} vram=${vram} root=${mmcroot} rootfstype=${mmcrootfstype}bootscr=boot.scrloadbootscript=fatload mmc ${mmcdev} ${loadaddr} ${bootscr}bootscript=echo Running bootscript from mmc${mmcdev} ...; source ${loadaddr}preenv=preEnv.txtloadpreenv=fatload mmc ${mmcdev} ${loadaddr} ${preenv}importpreenv=echo Importing preboot environment from mmc ...; env import -t $loadaddr $filesizebootenv=uEnv.txtloadbootenv=fatload mmc ${mmcdev} ${loadaddr} ${bootenv}importbootenv=echo Importing environment from mmc ...; env import -t $loadaddr $filesizeloaduimage=fatload mmc ${mmcdev} ${loadaddr} uImagemmcboot=echo Booting from mmc${mmcdev} ...; run mmcargs; bootm ${loadaddr}kernel_addr_r=0x88000000ramdisk_addr_r=0x81600000pxefile_addr_r=0x86000000bootcmd=if mmc rescan ${mmcdev}; then if run loadbootenv; then echo Loaded environment from ${bootenv};run importbootenv;if test -n $uenvcmd; then echo Running uenvcmd ...;run uenvcmd;fi;elif run loadbootscript; then echo Loaded script from ${bootscr};run bootscript; else if run loaduimage; then run mmcboot; fi; fi; fi; if usb start; then set autoload no; bootp; pxe get;pxe boot;fibootdelay=3baudrate=115200preboot=echo checking for ${preenv};if mmc rescan ${mmcdev}; then if run loadpreenv; then echo Loaded environment from ${preenv};run importpreenv;if test -n $preenvcmd; then echo Running preenvcmd ...;run preenvcmd;fi;fi; fi; loadaddr=0x82000000console=ttyO2,115200n8usbtty=cdc_acmvram=16Mmmcdev=0mmcroot=/dev/mmcblk0p2 rwmmcrootfstype=ext3 rootwaitmmcargs=setenv bootargs console=${console} vram=${vram} root=${mmcroot} rootfstype=${mmcrootfstype}bootscr=boot.scrloadbootscript=fatload mmc ${mmcdev} ${loadaddr} ${bootscr}bootscript=echo Running bootscript from mmc${mmcdev} ...; source ${loadaddr}preenv=preEnv.txtloadpreenv=fatload mmc ${mmcdev} ${loadaddr} ${preenv}importpreenv=echo Importing preboot environment from mmc ...; env import -t $loadaddr $filesizebootenv=uEnv.txtloadbootenv=fatload mmc ${mmcdev} ${loadaddr} ${bootenv}importbootenv=echo Importing environment from mmc ...; env import -t $loadaddr $filesizeloaduimage=fatload mmc ${mmcdev} ${loadaddr} uImagemmcboot=echo Booting from mmc${mmcdev} ...; run mmcargs; bootm ${loadaddr}kernel_addr_r=0x88000000ramdisk_addr_r=0x81600000pxefile_addr_r=0x86000000set_default_envenv_importfdt_fixup_memory_banksethaddr__of_translate_addressW3b3h3n3u3|3뀀33뀏33A뀍c2p2v2|2뀀22뀄22뀓2 2뀝22뀭22뀽22222222222 o3 33 3 3-363?3E3K3Q3뀍 011*131<1D1$U1b1p1 1뀘1 1뀵1111 11)2#2*252 H2Q2뀍0뀝00뀰0000000뀍  ( w 9909@9J9V9`9뀀9L 뀀 #(-27<FP'@Bmmc_set_iosmmc_send_cmdmmc_read_datammc_write_datammc_init_streammmc_init_setupH\p$$7}tofYPKB5<'. V_DMr{`i :3(!OF]Tkbyp#*18AHSZelw~ -$?6XQJC|ung 4=&/szahW^EL;2)  jcxqNG\U"+09%,7>mdvI@[R<5.' t}foPYBK 3:!(_VMD{ri`*#81FOT]bkpy!B c0@P`p)Jk1s2R"RBrb9{ZӜb$C4 dtDTjK( ōS6r&0vfVF[z8׼HXhx@a(#8َHi +ZJzjqP 3:*˿yX;l|L\",<` A* hI~n^N>2.Qp:Yxʱ -No0 P%@Fpg`ڳ=^"25BRwbVr˥nO, 4$ftGd$TDۧ_~<&6WfvvF4VLm/ș鉊DXeHx'h8(}\?؛uJTZ7jz *:.lMͪɍ&|ld\EL<, >]|ߛُn6~UNt^.>0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-EPTGMK(((((AAAAAABBBBBB0123456789abcdef0123456789ABCDEF #+3;CScs@@ !1Aa  0@``Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     QQ뀍QQQRR#R뀍@BDFHJLN"$&(*,.0@BDFJL^ZPRTVXZ \ ^ `b dfhjlnp r tvxz|~         2468: <>HJLNPRTVXZ\^`bdfhjlnprtvx z | ~  @BDFHNPRTVX\`bdfhjZ#Y0Jusbd_rcv_completeusbd_alloc_urbusbd_device_event_irqN/A*EHCI Host Controlleru-bootext2fs_devreadeth_get_dev_by_nameERROR : check_gpio: invalid GPIO %d omap3-gpio unknown bank method %s %d gpio.cOMAP%x ES%x.%xCPU : %s SDRAM: identified size not same as expected size identified: %x expected: %x I2C: %s baudrateMMC: ipaddrloadaddrbootfileNet: ### ERROR ### Please RESET the board ### fdtcontroladdrDRAM: Starting kernel ... bootargsmachidUsing machid 0x%x from environment WARNING: Caches not enabled ERROR: %s - start address is not aligned - 0x%08x ERROR: %s - stop address is not aligned - 0x%08x Resetting CPU ... pc : [<%08lx>] lr : [<%08lx>] sp : %08lx ip : %08lx fp : %08lx r10: %08lx r9 : %08lx r8 : %08lx r7 : %08lx r6 : %08lx r5 : %08lx r4 : %08lx r3 : %08lx r2 : %08lx r1 : %08lx r0 : %08lx Flags: %c%c%c%c IRQs %s FIQs %s Mode %s%s undefined instruction software interrupt prefetch abort data abort not used fast interrupt request USER_26FIQ_26IRQ_26SVC_26UK4_26UK5_26UK6_26UK7_26UK8_26UK9_26UK10_26UK11_26UK12_26UK13_26UK14_26UK15_26USER_32FIQ_32IRQ_32SVC_32UK4_32UK5_32UK6_32ABT_32UK8_32UK9_32UK10_32UND_32UK12_32UK13_32UK14_32SYS_32resetting ... (not set)%-12s= 0x%08lX arch_numberboot_paramsDRAM bank-> start-> size%-12s= %s ip_addr = %pI4 baudrate = %d bps TLB addrrelocaddrreloc offirq_spsp start FB base bdinfoprint Board Info structure## Starting application at 0x%08lX ... ## Application terminated, rc = 0x%lX gostart application at address 'addr'addr [arg ...] - start application at address 'addr' passing 'arg' as argumentsresetPerform RESET of the CPUbootcmd## Transferring control to RTEMS (at address %08lx) ... ## Transferring control to NetBSD stage-2 loader (at address %08lx) ... ## Checking Image at %08lx ... Legacy image found Bad Magic Number Bad Header Checksum Verifying Checksum ... Bad Data CRC OK Unknown image format! XIP %s ... Loading %s ... Uncompressing %s ... GUNZIP: uncompress, out-of-mem or overwrite error - must RESET board to recover Unimplemented compression type %d verify## Booting kernel from Legacy Image at %08lx ... Unsupported Architecture 0x%x Wrong Image Type for %s command Wrong Image Format for %s command ERROR: can't get kernel image! ERROR: unknown image format type! Could not find kernel entry point! Ramdisk image is corrupt or invalid Could not find a valid device tree Trying to execute a command out of order %lxinitrd_startinitrd_endcmdline subcommand not supported bdt subcommand not supported prep subcommand not supported WARNING: legacy format multi component image overwritten ERROR: new format image overwritten - must RESET the board to recover autostartno%lXfilesizeERROR: booting os '%s' (%d) is not supported yesAutomatic boot of image at addr 0x%08lX ... bootmboot application image from memory[addr [arg ...]] - boot application image stored in memory passing arguments 'arg ...'; when booting a Linux kernel, 'arg' can be the address of an initrd image When booting a Linux kernel which requires a flat device-tree a third argument is required which is the address of the device-tree blob. To boot that kernel without an initrd image, use a '-' for the second argument. If you do not pass a third a bd_info struct will be passed instead Sub-commands to do part of the bootm sequence. The sub-commands must be issued in the order below (it's ok to not issue all sub-commands): start [addr [arg ...]] loados - load OS image fdt - relocate flat device tree cmdline - OS specific command line processing/setup bdt - OS specific bd_t processing prep - OS specific prep before relocation or go go - start OSboot default, i.e., run 'bootcmd'bootdiminfoprint header information for application imageaddr [addr ...] - print header information for application image starting at address 'addr' in memory; this includes verification of the image contents (magic number, header and payload checksums)loadosramdiskcmdlinebdtprepList of available devices: %-8s %08x %c%c%c coninfoprint console devices and informationecho args to console[args..] - echo args to console; \c suppresses newlineexitexit script** No boot file defined ** ** Bad partition %d ** Loading file "%s" from %s device %d:%d (%.32s) Loading file "%s" from %s device %d ** Bad partition - %s %d:%d ** ** Bad ext2 partition or disk - %s %d:%d ** ** File not found %s %d bytes read %X ** Block device %s %d not supported ** Invalid boot device, use `dev[:part]' ** ** Error ext2fs_ls() ** ext2lslist files in a directory (default /) [directory] - list files from 'dev' on 'interface' in a 'directory'ext2loadload binary file from a Ext2 filesystem [addr] [filename] [bytes] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from ext2 filesystemusage: fatinfo ** Invalid boot device ** ** Unable to use %s %d:%d for fatinfo ** usage: fatls [directory] ** Unable to use %s %d:%d for fatls ** No Fat FS detected usage: fatload [bytes] ** Unable to use %s %d:%d for fatload ** ** Unable to read "%s" from %s %d:%d ** %ld bytes read fatloadload binary file from a dos filesystem [bytes] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from dos filesystemfatlsfatinfoprint information about filesystem - print information about filesystem from 'dev' on 'interface'The address of the fdt is invalid (NULL). libfdt fdt_check_header(): %s - too old, fdt %d < %d - too new, fdt %d > %d", "<0x%x%s[%02x%sfdtaddr/* NULL pointer error */The address of the fdt is %p New length %d < existing length %d, ignoring. libfdt fdt_open_into(): %s moNew length 0x%X < existing length 0x%X, aborting. mklibfdt fdt_path_offset() returned %s libfdt fdt_add_subnode(): %s Sorry, I could not convert "%s" Unexpected character '%c' libfdt fdt_setprop(): %s libfdt fdt_getprop(): %s %s%s { Nested too deep, aborting. %s}; %s%s; %s%s = %s/* NOP */ Unknown tag 0x%08X libfdt fdt_delprop(): %s libfdt fdt_del_node(): %s magic: 0x%x totalsize: 0x%x (%d) off_dt_struct: 0x%x off_dt_strings: 0x%x off_mem_rsvmap: 0x%x version: %d last_comp_version: %d boot_cpuid_phys: 0x%x size_dt_strings: 0x%x size_dt_struct: 0x%x number mem_rsv: 0x%x boorsindex start size ------------------------------------------------ libfdt fdt_get_mem_rsv(): %s %x %08x%08x %08x%08x libfdt fdt_add_mem_rsv(): %s libfdt fdt_del_mem_rsv(): %s flattened device tree utility commandsaddr [] - Set the fdt location to fdt move - Copy the fdt to and make it active fdt resize - Resize fdt to size + padding to 4k addr fdt print [] - Recursive print starting at fdt list [] - Print one level starting at fdt set [] - Set [to ] fdt mknode - Create a new node after fdt rm [] - Delete the node or fdt header - Display header info fdt bootcpu - Set boot cpuid fdt memory - Add/Update memory node fdt rsvmem print - Show current mem reserves fdt rsvmem add - Add a mem reserve fdt rsvmem delete - Delete a mem reserves fdt chosen [ ] - Add/update the /chosen branch in the tree / - initrd start/end addr NOTE: Dereference aliases by omiting the leading '/', e.g. fdt print ethernet0.cmd_gpiogpio: requesting pin %u failed gpio: pin %s (gpio %i) value is %lu input/set/clear/toggle gpio pins - input/set/clear/toggle the specified pinhelpprint command description/usage - print brief description of all commands help command ... - print detailed usage of 'command'?alias for 'help'Current bus speed=%d Setting bus speed to %d Hz Failure changing bus speed (%d) Error reading the chip. Valid chip addresses: %02X%04x: %02x%08lx: Error reading the chip, %02lx %04lx %08lx ? Error writing the chip. Current bus is %d Setting bus to %d Failure changing bus number (%d) CRC32 for %08lx ... %08lx ==> i2cI2C sub-systemcrc32 chip address[.0, .1, .2] count - compute CRC32 checksum i2c dev [dev] - show or set current I2C bus i2c loop chip address[.0, .1, .2] [# of objects] - looping read of device i2c md chip address[.0, .1, .2] [# of objects] - read from I2C device i2c mm chip address[.0, .1, .2] - write to I2C device (auto-incrementing) i2c mw chip address[.0, .1, .2] value [count] - write to I2C device (fill) i2c nm chip address[.0, .1, .2] - write to I2C device (constant address) i2c probe - show devices on the I2C bus i2c read chip address[.0, .1, .2] length memaddress - read to memory i2c reset - re-init the I2C Controller i2c speed [speed] - show or set I2C bus speedcrc32devloopmmmwnmprobereadUnknown operator '%s' Invalid data width specifier itestreturn true/false on integer compare[.b, .w, .l, .s] [*]value1 [*]value2-lt-gt-eq==-ne!=<>-ge>=-le<=## Total Size = 0x%08x = %d Bytes ## First Load Addr = 0x%08lX ## Last Load Addr = 0x%08lX ## Total Size = 0x%08lX = %ld Bytes loads_echo## Ready for S-Record download ... ## S-Record download aborted ## Start Addr = 0x%08lX ## Switch baudrate to %d bps and press ENTER ... loady## Ready for binary (ymodem) download to 0x%08lX at %d bps... ## Ready for binary (kermit) download to 0x%08lX at %d bps... ## Binary (kermit) download aborted ## Switch baudrate to %d bps and press ESC ... loadsload S-Record file over serial line[ off ] - load S-Record file over serial line with offset 'off'loadbload binary file over serial line (kermit mode)[ off ] [ baud ] - load binary file over serial line with offset 'off' and baudrate 'baud'load binary file over serial line (ymodem mode)CRC32 for %08lx ... %08lx ==> %08lx Base Address: 0x%08lx Tested %d iteration(s) with %lu errors. Pattern %08lX Writing...%12sReading... Mem error @ 0x%08X: found %08lX, expected %08lX Zero length ??? bytehalfwordword at 0x%08lx (0x%08lx) != word at 0x%08lx (0x%08lx) halfword at 0x%08lx (0x%04x) != halfword at 0x%08lx (0x%04x) byte at 0x%08lx (0x%02x) != byte at 0x%08lx (0x%02x) Total of %ld %s%s were the same %04xmemory display[.b, .w, .l] address [# of objects]memory modify (auto-incrementing address)[.b, .w, .l] addressmemory modify (constant address)memory write (fill)[.b, .w, .l] address value [count]memory copy[.b, .w, .l] source target countcmpmemory compare[.b, .w, .l] addr1 addr2 countchecksum calculationaddress count [addr] - compute CRC32 checksum [save at addr]baseprint or set address offset - print address offset for memory commands base off - set address offset for memory commands to 'off'infinite loop on address range[.b, .w, .l] address number_of_objectsmtestsimple RAM read/write test[start [end [pattern [iterations]]]]sleepdelay execution for some timeN - delay execution for N seconds (N is _decimal_ !!!)ERRORNo MMC device available rescanno mmc device at slot %x get mmc type error! list#part_num shouldn't be larger than %d Card doesn't support part_switch switch to partions #%d, %s mmc%d is current device mmc%d(part %d) is current device writeerase MMC %s: dev # %d, block # %d, count %d ... %d blocks %s: %s YesNoDevice: %s Manufacturer ID: %x OEM: %x Name: %c%c%c%c%c Tran Speed: %d Rd Block Len: %d %s version %d.%d High Capacity: %s Capacity: Bus Width: %d-bit mmcinfodisplay MMC info - device number of the device to dislay info of mmcMMC sub systemread addr blk# cnt mmc write addr blk# cnt mmc erase blk# cnt mmc rescan mmc part - lists available partition on current mmc device mmc dev [dev] [part] - show or set current mmc device [partition] mmc list - lists available devicesping failed; host %s is not alive host %s is alive gatewayipnetmaskhostnamerootpathserveripdnsipdomainbootpboot image via network using BOOTP/TFTP protocol[loadAddress] [[hostIPaddr:]bootfilename]tftpbootboot image via network using TFTP protocoldhcpboot image via network using DHCP/TFTP protocolpingsend ICMP ECHO_REQUEST to network hostpingAddressNot implemented yet ## Warning: defaulting to text format ## Warning: Input data exceeds %d bytes - truncated ## Info: input data size = %zu = 0x%zX ## Error: bad CRC, import failed ERROR: Environment import failed: errno = %d at %s:%d/%s() cmd_nvedit.c## %s: only one of "-b", "-c" or "-t" allowed -f## Resetting to default environment %s=%s Environment size: %d/%ld bytes ## Error: "%s" not defined ## Error: illegal character '=' in variable name"%s" stdinstdoutstderrCan't delete "%s" ## Baudrate %d bps not supported ## Switch baudrate to %d bps andpress ENTER ... ## Can't malloc %d bytes ## Error inserting "%s" variable, errno=%d setenvERROR: Cannot export environment: errno = %d at %s:%d/%s() %zXenv_buf [%d bytes] too small for value of "%s" edit: environment handling commandsdefault -f - reset default environment env edit name - edit environment variable env export [-t | -b | -c] [-s size] addr [var ...] - export environment env import [-d] [-t | -b | -c] addr [size] - import environment env print [name ...] - print environment env run var [...] - run commands in an environment variable env set [-f] name [arg ...] editenvedit environment variablename - edit environment variable 'name'printenvprint environment variables - print values of all environment variables printenv name ... - print value of environment variable 'name'set environment variablesname value ... - set environment variable 'name' to 'value ...' setenv name - delete environment variable 'name'runrun commands in an environment variablevar [...] - run the commands in the environment variable(s) 'var'defaultdeleteeditexportimportprintLabel: %s kernel: %s append: %s initrd: %s missing environment variable: %s Expected string literal: %.*s Expected string: %.*s Expected unsigned integer: %s tftpbootfile_path too small. (%d < %d) Base path too long (%s%s) Retrieving file: %s %ppxelinux.cfg/path (%s%s) too long, skipping pxelinux.cfg/%sMaximum nesting (%d) exceeded Expected include path: %.*s Couldn't retrieve %s Ignoring malformed menu command: %.*s Expected label name: %.*s Ignoring unknown command: %.*s localcmdrunning: %s No kernel given, skipping %s ramdisk_addr_rSkipping %s for failure retrieving initrd kernel_addr_rSkipping %s for failure retrieving kernel fdt_addrpxefile_addr_rInvalid pxefile address: %s Error parsing config file Missing default: %s pxeuuidusbethaddroutbuf is too small (%d < %d) 01-%08XConfig file found Config file not found pxecommands to get and boot from pxe filesget - try to retrieve a pxe file using tftp pxe boot [pxefile_addr_r] - boot from the pxe file at pxefile_addr_r getmenutitlepromptlabelkernellocalbootappendinitrdincludeBad magic number Bad header crc Bad data crc Bad image type Empty Script Wrong image format for "source" command ## Executing script at %08lx sourcerun script from memory[addr] - run script starting at addr - A valid image header must be present-o-a-z-nminimal test like /bin/sh[args..]falsedo nothing, unsuccessfullytruedo nothing, successfullybootdevice ** No boot device ** ** Device %d not available storage device not initialized. Use usb scan Rawerror reading partinfo...try to boot raw PPCBoot ** Invalid partition type "%.32s" (expect "U-Boot") Loading from USB device %d, partition %d: Name: %.32s Type: %.32s ** Bad Header Checksum ** ** Unknown image type ** Read error on %d:%d See InterfaceAudioCommunicationHuman InterfacePrinterMass StorageHubCDC DataVendor specificHuman Interface, Subclass: NoneBoot KeyboardMousereservedMass Storage, RBC SFF-8020i (ATAPI)QIC-157 (Tape)UFISFF-8070Transp. SCSICommand/BulkCommand/Bulk/IntBulk onlyString: "%s"%d: %s, USB Revision %x.%x - %s %s %s - Class: - Class: (from Interface) %s - PacketSize: %d Configurations: %d - Vendor: 0x%04x Product 0x%04x Version %d.%d Self Powered Bus Powered Remote Wakeup Configuration: %d - Interfaces: %d %s%s%dmA Interface: %d - Alternate Setting %d, Endpoints: %d - Class - InOut - Endpoint %d %s ControlIsochronousInterrupt MaxPacket %d Interval %dms480 Mb/s1.5 Mb/s12 Mb/s+-%d %s (%s, %dmA) %s %s %s %s (Re)start USB... stopstopping USB.. USB is stopped. Please issue 'usb start' first. tree Device Tree: infconfig for device %d *** No device available *** stor no USB devices available no current device selected USB read: device %d block # %ld, count %ld ... %ld blocks read: %s USB write: device %d block # %ld, count %ld ... %ld blocks write: %s USB device %d: unknown device Device %d: ... is now current device usbUSB sub-systemstart - start (scan) USB controller usb reset - reset (rescan) USB controller usb stop [f] - stop USB [f]=force stop usb tree - show USB device tree usb info [dev] - show available USB devices usb storage - show details of USB storage devices usb dev [dev] - show or set current USB storage device usb part [dev] - print partition table of one or all USB storage devices usb read addr blk# cnt - read `cnt' blocks starting at block `blk#' to memory address `addr' usb write addr blk# cnt - write `cnt' blocks starting at block `blk#' from memory address `addr'usbbootboot from USB deviceloadAddr dev:part %s gcc-4.5 (Ubuntu/Linaro 4.5.3-12ubuntu1) 4.5.3 GNU ld (GNU Binutils for Ubuntu) 2.22 print monitor, compiler and linker version## Copying part %d from legacy image at %08lx ... Must specify load address for %s command with compressed image Bad Image Part Invalid image type for imxtract Loading part %d ... Uncompressing part %d ... GUNZIP ERROR - image not loaded %8lxfileaddrimxtractextract a part of a multi-imageaddr part [dest] - extract from legacy image at and copy to %s - %s Usage: %s - No additional help available. %-*s- %s Unknown command '%s' - try 'help' without arguments for list of all known commands Panda # In: No input devices available! Out: No output devices available! Err: No error devices available! serial*** Warning - %s, using default environment Using default environment env_common.c!bad CRCERROR: Cannot import environment: errno = %d at %s:%d/%s() !import failed#address-cells#size-cells/chosenfdt_initrd: %s linux,initrd-startWARNING: could not set linux,initrd-start %s. linux,initrd-endWARNING: could not set linux,initrd-end %s. fdt_chosen: %s WARNING: could not create /chosen %s. WARNING: could not set bootargs %s. Unable to update property %s:%s, err=%s /memoryWARNING: could not create /memory: %s. device_typeWARNING: could not set %s %s. reg/aliasesethernet%deth%daddrlocal-mac-address%s: Bad cell count for %s rangeslinux,phandleCan't set phandle %u: %s okaystatusdisabledfailfail-%dInvalid fdt status: %x Warning: device tree alias '%s' points to invalid node %s. Warning: device tree node '%s' has no address. Warning: U-Boot configured device %s at address %llx, but the device tree has it address %llx. syntax error ** Abort ERROR : memory not allocated *?[\%uERROR: There is a global environment variable with the same name. %s: readonly variableIFS \$'";&|#Unknown command '%s' - try 'help' or use 'run' command Unknown command '%s' - try 'help' 'bootd' recursion detected ;$&|exit not allowed from main input shell. HUSH_VERSION0.01showvarprint local hushshell variables - print values of all hushshell variables showvar name ... - print value of hushshell variable 'name'thenelifelsefiforwhileuntildodoneERROR: - must RESET the board to recover. bootm_lowbootm_sizebootm_mapsize%d Bytes = Unknown OSUnknown ArchitectureUnknown ImageUnknown Compression%sImage Name: %.