ELFa( 4H9E4 (  .).)@<<((8Exexe$oۣeETeTe$$_DO! "&@00Q_: 0/xE\@/ XX@0 6QQO @@( @0 P`D  B00 R AР -L Xxekemain() returned0k   ),@@(TQ 0/dk -`LP@p@D0D 000``@ - 0LP@p`` V -L@P`p 00  0 0 0 0i -`Lp@P 0x 0s 0n 0i]0UO 0 B<P@01+T X@P 0PX - L 0 $ 0 $ -0L  T  T p-H$,$HP0`L@ 0p -0L(  -0L( _ "- L0 -4L\ ,00,0 200b104 0 ,00 200b10> p-0LSP P ,  4 ` ,  0P,00,0pp 0 $Pp@0D PT0T0S , , -0P@Lp8`  R   0@ 0 d -0P@Lp8`  R   0 @ 0 d -L_Œ @x`0 P  'H0!@ 0',0 0` 0 0' M-LM0'XX @X0 , %X 0  ( "('$' ,  pPP( 0"(X )%( 0 0 , 0'(h@(K 0-_02@P L0@ 0'0@-0@  0S  4000$ 4 @4@ -4L0S @440S - L0 -LM40S  3 lH0 ,PT K 0 KhT4:(: p-LM@`P3PUOx3e H0 PT00 h0 \8T3 @T89T3  : TTH:l:t;::X: Q-L@T0 T褒:: -PL4p`V$ 4! ,0 w0 `T]TZT,0 000,  ,  0hPV@0D PT,0 0,0x ;;Ȓ:В:ܒ::: 0-0L P@ ,00,0 R 0$ 0 00  0 0O,00,0 R$ 0 0 00  0 @  00h WiWi -@L.0  0;0hmlhKdVi -L` @Mu;0 dLdVi -4LSPp `00  08#8<8#8000 08#8@08#803 08#8 08#80  0  :y4S0=0Sh=KN(f4S 08#8 00L$H@0@@000 u31C0 1-L?rcWP`S V @ 0DPT0`T0d  D0PT0C4Q -LàL0L0Ϡ@blpP30 0S PVdp 0P0,0 00P 03Q - @p`R0 0L PP 00 0 0008#808#80\4SX 03g4   -L@pX00S2 0W6 - 00` 00P00Zpd3 00X3  # 0W  -0pS0L00@`% 000PU00S`U \6R    8,RU %R"R0 p-8P@L@`4 00 00S > S 0 p R  B  hQ 000 PQXp 0 00 QH::: 0-L@LP\ ! 0(  0( 0h ' p-L@`B  PUP00ShXP ?lp  000PS p 0U 0 0 0P 0UPp@p -0LSP 0S" 00 @ = p`Z8:Xo`Z6 @ 3S `V 0@ 0TTPPQ @Om@ m 00000@TP303r8P060 0 308#83 R 00  b @00Lh< p-L@] " P`dU  0 00PY YR`pp 0-LP@P 00dH@ @0cP' 0H@ 0V 0' -LM0` Pp @2 0S3  09P.0  0*0,0K0,0 Kho%  KhS0S 08#808#80KhP  0P00 0S  0P3g4 Kh, -0`10#LP8p@P@ 00 0000  0 0, |0| 004 P`0  @Z0@  00  H   : -L M0PSp 0S` K@K pPS 03K 3[8#808#83K0` P`h3[8#808#83K 3[8#8<8#83K0@0 4 @K?0Kx0  =RPX'L0@ 2RP0 0 0   xe<0G9 p-L@PV04`K"+@p -2L M PRl2   ``0KST2`0 !0 S<2004 plPRd0S| 3>1 :`@ 000S3033 T] 03dp0p|14 QP=303@To3 `3`V㏏H0"S3R1  K0 ,pK n3 00,0K,0K3 f @4  0+@K*K( ,n#t003 P3,00,0P `P0 R0C  (P01Ł 0PP9 x+r 00a=C4`#hh 0`IxQ C= 4* `C-0`:0'8': p-C= LP@p0`   000h2  4R` ^L00 S 0 PV@p $,$ k4$ -1@LP H0 `p 1 R 0 0< S\  SN  SL  SPS000H1  R < ,< ,< ,< ,< < < < < 1 9 0 R 0 0 0| 0 R0 R S 0 p0 `0 P0 C=  0 0 00$' -41` BpL R \> d> l> = t> = = = = = |> 0GS= = L> 4> = T>  0 0BMP@ `P Ol0l pᲀ\0 R     -L\M4@KP i03K/P3#K 8#c[Qr Qn 0S3Q  yi2 3K2#K 2["[`0 2[d h0  fi2 ㌂#K3K0[[3 1C 0"Pr0!2"[0<P"KKK 7 Py Ps r2 ">?DFcà.L !2c N"10,Ϡl`P!PdP0PhPc 0` P@G(K T1   D1`  T!T1QQZ@K&i05K015K P-V0[@S*T0[.S'Q0[-S$N0[S!U0[S[#!BR[ O[3 A 1C "P[05A1!1 00 `p["[2[DG'tG9$ $j;hQH::v'N$@:: 0-LMP C=  "D0@<0!0@ 9I=98' -9L@@C-000C-000 0-d3 LR@P H3R $<3R Q03R 20RB R3 00CR "2Rg -2Rv 0R- =0h*V0CRt 72RD >0R@2@ 0C 0h90CRI l2Ry 0R X2@@00CR0 0R( 0? R2 0h,0CR> 0R1@@00CR 0R1@@01@@0 1 01@@01@@0|1@@0X@0 g  g041@@0$1 0h1@@0 1 0 ?0h0@@0 0D g0 0h 0 0R |lF00 0 ($ C$$ $,$: -MLMC= 0 p 000CSp(KBKII 0 D )0T `0S` @ T YpP@VP98! #  $1  pP pP04 9(K0P @ A(0K  0  pP pP9 (0K 0!(K  T0  pP  pP9 0  ' -LdM℀Kpdf2 S108K(K9<ô99<%P@`PK+  fTP` V0 @ fTP`0008#88KT0  K40 df100' -LIM\0R,0 @, 0RJ(KK e8K e0D"0C4K#KK t0 B("(S04"43K@BK0 5[90K, 5Kd*K2 dL (@ 0 B{q$[4[Q04KD 0 D B0000 < { L(@Q0 BVqDt 0 0 0C0D 0 ^5[ K R@0 80$Ba#$:'T N0CT Q>Tu >TB-p 0l*X >Tb 0CT 0T  p0l0X 4X. X0S x Ix\ CC-0 :0`Z(K=T =Tu =T4 =ThqP 4XX l 6@ x xCd=T` '0CT 0ThPP,= R   /p X ,АP4X 0 S <R  R 0CR H= Xp0X,3 p p0X \,娐P l 6@= < R9 XCP hhPpzX \hP p X X+|PX0 \U;Q= ;Q 2 Q<  Q K0XPXPl 6 0#0p  + 0*0004K?4K P;$K NK:Q !0Q;Q |:Q :Q x:Q p:Q X:Q\ H:T @:TF 8:T,:T# $:T :ThuPp{X 9T:p X 9T 0Tl 6D = S @S 9 l0&9 p9X 8 Rp 010   ,X X0/ @9 XPX0 8R p 101{l 6 8 R@ 0p8X 0X <08 XPoX 0 Sk !X0 x cxp  ! xKhPs !p0!  x jP xX 6 Q0T0 p X 0T 00bZp 0{SX |0 P\ d0 t UW t0 `8  |@h _ hE At0 0$30 R0S   o_05 %<0 S  S  7S  nS  0t B02 R B000 C B0 2 R0x0 h4_Px00x0p0\ | 㼎Pp0 T0 p0 X 0T 00b Sp 0d | Sd :|0B\0 peX hP mp X X!PrX4 [$2X 0X0, 82 X@PX p0 㮻 XA1X 0X0, 1 XPX0 p0!h?Pp 1S  ?X 0p 1X 0X?P!l 61 1 p0j@  k4:ii i5i i i iiii 81-71$$%Ci8i|6i(iii8i i #A#,0X ꏭ@ x ]xP X 00"0X 0S00) 0XD ]#D2 RhBX0 u $Ⓔ0X 02X 0000 X 00200X0 T 4]X +002Q' D0CQz >0QDv3Q. 0Q=(3 RX D3  mC= u -C= p jC= @k bC= f ZX0 OC=  Y 3 R 3 X=1>,04 -LVKKEK5K\04X3K03K0 M r\2K n\ 6K3 R 9 45K05K3K C= Y3PpCP! 0,pK0  Pl, |3  d P]C= ,0C R<% `g9 @0;9< RY&\ @0Ÿ00VK 5KKEK\ 0\05K20K5K 0t2t"5K K%K 00@2K05K?5K 00"::1QK5K0DA5K 1!5K %KK01! #000 d1PL 0SI P D1D!5K 05K0%K 905K0K5K0)0 Q|0KK5K0'  ###: -$$h:D: $,$2$0$$*$! -` L@LtPi@DZte q쁟0 ( TXA 8R  #8X PR 8  #8X PR8  #8X 8#8 XJz/ pP 0@R0 ` (  0R  ( R4 h 0X Z9 T9<9  009<<$:: -LMP,0 60  Pqa,0> R6 l C R6 l 0X @R6 l 0X 60 i@P R6 l (T0P R6 l ((0P(K$4xV -L0M`P? QC D3P 83QX Fd0CQd  80-P/ @sR8 p 0X R8 p 0X\ RL8 p 0Ɛ2  0lP (K0SD2.`K0K2K02K(2Q: 0Q0SX2K?2K.`K02K00C SK@ 8 0 ~ (   ~ ~ ~ ~ 0!02K0"K.`K2K 10S: x10S. S08#[.`KK}H!TK0@20pPK&YW?D  K5KY0 P@T0 R08#P 0H2K.`K0"K2KC      $$'!'#((($,$ p-LM`80@PPP<<0 R0C8 p 0ԏxx$ -3LM PR@v"0 0!P$ 80 P4 娂 0rR8 p (0`P 0R8 p (0S (K`0\ RL8 p 0倏0? SD 1 R 1R 1R 0R d0CR< 0RP P 0AS@  Ђ Ђ   Ђ Ђ Ђ Ђ Ђ Ђ (1Q% 0Q0S? .PK2K"Kt0\ 0S40 00 000 .PK2K"KV<8# $'$ #'(( -LLME0 P5 0Rx5 RN e`P ; e1 e0 0@0@(KDp0p P <C42 D@F Q000P@ @|P  T4 RH4Q ?eDl0KP6[p5[p0 ve`P ; e1 p0 00pC bp b3 R 6[* RV  RT  RR $[Qy0H# 00. Px$3 P  5[  2 R 2 RlK @P dS v6dT0 0S Sk S2< @>h<@0 fP_6d=  A$[P& >K W8K W *K |W 0  0D P 0 0@0@d*6d갤[>0P 6[T6}d lKMW0 <0< P jd9 6<00 0lK CM,@ 0cp GyP 9 5Fd00 @0@< G0 g &bK'' $($::ė:P::: -C= L 9 s c @SR2 d 0X R4 h 2X訢b r0R2 d X 0R0 ` ( RP4 h @2Xsc 0R" D ( R4 h @0X1 Rh &4  1 R0C4 h :X``1 R0C2 d P1XU 2S?1 R0C4 h 0X0 R0C4 h 0X R4 h 0X R4 h 0X~0[x$p -L$M8888H}/` `P, 8 $K4K JKpP 4, 0R(K  FKUV 84h U70P9$ ! 0|1( =! `  P ?DD7D'p0C 0'00(7 ' <07 pp0d '006 &6pp ?$K3K@K0P66#[   6Q Q) Q +>3K ,6$K P3[SC-000  , 4TU 6:@K3K 03K5 P5  [^5ࠃv5  P BM@%5 0  0C 0 <@ ,=A?0C @300 0@0S 0 0=800- 0P0 00 }P4 ,0 py~H&$$ر ' -SLM` 0 ʴ9b(K0L 0  0A 0  V@K0KPK P0SK 0KPP 0 WpPQ 32Q> Qb 9 \(PP2  MP  P P 0Y$ 2ᲂ $ ڨ K0 K& 478. 0 0.2 R@ 9 .1  =!Q ʴ99 @pWx1 R0S( S Y@PU 0  Q9 A 0R  R1Ḑ0 1d. `.@PU @@P$D@T 9^  I.PP@101A0@0'(::X:&(:: : 0-9]L@0P OO0 R 0t0t P00h0X0 qP  x +>8 , 0h -$&$$ : p-CPID@DL`0 #DB@@0 00 R 0\00 0   R 0 0 0 @P'$-00C0p&$ -LM9pş@`h5P, ph P5MQ0@| 0CQ 0CQ -pş, 0R(K4Q :4Qpp4 @T  0{S|㨐K 000@TI 0|SE:|pH| N Ki  KeL4K0 6K34K3U K#4V0Kf KK:00 e0Kf K:0 f [(0K0=0AfK:0 f [(K 0=0AfK:0 f [(0K0=0AfK | }pP 긠K  c}pP=  X@T 0S`؀K@T 0`S:pF BNK K3AB?gPP``0O?0@@ cAQaQ p- @L`0T 0TP$ U  $8P pp -0L040 T -,0L8l02 0謍K0 0!2010P0S0SP(0-#206S,0&,000a>000, R000000 !2010P(0S(0S,P0 =2S, 0 ,(0 000 - 0p`L80@S@ pOX00090e,o@l0P`eo k|:T: 0S0 0 0-L@jP|0h p-LM H`T Y X@ 0 87040 06Kp 0KkPPP=@   ,0 0 ( (@ ^ 8q -LM008 0<0 =P}80s<0"0080<04 @0 ,04@\^j4 PL@&j, ;, p0 0, 4R0><ʅ0 S00,0 ,4 0PLCJ 3( 25 < ( 480, ^0, P80@ B00p*0 W!`<apP- ,#(0L",A P p4,80< 00 80< `(08 04p090(Ko(K<0$(Ko_<  (KoYꄢ: p-LMH`T X@0 860$00>Kp 0KjPPPh@   ,0 0  (0 ^ 8 -`P$0 SL0p4@P 00$1l00< @0, 00 00C 00$P202L@0040004 -LMS<0 <0GF, 0@,08 `,00 Ǡ0F0R4 p8 @84j:#:zc>0PP*3 S R 00 ጑ ```0F  0P"0X$0= @00C 00 市`P2p$<\ (K, 810\0S 00  0Q@P4P  0 0B$@Bp -L MP`%< 0+p,4@0P 0 r ,0 P000 | $$@ < R4 00,80  40,K@H,0P0  , a044080< % p108< 0, 0 0 帢$`庢40!,P(10L@0,0,0, ,0 , 02,0帢, $`-08 04lBpt2  l—0p \0S <2S W 0 0(Kl@< s N,K(0p! 0-LMHPT 08 500K0 0K*iP  ,0 0  (  ^ @8 -LMP0@= `Z0 p ;80 S9 P2 pW0[ P, Q 4 0 40Q # 800 0S00 00W#!@!h!!@ A(KP 1,0 P1 ,00,0m @ ) 80,  hPP , R  P 4 (" , ( D0r,0 (Ko$0,0(Koa880 s2+Z P40S`  4P$0U00 W 0SSQ 3N 4 <00b<0 L, 0 倐3. 0 p#> 00Y R00`V,0@ 1@*C6"*0S8# 00V,00,0 3 Y@ 0L0{@a0 R8S?X20CX2Z$pW@$0S 0 00lB pt2  B l˜p 0\80S 0 000D@a<0S8006@axR08 -$HLT H0S$8>0(8 N3e q@P 0-@LPP 3PPKi0 -L4M⨚ , 0p="R =,+ )0*T d<0@ %0& P('$Ry .0:R <R R R 0lB pt2  B l—p <\00@#a, 0R$(K Rk  R z`9R 0RU80R _(9R 0R 0 R H9R} RV8VUlB t2p  B l—!pP ,0 L#Ġ# XK WKVKU@KX0K'V8V!0NPPS񟗆!!!!!!!!!!!!!!! !| !8 !!!7R RmU000zx7Ru 0Rr 0sRn 0o7RWVU8VR!0NPPSL!D!!!!!!L!!!!!!!!!!!!!!!!!!!!!!8!^Ǖ= 0=lB pt2  B l—p <\)lB pt2  B l—p 0\@dh=^l— pt2   l2p , @TlB pt2  B l—p 0\lB pt2  B l—p 0\lB pt2  B l—p 0\lB pt2  B l—p 6\l— pt2  B l2 p, HlB pt2  B l—p 0\lB pt2  B l—p 7\lB pt2  B l—p 7\lB pt2  B l—p 8\lB pt2  B l—p 8\8l— pt2   l2pH ,T`K@( ᷍8 R0K$40#  $<@Q KO0KP@Kl— pt2   l2L p,P 0  @P ! 0 0R@1@!  T0K傍^ 0N4S= S* SH(U@1@# H8 C4  0dU00U  0U0 0 U 0R0* R# R   U`1 `#@f TP1 P#p@e *T@# $x P \ .  xe#  #<Ȏ<,J9:ڎ<<<: -L@^^P 0h2 -LMplBP t2  B l2pP ,Z8 <0 @1pCWp!@0W"@T`l• pt2  B l2 p,/.00 b` T!0,!