*s %sImage Type: %s %s %s (%s) %sData Size: %sLoad Address: %08x %sEntry Point: %08x %sContents: %s Image %d: %s Offset = 0x%08lx ## Loading init Ramdisk from Legacy Image at %08lx ... No Linux %s Ramdisk Image Wrong Ramdisk Image Format ## Loading init Ramdisk from multi component Legacy Image at %08lx ... initrd_highramdisk - allocation error Loading Ramdisk to %08lx, end %08lx ... reserving fdt memory region: addr=%llx size=%llx image is not a fdtfdt_highFailed using fdt_high value for Device Treedevice tree - allocation error Using Device Tree in place at %p, end %p Loading Device Tree to %p, end %p ... fdt move failed## Flattened Device Tree from Legacy Image at %08lx fdt header checksum invalidfdt checksum invaliduImage is not a fdtuImage is compresseduImage data is not a fdtfdt overwritten## Flattened Device Tree blob at %08lx ERROR: Did not find a cmdline Flattened Device Tree Booting using the fdt blob at 0x%p ## Flattened Device Tree from multi component Image at %08lX Booting using the fdt at 0x%p fdt size != image sizenoneuncompressedbzip2bzip2 compressedgzipgzip compressedlzmalzma compressedlzolzo compressedaisimageDavinci AIS imageFilesystem ImagefirmwareFirmwareflat_dtFlat Device TreeKernel Imagekernel_noloadKernel Image (no loading done)kwbimageKirkwood Boot ImageimximageFreescale i.MX Boot ImageInvalid ImagemultiMulti-File ImageomapimageTI OMAP SPL With GP CHRAMDisk ImageScriptstandaloneStandalone ProgramublimageDavinci UBL imageInvalid ARCHalphaAlphaarmARMIntel x86ia64IA64m68kM68KmicroblazeMicroBlazemipsMIPSmips64MIPS 64 Bitnios2NIOS IIpowerpcPowerPCppcs390IBM S390SuperHsparcSPARCsparc64SPARC 64 BitblackfinBlackfinavr32AVR32nds32NDS32Invalid OSlinuxLinuxnetbsdNetBSDoseEnea OSErtemsRTEMSu-boot%.*sHit any key to stop autoboot: %2d %2d prebootbootdelay%*s ** Too many args (max. %d) ** ## Command too long! Enter choice: %s not found ^C ERROR: NOT USB_CONFIG_DESC %x unable to get descriptor, error %lX config descriptor too short (expected %i, got %i) selecting invalid interface %dERROR, too many USB Devices, max=%d ERROR: USB_MAX_HUB (%d) reached Couldn't reset port %i USB device not accepting new address (error=%lX) unable to get device descriptor (error=%d) USB device descriptor short read (expected %i, got %i) failed to set default configuration len %d, status %lX usb_new_device:cannot locate device's port. cannot reset port %i!? No USB Device found %d USB Device(s) found USB: scanning bus for devices... Error, couldn't init Lowlevel part Device NOT ready Request Sense returned %02X %02X %02X No storage devices, perhaps not 'usb start'ed..? Did not get interrupt on CBI cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X (NOT READY) cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X USB Storage Transport unknown / not yet implemented Sorry, protocol %d not yet supported. error in inquiry READ_CAP ERROR scanning bus for storage devices... max USB Storage Device reached: %d stopping %d Storage Device(s) found CksumxyzModem - %s mode, %d(SOH)/%d(STX)/%d(CAN) packets, %d retries Unknown errorBlock sequence errorCRC/checksum errorInvalid framingCancelledEnd of fileTimed outSorry, zModem not available yetCan't access file(%d:%d) Vendor: %s Prod.: %s Rev: %s Model: %s Firm: %s Ser#: %s Vendor: %s Rev: %s Prod: %s device type DOC device type unknown Unhandled device type: %i Type: Removable Hard DiskCD ROMOptical DeviceTape# %02X # Capacity: %ld.%ld MB = %ld.%ld GB (%ld x %ld) Capacity: not available Partition Map for IDESATAATAPIDOC device %d -- Partition Type: %s DOS## Unknown partition table ** Can't read partition table on %d:%d ** bad MBR sector signature 0x%02x%02x hd%c%dsd%c%dusbd%c%ddocd%c%dxx%c%d ExtdFATFAT32%5d %10d %10d %2x%s 1 0 %10ld %2x Partition Start Sector Num Sectors Type timed out in wait_for_bb: I2C_STAT=%x timed out in wait_for_pin: I2C_STAT=%x Error : I2C unsupported speed %d Error : I2C initializing clock ERROR: Timeout in soft-reset I2C read: addr len %d not supported I2C read: address out of range I2C read: I/O error I2C write: addr len %d not supported I2C write: address 0x%x + 0x%x out of range error waiting for i2c address ACK (status=0x%x) i2c bus not ready for transmit (status=0x%x) i2c error waiting for data ACK (status=0x%x) i2c bus not ready for Tx (i=%d) Bad bus: %d Status Error: 0x%08X Timeout waiting card ready MMC Device %d not found Caution! Your devices Erase group is 0x%x The erase range would be change to 0x%lx~0x%lx mmc erase failed MMC: block number 0x%lx exceeds max(0x%lx) mmc write failed mmc fail to send stop cmd Man %06x Snr %08x%c%c%c%c%cCard did not respond to voltage select! %s: %d%s: timedout waiting for ics! %s: timedout waiting for cmddis! %s: timedout waiting for stat! %s : timeout: No status update %s: timedout waiting for status! %s: timedout waiting for cc! %s: timedout waiting for cc2! %s: timedout waiting for softresetall! OMAP SD/MMCBattery Current: %d mA Failed to convert battery voltage Failed to read battery voltage Battery Voltage: %d mV Failed to enable GPADC Main battery voltage too low! 000000000000genericserial#Warning: serial number %s is too long (%d > %lu) usbttycdc_acmDas U-BootU-Boot 2011.12TTY via USBBulk Data InterfaceControl Interface scanning bus for ethernet devices... usbethmax USB Ethernet Device reached: %d stopping %d Ethernet Device(s) found Error: SMSC95xx: No MAC address set - set usbethaddr Waiting for Ethernet connection... done. unable to connect. %s%dsmsERROR: %s(), %d: RECV_ERROR actual: %d buffer: %d urb_bad: %d ERROR: %s(), %d: no rcv_urb! ERROR: %s(), %d: no endpoint! ERROR: %s(), %d: F A T A L: malloc(%zu) FAILED!!!! udu %x ERROR: %s(), %d: (%p,%d) NULL device or device->bus DEVICE_UNKNOWNDEVICE_INITDEVICE_CREATEDEVICE_HUB_CONFIGUREDDEVICE_RESETDEVICE_ADDRESS_ASSIGNEDDEVICE_CONFIGUREDDEVICE_SET_INTERFACEDEVICE_SET_FEATUREDEVICE_CLEAR_FEATUREDEVICE_DE_CONFIGUREDDEVICE_BUS_INACTIVEDEVICE_BUS_ACTIVITYDEVICE_POWER_INTERRUPTIONDEVICE_HUB_RESETDEVICE_DESTROYDEVICE_FUNCTION_PRIVATESTATE_INITSTATE_CREATEDSTATE_ATTACHEDSTATE_POWEREDSTATE_DEFAULTSTATE_ADDRESSEDSTATE_CONFIGUREDSTATE_UNKNOWNGET STATUSCLEAR FEATURERESERVEDSET FEATURESET ADDRESSGET DESCRIPTORSET DESCRIPTORGET CONFIGURATIONSET CONFIGURATIONGET INTERFACESET INTERFACESYNC FRAMEDEVICECONFIGSTRINGENDPOINTDEVICE QUALIFIEROTHER SPEEDINTERFACE POWERUSBD_OPENINGUSBD_OKUSBD_SUSPENDEDUSBD_CLOSINGInvalid string index %d USB_DESCRIPTOR_TYPE_INTERFACE - error not implemented USB_DESCRIPTOR_TYPE_ENDPOINT - error not implemented USB_DESCRIPTOR_TYPE_HID - error not implemented USB_DESCRIPTOR_TYPE_REPORT - error not implemented get config %d DEVICE_SET_INTERFACE.. event? EHCI fail timeout STD_ASS set EHCI timed out on TD - token=%#x EHCI fail timeout STD_ASS reset The request port(%d) is not configured port(%d) reset error EHCI fail to reset Register %x NbrPorts %d USB EHCI %x.%02x OMAP4 EHCI error: timeout resetting TLL OMAP4 EHCI error: timeout resetting phy OMAP4 EHCI error: reset TLL timeout ERROR : Unsupport USB mode Check that mini-B USB cable is attached to the device ** ext2fs read block (indir 1) malloc failed. ** ** ext2fs read block (indir 1) failed. ** ** ext2fs read block (indir 2 1) malloc failed. ** ** ext2fs read block (indir 2 1) failed. ** ** ext2fs read block (indir 2 2) malloc failed. ** ** ext2fs read block (indir 2 2) failed. ** ** ext2fs doesn't support tripple indirect blocks. **

< ? > %10d %s ** Can not find directory. ** Failed to mount ext2 filesystem... ** %s read outside partition sector %d ** %s Invalid Block Device Descriptor (NULL) ** %s read error ** ** %s read error - block ** %s read error - last part FAT32 FAT12 FAT16 Invalid FAT entry ** Can't read from device %d ** ** Partition %d not valid on device %d ** %s%c %8ld %s%c %d file(s), %d dir(s) Error reading cluster No current device Interface: Unknown Device %d: No valid FAT fs found Partition %d: Filesystem: %s "%s" reading %s Can't list files without a filesystem! %s/%sCan't load file without a filesystem! compatibleFDT_ERR_NOTFOUNDFDT_ERR_EXISTSFDT_ERR_NOSPACEFDT_ERR_BADOFFSETFDT_ERR_BADPATHFDT_ERR_BADSTATEFDT_ERR_TRUNCATEDFDT_ERR_BADMAGICFDT_ERR_BADVERSIONFDT_ERR_BADSTRUCTUREFDT_ERR_BADLAYOUT%llu Bytes%s%lu.%ld %ciB%s %0*x %s 1.2.3Error: inflateInit2() returned %d Error: inflate() returned %d Error: Bad gzipped data Error: gunzip out of data in header Env export buffer too small: %zu, but need %zu himport_r: can't insert "%s=%s" into hash table ERROR: Failed to allocate 0x%lx bytes below 0x%lx. .%03ld(null)%s:%u: %s: Assertion `%s' failed.invalid distance too far backinvalid distance codeinvalid literal/length codeincorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid literal/lengths setinvalid distances setincorrect data checkincorrect length checkneed dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible version*** WARNING: %s is too long (%d - max: %d) - truncated Host NameRoot PathOpt Boot File*** WARNING: using vendor optional boot file *** Unhandled DHCP Option in OFFER/ACK: %d Invalid pxeuuid: %s U-boot.armv7.omap4_pandaDHCP client bound to address %pI4 DHCP: INVALID STATE BOOTP broadcast %d Retry count exceeded; starting again ethact%pM%s%daddr%saddrBUG: failure at %s:%d/%s()! eth.cBUG!eth%dmacskipethmacskip Warning: %s MAC addresses don't match: Address in SROM is %pM Address in environment is %pM Board Net Initialization Failed CPU Net Initialization Failed Net Initialization Skipped ethprime [PRIME] Warning: eth device name has a space! Warning: failed to set MAC address ethrotateunknownautoloadnetretryoncebad length %d < %d len bad %d < %d checksum bad ICMP Host Redirect to %pI4 ## Warning: gatewayip needed but not set ARP Retry count exceeded; starting again %d.%d.%d.%dnvlan*** ERROR: ping address not given *** ERROR: `serverip' not set *** ERROR: `ipaddr' not set *** ERROR: No ethernet found. *** ERROR: `ethaddr' not set *** ERROR: `eth%daddr' not set Using %s device Abort Bytes transferred = %ld (%lx hex) octetblksize%c%d%cFile too largeFile has bad magic %s; starting again Retry count exceededT blksize TFTP error: First block is not block 1 (%ld) Starting again done TFTP error: '%s' (%d) Not retrying... tftpblocksizetftptimeoutTFTP timeout (%ld ms) too low, set minimum = 1000 ms %02X%02X%02X%02X.img*** Warning: no boot file name; using '%s' TFTP %s server %pI4; our IP address is %pI4from; sending through gateway %pI4Filename '%s'. Size is 0x%x Bytes = Load address: 0x%lx Loading: *Could not request gpio %d %02X:%02X:%02X:%02X:%02X:%02XBoard: OMAP4 Panda raise: Signal # %d caught  $Dd `耠逴@耜 p T 뀍"뀍)뀍/뀍1뀍9 뀍=@뀍뀍/ DZ耍뀍Y耍뀍X耍뀍 T耍뀍W耍뀍W耍뀍 W耍뀍S耍뀍S耍뀍R耍뀍R耍뀍@耍뀍}耍뀍Љ耍뀍t耍뀍}耍뀍 Ѐ耍뀍h %逍뀍Q 耍뀍耍뀍38耍뀍T]T]\]\]d]d]l]l]t]t]|]|]뀄]뀄]뀌]뀌]뀔]뀔]뀜]뀜]뀤]뀤]뀬]뀬]뀴]뀴]뀼]뀼]]]]]]]]]]]]]]]]]^^ ^ ^^^^^$^$^,^,^4^4^<^<^D^D^L^L^T^T^\^\^d^d^l^l^t^t^|^|^뀄^뀄^뀌^뀌^뀔^뀔^뀜^뀜^뀤^뀤^뀬^뀬^뀴^뀴^뀼^뀼^^^^^^^^^^^^^^^^^__ _ _____$_$_,_,_4_4_<_<_D_D_L_L_T_T_\_\_d_d_l_l_t_t_|_|_뀄_뀄_뀌_뀌_뀔_뀔_뀜_뀜_뀤_뀤_뀬_뀬_뀴_뀴_뀼_뀼_________________`` ` `````$`$`,`,`4`4`<`<`D`D`L`L`T`T`\`\`d`d`l`l`t`t`|`|`뀄`뀄`뀌`뀌`뀔`뀔`뀜`뀜`뀤`뀤`뀬`뀬`뀴`뀴`뀼`뀼`````````````````aa a aaaaa$a$a,a,a4a4aqꀗ='J/DXP` Qeꀅ QꀍH$RL[N]Tya;,fAq,fqr耽r tr/lpPd n耇뀓n耸j<,kA] mlk3Xs^| Dx耭 뀾 t  ^ }d 뀕 } 뀕 | 뀕 ( y- T   }u뀓Љx< ЀEax xh %l뀔xjXn뀖0. Xr{ t老 |耡  K"S"h"0RȰ"뀍 $$2$* ** $(,048TH   t x      $ D  P0$,DHP,0LTX\t(\4<X\      !\!####$%%%%%&''' ''''' 'D'h'''''(H(X)\)`)d)h)l)p)t)x)|))))))))* *`**+++,,,,,,,, -......D2H2L2P2T2X2\2`2d2h2l2p2t2x2|2224444444445|77777777788 888888899994<8<<<@<D<H<L<P<T<X<\<`<d<h<l<p<t<x<======l>p>t>x>l?p?t?x?|??@@@@@@@AAABBB BCCCCCCCCCCCCCCLIPITIXI\I`IdIhIlIOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOPPP PPPPP P$P(P,P0P4P8Ph>l>p>LAPATAXA\A`ALBDDDDDEHELEPETE$HJJLLMMMMXN`NPQQpStS|UUWWWWWWWYYYY[[[[[[[[[D\^^^^^aa atcccccTdtdxdde eeeee e$e(eeeeeeeeefffffffffffffffffhglgpgtgxg|ggggggghhh hhhhhiiiiiiiixj|jjjjjjjllllllll4mmm@pADEpGMM8NNSTTlYpYZZ__ _____ _$_(_,_0_4_8_<_@_D_H_L_P_T_X_\_`_d_h_l_p_t_$o(o,o0o4o8o\}Pﾭﾭﾭ`dhlptxxV4JOLNPLN ) X LП//   @ ПP-P/@- @L0 , ,/@-=L8 <0, Rb0b00Ph00P  P@ P P  P   RS#RS5S/p@-@P PT `3``l048821 0 0 2 0000`03`0`0 3`03\1``i``i ``0<=<=ZE02 : 0202:: 02y02:02 dS02o<0002D3!)!@320202112a2 12\2 112V0 C0q!00  R  R0  R0  R0  R 0  R(0 AxR! B#00P2!)!-0S82P0USUPP$"0 S: 0!0 S: 0!0 S: 0S$s2* p1 /3' Q#%*13S0> #5!A430(0,0Q  B" , Q " , !@ !D !H ! )( ! | 0Sp0 " ! D0 06p@@ 0  Sp@pt#@DP@-GP /@-6}7z@- I @(M@-x@x0T0t00kh0 T0X@0f 0a0 \ 0WPlP @-0 Gl@-@0@!PU:6``F1# +PpPpppT0lPPrT08T0 010xTp@ M˿̿( 2$!@-5;@2$!5;13/@-:Р  ` PPP(M N@-@->@P9@Px4@l/TE @xR @j @ y @ @ @@idEjEmE<P@- 1$03/P R/0  -@-bM @T e/! @bߍ@Ѝ/0/ @-tE8@-P0@P0   @@@@0 PP 870J4 0000 008V' PE@-NP:PPZ0 03/ P$PtE0 @-      U   @dNE@-@P000@-@1US1S 68 P R$ p3HHH- 0` ?0?0H0M?@?@0A8 81PP[,30>B0Q .<1 00q84t 0PP ZDhXdZ,R0\ :R 0 00L ,L 0 Rp & 0`PB pW < P00S 0`|PP,PL00L0Pݍ @-13/D-PHp(@W 0`h0`vP``0`kPh0`dP 00D0S0  S0   8< @-Q 11 RH %H53/P0 N-M @$0 09I0 4릟?`P~I.p  AP +ˍ0I9 88404`Pg00:8+ 0I904 8 84`mVO$4l0P` d0hR P $x$$$$0 SX ğ!0  P U  @ PRP ?0!`p0 ;!/# 0`   U%1#)<00P  S<0+ ˍ0I904 884?`P000000[P?P2#S/0p3SP 0 84 0 < *&!:S R0Sh00S%20 9000S 0000 ] P`0 L0Pp0L0'   +70I9 8 PT84PˍI09  0T4P0D013/L0 2 2>Wt԰ w0P(W1 D 3/$D3/ P 0R 0R 0R  0R  *PL0pLp pGJwL0 110P0č PPTKv4xp 00"$ 4ht0p SSs#<h\x0\#.S HIBJHCBB@B#OF@(s@(sA@(As@(so@(co@(cAo@(Aco@(c_@(S_@(SA_@(AS_@(SO@(CO@(CAO@(ACO@(C?@(3?@(3A?@(A3?@(3/@(#/@(#A/@(A#/@(#@(@(A@(A@(@(@(A@(A@(H@BpGH@BpG8 Op@pG#H@BpG(ȿo@O@&)-@@pG@ @F :@CRBcF@CpG@@F :@CRBcF@CpGOL11555115511511 #(-27<FP'@Bx@l  DRAM: ? %dMB ### ERROR ### Please RESET the board ### U-Boot U-Boot SPL 2012.10-04280-g1a8ac55 (May 23 2013 - 14:01:59) (%d:%d) Vendor: %s Prod.: %s Rev: %s Model: %s Firm: %s Ser#: %s Vendor: %s Rev: %s Prod: %s device type DOC device type unknown Unhandled device type: %i Type: Removable Hard DiskCD ROMOptical DeviceTape# %02X # Capacity: %ld.%ld MB = %ld.%ld GB (%ld x %ld) Capacity: not available Partition Map for IDESATASCSIATAPIUSBDOCUNKNOWN device %d -- Partition Type: %s DOS## Unknown partition table ** Bad device specification %s %s ** ** Bad device %s %s ** -bootdevice** No device specified ** auto** Bad partition specification %s %s ** ** Bad device size - %s %s ** ** No partition table - %s %s ** ** Invalid partition %d ** ** No valid partitions found ** ** Invalid partition type "%.32s" (expect "U-Boot") mmcFATFAT32 Extd Boot** Can't read partition table on %d:%d ** bad MBR sector signature 0x%02x%02x %5d %10d %10d %2x%s%s hd%c%dsd%c%dusbd%c%ddocd%c%dxx%c%dPartition Start Sector Num Sectors Type spl: mmc device not found!! spl: mmc init failed: err - %d spl: mmc blk read err - %d spl: wrong MMC boot mode Status Error: 0x%08X Timeout waiting card ready MMC Device %d not found Caution! Your devices Erase group is 0x%x The erase range would be change to 0x%lx~0x%lx mmc erase failed MMC: block number 0x%lx exceeds max(0x%lx) mmc write failed mmc fail to send stop cmd Man %06x Snr %08x%c%c%c%c%c%d.%dMMC: no card present Card did not respond to voltage select! %s: %d%c SUNXI SD/MMCWrong mmc number %d 0123456789ABCDEF(((((AAAAAABBBBBB(null)%s:%u: %s: Assertion `%s' failed.P`P-Tp89U<VH>WAX DYGZbJ[d?M\P]O@T:pE  TT@D!@0e@  4,0e`6O@T:0?]JJJ@-@+@-@%8@- P@8@8@- P@8@@-0?????0????////////@-P/@- @L@-@@T \ ПP-0 , ,/@-H0 =v0 P 5 %05+20 %/2 a0 b 0 @-@d@-=#v8 <0, Rb0b00P@-/h00P  P@ P P  P   RS#RS5S/p@-@P uPT `3``l048821 0p 0 2 0000`03`0e`0 3`03\1``i``[i ``W0<=<=ZE02 : 02L02:: 02E02:02 dS02o<0002D3!)!@320202112-2 12(2 112"0 C0q!00  R  R0  R0  R0  R 0  R(0 AxR! B#00P2!)!0S82P0USUPP$"0 S: 0!0 S: 0!0 S: 0S$s2* p1 /3' Q#%*13S0> #5!A430(0,0Q  B" , Q " , !@ !D !H ! )( ! | 0Sp0 " ! D0 06p@@ 0  Sp@pt#XJP@-627/@-@@-P@ 0N 0I0 D 0?XlP @-0 2l2$!@-5;@2$!5;13/0$   Q330/2$ 5;03///@-@@8@-@P8@@- t@0 0 0 0  00 ((  8 8/ @-uJR8@- xwtup@pP hoT8 Vi?P?< 000L ": "ʠ  0 S:o0?O@OOP_8@-@_T8 @@O8/  P/P/0  /@ @-@ @-@+*8@-X:0 u J@-@tld`LX4PHH@@D8 J J J J J J J J J J J J@-03/Rp@-@@P f`0D @@p( JP J0/@-@pJ) J PP@-`@&4/ JPPN-`pP@@"0S@ 0 $ 0S@V!bY   0[p 0 0bzb[0D@P`P4=g& 05/ЍJL$JX JF-p0,`(@4P0Q$V V*T T```  8$0000 \`P000 80S #&xdD&v3 T#P 0S J J J J J1JN-XC`K/b@#f`#P# i`;aY3@ e@Բ%s$pTpPp@Ph$P]2pP #%#Pp%#W L}#P8 ,s%Q v%P/q%0S SS S P T0 # @0P0TUXq@ ab0@D0u%PTDkn%AT0S< #P(p]p0\0^@00L0D0SX%W` P0X00`0WW W Z 0 00h C00#P\0 HP hJTJ[J[JV'JJJJ JJJJ@J`JJHiJJ/D-@0MP pPu ZE PoA0 Se0^ 0Z1a: Z Z[@ZD ZL ZT6X0H0\00]00,0 000{PPEX,  a_?dt0h 0p0 a#PP5p 6ef t /e_ &  06/PP   06/PP   06/PP `p b  06/PP0Ѝ8XJhJJ\JJJJJ4JRJN-R@MPp0`80< 8d<00:SS #S   0T~ bPw)AX00\00]0080 000HPp pD0S "0Sxp p?$  0p[ 8$8 X @ a^]0S[ P _pP 0T d )`H0F3/! $^ 0AT [ `@^!^ l#  04/#  0@@ЍhJqJJJJJJ\J Js@-PT` 0P @_@P 000`@ 0B|J:J[J>JN-p@`\VP t|`0P 0u0XP`0P0j0pe`VW TJR@-0 Lc0c@-P@-P@-P@-PN-hM` @+c`Fp PV)J)J)J)J `Pr  cpP`  P c` PU@ Id 0*PBd00  0:00 0d1= <P 0<PV V1 8 P` | 0;;X0TpL Xnc@X hЍJSJJJ'JTJwJ[JjJyJJR@-`dM@##P\ P 0d*pP\V  P`P`<<P 0<i8PP $::dЍ|J'J~JF-RdM@0\0/\ 0PP2*pP&\C`P  0|n Xb Sb  MGp 0 (pWTdЍJJJN-RhM@`0Pd0ABd 0P)pP;dCP  0./   bV P  bV P  b0 FpPX 0P p  8 0Xb(XP hЍJKJvJJJJR@-PdMl@\ @ 0)`P \p-CP  0SFdЍJJD-R`MP`@\PP\ P 0x)pP\ CP  08V (FPP `ЍJ<J|JeJ@-$$  `0A 0m۶0 .R00@/R 0S//R@-P`@p , P  D0!J0 R  /(jJ8@-P @@D T8(jJ`0@S/0?S@/00 RS#0?/@-@ P8@- H@P00#0P0Y00)0P0 8@(jJ8@- H@P00#0P0N00)0P0 8@(jJ@- 0, 003/(jJ0, 4 8  < /(jJ04 , 8 <  /(jJ8@-@@, R @P5/0D R0,08@03/8(jJ@- 1`AH)  # D _ Q^ H HPL PbU@@PU~00@; PU!00@6 N0PU 0Cs0 0 00@- OPE\U@00@$ P0PU 0C)0-00@ Q0PUD0#00 @ PUN00 @ PU1  @ U0 @ "   ~ ! @XPp0 `p0 0``0Y00@`))0 0`@+(jJN-(MPpPB  ]@U` ]U@ ]PP U  P R[P2P N[ PXYP D Z ,p $$3@003 pp@0 0)0#0D0PPH{ P Pmu p@W q pS pKwp Wf pG @D t@@Dt0[ p0< 0V p@7 R 0p2 [# ?  P* 0C @D_ s0t@C$= p DY@DSYH 0S0!H0T( p [3 ? P p P 0 pSYvBY< 0p@Ppd P ZZ9   ]pt  @U  P Z`22P Z P (ЍP.$0@PpBSJW!J!J!J!J(jJ8J:JtjJjJ!JyJJ[J "J2"JP"JRD-p@ \t0 PP\8` IR F 4 0 W  \jJ#JR@-(@ \ jJ#JRN-P`V \UQ  \UL  {\U@  s\P P%[ ZJ v * o  0  S:pZ ` R 0|[ } P A  p`0V:T@dPe@20@#JL$J$$JM$JX$JRp@-`pW PP/ \ @\P U0U00U 00CS U 00CS 0 S pRF-P @P( [` p[ ` [P p j 0gL T T PpjJ$JRD-PM`@ `P`:V@ 0V@@ p[ [p p [P gjV0 V00Q 00P ` ` pPU`( Ѝ$J$J$JjJ$J$JD-`0B@S pP W[l0 PPP[T   H[W W㰠P@PjJN-pᴠR0`@P$^ @P  "[`[`   [Pcf 0d&Q0 @P`jJZJRF-@> q P` - `P3  ZPPp V V P P 0-ST P0f0PT Z0S V VTP 0 P`jJJ;JyEJ$JJqJRN-p@ڴS0Sc,P0Ü0'VPP xC '0P 4P+PP TVPP8C'P4+,0P 0S ! VPP ,{VPPHW2@ W `Z@pW WZ ` RZPpd[@&PP<T +w 0S,O L0W (Pp""A 1@0S9  4 Pb-VP` 'VP` !VP`OD1&VPp  PZ PY YWP P/ 0 F+V V  0J8J ":JJ@-//F-P(p,P`@'=PD eD0SFS H@P Pl 7H 4=T DP0 $ "0S0 S0S  @00^"0S   0y000Y0   @`yP:J:JJJJJ J;J+;JG;JF-P@` }Pp0  @p0pT+ W@0 0 ;S * ;;0S`t H t 8t$c@@;J;J;J J@-`P@Wp2 0;`P 8-4P<`{<JL$JD-p0Q@P S`A-00C00 Sʀ0@ S0000T T0: 00C000C0LJPJQ@-@P` \#p BW@Qpp paW G=0\P  000pW0P  000*?J/0N-00Mp  4)0S(00 0 0PS 8 [ @(@,@;PPl P`P夨團 ( ,0p@`T`\00S P@,@1#PQP*bP PUp P P@@  _,@000!SSm ZV0 V [P` <0( ,0p`KA0@SHJJJJHJHJHJpJ0@0̠C( ,0`F 0 v( P Pb PD P9 aP(P* ( 5,5:Py P Pb P, P PP`z POP_ P\(00C(0(`Vh(0, S*(00(`V\ (00C(,`P*`F`V  ;(  `V0FB(0,S8*XcT%,0( 0C,0S(00C(0(0S,Q $,0( 0C,0S(Q ,`A(`a ;(  `V0F,00Cq0S% C4r    R0 4!K0S S 00S000S ß1KT CNNK(00C(0(0S,Q tt#S=,0( 0C,0S:v:( ,R.*b =,0(0'(0`, S*` _:,00 0 0(0 0" 0-P` $ (0( 0c, 00,0<0( ,0p`yLR\2 1 90 0S0S00 00 02 1 zxP 0` !:` @$`pP U U U3 U ;U  U6U U1%0t0gO00KT$00C$0$0S @ 0S $ 0`q@ 0S0 S 0S $ 0``@ 0S U  $0P @@$$000$0$00$0qP 00 0j0Ѝ4pJ_JXJ*?J/?JL$J,JPJ3?JLJJ 0 +C,JJ@-@ 0 S S S @ 0S1 S S00T0 L6?Jqp@-`@q9PPP  0:00p@pp@-P@  ^=@Pt`' TPP P@P:PdU@DPP0%T00S U BU?J J_?J?JRp@-@P0`P<p\PPUpppp,J@-M0!A!MQPPQ RP p `P`V P  PPQ B:`5qLa`W p PQ RA:R:Ѝ00@s R/a0@SW@/A0@S7@/8@-@PP8P8N-@PSS 0S`V ` P~00F Sx4JDJTJdJJtJJJJJ @`  @`  @`  @`  `  @`  @`  ` @ s p RpH s03#" RA<P:pyP20py40P(04000P 4p0yPytPpp Py0UgP py P```/J@-pP@`4P 4@E7P PU@@謅J8@-PP@ <@P < 8 78@-P (048 840408 謅Jt0-4 DM4 8 \< h8H b71040$000(0,000(0,0DЍ謅J?J$ J4 J< JD J8@-P8@8YP@TTP8H8衆@-@0PJ@-LB04S E004,bPp0BP! 0PS SS S404i 40 4ep$4W0$4ZUW|8R0pPL pP0wS;0404 0P<  0P 4aU0P. (4S 0~P% @ $40"S (4S  0 $ 44P  0s0RD s0 $R@(0OPJJJJJF-@ T P `3P 0TA@@T pxP`@0pDADw ZP apDWZapDWWDP 7DP%SPT@TRPF-0,APP#00(40CT,T40TTT T$T8T4TQ4S 4+1PP0$R  R00 0$|0 $u h`FV(7(PC'404up `pWPJ4J(J N-Q>QC 0 g00 0C\9@ g0Z!R0C   0 (R 000#   $!g Pⴰ ` P &001 000UP D \ pP pW: p ЍDJEJN-0M@P`P@R vP JP A [ @1pW6T 000@0 S(@0000 P,00$0PP P0 00T00S  0 P000P T@ P T0[) @@0ЍEJ@EJREJp@-S0MP000@@0 S(P0000 ,00$0`PU 0 `000P 0ЍpREJF-@Rp PP@ QdvP a  Y `10P0Yp*@EJ@-@ M/   x@P}/ ЍN- M(@o7p 㴠p bPP9)0000P0  P,0P00 P SQ PNPP%/0S`V*Vt00 R0C00P0  :0 0001PP0T0S?@008P Ѝ D- M@  p ppPP<gl/Pp p00, 2 0   01 0PP#T/0SV`V*P0    :0 P000PP 8000T0S?@008P Ѝ-4M,0 , 0000 00(0$04Ѝ@-( M$4 @ 0P ЍP 0p@-+@L0 M0|0Q?P?PP 0`P P0S L000L0 ݍp?@-@0P 0 00@@-@iP1S3/-4M!"80 0@0,00(0$0L4ЍP N-+MPSp`@?p?`LPh70E>A8 813PP[,30>B0Q .<1 00q84 0PP ZDXZ,R0\ :R 0 00L ,L 0 Rp & 0`P pW  P00S 0`|PPPL00L0Pݍ @-13/8< @-Q 11 RH %H53/@-D13/P0 N-M @$0 09I0 4릟?`P~I.p  p-P +ˍ0I9 88404`Pg00:8+ 0I904 8 84}`VO$4l0P` d0hR P JJJJJ0 SX! @ 0  P U  @ PRP ?0!`p0 ;!/# 0`  ; U%1#)<00P  S<0+ ˍ0I904 884`P000000[P?P2#S/20p3SP 0 84 0 < *&!:S R0Sh00S%20 9000S 0000 &P`0 L0Pp0L0'   +70I9 8 PT84PˍI09  0T4P0D013/L022>Wt԰ w0P(W1 D 3/$D3/ P 0R 0R 0R  0R  t,PL0pLp pGJwL0 110P0č PP9TK]%4xp 00"$ 4/t0p SSs#<d/x0X#.S@02Dh2,`c+p '6%P  `LpPU7 @0cS w dǟp @n ZP0 U#` iU: RcPE `uPV:&%PT2 S?2PoM6& 6%HPv @00S<PE puPUPpF PE/Up @F/P 0V`@ 2* 0!C1S! S01U@ ,UE6&@d@ @l\0S0 P P  D% @6 bR  `T2 SQ6YN:$%]?Pp4 `@APT2 S( ?P% 1X% $pP P <pP  w W%P$%pP #6@ 00  Q,  PRQ #  PP Q PQ  P  r 3! AA R  B AAR B AAR pR `wp p  `T@0\R0@!6 jR%pG@ 7 @D@1wp 0@1W1 @!1 c6R%@%P@pT!8% ipP .p1 @T2 SA$8`1 0 0J@1% @0@@P0p%FpP   6%,pP p@P Wp*ލ% 0@PZV ``@ Pp@ @  @0` JJJJIJIJJJJJJJIJ.JJGJJ`JJ0H-?0Pd@f  US   PL9 S?2P 50 5C*`  0@ SP89 S2 0P2*`V :  0P@%   0P   @P 9 S2 0P* Pf` T@@| @zߍۍJJJL$JJJJKJKJJIJJ8KJ@-0 0+@-pM A0S- y000CSHJHJHJHJHJIJIJHJ |@Z0VDl @P tL K `>X0XV k@`0[@>pЍJOKJbKJAJAJAJAJAJAJEJoKJwKJKJ@JKJ0 @-@`Pp 00 0KJ0 p@-@P`  p@KJ 0P/8J8@-0/S\S10/S\S !h0 R Q0A/R\R    P.Q Q\Q/Q /\\\ @.T S\\/\Q 0A/\\\  B PR0T R/    / P 0A eQ00Q\ 0\/S\SL /Q\Q/\\\ 8`J`J`J8@-0$@2PPGR8`J|Jl 0@-MBtTj/Q\Q 0 0 2## 2/ۍ`JKJLJ,Jp@-@t M0Pbv\G/Q\Q 8 $0( 2## U4P_5_Z$pIy 0W LQP (ЍN- M`!2@pS0DH@#q ?0b QP:00 JS 4/PP#QP:$QP*0 ,H0W2P@ Q=  8 g"000!3PP+04P40P /_0 00P"! H"0H0 ,e0W2 0S IP ЍMJMJpL-M@B P` 0 0 0`@k022S0cP0  C0r027S 3/ߍp@-@P  0S@Ph`P 0 S*`#H 2S U,ЍpMJ8@-0@@ UT8&,%88諲*MJMJMJN-PM2@$ S $$4D@00D0t@00D0}PDp@0WQP$C@PD@0W3`` 0 $01/P@ TQP@@ 2 S0#q ?