@W 0 0 mO^ 0-=2LSP 0,@[0h -LMPP "R pWO 0``c00v[ VlB pt2  B l•A0p \4` X2\"0 X2\"|smW@IX2V0CX2 lB pt2  B l•p 0\4 04 ;l• pt2   l2p ,` "p0=2l• pt2  B l2 p,"`,?@` lB pt2  B l•p 0\l W`X80X8 6]P`y $X( `0X8q::Т:: 0-LMlBP pt2  B l•p ,488h -LM`0Vp0P`VJe=2 SlBt2p l•p ,4 0S 00h(] -0 L=2S<2S 0-LP\P@0oT0 -LMP00, =Z 40 000 p4@`P) 0 &$ 170<0@ ,0 00C  0"`$PL@\0,04`090<2S(K a( -L@j\P 0h -LM@P ` =2S  $K0 008 ?<0(K4p(P060( 060(202( 0(0 $Lp(0W   $P(0 S00( 4090lBpt2 l–0p \0S <2S $<2S l@N <p! -L@[P 0h~ 0-0L P@=2S 0P<2S00 -L@[P 0h P =2S<2S  -LMp0  R0 0 R0>0/8 $(8 80aP (Kx2|" ,-[04eP I 090[P < 090QP0 0@9P02>U 0 .P@=0E?01P E 0R904 0 @RJ1?P5@TZ 8` 3 2 \!l—Ppt2 P l2p ,l—@pt2 P l2p4 ,l—pt2 `P l2pH ,0 l—pt2 P l2pL , L, 4@ gdclBpt2 P l— 40p\dsclBpt2 P l—p 0\@ l—pt2  l2p ,@ TG @P@T ]l—pt2  x2l— |,00 p\lBpt2  l—$0p \lBpt2  l— $0p( \lBpt2  l—p 3\lBpt2  l2p ,lRp t2O  4l—0@0p \lBpt2  l2p8 ,l—Y %Ypt2@a  FN.B Bl— c0#1A80p4 \lBpt2  h"`l—1p@ \lBpt2  0l—:pH \lBpt2  l—P 8p\|blBpt2  l—pH 00\lBpt2  l—,0pL \0@ XbPQbl—`pt2 ` l2pH ,@ T0@P 004 PH LHlRpt2 ` l—4p1 \lBpt2 P l—p 40\<,:@%I$$<%! -LMl`ppt2 p l2p , H P81S[ l–pt2 p l2p ,lBpt2P p l–0p \@al–ppt2 p l2p ,@dTP ,lBpt2p l–p 1\lBpt2 p l–p 1\  D lBpt2 p l–p 1\@: p-LMPx l• pt2  B l2p ,d B`0 @`0P ^ T <Y 0`2xV0`2x\;j;h:|:: -LM0Ap`S8@!l;!x?!;!l;!t;!ilB pt2P  B l–p 0\<2l0<2pt2  x2l– |,00 p\lBpt2  l–$0p \lBpt2  $l–0p( \P8S LHT lRpt2  l–@@0 p\`lRpt2  l–@0p \lBpt2  l2p8 ,l–TH pt2P  10CN>C 0Cl–0b "!HQ0p4 \lBpt2  T8L! l–p1@ \lBpt2  l2pH ,lBPpt2  l–p:H \lBpt2  l–P 8p\W`lBpt2  l–0pH \2E`<2 0CL(<2T(P(i<2l–0<2ppt2 Pp l2p ,LHT lBpt2 p l–0p \2`<20C<2P}P0=2l–Lpt2 p l2p ,l–Ppt2 p l2p4 , TlBpt2  P(l–`00p \l–pt2  l2p ,@%I$ p-T0L@`TP @T 9S  @TpWi -04 10@LP  >00t*R90  q0@-P( HT L) 0!"4# 8̓ t\0S \0S  RJTPP \0SX00 P Pp0: p0C*:p0: _0C*:0p30 P  0 0@-Q 9SlD!PD!4D!D!lD!0@9I )Q 0@ 9I) 0@ 9I)0@ 9I)9S ) -bLV@pȐ\P RU00S ʜ\PQ 0P'S% 0QL 0! "4#8<V+*t9X ",0( 4;2( +>`P q(VX ",0( 4;2( +>$0"` [(405 6478`:p ?;P L<$+4"2L)540674 8<2L)! 0"#4 8̃ˆL405 6478;P8p 4 ? 4 8\,Q0P , 8K00K0S@P`P`D0 @@ DKB2MP`0 K ?c`LW? L -L^P`p@ P@L) 0!"4# 8<^P@+ ^'" "202 0-L@ 0 & 9PL)p G'&09l#R 0 vlp30C! 0-LP@@_T0u; K 0-@LP凷 0 0 9@)0h迸 -@4LP R00080 0 4P0,0 0$0(0 0-PLXIT R0009 0  吸0 -Ltɐ`p0P$ 0 0`0=40404094040|p倀D@ 0@@L0<@8:8 0h1400\  H ` d l00l0 k 0-9L@|  -0.@L 0 P hL!: -L M0 4 L, 04 8 P , 0S ,0 S S] SA p0,(Kp0 08< 044 @0 0@, 04``p4 `00p`pL998< =>@ $?:P(; W ,0 04804@V0 :0*:1 0C*:,0 0@ p,H`P0@pDP0` p0@ L#D <P`0@(!(Dp#L440@::: 0-L ML@! 0Y"4#8 0 K00SPtɔ0X R1X R0K! 00P000SU\p 0(ɄK0p 0\:<: 0-PL@z00P0@T0됤: p-@LP`ݵT0S @ 0 0 0 8 80P8 ph먤: 0-PL@T0S @ 00@0@0  0c̤: 0-LMP~@# 40  0   l (00(0 ,00,0$00$0K08| G / :: 0 -L4 8<S@: 0-0LHPT JT LL  C$P00 -*LR@ XQ\0\0\0:X\0*R*R XQ\0\0\0 :X\0*R*R XQ\0\0\0:X\0*R P ` Rd0d0d09` d0 7 PP Q00090)R P -L@h -@L R 0S0S PP  0S00 R0  00Wi 0-@PL YU 0)9  @)> 0 9Y 9  @@9 P R0 p-dPL `R@ 0S0S  R  P00ppWi -LXM@ %Н,  0D P`p0 %4 8 < @ @0 4P `p$8, (<4@,@0D8,(K`: 0-LP(0U@  0hWj;t;: 0-LILPL @#08 H 0 48 K5": xePJ9 -1L MP U$ . ,@K! r!P$ xW! \iV#`V P0 48<S@@T (T Q!P < \!$ 0R KzW XWixeLi`J9 -LMp)(0! *@@"`+P 48#\, @ n 21C0a1 @   !P0 48Q Q QD H Y0 $ (,      048 <   Pa0 48<@(0) *4+8<SL, 0RM(KO0 0 PP0   0 $ (, B  048<#,##Ƞ 00 $(,0"̠""N 800PPPW00PPP( xe:X:lJ9 -LM Ly@W ßX9 "10 0 0 屚P $̠$$$H  @ 0 P$ (< L  "\!4!!̠""HP 0@00   !" 4#`8X<::̦: 0-L@hPP (0d90h蠱 : -L M4 LYUp, m00a 0 0 /0C 0 B0C` 0 B<0C 0 ` ` `4 !LT9' 040'U)(Ƞ 4 V90 0'4W)!000(0C "#567@0`1`2`03` p4``````````040pYU0@ :  p`D PU# 0 (0,@X h ~0 8,H 0$ (0W TPU4 p9S  0`4p0S0 @49Ix|)(KV`p(`0@S 0 @D1D! p-\:`*414!|:*,1,!:*$1$!:*1!:*1!`@l:p*PXjTjdjtjxjjjjhjL+  0U CU cU U pU U"p !pp,)pps/pu!PU!!]!! C!|]!|C!\!Z!Y!8P!tg! -`PL: `:pSt PcL P_P P[\IT PPSPU@1S10 $8S V:*R:::8*: h1 -pQL @T `0T`SP h!ʅh1` ㆃ`$mU@00 k p-@PLPA 9`S(U2ٮ0P9`9S d9S 0 3 1C#PQH Pmph090 D l9SU 9 0pH:<<: -L@8 P -pILT p@T `hP 3P  0<= @pTW mP:(0 S-$0@L,`9S H:S h* p- L0410T`Ut@H h9S L)p :S0(0phe00`00%SI 5S@ +(S *SPp*M00(0  S S SP PS S SS S SPPPPꔧ:p: -@L⛆`9S H:S h -LP`@ᵭVp (0S0(0(0:S P% :S$X0S! TX R\0\0\0 :X \0 0P (0S 00 0:S hî L.{0 0 C:  p-@PLn`}0X0*X\ PH:ʄ0CH:ph\ p-n`PLgJT XQ\0\0\0:X\ H:0H:Cp -yPLHz2> ,0 W9 * Ʌʅʅʅ ` e@`9`d0)40@ 480<(0`PW8r!@0S8@0 --LM K00,< 0!/ K -hL@P , P  :: -HLTp` +^JT L p gPd:S +^ : -HLTp oJT L p BPPL9 h P PPo : - 1LM` hpP( @`0o/K\@XP ( 0R)$K_K Q1 S h a0$0K 0RSJ/K 0``p` @p@`pW`p$_V kxeedA,:J9 -@L`p  PsPL v X)R_ hp)t R t9 RX9"100PVp P Q0p9  0S00Qp p V#t9PP 0 S0 S RQ  PU p t9PPUpp P t9 P2T!   PP (X 0S> L)0,0 p h0OウQ@ @4 R 0 S@RXQQ 4 R 0 S@RXQT 0 xY,h 0(Ko0S*H4P@! <(\ $P2"0CR202 0S00Ql: :<`:l:V -LMe\pK 0, UPP P  d@, 0R(K  8@,)}K7g@P @U h1gzP dP@ h1 kz dh.K0@zP 1 S  t02(K (RQ 0 @ h1AzcW/K 4"  @  ! 2  "<K@K  ! }  \1`02 hK"00B@(,"042 B<K8 fH0 a@X@ 㷎m0a 0 0 0 /0C B0 0C B0 <K     = B41#4!2 1",,(##Ƞ0702>? ;90: =!"#0123456![8 1[ <0@!1H0!X YLXɀɀL \ It " 2p9vP"Oẏ"R' 0S0202协@X t PZ p  Q ۍ@ ‰xeȫ::J9ܬ: kedA,:@:::::x: 0-@1L PR "RE HT P0S J0T0R R R 0 0hZp)R \0S \0S R`w0 lP L)p f00h+,:L: : -L8M0pXK@`P 0( Xɔ\048 L1 $(T\ 6( 0Rc$K"1   P d X1U8@K `0` P 0 4 8,R* R R 004 80 0 @00 @ @ @Xh Q04 8,P00 $xemarc:XKXIA 1 1K01 <Qp_ 0S%40$ $yK! udPK h1wP@0 @PH048 1 $(Y |!h1 w9aX h1w0ar@.<1ZL K 0 0P$ h1 xwaVR Nh1B  (@  100 $0@xe: kedAmarcJ9CRAMX:::0: -LM0  80 pX "10!P040 QpiV0` + 0㨀00 ,0  0 \ 4P0\X0048 L1 $(T\ `V X0S\`VニY ~0(K0U \ 0P,\ \ B0\0 4 㕋. 8L .0,0 000 X*08\`P@( L 0 4 80P 0#,##8  0L" 048 <  " "4"Ƞ 0 @| p9S 3#| 0@@ T0 TU T * 1A p J`P \`TQP`P0ST9V L) p L)0W\IT x:S P @TXʘ\l  T0 Pd `Y#V#`F dR` TM`L `8@  BPL p hphP9`SQ 09L `@ p qQ!L) p `  , 4S PL @p0SP&$<$$$301 20@L  poL9p0 ODP  5L) p ~ᝇPp sPL  L9 p0h L xe:<:8:::T:$K9:s!t!::::l:d:::X:t::M!: -P4LȌ?; ,H  P ,#LK09=8< >:; $? (H3 L \(@,P, 09=@8<>Č?:;P|H Ȍl0`4pL ,H3 8 HLH H0LHO0X0偈L"RE 0SH0L202R(XP( s8< 2K 0s0S   m P 00h0  CR @#00D3  @0 QPZ2Q80L@K0C80L 0#L 0L@@1 r! 0X @P @DX3 0|Sl : $Z 0@1 r0@嚀P`p@ČDȌ,$Z 80R L#( 1@6K0p 16K   ` 0CSv PL4@҇L<` 2K0L=᫇<# <# XYY8cP@XpT $PPU@`W4P @$PPU@$CT $PPޅU@0Q0C 0#@хT@3S ɅD\ ÅP, 0<R?(K4Q @  y P0h0 $@T  n PP X 0SB*KL3<Ds @s 83S# `< $?(<L  %P\ X A P , 0RZ(KL@K  X0X #?`@9 8p ᔑ唁ČȌ/0P:̌p ! ; a唡! /T`Xl 0O| a  .K Op 夜q ȁ b?KKAsSO<@  !  ʃ|kK  ഑ 尡 mKcP\  |Q xa X ڀ!@xX Zz(|Yv$ 0 ATbK~KpWP`P`B2MP`.K gc0`Ap wgX P P` `8Q 4a c|( $ ㉓,q 0 \ (|P @X`@A HQ DA A @h ?$(Yt p [K]KpWP`P`B2MP`]/K fc@`(!\|Q0T0R d  0 P`\A 嘡9S@ N?K0@81 4A ~KP`0PU`@p0q , JK( $ x VFژL9L) 0!"4# 8̓ t 0X Ra 1X R[  QP 1AL)p x`QX, 0RO(K$axqVꘁ們L)p u| U(|Pr$!x1Rnq封p !""4",H1 @  < D! dXO@b0  娯 !tꀡdW lQU 0 xe:$::::H:h:`K9@-L)@ 0!"#48 <29 -LLM` 00K\0 @#X@ P\ L)! 0"#4 8<4  L H  ?< 80 ,00 H@4;T$P0 T a\0P@t 0 dkVTn 0D @0 TKpP0S[W \D0t L 0X$(^ ,K &L ty908 :=<;`$>0(?P ČȌ<L "l!4!Ƞ!"D"X Z?`90:;=@>P8< (Ko: 0- @0L,(0 :0 9 0X*T: :T!P!$!-0 4 8<S 0-,08PS 0L(0G@መ0 -LM L ?P@ D0HL`P0 0@ P 0   1 (K04 0@L0L)p T 0,0: 0-,0LS8P 0 ( @30h p-`LP kHLp" !]P0@pPqIT PB R 0<0`@Tfphq! -2L@P 2S P P "`4pP P0S0 (  R({00P2 n -LMP0l0p 0h0 ` Ph 00000 ,@ $ bR00S40V<0 ,"?110AOHL( 0h8p 0 0(0 40 ?  "2H0"X |(8Ly01`X99  \Ɇ|t   p< | @ 8|00!   08   B.\90L)\)(0*+48 <0# #Ġ#+)*(0PY 9|V@ t P2|/|@W )|X2L KLZ |xe k8:edAP:ȫ:t:::::K9x: -LFM@`KO_Kp@1 , @K\ u᧚ $@!  C@\=, 0R(KܹxeK9 -LzM@`TpP@K z" K肏K,PU @ @U@ -LM ( h9i)Pj 4k8|WN@ P`?< L#?1SDOpPP0U ! 3(00  D0 `P HLp !]P∰0@pPqr0mqixe::ܴ:K9:! -LzM@`TpP@K z K肏K,㹅PU @ @iU@ -1LMp@, h9i j4k8 XP` @P@K  |, 0RX(K  zP 0! "#ČȌ̌h  ;tp6 @K  ;+@K @P+P!0 "# ČȌ̌h  ;~p 0hkIiIjI ( @K;@K  r  zP@@P xe:K9 -L_MQ‘0\$0 @ \% goKpKcK@LIF$ 0RG K2S " R*/P@goKpKcK P 2SgoK .PP 1SpKcKpK .PP 1ScKcK ~.P P@執xeL9 -LM@ (p0`0@@@#90#@ !@"@^!0 " #ČPȌ̌ h;0 hkIiIjIΌ; O0  @@@ M-RLp0P`  4K sy@ nypO0 0 \90\IL))(0*+4 8<0###Ƞ+)*(02s- 9P2P000) 22s# @$ ,$̠$@L9$`$H:? 9;=>@8p80<@(Ko: 0- @0L,(0 :0 9 0X*T:P:l!!!@-L)@ 0!"#48 <9 -,0LS@P` 0(00  L |pT0S ppPL8p  0 (0 X::|: -L$M0K$"`P=L)0K0P 48<@0 ,  .  8   0LY@ty40 !0 "# vX00@1X R#X ty 1X R02I *(KLY 0! "#48Q8 <02A 0O0 K  HP  80Y! 0"4#4 8<S 4 L)p <ĵ:е:: 0-L MLI! 0Y"4#8 0 K00SPtɞ0X RO1X RK0K! 00P000S/ S 0S$0S,0S> U!!!!!!\0<' \Ɏ$ K0\0<&p 0\0<\0< p 0,L 0  n \:<:!: -LMP@`t)q0X@T& T !h!!x!!!$!V V t)0L)p 0PyV0X`p` 0d9+ܲ Ki0FSV ViV Vȥ:O9 M-L0R TKL9',&&Ƞ&'D'X? 9:;=@>P8`;p?P4 (8N  0]@^`\\ X0 Č_@ȌlWP05 eLQXpEP \ E0LRQr5BPPTp tᄋ4UL H0 jt p | x Pp `t08P 4` +@0 , <0 D@ 048<`p ` p 8 K `pP ` p <` K tpK@@@Prʠ K @@ Pd 00 0 0 0 0P\ K |K WLpKHL  2. @   0@ 0@܉X*X\ :Ph 00#剠 0   LɚX 048<@KQ \8 #@$,##$T$h P`0@L0 p$89`妀( | =@:P<0dp  >;4` ? 8 ́,Pl @h vdKlpKpWP`P`B2MP`l K VcP`DU 0T`K@0@|pSZ PIDP 9SW0|K@| x 00K8K T@8 4 P LxPP`ULL) 0!"4# 8<P`Utɚ0X R;  0X R3 0@P1QiL)p WPxT9S PR L)Xp (Ko0 8 够T\ l9ꈳ::: -LM00K0 @(&@ PLP`L9`]!\ Pp"@^ $#_` p( Lp Z 0`KP  0@Q0@5 0H@Pt@ pP 夀pP0H t 0c9C  0 Q 8@Qᄛ4T P0 0K0 @ PH0 D@ T0KtK0S@80 4@ @_\@ XP @ < 凔ᦛᆄ8Lt K PNY\Y@U  L9HK`p ` p KQ l h h0X`( ̂S c_ t K U@ K | x KUt K x@ R0Sd `0 ʮ 0|`K@`p|` xp pP `0K Fp`7NV>F DKT. P T`p0##8 K 0`t)|01C X R pWh (K\pQ\Kl h P T0`##02, l`KLp| 0 pP\`KlK`Vp\` Xp `D LL B0l@K0@ PLP| d0 PP A  0l@K00LP| P@P !P  0 0 0|PRULL)p 8j PR 0S 00@0 0 0X @X0`*\ :嘠ᑈ et<:l:H: 0-L ML@! 0Y"4#8 0 K00SPtɔ0X RM1X RI0K! 00P00 R- @R 0S$0SR4U x "\ "D " " "x "\0<& p 0\0<' ɄK0\0< \0<p 0 눶:<:: -LMP@`t9q0X@T% T p"""""""V V t)0L)p 0PPVVX`p0 0d9+⺬ KiևV꼶:O9 -L9@] \L^_  p<: M-L0Rp` z KL)0_^0\]LɐpG] \0^_48<4@s ǏP`7"#@$#$#\$d$x?9 :;P=`>p80<@ Ki: 0- @0Ld`0 p: 0 B9)D0D X:T*<0< t:|*404 :*,0, :l*:0 "d"h"!`!"!!" @-BA 0 0#^0E-Bl pA `P (  0 8 , 40<`. VP^i-\0\   0"  P1 0<0[iWi 1 0cWi[i-1 0 Wi[i -p`@QLU   nP 8p8 10!  \@^i[iWi -LM `, 0 V@Pp+  00 `!@P&  0  S  nP"   00 ,k(K P  `P   & - 0L @P`,0S (0  L pdppP L(p  0 (0X:: -`@LPpI0S  U R P L@ P L@ 0n000 L@ 0L0i - 0L0 0X0 *X\ : 4@T @T -LM00K0 @D.@ PbP`L9P]!\ "@ $#`( ^_` T Z 0`KP 6 0@R0@@ 0H@P@ P ĀP0H ㄐ 0c9C  0 Q 8@Q㣔4ˉX0 0K0 @P0 L@ 0K0 @ \ P儀KH0 D@ \0K0S@@0 <@ @_8 4 d@ `P 凔ˉd ` `>@ VB K QFQPVQ봐`L9pPKK   圀K KQ l h h(` ̂Y ʁ K {QH K | x tQ8KX 80Kt0 p@ pPx Uʳ 0|K@ | x x Yʣ 0|K@| x P 0K EP6NU>E ;0  ? X \@0##@ K D0SDڴ`@t   1X R02 X t R |PU  @D  RN P Q ! `Mp)90 |KDTl D^&`@P|\ K ` X l@K00TPˠ PPD@_\ dKl0KQ d `   PK`P`P ` T``T` H0SP  lP lpP} |L8@P uTl 0Tl " K PPlPK```K|` @pPWt K lPK`` @psPG` K ` @`dP8lKT | K  QP%l0K K @pt@  @>PlPK`` K `` @+PY \f  (KY@ t Rp0S@ |PUx`V@x\5 X%Y#0dQzdKl h uX \P0##@@P Pt@ pP zH^ P`@P ` lK| K T H@TP`@P ` P )  0 0 0|0X`Wt|^OF|K|p@0rpl T[lPK` K `T`ˠ  @@@`pPiD\`0@X ( tP* |\- ; 0l0KT@S   @G K  pPD`D0O\ʗH^X Y tPpPU |\x^@|K0@Ÿ|P 0@$ p l Tl@K0 K ```T`0 [ P`p(P Pl@K00 K P t`PPD`VL`0@X- t^/ |Q2 PU5 lK+T0 !0000 K P`DP0OUH\XY t^pP |Qx R PU\HPH\H^*;븀X 0 0@ 00X 0崐X*\ :帠i y(r::::[i<:d:(: -L MLɐP! 0i"4#8L8 K00STt 0X RM1X RI0K! 00T08 R- 0DR࠳ 0S,pWT4V 8&"&"&"d&"&"8&"^0>& p 0t^0>' K^0> ^0>p 0HU@eT `t9`X [TD눶:<:ȷ:ܷ:: -LMP@`t9q0X@T% T t'"'"'"'"'"'"'"V V ᯁt)0L)p 0PPVX`p0 0d9+y Ki蕁V꼶:O9 -L9@] \L^_  pHML) 0!"#4 8<0S039<: M-L0Rp` + KL)0_^0\]LɐpG] \0^_48<4@s ǏP`7"#@$#$#\$d$x?9 :;P=`>p80<@ Ki: -L@ 00 TnP0  H p:09X*808 T:t*000 :*(0( :l*:$"("(""d"("\" '" -LM  0j,#-" -LM) 0j,#-" -eL`Pp< (00p04S80,0d0804p J00 D, 0@07< w᭬&((0"4#220&$ 04 @ 0ifꠏ<$:0:WEV-" -P L d&@ ᜭpP` 1TI t1T) *`ᱨT1T* L1Te/J`,10S ` 0 ᥱ`P ӳ`P0T$ ᔱ0 00" 0`0 e`h@ 0be/h 0U %40$ ( `긏drdAhdsd edAk~gd-" -HL!88#!$P1 dp" H0020p(P00`|4Q!@04@aT@!0   LjJ@00dD0~@  o4 @+0804 D~@ oL KJ긏d<< 8 8-#TLL%pϬ`P 0@ ᗬ踏d 8 8-#L@(ᱬPPp 0`ڰpP ʧ0S  0FpŰ0 pP긏d -L@E0w/"0L00 -p`0L xgP$  qg@P P00 `(Pp 0P,0X@P00 @Y i븏dedT:4i<:\: -L|: -L|: -L뤸:800S SP 0S̏d -0L -L@\p``hs# 10 0 P 0 W h]̸:: 0-PL@0 00h -- LM K00, 0 K -- LM K00, 0 K -- LM K00, 0 K 0-@0L@PT@T P0̏d 0-`0L PRT  0@ST000@TfT 0̏d 0-PL@ {fP 0 @ P00S0 0 0̏d -LM q 1@T  P0 1T, %0T( 0T% @0T*0CT*0T0`K 0@PP@ 0RKp0T h0TP  @80T @(xe'B&B"B!B$BB B(B%B$L9 -QLMK 0K 0SB$  p-LMPK@` TCJ |4QZT00V0S 10C x 00ԏd80 P0S0SP؏d@ P P 0S00b؏d: -H L@T00 ((0 R00@JԏdЏdki: p-L`P@P @ph:P , P @``00p ph+:؏d,:r -`@L0S P@T <0 ,@Th؏dX:l:Ta%t;D: -@L ;hj 0-DPL0S 40@T  )@T000܏d؏d p-L`zPP @0 0` @0!# p,: 0-XPL0SH0@T  #@T000܏d؏d0@-\P@ 0R R R  0R RT@@\0@0@0 d -LMTa%0Q lj(iC;x: p-`LQ 0R p 0 S0\ P  \ 0S@@PP    \ phv (ia0 -LAO X -L;OH -L5O H -I L/O -L*OI - L$O -L P -LhMa0@K 0 Pp~ 0RMK@p P& @lPK1@0 T0\0X 0 T0P 0 L0H 0 lK@ <K0@ lPKP@@ _ P @ vP @R P  TH1 Tʺ,ס% % xe:C;x::0L9: P-L  0Pp;liTa%EfTa%Q0 h^g kTa% ᤼Ta%t fQ3Ta% fQ2Ta% fQR2Ta% 0fQiTa% ' 0fQ{TiTa% ' fQ2Ta% 0- 80fRPP@LT  e3@T0DiTa% fQY3Ta%Ta%bTa% fQ2Ta% -LQ @  Q̹:d -LM`r0`@ 0 P# PP P 4x 0RpKTH PK DP7 P1  @T; { P \ !0@ 0K\ 0K0   h1 R`1T1X!P!@10!01 $- @ 00@@; P  @KKUP00  00@@ ) P  00 0qx宠 P h~K2PLvyKx xex:{ikidkiki:Թ:kiPPg 0@^SD 0H@K 0p SpP  G   >  0@^SP2p/-t Y lh0`* `l0P8Ĝxeȼ:t;kiԼ:ܼ::;:::Ta%:kiXL9 0-0LSP@t   0hx d -L@P P P P P# P P3 P& 0 0 0  P 0 |0 lP  P D P |ikiki{ikiki:: -L@P P hP  \4dP 00c0X: p-LM`KP Kp @@?0 z PPP0@S00S@ P# K^P T 0S T U  j? T"T  0 4T p? +00: : p-LM`KPKp70@S@ PK T00  00b0 0 '0@S@P00: p-LM`KPKp 0@S@ PK RT002320 0 0@S@ P4 R$ 00:0: 00Cs0 -@`LpP 0 @0 SR0 ӧ P R @ 0a0CSa0Q-S   RD@T 0a_S@ ThdL9L9H:L: -L(M 0sS  P `PLKV>  Z a0@S( K$ \R0S  0S0SQ+0@a$0Lx U TA00 01 (KP0SK }1 ` |!0S PPB`aTU p0K8 0@ A00cP  0 7,U`&0S@  @ 0a0C0S0@SV P0P000 R  a0B0S(0K +00B R0:S 0:S_0PE$0L000C SP0 ZW liliP:d8X" 0-@QLPJ @TZ0 Q-L`ሀp@00fT*P 00fS 0c00f000f0{i{i p-@@@`08PcL0`000p{i{i{i 0-@QLPJr @TZ0 0@-L@~S~ `"d`"_"`"`"a"_"4a"_"`a" b"_"`a"(c"_"c"_"8b"_"b"b"_"b"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"_"4a"xx6 Q 0@^S)\V Q0q0 R:@0 00 `P0aU 0R 0 0CR0:E%0S 00C0x5l%0Q*LU@0Q* 0 RE5 Q* 0004$0Qd帄0\ᔔ $0ST t吤T000 0 S\4T00S0  0 0 @04#0S*cC3Q`3 be#C0 0Sn0RR0B B  0S 0S S0R SU K 0RLRr 0Gb 0SQ P000B Q6br00CS0吢% G"8:|R0B0 S C R0!H"010Q? 0$RC 0 0R "p쑟000 0 1R R 1 1`1蠡 G0000R010 0QH L!<000 0 41R R0 0R0 0p Đ P* Q% 0Sp0PQ 0S|0\^0SRL0 @N {i{i{i{ixdd|dlitdd:li -P@L@PpP`P0P @D@PPP P  00`{i{i{i{i0 00@|i{i<|i4 P00 0 Q4#5ᄔd{i<|i0ᄔd0ሔd -L 000舔dd -Lt T8 !0@]S@00@ SE0P03P0cp0 QR`TWpD@T7pD0u" @/TA DaDU9070S0pDU A D00DR Sa0D_TS0oPOPP tPTP P xPXPP 2P@A @a0@SR2\T( 2@P2@U tA @a0@SR@0@_P Q:P\P00 \Tbp P@8X0U0hSp P@I\P_P 0?SCj"j"j"j"j"j"j"j"j"j"j"j"j"j"j"j"j"j"j"j"j"j"j"j"j"j"j"j"j"j"j"j"j"j"k"k"|k"tk"lk"j"j"dk"\k"Tk"Lk"Dk"4k"k"k"j"j"j"j"j"j"j"j"j"j"j"j"k"j"j">P 国 +@<P*@.P @  褔d|ih:{i<|i::: P 00ꈔd -(@xL0P 00@@|i<|i{i0ጔd p-LMPP`V Dxh@8@0 ,$0`xe:ؽ:X`%j;: -SLM@ 00S S h0Pd  0^0?l 0厼000 P  0 P ꤔd,:4: :::$:0 0 `Rꠔddt; -鈠刀pL`Wt0@9VW@@ LT0g0C `pW` ?pꔔddd -1L `Rڴq B0R !0F]S& VT V1 VK VZ tQ-@@T cP: qP8 PP@ 0P0C0(A PU @0 0 S 000P@1900CR 0  0P0X 0000@0 (0 h꜔dd<:H:dddd -DL4M088 S, 2PLKHpKPKTK ` 0L @@ # L (TQ 0P PL0P P R d P0Sl0HH, 0R (K0@,$(dxe dl:dt:t;kx:L9r<0  4 40pQ 0|i|i|ili|i40,0, @pQ0 |i|i|ili<04 40pQ@ 0|i|i|ili|i cR(0$0] B   0 0|i|ili -8@LP 00@P 00謔dd 0-H@LP  Q 2l 6S Q X0X 0S 2H 8S T y$0u00dd 0S00|i -pL0@SSHP S 0S i `0 Q00 2| 6S Q n0000SXP 0  iDit|i|i -PL`eHps@P8 00CS0 @TR]@0S S' S: SJ 0S 00J 0 00C0 4 S 1!0S 2!8S 0S 10S 0S x10S 0S HpX!00CS0D1 R 8基,固 0Q/ 2 8S* 0 RT T U 0Q 2 8S0w00 CR@@DnTP`h U\ 000D 00CS0u |idd|i|i|:t;|i:|i; -L\  |i - 0L0S |i -L\  |i -鄐@L0Mp`0 ,0 P \ ,0K ,0SP11@5@T00 P(K|id -L\|i -LM@PP` \p 0KPV 00@0)V 00|i 0-t0LM R8K L@PD0T 0S@ xP UP 8ddd -LM @K< 0S0B :00A0 R 0 ee -LM$\  |i -LM$@0 0|i -L\  |i-0   |i -0L0S|i -L1L`MD0 PP(0 `pl KtKx KHtP 1l R*x0S@ hK0@@( 0R$$Kl RW 0pK| KP p| T@hK0@@$$ dxed;:x:L9 p-L@P`@P 0S pp4p3p - LR`P; R :R0p0E@2S P @T:00E` RZ p|0"P@0pS@ hP WPT:00E0Pp갔d:|i -LM@ 0P  K -LM PR@ ` R :R0p0F@2S P$ @T:00FP RZ `0P , 0"@P0`Sh G\0 KV@P(KT:00F`0 , 갔d::" -`pL`@2 RP tP @T$h0 谔dо: 0-LX@PP " 0 S0 00 0谔d: -Lp`PU0FS to@0@S S P 0@S oŷ(: : - 0L@ hxTT p0\ dpPb`\ 0 40WP$p$00h[k<:,:d|i0: 0-LAPMKQ0!0P 0Q#0SyH0@0Z0 R0 R Pged00K0l[dX0S P D08Jk$i|i|:kiP( Ka)pP ( R 00CS 0 P(v40h0 0c @0 (0l p`  pK?>pP(0\ $@<0<00C<0S+ (0 (0 @ (0P$(0 @ P(0 ,@0P(4@8P(0<@@P(D@HP(0L@PP';(  00CS 0 O0N} ; 0( 0 9+#(4wd d -<2LM02\@ ! haI !$PE   9NPP @ !0`qP?@M(Kc Kp l 吐 P h` qP0CK 0k9@P00S @"08!3Pc0Kp l 吐 0 P h` O@P@M"0K T*S' MpP @ 0@H0 D@  00K< L P0 @ 0p , 8 4` 00PKB9@P!0p!0"@"꤈i k: : -L4S  -L3S0"004S -3LS@ 3S 03 0-@L38PSᧁ0 -3LS@ 3S P ӱ03$: -LM@TsPc3#003SP3PS ڠ# $P ਱@: -LM(p"CP0 8000X jX0`80 VA Q010!8#X PÙ\ 0   0e8#p0(K3@T#TP0, , 0, 0D0e8#p P. jX`; $1! 0 V0   B0c0c08 #@gH$H 0 @4 ,D0d8s4#8@0000 p-&@8#8L`2S<6 00 Rp 00 RP P0P㸀 =0 0U6<6p (p-"(LPF`P 0 0@P0@  k8 ph)0 0@0@p -L M0 6=@SO (KHC0LS00`?p 0` 30X#T 0` 60C00h#T0l#T'4p#T 0` 30X#T0 08#8R0001;.0Ql 0 1S; kpP 1e 00LP  pk? Ø10C4\`:   Ϡ0; ("(<Z !