@0b QP: PP ء `47SPD@DCU 0dQ(`8P@,`81H L$H@P~LPUQP SR00S U8P("[[`^ P^( #0@0SQpL0S 4pL0P4 <@@, U( 0`gV`% pPPQ[%$TuPWC `4!L0S0#$4s0S (02" 004 ; $00 1/P {, [ 0 !QPe:PP@DPPЍ<@ `400SNJ'NJ>NJN-HMP`0020@S4 %4 T800<000uP$@STpP[<@80TQP%S8PE$ c}PT4P8Yp$p1QP12S8@!4q ?0b QP:fpP|;Х   Pb@B@P 00D r0(TP 0B "0# A 0 @[ Z$! "T , #!С " 0#\!! pء 0  " @ b 0I#7Q! ,p0@@D@pPDP@@UPAQP SR00S RZ PP0PSPU pE i2PI[ c0503#TTuP`I `Ơ(pp @0f050S00U @㔕%0P0SZء 0 S RG@`[&4d0v`#{00V5 P$啖& PdUP` `P'0@aS&4dv` T P0@(pS0S 0 `㖓,@ 0$04 4@ PP U4p$?@\8Z@p7HЍPNJHJBוWlNJ'NJdNJwNJNJNJNJ>NJN-HM@`@, lp7PPh00$PP //d)h P f   0 0/S S000 @eP Q D @D`U[\  0$@0 0PP480 (PP, 0#PP 5 #0 /S S@S* 0[  /[2S03 0& PP 8 0PP 0#PP0S03 003$#PP R+ 2S03 03&P0 0P00#P Ppn, R#, .hY!@P 0 0ppPP @ 0PP$SRPDX#|8 H0 pPP# pPPP h$wP$(P%^ 0/S SH  `P /VV[.S [.S0.S 0S P@PC 0S $P$,8 0"P2!rP+ # @ 0!#pP` @ /(P ``P$P PHЍ @ P2S |JNJOJJ8JOJ#OJ(OJ:OJMp@-"M#nP8D  Q0002 S04S32c 0$#P#K0#0 0`@`P/0PtA@#!P PE 002S0cP"ލp@Ѝ/KOJ^OJ#OJqOJOJ@-BMM`p_8DpP@_P2 S!, B AwW A7/$Ѝۍ@-BMMPpo8Dp`@;P"2Sp!, B Ah @0p`0   wW A7/p$Ѝۍ@-@ 0 0000P 0S$ǿ0ЍOJ@- 000@@PP `VPP᭿0`FP`1LPP   @ЍpOJ0@-M 0 0000@PP  PP  |  x Ѝ0@- 0000 0PЍN-MP0 000 0@PP0 0U%* `p p @ WP@` VaV*0WH?P  UPP  -  ) ЍOJOJ@-@0G4EC@@N-MPr@@`P r. P44`P ` 0@P%X%000[ 9$0 0Ġ 80<qأ 0 Pz PP<V(SR N PտA"ο: Pſ1)@PUT*)@ᘾ>@P尿xt PᨿUPL P40( Pqꎿ"  b(402P0U!GS R8S2T07@TDI p\@`e@ 4 @!SRS:0#QP  SRPPP|"0QPu0 QPPu2 P\ U `!`S Rd 00p0P@P 0(`EPU0S_޽@@P@pT Z:Ww P3PP 0X0 ZP4ܾ X @`SR( 0@@ PP 婽z ľ`0 S *垽o幾 ᷾`, T\ P  夾 ᢾЍWOJOJPJ1PJ5PJMPJWJbPJPJPJPJPJPJQJPJQJQJ0@#DD0"`w 0 0 PPg,4SW Q, B A A| 7/7 eS=0`Fcpl3Т,p 0!n 0 0`@=P  %0@H 0P  P(4S2cB 0&!n`@pPd P5SD P4˻ 4ЍۍRJqJLrJp]J:OJ0/8@-P@0 P@8N- M `p@PD@``aU`pU @ 0  0 ! 0! T: 0 Ua `p 0U   U   U!`pa ЍN-(M `pHPL@a``U  0@ 0 `p T:U `$p@ p U  h U  `!U! $X`pa(ЍN-JM0 @(`0@Š@ Ȍ @$ (0 (8 p$P@ R@XY%,% CaI$$@00@ ` 00p @` `$0 Pp@ 0 `P 0p( p@ Tp pp, bsu' |'p!pp'p p*c*c* p @ ` ` 0`00p p Pp$ P  JߍJ0?̠ !̌ Č!Č /N-M @`Ȱ?p@TP\@` 0SR: P 0S@ 0 C0 0@?P8U0anၡ PE/pu@@,@@ T:[@  @[@  P[@  @[ 0 @z 0P!ЍJD-0 @`@ T`@P *PP pPt{'{LW3Z%QPPUJ\:P\1P#P3:\*йuSJ0@- (@ D$@@$pRJ0p@-0R00S 0 R,| , @"!PA0`L p`a &p`a &p`a &p`a &\T!p$ 00S,| ,pJ@-@-0@0$SJ@-  lJ;JF-M@<` G 0 Z @ `FT NЍp 5 0 0 0@ A FS%$  P@p @@8+T (&  ЍF JSJSJSJSJN-PMppP@@S@PU<P7 UP! `T 0 ! T    `V`    .`V P T0 peD CҸP 00WPЍ;JSJJSJL-PР@`p Q U pZ 0 `p0 R000 W V0#02S[Z: Z 0 pf``0 ᤹)N-@0@MPp$00 `(0<0d`K P k0P0f0p WPp [`X x 0q cp  f PePi @ЍhJ`JSJSJSJ@-\    @ Č @T @T\: TJTJ 0 D-`P@pQ P `pWp@-`Q0  p0S@@PPS*QQ 0@0 ppPJD-@P `px0 0P0S Z \  0UJp@-@`TP1P!@Tp耖@-@@DTN-@͠ i`0!SR3:VRV&6  `b&  Šlf0``aPaP  Ul0  àa10 Q1c0000Ѝ0p0 0 Q P   OPUU%&00PS% 0 eVe` 0PPUef0``!a0!b00  @Ᶎp@-Q`@`P:0 0 0PER00SR 0PE0RpEUJN-`M@တp YP ' pq  R r0PE-PE+PE [ YPEPE00`0& Y Y`  @I 0s 0 |1   `c  0 @ ` `f0V00Pc    RZ/PE@PbZ[ Y0 @ X  @  0 RZ/PE@Pb 0 0CV 00SZV``0  0SZU`ЍJN-P@ `%S0@0p+S  S #S -S 0S @0C Z <,0Lp00C Y *Sp0\l 0.S00@0C Z0  #00Cp@0@ Z @*Sp0p@S  0hZlZ LZ ZZ zZ tZ@lZ@lY@LpnWO cW %Wp XWR\dWM iWMJsW oWA pWEuWK xW@;`L\00`L0\ ap Zp R p |00 ! @04!0?0 e :  %000S0@D+ LZ p@ lZp ZZzZp  tZ  hZz z  00 [ @0S0eЍLUJJp@-00S 0xS00D R R L`0 P0@D 00C 0Cs070CS:QPpJ@-00@pP`P  0S R 0d0V R@--\`@@-@0 KR GRMR kR iR BR0000F-0M0S 0xS00D R R @ `p㌠  @,7#``p0 D 00C 0Cs070C_0P @SR:YЍJ;-@-  5 @ Ѝ/-@-c : 0ɗ꠆@-SUJp@-0D@P0@@ j `0F  PPpXJGί0L CN- @MP :S 000C00 4`,@a 0,B(` B0CT` 0@ @( f`F4`X`$ ,fL`FP8< 0p($@K@ 8`<@ PRP@DB 4P`Aa@V1 `@  ` R520@ 2 f1R`P@UR 8 ` @ QA`P1 f @`R* R"520 2,d d`F`1`@jVj0@d T PhCWP$T PdP *d   T8@@W%*< dg[ P%*k@ @[W 0*gP@(PU@0PfTPdP*d   T 00@00000P0P_ `P0`X /f@@@0V@CKP堰` 00S ČK ደ 0 0 PSV0%T0``VP00) 0%@ D@D@PA`P: P@@@@@ f`F`@Qa@  P @@ @PS\1: PA d`A d@@@@ 0cl< @008< @ЍuUJUJUJN-M`4PP Q @4p@@TT 08xvS <  vS x vS x@@<@TU .wS.wSAvS vSz"vSz"xᧁAvSCtvSCtvSj"ySCvS=%vS=%vS(zFAvS+}7vS+}7vSvKy:{5NYAvSvKy:wSEwSE|týYCvSUpvSUpvS }ۀ&x Ї_ v =h,h5)j hՉ)UZXthdhS 3vgrSK_L;^X^*&Zgz.n)AA+7$XT~^$tETp~^cluΑ/bwykԳ=gjo}^S>?ZRjEJuԗ #[@\b|l-+SL`ĚP*9 8 I{ j0u`r#8 XOeAK+.Gz67P\WYG}?LfkLH9K9KW}ߛ:MQEC fOq7<geT|0A1EgčXP[Pew6EdǂZ=Cگ`xAG2v$^{i!2>$@k H'8u N;%-hvq6V;j"C",n-jޣMJJ\t+7WJ8{vBR:xyƚOZtesV'*;o&<ql~6[.3ǚ*|&LKha>߄I5UeNؔV~:pK?׻sQ4x^wuF+ . ..archn catdatenchmodchgrp cp dd df edexprnhostnamem ksh sh ln ls mtsha256sha512mkdireject mv pax tar rmsleepsttyn|syncn ... ... ... . .. tmp db runemptytzlist ... ...PTDQp@@P|U T@P@P@T P@   3겠Z\ Y 1 Q 1PአZJ TZ @p@3Z@TpP@G@ PT㻐Რ ഠP@ PU PఢUነⰢE@@TP PC,$ >P P@ p$p@ ` `$pP! @B gr << 8@Y  R(``@( d$pp,P(0ŀ `p0pǰ0 pdwp 2pp piLD@0pkW'Hppkp i`Z* H @00 0,00D@\@I`pL @0P㐐p@   tPpGwpt@W \\ (4p\8  P TPp@ `d0匰p aZ`⊠0Q: p 㯵v p l0pL0 0T0T00/>0l0P7.0h000d `000xTL J 0SW$ 0pG ePPW pG ePU:6cPc0hOPW pG ePU:Q6cPc1 0  &a6PE&PW pG ePU:6c  aW pG ePU:6c  cc0P Q85000 h Rh7hQ:0S lS>/l0L0 0pT0T0 0` P4`l08P00X0X0 0d Ph400 1WZ p 8` HIBJHCBB@B#OF@(s@(sA@(As@(so@(co@(cAo@(Aco@(c_@(S_@(SA_@(AS_@(SO@(CO@(CAO@(ACO@(C?@(3?@(3A?@(A3?@(3/@(#/@(#A/@(A#/@(#@(@(A@(A@(@(@(A@(A@(H@BpGH@BpG8 Op@pG#H@BpG(ȿo@O@&)-@@pG@ @F :@CRBcF@CpG@@F :@CRBcF@CpGO>11555115511511] Je Jl Js Jz J J J J J J J J J J J J J J J J J J J J J J J# J* J2 J: JB J|JJ@Jdo_env_import%Kdo_env_exportU-Boot 2012.10-04280-g1a8ac55 (May 23 2013 - 14:01:59) Allwinner Technology bootcmd=if run loadbootenv; then echo Loaded environment from ${bootenv};env import -t ${scriptaddr} ${filesize};fi;if test -n ${uenvcmd}; then echo Running uenvcmd ...;run uenvcmd;fi;if run loadbootscr; then echo Jumping to ${bootscr};source ${scriptaddr};fi;run setargs boot_mmc;bootdelay=3baudrate=115200console=ttyS0,115200root=/dev/mmcblk0p2 rootwaitpanicarg=panic=10extraargs=loglevel=8scriptaddr=0x44000000setargs=setenv bootargs console=${console} root=${root} loglevel=${loglevel} ${panicarg} ${extraargs}kernel=uImagebootenv=uEnv.txtbootscr=boot.scrloadbootscr=fatload mmc 0 $scriptaddr ${bootscr} || ext2load mmc 0 $scriptaddr ${bootscr} || ext2load mmc 0 $scriptaddr boot/${bootscr}loadbootenv=fatload mmc 0 $scriptaddr ${bootenv} || ext2load mmc 0 $scriptaddr ${bootenv} || ext2load mmc 0 $scriptaddr boot/${bootenv}boot_mmc=fatload mmc 0 0x43000000 script.bin && fatload mmc 0 0x48000000 ${kernel} && watchdog 0 && bootm 0x48000000bootcmd=if run loadbootenv; then echo Loaded environment from ${bootenv};env import -t ${scriptaddr} ${filesize};fi;if test -n ${uenvcmd}; then echo Running uenvcmd ...;run uenvcmd;fi;if run loadbootscr; then echo Jumping to ${bootscr};source ${scriptaddr};fi;run setargs boot_mmc;bootdelay=3baudrate=115200console=ttyS0,115200root=/dev/mmcblk0p2 rootwaitpanicarg=panic=10extraargs=loglevel=8scriptaddr=0x44000000setargs=setenv bootargs console=${console} root=${root} loglevel=${loglevel} ${panicarg} ${extraargs}kernel=uImagebootenv=uEnv.txtbootscr=boot.scrloadbootscr=fatload mmc 0 $scriptaddr ${bootscr} || ext2load mmc 0 $scriptaddr ${bootscr} || ext2load mmc 0 $scriptaddr boot/${bootscr}loadbootenv=fatload mmc 0 $scriptaddr ${bootenv} || ext2load mmc 0 $scriptaddr ${bootenv} || ext2load mmc 0 $scriptaddr boot/${bootenv}boot_mmc=fatload mmc 0 0x43000000 script.bin && fatload mmc 0 0x48000000 ${kernel} && watchdog 0 && bootm 0x48000000set_default_envenv_importsaveenv;J;J;J;J<J<J <J<J<J!<J(<JL$JL$J/<J<<JB<JH<JL<JV<JP<JZ<J_<J d<Ji<Jn<Jy<J<J<J<J<J<J<J<J<J<J<J<J<J n3J<J <J<J <J<J<J=J =J=J=J=J#=J(=JL$JL$J 6=J?=JtJQ=Jb=Jk=Jt=J|=J=J=J=J=J =J=J =J=J>J>J">J 3>J=>JT>J]>JJv>JGJ>J>J>J >J>JL$JL$J>J>J>J>J>J>J?J?J?J?JL$JL$J  ?J?J@J@J(@J4@J>@J^@J)JJ #(-27<FP'@Bx@l  tHJIJ JJFATRJWJ|J J+SJ|J0SJ6SJOJ=SJOJDSJOJKSJOJRSJOJYSJOJ`SJOJgSJOJnSJOJ/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxqg jgrn<:ORQhك[!B c0@P`p)Jk1s2R"RBrb9{ZӜb$C4 dtDTjK( ōS6r&0vfVF[z8׼HXhx@a(#8َHi +ZJzjqP 3:*˿yX;l|L\",<` A* hI~n^N>2.Qp:Yxʱ -No0 P%@Fpg`ڳ=^"25BRwbVr˥nO, 4$ftGd$TDۧ_~<&6WfvvF4VLm/ș鉊DXeHx'h8(}\?؛uJTZ7jz *:.lMͪɍ&|ld\EL<, >]|ߛُn6~UNt^.>0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z- $-6?HAZSle~w =4/&QXCJu|gn2; ) zsha^WLE+"90cjqxGNU\dmv@IR[,%>7}tofYPKB5<'. V_DMr{`i :3(!OF]Tkbyp#*18AHSZelw~ -$?6XQJC|ung 4=&/szahW^EL;2)  jcxqNG\U"+09%,7>mdvI@[R<5.' t}foPYBK 3:!(_VMD{ri`*#81FOT]bkpy(((((AAAAAABBBBBBEPTGMK0123456789ABCDEF0123456789abcdef #+3;CScs@@ !1Aa  0@``Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     WJ-WJL$J8WJCWJPWJ[WJoWJ|WJL$Jv7_dcache_inval_range1234567890-= qwertyuiop[] asdfghjkl;'`\zxcvbnm,./ 789-456+1230. ext4fs_devreadERROR: %s - start address is not aligned - 0x%08x ERROR: %s - stop address is not aligned - 0x%08x CPU: SUNXI Family usage: watchdog seconds 0 to disable watchdog %p: %08x watchdogSet watchdog. 0 disablesI2C: %s baudrateMMC: loadaddr### ERROR ### Please RESET the board ### fdtcontroladdrDRAM: bootargsmachidUsing machid 0x%lx from environment Starting kernel ... Resetting CPU ... pc : [<%08lx>] lr : [<%08lx>] sp : %08lx ip : %08lx fp : %08lx r10: %08lx r9 : %08lx r8 : %08lx r7 : %08lx r6 : %08lx r5 : %08lx r4 : %08lx r3 : %08lx r2 : %08lx r1 : %08lx r0 : %08lx Flags: %c%c%c%c IRQs %s FIQs %s Mode %s%s undefined instruction software interrupt prefetch abort data abort not used fast interrupt request USER_26FIQ_26IRQ_26SVC_26UK4_26UK5_26UK6_26UK7_26UK8_26UK9_26UK10_26UK11_26UK12_26UK13_26UK14_26UK15_26USER_32FIQ_32IRQ_32SVC_32UK4_32UK5_32UK6_32ABT_32UK8_32UK9_32UK10_32UND_32UK12_32UK13_32UK14_32SYS_32resetting ... WARNING: Caches not enabled %-12s= 0x%08lX arch_numberboot_paramsDRAM bank-> start-> sizebaudrate = %d bps TLB addrrelocaddrreloc offirq_spsp start FB base bdinfoprint Board Info structure## Starting application at 0x%08lX ... ## Application terminated, rc = 0x%lX resetPerform RESET of the CPUgostart application at address 'addr'addr [arg ...] - start application at address 'addr' passing 'arg' as argumentsbootcmd## Transferring control to RTEMS (at address %08lx) ... ## Transferring control to NetBSD stage-2 loader (at address %08lx) ... XIP %s ... Loading %s ... OK Uncompressing %s ... GUNZIP: uncompress, out-of-mem or overwrite error - must RESET board to recover Unimplemented compression type %d verify## Booting kernel from Legacy Image at %08lx ... Bad Magic Number Bad Header Checksum Verifying Checksum ... Bad Data CRC Unsupported Architecture 0x%x Wrong Image Type for %s command Wrong Image Format for %s command ERROR: can't get kernel image! ERROR: unknown image format type! Could not find kernel entry point! Ramdisk image is corrupt or invalid Trying to execute a command out of order %lxinitrd_startinitrd_endcmdline subcommand not supported bdt subcommand not supported prep subcommand not supported WARNING: legacy format multi component image overwritten ERROR: new format image overwritten - must RESET the board to recover autostartno%lXfilesizeERROR: booting os '%s' (%d) is not supported yesAutomatic boot of image at addr 0x%08lX ... bootdboot default, i.e., run 'bootcmd'bootmboot application image from memory[addr [arg ...]] - boot application image stored in memory passing arguments 'arg ...'; when booting a Linux kernel, 'arg' can be the address of an initrd image Sub-commands to do part of the bootm sequence. The sub-commands must be issued in the order below (it's ok to not issue all sub-commands): start [addr [arg ...]] loados - load OS image cmdline - OS specific command line processing/setup bdt - OS specific bd_t processing prep - OS specific prep before relocation or go go - start OSloadosramdiskcmdlinebdtprep\cechoecho args to console[args..] - echo args to console; \c suppresses newlineexitexit scriptext2loadload binary file from a Ext2 filesystem [addr] [filename] [bytes] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from ext2 filesystemext2lslist files in a directory (default /) [directory] - list files from 'dev' on 'interface' in a 'directory'ext4loadload binary file from a Ext4 filesystem [addr] [filename] [bytes] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from ext4 filesystemext4ls [directory] - list files from 'dev' on 'interface' in a 'directory'bootfile** No boot file defined ** Loading file "%s" from %s device %d%c%c ** Bad ext2 partition or disk - %s %d:%d ** ** File not found %s %d bytes read %X/** Error extfs_ls() ** ** Unable to use %s %d:%d for fatwrite ** ** Unable to write "%s" from %s %d:%d ** %ld bytes written usage: fatload [] [bytes [pos]] ** Unable to use %s %d:%d for fatload ** ** Unable to read "%s" from %s %d:%d ** %ld bytes read usage: fatinfo [] ** Unable to use %s %d:%d for fatinfo ** usage: fatls [] [directory] ** Unable to use %s %d:%d for fatls ** No Fat FS detected fatwritewrite file into a dos filesystem - write file 'filename' from the address 'addr' in RAM to 'dev' on 'interface'fatinfoprint information about filesystem [] - print information about filesystem from 'dev' on 'interface'fatls [] [directory] - list files from 'dev' on 'interface' in a 'directory'fatloadload binary file from a dos filesystem [] [bytes [pos]] - Load binary file 'filename' from 'dev' on 'interface' to address 'addr' from dos filesystem. 'pos' gives the file position to start loading from. If 'pos' is omitted, 0 is used. 'pos' requires 'bytes'. 'bytes' gives the size to load. If 'bytes' is 0 or omitted, the load stops on end of file.?alias for 'help'helpprint command description/usage - print brief description of all commands help command ... - print detailed usage of 'command'Error reading the chip. Valid chip addresses: %02X%04x: %02xError writing the chip. CRC32 for %08lx ... %08lx ==> Current bus speed=%d Setting bus speed to %d Hz Failure changing bus speed (%d) %08lx: Error reading the chip, %02lx %04lx %08lx ? i2cI2C sub-systemcrc32 chip address[.0, .1, .2] count - compute CRC32 checksum i2c loop chip address[.0, .1, .2] [# of objects] - looping read of device i2c md chip address[.0, .1, .2] [# of objects] - read from I2C device i2c mm chip address[.0, .1, .2] - write to I2C device (auto-incrementing) i2c mw chip address[.0, .1, .2] value [count] - write to I2C device (fill) i2c nm chip address[.0, .1, .2] - write to I2C device (constant address) i2c probe - show devices on the I2C bus i2c read chip address[.0, .1, .2] length memaddress - read to memory i2c reset - re-init the I2C Controller i2c speed [speed] - show or set I2C bus speedcrc32loopmmmwnmproberead## Total Size = 0x%08x = %d Bytes ## Raw upload complete ## Switch baudrate to %d bps and press ENTER ... loady## Ready for binary (ymodem) download to 0x%08lX at %d bps... ## Ready for binary (kermit) download to 0x%08lX at %d bps... ## Binary (kermit) download aborted ## Start Addr = 0x%08lX ## Switch baudrate to %d bps and press ESC ... load binary file over serial line (ymodem mode)[ off ] [ baud ] - load binary file over serial line with offset 'off' and baudrate 'baud'loadbload binary file over serial line (kermit mode)dumpasciiprint raw ascii data[ off ] [size] - save S-Record file over serial line with offset 'off' and size 'size'CRC32 for %08lx ... %08lx ==> %08lx Base Address: 0x%08lx Tested %d iteration(s) with %lu errors. Pattern %08lX Writing...%12sReading... Mem error @ 0x%08X: found %08lX, expected %08lX Zero length ??? bytehalfword%s at 0x%08lx (%#0*lx) != %s at 0x%08lx (%#0*lx) Total of %ld %s(s) were the same %04xmtestsimple RAM read/write test[start [end [pattern [iterations]]]]infinite loop on address range[.b, .w, .l] address number_of_objectsbaseprint or set address offset - print address offset for memory commands base off - set address offset for memory commands to 'off'checksum calculationaddress count [addr] - compute CRC32 checksum [save at addr]cmpmemory compare[.b, .w, .l] addr1 addr2 countcpmemory copy[.b, .w, .l] source target countmemory write (fill)[.b, .w, .l] address value [count]memory modify (constant address)[.b, .w, .l] addressmemory modify (auto-incrementing address)memory display[.b, .w, .l] address [# of objects]OKERRORNo MMC device available rescanno mmc device at slot %x partget mmc type error! listdev#part_num shouldn't be larger than %d Card doesn't support part_switch switch to partions #%d, %s mmc%d is current device mmc%d(part %d) is current device erase MMC %s: dev # %d, block # %d, count %d ... %d blocks %s: %s YesNoDevice: %s Manufacturer ID: %x OEM: %x Name: %c%c%c%c%c Tran Speed: %d Rd Block Len: %d %s version %d.%d High Capacity: %s Capacity: Bus Width: %d-bit mmcMMC sub systemread addr blk# cnt mmc write addr blk# cnt mmc erase blk# cnt mmc rescan mmc part - lists available partition on current mmc device mmc dev [dev] [part] - show or set current mmc device [partition] mmc list - lists available devicesmmcinfodisplay MMC info- dislay info of the current MMC deviceNot implemented yet ## Warning: defaulting to text format ## Info: input data size = %zu = 0x%zX ## Error: bad CRC, import failed ERROR: Environment import failed: errno = %d at %s:%d/%s() cmd_nvedit.c## %s: only one of "-b", "-c" or "-t" allowed ## Warning: Input data exceeds %d bytes - truncated ## Resetting to default environment Saving Environment to %s... %s=%s Environment size: %d/%ld bytes ## Error: "%s" not defined stdinstdoutstderrCan't delete "%s" serial#ethaddrCan't overwrite "%s" ## Baudrate %d bps not supported ## Switch baudrate to %d bps andpress ENTER ... ## Error: illegal character '='in variable name "%s" ## Can't malloc %d bytes ## Error inserting "%s" variable, errno=%d setenvERROR: Cannot export environment: errno = %d at %s:%d/%s() %zXenv_buf [%d bytes] too small for value of "%s" runrun commands in an environment variablevar [...] - run the commands in the environment variable(s) 'var'set environment variablesname value ... - set environment variable 'name' to 'value ...' setenv name - delete environment variable 'name'printenvprint environment variables - print values of all environment variables printenv name ... - print value of environment variable 'name'environment handling commandsdefault [-f] -a - [forcibly] reset default environment env default [-f] var [...] - [forcibly] reset variable(s) to their default values env export [-t | -b | -c] [-s size] addr [var ...] - export environment env import [-d] [-t | -b | -c] addr [size] - import environment env print [name ...] - print environment env run var [...] - run commands in an environment variable env save - save environment env set [-f] name [arg ...] saveenvsave environment variables to persistent storagedefaultdeleteexportimportprintsaveBad magic number Bad header crc Bad data crc Bad image type Empty Script Wrong image format for "source" command ## Executing script at %08lx sourcerun script from memory[addr] - run script starting at addr - A valid image header must be present!-o-a-z-n!=<-eq-ne-lt-le-gt-getruedo nothing, successfullyfalsedo nothing, unsuccessfullyminimal test like /bin/sh[args..] %s arm-linux-gnueabihf-gcc (Ubuntu/Linaro 4.6.3-1ubuntu5) 4.6.3 GNU ld (GNU Binutils for Ubuntu) 2.22 print monitor, compiler and linker version %s %s %llu bytes read %llXzfsloadload binary file from a ZFS filesystem [addr] [filename] [bytes] - load binary file '/DATASET/@/$dir/$file' from 'dev' on 'interface' to address 'addr' from ZFS filesystemzfsls [directory] - list files from 'dev' on 'interface' in a '/DATASET/@/$dir/'%s - %s Usage: %s - No additional help available. %-*s- %s Unknown command '%s' - try 'help' without arguments for list of all known commands sun4i#Unknown command '%s' - try 'help' 'bootd' recursion detected In: No input devices available! Out: No output devices available! Err: No error devices available! *** Warning - %s, using default environment Using default environment env_common.c!bad CRCERROR: Cannot import environment: errno = %d at %s:%d/%s() !import failedNo MMC card found MMC init failed env_mmc.cWriting to MMC(%d)... done syntax error ** Abort *?[\ERROR : memory not allocated %uERROR: There is a global environment variable with the same name. %s: readonly variable%s=%sIFS \$'";&|#HUSH_NO_EVALUnknown command '%s' - try 'help' or use 'run' command ;$&|exit not allowed from main input shell. HUSH_VERSION0.01showvarprint local hushshell variables - print values of all hushshell variables showvar name ... - print value of hushshell variable 'name'thenelifelsefiforwhileuntildodonebootm_lowbootm_sizebootm_mapsize%d Bytes = Unknown OSUnknown ArchitectureUnknown ImageUnknown Compression%sImage Name: %.*s %sImage Type: %s %s %s (%s) %sData Size: %sLoad Address: %08x %sEntry Point: %08x %sContents: %s Image %d: %s Offset = 0x%08lx -## Loading init Ramdisk from Legacy Image at %08lx ... No Linux %s Ramdisk Image Wrong Ramdisk Image Format ## Loading init Ramdisk from multi component Legacy Image at %08lx ... initrd_highramdisk - allocation error Loading Ramdisk to %08lx, end %08lx ... Invalid OSlinuxLinuxnetbsdNetBSDoseEnea OSErtemsRTEMSu-bootU-BootInvalid ARCHalphaAlphaarmARMIntel x86ia64IA64m68kM68KmicroblazeMicroBlazemipsMIPSmips64MIPS 64 Bitnios2NIOS IIpowerpcPowerPCppcs390IBM S390SuperHsparcSPARCsparc64SPARC 64 BitblackfinBlackfinavr32AVR32nds32NDS32or1kOpenRISC 1000aisimageDavinci AIS imageFilesystem ImagefirmwareFirmwareflat_dtFlat Device TreekernelKernel Imagekernel_noloadKernel Image (no loading done)kwbimageKirkwood Boot ImageimximageFreescale i.MX Boot ImageInvalid ImagemultiMulti-File ImageomapimageTI OMAP SPL With GP CHpblimageFreescale PBL Boot ImageRAMDisk ImageScriptstandaloneStandalone ProgramublimageDavinci UBL imagenoneuncompressedbzip2bzip2 compressedgzipgzip compressedlzmalzma compressedlzolzo compressed%.*s%*s ** Too many args (max. %d) ** bootdelayHit any key to stop autoboot: %2d %2d serialCksumxyzModem - %s mode, %d(SOH)/%d(STX)/%d(CAN) packets, %d retries Unknown errorBlock sequence errorCRC/checksum errorInvalid framingCancelledEnd of fileTimed outSorry, zModem not available yetCan't access file(%d:%d) Vendor: %s Prod.: %s Rev: %s Model: %s Firm: %s Ser#: %s Vendor: %s Rev: %s Prod: %s device type DOC device type unknown Unhandled device type: %i Type: Removable Hard DiskCD ROMOptical DeviceTape# %02X # Capacity: %ld.%ld MB = %ld.