<3P 0  0 ?008#8S0k0 00Cs Bb qW  010R!!  0 10C1TP , P @0T @,t`PU06;67: -ML 3Hc, /003L@ /B0@ 30 X#T0@   3 #T #0T #0T3 0 #T0 #T3SB0 d#T0 \#T `#3T #0T@ t#0T @ 0 3A0 X#T @ 0 p P @\#2 TXP@84PK:@x#0@ TTp! 0 08#800t#@DT  0@ 30 X#T  0@ 9#  00 #T0 #T3S   0@ 3 X#0T9@0;9:T, 0R(K #H0T5 |#0TJZxeL9 -LMHSLs@` @0 30X#T@ 0 D@@T %gt#$ 3S -PL@p``|1T% 0CT/  08@4T b01T (1T0/ⲃ@4T6@ @b6 @& a@@P608#8@6 0 R8e@ v6@06U@t@P_@[i 5i 6i( 0-L@}`PXL0ha -L MHLp@  0@ 3B0 X#T0  @ t#$DR0 0S  0@ 30 X#T @ 0 @ , K 1+[[P35#5000b00a 0a0 " 2 0 B S 0B 48#( RG`A0SC_0S? B("(+[ 0A1P07d#0C220 T00 R 0×  b$\PCTc $,K $+K $P $TRK0< Z00 @0@>(K: -@L 0C  0 0h&: -scWDqLs VP40 ;> ;>N/!10CĠ0@F ÅC`P  V;> ;> Op m1l Sh0!1`0 1X0!98P|@%8@zI~$"$"l"8"": -OL( (0΁ !0ᬂ!hÂȗ"" -L M38 SHL0 (K@  0@ 30 X#T  0@ t#$pP :  H4 Rv g 0 0@0@3S 0@  0@ 30 X#T @ 0 % t#$pP4 0 t#T40  t#T t#0T t#$ 0 #$ #$ #$ t#$pPm0 0@0@ l#$Pw h#$00 @0@P`0 0 B("(@0@R0 9^ !HC0LS0 0?0`,0 0` 30X#T 0` <1 60C00h#T, 0l#T, "4p#T 0` 30X#T 0 B08#8 Q000 ) h#$ UP` P`0 0@0@ ~ p-9@@  LHÔ`PLX#0TH3Ld#$$00 HÔX#0LTp#00HÔLp#$@060 p-9@  HCP`LLX#0THÕL\#0TH3Ll#$#HÕ0?0S0Ll#TH3Lp#$3HÕ L@000p#THCL\#0THÕX#0LTp -LHÐP0L TH3L $H3@L @$@T# T pHÕ 0LoTh h0dP@ @0᱀ThƀT T$p0@#ppȗ""L9# -LG-@0 084 0<0   0 0 84 0M<0   R0 P ` p@  l0 P ` p08 40< 00 (0$ ,$  084 0<(00 ( 0$0 ,, 08 40<0 (0$ , 0 8 40<0  (0$ , Ѝ0A?@P$P`(`p,pԀ0ؠ48<@q@@pG@q @?P P8A4P`0``, 0R(KP p  00@1Qp P8A4P`0`9xeL9G-QM= 0`p0Fjj hq,f>0-: 3:*fA*Q 0, ::,!,,,\V0 !0!"Y!0` 0Ѝ褁iiXeLM91s s0<0 0<0ᐖdd@-;@ 0$@@-:@ 0$@Pკ$0 -Lh|O9ii -LM[00p̠`0@(P \(, 堀0,0 ( @w[,KX\[ P@P\0 0S@0%050%\_[$K{|diddiii -#LM0pŸ @ 40, :Bq PPN[ 00 0bC2S0c0S U 2@8P 8< X[(K`0H"\B"\$t \q 04, : "1  1b < 8 @ P`@P`P`}p=<K !\!P@PD` $@qD$A00SA Z 0 0c bo"oFS0c aR bV00S0 "^08PP C4PC2P C1P0PPUhZ 0XXeP0@0P 04 4KrD {ꨁii|dddii -LlM蠟0P`(0 $UpK8K pK8K*WhN*PU@1@#/Q G0dPU`<X( 0R$K `xeeXeM9 -L8MD0L`K(pX@K$0 9r 00#0 QW8@ ;P 00#0P(U0,{ )0 +x"0@ll0 W XYh$ 0R K,Y$xeTee Ue\eij`edM9 -LP`p  APP  P@1J# [pP  00 RAP PpX @/ -0L R/  00 0   he00 R 0  0ll[}h dxXX hxL !@xeiF9<(ia0ei""ii,": -xQL@pXY0SI \!0Z0j005@*ZD `.44 ;0,( A?V0 0pS PV@1@!c "` ,0`d0dS0 V0  @0X  oX,<44,[ 10ed`e\eTee UeXei -LlMd@0Tp$0 $ 0RL K  @ T`P0Q$  Q@1J#U 0K < Z@P U$?[ Z@PQU@ K@&L@KPK(D,0N,K(P}xe M9 p-LM0A0X0S: !0S0C01 a0S ;0,$( x?0@ aK"P` j0@L X AXx,<44, 10ed`e\eTee UeXei P0-LP ` @T 00C-0 pR 00P`U%  \00 N @ l3)^Q<0PU TX 0> n1 ^2p* K<0PlD"[0R =X X R h@X0O|0 x@ 4`S< ph P26B 0bC  R7AQT7Rx 0P0K |K0Ph `@800 j L0l0 |K48d R 0@@PSPT00S40,00@8V` w0<S t0X@lL4 K0T0@0TV ^< tH*D06040H0D 0  H0t10PD@0 :@^^ `P`p4P8`2@8P 8< d UL 0.S#%@DP@ L T pX :LPH =8jHt TN8jt0a< t)D060<t X@L0T04 K @P>V UF40H0`1@0P 04 O09t2 t H y\@  ;0S9@0U5:0S\ \ 0S 0S 0S0P R @ R 0@4 R(K0S  R P`0OTS/0 0OR 0 C, l5.)0S#Q 00KOP0 L00@PQ -L4M  $0 0<0 @K;   1KB Kd -L4M0@ $ @K <0 3 K̗d 0-L M(0@ P b$p$!0S(0 K0S   00 p $ (0!Z(0 df; J p-0L@`P5 P p[0p0d0p0|000pp0P d0P |000pP p%0p0d0 |8p3Pd-P 0-@LPϝ 0h(: p-0L4M"`@l1Ph P 01`l1D ؾP <LK( 0P H0 t  Kp0:d 0-L8M @( ,0 xP!0Kp!H 0@ $ K0[S< L@KLK0L@KH0 0H0 Ld\d p-0LS@P p R R`d ㆾP0 <0p`8{P0 S qP D:8:P:0 <#<0@0  p-0L@ S """ "" " " " " " " " " " " " " " " " " " " " " " " " " " " "" "P8#`(0  ("( Q&*0(00 $0 e0b$000p` PB8#`Pp`P\`P0PP`8#$ $0V0$0000p\:df;ii -LM0 0P0,0 , (0U@$p0`>*V2S/00@0 S\""""$""""|""""""""P""""""""""""""""4"h@`T  ᷽ 0P,0pS(0$p@0`0 0S000 (K`@T (000 $00a$0 `ᐐ@`Np@`d0\@`0pd `㰐 @` pd@df;|:ii0@- 0P840 `P000 U>`P 0!  0J>`P 8! 0100 嘀K  P`P@00TP T   P0P@T P`3hxe:M9 -"LPMx |"d0K, d 4PP *D, 0R(Kd0 h Kd PP`@K4   \K[KZKK(4K[ 0D K xRKYPKXPKHP @P , 00 0^nP`U TG*AT1 @f0P  00,80 (KT/*. A.0P @@0 0 Y 400 00< 0S0c<0la0 , LB@>@:@b6@y@B#A#@# p-L M@P0`   0K`{P0SKp -LMBPBp (` 0@@P/22 V/*@ @T**0S 0 PP: x(P 0@P  R0S  P @)(&(P -L4M 0 , 3SPp%\P!10C8S1< R (KBB 5(  0@iP 'E01 1\$ @`L 0 Sj*  0GP_`\ @0SYt SLPL L 1S D  84 41, 0 S  4@@:P 3\0 @,`K0  P\00SP2S@ H `< @ 4@ 8@ R R7 < 2 S< @ `4@ 8@ RY{  ʃwRL 3R@P Q: 0R_*21C   0 @@DP a@  @@@DQA L V L 0@ c0  00K4K8KP@0 D0 0 80 1sY Q40000b0a1!1H L0SY D X 1sB Q40000b0a 1! 1D@ 0  0H0 1s0 11s* @0DY0$1  'HD 00" 0D00, 8D! &h40!1J40! 1F !10>0>0 1!D0 4K 8K00K90 D {id:|dۣe4@# -LrMuD, LP  ! 1 P 儀 K`P @0pW `P&d00 , 0Rg(K0! 0`PL0$ 0 0`P P 0 `@K 40`PP5[S `C[ Bt&PD 0@`PC[Ta !a ^  0S0q.(K !p0>00b>0q 1 ! ldz q0G 0gP p@ DqpP( K10   h !t.  . a0 S2Q>222>303h0 5T( 0! 1 1 hK{P Z pD@h0Q q.0C 0b 0pp@Dq  ! !@Rʴ#[Rm0ˠ@1 1 1Q8  @ R ]h l Q!lKR 0c!d d hK d0KA PH\3:h0\d% * d b 00b$1#[0d0 Z!0Q$*"!B00  000 1#[0j1 hd ` /1xeN9ۣe4@# -LHM@aD1V@$0 p 8Q$K 0wP P %l K %cZ0d0  0\0 ` 0T0 X  0P L0 *0D0 H  0@ 4 8 <0 0<dK7 ( , 00 ?i -L@\P @1S<@ -L$M (18 @ `@ 0S` RP 0PSU *0 S   0 S  R:p(K00@ T T@ T T TH@ L@ D@  0T0S' T L  0L0  T LL @T TT D H 08#8;00 0 40  8 0 0  P,&,K. p,%W0<0 w(1, 0(1,0, $,0 , (00(0, 00CS 0  c00P L0 @(1? 0(1 a$?< \$0 0` Ȍ. qΌ@P 00 `Kp -LM pR`$K0.>0 0`. 0 @P`0 `P0@ `  0``P0S   . . 0`` -LM @R`@" 0:#:S%0:#:S z'zW O3P @  @ Ȍ PqΌ00p -@P K0@ 0-LQ@ P21C 0 P  QP P0\0 ?"00P0 -0LS`@ p2PC@0 0 000 p@P00R00S p-@P00L? @""`!B# 0P?F"`p p-1!1!0@!00>0>0PL 1/*"`!B ` 10a 0`0PP PPP0P:"!B00` 1 0 10a0P PPp@#0hq k0hE k -0LHM,0 0@ L0 T0$ ( TK BP T0 jP P ${ Kw@S:<:: -L8MA 0R<0 0 !UO0S $0` a1(K *0!@0P0 `PX ,0lx0PUM +#0@c 00 0`Cp0K 8@ 0p X/@F 8K80 PKD KP0 L@ Hp 'P& P PU 0- ,04 Kj 4K1@K@``ds0 30K2K0@ <` `F<K (K,(݆$ۆ넊i\: ,d:i::h: -6儆LM|h0rYIaWhhhVԅeܝY} & =`0Q00`P 0  Rp0dqP $a 0 0ş40S 40800娥 8 0%S00(00 P0Pp`0-0<5(4 81峦T$ Y SY 50 @'0 p:4$01 0A R4@x4@@ P  kp@P0@0`d @0FP`pP`pX@\Ph@lPp`tpT@`d*1@@@*3 T! P%-Lx/@p0]{^S밉PjC#0S @P0SS[67\S@ZWGv80S0 @K`,c,ß 0@@ `aP#0B00S 0 "M0Sx:.dz20S P 岅,K,00ŸR$09$0 0 @Pc Hr 0g! 0 @ 0 0Y 0 @P`V P=U @N 0!1APU`V(* 1P5p!pp1P, \\1P# HH1P 441P(9 !00cL !0@CM86420., kii,N9C;ii ixi2404 @,0( ?8hx3Li,iPi(idehe p-L M@$KJ $0PQ@c=YB@DB ]BT00U00S Kp0Tڀ0`Td0@AP8 41Cc0A0c<< -aLhQpU (0"  l1 R. H00CSH00LSP0@0S4 !1 1S 1A.NP(0 0@P `30S h3H00CSH0ʀ=Y000 0@@02 0 1S 40MP(f0 k,i<0LiDi -L .x0P l l0@@@7\0\QT00S%<<0 R@hI$ 8$Didehe,i(i< v0i i p-LM0`P@P P \-P Kp 00 0 0$( $ 1K0 , $01KP K(00(00 00KP 00CS 0 00KP01K(00 (0 -LM`Pp Q B  Q D00BS 0 K0S@$@P K40K,@ (P 4@ 0P K ` -pL2`0C8#8S2? P@U R 00 0 PU@Z000S0202S'2'/P P8P%@P!8hwu'00202SXi 0- @L2vTP @00` P \,\X00@2000CH 400  @2$@0Xi8:Йd -LM,0,0 <uPH mP- P*,0 2 0SRH0 @ `P0 0a 0q 0 @J F B >,8 S 0@S`S  0 `S@ R 0s 08C8SA 0`S@40s 040< 8 @ @cTڃ ?@cTT' 02` 0Q q '0a'  Xi8: -L Mp 1R-2P4 , !`' f@A  d3@ ,0 d(0SR020V400(K040 042!Pb, a' 1PQ0 ' *@@B@BA 000 d@@B@@A w d00202S''0'0 -`LpkPP ` 0 S  S0S<0 ``0BS 0-`$@ ?  `x -LlMPp4@P ` 0匀K0 0  0`0CS 0 V  KhVP0` l ` -L `qP@1 00qW 00 000   Q$  0R0W0S 0WP( 40U  1 2 1 1s 0U0 P00 1 21 0-@ MLPPPPT 0P~u804 P@uu0@K0Td@: iH:Xiďi -P ph` L80@03P9 00R2 0s% 0` 0 0  00 0101 1s 0U0 P001 21 / R <0R  k -LM0 000p0$\ 1! Y 01 0!,0 X0 R4 8 \C:0BF  c03P? I2@`v`  V1@K0 SSBC  c03P< 02@pI00!0$ P1! Y 01 0!,0 X0 R4 U Y(K@020Tp 10 pR@ @Tp 10 pR@ ڷ2,^  1 @2 1 1s1 21 0$ ^ 40R00$8 0 0$< -L ,0 $ 0,000C0YJP'  5&00Qp0 ZP唐 R00 000 g'Y40j<0 P,00,0  B 00 0 @,00,0  B E'<0 d %p7'0Z. 8  <"!B$f0 j[00SHڈ!43C" cb @K@4pK@0K,8 p@!Q4p 0 , 0p=)A@ -B4p 0 , 0@40 0@ , S X8 ,0R  L 0R 0@=9 =L H D0 4 d0R 00 g[s a 0#SP ]&@ ZMb`:0p `Ha@対 @0R @P0` P @ (K a@嘾>0`0`,K@0 @P0` P 4,%0, j,d -LMp4 8 @P 8K` P*840 @10@0!0P,0 P@8 ,K ,P8 0,0 B0R,0 P8  P'00K@ (K4K  P`@Z`J,K ,P0 ,0@T0P,0 ` J |P'00K  rP -L M"0(0, `PP 0pWy W P8Tg (K0  0{PPL0$0! 0@;00 0 XPP1 I 0  0)PP @0 Pp0 ,K PP;, 0l0b 0 RP0Tq@ P41<  T T (1#209P0 pS00S 0S T P P @ 0S* P0  0 8`fvPT$1 !SP#P3R0! $0S UbP`Dixd`d -LM0h d2 0l" 0 `2 pP (Kd8p hJc0? 0 P lp hp p d b TʟH" 0K L @2 <" #>KB/K %K(q Dr q q 8r 42 L!  pPA*(1\ @AhPU  \P , Ra 0 pP{00@,K`d 0` ϾpP00KP K?(1>QH ?fP `" 0P& \3f 9\'PL? p $ R\B \BP0S 00S00?  R$? (10(1 0,(1 Z ,7 h"PU Xr , R 0 X2P0X2 00@`d,K 0` bP00KP p?W8pGXr W0S }! 0X"0 000100\00`00!0S00 pq 01  !H1 ` p0D1%K>0#6`0@1t00#6l08!x 41|0P00X1cL@KT2 @  H %K\2$P = ~PP1 4&'QteP \me`"P 0X'\L?  pp ?Ppp e 00 B0 ydLN l@ " 4QT0S0# X00 峎d2O/5d000@P0P1dT00Lpd"80@0 Q0Q p q1  Ppv0 00 0  d80 e0@0@0@0@0@ 3 '\ \d`"P 0d4,0S %KPoT"l2%K ( Pcd"80   L?c81S# L R  S (1 /  1S/0D 0R %K 181p  jp d@SAd"21C0 \  @ p00`@,1  0 001 0 00, 040 P4  X, G< K4K X@@PXJ8KP% 0G 8 :P4X8 ,<00<040@4 00408 40$ 4(00(04  00CS 04 p@d2 8d g4 0Q0Qp r<f4 8",6 z<Z4 ꄈiܙd(diPdd 0S$ R(0(0(0 , R$0(0,0$ (0, -Lc 00C0Xihd 0-L@P $ R(0(0(0   00P00XP*U\HcF0@,c$c 00C00hꈜi0iidd -P@PLP` pP 8@P@ h3H H00$S$0#H0]/00\ R 0 0 0 0ch -`Qp0 !L`a m,@T~ 00S 1 r $@TS 8P v-\U 80< S \+  (0 (00 Y0W p10< R -0S(0C8v00 Y0@ <]/0400 (0  8]00 Y0' ]/0400^ 0 (4P 00 Y0]?  0S \P  > 0@|: 0-L\M0@ S  K\0hKPTPPQ K 㰻P Q hKP 㨻PK0 0-@L8G4P,0S40 4080@8P)0h2Td`d p-LM`0@T  04@T 4 xR808080 (0P80) 0-0  2`dTd$: -00LS`@P!$ d~k(p0S U U  R0000 0 ( y0S @02#f30S80 \X 01c(0Sf 81L0S4 0R-0808080  R 0 0 0 ( / R 0 0 0 8  $0S0 0 0p ,@T 0A2U@ 0$P80 Q8H< R   F.(0 3p ( A(0X"d10Cd10004j0S 2S>  @0SX  0 $ 1 8 `80  1 @ 10SC8P0]/@8@= @ 8 130m~qH q7$ /b\0S\: Xa\5 i R 0TP o00 |0S   姂P  PR::ii/k:i -L  -LM@Q K00  P   @-88 @2 1 0!0 c@leQ0i -L@ R 0 S1P\PP0Q  1S 0S Q 00 R0ii -`0L RP 0@@< @P @Pipe 0h!4o k -0L8 @ ^hb -L`PVa0@0 0p 40,`` Pdq(H GG>a  000!0000P0cSl G<8 0080 0S  <@ R0 0 @8i0i$i -L0, Ã0ɃQ #0@S00*0,0T0a  㒅88!>0 C6 00 6P@40  04 0P @@@ PP  Y0 0cC61p00@4 0ii00S00#00!P0 ,d @d 4c(dtidi0ddhili|:D:: P>0 à 0Rl PR 00S 0000S 0- PL@0h p-0LP`@V0D  Ppph+00 h R 00CS0  k -0L(!(M10 ph  `@0   PP0S (K]+@8K" 0P+ p38K ,  #8K+ up38K+8K}+P  kO9 -H0L h  R@0 00P00 k -L @ hgFP -L@ hY A7P -40Lh!  @*Phh k -L@ h\ P@0S8@0 -LMbp<0 P @2Pp8 hp (K)0  @.[2`00Hp408P0P0Sprp4P 4 10S 40<404 00*  4, 4 |00S8@0@0<0 @PR00,K  嶾pPA,0SL0O 8040@ 0H!I+40  40040,P0 0  U40; 8pWpWD@  `0b 0R0@ b0 @ Y0@STYe,0L0 40S4 p ki!Ce:P Q 00 RH0 @0 P00 S00 S4Pi iT0 L0 P 4P 00 S(0i iH0 @0 P0 S0 SPiX!00X1X!Ri -@L 0@ei -LX0 0,X0!00 @dd0$@d@X1  0  0R>802P U;P00 U"@#0 @@0pа P( K0E0"@E0`0@P ڸV(K@@,  ` 夗@@P -QLTM| Q0JS-@P |P -00C0S(0  800JS @ l@ P00P0 E`=1X 4 @PHK`0 \@ p80K lhK8 TP h0 dP P` L ʣPZ Z ZD< x x H@0x|p0 p t 10 0!P,0 A eZ,Kt 0Pfp00KT d  @P80 l80KhKP `@ \P X 4 h0 L 口PN0 RA :#:jc0T0 d0 0@P8K lhK`@ \P 8p 4` h X` P L0 sP2V6 0S@10S @T000Z8, P ,0 0T ,0 50 0 00 (K Z(K00 t Ȗlh@ 0 0RA P<  | D0, 㟖P ,0x 0^x ,0 tt Zpp U | <0dZZ|0700 -LM D0 pP/ gDP   0@ 0$@ 04 0@80<@$ @D  0@H0L@\ X\ 0@(0,@ d (0@ h08, 1x00000000 04‡08‡0_U0 - 11=H - 00 05B/A#b 00=9 =\2 01A !L D p0^0 H0@1AD0]1! !1$1$0S1(1$0S1,1-001(!M?3!O/ 0 8 f Nf f0S`00`00 S`00`0- 0B0RS) 0S X01 `01 h01 l01T1@0@- 0!t00x 01 111!!2!P0S lQ  fDP1SP0D2HB-00C0SS 0!1=1A2H!B/A#b!0O1A/!0O1A/!0O1A/!0O1A/!0O1A/"0O2B/ "0O2B/ " P`!0P`Pc$R(0@L2PB$!`"00 l 0S00 p 0S00 t 80 Q p00|0D@S00CT|0 0@P0T@0|00- 0B0SR 0 0@ K4K, 80/4@?@#bL3c1!(K` h0x ?A3c 0\"l00@t!|01 A = @0P` @P0@X1\A2Mb?B -L$MRH0 HD Q`V pWV (K ,3hA1!< ,0 4 p30 DP  k2PD@ 8 U; !R5 @-0S1 ,0SmdQ$R$R$R$lR$HR$(R$pQ$(0 "ZWi4 R @T@T ZW00@ @ VP fpGC@TPU80Sa1P8 0 <0Q P0 < 0S P80 0 0S p0<S P 00S 00 <0R P0< S P00<S P@0Sa L L[@ 004P Q Q@p 000Q@ P fpGwD R 0b SH 3010H 00 kii -LxMP /p` xdU|! X0@00( 00  00"0 ( 0 , P. 0 0 R& 0@80<@00CSnU$tW$LW$4W$V$$W$0 @ 0$@ 0(0 ,0@004@$ @D kP080<@,HL 40P0T@<X\ D0`0d@Lhl U$`X x0@p0t@0 x 0|04 0@0@L  LQ ` Vd0 0 KoP0K0@|PK`d3D!0P`  R 0 00x10 00@A00=9 =1d R0 !(K$04 t!$0 l! pX$ H0@`1dAL0h1$X01 !W 0@1A 0 ! 0 $0@1A !L0Sr X@1AT01AP $1SS S6 SX 0@X1\A !0@1A pt 0@1AQ y  BxV 0y000000x0 | 400F0@1AD0@(1,A#0!,0410 8!40<18 @!3D1 H! 0L1$ P!(0T1 !HX D0@(1,A3018 4!3D1( H!017P0S 0@1Aꨴd -QL8MP0 Q PU RPH H  @U< (K8hD %p34   U 1/#TL @ r TP T080  LX8Y0!0  P0S 3#P<\s7@T `8 8  8 @T 0S HD^030#P0S 04L L@ ޑPHDeA`H D 07@T , 8 p(0 80 -0S S <\-0 0 S' @T<0s6@T 0 8 p(0  80 -0S S <\r00 So @TsL7Q\ HD^030#Q0S80080 \ HD^030#P0S80080 H\ HD^030#P0S80080  R`80080 `R0Q (0HD^030#P0S 40L Pj@ L,;P ,HD  Be, H D  L 0\ HD^030#P0S80080 \ HD^030#P0S80080 \ HD^030#P0S80080 H\ HD^030#P0S80080  RO`80080 `RG0Q (0HD^030#P0S 40L P@ L0ĐP 0HD  Be0 H D  4 0LPL,@ 婐PD,HD e B, H D 74 0LPL,@ 吐P,HD e B, H D 4 0LPL,@ wP,HD e B, H D 4 0LPL0@ ^Pp0HD e B0 H D c4 0LPuL0@ FP+0HD e B0 H D 4 0LP\L0@ -P!0HD e B0 H D 4 0LPCL0@ P0HD e B0 H D kďii -PL`p @ 0S:PVPR00S P0 @ P00  h] -LMP p, `U`&,0 SR00 SU0 0S @V  ᶏP00`,  +000V R S  D☏P`@A ㏏P00j; -L MP K -L MP K p-PLP`  0S@U@R00S P 0 XP00pp p phˎ p-PLP`  0S@U@R00S P 0 /P00pp p ph袎 0-LM\PQ Q0 \\ 2 1C0@T P 0K0P L0 <0K00,0 00<0xd`d@-R @ Q\ 0@- 0-LMPR@@ KsP0T30%K00 -L MP \Q`@10LS4i$tl$Tl$8l$(l$k$k$k$Tk$4k$ k$j$i$j$j$j$li$ j$i$Hj$i$i$0S s p9@P 0dSd00S@0S KD30S,-@ $3@3 R ß 0:@Ÿ 02@2@FP0 P@20S  @|2"@ 0@cFP0 P@L20S-@820S-@$20S-@20S $K@P $0@A0G@ 0@ @P}x1x!à0L @p @Pk810S 1@` :@Y 0 0b 6@M 0 0@B 0@: x0T@3, Y@+ihdi@d idؙddi/k ii0i,idid|dj;ԙdk -LKMԝ\, `p @ C 0B>S񟗐Pn$o$o$o$o$o$o$o$o$o$o$o$o$o$o$o$o$o$o$o$o$o$o$Pn$o$o$o$o$Pn$o$o$o$o$Pn$o$Pn$o$o$o$Pn$o$o$o$o$o$Pn$Pn$Pn$Pn$Pn$Pn$o$Pn$Pn$o$Pn$o$Pn$o$o$o$o$Pn$0BMS8(p$ p$t$t$hu$Du$t$t$$t$s$s$s$hs$Ds$Ds$Ds$Ls$o$o$o$r$p$o$(u$u$p$p$y$|y$xr$Tr$p$o$o$o$o$u$v$u$v$v$`v$@v$w$w$lw$Lw$w$w$4x$Ds$(w$hp$Dp$\y$ d6mXƟ 0; 0]Ɵ 0+ş 0"L 0@ {0 S<0Vt KOK埕 SjL 0@M`P5\ @5R V0ş 0N  5JE` 4A<Ԥ  [ 00 0QT@ R @T h4@!`ğ 0@ğ 0 $ğ 0ğ 0L 0}RL 0S/|3^ l3R  0dCNK 08 lP81 CRS0 ß 0XŸ 0OϠ 2Ÿ 0gŸ 0_tŸ 0WL 0@8Ÿ 0~Ÿ 0uL 0nL 0-eL 0\L 0BUL 0%LT 0PCkAL 08 010|`*xeXF9PF9|dd\F9hdLdi$i4<0d8`0K(0Q SJS T 0$KSP\ 0T0SP 0= @ -LM# 0  RXP`P` (K 4KP`0`1P`PP`0P@`=9@P` =C0 P`4pKU V  R U V ,0R  R 0@K,08 @K cPR@ < 8  Ԯ80@QS 4KP`0@=9 =@ < 80 ?B -L$M@PT` KDK Q S0p@ 0T<0 0 0D0 @@ 8 4   㼀,Kl8K000S ,@K0P% U T R 0@0 80 4@  0 $0P cR8 4 0 0@=9 =8 4 00 Q0 $0R  -L,M`PVpT@T PK 0PHW  ,K(p ,` {0P>T0; DPKPPpK8P4V4SOK8KD @0 <0S VD0K8PK`< 0P `QDP @` < 0P@`=9ADP @` =C<0 0$K0  L @P0?B -L MZ  4KP 00៮ `p04` 0p  P, #4K  PX P (K4K WPXP400,0%"O04@`00@=)@ -40 0@ , Di@B -LM@pTP $`K 0P K 0PU0 0P$@K 0P0 p-L M`U $@K 4PP |PV   tKp< -L0 R0$KT Q  R  Q h,oP 80QU 0R  DiH: ix: p-L M00V`P%T ,K |P U  K |PT $08K#!B !,0K0 80 4@ PU  0KKp`< 0-L M@!P K0 PK |P0Sk$0$ 00:   RLiLi00  -LM@`P" 0匐0cQU  Bt,K0K Yr r0L0\0  b0 0l,@V(KLiHi:: 0-<0L4\,0Z,,(@Z@T0Hi::LiLi -pPL%ڔ`eP0^ x@ 00bW00 0 ^@P Um/HidLiLi 0-L8Ÿ  01 0S Q Q0!01 0 P01   0]C401 0S  0C40!0C401 0 P0C401   B4:B801 0S  0C80!0C8010 P0C801   B8"<1 0S  0!010 P01   @@T@0褮dHiLiLiLi 0-@LH0 P 0$0P00000褮d 0-PL@0 0@  @  c0cS@  t0  @0PP@\080  0 PPO@0褮dHiLi -00@ ALh< - 0@Lݧh< p-P0LϠ\ @?2 Rphp<@-,0 2Ts< -p 0tLQl0ᤧ\0`P/ 1./@ Ribq@B<< -0@ LAp}X0`P/ 1./@ Rh;q<< -p0@Lp[X0`P/ 1./@ Rhq<< p-4L,b\I  000cSoSb SA400!!Ń1у10000 0bSG SA400¤!դ!Ń1у100000cS- SA400h!h!Ń1у1000 0 bR RC400$!$!Ń1у100\ph?RC80#< Ń1у100SA80!< ո Ń1у100SA80!< Ռ Ń1у100SA80!<` ` Ń1у1000 P000@ t꤮dLiHiLiLiLiLi -H@L0S 8Y40$00 谮dTiddd -LMhQQ-@ P P@ K0q p@P0S7 aQ =@0S`K00, @P0Sp 0 p0S |`Qp0d0 L ,`0S , 0갮ddliXdTidd<$ -L0L R <@<0,0 $h谮ddd 0S)%   㱂V0-0 !000ς 00 KP0U $0S000S 0S0@ 0S0S0%@k) ,, ( $ kɚ;6e4k/k(k 0-`0PLhQ n!1 1- @W000R0h& k: 0-D0L hAR!1 P 1- >00090h k -p1p!`0Vム`1L`X1@T= Hq@T8 -0t 0C0Sx0 0x0t x0p S5p0 dVpPL L"1¡H0 p L ⺡HH 1Q-0S!! !?@T3P o!!"1!S !1 1,i k(ii d$i -<@L 0D,0, /C!b0 he $pP= T*p 0!R20,00Q0S Q0!R 0S S0 R 0Sʵ!Cӽ8_#4]#0[#(X#$0T  R#L::T::::|:: -PQL 0 Qp0S" `0S 0C8S 08J@08 J 5RZ 08Z `0SE< -0LS@`p3 0S$0S  0PS'0U 0S P_Pp0S00S0x"0l!0S T!p0 0!i7!d::::: -QLM0P0 4 ,0 (  0 Qp0 $ R 0  `0S 0C8S  08J@ 5R 08Z `0S`0 R , R $0DS 000!,K4Ke!<d0:D: -LMr@0S 1 V0S00X] 0 QP @V ` 0,0 Q0S00P t@@00 PXJ D A!Y   !0S  0S V 8CR0S00 S00 0S %,0 -pr00CS0T PW(K"P 8CR00 0id:4ih:<\: -@PL` pP  0hZV 0 d; -LM08`, J|pP4 ( 0 $ 08JE00C8S0BBP4K08Z,K4<< p-`@L PP  0ph  pt:820P#! 00"8Q#(p@-(0 S<3(057<@ @00@09780<S3 ; @@0@008<<7P`@ +7P`@ :00;@0$TP7p"p -LM80PSH`= |pX9@Y (@Ġ 00 ,0 忟 40 ;8 40D(K P020P`00 @$"X W Y 4POT @SD4K@0XW0  0 diTiHiQ S 8Q20 R  \  \ | 0 00|  | 0!|  R  R | 00010|  0001| 0  0| 0< P0S 0 SPd -L P @0 R 0P 0P R Ti -LMa/, pP@!@P , 0R\(K&AP?= c080 4K  @ 00B0 S??( K Q02\ 0A1@T (0 P @  -@P- @TZ \ 080 @P0.S a0B0S8 a0B0SW0B$PZxeTi ;j;:O9 -L MPp`* ((0"4#220 $04 D,K:P 0 @z(K, h1gPh ,0եP 0t _` ,h1 a,0< P h1,R, p: kedA:: -LM`00PK  0 ?@P 0RK00[S  00C0 S00•0SLpQ @@Q ?P10xedP9 p-0LM`@K Kd0 ]PP#0 K0 @@0@0  K0\S Q`0 QX0 QPL0 0RKp,~$ Texe#xC.X:-P9;<: -PQL`. 00S`S%p0@T@T 0S ?P00SbP020$ 0440apCWPE@4i -L@P TP0@T @T 0S$@T:4i:t; -LM0x,0 ` P@T $0s (0u @TU 4@K >x >P RVX H>D00<(8(0000Q[ 0#4PP0 7@PK$88@#D0a'$B4? 0KC@P VPPpT00S 0S V 0Sh 0SO @2, 0R(K R 0S(0 @ S>&P0& 0T0U0StƟ0s0Sh @pPP0೼0  " 40 $@ 020$ 04  6 %ş00a6 0W 0S" |$ 0#(("#4@!| ,40T,((0 "4#Q r  H0R<5 (p 5 "88 #$0a0""p  4 "88 #$0a0""PpKV {0Sx v|t @>h<P8h@=P 0u03V0STU@E( K0^*S@ K0 PP 0S$ F3\#  >< p@h~<h`=P X,0S] S7 @#002TPPp㸀K 0N>PP ==Pa 0K)P 0S \ @ X@T@T $0s (0@T@9P  ((0"4#220 $ 04ă\ l `@P 0pP@ P` = <P pW (0 P @ <P @VPP|@ Ze`@P 0P@ P`WxeTi\iLiTeiTe:4:<:TeTe$:4$::t;:::Lv;::j;::;:;:d:(P9::;Vͷ 0-P@L,00S,0 0hdY -0LMp80 < ,00Cs,0a 4KE4PK`d0,l PU`QMJx0pL1 Ppt x0@ =9@pt =Cx0d0Y*<0S /PP`P`80 0@80<@PPT`80 *s(K /HP`P`00 0@004@HPL`@0 0@@0D@0=@P` ?B: -鰀L0`S Pp@0@S 0PSp0S P`p@00@S 0PS  0֊  0Њddd*\< 0S!  0@  i0 0D cD0I  Y4  0LS@0!