%ld GB (%ld x %ld) Capacity: not available Partition Map for IDESATASCSIATAPIUSBDOCUNKNOWN device %d -- Partition Type: %s DOS## Unknown partition table ** Bad device specification %s %s ** ** Bad device %s %s ** bootdevice** No device specified ** auto** Bad partition specification %s %s ** ** Bad device size - %s %s ** ** No partition table - %s %s ** ** Invalid partition %d ** ** No valid partitions found ** ** Invalid partition type "%.32s" (expect "U-Boot") FATFAT32 Extd Boot** Can't read partition table on %d:%d ** bad MBR sector signature 0x%02x%02x %5d %10d %10d %2x%s%s hd%c%dsd%c%dusbd%c%ddocd%c%dxx%c%dPartition Start Sector Num Sectors Type Status Error: 0x%08X Timeout waiting card ready MMC Device %d not found Caution! Your devices Erase group is 0x%x The erase range would be change to 0x%lx~0x%lx mmc erase failed MMC: block number 0x%lx exceeds max(0x%lx) mmc write failed mmc fail to send stop cmd Man %06x Snr %08x%c%c%c%c%c%d.%dMMC: no card present Card did not respond to voltage select! %s: %d%c SUNXI SD/MMCWrong mmc number %d ** Can not find directory. ** Extent Error ** SI ext2fs read block (indir 1)malloc failed. ** ** SI ext2fs read block (indir 1):malloc failed. ** ** SI ext2fs read block (indir 1)failed. ** ** DI ext2fs read block (indir 2 1)malloc failed. ** ** DI ext2fs read block (indir 2 1)failed. ** ** DI ext2fs read block (indir 2 2)malloc failed. ** ** DI ext2fs read block (indir 2 2)failed. ** ** TI ext2fs read block (indir 2 1)malloc failed. ** ** TI ext2fs read block (indir 2 1)failed. ** ** TI ext2fs read block (indir 2 2)malloc failed. ** ** TI ext2fs read block (indir 2 2)failed. ** invalid extent block < ? > %10d %s Failed to mount ext2 filesystem... %s read outside partition %d ** Invalid Block Device Descriptor (NULL) ** ext2fs_devread() read error ** ** %s read error - block * %s read error - last part FAT32 FAT12 FAT16 FAT: Misaligned buffer address (%p) Invalid FAT entry error: overflow occurs error: wrinting directory entry Error: reading directory block Error: %ld overflow Error: clearing FAT entries Error: writing contents Error: flush fat buffer Error: writing directory entry Error: finding empty cluster ** Partition %d not valid on device %d ** UError: FAT sector size mismatch (fs=%hu, dev=%lu) %s%c %8ld %s%c %d file(s), %d dir(s) Error reading cluster No current device Interface: Unknown Device %d: No valid FAT fs found Partition %d: Filesystem: %s "%s" reading %s writing %s Can't list files without a filesystem! %s/%sCan't load file without a filesystem! ** zfs_devread() read outside partition sector %d ** zfs_devread() read error ** ** zfs_devread() read error - block ** zfs_devread() read error - last part zfs unknown checksum function %d zfs incorrect nvlist header empty nvpair couldn't find a valid DVA compression algorithm %u not supported compression algorithm %s not supported incorrect dnode type: %02X != %02x incorrect dnode type too small osp bad ZAP magic bad ZAP flags bad ZAP salt external pointer tables not supported ZAP leaf is too small unknown ZAP type couldn't find '%s' invalid leaf type invalid leaf magic invalid chunk number invalid chunk entry invalid leaf chunk entry zfs fsname = '%s' snapname='%s' filename = '%s' root_datasettoo new ZPL version ROOTcan't resolve .. not a directory zfs failed here 1 zfs failed here 2 zfs failed here 3 zfs failed here 4 invalid uint64 invalid string trying to lookup past nvlist array incorrect nvlist array statezfs pool state not found zpool is marked as destroyed txgzfs pool txg not found zpool is not active zpool config version not found SPA version too new %llu > %llu vdev_treeZFS config vdev tree not found ashiftZPOOL config ashift not found ZPOOL config guid not found pool_guidZPOOL config pool guid not found ZFS Pool GUID: %llu (%016llx) Label: GUID: %llu (%016llx), txg: %llu, SPA v%llu, ashift: %llu zfs error checking label %d zfs error reading uberblock ring for label %d invalid uberblock magic uberblock rootbp points to invalid data zfs No good uberblocks found in label %d couldn't find a valid ZFS label couldn't zio_read object directory osp too small Missing @ or / separator not a file filesystem is corrupt :( @inheritlabelgang_headerzilogfletcher2fletcher4SHA256zilog2lzjbemptygzip-1gzip-2gzip-3gzip-4gzip-5gzip-6gzip-7gzip-8gzip-9lzjb decompression failed %llu Bytes%s%lu.%ld %ciB%s %0*x %s 1.2.3Error: inflateInit2() returned %d Error: inflate() returned %d Error: Bad gzipped data Error: gunzip out of data in header Env export buffer too small: %zu, but need %zu himport_r: can't insert "%s=%s" into hash table WARNING: '%s' neither in running nor in imported env! WARNING: '%s' not in imported env, deleting it! ERROR: Failed to allocate 0x%lx bytes below 0x%lx. .%03ld(null)%s:%u: %s: Assertion `%s' failed.invalid distance too far backinvalid distance codeinvalid literal/length codeincorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid literal/lengths setinvalid distances setincorrect data checkincorrect length checkneed dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionBoard: A10-MID-1GB raise: Signal # %d caught   JJTJJ JtJJtJJ\JhJ JL$JL$JJL$JL$JJL$JL$JJL$JL$JJ L$JL$JJ@L$JL$J JL$JL$J J4JL$JL$J J7JL$JL$J J1JL$JL$J!J7JL$JL$J!J3JL$JL$J!J7JL$JL$J !J1JL$JL$J!J0JL$JL$Jw J0JL$JL$J J5JL$JL$J@1JSJL$JL$J1JtQJL$JL$J1JZJL$JL$J1JQJL$JL$J1JhUJL$JL$J .JJL$JL$J1JTJL$JL$JVJYJL$JL$JP[J[J[J[J[J[J [J [J([J([J0[J0[J8[J8[J@[J@[JH[JH[JP[JP[JX[JX[J`[J`[Jh[Jh[Jp[Jp[Jx[Jx[J[J[J[J[J[J[J[J[J[J[J[J[J[J[J[J[J[J[J[J[J[J[J[J[J[J[J[J[J[J[J[J[J\J\J\J\J\J\J\J\J \J \J(\J(\J0\J0\J8\J8\J@\J@\JH\JH\JP\JP\JX\JX\J`\J`\Jh\Jh\Jp\Jp\Jx\Jx\J\J\J\J\J\J\J\J\J\J\J\J\J\J\J\J\J\J\J\J\J\J\J\J\J\J\J\J\J\J\J\J\J]J]J]J]J]J]J]J]J ]J ]J(]J(]J0]J0]J8]J8]J@]J@]JH]JH]JP]JP]JX]JX]J`]J`]Jh]Jh]Jp]Jp]Jx]Jx]J]J]J]J]J]J]J]J]J]J]J]J]J]J]J]J]J]J]J]J]J]J]J]J]J]J]J]J]J]J]J]J]J^J^J^J^J^J^J^J^J ^J ^J(^J(^J0^J0^J8^J8^J@^J@^JH^JH^JP^JP^JX^JX^J`^J`^Jh^Jh^Jp^Jp^Jx^Jx^J^J^J^J^J^J^J^J^J^J^J^J^J^J^J^J^J^J^J^J^J^J^J^J^J^J^J^J^J^J^J^J^J_J_JUJEJ9J9J89J9J 9J9J9J 9J ,J 9J 9J ,J,J,J!@#$%^&*()_+ QWERTYUIOP{} ASDFGHJKL:"~|ZXCVBNM<>? 789-456+1230. 13457890=    ;'~ <>?789-456+1230. /RJWJOJ JxJRJxJRJSJăJ SJJSJxJSJ$SJh {f0ȠJJJL$J JJ JL$Jw JJ} JL$J JJ J JkJJqJL$J#<JJqJL$JJ %JJJJ((JJJ=J(JBJL$JNJ)JWJJJ,)J"JHJJT)JJJrJ@)J"JyJyJT,JJJ/J.J7JZJJJ"J"J#J>J#J"JE#J:JO#Jd#J%JCJ %J$%J JEJI%Jh%J%JCJ%J%J JCJ&J4&Ju&J\GJy&J&J&JFJ&J&J!JHJ&J&J!JhKJ'J/'J!JpKJD'J/'J JTIJn'J}'J)JxKJ)J)J*JOJ*J*J .JJ$.JL.JjJ-JYJ.J.JjJ%/JhUJ./JJ/JjJ1JQJ/J/J1JTJ1JL$J2J`_J2J2J3J_J3J63J_J<3J%J_JW3Jq3JWJ dJ3JL$J74JdJ?4Jf4J 5JfJ"J5J8JJ9J$9J J$J(J,J0J4J8JJDJHJLJ JJJJ(JJJJJJJJJJJJJJJJJJ,J4JJJJHJdJJJJJJJJJJJJJJ$JDJdJJJJJXJ\J`JdJhJlJpJtJxJ|JJJJJ4JxJJJJJJJJ J$J"J"J"J"J"J"J"J"J"J"J"J"J"J"J"J"J"J$J$J%J%J%J %J%J%J%J%J'J'J'J'J'J'J'J'J'J(J(J (J$(J(J)J)J)J)Jd+Jh+Jl+Jp+Jt+Jx+J|+J+J+J+J+JH,JL,JP,J@-JD-JH-J.J.J.J.J.J.J4/J8/J/J/J/J/J0J1J1J1Jp3Jt3Jx3J|3J3J3J3J3J|4J5J5J5J5J5J5J7J7J7J7J7J7J7J7J7J8J8J9J9J9J9J9J:J:J;J;J<<J\<J<J<J<J>JBJBJBJBJBJBJBJBJBJBJBJBJBJBJBJBJCJCJCJCJCJ|EJEJEJEJEJTGJXGJHJHJHJHJHJHJPIJJJJJLKJPKJTKJXKJ\KJ`KJdKJHOJLOJPOJTOJXOJ\OJ`OJdOJhOJlOJpOJtOJxOJ|OJOJOJOJOJOJOJPJPJPJPJPJPJPJPJPJPJPJPJPJQJQJQJ QJQJpQJQJSJSJSJSJSJSJSJSJSJSJTJTJTJ`UJdUJUJUJUJWJWJWJWJWJWJWJWJWJWJWJWJWJWJYJYJYJYJYJYJZJP\JT\JX\J\\J`\Jd\Jl\Jp\J\J]JP^J@_JD_JL_JP_JT_JX_J\_J_JcJcJcJcJcJcJcJdJdJdJ dJdJdJdJdJHdJLdJPdJTdJdJdJdJdJdJdJdJfJfJfJfJfJfJfJfJfJfJpgJtgJhJhJhJjJjJjJjJnJnJoJoJoJ oJ\oJpJ pJpJpJpJ qJLqJtqJqJTsJlsJ|sJsJtJtJtJtJtJtJtJtJuJuJvJ(vJvJvJyJyJ~J~JJJHJLJPJTJJJ؅JJJJĆJȆJ̆JІJԆJ؆JJ JԇJ؇J܇JJJJJJJJJ<J@JlJJJJJĊJȊJЊJԊJJJJJJ JJJJJ J$J(J,J0J4J8J<J@JDJHJJJJJJ8JhJJ0J4J8J<J@J`JpJtJ$J(J,J0JJJJXJJ`JdJhJlJpJtJ\J`JdJ`JdJhJlJpJtJxJJJJJJJJJ<J@JDJJ\J`JJȮJ̮J JJ$J(J<J@JTJXJJJJJJJİJȰJ̰JаJ0J4JHJLJ`JdJxJ|JJJJJJJJijJȳJ̳JJJJJhJlJ<J@J,J(J,J0J4J8J<J@JDJJJJJJJJJJJJJJTJJJJJ,J JJJJJ J$J(J,J0J J`JJlJtJxJ|JJJJTJ\J`JdJhJJJJ(JlJpJtJxJJ(J,JJJJJJJJJJJJJJJJJJJhJlJpJtJxJ|JJJJJJJJJJJJJJJJ JJJJJJJJJJJJJJJJTJXJJJJ JJJJJ J$J(JJJJJJJJJJJJJJJJJJJJJJJJ JJJHJJ,JJ J JJJJJ J J$JJJJJJJJdJJ|JJJJJJJJJJJJJJJJ J$J(J,J<JJJJJJJJ J$J(J<J@JDJHJLJxJJ J J J J J\ J| J0J4JhJlJPJTJXJ\J`JdJhJlJpJtJxJ|JJJJ`JdJJJJJJJJJLJPJJl!Jp!Jt!Jx!J|!J!J!J!J$J%J&J&J&J|'J(+J,+J+J+J0,J1J2J2J;J;J;J;J;J;J;J;J;J;J;J;J;J;J=J =J=J=J=J=J HJ$HJ(HJ,HJ0HJ4HJ8HJ@HJDHJHHJLHJHJHJHJHJHJHJHJHJIJIJIJIJIJIJIJIJIJIJIJIJIJIJIJJJdJJ|JJhLJlLJpLJLJLJ$MJ(MJ,MJ0MJMJMJMJMJMJOJOJOJOJOJOJRJRJ0TJ4TJWJhYJlYJpYJh]Jl]J^J_J_J _JcJcJcJiJiJiJiJiJiJiJiJiJiJ4pJ8pJ! D7 D!l<dv$HzHz!(Ĥ(!)!x! z!bԡb!c=c"b,4c"4c"X,". "lނ $"H,"x4"1<"$JD",,#885H8|66`7xxddP/&du'du'du'du 'du('dduP,2@X'4H X)`)X)h)X)ee`)ee((p)X)p)(t)(|)|)|))T)))T < *P  044'nativelK424DXnativelKț'DXl-x--$7ȷĂ H | \z($7Ă kh䰂]z mY V\_LLh$7 xu xt $ l n$gdZ(Y|d=e4\exe|$7 $4$7lj у@Ii c lEx] {4vLum`Ă䯃t dd t p0b` P\$7a0`$7HXy\ q$7P  z l} J4$7$7d Ԃ(p\$7$7d$$7$7$7$7$7$7o$7 Ȍ $7 lRV$7P$7$7`Dly`q,{\Ndh$7$7$7$7$7$7$7$7$J$7$7$7$7$7$7$7$7$7$7$7$7s$7$7$7@$7$7$7$7$7$7$7HHtF$7$7$7$7$7$7@$7$7$7$7$7$7$7(di <$7 L$7K[XQLT$7$7$7 $7$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7 $7  S8 L$7$7$7$7$7$7xo$7$7lGEt$7$7$7$7$7$7$7$7$7   ` $$7 TD~$$7$7$7$7$7n$7$7$7$7췂 !X8$7$7$7$7Tkj$7fXV$7j HN 0lm,zcdP i th$7$7$7 (0PȆ4Ptl&&&&P*& 8' p3333333333p633!344 4$4,40484@4>Dk4k>>>>>>$???yyyz׋dыONNHk L)s$SPr<,\EZ8REpEdELO,OT\HWdU nMSFONNkLpmPr<, H(LL nܤLONNk`pmPr<,LPLL0 nlLh(GhG(GH(G@H ... ...ONNHP܌̈sڌ،ی\EXL׌݌dEL(0݌،ތXߌM݌ONNPLpm،ی H(LL،ܤLONNm`pm،یLPLL،lLh`48G),3|2,8GCޏt8GlĬDŠ݊8GpTH8G:{TH<^E8G<.8G+h8G, 58G)TH8GTH8GpTH` D8G@@  XdXGGIIIIIGGI>?? ' ` ~ ^ "' ,AAA AA'CEEEEIIIINOOOOOUUUUYaaaa aa'ceeeeiiiinooooouuuuyy"A"E"I"O"U"a"e"i"o"u"yA^A`A*A~ACE^E`EI^I`I~NO^O`O~OU^U`UYa^a`a*a~ace^e`ei^i`i~no^o`o~ou^u`uy8Hwy(Pw,'LP$TXDHޓٓړp?pB mm mmb8d0X(l\\USB audiouaudioH/p/03`1.ౙ|} }(}8}H}X}h}x}}}} } }#}'})}+~*~(~8~H~X~h~x~~~~~~~~~(8HPX`hpx (08@HPX`  btbbbb؀  % 3u Du u <u 8u 2u 0&'u 1&u 0&u     )%uu 0 1 8%u   3 D D%uu < 8 2u 0&'u 1&u 0&u  P؀仗ȵ””A”+ ”,l*dP(@ę# # řTř4șș{{ștəə4X(xH˙4<|˙ X | @̙$<|t̙T!%#L'D&L͙,H10-@-ΙQ(MpID;>@4h:87 :\66ϙdЙ :5hv1! !vvvvvvv3 P q q2vqqqqCW 2D k"{"{"3" dAdAW 2]\ \ ;  hЙxЙЙЙQЙЙЙЙљљ0љLљhљљ`֙֙4 ܃֙'@ P'@'  '@'@'@'@'@'@@' @' @'@ @' @' @' @'@ @֙@$֙@@%֙@&'@'@@'@'@CB H('@vw` @''̖KlƖp08 H8ؖ'8ޖ'8 '8 '||'xL֙' l t | |T'd` '@H ' H(1H%( I&(1H(I( I(@I (`I!(I"(@1H (IJ( HSܙ H'`0J @JJ H( J(1J(PH(pH(H (H!(H"(@1J (HJ( HSLJ@JM'D $(D ' H0(I 8(HD8( HE(PD (DH(pD`(Hb(H (H>(H@(H@(J@(P(X(`(h( ^^h(h(t(|(ܙ (((((((((@7` 8@'(ܙ@&ܙ'P(X(h( ^^h(h(t(|(ܙ (((((((((@7` 8@'(ܙ@&ܙ'L.symtab.strtab.shstrtab.text.start.data.openbsd.randomdata.sbss.bss.arm.atpcs !0j(,P.,,j$B00jH00jWM0j0jX@j  ilv,00   d0Z"lp-T84NDY(p4y }G`ՐL4@,A( ,Lm $4|A8$\hXt|{(|TXX pR )T=D'&9rLS^Ȅq̚0~6l tMYXτ,(p8d@C\4!Zd2:94(H-Td_dAl%ùDDP0lڃ`d@78$)|6d=D,Q^|Hl(\v p<dh:`L! ^7$8|1?YJpSsz C[ޒh}ttt@$h D3@0!L0F?hjdNDw8^Ĉ|n,:|Ԃ4če(TP.:4D`(:9lBKlKޗTl=dH\n\~1H_`AB47l؃hPXLtl؀ &(~*2dB(IQp]) xÉ h\yT:  Ӓ- `7 HhlL [ v\t u}  ԅL 8  t 8+p 0 (G  $ p2 t^F LdPQ Std x0hk l  @4 pM XD$  L.   < |X+ 6 = ܙT] @m  X  hE (`    >  l_< @ȂX (| 5 PRA ;8K tV d Dm  E ܾP P C tL  Px *Hd'Hޗ14:.IlHS(hgऔPsm<t\P蹂P8)HTDhy$ԏ)0 $8TnLtfL0y(ؗ P0QLHHt:4@D$EX4>tO_,j|q (~(D@ n0'ɔF 4l&PX;XNrDY<d$Hmh׈ Pއ@3uht~+ :APH=Qx?<b1l|ԕu8aڑ$XkP==lX l Zh)-(3t9<>LHT$bn#t%X/H`K`(ŔxlE4 ,<(/;V@H x PHf$s4d0dtL!H<k0p$./: wHJ IT a |l X(y @ p  p_ x "< | 0Hd 00! P(!ؔ*!l "t*"غH"V"i"Yq"&"Љ"LM"` "s"dF"0o"ӊ0"ʕ"##E$#p0$#mH5#K#([#b#0u# #@Np##謊#|)p#(,#p##<$$e"$P6$ɃJ$-[$,M e$fn$ $4!($dH$L'$<{t$4$8b$,$al$ iP%J%V<%` "%,+%(7%\tG%XmU%c%n%%+0%8Ll%<ю%ɑ%A%5%ր`%d1%@&* &x؁+&9&ٖO&a&dE j&C{&@&Mt&Ld&P&%&0t&pυl&DM&Tkl& z'@,,'0݌t#'.'|:'8ޔM'Xx['lGj'}`t'pE'X'\6p'lߑL'ܺ|'|,'07'ؑ0'(H (4d2(+DB(0wP(|E c(TȔq(<}(8э$(Xt(<((ȓ((Ĕ(w8(x4( @(c$(DŽ)d*)ϑ#)7)u$K)n\){g)`})|P) :\)!T) `) )()p)`Ð,)p)!d*h *dv*2<)*|00*>(A*(TR* F]*\q**`y*,ąL**൑,**4*td*r+l0 +訁h+4i!+`-+lɍd;+rL+lXZ+X8p+"+1+Q+`+G++ĂX+<+0+D9+D!+\,Pl, L", H,,d<,QI,|w\,Hk,mxz,, ,G,D,셇X,,h ,E|,&-%<-Ox )-@_6-`Ă<@-sK-HpZ-Dc-ˆn-D}-x-d|-אx-a<-t--\N-L4 .l$. /.D:.ZJ.&R.CZ.t;f.,n.,6z.<,p.$(.}h.`.I.H..z.@.t(.܈/h:@/8/T1/\0=/ N/a/Tj/Lx/@/Dd//c@/͎/xxD/T /1//l/y000h020䤑0D0GY0x;`0q0(0040X"@08ϔ0I@0 0@L0(111 $1<=1J1U1`1xՀ(u1d_}1@141Ζh1,1LԂ01J1z 1li1;DL;T;W$b;T<q;H=;|;;ރ;f(; ;' ;4;p;pP;;Tkt;< <ȕ.<D@4<qp?<R<xǍ,h<w<ޏL <<<Ā<<tt<u|<<<(x<\0 = = l1=n@G=,4T=dՎdd=4t=8==?=JP=̀l=$=h<=0ۃX=d==>+|>t!>hG.>05>Q> f_>DDd>$t> .y>@ >Pހh>>|>,>Hd>>l>ЖH>X>0k ?P?쌑#?4? /;?pP?\ b?Xz?R7?L?G?T?9,?É??X?py@@D@p,%@Lߖ2@ A@M[@1Xd@tq@`E@쫕@ @(WP@`@du$@쉑@4@,5@EAPA؈LA@Y2Ap?A RAƊ\AL{hAXxtAHi0AtAȑPAHAtǃ|AI@AܒAAH@AHAapB {B4Bt(&B' 5B(HBxSBHM\B݌(lBdؗ ~B(`BOB$g(BPB:B,lBXBD*B(BԋdBՌ C CBh+C,13Ct=ChCCӃOCT]CSiClƖuCxCU(CoCtaCC@CDCd0CL%xCD4DoDD-D4DGHD$gdfD,ҏrDT4yDj|DBDD,DT`D|DTḎHD| EEPږ +Ep>ET LSE<<^E 1gE| pEȉ({E*E8E<EBlEoEHE|=EwdEhELF\ #F)0FU:F$tCF 2JFVFP^F X0kF/qF |FF,F.FF\Fl7FF0FFF0Ȑ GG3GD@GP MG4D[GiG$ʍ`{GGGlLG\xGLtGՀGfG,:\GGdGx(H"Hٓ.H DHHx0^HPhHrHP\H<4H4 LH<HHHpƂXH$$HHspIh`I9I@*IZ5Ix0GI\+4`I%prIx}II&I( IӉI^4I(I-II[IIJՏ4JxXJ*$)J43JrBJlÏ0PJо`J$kJzHJHيJdJJtoJ8X J܁J)dJ?JJK$K8"Kچx(K60KƂ?KXYKxiKǑD{K8K3 KhޒKc<KKK6DKTKMdLhLLT+L>LwKL)\LmL`LLx L|L@LTLeLLǏDL&L@hMuM uM,$M, 3MODMlSM، fM.tM䙑L~MhnMnTMlM4M@MHdM@M(hM NNP}1N<=N|gMNXN蜀PjNлrNP}NDNFxNxNԿ@NtN}N NhXNɑO O\/O ;O yNOD1WOUT!U4U$U\VV #V|/V6AV;NV eV| pVnp~VvHVTVV|xVJVhV b V uWLWD,WP WпDW0WWlGWxW7@WxuWWqXx X$*X(@3X$ =XHXQXז\hXh0oXDX*pX8qX X4XX-pX-X(Y( YYl,Yܳ;YGY0YY4,fYl{YP'YGYֆYH8DYYX݂XYN@Y|?xY܌YXUZZ쪉@Z0u4+ZL3P6ZȎxJZ:YZdP(fZ|*pZDyZD |ZpҊxZӓ$Z14Z}Z )Z0 Z Z0 [Pق@[lނ("[̃,[@,F[8W[m[7 z[$L[dP[[,[[L|[<[ۉ\%L\҄\G/\8:\ ۑQ\~Y\e\30s\yt}\\\ז8\D\ ٍ\\ \@\ؐl\tχl]\]']tp?]L,N]h<Y]tb] )H],]]t7l]B]$]].],]T] l^5^\($^1^$\C^ [^hdg^Jpo^ ^\^X^`;^΃^쬔\^3t^|Q^R^H0_D_p|t#_85_cPJ_S_xd_dKo_4~_D _ _]_ޖp_ _ȳ`_H_ _( `,``,`ϕ6`Ԏ B`GPQ`/He`tw`t`4`$``Օ,`tT`pĐ``ܮ`u``IaaDa߆#a01apt:aL<Ua]aX$baDna8aaaGàda@؈haWLadadbԶX bb 2bhJb,eVb$>]bDpbtbbobbbbjbKXbXTb+c࿒c@%c‰p2cאxAc0ЖRc$bcp֑hoc(f<cclX cXcCcchJTcPcct4d dȱDd1d4J9d\Gd8~HVdф_dkd\րTyd$xddddhdX>d d`dړeć(eKeI,+eBe؏<Retm\e$|jeTe̍eԈeepee$e2ey ed= f f|*f@03frXIf ",Wfcf(dvf8fLLf؟DfȸfHf< f诗@f1gX gAgDL/g@;gXEgX^g芆@ig.xgHgEDg, gxxgHggЎgm@gl|h<߃h蛇<&h)5hдAhLXhNih oh`uuhPF@h h:h0hljh֖hl$h$hغi i i`Ҕ'iȞH3i<Di$4\iItoi~i\i4PipiPilEi` i@AxiXd|iԑj_ jj|2-j s=jLIjl%4Tjs[j<hj`tjdj.Dj$Kj|DjH j`j%|j8qxjGjDjjgt k!k3k^BksYkތgk pkࡇklk :lkXkY<k$k1k.k<ьk<@k԰d l\ll 0l@ldKlTWlҁbl dsl}lH`l0l`*l$ lllv &tHvQv$ӏ]vX,gv;xovvv4spvGvv|DvЕvdTvl1vnwh0w w8r0w໌Dwp@Xw1iw&vwpmXwLwt w(^wpw<(ww$#wx<xpےx-xDm4xEx<Rx_pexŀvx|4~x}xVDxĜ0x6x ؂`x|DxČtxxy,yܖyL>@.y@ynMymyy yytyp xy4yy迃4yppyvzǁxz”l'z5zBzNz&\zXizxuzczztzH͆z4zhzDHzAtzȒzv|z@-tz؈{D{F\!{p؉.{'HA{LxP{l1[{֕f{u{({{{{s({,vd{p{ԑ({ g<{X{ p||x|ևL*|8 4|<?|XQ|tɓd||v|a0|A|R |tV|LH|,|LqX| |Dp}Г}  }80/}!$B}\_U}l\},~$i}[Xx}} }v}}pH} `}č@}~ 0 ~W4~~h!(~00~$G~\$Z~h0l~ Tt~3ty~ӂ~%~~~8~Hd\~~{~φ4~N@~~l~D8 40,^$$+T8:M.Yphq̺8@9XĿxєڌ0蒉PT$xZP8`آ #dY\4Da=GK@V`͍tgȊ8sȌ}TtӃ|P' ɍL/lˀ)8ۀ M9c<h$̒T2ACI88Y( gDxp"K\PQ,8p8ȁ܁ՁH@:\Y8" 4L+@:ԂC\X @fʇn؂D|^(@(.ςR0ނTȂt&˓L6f(BXr,Sc8p9}dxDqHpOƃh>Ѓt܃ف k4KL .0,ف\ExSܖl_ylawŊ\CD(MT \THӅr  p< XT &Ɍ4440CƐ^llĽsߊH080sŎP ƑxІS ݂8ر D"4L. m;P4F0ԔtV,aʑs<Hp<DčdӇ`y$lW h˕8T.9p*MŇZP@vQD6|8̈x4Ԉl,/W$<LFdPUH^}kpDw @jH4Pƕ$L0ˉ/Pm0C`< X*>9|. G 4Q1 e`KTs$zTǂ4.D$0 Ɗ,2ΊD׊@P ,ԓd\p,z:LȌpLle/pdH ,O`$T]Ę`䶁$ˋHe؋ DhPXl,t\3=`<DOH@][gDyd1\2<Ì4>ӌH@یP$'րT' 54GfO\ UD_=t(&\L4Ed@HH\pTō$ύ`ٍ|lŐ4p l+ΐ$1A2L tVԟxd_n|]xx |0-=)D1K&WLo{ 4P XÔڔPӖd'0< _\06m4A8R,Z<i<~P،H3P4ĕʓԕ80ەÐx"$l4А& 1 @BXpNcqъ8 xD4LĖ@Ζ ǃhږt(P\\N (2,=`EQD[(hΑu (:6×olޗdr$kP[Wp <.t9UD HKU4lTivD?,4?\@ O@>Ø<ɘט" ȎΏ, x`4DEPq@hx ْP2PjĝT͝ƍߝt|T@4p& 2/h=e(I ,T襁`4n#|14H DH:ʞ/t؞gx܁8l觑'P+ (?t`S>_-$kثT{(p Cl|&̟x&۟d 3xƅx) p4, DiM <TePq0l[`X0bX,|͠ӠĠPݠ|thlx @P$*18l@IWU\dx} 4Hơ؆ס(1pЁ||[Ō+֖<K\T2d0mڒPtwp @`hӢԀPhPs*"l 5(>8`lm6D;$кL8 tETτƣzxΣ գ3ߣ$rl=8r @0, +Lݑ`; tEp[GjyX6`44݃ΤQؤh Ap0!/ <<xHRW(`a$ō@yLe`PEX8:åpӥĕ|3˄`fHz P~(t X1 <=TJXc躈z̸DpE@|-h/4DĦѦ;t\P,,;<T! 'JC|ʼnMHXpim(u ~|4W<'4(ȧ$UhӧL"$8t .h#䑈x9>pI7[\֐u4p>PШ8ܨ(yh8 `L$\M4pgFYWh) x@L0ا8d$ 9ϩLܩ`T |l (xG:{`E4tN XXh8X<0!pƪDӪPѕݪA4>hԾp&6@D؋QH ]qw\@9X 0 Уͫtثxhx% !-U<F0lS@Zjaw4kl4B/<xͬBlܬؓX6@NHVKckX=,|Gϔ@Tϭ<؇ۭQ˒<D V0`,8| T,T2P7 Ct [g`zpt؂HJ\~ĮخDۓL8k8%(2<\e(FtHd~h<$DǯH֯V*t|ؗM%$3|LDS($cځo{ddt,z0`Ұ~ ۰)4%H'4ח CL贕LW4c&p <(͒<VLhy(ñǍ|ѱ>4CHܙ pP0 4\ψGTJTVt_U$ts~4XD 8$|˲'ز1@$ 00Ŕ@#//HAp؁H@YLmb~<~y\H$DLųc,ҳ(D޳ИPG"@*87<GJ0J8S>apz4x.,Ŋ|Hȴ@d\Զ4 L18=X0IyhT<b2r }40_,\* ֑0̵;ڵhʕXَT 1h": 34V=h 0Jf,*r)z`A.@a(ڑvTlT'2@ph48ǺغX0(4l8 0$ߔp0x=;"@LLaLp|Lzt8pLdЍƻ%XϻTdٻ<ځPLז\.u7B|S/kpu\>,\HǕ^Ҽ` @ \p0 ;8@PLXdqly@Ց0X Tуp=Ȫ< ((? ۃ$,H-4\W\I8e4ւn0D{|$H̒ i<< ,~TԦt ܀`<4&h;ބC[`4n98,h( j, X(`HlF ܌Ld(얓8NH`ZӖHpЁ<.-4D :kH|$D8c ܒI@%Y04׃<uCX14c {|HY| <XԐX$lۇ 7̓(74P<8E$UD˔aАqC}P*|44h/X<=؈`D @#H%|6Kg\ZtLoHDxH<(%,7X0 DŠ\X,$p#D4t<m0J|d]410o_PyZ|,Xx(. d >$<$H ę,cX;d)L1\\ddn4uL,|gx X, |d.4p `.Th>*J?TgyP"4,iHφ$p\t ӆP#5 -L(= EĜ(N\fqtL}4L҃d @]hcDdH  L i@h$ p4DETTR$blt̎plLP̄̑ |o <|{< "X7x?8 T1`h$sЌ@ƅpؗ  LpXH8 o|L(!pӄ) H2tՀFl@U8a4ujqwrlAp$t| ,T<\CL FDp~d9&x.P(?0H`RhHφlIؐUČan9x{x!҅-(dxZp앃<=PX xҔ7БHX Sa7r͊H@IL[ihޅwt| +Հa< U`#L4ϒ ƒ0/cHC`D\KpxXD0,`1y\|d?䉑yL`o0BH Q0H$|̈=ǔhI V\2d(m!Hn@ϐPد规<P@މt4dD <#0<?pN`[ icHyX$2P>|WhB~!h>u(c050=eN ]lΑ$Δ?h XddžpLH@$:D % 4' `:TJ xVĤ h@},`$g|t8 LߍP+\ LD$J 2ÕCК(T&^ӁiG|} J$/@z1 w.Xߌ0;gEWP,p[LfhlwDȆ!ӎ$ܫqTT(dTth{#5PA)0N Ѓ\axfHڊt <,@<*8lKl!x'1\ <CDUTmc4otL438ؖ}ETtP5P T ,܅!8~/@APT bPuxl>|@8x84c\\ЄD\G \ &01<BZptXp侍dใ4ܢ,42Td-ڒx`T"!4DiR0ՂZL c} km8u{0x~$ԇDY00=̕<G8XHN| -d@0*Hޓ6O0d^q@T|z>Lt`l,/x844*V1x`A8MU`bw<$d.@@,"L$( 18xiIp8Y Cg@r /X$pS@8~4Lu8ޕ@ 'l>pGN.XTh@0$X\Z5|xq\ج4-x<:4NԐ,arHn،}ыdЂ0j4y87TDݏ 0hC'//3<ە0EpTPH#^zguP,|$0șxC B8,y DʑP!D+6:HEULtcd1s,~ˍDP`qx؁4HlDT8xk$+\< |MT,Y>pTx{JPz؃\|䯔hhπX&ļ,7.B|0K\.U`=b`#d|PX0pEĆ\tkԐdp3\Pnd*H8kCԞWLdt`(xԅ - '82E|Ylq$ӈ*dM;仗@ۑD`!0 T,<*B5XL`BX|w qh1 (x,4Pt880$J\ˆ %`h:pnHБZp `$]@jݎyA q@lxdh(|PO<<'ٓ7 BVptd,v8 DT%(d  QH\xٓ$|D8+p@~NBUl*\jȄ4q,<pd)4P0dU<8d !* 3$hJCPTd\\h\sXd? X8ԍ3T#8Ј<xEhR?bAn8~lZ( Dl<+8<D4Hdے|(dZ( T8:`Fx$M4g muDK |Xd͒Ɛ@LdIh`V(D TVX*`5 ?ː4VC\gHf(sTŎ<Lt( <1`h~(ؗ ?%(?3xXCMLcdtk8TL)82blhʃ HdC0*"54<C܁P$X<fPIXrB88 \<+m|ML70, ?M XWZc,c op}0hlălu Y\xW$08H X!d}p)k<5 qE* N B]|rL`8Ԣ,8T ,: H (B% h2 0? ͇@R Y 7|w .~ ˑp ` | ח  B "="T"#ē#h#-#~8#B?#F#MO#Pˁ [#D;o#0#C@##ԂX##,@#$(#s0#$Ԃ$#|$([$$=0$;$MO$ W$侉<c$آ(x$ n$X$PL$t$7$x$|,$p8$؆ %%3#% ',%@9% P%qZ%%hb%!`t%L%%4·%܁%,%,%=%I%Ԅ%xʃh &8$&g4&A&GP&(2[&g&Ln&X z&.&4>&xx&|&䦑4&[&<D&lg,&|&'P 'Ȍ'<!'+'5`>'58M' X'f'$/m'ۃT{'''A'8'*''@'p'$?''(dˇ(lX(e</(8$<( \(pm(9<}(PC(t$( <0(h8,( o(h5(P(-(,Ž (е )䀒).)=)+LJ)ҐZ) se)z)K))Ԕ)P0))l})p))T@) l*  *i!*8M<2*H?*h L*^*Lj* x*,{@*ׁl*~*@*4***TP*.+>+|6-+>+8I+<e+ q++H+n++\i+,' +d+| ,͖,hTp#,.,5A,WP,M`,ٕs,$},\F,,Dk,P,h,<*,p4,z,࣑@,Ht,Pؗ--<-K@/-n:-E-ЄO-`-r-,!{-t-܄--HV -:--jX-t-H,.>.HH&.j\0.ۀ\E.hC`V.@'_.LÖm.8|.݃L.L8.'4.0.^.*.(..d/ /ln/Pm!/0ՇP-/xp7/\,E/OQ/`<[/hf^/LDv//Ő,/,#,/\LH//ԑX/= /E$/<0i|0DL&0䣄t40 X>00K0XY0h?Te01 w0,0*08 0(^0(P0?l0<00n< 1xd1y$1@ $10?71QB1T1N,a1Kk1t |14%1>81ܻ@1%101ƕ1H1<(1t1I22D#24v.2K(82,L2_2Dxo2*0}22Dm2x,2h2܃2ʔ`2f2ox24\8233?3D23|@B3V3LY(a3(9 q3dQ0~3$3\3X3h083|V38<3 3Pl3hK4 /(4/4,%44@.4>4PH4\Q4[4xn4X|4T4 4)<4*4$4p4(4в4PZ45h5)5Ь@95D+B5 R5X5H1(a5x5l5(5|5T5сx5X?p5$5j|6  66 #64464I6-^6:h6ts6Cz66Z6~6$) 6lD6@66"66L<6ܑ`6!7\7\ ,7@$17쳀DD76^7 0l7Lgpu7@p70)7ÐP787bP77pI71T7h84 d88`g#80H388>?80H8P~T8e8<$q8Q`z88<88(8$808Ώ884. 8\8ŏ,9ȃd9LŽ9S4,9t79ҒD?9>T9P(_9$l9Gy9XD9T9l9@ՐH9Tڐ, 9+<9l;9 9d:^ :,$:eh4:Hm<:8=N:s W:DE(f:H5t:M::<>:誅:`:&:0*:A:D :\6:pՀ;;$ߑH;pم;; G;4KW;c;d\s;.;d8;;;C;D;l(;\PT;\у<H`<Tpl/<,ڇ@7<H<`Z<ln< χ,y<&P<<<ly<x<w<<<<=th=L=L&=2=P<=LtL=BX=TDg=D|y=l ==8n=TP=݂d=oL>|#>pZ8>>L>@V>ҖLh>Lq>T"|~>>x>(%>dJ>x>lێ>lF> ?T!?б(?l>?0)0G?4@S?|[?ӂ`j?8Dt??,? ?0b??0?*L?]?M?l@pB@$mL@D#@ nt/@:A@|}H@ɃpY@!a@Ao@#y@ȷ$@ |@L@{@0,@`(4@"@螕D@6@8}ATkALD A&A`1A9ArIAXZA:eA(ˑyAsxAgA,A&A AP 4AIAIA|A0 B!Bh&+BI5BGFB0dRB<\BcB@*,}B ,BB!BBP|`B<BnB4ΐ`B2 CCxC0)C/4CD 0DC<PC bC qCPڏCÅChCrCXCSCxjCdC `CP<CxߕCxCр D.D@D LL+D45D?D!HDĸtQD4[D0ddD0{DPו0D8+D D|LDpDlD8D`DTD#E(E䯃x(EL=;ED|PE,WExaE.oE}EoEƆE@`E|DEtME\ E {ĚET| F8Z#F${,2FP\IFVTFޗ]Fd^4jF{F@FۀFĕFFԐFF$'F0FFx|GXG֓G l.G8GdCG `PG|_GrG`GG쀗GH7<G(6GGLGǃGTPH,kH,)HB:HHHSHJ]H(@loH~H DHHlH H<HDH@H@H.HwItISI*I؁p2IΔHISIT[I|,,mI׀ID0ILQIXI@1ITIPwI|JsJH!J<+JXM0J0'`DJwYJxbJ,ioJ& yJ 7J JNJJTJ0 JD@J_JtFJ\ЀJɍTKDKL *K(`3KΑ<HKAQKԵ$YK|ӔnK'K4=K0= K KdKK KH`PKL<8L@LӐ0-L7L|@LPKLȓ [L4Z<mLwLPTL!L(xlLlLL0ELЃL0`hL'hLL 0M pMXUH1MLpDMDъpQM6kMwM4hM(NJMXMM<MmM8C$M,Ml(M|9h N@@N -N,8NXlLN|VNdN,nPnN0tzNdNDm@N2NDN@Nȝ<NRNdNÐ4OI OOhO׋ +OD7OBOLO^OtgO҄0qOTGhO4OO.O쇓(O˃|O`O<tOO؞OAP8P'PЖ 7PAP8WP4[\[x][" [D\t|"\D-\׀0F\GY\Wh\w\߀(\D$\lג\0\L\<\\% \ 9p\\]a]|-]܎|E]BP] |c]qu]=]4]]]ϖh]4\]χ]]]I8^^L-^(7^d F^U^Tb^Tt^|^<^ɕ^^n^Z^@^A|^^lՀ_ n_L$,_ӎ:_X7P_ n`_Hti_l~__ k_쉆@_T__s_0\_<_D_dޏ`L`\M`84&`D0`38<`tM`lX`̎j`=Xw` @`ߑT``|`h=`P`8`ٕL`ԍDaȽa4ad |.a dL8a0DaOa(@baӐpah||a6a\aLa4Taba8aa4- a ܃  bʖbHX(bˆ>bTMHb$`b\zbhb bLwbhbubd,b0b,?bbLcdch"%c>8c8Sc׀ic sc<c0c:cdctcHחc4c@a8c@pdxdhhdD'd2/dǑAd,MdLxZd̅tjdؒ@udxdd+d_dTld<ddXe+e֕$+etY ?eRetG`e@2<sexe4<ed7HeD=exje1e@PeP(e< f(fH +fH9fhAHft*[f>kf|+Dtf]p~fXf\f fuxfufga8hH:hهPhHT*h{$8hKhZhprhh, h h/(hنhH4h|hMhĕhܤit!iƊ*ip3i??iXQJi4 TijbiP4miDԉ,zi\Diini3i$i`ii׀,iki8$hj(j8'jpʆH#j *j '7jxّFjdRj7\bjljj30jrjj`6jjtj @j kl"k*k@4kCk,#4VkshkނXokxdkY kx߁\kpktxk$k)k`8k%kl#lI/l r<FlHVlx]l]glzlV`l& ll,Ll(Hll\lm  mm,mݑBmC\Tm\#]mlhmH0umdMm?mDT`m1m,ɂmIpmۃmm`m Pmd׍ n͐d!nځ)nK3nĂ?n ՀInz0Wn$]bnԂhnn}n(n,8ntЇn Wln0n $n>nn n قD oՐH#of4oːXCotUo$)@`oۀlkoso Looo<o$HoP>o0o%oLopL"p$9"p0(D5pGIp#xRpđap4ʼnHmp< {pp"p4,p,Zplŕp&p`p<pl q@uq8@L *q5q %EqĘZqtiqxsq찄}qԦ@qq q|q qCq8Pq\q, rrƒh!r00rBr0$Vr$^r(YhnrHr0r rr` r4Drdehr+|r} r U8r4sT'Hs@ys44&sL`4s(DBsMsD̎h]sisD>ys ysGsss,sm(ss@@@ťt<tP't\:t,GtnYtRctDbotωXtttxt@Dt$ thт0tlNtxth tH{$t(t,tluh4u\΅l/u FuPRu``upluLwul u0udfDuu 4uاuxu(uulu% vvY<(vDn;v@mCv0POv8tdv,tv@{v@E%vDžvl& vdōswap_onwi_set_nwkeyucom_unlockpfslowtimonanouptimebuf_rb_bufs_RB_REMOVErandomreadehci_device_ctrl_closeaxe_tickuaddr_bestfit_functionslongjmpwi_usb_rx_list_initarm_dflt_intrarml2cc_sdcache_wbinv_rangeproc_freekdb_trapvfs_allocate_syncvnodetc_setclockarpresolvechrtoblktblsw_reg_strategysys_minheritlinear16_to_linear8_le_stmieee80211_tree_RB_NFINDputcharuvmfault_unlockmapschild_returnsmsc_cauaudio_add_outputHMAC_SHA1_Updatertlabel_unrefsmsc_startuvm_map_inituvscom_attachipsec_soft_first_usenkmempagescopyinstraue_miibus_readregieee80211_send_group_msg1sys_getgidieee80211_tkip_micdofilewritevwi_inquire_usbuftdi_matchsdmmc_intr_establishdumpmagieee80211_derive_ptkttyflushsys_setsockoptsys_ppollieee80211_watchdogclock_gettimewihap_sta_disassocdefrouter_lookupinetswwi_get_fid_usbwdog_periodcdce_rxeofffs_fifovopsip_reassrt_maskedcopyin6addr_anyVOP_ACCESSusbd_get_quirksip6_get_prevhdrscheduler_startdb_logatascsi_disk_vpd_infopmap_alias_bitsuvm_maxkaddrimxenet_dma_mallocumass_io_putieee80211_getmgmtipmforwardingmainbusprintarmv7_bs_w_1imxgpio_matchsys_closeusbd_do_request_flagsimxdog_attachrtflushclone1ffs_inode_allocsys_setsidieee80211_encapaudio_attach_mi__ashldi3vn_statunp_detachnd6_nud_hintether_ip6multicast_minumodem_breakusbd_submatchtcp_secretrti_findchange_sign16_swap_bytes_be_mts__mainaue_stopufs_quota_deletehardclocksd_vpd_thinieee80211_eapol_timeoutwi_read_data_ioumodem_set_comm_featurein6_domifdetachieee80211_get_authvtagsmtx_enter_tryfilt_audioreadsmsc_sethwcsumwskbd_cndetachdb_get_variableieee80211_inputatascsi_disk_vpd_serialgeneric_armv4_bs_wm_2if_group_routechangerw_assert_rdlockarmv7_bs_wr_4sys_fstatatnd6_timer_workahci_put_ccburl_csr_read_2dest6_inputgsignalmii_mediachgipport_firstautoehci_strwi_txeofaue_devsipsendredirectsbpf_setifunp_internalizetk_rawccscsi_xs_sync_donefc_lfcemptyvfs_export_lookupif_cloners_countifnetyieldm_freemuhid_seltrue_filtopssc_print_addruaddr_free_rbtree_RB_NEXTfilt_seltruelogahci_pmp_port_softresetsmsc_tick_taskvn_writechkata_identify_block_l2p_expin_ifscrubuvm_pmr_freepageqpdevnames_sizemichael_updatealaw_to_slinear16_be_mtsscsi_mode_select_bigplatform_bootconfig_dramroute_dstsingle_thread_clearch_usergetelemstatusinit_execuvm_pmr_size_RB_NEXTuvm_addr_alignieee80211_send_4way_msg4wskbd_cdsdmmc_mem_enablenamecache_rb_cache_RB_FINDbcmpgeneric_bs_r_1ieee80211_node_detachdb_set_breakpointsuaudio_set_paramsnd6_dad_startrum_inituaudio_add_extensionexec_maxhdrszdb_force_whitespaceSHA512Initieee80211_ifattachmmmmapieee80211_clean_nodessetjmpsd_read_cap_16prefetch_abort_handler_addressuvm_deviceopsuvm_addr_align_backlogread_filtopsvndxfer_poolfilt_fifowritecpu_info_primarytcp6_mtudisc_callbackcopyoutstratu_caieee80211_countrycode2regdomainradio_attach_miusb_transfer_completeuaddr_stack_brk_selecttcp_attachla_hold_totalwskbd_cngetcbuf_dirtysoo_writesystempageieee80211_align_mbufm_zerond6_llinfo_timervn_fsizechkunp_gcingreaddoslabelbdevswcalctsruumodem_matchpmap_get_l2_bucketbaddynamicportsworkq_initau_set_lr_valueX_db_line_at_pcuvm_mk_pclusterbswap16domainnameehci_endpduvm_pmr_addr_RB_REMOVElockinitwsmouse_detachttywrite_filtopswi_usb_devsplatform_powerdownnd6_ns_outputbpfkqfiltersorwakeupttyunblockhidms_disableremovedeudav_miibus_statchgigmp_timers_are_runninguvm_deallocatefilt_procattachufs_quota_free_inode2filt_procdetachsys___thrwakeup__divdi3armv7_bs_allocallowpowerdownsys_clock_settimeuvisor_calocnameshidkbd_bell_fndisk_busydb_breakpoint_allochidkbd_belltcp_pulloutofbandevcount_sysctlsddetacharprequesttfork_child_returnsiginituaudio_activatepool_set_constraintsuaudio_query_devinfousb_task_thread_procip_sysctluhidev_closemsdosfs_vptofhscsi_mode_sense_bigusbd_clear_endpoint_stalldb_vnode_print_cmdums_casetdisklabelknote_removepmap_bootstrap_pv_page_allocbufq_nscan_createuvm_mapent_addr_insertroutedomainhid_locateicmp6_errorarmv7_dcache_index_maxVOP_MKDIRpool_large_freeip_protoxsys_settimeofdayimxesdhc_attachsdstrategyaddlogehci_sync_hcuvm_page_physgetmsdosfs_synccheckdisklabelscsi_mode_senseip_savecontrolstackgap_randomulpt_detachpmap_pte_init_genericvm_map_unlock_lnarmv7_setupffs_clrblockusbd_set_hub_featureuvm_addr_linsearchbpf_filterchgproccntip_drainieee80211_tree_RB_PREVdb_map_print_cmdumass_init_shuttlesoqremque__adddi3uvm_map_inheritfifo_printinfosys_getthridarmv7_a4x_bs_tagin6_ifawithscopebuf_page_offsetaudioreadumodem_set_line_stateuvm_pmemrange_addr_cmpkm_freeusbd_is_dyingarmv7_idcache_wbinv_allsync_printvnopsieee80211_rssadapt_inputsys_lchownmsdosfs_removedb_read_tokenieee80211_regdomain_compare_rnfilt_timerdetachwi_get_idzeroin_addrehci_device_bulk_closeampintc_intr_enableuvm_map_protectusbd_get_xfer_statusuvm_map_setup_mdprintfehci_alloc_sqtd_chaincdce_devsrandomwriteprelist_updatesmsc_miibus_readregip6_protoxsys_recvfromttrstrtrandomuaudio_mixer_add_ctlif_getsysctl_doprockcopyaudioattachsdmmc_mem_mmc_initext2fs_initrtfreesingle_thread_checkimxahci_caampintc_spllowerimxccm_get_ahbclkukattachhostnamelenlinear16_to_ulinear8_be_stmupl_cdusb_needs_reattachuaddr_hint_selectttyopenuplcom_rtsraw_ctlinputwi_usb_ctl_unlocknd6_ioctlsched_chooseprocphyslockspec_setattraxe_miibus_statchgpte_l1_s_protousbd_get_stringfill_prlistipsec_exp_allocationsHMAC_SHA256_Finalbpfcloseusbd_probe_and_attachsys_writevsys_setpriorityumodem_set_line_codingm_tag_prependaxe_cmdurl_unlock_miiumass_detachusbd_free_iface_dataip_defttlwi_usb_attachurl_rx_list_initusb_schedsoftintrarpintrsdmmc_activatealaw_to_mulawrum_writekqueue_registercred0in_delmultisdmmc_io_rw_directsdmmc_io_write_2uvm_forkdisk_lookupuid_findumass_activatend6_rtrequestuplcom_cduvm_km_suballocusb_delay_msucomparamif_getgroupattribsbpfdetachsys_closefromfifo_ioctlumodem_closeehci_devdttydefcharssigexitscsi_link_openhidirtypagesuk_cdin6mask128armv7_bs_wr_2bus_space_read_raw_multi_4uvm_amap_poolin_pcballocVOP_LOOKUPdb_shift_exprphysical_startbs_notimpl_bs_c_8ifa_delpcred_poolenqueue_randomnessusbd_set_idleieee80211_find_node_for_beaconemul_nativeaxe_txeofwskbd_inputimxgpio_v6_clear_bitsdmmc_printcpu_do_powersaveaue_rx_list_inituvm_km_pagesufs_quota_alloc_inode2ieee80211_name2countrycodemicrouptimesocket_poolarm_init_smaskpgrphashsys_setpgidprofhzcache_enterntp_update_seconddb_watch_tableexec_elf32_makecmdsradio_cdradio_causb_rem_wait_taskext2fs_bufatoffsys_setlogininitarmatascsi_passthru_doneamap_listdb_trapuaudio_halt_out_dmaip6_maxifprefixesieee80211_node_cache_timeouttcp_do_rfc3390ieee80211_req2nodesys_setresuidrn_deletesd_get_parmsiskmemdevstat_rush_requestswi_watchdogatu_start_scanipsec_def_compfc_lmdistancench_poolphtree_RB_REMOVEsomaxconnugl_initscsi_xs_get_donesdmmc_card_intratu_external_firmwareipsec_exp_timeoutip_directedbcast_bus_dmamap_loadahci_dmamem_allocuvm_pmr_pg_to_memtypeuihashtblieee80211_node_getrssitaskq_syspoison_memaudiommapau_get_portumct_activatesd_buf_doneieee80211_get_rtsamap_initffs_flushfilesubsa_baudrateicmp_sysctlsys_lseekulpt_resetaudio_check_paramsllinfo_arpmsdosfs_pollmsdosfs_accessaddupc_intrdvd_read_bcavm_map_lock_read_lnau_set_mutewsevent_finiip6statuplcom_set_line_statehidms_enableuvm_pageboot_allocconfig_pendingmii_phy_updatesys___thrsleepether_crc32_leuvscom_set_crtsctsaue_csr_write_1rum_rxrateugenread_isoc_filtopsipipstatsecureleveluftdi_cadb_consolerum_txtimeurl_matcharpt_keepsdmmc_mem_mmc_switchsavectxdb_printsymums_disablepte_l2_l_cache_mode_ptbinuptimedogetrusagesys_seteuidhidms_attachuao_shrink_hashugl_rx_list_initwskbdpollmax_protohdruvm_map_checkprotmixer_openatu_tx_list_initcdce_activatedb_access_irq_spieee80211_add_qos_capabilityieee80211_cipher_keylenumass_scsi_attachsdmmc_alloc_ccbsrandomkqfilterbufpagesusbrev_striic_execsleep_setup_signalprocess_newsys_keventcopyargsarc4_reinitmi_switchsysctl_sensorstsleepuaudio_drainkern_sysctlnd6_delayrum_bbp_initin_pcbinitsys_fchmodatbs_notimpl_bs_rm_4nmbclust_updatehw_prodfdremoveigmp_fasttimoatomic_setbits_intehci_device_ctrl_startpmap_pte_init_armv7linear8_to_linear16_lewi_get_pmumass_bbb_stateaudio_init_recorddb_print_loc_and_instrt_mpath_matchgateubsa_stopbitscdce_startuaudio_identify_asusbd_port_disown_to_1_1uvm_map_entry_poolcrgetunp_bindtcp_delackcsignalreaddisklabelvm_map_unbusy_lndb_print_cmdusbd_clear_endpoint_stall_asyncplatform_disable_l2_if_neededvirtual_availbs_notimpl_bs_rr_2tcpstatuvscom_readstata4x_bs_r_2dma_constraintdb_break_tableuvm_anon_poolicmp6_mtudisc_timeoutfillmapentrytcp_timer_persistugl_intrcpufunc_ifarudav_newbufsys_umaskpow2dividesyn_cache_reaperieee80211_find_rxnodefilt_fileattachsysentlinear16_decimatorcpuset_addpmap_alloc_specialsbs_notimpl_bs_r_8tcp_setpersistufs_ihashlookupubsa_intrscsi_inquire_vpdpmap_kernel_l2ptp_kvaicmp_rediracceptmemmoveugen_set_interfaceusbd_get_hub_statusworkq_create_threaddb_boot_halt_cmdip_outputbpf_mtapahci_get_err_ccbuaudio_add_selectorfindblknamenkmempages_maxkue_rx_list_initarmv7_bs_mappool_inituvn_referenceuvm_pmr_addr_RB_PREVbpfreadatascsi_attachpool_putm_copym2umidi_casxia20_devsbuf_alloc_pagessysctl_structau_gain_matchbufqs_stopimxiic_i2c_release_busaxe_ifmedia_stssysctl_rdstringuvn_attachsdmmc_send_if_condlasttimefiforead_filtopsehci_freexahci_port_portresetarm_dcache_l2_assocsysctl_disklockcnkqfilterdesiredvnodesimxiomuxc_enable_satabs_notimpl_bs_r_2ufs_pollpmap_map_sectionmsdosfs_readlinkpmap_devmap_bootstrapieee80211_decryptusbd_get_device_statusukmatchsdmmc_verbosenchinitexec_mapdb_qualifysnprintfiicbus_printext2fs_readlinkaudioprobeether_ioctlumass_bbb_transferrum_bbp_writeip6_forwardingkue_resetarp_allocated_bus_dmamap_load_mbufwi_watchdog_usbsdmmc_io_write_1platform_print_board_typeslinear8_to_mulawifindex2ifnetimxuartdevrt_mpath_conflictin_pcbnotifyallfilt_audiowdetachuvm_pglistallocsyn_cache_addpool_large_free_niulpt_do_writebuf_kva_enduvm_map_splitentryincorevm_map_lock_lnhzomap3_devsulpt_statusmsgdefrouter_resetcheckaliassched_exitcue_activatettyretypestartuphook_listsdmmc_card_detachpte_l1_s_cache_modeuvm_pmr_remove_addruaddr_pivot_poolkue_detachrt_timer_queue_changelf_initwi_ioctl_usbcpu_attachmii_phy_matchsdclosevop_generic_kqfilteruaudio_set_speedampintc_splraisepffasttimoinitsiginfosys_getuiddb_set_cmdatascsi_pmp_sensecpuidsexec_setup_stackrum_free_rx_listuao_createdb_free_watchpointssensor_detachifaddr_items_RB_INSERT_COLORbuf_mapaue_lock_miiarmv7_submatchidentify_arm_cpuffs_realloccguplcom_set_crtsctswskbd_load_keymapm_clpoolaudiocloseugenintrgroupmemberuvmspace_initscsi_plug_detachether_sprintfatu_calculate_paddingmsdosfs_unlockselwaitpmap_init_l1udsbr_get_infoicmp6_mtudisc_callbacksnd6_slowtimosys_forkbufq_implsip_setmoptionsuvscom_reset__qdivremifaddr_items_RB_PREVumct_matchspec_openmld6_checktimerfilt_bpfreaddb_watchpoint_freeehci_alloc_sqhuvm_fault_wireusbd_abort_pipekernelstackicmp6_mtudisc_timeout_qvm_nphyssegifaddr_items_RB_NFINDrum_eeprom_readip6_randomiduvm_pseg_initproc_filtopself32_os_pt_noteSHA512Transformfiledescopensys_vforkcomcnspeeduvm_pager_initcpufuncswinChkNamest_decide_modedvd_read_copyrightieee80211_recv_4way_msg1arml2cc_disableuvm_pmr_addr_RB_MINMAXdb_history_previmxenet_intrsys_mkdiruao_reference_lockeduaudio_get_propspmap_devmap_tableufs_fhtovpwskbd_translatedumppcbrttrashtargetpagesmblowatgetnewvnodeufs_inactiverum_readkue_load_fwuaudio_opennd6_mmaxtriessingle_thread_waitrum_setup_tx_descsys_socketuaudio_getdevugenopenffs_cgreadwi_init_usbugenioctlvm_map_lock_try_lnulpt_fwdevsspec_close_clonevop_generic_bwritenanotimeufsspec_writesd_read_cap_10midireadfifo_badopfdfreeuvn_detachieee80211_ccmp_set_keyuvm_km_valloc_trytty_countugl_cdhidkbd_detachuaudio_devsuftdi_detachraw_disconnectsensor_task_registerarm_dflt_spllowerip6_neighborgcthreshbufkvmKERNEL_BASE_virtuaudio_identifyremove_coproc_handleratomic_clearbits_intumass_polled_transferucom_to_tiocmsxia20_inituvm_pmr_extract_rangesensor_attachbrelvpmsdosfs_mountfsvfs_relookupuvm_map_addr_augment_getffs_checkblksys_utracencpusfoundehci_root_intr_startwi_stopsync_fsyncsetstatclockrateimxccm_get_pll2_pfdimxuartcnproberrw_inittiocm_to_ucomext2fs_allocwskbd_deliver_eventdb_eregsieee80211_delba_requestst_loadbread_cluster_callbackfdcopyin6_proto_cksum_outbuf_acquire_nomapatu_send_mibuaudio_setemul_findb_to_quvm_pmr_size_RB_INSERTin_len2maskbus_space_read_raw_multi_2ugl_startusb_blk_freelistudp_sendspaceulpt_cauvm_objtree_RB_PREVSHA1Updateifg_headvfs_rootmountallocehci_device_isoc_transfercue_tx_list_initbs_notimpl_bs_sr_2netintrrw_initarmv7_bs_r_2vm_map_busy_lnbuf_rb_bufs_RB_FINDcmask_bss_end__ext2fs_blkprefdb_pool_print_cmdwi_alloc_nicmem_iodb_delete_linescsi_activateuhidkqfilterVOP_ISLOCKEDsys_kqueuemidi_timeoutieee80211_tree_RB_REMOVE_COLORuao_referenceurio_cain6_addrscopebuf_getsys___threxitieee80211_ifdetachdb_searchuvisor_attachbs_notimpl_bs_wm_4vfs_getcwd_scandirmaxlockdepthwi_usb_tx_unlockplatform_boot_nameieee80211_free_nodeieee80211_node_leave_11graw_usrreqnblkdevinitiduhidev_detachbs_notimpl_bs_wm_2urioclosettyinputscanc__stack_smash_handlerukbd_consopsbiodonedb_set_breakpointicmp6_rip6_inputmulaw_to_ulinear16_be_mtsehci_free_sqtdwi_usb_txfrmsmsc_encapukopenmaxslpext2fs_makeinodeehci_device_intr_methodsswap_bytes_change_sign16_leimxenet_cacue_startaue_csr_read_2st_read_block_limitsufsread_filtopsufs_symlinkm_dup_pkthdrrum_ack_rateudsbr_attachufs_mkdirvfs_getcwd_getcacheusbd_get_no_altssdmmc_initnamecache_rb_cache_RB_PREVin_iawithaddr__anddi3phtree_RB_REMOVE_COLORrt_missmsgVOP_BMAPatascsi_disk_vpd_supportedignore_addrsip_dooptionsvn_lockcue_tick_tasktimeout_add_tsrip6_ctlinputchange_sign16_swap_bytes_le_stmubsa_activatescsi_link_shutdowncdce_caSHA384Initumass_cbi_adscsbdropmidi_out_stopmsgbufphysuaddr_free_rbtree_RB_INSERT_COLORusbd_desc_iter_nexttcp_debugusbd_transferimxccm_get_fecclkarmv7_dcache_wbinv_allinpcb_poolnextralocsmsc_miibus_writeregbus_space_write_raw_multi_4uvm_addr_fitspacesys_setegidnoswap_bytes_mtsucom_status_changern_matchfifo_readautoconf_verbosein6_setpeeraddrunp_externalizesys_munlockallimxiic_detachuvm_faultrandomioctlarmv7_bs_sr_4softraid_disk_attachsoreceivepool_getuextralocscsibus_printlinksdmmc_discover_taskdb_show_radix_nodeimxenet_ioctludav_csr_read1ieee80211_eapol_key_inputffs_dirprefucom_shutdownrip6_outputscsibus_cdin6_get_rand_ifidndflushcompose_tab_cmpieee80211_parse_wmm_paramsrn_insertspec_pollbpf_wakeupfilt_kqdetachmidi_cddb_flush_lineaue_unlock_miiipsec_exp_bytesbufqueuesconfig_defersys_faccessat_bus_dmamem_allocm_tag_initimxgpio_set_bitbsearchif_attachugl_casys_setrtablem_reclaimimxenet_recvuvm_map_addr_RB_REMOVE_COLORnameiovero_devsbs_notimpl_bs_sr_4uvm_map_setup_entriesext2fs_readdirip6_ctloutputdead_pollpte_l2_l_coherentwihap_initversion_bus_dmamap_syncuvm_pmr_remove_sizebuf_needvakqueue_initieee80211_wep_delete_keyuplcom_set_line_codingaxe_rx_list_initieee80211_bip_set_keyuvm_pagezeroin6_setsockaddrigmp_leavegroupiic_probe_sensorbs_notimpl_bs_rr_8mountlistsys_getdentswihap_mgmt_inputudav_initVOP_REVOKEconfig_deactivateSHA256Finalclallocbiowaitata_polledprobe_addrs_sensorfilt_ufsreadunixswuvm_objtree_RB_INSERT_COLORdb_stop_at_pcsccsehci_check_intrccpupmap_updateehci_device_setintrgeneric_bs_sr_1hidkbd_inputprocess_zapfdinitboothowtoarc4randomimxccm_get_uartclkrum_ioctltcp_delack_ticksupl_stoparmv7_bs_rr_1armv7_tlb_flushDttopenukbd_apple_iso_mungeip6_randomid_initieee80211_tx_ba_timeoutether_ipmulticast_minconfig_rootsearchrip6_sendspaceieee80211_countrycode2nameuao_dropswapin_addprefixenxiosys___getcwdusb_cdrnd_event_headin6_maxmtupmap_enterimxdog_resetusbd_ratecheckundefined_handler_addressSHA1Initsys_setreuidwi_usb_open_pipesudav_tick_taskuvm_map_findspacewsevent_initarmv7_bs_subregiondb_var_rw_inta4x_bs_w_2sdsizeuao_dropswap_rangesys_pwritevudav_lock_miikqueue_scanieee80211_pmksa_finduplcom_breakusbd_iface_claimedtcp_closeumidi_evlensd_patternsX_db_search_symbolscsi_initsdmmc_disablemsdosfs_advlockwdog_registeratascsi_detachimxgpio_cdkue_attachusbd_free_xferdb_varssys_utimensatfallocimxahci_detachatu_joindeadproc_mutexdb_breakpoint_freepfctlinputphys_mapext2fs_pathconfumass_bbb_methodssoft_intrqufs_locksys_accessuvm_swap_iokillpg1url_tx_list_initarpproxyvputonfreelistahci_ata_freerum_set_macaddrext2fs_mountrootumodem_methodsieee80211_findrateregyearurl_ioctlpage0setrunnablerum_next_scanpool_do_putimxuartopenuvm_pmr_getpageswi_set_ssidcue_ioctlnd6_prefix_onlinkugen_seltrue_filtopsffs_specvopsumct_intrcue_attachelf32_read_fromau_get_lr_valueosversionatu_get_mibhid_is_collectionimx_cdwi_usb_tx_list_initfind_pfxlist_reachable_routerip6_pcboptstvtohzieee80211_get_eapol_keyphtree_RB_NFINDratecheckin_rtchangevfs_syncwaitudav_ifmedia_statusaue_crcffs1_reallocblksieee80211_node_lateattachcansignalimxiomuxc_enable_pcieieee80211_up_to_acmsdosfs_check_exportlf_setlocknbigpipecue_devsin_controlieee80211_get_addba_resplmaxuvm_pagecopyphtree_RB_NEXTsysctl_quadsys_readexec_process_vmcmdskue_tx_list_initmidi_attachieee80211_tree_RB_FINDahci_get_pmp_ccbuaudio_matchucomioctlm_cldropmbstatuhidev_intrttyinfodb_flush_lexttyingetnulldevispidtakendb_dmesg_cmdextent_destroydb_lpif_group_egress_buildloop_clonergetcttsetwaterieee80211_addba_requestmididetachampintc_attachomap4_smc_callifaddr_items_RB_INSERTdb_last_addruvm_pseg_lckpmap_enter_pvmsgbufenableduvm_mapent_mkfreeunp_disconnectarmv7_bs_rr_2ufsfifo_writesys_listensys_mountehci_root_ctrl_donebpf_mtap_etherpgsignalehci_waitintrfirstclinear16_to_ulinear8_bedb_read_bytesuhub_detachaudio_silence_copyoutieee80211_ccmp_delete_keyffs_fsyncau_portofucom_do_openinetdomainehci_abort_xferscsi_devid_wwnarm_dflt_intr_stringmemcpykthread_exitaxe_activateuaudio_chan_set_paramscsi_req_detachcue_newbufvfs_unbusydisk_constructrip_usrreqvm_map_upgrade_lnahci_port_read_ncq_errorahci_pmp_identifyspec_writeaudiostartrkq_timeoutmaxsdmmc_inquiryin_broadcastfd_getfilehidkbd_set_ledsatascsi_passthru_16msgbufaddrucomclosesdioctlutsnameip6_setmoptionsexit2ata_completeaue_resetkue_open_pipesip6_mloopbackext2fs_cgupdateahci_startieee80211_send_4way_msg2tcp_update_rcvspacerddumpcpu_setperfuaddr_rnd_poolufs_lookupugen_attachufs_bmapdoasyncfreeudav_miibus_readregcpufunc_dfarip6_randomflowlabelttpolldegetlogpollkthread_createmulaw_to_slinear16_le_mtsugen_set_configsdmmc_mmc_commanddb_elf_sym_initlogclosesd_vpd_block_limitsieee80211_kdfgeneric_bs_wr_4install_coproc_handlernd6_dad_findudav_detachufs_strategyam335x_devsrum_bbp_readimxenet_newbufimxgpio_v6_set_dirkue_watchdogphysical_freeendcopy_statfs_infobounds_check_with_labelarc4_timeoutrum_newassocumct_opensd_ioctl_cacheext2fs_checkpathsocantrcvmoreprocess_poolip6_setpktoptfile_filtopsahci_load_prdtst_cdch_cdbuf_unmapmsdosfs_renamesysctl_proc_argssdmmc_mem_initext2fsfifo_reclaimpipe_wfiltops__lshldi3purge_detachedpfxrtr_addcd_load_unloadipq_pooluaddr_kbootstrap_destroypmap_activatebuf_dealloc_memmidi_getinfoconfig_make_softcpte_l2_s_prot_kruaddr_stack_brk_functionsunp_discardcue_csr_write_1ip6_outputwi_read_record_iouhid_caudav_rxeofswap_syscall_lockufs_kqfilterieee80211_newstateums_enablescsi_autoconfcheckdirsexecswmulaw_to_slinear16_besdmmc_set_relative_addrumass_atapi_attachin6_are_prefix_equalin6_controluvm_pmr_rootupdateleapyearsleep_finish_timeoutsys_sigsuspendehci_device_bulk_abortnamecache_rb_cache_RB_NFINDtrapsignalrushjobpmap_devmap_registerrn_inithead0db_single_step_cmdnd_defrouterfdcloseexecuvm_map_sel_limitsevcount_attachlimcopybio_doreadwi_do_hostencryptahci_pmp_readscsi_req_probeuvm_mapent_forkcopytcp_timer_rexmturl_ifmedia_changerum_rf_writeuftdi_attachrt_timer_initudsbr_cdnd6_useloopbackuaddr_rnd_createieee80211_next_modeputsaxe_tx_list_initatascsi_passthru_maprip6statip6_id_ctxmulaw_to_ulinear16_le_mtstcp_debxcnpollcd_casdmmc_task_threadsys_truncateesigcodescsi_xfer_poolsysctl_wdogudav_csr_readarmv7_bs_w_2ieee80211_tree_RB_NEXTsched_choosecpu_forkcdce_newbufsoacceptkqueue_pollcdgetdisklabeldb_call_depthuaddr_pivot_randomdb_printfehci_device_isoc_doneuhidreadin6_ifaddloopufs_creatend6_freend6_optionsimxiomuxc_pcie_refclknd6_llinfo_settimersdmmc_mem_write_blockmsdosfs_unmountelf32_load_psectiondb_show_all_bufsuftdi_writern_mpath_nextnamecache_rb_cache_RB_MINMAXtaskq_create_threadarm_pcache_unifiedmidi_out_startdb_add_symbol_tableuplcom_setarmv7_setttbm_tag_nextuaudio_id_namech_getelemstatusmsdosfs_writeimxenet_startcue_resetbs_notimpl_bs_w_1exec_script_makecmdsehci_rem_free_itd_chainiic_matchieee80211_reset_erpfilt_pipedetachentropy_add_ptrdb_unarydisk_attach_callbackselrecordffs_validateatu_wait_completionaxe_ax88772_initffs1_compat_readrip_outputrrw_exitext2fs_accessmld6_fasttimeouaddr_rnd_insertkthread_qimaxwsmouse_matchchioctlstioctluvm_object_printitmbpoolclock_secs_to_ymdhmsst_write_filemarkstcp_canceltimersrip_recvspaceroute_initswap_prioritylink_rtrequesttc_setrealtimeclockuvm_vmspace_poolstackgap_initpipe_createfifowrite_filtopssysctl_vnodeimxiic_i2c_acquire_busnd6_sysctlsyn_cache_putdoopenatimxgpio_v6_set_bitvn_openif_clone_createbufq_fifo_requeuecdce_tx_list_initSHA384Finaluao_detachcpufunc_controlmallocahci_port_cloamap_pp_adjrefatascsi_disk_vpd_thinin_pcbrtentryknote_dequeuewi_cmd_usb__udivsi3tcp_outflagskqueue_statcdce_ioctluaudio_io_terminaltypebuf_fix_mappinguriowriteip6_v6onlysys_preadvdb_tok_stringuserretsys_recvmsgpipe_statHMAC_MD5_Finalvn_writehidkbd_hookup_bellVOP_LINKubsa_devsicmp_inputumass_cdimxccm_enable_pll_usb2vcountvm_page_zero_enableieee80211_get_sa_queryuvm_vsunlock_devicerd_root_sizein6_delmultistathzroute_ctloutputwdog_ctl_cbuaudio_mixer_get_portsched_idleuftdi_get_statuswskbd_cnattachrum_attachhookvirtual_enduhidev_get_reportsys_getloginifaddr_items_RB_NEXTbuckstring_initicmp6_rediracceptdetruncdb_elf_symbol_valuescopyoutpfindbufq_peekip_ctloutputuhidev_set_report_asyncwsevent_readimx6_devsarp_ifinitdb_write_variableufs_dirbadrum_enable_tsf_syncvfs_unmountallsys_renameatcopyrightsdattachsched_peg_curproctcp_timer_keepusbd_devinfo_vpsbsynctcp_mss_updatefree_pagesffsfifo_reclaimehci_root_ctrl_startdb_proc_print_cmdrw_enter_readdb_show_all_procsvunmapbufehci_device_ctrl_transferbootstrap_bs_mapuvm_map_pageable_wireroute_outputrti_deletefreepidsys_geteuidchange_sign16_swap_bytes_bedb_output_positionsdmmc_mem_single_read_blockicmpmaskreplin6_pcblookup_listenmsdosfs_mknodttkqfluship6_defmcasthlimsys_munmapsdmmc_io_write_multi_1kp_noneudsbr_hw_iffilt_solistenvsnprintfpte_l2_s_prot_urimxccm_armclk_set_freqarplookupuvm_map_pageablechainallocuplcom_methodssw_reg_startarml2cc_attachifmedia_baudraterum_get_rfimxesdhc_card_detectusbd_setup_default_xferuvm_pagelookupsoshutdownuftdi_cdata_identify_block_logical_alignproc_cansugiddb_command_tableip_mloopbackbpf_iflistarmv7_find_devKQREFimxdog_scieee80211_node_leaveip6intrqaxe_newbufatascsi_disk_capacitytodr_handlend6_rs_inputscsi_activate_busuaudio_create_encodingsahci_pwritesoabortlinear16_to_linear8_beuaudio_trigger_outputm_free_unlockedunp_inotaskq_threadhidkbd_attach_wskbdlogkqfilterbpf_mtap_pflogni6_dnsmatchdb_extent_print_cmdip6_init2uprintfsensordev_installdb_clear_single_steprandomiduvm_page_printitmainbus_cacoredump_elf32softdep_flushworklistsys_issetugidinitclocksimxiomuxc_attachsdmmc_decode_cidif_detachaue_watchdogpmap_kernel_l2dtable_kvamidiprintnd6_cache_lladdrcatqsession_poolugl_txeofunp_connectuvm_pagermapiniic_smbus_read_byteif_detached_startudsbr_set_infopool_serialuplcom_activateugl_ioctlscsi_probe_lunampintc_calc_maskaue_ioctlirq_entryni6_inputvfs_mountedondb_expressioncputypert_lookupfc_lookup__bss_start__atphy_cdlinear8_to_linear16_be_mtsif_downndqbVOP_GETATTRimxgpio_v6_get_bitieee80211_fix_ratea4x_bs_wm_1ip6_mtudisc_timeoutwihap_deauth_reqieee80211_node2reqwi_usb_matchelf32_check_headerdb_historyttytstampmidi_unit_countieee80211_node_allocieee80211_crypto_detachpmap_unwireipaddrip6_auto_linklocaluvm_pageunwirerti_fillHMAC_SHA256_Inithw_serialehci_device_intr_abortautoconf_attdetufs_chmodbufq_nscan_resortuaudio_halt_in_dmaatascsi_port_set_featurescdattachurioreadin_localaddrarml2cc_enableimxccm_get_usdhxsys_sigaltstacksdmmc_cisptrsoisdisconnectingsched_steal_procwi_media_changesyn_hash2rttimer_queue_headarm_pdcache_sizeucom_dtrrtredirectuvm_map_printitdb_read_variableulpt_cdsoftintr_initieee80211_setkeysdonedb_regsdb_stack_dumpuvm_pmr_pnaddrttymodemdb_lbuf_endehci_free_itdmtx_enterimxesdhc_wait_intraxe_devskqueue_pooluaudio_mixer_set_portvntblinitbuf_rb_bufs_RB_INSERTcpuset_intersectionuhub_activatesleep_queue_initampintc_capmap_preferin6_ifattach_linklocalVOP_REALLOCBLKSugenwritesys_setresgidsdmmc_mem_read_block_subruvm_pmr_freepagesieee80211_input_bamsdosfs_sync_vnodesplassert_failarm_picache_waystty_initaxe_ioctluvm_km_freesys_killrn_mpath_reprioperflevelpmap_set_pcb_pagediruvm_pmr_addr_RB_NFINDrt_setmetricssys_getegiddb_set_single_stepst_spaceuvm_objtree_RB_FINDsw_reg_iodone_internalhidms_detachimxenet_ifmedia_updumass_init_insystemst_quirk_patternsfrag6_deletefraghdruaddr_destroydirchkifaddr_items_RB_FINDipip_outputpipeclosealaw_to_slinear16_le_mtsVOP_REMOVEimxuartconsiohahci_port_signaturewi_usb_activateconsinituvm_pmr_isfreesdmmc_scsi_minphysext2fs_dirremoveuvm_vnp_uncachesysctl__stringffs_clusteracctconfig_detachifaof_ifpforaddrsensordev_listhidms_ioctlrt_timer_queue_destroyatascsi_disk_cmdwi_cdsd_cduvm_pseg_geticmp_mtudiscipport_hifirstautoieee80211_tkip_delete_keysys_fstatimxccm_enable_pcieufs_itimespte_l2_s_prot_uwext2fs_vinitdb_endlpuplcom_intrumass_bbb_resetffs_alloccgbuf_object_storeatascsi_disk_capacity16smsc_wait_for_bitsgeneric_bs_w_1sa6_anysys_getpriorityatu_radfirmarmv7_cpu_sleepsysctl_diskinituvm_km_vallocieee80211_send_mgmtcue_getmacimxuartdefaultratescsi_xsh_delrt_mpath_nextatascsi_pmp_inqscsi_plug_probesys_unmountuvscom_dtrbootdvelf32_probesumct_detachin6ifa_ifpwithaddrvgonelsofreend6_dad_timeruaddr_rnd_destroycpuset_unionuvscom_shutdowndb_del_symbol_tabledb_add_exprpmap_removebpf_mtap_afuaudio_determine_classhidkbd_parse_descicmp6_fasttimouvm_pmr_addr_RB_INSERText2fs_removemtx_initif_clone_destroyehci_close_pipevmcmd_randomizeplatform_watchdog_resetbpf_setfuvm_page_unbusytk_noutusbpalockext2fs_mountpmap_collectukbd_enableuvm_map_addr_RB_PREVdb_symformat_elfgeneric_bs_rr_4cpu_sysctlip_randomidaudio_rintaue_tx_list_initnettxintrsdmmc_io_function_disableieee80211_recv_disassocnosuidcoredumpukphyattachcddumpdb_search_cmdparse_uboot_tagsastusbd_claim_ifacetcp_disconnectuvmspace_execwi_usb_detachsys_mmapehci_bus_methodsbootuaudio_hw_ifnd6_is_addr_neighborunp_rightshostnameaudio_cddb_print_llinfodisk_closepartupl_outputext2fs_bmapuvmexpbufq_doneehci_detachsensordev_getufs_diremptyreinsertfinishdupsleep_setup_timeoutuao_grow_hashukphy_servicesmsc_stoppool_destroylogwakeupshutdownhook_listhidkbd_attachip_dosourcerouteieee80211_node_join_rsnsoread_filtopsieee80211_media2ratedmapoolsimxdog_cdbdevsw_lookupdisk_changeimxccm_get_periphclkuplcom_matchsdmmc_create_threadamap_lookupsdoreallocblksampintc_eoicache_revlookupimxiomuxc_enable_i2cbpfread_filtopssoinituvm_mapent_isjoinableVOP_MKNODuvmnd6_ifdetachin6_ifaddrroute_protofilt_ugenread_isocsync_vopshw_uuidext2fs_truncatecd_play_tracksscsi_do_mode_senseuvm_pmr_allocpmrip6_maxfragpacketsdb_errorehci_confdprefetch_abort_handleruvm_km_threadscsi_probe_buslminm_leadingspacesys_fpathconfarpt_prunekp_zerosoconnect2knote_poolcnopenscsi_test_unit_readynmbclustrum_set_basicratessominconndma_freeuvm_vnp_syncpool_allocator_large_niieee80211_get_disassocwihap_assoc_requaudio_chan_ptransferarpt_downrdgetdisklabelsabrelite_devsulptclosearm_pdcache_line_sizebpf_tapnthreadsdb_lookupuvm_pmr_addr_RB_NEXTnumnegchange_sign16_le_stmmii_phy_autouvm_pmr_addr_RB_FINDuvm_mapent_free_removemsdosfs_initwi_write_record_ioext2fs_writelf_clearlockgeneric_armv4_bs_wr_2uvmpd_scan_inactivech_exchangedb_lastsymurl_memip_srcrouteuaudio_add_mixeruhidioctlip6_accept_rtadvieee80211_recv_4way_msg4pte_l1_s_cache_masksys_setregidusbd_device2interface_handleallowapertureurl_csr_read_1cpuset_infosusbd_dopollvinvalbufsys_ftruncateubsa_dtrm_splitsoftintr_disestablishentropylockfifo_pollumodem_ioctlurl_stoptcp_timer_initdb_tab_stop_widthradioattachdb_putncharsahci_ata_cmd_timeouttuagg_unlockedau_get_mutend6_maxnudhinttcp6_inputsosetoptkp_dirtyehci_set_qh_qtdtcp_mssrt_sendmsgifa_addcache_purgeudav_stop_taskbpf_mcopyrum_write_multiuaddr_pivot_insertfork1db_activeaudio_set_blksizevfs_hang_addrlistst_cach_cacue_tickdead_writeufs_dirrewriteinsmntquettreadtk_canccdb_write_bytesext2fs_blkfreeudp_outputfind_last_setsys_chmoduaudio_get_default_paramsucomreadprelist_removeuvm_objtree_RB_NFINDuao_shrink_arrayffs_vgetaxe_encapinitprocip6_getpmtu__umoddi3bcstatsarm_dcache_alignvm_map_downgrade_lnugencloseip6_log_intervalsched_idle_cpuswihap_auth_requgl_newbufscsi_activate_lunuvm_page_physdumpuvm_atopgX_db_sym_initmaxprocesssyn_cache_timerext2fs_checkoverlapieee80211_auth_opensolisten_filtopshfsc_dequeueatu_internal_firmwareprocess_kernel_argsin6_update_ifaSHA384Updatecdce_detachuaudio_match_alt_rateehci_alloc_itdrt_msg2suser_ucredmulaw_to_alawsd_shutdownahci_ata_cmd_donemem_noext2fs_buf_allocbufbackpagesatu_xfer_list_freewihap_sta_deletestwriteuaddr_kernel_functionspmap_free_l2_bucketrevarprequestmsdosfsreadwrite_filtopsrrw_enterkernel_mapwi_init_iodumpdevwsmouseioctlusbd_ref_incrieee80211_mgt_subtype_nameimxesdhc_shutdownugen_do_readchange_sign16_swap_bytes_le_mtsdb_not_taken_bkptm_printuaudio_chan_inituvm_pmr_splitvfs_mount_foreach_vnodekqueue_kqfiltermidiclosetimeout_add_usecbeagleboard_devswi_mgmt_xmitaudio_openulpt_ucode_loader_hpuhid_do_ioctlzeroin6_addrstrncasecmptimer_filtopsatu_tx_startuvm_objwiretcp_mss_advin_ifaddrnd6_optionwin2unixfnmax_hdrffs_readm_freephtree_RB_FINDimxgpio_caaes_key_wrapieee80211_get_assoc_reqscsi_inqmatchfdesc_poolpool_page_allocin_pcblookupm_tag_delete_chainfilt_pipewriteiicprobencugl_detachbadaddr_read_4bzeroumass_scsi_probeswapdrum_addufs_closedefrouter_delreqfixjobcsdmmc_matchuvm_pmr_size_RB_REMOVEimxenet_miibus_statchgdb_show_all_cmdsscsi_devidin6_addmultirn_newpair__udivdi3sys_obreaksdmmc_intr_enableusbd_set_config_noimxiic_wait_stateieee80211_pmksa_addlastddateucom_do_ioctluvmfault_unlockallm_inithdrpmap_curmaxkvaddruvm_pmemrange_addr_RB_NFINDin6mask0bpf_validateusbd_get_string_descvaccessuao_set_swslotsys___thrsigdivertsys_getdtablecountmbinitchange_sign8tcp_secret_ctxusbd_get_reportabortwskbd_default_bell_datascsi_readsafe_cmdieee80211_set_link_stateamap_allocVOP_LOCKbuf_rb_bufs_RB_INSERT_COLORMD5Finalwskbd_matchcp_timeaxe_rxeofl1_listlinear16_to_linear8_leplatform_smc_writedb_page_print_cmdwi_intrvgetrw_casrd_attachkd_nowaitcdstpugenpollieee80211_create_ibsswsmouseopenwinChksumbufq_requeuefreeclusterchainmld6_initscsi_get_linkswapmapdisk_initSHA256Updateatu_cdrip6_ctloutputrum_prepare_beaconimxocotp_scdisk_readlabelaue_sendusbd_getnewaddrnd6_na_outputext2fs_fhtovpumass_cbi_transferext2fs_createieee80211_gtk_rekey_timeoutimxuartcloseimxesdhc_functionswi_sync_mediauvm_map_teardownpipe_pollpool_reclaim_allucomopensysctl_dopooluhub_matchuvm_mapent_clonetcp_respondsys_readvamap_cow_nowroundrobinbadaddr_readuvm_map_createissignalfilt_uhidrdetachin6_selectrouteieee80211_recv_rsn_group_msg1cdevvpscsi_pending_startmsdosfs_kqfilterch_get_quirksigmp_joingroupuiomovewi_usb_wridrespmsdosfs_startlf_alloccpu_idle_leavedb_loop_countwi_intr_ackbpf_reset_dslinear16_to_mulaw_lend6_dad_stopdiskmapioctlhid_start_parseuseloopbackuvm_waitnexecsststartmclpoolsieee80211_regdomain2namepmap_referencesys_binduaudio_trigger_inputsdmmc_done_xsloioctlrw_exit_writebs_notimpl_bs_wr_8ieee80211_eapol_key_micimxiic_attachumct_initusb_abort_taskspmap_bootstrapbs_notimpl_bs_wr_2sys_mqueryarm_picache_line_sizekmeminit_nkmempagesusbd_new_devicescsi_io_putscsi_iopool_inituvm_pmr_size_RB_REMOVE_COLORmcllivelocksarmv7_bs_wm_2uvm_pmemrange_findfillinusemaprecvitums_cdfilt_sowriteahci_intruvm_kernacccnpollcsys_linkucomsubmatchuvm_addr_initlog_openimxiomuxc_scfilt_randomdetachuvm_pmr_size_cmpuaddr_free_rbtree_RB_MINMAXfragtbl124imxocotp_caieee80211_plcp2ratert_tablesrt_ifmsgrandomread_filtopsimxuart_softintrealitexpireipstatunix2dostimedounlinkatscsibus_caubsa_attachiic_probe_eepromuvscom_openurl_newbufusbd_delay_mscrfreecnputcuhid_do_writeip6_lasthdruhub_uhub_caugen_matchtcp_reaperpool_sethiwatwi_read_record_usbuftdi_methodsmicrotimearm_dflt_intr_establishuvm_pmr_addr_cmppipeunlockuvm_pmemrange_addr_RB_MINMAXuvm_swap_getaudiosetinfoext2fs_reloadelf32_copyargsampintc_intr_establish_extuvm_km_alloc1cdopentcp_usrclosedaue_ifmedia_stsatascsi_disk_vpd_identphysmemuvn_flushurl_cdsdmmc_del_taskuvmfault_relockinferiorukbd_attachclusterallocuplcom_cart_if_remove_rtdeleteamptimer_cdwskbd_attachin_pcbbindumass_cbi_stateudp_notifysdmmc_app_commandpmap_l2dtable_poolendtsleepwihap_check_txstrnlensigactsshareuvm_map_freelist_update_refilldb_set_watchpointuvm_map_addr_RB_NEXTbpfattachuftdi_openugl_openpipesif_detach_queuesitimerdecrieee80211_get_delbaether_outputpmap_bootstrap_pv_page_freeuvm_addr_printbpfilter_lookupm_copym0axe_miibus_readregsdmmc_io_detachvm_physmemrdwriteieee80211_node_join_htrnd_timeoutieee80211_parse_edca_paramspipe_ioctlfilt_timerexpirewskbd_enablepmap_devmap_find_vabpf_allocbufsset_stackptrrt_gettablemsgbufmappedcdsizedb_symbol_valuesumass_lookupdb_evarsupl_activatesmsc_attachiic_smbus_write_byteufsfifo_closewakeupuao_growgetnanotimeimxuart_cdatu_devsa4x_bs_wm_2tcprexmtthreshkprintf_mutexrt_getifadb_malloc_print_cmdwi_get_fid_ioenosyslockmgrrtlabel_name2idhidkbd_is_consoleuvm_vnodeopsdb_bcstats_print_cmdvfsconfVOP_OPENurio_attachbuckstringimxesdhc_soft_resetusbd_fill_deviceinfoscsi_interpret_senseugen_do_ioctlext2fs_flushfilesieee80211_send_eapol_keyimxenet_scwi_usb_txeof_frmufs_readlinkrdopenin6_ifadddoscheckpathrum_set_chanpcbmapaudio_readatu_newstatend6_option_initbufq_quiesceaudiopollext2fs_setsize__guard_localin6_init_prefix_ltimesnchstatsmsgbufpsys_setgidfilt_ufswritert6_flushehci_timeout_taskgeneric_bs_r_4filt_midirdetachmmrwffs_bufatoffieee80211_add_ds_paramswi_usb_rridrespdohooksahci_pmp_cmd_doneieee80211_rssadapt_choosenprocessesehci_free_sqtd_chainukbd_activateif_detached_ioctllocnamppsegswi_usb_caip_mtudisc_timeout_qaddress_exception_entryffs_fhtovpgetvnodefilt_ufsvnodepool_setlowatkmembaseswi_entryrip6_inituvm_aiobuf_poolampintc_intr_stringsysctl_emulseltrue_filtopsamptimer_cpu_initclockssys_sigprocmaskdb_commandin6_if_upfilt_pipereadsoreservedb_formatuvm_mmapusb_activatescsi_report_lunsufs_quotactlradioactivateimxuartattachdosymlinkatuvm_map_uaddraroundin6_pcbnotifyifaddr_items_RB_REMOVEusbd_clear_endpoint_toggleexplore_pendingatphy_matchstrrchrimxuartcnpollcrum_detachst_check_eodgetdevvpm_clgetuaudio_get_cluster_nchandefrouter_selectamap_unrefext2fs_statfsbpf_mtap_hdrcrdupamap_wiperangedb_strlcpycfrootsscsiprintwsmousepollchrtoblkminphysukbd_matchurl_ticksys_fchownatrtalloc_nocloneether_addmultitimeout_mutexieee80211_recv_actioncdce_cdarm_intrffs_vptofhvfs_isbusyifunitimxccm_cdirqstackarm_dcache_l2_nsetsbawritetputcharpoison_valuewskbd_detachpmap_postinitpool_print_pagelistffs_fragacctimxccm_enable_usboh3ffs1_ballocsys_fchownuvisor_methodsums_activatedb_breakpoint_cmdvwaitforiomii_phy_tickcd_read_subchannelsdmmc_io_function_enableuao_shrink_flushflsextendfilelortrequesticmp6_inputbuf_valistsdmmc_io_write_4board_idwi_func_iocreatedefilt_randomreadimxenet_dma_freeuvscom_closeieee80211_michael_mic_failuresbreleasedb_history_sizein6_selectifmsdosfs_islockedmax_linkhdrumass_attachalaw_to_ulinear16_leudav_resetget_stackptrsysctl_rtablemsdosfs_reclaimsys_readlinkatuvm_objtree_RB_REMOVEext2fs_getattrrtlabel_id2namesbdroprecorduvisor_activateuvm_coredumpnamecache_rb_cache_RB_REMOVEsdmmc_io_scanip6_sysctlsuserdiskconfatu_get_card_configvn_syncer_add_to_worklistusbd_get_interface_descriptorgeneric_bs_rm_1memalltk_ninsysfilt_opssdmmc_io_function_readyclusterfreefilt_randomwriteieee80211_alloc_node_helperrootdevaudio_fill_silenceehci_device_isoc_startimxccm_enable_i2cm_tag_firstmixer_closecdmatchpmap_map_entryusbd_get_config_descriptorpfxrtr_delffs_checkoverlapdumpsysicmptstampreplif_detached_watchdogimxenet_attachrip6_sysctlext2fs_fsyncdoforcesys_fsyncwi_usb_stopusbd_reset_portifconfampintc_routeamap_wipeoutswap_bytes_change_sign16_be_stmrum_select_bandtcp_output_bus_dmamem_mmapupdate_ledssdmmc_mem_read_blockext2fs_updatetcp_timer_2mslaue_openpipesudsbr_detachffs_reload_vnodebuf_putmsdosfs_setattrVOP_RMDIRwdog_tickledb_delete_breakpointif_addgroupieee80211_setmodeuhid_matchieee80211_add_ibss_paramseopnotsupppool_allocator_freefilt_procumodem_paramsdmmc_enableffs_reallocblksphtree_RB_INSERT_COLORrandomcloserootvpaxe_miibus_writereguvm_pmemrange_addr_RB_NEXTsun4i_devsugen_do_writeieee80211_eapol_key_decryptpool_reclaiminitdisklabelusb_quirksbpf_sysctlvflushehci_openieee80211_bip_encapmidikqfiltercddetachpmap_clear_modifytcpctl_varsarptimerbufq_dequeuetcp_reass_limitruaddsys___set_tcbrdstrategym_copymbcopy_pageip6_freepcboptsdb_free_breakpointsif_upcoredump_notes_elf32timeout_add_nsecehci_intr1uvmfault_lookupm_extfreeupl_intrucomprintsdmmc_set_bus_powerVOP_BWRITEbufq_fifo_peekrt_timer_queue_createm_cluncountmsdosfs_ioctlupl_matchspllowerno_constraintsys_openurio_matchusbd_match_deviceinet6domain_bus_dmamem_alloc_rangeether_crc32_be_updatepgdeleteuvm_pageidlezerowskbd_do_ioctl_scsdmmc_io_initdead_vopsdb_symtabsieee80211_media_changeucom_detachuaddr_hint_createraw_attachhidkbd_cngetcscsi_ioc_cmddb_boot_sync_cmdamptimer_readcnt64astpendingifnewlladdrether_ip6multicast_maxpipe_pooluao_initudav_iffimxiic_cdsdmmc_needs_discoverifa_ifwithroutem_clinitifpahci_pmp_writeumidi_get_quirk_data_from_typeuaudio_set_speed_emu0202spec_kqfilteratascsi_disk_unmap_tasktcp_notifyieee80211_match_bssffs_dinode1_poolieee80211_set_keyarm_setsoftintrimxccm_cpuspeedieee80211_bip_delete_keydb_print_positionrtflushclonedb_radixgetblkmaxsmapip6_mcast_pmtusoconnectvtypesuvm_map_fix_spacenobuffers__lshrdi3data_abort_handler_addressin6_delayed_cksumrtrequest1usbd_errstrtcp_identtcp_rst_ppslimifinitsd_cmd_rw10cd_load_tocunpst_recvspaceuvm_map_mqueryscsi_io_getget_ifidkue_inituvm_map_kmem_growraw_inputkue_ioctlfilt_logrdetachtimeout_add_btnd6_ifattachunpdg_recvspaceaudio_quiescedofaccessatpipe_closeaudio_drainsoftdep_mountmsdosfs_rmdirdb_is_activemsdosfs_fsynccfdataffswi_usb_tx_lockusbd_do_request_async_cbufs_checkpathpfxlist_onlink_checkdiskmapreaddb_elf_lookupinittodrm_tag_findvputaue_iffpte_l1_s_cache_mode_ptvector_page_setprottcbhashsizeworkq_syswqusbd_get_configieee80211_node_leave_rsnuaddr_kbootstrapufs_quota_initallocpidkqread_filtopscoredump_writeusbd_setup_pipeaudio_closeaue_csr_read_1ieee80211_beacon_allocbuf_acquireatu_attachubsa_get_statusdolinkatbioopsahci_unload_prdtcpu_classesieee80211_add_htopbpf_setdlttcp_flush_queuepool_setiplarm_intr_establishmsdosfs_statfslboltpipe_inituvm_wait_plarn_mpath_priousbd_open_pipe_intrsyncerprocifa_print_rbufs_ihashinsin_setpeeraddratu_taskdb_readlineether_ifdetachieee80211_recv_probe_requhidev_get_report_descrndstatsst_touch_tapesdmmc_mem_write_block_subrmsdosfs_inactiveimxccm_capanicstraudioioctlupl_newbufumass_scsi_cbscsi_delayext2fs_sync_vnodeimxccm_disable_usb2_chrg_detectif_startunpdg_sendspacesession0viscpywsmouse_do_ioctlehci_abort_isoc_xferhw_ver__umodsi3copyinudav_senduaudio_round_blocksizeehci_reverse_bitsrtalloc1bs_notimpl_bs_sm_8uao_swhash_elt_poolufs_ihashgetuaddr_pivot_selectsigacts0uaddr_free_rbtree_RB_REMOVE_COLORfindblkmajormsdosfsvnode_filtopsntohlsorflushugen_cauvm_mapent_tryjointtioctlarpintrqttycharsvprintfslpquesyncdelayuvm_vslock_devicewi_usb_infofrmugenreaduvm_pagealloc_multihidkbd_enablesdmmc_io_read_2ffs_mountuaudio_chan_rtransfericmp6errppslimbadaddr_read_2msdosfs_vopslinear8_to_linear16_beimxgpio_get_bitconfig_process_deferred_childrenbufq_waitieee80211_add_htcapsahci_port_allocsdmmc_decode_csdbs_notimpl_bs_sm_2in6_setmaxmtumsdosfs_rootimxesdhc_cdbpf_getdltlistm_tag_getuvm_map_freelist_updateuaddr_bestfit_insertsb_lockatascsi_probeuaddr_bestfit_removert_labelsHMAC_SHA1_Finalupl_watchdogsuid_clearttwritedma_alloc_initatu_initchange_sign16_lebuf_rb_bufs_RB_NFINDbuflowpagesaudio_wakeupehci_activateswapdev_vpieee80211_deliver_datadead_readufs_pathconffile_pooldb_boot_reboot_cmdunputcendVOP_CREATEcpuset_firstatascsi_disk_inquirySHA512Updatecdce_stopifai_cmpahci_port_inituvscom_get_statusnd6_recalc_reachtm_intervalin_ifinitfifo_closein_pcbhashlookupsys_mknodatkp_dmaucom_cleanupVOP_ABORTOPehci_pcdcoredump_tradchange_sign16_swap_bytes_ledofchownatuvscom_set_line_codingsys_acceptuvm_map_entry_kmem_pooluvm_pagerealloc_multiieee80211_wep_decryptcwbpwi_inquireadm1032cloneprobearml2cc_sdcache_wbinv_alluaddr_bestfit_pooltcp_rst_ppslim_countieee80211_recv_assoc_respieee80211_parse_rsn_bodyukbd_detachaes_key_wrap_set_keyif_clone_listtc_windupsys_futimessdgetdisklabelsysctl_proc_cwdwi_do_hostdecryptinternal_commanduvm_map_boundarymalloc_errintvlin_losingVOP_SYMLINKgeteblkusbd_set_interfacescsibusmatchvn_ioctlwi_usb_ctl_lockufsspec_readdb_show_calloutaxe_cdrum_tx_datapipespacefiqvectorget_last_resort_ifidip6_sendredirectsddb_sysctlukphy_caitimerfixip_stripoptionsieee80211_node_join_11gsyn_cache_countulptuseinuaddr_stack_brk_createieee80211_add_xratesnd6_timer_chugl_rxeofuvm_pseg_releaseahci_pmp_probe_timeoutcpu_resetudav_ticktcp_ctlinputether_multiaddrstart_cleanerarmv7_bs_w_4ffs_blkfreearmv7_tlb_flushI_SEexit1rum_media_changebdevvpifa_ifwithdstaddrehci_cduaddr_bestfit_selectuvmspace_dusedmidi_ointrdb_watchpoint_allocudav_ifmedia_changeselectroutearmv7_tlb_flushID_SEin6_nigroupscsi_mode_sense_big_pagesys_mkfifoatuihashrijndaelEncryptscsi_ioh_deltcp_keepintvluvisor_detachcdwriteufswrite_filtopsttybgconfig_searchrum_newstatephtree_RB_PREVwihap_sta_findusbd_printuvm_km_valloc_prefer_waitsyn_cache_poolpmap_kernel_l2ptp_physffs_allocaue_tick_taskdb_prevucom_hwiflowbswap32ipsec_exp_first_useplimit_poolip6_defhlimumass_setup_ctrl_transferunp_connect2usbd_set_pollingrn_walktreepool_prime_pagechclosestclosesys_chownuvm_pagewirein6_joingroupsys_munlockuvm_anfreedofilereadvimxesdhc_host_maxblklenipip_sysctlbs_notimpl_bs_sr_1vn_statfileieee80211_iterate_nodesrw_exit_readwi_intr_enabletablefullumct_set_line_stateuhub_explorearmv7_bs_r_1upl_txeoftcp_maxidlevfs_getcwd_commonststrategyset_cpufuncscttyioctlsys_lstatieee80211_recv_wpa_group_msg1ieee80211_recv_addba_respieee80211_tkip_set_keycttykqfilterurl_activatecttyopenpmap_link_l2ptinet6ctlerrmapicmp6_redirect_diagdisknamessched_queued_cpusmidi_iintrumass_quirksdumplomsdosfs_mountffs_clusterallocrum_read_multiuvscom_activatenullcnpollcuvm_km_inituvm_objinitbzero_pageffs_sbupdateudp_sysctlsys_openatm_clcountbs_notimpl_bs_wm_1vmmapbsyusb_add_taskurl_int_miibus_readregdb_list_breakpointsusbd_set_protocolnkmempages_minukbd_accessopsusbcloseudav_matchvector_pagekq_ntimeoutssys_sched_yieldvmspace0stmatchchmatchscsi_decode_sensettywaitwsmousedevprintuvm_map_setuptcp_syn_cache_sizeuao_grow_arrayieee80211_add_tieetextifa_ifwithnetmemchrpte_l2_s_cache_maskieee80211_recv_barsysctl_cptime2sdmmc_cascsi_mode_sense_pageboot_argspipelockumass_scsi_setupproc_pooluplcom_dtraue_intrudp6_inputsys_writedb_get_valuegeneric_armv4_bs_rr_2sb_maxusbd_fill_iface_datacd_set_pa_immedulptopen__bss_end__ip6_insertfraghdrcnstopextent_print_allihashtblieee80211_set_shortslottimesys_dup2db_inst_countdb_read_linearm_set_intr_handlerbread_clustersys_readlinkext2fs_size__ashrdi3bs_notimpl_bs_mmapip6_auto_flowlabeldevid_copylf_splitifafreeVOP_STRATEGYtimeout_add_sectzucom_rtsrip_sendspacecoredump_writenote_elf32uhidev_writeusb_generic_tasksamap_addtcp_freeqif_setgroupattribsdvd_authswap_bytes_change_sign16_be_mtsumass_scsi_cmdcdreadarmv7_bs_sr_1spec_inactiveehci_device_intr_starthidms_setupwi_func_usbsys_sendtoicmperrppslimgeneric_filtopsknote_dropuftdi_setcue_watchdogampintcin6_selectsrcrd_casdmmc_read_cissoftclock_siwi_usb_threadugl_watchdogin6_pcbsetportalldevsatascsi_disk_cmd_doneicmp_do_errorvmcmd_map_readvnsmsc_initrandom_startusbd_get_interface_altindexamap_extendsigpropvmapbufumass_scsi_switchdehashtblsocketopsX_db_sym_numargsnd6_maxndoptuvm_map_clip_startffs_fragextendtcp_always_keepaliverawcbtablespec_readumodem_cdunp_markicmp_mtudisc_timeouta4x_bs_r_1ttyread_filtopsuvm_mapiic_printgetinoquotafifo_ebadfscsi_do_ioctlrtable_existsdisk_lock_nointrehci_free_sqhcd_resetX_db_forallscsi_ioh_addscsi_detach_busudpstatroute_inputsetrootcd_read_toccdioctlieee80211_defrag_timeoutbufq_switchcue_stopuvscom_detachifmedia_addatu_usb_requestfrag6_queueusbd_set_config_indexlogopenieee80211_add_rsn_bodycd_buf_donescsi_devid_pg80breadntcp_hdrszscsi_devid_pg83tcbtableieee80211_recv_4way_msg2__xordi3frag6_drainuvm_objtree_RB_REMOVE_COLORdosdiremptyulpt_load_firmwareigmp_slowtimoifpromiscimxenet_encapip6_setpktoptsfork_returnsys_getsocknamewi_usb_intrusbd_alloc_buffermask_rnheadsw_reg_iodonepte_l2_s_protoarmv7_tlb_flushIufs_rootsdmmc_detachtcp_sysctlVOP_SETATTRsmsc_chip_initpmap_kremovesigactsinitsdmmc_io_rw_extendeddomknodatusbd_set_reportcpu_kcore_hdrexec_elf32_fixupradioopenrt_newaddrmsgvop_generic_lockuvmfault_anongetconsttyusermountext2fs_dirrewrite__ucmpdi2vn_closefileumass_discoip_mtudiscvfs_free_netcredmld6_start_listeningcpu_mainbus_cakue_matchpmap_kenter_papidhashtblaue_matchusbd_get_protocoluvm_mapent_forksharedm_pullupenterpgrpatascsi_atapi_cmd_donecnbellm_copydatabufq_nscan_requeueimxccm_armclk_set_parentatu_stopcd_setchanuaudio_value2bsdieee80211_get_probe_reqmtx_leavefilt_signalsigactsfreeuaudio_feature_namettymallocupl_attachums_intricmp6_notify_errorieee80211_recv_probe_respsxia1x_initbs_notimpl_bs_sm_4kue_setmultimmioctluaddr_free_rbtree_RB_NFINDuvm_coredump_walkmapdb_nextumass_matchsched_choosesendsigsdmmc_print_cisbpf_ifnamesmsc_iffvfs_busytimecounterfilt_ufsdetachbufq_initlf_getlocksolistenwskbd_compose_valuespec_getattriic_scanip_