*P: 0E40R\!: d0 R00S,0R0#03P0S<08  , 8 0 00j0 @R , q 3P R] v @000@0!Pb (K@4< E>* W?: R e 00 R0S8,0R0#03P0S<08  , 8 0 0@ 0  i0 0D cD0I 0Y40\@ * W %0 :4 S R!*0 80@< @ <0@4@< 8 0 , @#40 8 , L:A-(p@p,@ P$`(p,A -LMpP`@P    0  K -LM` QPpA:0A @T<P6 \B  T?: U 0  T: 0U Q -  2 U: 0S+P0pe000 0P T T0S*@B0ep0 R000 b [#L: 0- LRP00 @K @T0@@ R000   00h -LM@BPpUp^, `F WT  2,0FS@0$P(` 0@ F,@ ,0 0 BS0 0R 0 0 ,00  0000 0 ;P R D00  @(K0S0 000 @ ; 0W0 0    P ,0p 0@000 0  PP  0S00P0P0@W ᇫ@(e,e0e:hi-00 R0  R 0 Q R0S0S0000 00S(ia0 P00 i0  i,i@-@ 00bO 0$@P 1 Qp-LP4 1Q 0Q  p 1Q 0Q0 p0 00  0  p` 0 @a%T0 @@pP8 4 0000 00p}f~fvtwt@,i(i -@L 4 R00 0S00h,i -1Ls@ 000 <00 @0 00@8d(i,i -l0L RX@0 D 80X0000 0 i0i(i p- L@`iA@P <0 S p@p(i0i -1L @PJ`p\ 0+`P ~z 000^  S 0El@Q@1@!T F`P0Q 0Q`X#`(i,i: Q0-L@0PA 0R  -0x0 0 PR0 R P P0000 0S0SU RU(ia0$ii0@-P@ R( 0S%\ ) \ ^ \@ 0 0\0 S 0  0S R 0 000@ 0 0  R P,  R/ 0\ 00 S 0  0S0S 0P@ 0S@@0  @0@ 0 0 0S00S0@ 0\@@  @0@- R 0S^ 0Sk0 0R 0SI0SD \  R0 0 \0S0  0S R( ^ 0Sm R 0S 0R 00 S00 S0 0S    R 0 000 0 \0S0  0SR 0S@0T 00 S @0  0 S 0R 00 S00 S0 0S    R R 0SP0U 00 S P0@  0 S@ y -LXp5 PU?P0S`X`V  0S@ W`RP 0WPP 0RPPV 00SZ  `X `V 0S` -@LP' ( 00 S\   R (0c\0 0lS0P 0 \/0 0%-P( 00 S00SP (0c\0 0lS00@-P (@ 00 S00S@ P (0c\0 0lS00 P 0S0SP0SP0S  P 0S0SP0SP0S PQ00SQ00S0S000 Q0-PL <@D40@-HP O|0@0 x L0 0-@LTP ($ @T0: -LM0PS`p ppS0pS(`@ $0X@T,L<D H0W 0S0S0SdP (@K0:::,:`::::::: -LMpX,  $`,@V P,  P 0U@XPU!  0,@02$` 002 TV 0@ 002T , `F V 0PU -LT0T 0 h90 h49 p-LM@(@K`PT0K P  0 KiKpxP99 p-LM8(KP`@ 0  @K ` 5iKpP949 p-PL@AT0`0 hph~(9 p-LMX(@K`PK P 'T0P  i@dKpP9(9 p-LP@` ' T0P1pT0Pp -LMRp0 S`( - S& S ZQP1@T (  ( P0S( P0S @0T 0S (KJ[ZQP0z03Q0SPP P P X[,0 R  $[ X[Hd -L MT0p (@\`X `0 .001 P\@\001@P$<@0S!  0A@4  / (0X 0( (K `" X (0T`@  X  0  0 A : :p:(:: p-@LTP` `< @`T@T  @`T@T  }@`Tp -L8M⼢ ( pWaWW "2 2`Vkt0Sd 40s 8Kd"| X X P@_e @ @@@Od $ P@P_e  @@@Od  P@P_e  @@@Od  P@P_e8  @@@Od h P@P_e0 H @@@Od , @a W `V aWX T0 `V( 0R"$K L 0 s g8K qxj pxe:@:;:Hd;Լ:@:H:P:X:`:(:::::::::::::<:d:dP9 -0$S(00P 0@ p0Lc 00# 0 (pT0` $`0 `0 . pl 0 Q0pp`X0 0h,0>0S! ! ^P11"p"l00pp0SV\60D D0D0D 0 0 F0BHiLi@9Hd:Td8i8i3%T3%T4% 4%: P 0Qp21C c i -L MtptP`@F ` 0 04`V pPK4ei:p9 0P \| 2 1C ci -P1LH1\@1Pp  U00S`@! 1 Q X00S@Pp PVP$1 VV$W 0X0Q0S U   !PW \ 0U00U <000 R iH(i$itdd$i -RLhM  !p @ |@ , pP@ P t l PT t%PP00mP} d0  t h0 ` \0 tp t p 0@ZSKX%W%W% mh00h0 h@   `0\0  `0S @`h00P00h ,Kl  R_ , K2l 51:Rb H %@L``Pl@ \0U  SX  X h@XX hx dX @bTZ P W00 S 00   @DT\Q Z  P W00 S\@@ 0  xP @eTZ PW00 S000  z @Dh00h0 h@ K  `0 \0 hh h   `Vx-Pu`\ sd`d th  h h0Rh@ Oh@L 08CXo 1>A P`0l@0  dl@ h d 0Rl l000b al  b``P^h-h *h @' 08#X` h#h  h @ 08#X` p 00Bt@!0000L Qt@ p d0 t*P 0@ \0p `0 t0 Pp p@!00D0 0 \?`0 t hthh ^t0+@\@ Y0PCK l XP C0K`\` th @ h Ht0lPh@h @t0 h@ h < ( 7R `0S l  #P l@`Pd U`PX X hdG T@ Y  `h@ 00h  \ h \ h  ] L0 H@  ` 0S S S`H@L0CK&@@CD Re ZW P W00 S   Q @0hXFxP` T@ h p \ Xth  h h T hh  h0@ 08#X` t0h@Lh@ pP PCK l XP CKN\ Rt0t@ \ th  h 0d0 d@0Tt0Po 0P` 0P`  @DAP@W00 S   ll PU):l0Z dX @bT:Z P W00 S000   @D0 @D%0 @Dh d X0@cTZ P W00 S 00   @DTP  @Dh Z] PW00 SH  z \ vV U-K,Kl ',Kl %2T> &BP l0`cl0  c/,K @ 0 70d 0(QP` @Dl@ l@00 d0 P0P` 000P0S  Rp @ &  0#p h@ h  h@ 0 8#8@L0 H@ 0 L H  @|Q pL0H@0o `Pu  P@ l@2A \@QLK<@00` !0@0^S!0@0^S^<,ZD PW00 S   !0@0^Sxe,:::::P9::P@W00 S   !0@0^SZ lw"/PX H@L0CK @F%`P?X0  HL0CK 6^ Z| PW00 S>00  ht@0?`0 t -L@MQ  K" 0( K 0 K(0 --0 L M0CQ0  0( K  K0 K( 0 0-LM@TPv 0Ps40@ R V8Q8hd(i --LMPY 0 T,0@ R 7Khd(i -@L; -LC; -(0LM \0&pd --LM00 K --LM 0 K --\0LMh!80 1 Q @@ 1  0@K k p-LM`0@< 3PK0 0\ 73[P @ vP >o 0RKpxe4v;P9 -p-LM `勱 0@PP PDz00 R0PP Kp i -p-LM@ `hP 0@@ @ᢲ,0 R0@@ Kp i H: --pLM0PS0 P `AO hP TP0 R #GAA0@ 0@L(i|d\:t;tde -@0 LH@00S S S  AhFhAd:|d: -LM  0: -LMP`R80#40#00S 4!R8 b10!#88P$H*,1pK@ NP1[0 1KFOP F~ -0LKσ0S  c1 #880S$H:P1L0P1([0 0Li p- @LTP`T~p ㏰ @4! 081 ,!001/~ɱppE-鰠0S㨀 p嘀` @00 q0 pP A8Pq 0S2  0S 0N0
v%8w%Dw%Tw%Tw%4QT"(1 T0`!10 p0 0c0C1 0S/0cd0N:\0h]0hZ0hV0 P@d6"DpE0 L=@@885ꈯd `f@PcL$< 0 @0 0D0Q|f}f~fvtwt@f -LhM Qp@P  Tㄡ  Tf 00CS 0 qo (KT 0PK0 @>P=0 00 0TpHP D@ 4 ,0 8 p8p 0S3W00p8p 0S*W( RP  H K0@P8`4P`pǏP L0`0@4P8`L0P@00S 8W tT  CP #T T  ϟ8 -LM`@PpnP 0 K 0 0 0P pT -LMpP`n@P 0 K $0 ( 0 0 0@(0KP@ /0Q$ 0Q0Q  1Q h0QD000D000PL0L000L0L0}f~fs s@-80!$rH r<0<0  ^0 <0  0d@d80!$rH r R00 0S00\ R00 0S000-80$ H@P @$PL030\0SL0 1 910T 3 #@-80$ HQ L0 !0@ 0$@)! 00b@ S3# 0$@ -L M((@ $T 0@K:TdiL < L0! K -0LS0s0s S-0p0B!`R?R? 8#L0 CR Q8#8dQ0d08#8>gfff0  iliR  Rx0x0'' Q Qx0x088 RA^ -0@ 2L ]0Q p00  (00H >1>1>1t00  |0S0 0 0l0$0(Qlii p-QLM@`@00CS %D%P%\%h%000 P @Kp-@h0`0X0KH02 0B @Ȃipidixili 0->L@ 0PT;:h0h0h A(h =Hh 9D00 8 P0$0 0P޺0ili% 0-LP 0NP.8CR0 -@L`^OVpH h10RUV hp t0`0t00H0U h10 XH p l k<: 0-@Lt0P0t00hX p-LM@ P`H0St0t0$ 0  0S H0St t  0  0S 0t0H 0tPP !xd p-`@Lp 40l#"B PĘH L00bO 0$@H >RPPp1P91pH H0RZ:0 00R  RS P81Ì0K4K@eȌ@6̌^4 0 , 8 @`K Xh Ld @`(0, kQ:ɚ;p:x::k_k::0:P: -@Lt0 | h -.H0LS@ t0h0t0H p-@LP t0p@ @` 0t0t0N<t0Dp -t0L@@ 0  P HPt0@0t0~0 0S Pt0@0t0 - L X_ X X X - X00"# 0@d 0 d H PT#0?0S %%%%%%%0r8#(.a0HS H0 `0HSsH%%%%%%%%%%%%%%%%%%%%%%%%%%%@%8%P%0% 0 .0Pc0>\pH 1 P``0O0@d  d 吗>V0 H>{  0@d 0 d  HV P 0>eHb 08#(08,!#8 Q0A8#(}zA0H\XSNP 0@d \ d H) Pj ;^P!P(P'P)X)P0 l 0@d 0 d  LH PH>SB >piP9; p-LP@˕t0`   U Wp0 p 0-t0L   % P"20#0 P0S  @@T 0h0@T00 P0S P ^T @^? -LMPP o(`$pK @P $ @P` @P $ @Pt0:t0呖0>0> p-`QL@ Pd aP]Up -LM2@0 SP 50 ^ B?@0CS+1 ? R  t0 ! W0N>N2n @ :t0\ 8CRޔt0 :t0>%`(pKⰎ >< PP ( PP0t 5*0t .8C8Ac Q.PPQJPUZP9: -LM0`P0 ,0 8" p4b 㓔t @0  82#3ŕY  Gᾕ\#0h  R|  VR8 0H0XDVT V(ڠ0@ "?0L@V' 0>H * .` . 0O0@d P d p`l?ʨ0H0X VR  ^NSP)0p`FH0XH0@X#82Tt0!0t01H R`1l#OK -P@4Vpp4b ŚH0CH0@X:\8  |0P| 0y @w$0!s1Fp0S7  㿕 0@jP< T  4QK, 0 R(K  4 Q 02R# #}L޺4K  oxed kP9pid$idP9 ꈰd p-L@Pና` (Q+Q%t0 >;.t0.}<ph蹔p0t#40#"Bp0t HQHP 8 ( Q HP h{lii -| @0S00L>0 Q>|  00CS0 tttdi -`pLp90 㨀Q@ᓓ  0@D  D 9@P ✠% !,t 00S t PWP|@$ D 20P== t {RyW  b @h0(PTh ?R](0Sڜ0  P H Pt0@t0 0S Pt@tt  p [ t|  0S- 0S  0S 0SI 0SW~ X+ | 㛓t p 0@$  $ h0 t@0   th0@t t    0R40,50t o pG0 #Y!   A0GS p0S P 0S 0SM @T T   t@(0 h0S&  .H0Sqtp  0S 0SWt W W@ p p(0 S|PPKPY T 0S 0S 0S >08#8S>>>t  ^W0SpSn l >(B8CS@1@#Td@DT]0p  x t  (Wt{pp !W|pl 'W`pi W X@0|S W 050;- (0 0S050,| 㔒tWtW   ^tɌt z Tx 0>(NxW 0S MtWW9 tl 0W4tW   >Rs kQe0>t>tW  |@ P0 P p p P P 0 @Pp0 P P W 0@0S Ftt/C W   t}\WˌtxXop0̌#40#"B0t )W}p ^W~p > R @l0Sa&| 㿑zxiidiP90S8\, w 8 8/80S, 8&0pя#ppˏp k0C 0 00003!0 !00l # B,0 000-0S 0x 0 QR BP0R 0P R00c!0R#<0伥e-H0P R 00c!0R#<0伥e p-@Lt`Q@# 0 R00B0C 0 0 0A00P0Q  00b0<^,00\00S0 0@ᐋp 0-@LP@0S US 0S\ a aR QPb0bU00S0 00hd000 0 -@L`p^P V  0 PbU0PbI 0 b PP 0eS0 1S00PS0eS0 0PS p-@LΉ0`SP!  0P0Q  00b0<^,00\00 0S00000CS00 0p -PL`ᛉV@-Q@)pQ$ 0S`0`Q@@ | P 0ay0 0S00`dd0Vp@hQ   -@LP U>}rP 0SBI>qr000 p-@`LP >rV`0 0 0P  pUB> r -pQLP@p1 Q( Q* `0Q! 0Q a a0RPP `P  0a 0 0S 00pe 0W2 R 0   p-LP@ӈ `R4 R0S) 0 0 0P \  a 0 10 0 P000  0p0 #0 00  V0p -LMpᏈ0S" 0S 0R ɉp$K@@KP@K $Km謉00h! 80 1 P w] k80 1 0S Y]@ p-LM`P8  @T \Q Q 0 S 83Kp`]at -Pp L80` 1 @T  ^ 0\ `^` -Pp L80` 1 @T  ^ 0\ `]` p- P80L` 1 @T  ^0 H\ `]p`p80 P0S0SPi -L@PP*0S( BT 4P: P0-LP@0P QT 4Q08C(R0S T0SR\ 0 -h0LPpU` @T * \4@0  ^PUi p-`0LP`U @ T*$04@S  RPUphi p-`0LP`U @ T*(04@S  RPU}phi -LMQP@#P P CP U Q4Q0S0\ E 0 $K*A$Kmϋ 0-0 L 0P0S@ T* 04@S  RPUt t0pS00d0 \0 LL (700h3idddd\iإe &ihiet &$ 1S!P@(d/R0?? S9?R0!03Q?  p-PL@`p21C0Oopp@-X!Xa0P 0cS@*<1<81 ,1 ^  ?!("(R 30bS01\? ^21C0Pp0S6@ 21C 0Qҁ0S00lS0?p, 0 0cS00Hi0i@dXi`ie"!B ?0?\P 1 0 SXQ \0\"!B ?0C?X@-@P$ Qࠡ \00 a0 0l 0^Qʲ1 0 a0b0  R( 0 0 R`0 SQ1 a 00a01 a 0S*cPQ- ^0n\  S ^ 0n\S1  `0S   D00ccD 0b1  `0S  0  b D P0 0c 0-@PL1!xl \TD 1 DP (\ TX HL d `0 0" ( ,04 8#>t tl?@ 1::::::: :L:`:::8: ::::::$:l:P:: -LpP`A @A1 00100 P1D001 D'$PD! p-L␄h0`PU @ T*,04@S  RPU 000ph軅ii -QLM`  p$R KPP VU 0 @@cV@1 T`d0 0 VpP  :::: D0- 00@ 1L0-0@0 -`LQ@ d0d0d `1 01P 1 H0S L DP1 01P  \ D21C cli : 0-1|00!L B!1@ P 8e018U1:11ii 0-@PL ̓PP@0h 0 0-L@㽃P@0 0-L@P@0SU 0  00 0PP 1  `0S1 0S P00 p-@L`ჃTPt@P h 101ẄD0 001a 0e0@0pᩄpii -L@pP`SW P1T% 21C" cUPPD# W / y1D 01 0P L0\`XpH0d@`@P @ a ^@Z = W@li p-PLP@. w`PC  R'000 01  *1! $ DDN1D 01 dP`P1 0@ ,@1 p0 r17pD N‚@7p p-@L`᱂TP\@P P 1010 a 100p݃pii -LM@Pp `QP P R*P`bU1f0Z P 0j0!: D@D00Z`0!`01`` 01dPd啃0 0 `0 P  vP&0!0g00,0 pZ 0j0 %0 PPS,00< -LϠMϜp0 Q10 K0 h`P} W0,0 ,@K,nDD0@0 0 0`0!`01`P `0d`1dP"00W  pl 000 S0`00 WEVA @ PP> Z& 00 0bW1! & 0S  ;O JW1! 0  00b\! 0 ^M  Pd0Wp00 MMW,(K,42 0ʚ;|:`:D: -LM^ -LQӻRQ`pP PP 0 \@ @ 0S*@cTS5X V 0!0 00P0000f0yPP" 1 `000 0X0j 0    0S 0S00P 0PX 4 -LM Q-Lp@`8W 0 0g 0 1000,P% 1 Q PQA @@AQPQ100D00 0g0 `` pt`:0 0 GHii0i -L@P   -P@P`N^LpL P <03@T0hli(L06∅h -0@080L06yh -L ML H32C0bC^ (K#0 0Rx ̵P 0 A0 <^,0 A@@0@@D0@D0@0C C<Qaq0 @P(0 0??<PXP <  a0 h!  @ 0PX 6 000 0嬴 Z 头liQ4i k 0-0P; 00UL@0 CP6e0h` \60h覄 -pRLP` 10^ V@ @@ 0R 0 `0aR \^P 0 0 T`pV`0   0 1SS 0001P00S 0 00!RR 0001P000$0S $ BX:$10 -LM @S 1 !@ PK  0-0@$1LSP S TP 0$A000]P -L@)=P  0S 0& 0  0S -P;0SpL`p3*vV@ ; 1_7p `  pP U@0S0#S0`G -LMp`$ K@P$0$P 0S  00CS 0$=9@ K(K @P $  00CS 0 )  @p0@P(0@@$< -LMp`$ KaPP  K(K PP $  00CS 0 X $0$@  Pp0PP(0P$< p-L M0`@ K 0 !PP* 0S* $K p PP0$ 0KPP Q $ R 0S R $  PP   00CS 0 PKp$P i<$K P -LMp@ KPP%0 SP 0S` i0`SV   PP!0 0 0 $0vP  00CS 0  +<7P; 1V 7P  00CS 0 p-LM`@ KPP x0$ P 00CS 0;x -L@M\ `, K4 0 lPp 0@ P0 L@ \0\X T D @ <0 H  0SH0 ~Q{H00SH0 v\  ,0R@$ @4K00KX KHPP@bpPH0r 0c0Qp 0Pp8  08 R ! pPJ80X0 8K pP@Q& X" 4PU  0X05! 0305  P0U @@X00P0Sp U0 cW,,0 0@,00@0,D0/0@D0H@p,  00CS 0 0PK4PH(K\,@;H0S wW #W -L(M0`Sp @K  P02(K `D < D K8 (@ $P 4 ,`  K@0 -L`MDKPp  @P8 P(@P`K0P,0  000 0 0000008 $ <048@0 PP$0S DK PP, (00(0, 00CS 0& 0 (00(00 00CS 0 T84PP @809080 D8,9040 09,9ld -LM0p@ K$0 PP $`0A?AS  00CS 0 8%PK $K0PP 000  00CS 0 $PuP$PP0A?AS  00CS 0 $$P 8 8i@06F8  0\MPP jU0S3h: -LM0pS`@   0KyPP,K PP (K,fi,08 $@ .  7 3S PL0,/T 4 K"?P, TUH< 3SEk,T4"8,8,S0P8uj 00CS 0O83SP0 0F6!PP 8Zj 00CS 05 5#03P8Lj 00CS 06~  ,PB IA,0 , ,0  ,0<$PP  R 00<SPP ,S47,d8,S< #P5P, (00(0, 00CS 0 40@ 0,7gp:ldx: p-LM`@ KOPP x0$ P 00CS 07x p-LM`@ K1PP Kp K09PP   00CS 070 $ P  -@PL' Q 1S 0 Sl0 R0S0 0C#qW P`Z0 ` 0WP@TP 괈&P( 0S0 0  (0(iP 0  0C0 00C07i -L Rg r R@0T0  (0 ( @T@T ( e  ( 00C0( 0 S( I @T@T1 &:Q `R3 P  Q 0Q(0  00 0P pLW@P@T J P0S$P @TZ@WP>7@TPZ&P00$Q d0 R0 D)@ Q 0Q@iďiiidp&P 0S  0r mꈳd -L M`4 0PS t2R P(K Q 00\<2< 82 A0!/@!b0SP0p1`k P @2; 1^ ` 2NP  @l@T 0X0 P 0 0@Cp0PK 0sD 0sA 0SSB , p 0X0 0,@D000  0  045\,K , ` PW,pK‡@ , `F 0V0C 0,00C0  B sPqO7Pl` PPg`P$0#6Po ?Q t0Sx0"0 ?QR B "0>] s1 RP܁@T  P `O&!0OQP@Td1d!h0\ T1 \ HA0ss0~pW (K4K 0H ,@K@t2 PD,04 @r,@ T'P<  EPD < PR.JD 1`PU&J0O U 00HP`F<@T D1P @40;40< TD4E0 <D0\ 1@ > D8 1P(`80 p0@80<@(,  /40lP`904040K | 0h X. WFʁ qp tq U<9 Xt0   0 0Su0000rtuXYTU0SVt0 TY t6 q: R Q W t0 00R XY V qrruuXuVzrQd: p-L M0PK0%@ `K0S 0S  0`%PKp  -LpP01 0101 P`u 0P@`PU`P `400v0@0 @ -@L0?00C0h5i 0-L@P>UT0040P0T$0 0   R0i\d -0SL 0R& 08 pD P` 0S@ 0@ 0p $0( 0S 0 0@ 0R0 @  -L M0P@T$pK `K$0   0`x@P ]0DS &&&&`& 0 0 @K 0 @ 0@ 0$0 @ 0$  0@R  0S v 0 0$  @ 0R 0 0@ -L M0SPIJ@PN d @ 0@ 3 cPQ l0S\  0@  0S @ K  `V $ (0@(, P$0#0of0@S (Q,0, ,0, $ 00T 00F` pK'`@(K 0P ( `P L&l&l&&&&#@@T $0@P(  0S^ 00@T$0P( 0 0@(z@0SL P ( R,0,0,0,0$0 $0 ,0( P((0 $0PT& $ 0P( $0  q@ 0R:  0R& `P(0 @ 0@ ($ 7@(0$ (0S *(0S # 0R$0P( 0 0@.@'Xd`d -LM40 1\h10 ,0 080 G\C`VB p pppV4X 0 P; ,Y0 = @PMP$ ` p4  00 08 0@$0  8 0 ,0 00Y40' Y Y P\ P(K`P`(KoY0P1, 0 'P PU k -L M((@ $8 0@ K|:Tdi -LM 80@ `%0 R\ 0 [  "P|0P0C,P SP%0 ,0S 0 =$xP U 00WL0$  P WL0$  0  R  0  ,0S L0$ w # 垜圜:: -LM,( 0 080 R0 0`(40 S P< 00  , $<@0/S D 0S/S 0S/S0dS@0 c0/S ,,0SɌ,80SɌ,,Ɍ,@0S , ! 0U D0U 40,P L0P  L$0Sy 0Sv 40 ,  00,P !@PD R,Z, 0 jb, D@0,SɌ,P00 Sx@T$  "P, P#,K0 p{W^ ,P,P00 S SJT30 S ( @<@ <@ D 0S/SY0c@ 0/S^0/S ,`jnj ,WPP,  (00CSP  z40S,r @Q p!0.SM0.Sʌ,HIS,hR 8 @0! RN r T+ 00(K0/S 0 db<00@S@ p0S4 0p03R0S@,PɌ,p@B ?@p "pt,@0 R1L0$ ,  0p " , 00S L0$ 4 Rs L0$ o p@0 0 jȌp,0 @pi@  -L(M0,0  p0(40P 0S 8+0`V/ R+ ,0 80CQ 0S/S0/S{L Q0$0 R3  0/S dq P8刑 ``8傑00(K P}8L0S < P `Pu,0n 0`"\ RU $0S0$0o0S8$(0`0K4 PP 0PK@4` H0 D@ 8 `8l  00d R8ߐ `?`00PS8Zii0@-P@ R( 0S%\ ) \ ^ \@ 0 0\0 S 0  0S R 0 000@ 0 0  R P,  R/ 0\ 00 S 0  0S0S 0P@ 0S@@0  @0@ 0 0 0S00S0@ 0\@@  @0@- R 0S^ 0Sk0 0R 0SI0SD \  R0 0 \0S0  0S R( ^ 0Sm R 0S 0R 00 S00 S0 0S    R 0 000 0 \0S0  0SR 0S@0T 00 S @0  0 S 0R 00 S00 S0 0S    R R 0SP0U 00 S P0@  0 S@ y -`LV@3 ^=0S`PVPU p` 0S`` TPR 0T 0RU 00SW `PV p PU` 0S``P p P 0S0SP0SP0S  P 0S0SP0SP0S PQ00SQ00S0-t@0t S0 UTR p-@LTP `P`@@T@p 0-@LPT P@@T0 p-@LT`P@P  R0T 0 PPP@p0@ 0@@P0 L0PP 0S 0RPDi -LM 0 `0p00Ġ R 00@4l 04 0Q$0 $PK @$00$0 08P#8@$00Kd4eDi@-0@ 0@ 0$@\0`@D0H@80<@,00@0l0 0P T L @ 4 X (    L0S X R\0\0\0 QL0SX0 X0\0\80080@0D  D R80SPPPT0T D0T0 PT 0P0 PT 0D 0D0LiiD0@ 0CD0S80SPDPT0T 80T0 PT 0P0 PT 0iLi -L@p`\ L0S XPPU L0S \ -L M0   K0 P K''-2L?0\ \ x 0S00S ix0S 40  0 R  R x 0\0 00R0S R 0-L$@ P R 0100S P 0$   00$0@- P@P -0A0@0@P -LMH4P08@t ` @P|@0l0 (@0LPp儀<@0 p  $K:::: -L M`0P1p ^0Lx@10P @Dl@8 <0@WKd@T  @T\h@T < @Td8:ܴd@:p:::: - pLt Ŷ,0S+ 0 ,\`0h h0dx<0@@pP`0LP T0X@DPH`Z ڵBZ յYNZ ѵ el i̵ -L M$`R @0"( Px  0PXP 8@0H @`0 ,0 ,04 00`KP `p PX``@000p @0 00 x@0h0P @0p0P| YϊB?0 \ T @TP P01Ps #X 10CR c. \P X@T (^$K @T 0Xe\"!10C c RP X@T\ \ L ::t::::D:l:::::t;:::, ; -pL@T P` 0 `@S WPQ 00 R 0 QR0ijdd p-0L@`T  P @T +P pH0@Q @`0(0S ppijdd 0- @RL R000 40@ dP h0S& 0S0 00@P0@0hP00S S t0$d 0?x0 R <0< Cp0Q@0t0t0t0!CeDdVUUU -LP  p R R000 @  h0S 00hp0\@0t0t0t0!Ce: 0-0LSP@@000CSx00 H0H d0S0d 00dP@0ٓ: -@LED@ 0tt0P \@ 0P0 PT 0@hJF0SP0 P0P0T00@TiLi -L@p`Pll\ 0 @@[P  -L`pDh@PT! 40  R 40@40$ 0F0WSDh@PTW 08 h0S EMhET@:(: -LPp` D0@!h0S E 0 @Pd{Dl0@Sh0S )E`mDd R% V@ x0S'PD @VP x0S40&40 X,40;40@Ud RhP) V P @PP x0S40840` 0Z@P jE  eE `E@VR ǒL:X:p: P-L l00Csl0 @  S 0@0lhY孒: p-`LV@P40   R000   pl00l0!Ce@-Q @P -\ 00 R 0@R iԴd -1h!RL ePpU. `PU 4 00S40` C@DmW`pGZ`V Z I'P0@X PU`(< 9 kdi'5 :: p-LP`\@0^0$C! I p\ 2P @0  0S p@0@  0S pp$3 0S p p-LP`@`T0  @,00%VPp' - L@0 1+, -LM\@PT`o T^dP[TYPW1 F,p`X\ PH\ 0S d RE@$T@7 0\ 000   P00V@@T@!0400P }0400 R R 0S 0S $1 0\7@1+@@\` @Pd 0S ǭ$0 @0400P A 4 $0<$0i p-0L@P`    eP$0<$0p7$0<$00 -L MQp@@ @+ R t1\ \ 0R@@@A 0,P K0S S S -P0 KiHP0x  KiGQ0PU 0S0S PU-P $`+@$ 0 00$ 0GP+ijddi -QLMp`0T@$KW00 P@ $W -80T 0CShL@80  h80S@0 h k -LM8P@U08040`pI<40;:`9U2 V$zP7U 800CS80 0,0@40, 04  KD0SQ 0<40 Ki@W v 0 딶d::: p-40L\@ !04phX L0S 000CS'80 S0 @0p)AD0SXp0S P\QT0T0T00T P0SP0 P0P0T00@TphSBxQ 0S00 S1 x 0S004 # x0Q' P`Q x 0S0 00RV`V 40;404;40)0x0xQ儏傏倏:i:::0hq k -40L @ x 0P Q x0  R0 00R8 0r03P0S 40 8 -80LS ; - 0RL@h!  40 <0S 00S 80S 000 000CS0,0 kd 0-80p 0CShQL@80 0 P 0%80S@00 k -40L @P`  P<400!VP@08#1pQ  R8P  PP 800CS  R80 ?D0S P R T0T0T0 @00@07A8P RT 0 P T 0 P ,:iLi -000CS1!h2?01L`P@p 0 00S 80S2p@T @T x 0S @T $ )x Px0Ppx 00x Px0PxѮT` 4 +4 40;40@ WPY00S    ,0 0,0  k i -LM1 `h10U0 4 8 ,0 OL ȁA0 ?0S0 " 0`O?1 `RD!0S9 P@UKPPUH |PP RT0T0T00P T0 @  @ r@00S ,0x04000@0800@,040P80@(KT`p 0S 0S I@l P0 0 `0|0 P 9@0墍00i kii0eiLiTi: -p0LM@Pp0 $0KT `P00 $`0p P$  $``d  ( 0- 0LSP@  @(P0@(4: -L0p @T( `@U 0 PPt0h!0P  PE@U`V 8>W ,:0p @TDi k<:`:: -L?L'H0Q P ,h$h :(i::i -PLM8 < Z <08 1X80 Z 4 wP 4X0 80c<0p.,1 R$ R, ) L0X@S0 `Y%:P,K,pPT,@  L0X S@Y:` |pP P :(K0` 40` 08 0b< p0*40p " <- Diشd:i -0LP@U3 PU0 `pP '@p P 0$0 p0 00$0$(0$0 m/0B0Z 09YZ 04@ijd 0-p0 ML@d@P@XX 0PP)< <<0 P0PPK0hL<i<:TdTiLiiDi - L-: -0 P0@L`pS=@  p Rt0t0t0 @  @ 0EL X000 Rp p0t0 @ti{>@dPdiDe 0-@L80Q 90L0PP=pQt0t0t @00@0[> `  00CS 0x -LxM@( KPP$(`0W00# 0 0P$  00SP PP  ( 00CS 0 $K(@K|` xp (0 0u P -LxM0@( KpPP $K(0 $`hL0$ P  00 'P0 R 0圠K 0 / PP  (  00CS 0(꜠KP  P 吀 p 0  0" P0[SԴd -LM Pc0d h0 l D @ 0P 0@KP K PPP P00S-P  SP{20S P00SP  0PPP PP  @K[PP 0@@ P PP P 0|PPP <00<0L00L L00! PL0$% 0 @d0 `@ l0 h@ 0K5K P @0@UKl0KPL @EP0PP0 } PL (00(0 PT L (00(0L  00CS 0p LlFP^(W 0FPPV|xedQ9 -LhMp0`$0 @ PP $ 0R* K0D cKP `P \  0 X@ .PPt@@K ᨟L08K < @ L 0$PU PWxeR9 p-LMP@P `K ~\ P Kp/\ Pdd. -LMPp$ K,@P $ $0L`V  00CS 0$B@,0 $ @ 00CS 0 T$048,0 @$" -LHM@0p P80 dK0C\ `0 d < 4P P KPL@,`0 P$048,0 s -LM,p @,K0 K`P*00 P0 000@0" d0 A0C` 匐 吠 <0h` `p K0"0 K`P V v`0z,%M(K, <`| ,0,0 0, $/ 0 @@0 <@ H0 D@  0#K3K @0@cK| , H0K@@P 0E,`0[ !, (00(0Y$ ,0  ` L0$ `00S< `PAOK 0 0 ,0 0`P  9 40 0, (00(0,  00CS 0,9< Rv00I`Pn,00 0o` d -LMP @0  @!K -LM c @K -LMpP  0$S00PS  O 0@ 0aP x@ T P(K0 `V(P x@T PE ` -LM1, ΄ 0 P夣Up1$048,0, `P+PT @PW X*Y,`, 0P PTW X00`(K0`k:Di -0L p@T @V 0 `zP$P@0$0\'00 @$0@0$0Di -LM80`S% x K0 P00PUp p@0S 0S PU@0S W @@T  m 0p 0 g 0p0 a 0p0|ii: -$0@@0$0Lp`P 00$0 0 0PP4 0PUU  $00#X00S$ R0 00  0 P 0x03 00C0PU  +|Di: -LHMD0 p<0 hK0C` d0 h @ 8p @P0TP L`0P @P$0  ~@ Kx40 r P@ 0b@ -5LQM☕0 S, @p`PPK Z 0PP , 0RV(KD00  0CKP 0 p PP̀ 40C/P0UK 0PP10 H1S YPP%TP  1L `$0`0 03PP 00S P`0x@ `SL` X $ \! -PP`10 P PP P  \```PP`8$$`1$`$"2` 00$ p0K` PP"`!0@`$0H `$$`!U$\$9`0S` `2`1x0U~X000`P `1 0` E`$0 `r``!0,  ` 0PP `PO`!00%0<K PPG10SX1 PX1 0SX1 K X!