ecn_ingressmsdosfs_bmaprip_ctloutputffs_vtblif_getgroupieee80211_parse_rsnpool_debugkqueue_ioctlmax_processessys_wait4rip6_recvspaceamap_share_protectieee80211_bar_tidfs_sysctlukbd_cnattachieee80211_ibss_mergeboot_filefilt_sordetachknote_activatepsignalieee80211_regdomain_compare_cnconfig_pending_incrusb_task_threadimxuartconsiotamap_pp_establishieee80211_setkeysuvm_pmr_nextszatu_activateuvm_anon_initffs_reclaimusb_free_deviceusb_exploreifaddr_items_RB_REMOVE_COLORbufq_nscan_queueif_link_state_changepmap_virtual_spaceieee80211_add_wpaieee80211_eapol_key_check_micusb_disconnect_portpage0_endieee80211_add_capinfobpfpolluvm_pmr_nfindszupdateprisched_kthreads_createumidi_search_quirkulinear8_to_linear16_be_mtsuhid_cdwskbd_cnbellbintimewi_seekfilt_soreadrtable_addzeropageipsec_def_encffs_nodealloccgsoftintr_establishuvm_pmr_removeip4_input6pdevinit__iordi3uvm_pmr_findnextsegmentinetctlerrmapresetpriorityau_set_portenoioctlwi_usb_start_threadflslsigacts_poolexecsigsconfig_initskip_fcicmp6_redirect_inputbuf_rb_bufs_RB_REMOVE_COLORrw_enteraue_read_macuvm_addr_destroyst_interpret_sensech_interpret_senseuvm_pmr_size_RB_MINMAXmixer_ioctlpmap_pv_pooldb_access_abt_spnd6_ra_inputffs1_blkprefin6addr_loopbackuvm_objtree_RB_MINMAXvprintttypendarmv7_icache_sync_rangeuvm_swap_freepagesnd6_dad_starttimerin_revarpinputstrlcpyuaddr_bestfit_destroyX_db_symbol_valuesehci_device_isoc_methodsumodem_setusbd_reload_device_descsmsc_read_regext2fs_advlockknote_fdcloseusbd_get_devcntehci_device_intr_doneahci_detachimxccm_get_ipg_perclkif_clone_detachpipe_rfiltopsubsa_openin6_cksumstrncmpcsrc_ptevfs_shutdowngetsockieee80211_get_deauthbs_notimpl_bs_c_4upl_startsyn_cache_respondif_creategroupllinfo_nd6sbcheckreservepreemptuvm_ioieee80211_begin_scanunixdomaindb_next_free_breakpointscsibusattachugl_devsumct_rtsaudiowritesyn_hash1ulminwihap_data_inputarml2cc_cache_way_opdb_last_symtabproc0paddrrn_addmaskifaddr_itemsahci_port_intrusb_attachbpf_bufsizeselscansoo_pollumodem_activateulpt_attachuvm_map_uaddr_ertafidx_maxsig_filtopsknote_processexitukbd_cdwskbdopenttclosurl_rxeofipsec_soft_allocationssleep_setup_bus_dmamem_mapst_mount_tapeip6_fragmentnet_sysctlsxia1x_devsuaudio_identify_actimeout_adjust_tickswskbd_do_ioctluvm_pmr_size_RB_FINDudv_listdead_ioctlaue_initusb_matchsdmmc_complete_xssysctl_iflistvwakeupif_clonersvgonepmap_initializedtcp6_ctlinputsched_init_runqueuesdb_stack_trace_cmdusb_allocmematascsi_disk_inqsd_sizeufsspec_closend6_prefix_offlinkuvm_anon_dropswapwi_detachucom_lockigmp_inputkmemusagelf_getblockautoconf_attdet_mtxumodem_attachpmap_pmap_pooltcp_rttdfltcleanerprocuaudio_unsignextfifo_reclaimieee80211_parse_edca_params_bodysbappendstreamm_tag_copy_chainsowrite_filtopsstrncpydb_disasmsdreadsys_pselectlinear16_to_ulinear8_leupdatefatscue_memvfs_getvfsaue_txeofffs_sync_vnodeimxenet_init_txdproc_stopvfs_vnode_printdb_history_lastrrticks_initusbd_set_port_featurebpfilter_createsysctl_locklockfpoolwihap_disassoc_reqaudioread_filtopsieee80211_find_nodecpu_switchtoucom_caimxesdhc_host_resethtonlsched_all_cpusin6_mask2lentcp_dooptionsdos2unixtimesys_sigactionatphy_cadeupdatusb_fill_di_taskehci_ifcdSHA256Transformrndlock__negdi2in6_purgeaddrcpu_modelimxuart_caarmliicc_caarm_dcache_align_maskcttyreadschedclockrum_cabpfioctlconfig_attachcue_rx_list_initimxuartcnattachdisk_unbusysysctl_fileusb_syncmemugen_detachsoisconnectedsdmmc_ccb_allocamap_clean_worksimxenet_initimxiic_i2c_execusb_block_freememVOP_PATHCONFumass_fixup_sonydk_mountrootassertwaitokdb_run_modescsi_minphyssdmmc_delayvattr_nullsys_getsockoptumct_paramuhidev_attachdb_vprintffrag6_nfragpacketsarmv7_drain_writebufdb_linepool_allocator_largeuvm_anon_lockloanpgvfs_sysctlcpu_get_controlVOP_READLINKbuf_mem_initumass_cbi_methodsdb_ed_stylemii_submatchuvmexp_printmsdosfs_pathconfoldpidstimeout_wheelbpf_m_xhalfumass_io_getaverunnablettyfreettysleepehci_root_intr_doneatu_get_opmodeunp_disposechquirksscsi_inquireufs_getattrieee80211_mhz2ieeevfs_exportuplcom_closeuvm_km_pgremoveex_region_plfscalesmsc_matchffs_alloccgblkip_optcopyvfs_registerieee80211_proto_attachm_livelocksys_dupulinear8_to_alawmcllowatmii_printieee80211_setup_ratesbpfilterattachproc_stop_toarmv7_bs_rm_2armv7_dcache_wbinv_rangeimxgpio_set_dirtimeout_tododb_lcarmv7_bs_unmapcpu_read_cache_configpanicarmv7_idcache_wbinv_rangeget_pc_str_offsetcue_rxeofL_cksumdatamsdosfs_lockseltruebpf_m_xwordimxuartcninitscsi_xs_syncieee80211_recv_group_msg2softdep_initializestackgap_allocunp_shutdownarm_do_pending_intrieee80211_tkip_encryptwi_resetdovutimensdummy_get_timecountext2fs_sysctlgeneric_bs_wm_4kthread_run_deferred_queuearc4_initahci_active_masklastdaycheck_execdb_max_linewi_usb_cdtcp_initsdmmc_start_xspte_l2_s_cache_mode_ptdeferred_config_queueucomreadcbbuf_rb_bufs_RB_MINMAXnetisr_initipport_lastautouaudio_chan_opendb_last_commandip6_pcboptwinSlotCntvn_kqfilterext2fs_syncsched_stolenpoison_checkpte_l2_s_prot_maskudav_ioctlcache_purgevfspostsigsys_pathconfcue_open_pipesin_addmultigetmicrotimeatascsi_disk_sync_donebs_notimpl_bs_rm_8maxthrsleepumass_clear_endpoint_stallimxuartconscflagaue_newbufscsi_probedevaxe_ax88178_inittcp_templateieee80211_notify_dtimmsdosfs_readdb_object_print_cmdimxesdhc_wait_stateusbd_setup_xferieee80211_tree_RB_MINMAXmtagpoolbcopyiic_attachwsmouseclosewdog_autourl_tick_taskrum_amrr_startcue_detachusbioctl_bus_dma_inrangekqueue_wakeupip6_unknown_optuaddr_rnd_removetcp_reasssys_getfhomap4_initext2fs_vgetrt_timer_timerrtbl_id_maxKERNEL_BASE_physehci_alloc_sqtdimxgpio_v6_get_dirgeneric_bs_rr_1ni6_addrsaxe_resetdefrouter_addreqin6_clearscopend6_dad_ns_inputuvmpd_tuneusbd_set_addressaudio_free_ringudav_openpipesffs_setblockipsec_expire_acquireimxenet_ifmedia_stskue_stopicmp6_mtudisc_cloneatu_send_commandmemcmpwskbd_init_keymapnamecache_rb_cache_RB_REMOVE_COLORumct_dtrip6_dad_pendingieee80211_rate2plcpmsdosfs_createdb_output_linedb_examinecfroots_sizeimxuartcngetccwb_ptearmv7_dcache_sets_incdb_end_linetickadjpool_alloc_item_headerip6_splithdruvm_map_addr_augmenttcp_secret_initieee80211_recv_sa_query_reqsbreserveslinear16_to_alaw_be_stmundefined_initvrecycleubsa_matchin_pcbnotifymissextent_printaudio_caieee80211_alloc_nodecrcopydb_symformatundefined_handlerscortexmatchsys_revokesysctl_stringsys_rebootuvm_unmap_kill_entryext2fs_specvopsbufpoolproc_finish_waitarmv7_bs_rm_4_bus_dmamap_load_buffercpu_forksigonstackumidi_activateuaddr_kbootstrap_selectaudioopenwi_write_data_iodb_print_ifattylistuvm_vslockuvmfault_update_statsttyoutputkue_caexplicit_bzerowskbd_cauftdi_8u232am_getratecopyaddroutumodem_detachcpuset_add_allVOP_READufs_ioctlffs_freefilein6ifa_ifpforlinklocallastdtimegetdisksys_setuidahci_put_pmp_ccbstart_updateudav_cdusbd_clear_port_featureusb_abort_task_threadufs_quota_free_blocks2senditudp_detachbufq_fifo_destroyarmv7_bs_freecluster_writernd_event_tailuriopollhidkbd_decodeuvm_setpagesizeehci_root_intr_closetcp_xmit_timerst_rewinducomwritein6_recoverscopeaue_tickch_positiontimeout_add_tvtickmclpool_warnmsgscsi_pending_finishdb_termscsi_preventmmcloseieee80211_get_assoc_respffs_statfsrijndael_set_keycpuset_complementudp_recvspaceuaudio_caa4x_bs_w_1km_allocfdropsyn_cache_unreachsys_getrlimiticmp6_errcountbpf_attachdicmp6_ctloutputieee80211_ba_move_windowulpt_statuscpuset_issetufs_dirremoveumct_setieee80211_add_timarmv7_bus_dma_tagrum_amrr_timeoutamptimer_intrif_attachsetuppipe_writem_clsetwmsuvm_map_addr_RB_FINDin_pcblookup_listensbappendm_copybackscsi_remove_linkuvm_swap_puticmpbmcastechoHMAC_SHA1_Initfifo_advlockextent_print1db_continue_cmdehci_timeouturio_activatebufheadconfig_scanatascsi_atapi_cmdwi_get_nwkeyatascsi_disk_vpd_atakp_pageablepmap_copy_page_funcuaudio_chan_psync_transferripsrckue_txeofugenkqfilternlineswdb_restart_at_pcdb_sstep_printether_ifattachsdmmc_function_freeumass_adjust_transfersignal_initfill_drlistffs_updatedb_print_formatunix2dosfnspec_advlockfragtblraw_sendspaceubsa_cauvscom_breaknullopuftdi_2232h_getratesdmmc_intr_disableAES_CMAC_SetKeyextralocvop_generic_bmapunsleepimxuartconsaddrscsi_xs_getX_db_lookupsched_proc_to_cpu_costipintrgetnanouptimeudav_activatesdmmc_scsi_detachmaxdmapusb_block_allocmemext2fs_symlinkdb_skip_to_eolip6_savecontroldevice_registerau_check_portsimxahci_attachimxccm_get_pll3_pfdnd6_dad_stoptimerq_to_bmountrootsdmmc_scansyn_cache_resetdb_inputcharimxesdhc_transfer_datauhidev_opendb_boot_cmdsundefined_entryip_initreaddeprocess_read_fpregsufs_check_exportsysctl_rdintcd_interpret_senseampintc_irq_handlerin_mask2lenscsi_iopool_destroylodirtypagesimxuartwriteumct_get_statusfindwin95VOP_WRITEsys_nanosleepstart_init_execifa_update_broadaddratu_detachnd6_addr_addifa_ifwithaddrclock_ymdhms_to_secsrootduiddb_write_cmdif_clone_attachuplcom_get_statussys_getfsstatbpfopencdstrategynetisr_intrrandomwrite_filtopsahci_empty_doneimxiic_writend6_slowtimo_chuvm_km_valloc_alignrum_set_bssiddb_max_widthip6_pullexthdrfilt_audiordetachmalloc_printitulptwritestreadcpu_idle_enteruvscom_intrbuf_kva_starttuagg_subVOP_RENAMEcdclosesys_fchdirsdmmc_scsi_cmdext2fs_fifovopssysctl_ifqprocess0ieee80211_send_eapol_key_reqm_cltick_tmorandompidurl_initfilt_ttyrdetachsdmmc_mem_send_op_condarp_inuseuhidwrite_bus_dmamap_destroyvn_pollinet6swrouteswdosdirtemplatemainbus_cddb_uvmexp_print_cmdahci_ata_probeuaudio_query_encodingsys_mincoreamptimer_setstatclockrateieee80211_tree_RB_REMOVEuaudio_add_processinglastsecondswdog_timeoutuaudio_signextwsmousedoopenwi_get_txpowerudav_stopimxehci_detachusbd_error_strsaudioactivatetcp_maxpersistidleudav_tx_list_initspec_ioctlufs_initproc_reparenta4x_bs_r_4uvm_exitfc_bmapcallspr_rmpageffs_initsdmmc_submatchcluster_wbuildscsi_ioh_setbootsyncuvm_initahci_ata_cmdaue_attachieee80211_crypto_attachsys_ioctluvm_map_addr_RB_NFINDif_free_sadldb_dotsdmmc_attachucomstopieee80211_node_joinfilt_bpfrdetachrum_update_slotumodem_openst_loadquirksicmp6_initbs_notimpl_bs_rm_1disassembleuvm_mapent_free_insertfilt_ttywritepool_update_curpagehid_end_parsein_setsockaddrbpf_moveinostypevndbuf_pooluplcom_resetuvm_page_physloadaudiogetinfoaxe_iffucomstartreset_entryuvm_pmr_remove_1strangefilt_midiwdetachip6_insert_jumbooptipintrqtuaggudsbr_statusmidiwrite_filtopsusb_frag_freelistip_slowtimordsizeuaudio_add_inputrijndaelKeySetupEncubsa_rtsip6_nexthdrrtdeletemsgumidi_cd__bss_startrt_tab2domkue_rxeofVOP_KQFILTERukphy_funcssys_msyncwskbdreadsbappendrecordevcount_detachsd_casoftdep_fsync_mountdevinitmsgbufehci_device_bulk_startrum_select_antennawsmouse_attachmemsetpipe_free_kmemufs_getlbnsieee80211_get_actionieee80211_sa_query_requestphysioin6_selecthlimdb_show_all_vnodesimxenet_iffupl_senddb_symbol_is_ambiguoususbd_set_report_asyncmii_phy_delete_mediain6_unlink_ifaicmp_mtudisc_clone_splloweruvm_pmr_insert_sizesodisconnectrw_assert_unlockedumct_closesys_setgroupsmainaue_csr_write_2ahci_flush_tfducomttyimxenet_init_rxdether_crc32_le_updatetimespecfixuplcom_openarm_dflt_splraiseuaddr_bestfit_createatascsi_donestminphysip_flushieee80211_delete_keymidipollkue_startaudio_polluvm_unmap_removeatphy_attachpmap_alloc_l1imxuartprobeicmp_errordb_hangmanbs_notimpl_bs_sm_1upl_rx_list_inituvm_swap_markbadkqueueopsaudio_pintsmsc_miibus_statchgvholdbufq_fifo_dequeueubsa_parityurio_detachidgen32db_help_cmdrt_if_removescsi_default_getusbd_no_quirkmidiopenm_adjalaw_to_ulinear8mld6_stop_listeninguao_shrinkpmap_map_chunkextent_alloc_subregion_with_descrppsratecheckkmemlimitbuf_rb_bufs_RB_PREVamap_copybufq_drainphysical_enduhidpollieee80211_ieee2mhzsched_wasidleieee80211_dup_bsssysctl_kmemlockuaddr_hint_destroylf_findoverlappandaboard_devsfilt_msdosfsvnodelf_wakelockkv_anydb_sym_numargskue_attachhookdumpconfAES_CMAC_Initwi_rxeofimxuart_pwroffuaddr_lin_selectdead_badoppool_large_alloc_nicalcrusys_unlinkdb_cmd_listmainbusmatchrt_setgateulpt_activatetcp_ack_on_pushpmap_growkernelext2fs_rmdirufs_chowndofchmodatsysctl_intampintc_cdupl_tx_list_inituvm_shutdownkqueue_closepte_l2_s_cache_modeuvn_initstrlcatsysctl_int_arrulinear8_to_mulawau_set_gainbs_notimpl_bs_wm_8uvm_map_set_uaddrcdce_matchumidi_quirklistsoftintr_dispatchdisk_unlockufs_ihashremtaskq_destroyieee80211_recv_4way_msg2or4cttywriteimxehci_attach_bus_dmamap_createSHA256Inittcp_update_sndspacearm_splassert_checkurl_stop_tasksdmatchusb_freememudav_txeofatascsi_io_getpool_chk_pageproc0cdce_initufs_renameaxe_cauaudio_chan_pintrext2gennumberudav_attachuvm_map_entrybyaddrusbd_get_hid_descriptorrt_ifannouncemsgsoo_readimxccm_attachuvm_km_doputpageufs_opencopyout_statfspmap_modify_pvsplxm_catrtinitcluster_collectbufskp_dma_contigwi_write_data_usbumass_scsi_minphysuvm_swap_inituaudio_add_featureuaudio_chan_alloc_bufferstcp_nowahci_port_freeaue_miibus_statchgdb_trace_until_matching_cmdproc_printitunp_gcsys_clock_gettimeip6_hdrnestlimitpool_catchupcpuset_clearfrag6_initbuf_replacevnodeimxesdhc_card_intr_maskuvm_pmr_size_RB_NFINDuvm_mapent_addr_removetimeout_setrdread__subdi3armv7_dcache_inv_rangentohsmsgbuf_putchar_bus_dmamem_freedb_boot_poweroff_cmdsd_flushcd_setvolext2fs_mkdirmii_pollstatpte_l2_s_coherentext2fs_direntersys_symlinkatrw_exitst_erasekv_pagedupfdopenidgen32_initchange_sign16_beifmedia_list_addpidhashrtprefuvm_totalencdebugugl_sendicmp6_ratelimitdb_unread_charsys_mkdiratsdmmc_io_attachiic_searchdofstatatstart_inituhub_attachieee80211_recv_assoc_reqether_fakeaddrsysctl_tc_hardwaresmsc_rxeofscsi_ioc_ata_cmdtcp_mssdfltampintc_setipluvm_swap_freeatu_newbufdata_abort_handlerbs_notimpl_bs_r_1axe_initdb_look_charuhidev_set_reportin_pcbdetachmsdosfs_vfsopststohzaue_ifmedia_updradiodetachcd_sizettycheckoutqicmp6_mtudisc_callback_registerdb_set_variableuvscom_set_linevm_map_unlock_read_lnaue_causb_explore_tasksrnd_event_spaceswap_bytes_change_sign16_le_mtspmap_clear_referencert_getmetricsin6_ifdetachcn_tabdb_search_symbolswaplist_insertsmsc_lock_miiip_forwardsensors_taskqextent_createrdclosebpf_freeddisklistslinear16_to_alaw_leswap_bytes_change_sign16_bein6_lifaddr_ioctlsys_fstatfsurl_txeofkue_devsbs_notimpl_bs_sr_8m_injectimxenet_miibus_readregip6_mforwardingimxccm_scffs_isfreeblockatascsi_disk_start_stop_doneseltrue_kqfilteruvm_map_lookup_entryhztobs_notimpl_bs_w_4ieee80211_get_probe_respdead_strategyswi_handlerni6_store_addrsrum_txeofspec_fsyncuvm_map_deallocateicmp_reflectieee80211_parse_wpaarml2cc_cache_syncscsi_xsh_iohext2fs_reclaimffs_ballocsys_getgroupsurio_cdieee80211_node_attachsys_linkatuhub_cdwi_start_usbgeneric_bs_wm_1ip6_raw_ctloutputkernel_textumodem_get_capsufs_startsigstkinit__end__kinfo_vdebugurl_sendcdce_encapufs_bmaparrayfragtbl8uvn_sync_lockarmv7_dcache_sets_maxumct_attachurl_resetusb_needs_explorearml2cc_scswaplist_findufs_quota_alloc_blocks2fc_fileextendsfilt_sigattachwsmouse_cdsdmmc_go_idle_stateVOP_FSYNCffs_sysctlipport_hilastautoarpinit_doneusb_wait_taskuvm_anon_pageinspec_closeuvm_map_mkentryatascsi_freeuvm_map_addr_RB_REMOVEsys_shutdowncngetcehci_rem_qhtc_adjfreqrnd_statesuaddr_pivot_createm_gethdrahci_ata_put_xferrum_cdugen_activateconfig_rootfoundahci_dmamem_freecue_cdputcieee80211_phymode_namebufbackoffsysctl_rdstruct__divsi3uhidev_cdwsmousereadschedcpusbappendcontrolukbd_set_ledsa4x_bs_rm_1ampintc_matchwihap_sta_timeoutugenread_intr_filtopssoftdep_flushfilesdb_access_und_spipv4_inputm_getclrpool_headipforwardingieee80211_get_cts_to_selfdb_lexusbd_open_pipe_ivalicmp6_redirect_timeoutaudio_calc_blksizesyn_cache_lookuparml2cc_cache_range_oparm_clock_registerprtactiveaudio_mmapimxiomuxc_caksym_upcaseufs_makeinodescsi_xs_ioip6_process_hopoptsufsfifo_readusbd_find_edescif_link_state_change_taskfifo_writefilt_ttyreadsys_getpgidswaplist_trimcache_lookupaudio_clearrdioctlrijndaelKeySetupDecdb_boot_crash_cmduvm_objtree_RB_INSERTsysctl_tcurl_detachbs_notimpl_bs_rr_1umass_scsi_sense_cbsdmmc_intr_disestablishrijndael_encryptieee80211_recv_mgmtimxenet_chip_initaxe_detachdumpsizesowwakeupukbd_keydesctabsdmmc_io_read_multi_1smsc_setmacaddressextent_freeuvm_aiodone_daemonaddupc_tasksched_syncusbd_clear_hub_featureext2fs_vopsieee80211_send_4way_msg3db_mount_print_cmdsetsigvecurl_iffsys_sendmsgimxgpio_clear_bituhidopenvn_marktextiic_cdimxuartttystrcmpsys_quotactluhidev_matchieee80211_get_hdrlenuaddr_pivot_destroytcp_mtudisc_increasearm_intr_funcsdmmc_card_attachulmaxatu_txeofin6_pcbconnectdehashahci_port_stopkue_cduvm_pmemrange_addr_RB_INSERThook_disestablishudsbr_setfreqbpf_catchpacketahci_enable_interruptsffs_isblockucomwritecbdb_stack_trace_printusbd_find_quirkuaudio_getuvm_swap_allocpagesuvm_aobj_pooldb_show_frame_cmdsys_adjfreqdb_examine_cmduvscom_seticmp6_reflectsetrunqueueudv_attachsettimecdce_rx_list_inituhub_intrarm_pcache_typertable_inituaddr_lin_functionsuvm_addr_entrybyspacemii_phy_auto_timeoutsyn_cache_getnetisrdb_clear_breakpointsttyrubieee80211_get_ratevop_generic_islockedrum_taskuaddr_hint_pooluaudio_match_altm_pulldownbufcachepercentpmap_initufs_rmdirieee80211_next_scanudsbr_startminpmap_zero_page_funcip6_initconfig_detach_childrenrawcbsmsc_detachukbd_cngetctcpcb_poolimxenet_wait_intruvm_map_addr_RB_INSERTuhidclosetimeout_add_msecipip_allowsys_pollalaw_to_slinear16_beuvm_map_clip_endufs_makedirentryusbd_set_configuvm_mapent_mergeieee80211_recv_addba_reqm_defragrtable_l2setvnode_hold_listlastdosdateudav_unlock_miibuf_rb_bufs_RB_NEXTufs_linksched_choosecpusys_mkfifouaddr_free_rbtree_RB_REMOVEdb_cmd_searchin6_ifinitin6_leavegrouprtlabel_id2sasddumpiminsys_chflagsslinear16_to_mulaw_le_stmget_hw_ifidKQRELEslinear16_to_mulaw_be_stmdelaysdstartdb_machine_command_tableip6_hopopts_inputch_get_paramsampintc_splxddb_regsieee80211_media_initselfalsescsi_default_putpage0_datavn_isunderusbd_get_port_statusuvm_pageoutpffindtypepdevnamesamptimer_get_timecountqsyncehci_resetwi_setmultiuvn_clusterifaddr_items_RB_MINMAXfifo_openwi_attachusb_caatascsi_disk_write_same_16_donemii_phy_downuvmspace_forkraw_initknote_enqueueswap_bytesums_accessopsudpcksumtcp_sendspaceurl_csr_write_4db_maxoffpmap_zero_page_genericuvm_pmemrange_addr_RB_REMOVE_COLORffs_oldfscompatrijndael_decryptieee80211_add_rsnmaxlocksperuidfilt_ugenrdetachin6_matchlensys_madviseupl_openpipesehci_device_ctrl_methodsscsibusdetachdisk_attachwskbd_displayioctllm75probeimxiomuxc_cdip6_clearpktoptsncpusdb_cmd_loop_donearptfreeubsa_detachfilt_ugenread_intrdb_show_arptabbufadjustieee80211_ccmp_encryptaxe_stopbs_notimpl_bs_w_2dead_printmii_media_tableswap_bytes_mtsttyprintfreaperprocsigcodedb_elf_search_symbolipip_inputatascsi_disk_start_stopieee80211_send_group_msg2db_delete_watchpointbuf_undirtysysctl_tstringatphy_servicedb_watchpoints_insertedusbd_start_nextfilt_ttywdetachamap_swap_offpool_allocator_nointrsys_sysarchallprocessrum_free_tx_listigmp_initmii_phy_add_mediafilt_msdosfsreadwriteatascsi_lookup_portcpu_reset_needs_v4_MMU_disablecache_zapMD5Initbus_space_write_raw_multi_2ffs_vfsopssysctl_mallocwihap_ioctlieee80211_outputfrag6_slowtimouvm_pmr_insert_addruvm_map_hintwant_reschedpmap_bootstrap_pv_allocatorieee80211_ioctlmsdosfs_mkdirkthread_create_deferreduhidevsubmatchbufq_simple_nscandevid_freeieee80211_sa_query_timeoutscsibusactivatend6_timeruaudio_bsd2valueatu_matchin6_ifloop_requestatascsi_disk_synccd_patterns__cmpdi2sd_ioctl_inquiryscsi_xsh_adduvm_pmemrange_addr_RB_FINDraw_detachaudiodetachscsi_xsh_runqueueaudio_writemulaw_to_ulinear16_lebs_notimpl_bs_wr_1domainnamelenehci_polligmpctl_varsusbd_get_report_descriptorsd_thin_paramsip_rtaddrfiledesc_initurl_ifmedia_statusatu_get_cmd_statuscue_csr_read_1vrelewi_set_pmscsi_xs_errorprtrealloccheck_consoleamap_freein6_domifattachatascsi_disk_vpd_limitsugen_get_alt_indexusb_blk_nfreeomap3_initnd6_prefix_lookuptc_getfrequencysync_inactivespec_printext2fs_lookupmsdosfs_openehci_hubdext2fs_linkvop_generic_revokefifo_printieee80211_add_erpieee80211_decapfilt_sigdetachfilt_seltruedetachradioprintarmv7_bs_rm_1ext2fs_renameipsec_def_authusbd_setup_isoc_xferttywflushurl_startumidi_hw_ifwskbd_default_keyrepeat_datacomcnmodeclosefumass_cbi_resetscsi_ioh_deqsoftdep_sync_metadataif_clone_lookupgetmicrouptimemidiread_filtopsmii_tickdisk_openpartip6_dad_countatu_complete_attachumct_breakuvm_pager_dropclusterfilt_generic_detachuvscom_rtsip6_getmoptionssensor_task_unregisterehci_intrlist_timeoutpool_print1db_breakpoint_listimxgpio_attachimxccm_enable_enetrum_startcd_get_parmsrum_enable_mrrpmap_extractin_purgeaddrnd6_ifptomacimxahci_cdwsmousedoioctlamap_unadduvm_pmr_insertahci_pmp_port_probeif_congestionnfilesswap_bytes_stmin6if_do_dadrum_watchdogcue_txeofatu_rxeofaue_detachieee80211_iserp_stapipe_kqfilterdowait4rum_rxeofext2fs_openpmap_devmap_find_papmap_kenter_cacheusb_insert_transferaxe_matchukbd_keymapdatamulaw_to_slinear8st_mode_sensestopprofclockbufq_nscan_destroydb_hangnullioctluaddr_pivot_printimxccm_enable_pll_enetpte_l2_l_cache_modeimxiic_readmclsizesparsediskumidi_print_quirkalaw_to_slinear8wi_set_debugbcstats_printsdmmc_mem_single_write_blockbreadieee80211_node_copyamap_lookupipctl_varsuaudio_chan_rintrpmap_page_removert_timer_remove_allwskbddevprintuhid_intratu_ioctlieee80211_classifyudsbr_matchieee80211_media_statusproc_stop_sweeppmap_set_pt_cache_modeatascsi_disk_write_same_16scsi_xs_exectcp_usrreqmichael_keydb_playsieee80211_setbasicratesatascsi_pmp_cmdsd_interpret_senseuvm_map_pageable_pgonuvm_addr_invokeudp_usrreqifmedia_initrtable_l2ext2fs_vfsopsarmv7_matchuvm_mapent_freeext2fs_inactivedead_bmapdb_guessesif_getgroupmembersdb_show_all_poolssoo_kqfilteruaudio_add_processing_updownfifo_pathconfcpu_startupahci_writeamap_refehci_device_bulk_transferfilt_fifordetachdb_command_loopfilt_fiforeadfdexpandtickscoredump_countsegs_elf32msdosfs_closerd_detachpool_do_getext2fs_setattrsysctl_clockratevn_rdwrarm_dflt_intr_disestablishnd6_need_cacheip6intruftdi_activatesyncer_maskimxuart_diaguvm_pagedeactivatelinear16_to_ulinear8_le_stmufs_unlockrum_matchtcp_ctloutputuaudio_chan_psync_intrukphy_statusieee80211_derive_pmkidMD5Updateblktochrifmedia_settask_setpmap_createuvm_map_extractnd6_prelist_addufs_removesysctl_tc_choiceptsignalboottimeVOP_ADVLOCKdb_watchpoint_cmdaxe_watchdogfrag6_inputpmap_alias_distunpst_sendspaceffs_indirtruncsmsc_cdieee80211_add_ratestcp_rscalettwakeupuvmspace_freeext2fs_inode_poolffs_ino_pooluaddr_rnd_printmulaw_to_ulinear16_bemii_phy_statusmsgcpufunc_domainsswapdrum_getsdpVOP_PRINTfdshareuipc_setaddrugl_tx_list_initsdmmc_intr_taskicmpv6ctl_varscdstartsdmmc_stimeoutfilt_generic_readwriteumct_methodsvrefin_scrubprefixusb_detachimxesdhc_host_ocripforward_rtarm_dflt_splxdb_elf_foralluplcom_attachurl_int_miibus_writereguhidev_activateAES_CMAC_Finalnd6_dad_na_inputuvisor_cdsd_cmd_rw16db_set_temp_breakpointdb_buf_print_cmdimx6_initinpcb_pool_initializedsys_nosysrum_set_txpreambleallproccdevswahci_ata_get_xferumodem_get_statusuaudio_process_assys_mlockalluaddr_free_rbtree_RB_FINDimxccm_enable_satawskbdcloseuvm_sysctlmalloc_lasterrucom_do_closegetsndiskmapopen_bus_dmamem_unmapsys_fchflagsnamei_poolrt_timer_countvfs_buf_printworkq_destroyfilt_audiowritesmsc_ifmedia_stsukphymatchuvm_pager_putdiskmapcloseudav_cain_canforwardahci_attachsmsc_unlock_miiifa_item_removeieee80211_tree_RB_INSERTpmap_destroyip_oursscsi_mode_selectkernel_pt_listuvm_map_freelist_update_clearetherbroadcastaddrieee80211_rssadapt_updatestatsvfs_getnewfsidimxuartcnputcaue_rxeofucom_attachSHA512Finaludp6_ctlinputitimerroundarm32_vector_inituvm_pmr_size_RB_PREVwdog_shutdownuk_cascsi_print_sensewskbd_update_layoutmmopenffs_inode_freeukbd_intrifa_item_insertrtioctlkue_ctlscsi_xs_putbeaglebone_devsata_execifaddr_item_pluaddr_hint_functionsieee80211_tree_RB_INSERT_COLORarmv7_dcache_wb_rangeprofprocsip6_inputbuf_free_pagessleep_finish_signalwi_usb_cmdrespgeneric_armv4_bs_rm_2route_srcbootduidspeedup_synceraudio_blk_msigmp_sendpktloop_clone_destroyimx_caifmedia_baudrate_descriptionsv_putcsdmmc_add_taskm_getptrukbd_caufsvnode_filtopsuvm_fault_unwiresched_noidleumidi_detachsys_getitimerhid_get_datadonicecpu_configureip6_freemoptionshidkbd_delayed_decodearmv7_bs_wr_1ieee80211_amrr_chooseaudio_alloc_ringusb_create_task_threadsieee80211_end_scancdce_txeofbufhighpagesarmv7_bs_vaddrpmap_fault_fixupuaddr_poolrn_refinesgeneric_bs_rm_4sockargshidkbd_ioctlvop_generic_abortopstattachchattacharmv7_bs_wm_4setregsupl_rxeofni6_nametodnssobindvmcmd_map_zerodb_read_charvfsinituvisor_closeupl_caubsa_paramcncloserum_load_microcodedb_tok_numbertcp_do_rfc1323ip_fragsfilt_fifowdetachrum_read_eepromrum_stopmii_phy_setmediain6_ifpprefixkd_trylocklo0ifphostidpool_chkaudio_ioctlwi_alloc_nicmem_usbusbd_free_bufferuvm_pagermapoutrt_if_linkstate_changerw_assert_wrlockif_downalluaddr_pivot_newpivotext2fs_vptofhnam2blkrw_statuscoredump_writeseghdrs_elf32rt6_deleterouteip_maxqueuesysctl_ttyieee80211_chan2ieeeuhub_cain_socktrimieee80211_recv_delbaext2fs_dinode_poolieee80211_node_cmprtallocsys_mprotectieee80211_std_rateset_11gdequeue_randomnessurioioctlcortexattachuvm_km_kmemalloc_placue_casyncer_maxdelaydeadprocstart_reaperehci_root_ctrl_methodssys_fcntlukioctlvfs_free_addrlistsys_setrlimitsys_sigpendingloop_clone_creatediskmapwriteuvm_map_cleanuvm_pmr_get1pageicmp_redirtimeoutatascsi_detach_devttycloseworkq_add_taskulinear8_to_linear16_leugen_isoc_rintrarmv7_bs_r_4icmp6_nodeinfomaxvfsconftimeout_addcpu_cdip6_forwarddb_fncallnumcacheuvm_pagecountarmv7_context_switchcpu_initclockscue_sendmii_downwskbdioctlarm_get_cachetype_cp15v7rn_mpath_hashbrelseext2fs_unmountpsratiosdminphyswi_usb_tx_lock_tryaxe_unlock_miicpuset_delaudiokqfilterttyoutdevice_lookupDebuggerehci_device_requestwi_usb_txeofudsbr_stopata_polled_completecdminphysschedhzrip6_inputtcp_totbackoffvdropsdmmc_mem_sd_initlooutputcue_setmultisoisdisconnectedcpu_coredumpahci_issue_pending_ncq_commandsdvd_read_disckeypmap_clean_pageuvm_aio_aiodonerum_plcp_signalpmap_clearbitieee80211_mgmt_outputsyn_cache_rmfifo_vopsclrbitsdb_boot_dump_cmduvn_putigmp_checktimerscsi_add_linkieee80211_proto_detachmii_phy_statusuvscom_matchamptimer_attachsun7i_devsgeneric_armv4_bs_r_2soclosebootstrap_startscsi_detach_targetinstall_coproc_handler_staticwakeup_nsys_connectbuf_daemonahci_get_ccbskpcsdmmc_scsi_attachdb_leieee80211_bip_decapbufq_fifo_createipv6ctl_varsroute6_inputbs_notimpl_bs_w_8imxuartreadboard_startupsys_socketpaircnreaddounmountfilt_midiwriteimxuart_raisedtruvm_swap_allockthread_create_nowalaw_to_ulinear16_behidkbd_bell_fn_argtcp_ackdrop_ppslim_countdb_elf_line_at_pcarm_picache_sizettspeedtabulinear8_to_linear16_le_mtskqueue_readieee80211_add_edca_paramsst_mode_selectcue_initarmv7_dcache_index_incuvm_pmemrange_addr_RB_INSERT_COLORfork_tfmratepv_sizeimxesdhc_bus_powerimxccm_decode_pllatascsi_cmduvn_sync_qin_proto_cksum_outwskbd_activatewi_media_statusurl_miibus_statchgnd6_purgedb_mult_exprtcp_keepidleif_attachheadnextcdb_listbreak_cmdwi_scan_timeoutuvm_wakeup_plaiszerodevieee80211_recv_pspollumass_cageneric_bs_sr_4lf_freecortex_bus_dma_tagsys_fhstatst_unmountnullmodemwihap_sta_deauthrum_alloc_rx_liststdetachprobe_addrs_eepromif_attachdomain1sys___get_tcbieee80211_amrr_node_initraw_recvspacediskerrwi_startcd_cddb_machine_commands_installieee80211_state_namesys_preadscsi_moveehci_root_intr_abortkernel_pt_lookupkmem_mapimxuart_startukbd_translateconfig_pending_decrrum_update_promiscaxe_startieee80211_input_print_tasksoqinsquediskstatsums_detachcdce_attacharmv7_periphbaseudp_inputnchrtoblktblihashrn_search_mresettodrusbd_ref_decrufs_readdirsys_flockpvwi_usb_do_transmit_syncspec_badopampintc_intr_establishmsdosfs_linkbufq_nscan_dequeuebs_notimpl_bs_c_1sdmmc_check_cis_quirksicmpctl_varsigmpstatradioioctlmichael_finalvn_initialize_syncerdpipeselwakeupicmp_sendadjtimedeltacdce_watchdogsmsc_newbufdb_mbuf_print_cmdieee80211_choose_rsnparamstime_uptimeuvm_pagealloc_pgfill_filecdce_intrsmsc_rx_list_initfilt_uhidreaduvn_wlistuvm_pmemrange_addr_RB_REMOVEsowakeupinsideahci_inittcp_autorcvbuf_incbufq_queuebs_notimpl_bs_r_4db_putstringcortex_cdarmv7_bs_barrierprefetch_abort_entrysigactsunsharetimeout_hardclock_updaterdattach_edataupl_detachttkqfilterm_tag_deletesensor_findip_fragmentfilt_timerusbd_endpoint_countsys_statfsSHA1Finalsensordev_deinstallsched_nomigrationsinittimecounteruaudio_attachrawin6pcbtablepmap_protectslinear8_to_alawkprintfdevice_unrefulpt_matchrc4_keysetupscsi_startuvm_pmr_addr_RB_REMOVE_COLORin_cksumzombprocessvnode_pooluao_shrink_convertvnode_free_listarmv7_tlb_flushD_SEtcp_savetiuvm_pagereallociicprobeinitsensordev_countahci_preadahci_readiic_ignore_addruvm_fault_unwire_lockedklist_invalidateuvm_km_createthreadaudioprintpool_printitubsa_flow_endrt_senddesyncsogetopthid_report_sizeuvm_unmaprd_matchmidiwritedb_deletewatch_cmdusbd_ref_waitpollscandomaininitvflushbuftime_secondip6_forward_rtwskbd_get_mapentryuvm_pmr_initusbd_read_report_descsbcreatecontrolsys_mlockuaudio_add_altieee80211_setup_nodedvd_read_structvdevgonearm_intr_stringhtonsubsa_setdb_show_callout_bucketbucketkqueue_writesys_syncieee80211_reset_scanaudio_selwakeupatascsi_disk_unmap_doneahci_issue_pending_commandsieee80211_add_pmkid_kdeenodevffs_mountfsudsbr_reqin_delayed_cksumslinear16_to_alaw_beahci_port_detect_pmpm_clticksrum_attachrtstatttvtimeoutatu_startkd_waitokabtstacktimingsafe_bcmpspeclisthbdwritecpu_idle_cycleversion_to_spcVOP_INACTIVEsdmmc_io_read_4pte_l1_c_protouvm_mapent_biastcp_syn_cachehaltwihap_sta_is_associeee80211_std_rateset_11aimxesdhc_intrkputcharums_ioctlbootargsampintc_intr_disablesys_getsiddb_trace_until_call_cmddisk_gonewi_write_record_usbdb_show_all_mountscue_csr_read_2m_trailingspacefileheadrc4_cryptusbd_alloc_xfernextvnodeidcttypollkp_dma_zerosensor_task_ticksys_swapctliic_dumpcpufunc_dfsrbd_reqwskbd_set_mixervolumest_patternsch_patternsbs_notimpl_bs_rm_2copypktoptsin_selectsrcmsgscpu_exitip6_initpktoptsworkq_threaduvn_getbpfilter_destroyunp_attachch_movetcp_syn_bucket_limitsys_renamefrag6_nfragsip6_log_timertalloc_mpathst_buf_donescsi_activate_targetarml2cc_sdcache_inv_rangedisasmufs_ihashinitunp_deferuvm_km_valloc_waitsys_sigreturnsbflushehci_device_intr_transferscsi_link_closeswapdevipsec_require_pfskue_sendsysctl_intrcntaxe_tick_taskarmv7_bs_tagvn_readnclrunegheadbwriteleavepgrpukdetachkernel_pt_tablepmap_get_pde_pteuvmpageropsuvm_page_initehci_root_ctrl_closewihap_sta_allocsdmmc_io_xchgnamecache_rb_cache_RB_INSERTatphy_funcstcp_timer_funcsipqent_poolif_attachdomainubsa_requesticmp_ratelimitieee80211_rssadapt_raise_rateuvm_km_page_initrttimer_poolieee80211_regdomain2flagadd_entropy_wordssosendtaskq_initdosetrlimituvm_pmemrange_addr_RB_PREVrn_initimxahci_activateieee80211_set_timuvm_objtree_RB_NEXTloopattachukcloseieee80211_save_ieusb_abort_task_thread_procdb_listwatch_cmdscsi_cmd_rw_decodechainlengthprocess_read_regsusb_fill_udc_tasksys_unlinkatarmliicc_cdttwakeupwrau_get_gainrn_lookupthrsleep_unlockrtmask_poolsmsc_write_reguaudio_find_ifacesys_execvesdmmc_mem_send_cxd_datafdallocimxesdhc_exec_commandprfindscsi_donechkvnlockhw_sysctltc_ticktockahci_pwait_eqphtree_RB_MINMAXdb_siftingdb_look_tokenpmap_alloc_l2_buckettcp_syn_cache_limitnumvnodesimxccm_get_ipgclkurioopenuvm_pagefreeehci_device_isoc_abortext2fs_inode_allocatphy_mii_phy_autobufq_fifo_queuedb_examine_formatin6_pcbbindpool_large_allocicmp_do_exthdrieee80211_inact_timeoutreaperieee80211_add_gtk_kdecoredumpfilt_kqueueugen_cdmalloc_rounduppipe_readaudiostartpuvm_map_addr_RB_INSERT_COLORifioctlsys_utimesdb_symformatsusbd_do_requestnd6_storelladdrrip_initsocreateusbd_find_idescureadcatu_get_dfu_stateaue_startufs_setattrieee80211com_headlogpriworkq_queue_taskmemhookdoclusterreadahci_pollsys_exitsbtryuvisor_matchieee80211_send_4way_msg1atascsi_port_identifyarm_smaskm_applyudav_startaxe_lock_miiuaddr_pivot_functionsdomkfifoatudv_lockbufqsdb_watchpoint_listcd_playHMAC_MD5_Updatesys_clock_getresaxe_attachsdmmc_set_bus_widthsyn_cache_insertrc4_getbytesttystats_initatphy_statusmidiprobestactivateucom_matchnd6_umaxtriesimxesdhc_bus_clockuaudio_merge_terminal_listpte_l2_s_prot_kwnd6_setmtu0nd6_debugip6_maxdynroutesuvm_map_pieumodem_castdumpdb_delete_temp_breakpointehci_root_ctrl_transfercpu_cpuspeedcsrcpcpufunc_iddefrtrlist_updateurl_csr_write_1arm_clock_funcamptimer_set_clockrateSHA1Transformesymieee80211_defragosreleaseubsa_breaksdmmc_free_ccbsVOP_RECLAIMscsi_probe_targetarmv7_set_devsip6_getpcboptbuf_releaseucom_cdHMAC_MD5_Init__modsi3smsc_txeoftcpqe_poolpgrp0mainbussearchfilt_midireadurl_watchdoguvisor_initwihap_timeoutdb_panicuaudio_closeufs_advlockicmp_initimxiic_cacdst_pteuvm_growinet_ntopvfinddevieee80211_node_cleanupugl_attachrt_msg1ehci_device_bulk_methodsether_delmultisave_rtedb_history_currmainbusattachrn_mpath_initheadarc4_taskuvscom_paramexec_sigcode_mapsys_gettimeofdayipsec_soft_timeoutieee80211_rate2mediavcleancd_getvolsplassert_ctlsys_getresuidsys_fhopendos2unixfnscsibussubmatchrtentry_poolbufq_restartlinear16_to_linear8_be_stmuaudio_cduvm_km_pgremove_intrsafeext2fs_sbupdatein6_init_address_ltimesdefrtrlist_delsdmmc_mem_set_blocklensys_fchmodudsbr_caatu_watchdoguvm_unmap_detachieee80211_recv_authehci_add_qhupl_initusb_dev_quirksdopselectvfs_mount_printhfsc_purgestartieee80211_needs_authaudiogetbufinfowdog_cookieusbd_devinfost_identify_drivevn_isdisksys_selectahci_wait_nebadaddr_read_1vop_generic_lookupdb_branch_takenarmv7_bs_sr_2in6addr_intfacelocal_allnodeslogreadahci_port_softresetrn_mpath_capabledead_lockworkq_next_taskieee80211_name2regdomaintcp_issphysical_freestartfc_largedistancesys_setitimerurl_attachnd_prefixsmsc_tx_list_initvfs_unregistersmsc_ifmedia_updmii_phy_flowstatusdisk_mapselwakeupumct_set_baudrateffs_reloadimxehci_caatascsi_passthru_12db_set_watchpointsuaudio_ctl_setfill_kprocmidi_out_docnwriteumass_bbb_get_max_lunin_ouraddrpolloutdb_show_panic_cmdehci_device_bulk_doneuipc_usrreqnd6_na_inputdb_next_free_watchpointvflush_vnodemulaw_to_slinear16_lewsmouse_activateimxocotp_get_ethernet_addressaes_key_unwraprip6_usrreqin6mask96coldahci_pmp_phy_statusdb_clear_watchpointsunp_scansbappendaddrbufqs_mtxbpf_maxbufsizeextract_entropyufs_islockedusb_detach_wakeupffs_unmountfifo_inactiveffs_vopsdofutimenssys_pwritewihap_shutdownuvmspace_allocrevarpinputbufq_nscan_peekcd_pausesdmmc_function_allochashinitttstartumass_setup_transferata_identify_blocksipsec_keep_invaliduao_detach_lockedahci_atascsi_methodsumct_set_lcrieee80211_parse_rsn_akmsdopentcp_tracemii_phy_resetip_getmoptionsmidi_attach_miamptimer_matchin6mask32__moddi3disk_countscsi_detach_lunpmap_page_protectdead_openkue_setwordpmap_l2ptp_pooldb_list_watchpointsicmp6_redirect_outputroute_cbtaskq_createsys_futimensahci_pmp_port_portresetreadepcpuset_init_cpuimxocotp_attachscsi_init_inquiryuaddr_pivot_removetcp_slowtimoieee80211_std_rateset_11bcd_play_msfpmap_remove_pvtcp_newtcpcbsbchecklowmemswapmountffs_mapsearchsys_fhstatfssmsc_activateelf32_load_filesys_getpeernameumidi_attachchange_sign16_be_mtsehci_device_intr_closeimxenet_cdieee80211_get_txkeyehci_intrdb_taken_bkptdb_eqnamescsi_strvistcp_set_iss_tsmbpfwritedoingcachesys_getrusageaue_reset_pegasus_IIuvm_map_addr_RB_MINMAXbufq_destroyusbd_get_cdescampintc_iacknd6_prunem_getarmv7_bs_c_2ffs_truncateuhidevprintmii_attachuvscom_carum_alloc_tx_listsdmmc_cdttylclosepool_allocator_allochidms_inputin6_ifremloopchar_typeusbctlprintworkq_createvn_closeuftdi_readudav_csr_writeuhid_do_readdoclusterwritechange_sign16_be_stmusbd_close_pipeusbd_deactivateffs_writeieee80211_wep_set_keybremfreefilt_sowdetachnd6_initip6_maxfragslimfreeatascsi_probe_devnl1doutimensatata_swapcopydb_show_regsuvm_km_free_wakeuprootvnodeehci_initifmedia_ioctlimxiomuxc_pcie_test_powerdownwi_usb_rxeof__one_cmpldi2cpufunc_nullopumct_caatu_media_changemii_phy_detacharmv7_attach__muldi3umct_cddb_qualify_ambiguous_namesuhidev_caurl_lock_miiip_mtudisc_timeoutrandomopenin6addr_linklocal_allnodesbufinitubsa_closebootconfigscsi_quirk_patternsuaudio_ctl_getlimit0wandboard_devsrt_if_trackuvm_md_constraintsif_attach_commonuniqdosnamedb_recoverahci_cdamptimer_frequencypfxrtr_lookupudsbr_activateext2fs_mknodvttoif_tabdb_delete_cmdbgetvppgrp_poolsmsc_ioctlsd_cmd_rw12ucomstartreaduvm_pmr_addr_RB_INSERT_COLORucred_poolcpufunc_ifsrip_insertoptionsarp_maxtriesaue_eeprom_getwordukbd_cnbellphtree_RB_INSERTnaptimeufs_dirbadentrylogioctlubsa_databitsgeneric_bs_wr_1_bus_dmamap_load_uiocortexsearchstrlendb_machine_initsensor_task_workfifo_kqfilterconfig_suspendmidiattachieee80211_parse_rsn_cipherkue_activatepool_page_freewsmouse_inputcopystrsched_nmigrationsiftxlistwdog_ctl_cb_argsys_pipeusb_detach_waitarm_pdcache_waysarp_rtrequestieee80211_encrypthw_vendorext2fs_reload_vnodeelf32_check_brandwi_cor_resetudp_initieee80211_recv_4way_msg3proc_trampolinesys_rmdircpuset_copyspec_accesssocantsendmoreusb_rem_taskimxesdhc_write_datapte_l2_l_cache_maskcdactivateuvm_vsunlockether_inputatascsi_io_putlockstatusquotaoffcoredump_note_elf32imxuart_paramfs_posix_sysctlaudio_init_ringbufferulinear8_to_linear16_beif_slowtimosmsc_tickudbtablewi_setdefchange_sign16_le_mtsarm_dcache_l2_linesizeufs_printuaddr_lin_createfatentrywi_update_statsAES_CMAC_Updateusbd_printBCDsys_statukbd_apple_mungein_baddynamicieee80211_keyrunlineswmsdosfs_symlinksys_symlinkarml2cc_cache_opicmp6_sysctlampintc_intr_disestablishclfreeconfig_found_smalaw_to_slinear16_leuhidread_filtopsusbd_interface2endpoint_descriptorfdreleasedb_line_at_pcehci_disownuvm_swapout_threadstask_addknote_attachmax_keylensplraiseieee80211_tkip_decrypt__assertif_congestion_cleardb_put_valuend6_dad_ns_outputin6_prefixlen2maskuvm_pmemrange_use_insertudp6_outputieee80211_prfcn_devvpwi_get_debugmaxfilesupl_devsuvm_pagecmpuvm_pageactivatein6_addr2scopeiddma_alloc_bus_dmamap_load_rawffs_mountrootrd_cduplcom_paramrrw_statusuvm_map_pageable_allsleep_finishehci_device_isoc_closeipqtaskq_next_workmsdosfs_strategytimeout_delm_cltickieee80211_chan2modeif_delgroupspec_strategyiic_cauvm_pglistfreemidiioctlusbopenums_attachext2fs_readsoo_statwskbd_cnpollccortex_cakue_newbufuvm_map_isavailrusage_pooldisk_detachstrchrtask_delsystqubsa_methodshid_clear_localehci_check_itd_intromap4_devsscsi_plug_pooluvm_pmemrange_use_cmpuvscom_cduvm_pmr_size_RB_INSERT_COLORdb_deleteiftovt_tabsysctl_int_lowertcp_backoffworkq_task_poolsys_chrootehci_odevdubsa_cdieee80211_rssadapt_lower_rateumodem_dtrehci_device_clear_toggleicmp6_redirtimeoutsoisconnectingarc4random_bufehci_check_qh_intraobj_pagerchopenstopenarmv7_cpufuncsuvn_iogeneric_armv4_bs_w_2MD5Transformumidi_matchmld6_inputgeneric_armv4_bs_sr_2pmap_copy_page_genericuvm_objunwireieee80211_rx_ba_timeoutbpf_d_listimxesdhc_read_datasyn_cache_cleanupip_pcboptsfc_purgemidi_ca__data_startimxccm_get_armclkieee80211_eapol_key_encryptifmedia_delete_instancefilt_timerattachurl_caucom_breakuvm_mapent_allocudav_miibus_writeregicmp6statdb_single_stepgeneric_bs_w_4wsevent_pollieee80211_pwrsavesys_profilvmcmd_map_pagedvnugl_stopin6_pcbhashlookuparmv7_devsbpf_detachdVOP_UNLOCKpmap_uncache_pagesingle_thread_setehci_root_ctrl_abortsyn_cache_initieee80211_find_txnodeip_ecn_egressether_ipmulticast_maxuvm_init_limitsukphy_cdentropy_input_rotatein_pcbconnectieee80211_add_igtk_kdeVOP_POLLVOP_IOCTLarm_dflt_delaysafepriaudio_init_playuhidev_ioctlarmv7_bs_rr_4ip6_copyexthdruao_swap_offmachinewi_cmd_ioVOP_CLOSEuvm_anallocin_pcbdisconnectradioprobeuvm_vnp_terminatewi_usb_rxfrmampintc_set_prioritysdmmc_io_read_1sys_getpiduaddr_rnd_functionsipmultipathunp_dropslinear16_to_alaw_le_stmugl_matchuvm_map_advicetcp_mtudisctimeout_startupahci_port_startcue_matchrn_addroutesdactivatefilt_msdosfsdetacharml2cc_matchdb_print_sadb_elf_sym_numargsdb_trapperradiocloseukbd_cnpollcdoreadlinkatimxesdhc_start_commanddvd_read_manufactundstackconfig_activate_childrenimxuart_intrip6_check_rh0hdrieee80211_input_printdomkdiratimxenet_miibus_writeregmulaw_to_slinear16_be_mtsarmv7_bs_wm_1remrunqueueatu_initial_configusb_fill_udf_taskatascsi_switchsoo_closeumodem_rtstcp_recvspaceuvm_meterumodem_intruhidev_maxrepidpmap_needs_pte_synctcp_ackdrop_ppslimlinear8_to_linear16_le_mtsehci_device_ctrl_donemaxthreadimxesdhc_card_intr_acknd6_lookupieee80211_cache_sizescsi_iopool_runurl_openpipesukbd_countrylayoutsys_getppidscsi_ioh_pendingmii_anaruaddr_rnd_selectrc4_skipVOP_READDIRdomainssdmmc_select_cardcortexprintsys___sysctlaudio_calcwatersd_cmd_rw6arm32_dma_range_intersectin4_cksumextent_alloc_subregiondb_putcharieee80211_recv_sa_query_respneedbufferusbd_do_request_asyncin6_ifattachieee80211_get_addba_requgl_activatetcp_rst_ppslim_lastbs_notimpl_bs_rr_4ip6_multipathatascsi_disk_senseusbd_get_device_descriptorumass_fixup_yedataiicprobeipsec_soft_bytesmichael_initnselcollemul_elf32usbd_open_pipewskbd_set_mixervolume_callbackmulaw_to_ulinear8msdosfs_lookupspec_pathconfhook_establishmountroothook_listtcptv_keep_initaddrmasksys_chdirdb_unread_tokenext2fs_diremptyuvscom_methodsext2fs_inode_freedb_find_variablescsi_io_get_donebuf_objectip6_rr_pruneuao_grow_convertusbd_desc_iter_initsbcompressiic_smbus_receive_bytepmap_free_l1nd6_outputSHA512Lastrijndael_set_key_enc_onlycdevsw_lookuplogsoftcsys_adjtimeamap_splitrefspec_open_clonewskbd_do_openrum_activatesd_thin_pagesnclruheadscsi_move_doneuvm_aio_biodonern_initheadusbd_get_descuvm_pmr_printvop_generic_unlockuvmspace_shareieee80211_node_leave_htrt_timer_addentropy_poolieee80211_print_essidroute_usrreqdeextendspec_vopsahci_put_err_ccbatascsi_disk_unmapieee80211_wep_encryptieee80211_recv_deauthsched_init_cputcp_dropicmpstatudpctl_varsuvmpd_scanm_prependsys_getrtablesmsc_resetin_pcbrehashpool_walkimxiic_setspeedarm_intr_dispatchsyncer_delaynoimxuart_scin_arpinputpmodehci_root_intr_transferufs_accessin6_embedscopeif_alloc_sadlphpoolunix2winfnmsleephfsc_enqueuesdmmc_io_resetreassignbufip_freemoptionsums_matchieee80211_release_nodesohasoutofbandddb_initbs_notimpl_bs_c_2nd6_dad_duplicated_bus_dmamap_unloadieee80211_free_allnodesmsdosfs_fhtovpaudio_lockpte_l1_s_coherentbs_notimpl_bs_wr_4maxvnodesether_crc32_beieee80211_add_ssidcpu_reset_addresspgfindatu_rx_list_inittcp_ackdrop_ppslim_lastloadfirmwareuaudio_chan_free_buffersip4_inputtcp_inputsysctl_dumpentrydkcksumatphy_resetuaddr_free_rbtree_RB_INSERTarm_dflt_setiplnd6_gctimerieee80211_ccmp_decrypturl_csr_write_2iptimerip_inputaudiowrite_filtopswi_set_txpowernd6_setmtuimxesdhc_caaxe_ifmedia_updata_identify_blocksizedb_last_non_spaceusbd_get_endpoint_descriptormii_detacham335x_initudp_ctlinputudav_rx_list_initsdmmc_io_send_op_condpool_sethardlimitip_freefvfs_lookupdb_show_cmdscpu_info_listudbhashsizeicmp6_mtudisc_updatesun_nonamekmeminitnd6_ns_inputdevice_refehci_device_ctrl_abortffs_syncrd_root_imageuvm_map_submapamptimer_startclockcnioctlufs_vinitsys___tforkehci_noopuaudio_devicepool_primedevid_allocsdmmc_mem_scanpgrphashtbldoppollifmedia_matchstatclockimxuartstopaue_activatewi_read_data_usbdvd_read_physicalarm_intr_disestablishrw_enter_writearml2cc_sdcache_wb_rangeatu_media_statusamptimer_delayuaudio_chan_closem_tag_copyehci_idonest_readamptimer_carum_amrr_updatedb_value_of_nameahci_activatepmap_l2ptp_ctorrn_mpath_active_countdata_abort_entryarmv7_icache_sync_allhid_get_itemrt_xaddrsmsdosfs_getattrdb_find_breakpointip6_maxifdefroutersm_devgetwritedisklabelin_ifdetachmsdosfs_printkernel_pmap_storein6_ifattach_loopbackstartprofclockupl_ioctlundefinedinstruction_bouncesys_getresgidprocinituaddr_free_rbtree_RB_PREVatu_switch_radiomsdosfs_readdirdead_ebadfextent_do_allocusbd_interface_countnd6_timer_taskimxdog_casoo_ioctlswap_officmp_redirect_timeoutforkstatwi_card_identaue_miibus_writeregieee80211_recv_eapol_key_reqwi_send_packetigmp_sysctlin6mask64db_lbuf_startsoftclockaudio_initbufsarmv7_tlb_flushIDieee80211_node_freetc_initupdate_modifierffs1_compat_writeieee80211_amsdu_decapdb_breakpoints_insertedswdevtdisk_lockarc4random_uniformsbwaitufs_reclaimkv_intrsafescsi_xsh_setsdwritememnamewsmouse_cafilt_logreadsysctl_rdquaduaudio_detacha4x_bs_w_4uvm_vnp_setsizea4x_bs_rm_2vmcmdset_extendaes_key_wrap_set_key_wrap_onlyip6_use_deprecatedehci_softintruftdi_paramextent_alloc_regionsys_mknodimxocotp_cdpmap_proc_iflushext2fs_mountfskill_vmcmdsuhid_attachplatform_init_consimxuartioctlphyflex_imx6_devsufs_mknodsbinsertoobin_lifaddr_ioctlknotelf_advlockpffinddomainsdmmc_ccb_freefreedorenameatwi_ioctlimxesdhc_powerffs_hashallocswstrategyehci_allocximxenet_stopscsibusprintnamecache_rb_cache_RB_NEXTehci_root_intr_methodssys_getpgrpuplcom_detachuftdi_breakukbd_ioctlaudio_defaultiicprobewsonewconndb_fetch_regufs_direnterudav_csr_write1uhid_detachgeneric_armv4_bs_c_2pffindprotoudav_watchdoguvm_pageallocsdmmc_io_enabletcp_saveti6HMAC_SHA256_Updatenchrdevfrag6_freefundefinedinstructionuvm_pmr_use_incaue_cdaf2rtafidxnamecache_rb_cache_RB_INSERT_COLORcoredump_unmapuvm_map_vmspace_update