<KPUPx\d  "P P B` +X`  0$ 48$`! 㜛`10d!`$\! 0 ?dxeR9^dDiijd -LM,0 0S K- -L M,0   <0S-K K -LM,   0 $0S-K K -LM,   0 @0S-K K -LM,   0 D0S-K K -LM,   0 0S-K K -LM,   0 0S-K K -LM,   0 ,0S-K K -LM,   0 |0S-K K -LM,   0 T0S-K K -LM,   0 0S-K K -LM, 0  0$  0  40S-$K K -L M,0   L0S-K K -LM,0  0S-K K -LM,0  p0S-K K -LM,   0 (0S-K K -L M,0   h0S-K K -L M,0   80S-K K -LM, 0  0$  0  l0S-$K K -LM,   0 t0S-K K -L M,0   x0S-K K -LM,0 0   0 0S- K K -LM,   0 X0S-K K -L M,0   \0S-K K -LM,0  0S-K K -LM,0  00S-K K -LM,0  d0S-K K -L M,0   0S-K K -L M,0   0S-K K -LM    ,0 0$ 0  0S-$K K -LM,0 P0S K- -L M0AS'''''''''''''''',0   H0S- K00 K<0;0 -LM,0 0   0 0S- K K -LM,0  `0S-K K -LM  ,00S K- -LM  ,00S K-40040 -@ ML̠ 0 @PK$K p-@PL@` P4< ? 4  0Pp:$ -L|M$`@0p\*  0 PP00W00S 0 ! @`mT   ` Q X00S PP$K K PP x00b0at f@ -LtM0 P KlPC l 0K0 @  000CS6괆'|''''''@0K4;DL0P@|0KpPK`D0H@dKX0K P$`80<@,0 0Dh\P@tPH`Lp 0(4@@TPX`\p (K  $ -$pP0 LR3 ``L0S $0 0 @ 0 @" 0 D `00c@  5  0S` ` -L M$p0 40 R0 0,0 !P`Q VP! , 0 @0 RP 40  P000c@ , (KUP -L(M`0 p0K@0 ,0 P L H0 D@ < P8p 4 @( W0 PKX@ Y@00 (K0 PKX@ Y@00@0 S T R@ ` -@<0L0C<0P`p Q0  @ -LM(0`$p @PK 80K0@ ,P 8@ 4P K 0 K -@0L00Q00\0S  1 S ppW P`V  x(RU0 ` b 0a0 -L0L$  0 R02& 40 P -LtM0`0p@a 20 S] ,< D00( ,0PP100S-PK S>PH K ` 00SP< PP8 0lPP1  00Sb  0>PP%40 H<00<0(K  0,0@0,0(ZPP0S (w0P#  00l PPSPPK 00 000 @ 0( PPk  0PP@;40  00 w@KP 0@|@ xP PP -LMPhp, @P t m000(K`H0 00 A @P00H00\ R00 @P 00, @ k -SLM 1 P   K00 `P0 @L 0Cp"(40 0ǁY000Q 0@P` < B2MϠNlppЍ8p< iųE.(i,inmR94R9$ik_k0@-P\0  U0 @  R 0U 0  Q0a R.00  \@ R (0U 0 P 000LT9LR9E-@Mp 00 Q.\R00S .0Wࠃࠓ0ЍQR J \.\ 0 S.SQZ0.SR.0Wࠃࠓ00P^ J0 S .SU \ ^ZX \0d `h`cV 0 S  ^Q 0 0LV \00SQH\ᠡ'P0@ S  ^R 00A\  Q00SRQ 0S0C0^ Wࠃ~\_00W @0'!000c00 Q 0l T0#02SpRs  B0 S 00l bS0a  ~0 R0M 0 Q0F0 s R .R LS90@-@0 S0C R .RN21CP 0 0 R 0e0@ 0  @@  ^@%J 0p 0 ^ BJ0r0 ^J0 BR0000@000  E- @@  0S ~? 21C0 CPbUP U`p@PEupG8 0`P0@Sw@pPUpG&J 0`Pᐠ0@SwPU@J 0P0SU@ J 0P0S 0S LR9p@-@?0|03\0SP`@ 2 1C 0 0q  ? >1C0 0C 0S0 00n 0C0p 0S p/SN 0S~0S0 00n0C000Bp/SN V:0S~0S0 00b0C0/S 0S0S0  /S 0S 00L 03 0A0qQ P@ R .RQ4 0?AcQ 0?AcON -`PL@p`@0!0Sအ0 <P`lPh1 X!X10QP4!<1>A Q  0PP 00C0$#Bb2 0a 0>'R2 !0@~`l"`  Bp@31C#0 ` 00 @# (i4i0i4R9nmR9Q<:0@- P$@ 2 001^   R 0\$0T0U00S 00 0|0  -QLM@PP0 Q( `,K4K0pK#rp :CR(00L0 40#B@(0!L 00 x @00 s@TGP0SD:0  0p,V (0S  U,(K 40廹`PV,` !T00T01 01x 01R(00L 0(0L 00@ x @00 s@T(Q. , `$K( 0L0 0@0$(0  ̠L @00 $ (0 L 00  (0L 00 x (k` -RLMp<  @1 11T  B^T Ya<0IP 0S[Q `P0g0K, K40K8,8K 40%@P0@#pC :CP80L 040 :0 80 L 00X 0@@0@ @0@ 40T*UH xl1PU` P80,L 80 L000@40@T0@ :8, uU.@(K80L 0 400 0280,L 00 80,L 00,̠ 80L 00 0@@0@ 8, C0h0Q 0S<@@8嫳 -L MQ`@0 pw W<  h@  i2iPP  98 0\ B 020C!0s 20C@ 0WFX8@ 5PP10\ B Z! у20C@ 0W,P8@ Z 02B!0C0s  ZX < R8  @0(K4K,,0 C<  -RLM`PP0R (K010K, K40K,8K 40PF8@ xpwC 8@0L0 2$W y  00 s00( x1\a |9 :C\L00 40  0:80 L 00 8@, C@0h08@ T Ჲ8寲8@0L 0 4 00, L00B 0  0$  " 80"L0080"L00",80L00 8@L 00" 8 0L008@"" -0L|MT00T0R1@01`  0K1P 0! !TATKV 00 -L M`< @0 P4p S0 ma4 4(K"000p r <t0\x |04  `0,KSt0,0  , 0K,< 0cP4 @0 Q,08 040@0 `0Sd, 4` 0 0A 0 Bp0t <8 Q< `X, Hl0B , d0 PL@IZ0D0P0 00As00 S0`` Xd0b ``` PX0t0b>x c @SPQ0| `P2|0s L@Z0D0Pኳ0sa,t 40u@Pp0, Pg p@ X,0K@P4 Op W0@|0@4 , 4@ Bt:i:@i -LMP p 02@$p  0 !P  0P:0RT0S$pL0 X1$^D   !T00T01 01$pP0S5:0YlPH`P00W0S W#( K,0K($K ,0 PP$px~L 04 0 0, $pP K$ -LM4p`P4K(K 07@P$,K(04KѵP,(0L R:S 0S Q0Sǰ$KðP,庰 -LMQ@`PdX 032`DnP6"\050@0 0 P呵pPX 0\ L `X H0N a 0PzpP 偰00 -LM$@ 40   -LM04`<0  <0ZPD p,K8 K0PP40K,08KBPP.0, L0P*0@SL0 @0S0S 0 㔀P 0, L0 @0S&p"(KUP0<\PP0<00<0 -LM4p8K,K 0Q@P80K,08KP30P,L0P *@,0PL0 @0S\ 0` \ <P d 6P 0ϯ˯pǯ(KT0徯:: -LM00( 0C4Pp00 @4K,KX @D4 0`P1(K,04K呴`P-(\0L0 R (0S  @000 A @D\0 0S (坱`P 0\ 00T00S$Km(j -L M, ( S0 S0 p^(0S$K``0\p \H 4`x0sA ,K`X H `0Ld0 /pP@,L0 @ 3  P,0x 4qP0 40X`0S( U$ q@0S (0, (0K,p pP(S0 `@0\p,p\ W,,p:: -L(M(PdL ^p4:dX0  a<à  0, `PX0d ,(#d X4K>< K,0K`P( ,0H S\00K H 40<K媳`P00(\ L @H P S0 0 T0 0% 5#40% 5#40% 5#40% 5#40% 5#40`  `0#40S dS0d00#400S0d00#800S0g00040x r`00#80040x rc000,0SKVD  @  D 0 @ P: ,0 @D0CS,03(0\ C(0V`P< K0 (4K A(X>}`P0K40<K`P00\ (L @d 0(K0 0(`PL R S0 `, x0s P0H0  H L0,`@0P,` H -4LhM0,0  H x @00 T |  d 00 4| ` dS0t , 0tR/(K@ 0Pt | Pt @40p@ * 7K0P Pb P0t0 \ X  `\0 0R   S R\ q T `m 0Y 0R S .SY B0l0 D0 h0 p@KdhP K<0KPB`HK@0PKW@P4@PHHPL 0@ s 3S00S9 \0S`lp R PP pChh I \ X 5V\ `lp V0fl2l Q 0\0"'t V |  ᛹0t0 N\`\ 0\`S  P X0S@H` 0 0  #H@7K V}Pd(pd0,0`0x 4r` <0SPZ V<` PRH׬ v 3`x0s00 @`Rw T 00R00SS  Q u  0Pt d`0S  Z Rt ` <D0KwPt p D0R |0 0;0x t95\ X d\(p\ 0B,00.S  R R0.St`R <` T d`0S  Z R= Z | 0  |  ԸT0  u  0aPt |d`0S  Z Rr 6 | m0 40@hQ`K0t0 aH)t@ ]P t Y` <D0KPhp0S T x 060D0| T   d00S  0Pt 1\d 0A,0l0(0p0\;0t #x tq0 6t 0x g0`60 <D0K@P!pQ T  &D0 |0 m` <D0KPt p0|SD0 x t?060x P0t@ 6t@ 0x P060 D0t BxeLU9 00  $00 0-L`P @3P004  0 0 -LM0K@`DP00 0  -LM"0K@`3P0   -LM`B`0$0 ,` (  h0PSp 0S\, KU   0P$  $K[[': p-00LSP@0 0< 0S  [`P  0P *ph0S 0S p-``Pd0,0d Q L0L@ 0@T  T0@0 @0@ ,00@$( Z S{BZ N{ e| J{ t |p -L  p(`P`R x0`@0Q `V<H;E$0 :$0`" -L8Mx0Pp &@P (KDPڈ7 U@ 0` 0``T@ T$0040  0b@P(K@ H H :U@P x0, PX 4 0R S  V P<;`, ;40k040,0 L@ 0 4 !0 4 !0 4 "0 4 "0 4080 0$02 0$`08  24 \ 8#8R$402@SQP  0 400 0,0 0 @400 0002SL0 $PP80S 0 40S0 x0 0 40,0080 0$ 00020^t 8 0Bp \n:0L k0Qh 8^e 4@,0!< 80x D 0,<0r8<00 L< 2!?04 H @D000H0`T 80D 4t0LP QT 3R 0D 0 D x 2tQ0 08l0l00P S@CXP@l0 4p0y0@4 C`\ d0yd @0RX O@@0 40,0P 0 R,-0,0 |QKP00B JP< P P@P$00104P0010h0 0`b删 x0g"0#4X0 <0! .X@ $ 0@,00@0H&0%40| e0  x0x40+H#13 ȭ@Pr,0L@ .yP 0|0,04 +4 ,0,0 yX yPD yP, yP ꤈i:P:X:\U9 -LMDKh p | , P `P$ # `0S    `P$ -` 0S`P W/Ko`, 0R(K`KZ 0㈩`PKKZ 0A8ps @0,00C 00K(` 00u`PP00S` cx  0 #40S` P $0 lmu0 0 @` V$0P 0S`5V`R0 0  00 0 0JHx0s00C KP3  &`x P 010o00KKZ Wx0 d1 "0 0 d` dXV [ 0%`0吀Pb밀B_Z'xPhZ xZxKZ Y_xZxKZ x | x+xeddU9E0  B40R+((((((((((((((((((((( 000    00 005w-|`| @!0@`$dP#r"XX 0' @(?0# O $ Y `@&0#@8^nCCX좙N 1s s s (0<0@00 0<0dd@ R00 0S00@Q $ 00!0?A0100000@Q 0 S 1 91 0-L M Pd @0 80aK0 p-0L@`` $0D VP~4%(P%(P 0 0"$Up`::j;: -LM0 pR 040`V  PR00` X0@0b4` c SPQ 0P -LMp 00匀0CSDt0|P`S u*  x 0H0,  x0S40@` X0b5 ` PVQ| @P 0@|0@L@v|P`0D0v@   |0s0siV:0<0< 0 < -L@p- -L@e- -00 LR@`Pp Lp0V  -LMPPpWpP 0@ BpT{v pPᱰh 0 npᥰ p-L M80@SaPP Kp$`K0 00 4 0 00 000^\ S0 0S0T0XV 00Z0 -0@,LhL0 7i -LM0 ,0 @P`0pS( d0R`# :GL, 0Rb(K謐K ud K`P 0 !0 04开KY0K00 x L` H` 0 00 ,x0 "0.00  K0#`P0  0  0TKV KX0K+0PK0NKP K Y0[ 0Y0K0 RK0-xeiU9 -LM0 ,0 ``0S4p( d0R# :Kp, 0R(K@K 0@PK@K#u00 xp 0 00 x0  000 `X 0H `0Cd0 PPP˨d@LtL@ t L 0#40%[ 5[#40%[ 5[#40X [ [5[#40$[ 4[#40%[ 5[#40x `r= !4 0 0 %[ 5[#40%[ 5[#40X [ [5[#40$[ 4[#40%[ 5[#40x r \P d KP)  b0#80 [ `0#80c  @0S 002y TKV KX0KDr0NKP K>Y0[ 0Y0Ke@ PK K 0H YKL @ P P0  0  0"8,0 RK0Jxei$dU9 -LdM@0 P,0 H L x7`LL h1L^|0 `p  H0U `HP]LƟ, 0 R(KP L0^\ | PL x S0` T  0S x0Q 0 0 x0@x @0` 0T B0Hp0 Ppt (0 d p,L ~| L ``0P vTQ   \  Zt0SHpxPf0 R HK \P]HPp Tt t   \ t R S0oT\atpgP\H0 Ht 7 KPJ00 0 0 \QZ  LK LPX x X \l (0h0 Z T\QpL L|  mx 0@00L) | Zw+0 .R=| PtQ Hh00 \0 0 PB `0S ᜭ | 1T R0S8x H@ BK s7K sp0 ,0d 0( xp pP BK r0SLxl00h 0( 00lxpP 0S | L}|  LN`\Xd x2p 0@P Q | Lp^x  0S\0d 0$0XQK |  RE X0`@T9 `X H `0Dd0PK pP'P $4L0@x0ps` 40  0x0s $,$8  0P$pP L@0S 0PL $ R RRRxe kU9 ::P;: 0-P@QLqQ0h -LM@p0`SP40s0s0s (K0s(0sX0s\0s`0sP0sTq L0$  0R PT!88S(-S0 0S00 00 z L0$ z0  ,0 s 0,0 0S kP0 S 0, S p 00S~ S  0P,0s L0$  0R BP l0  0[P00S 0  ,0sp 0,00Z0_80sb 0800^\ 0TS0 0 S0 0s L0$ X 0S PQ00S 0 S0S000S0S0S0 0S0 0(KoS0 0S0dZx 0, S PsnL0$  !qvPTA0sMg00sz80sw<0st<0s00s -L M0,@KP4p`0 004 0 0~ 0000S `K Pl S0hd240 S0 0L004 p 08@04 0Xp 0d0 $40 S,0DTS0P 8T04 d0(04d \0 00@\0`@ 000 Kd0S 0S`X H a0C$0"@(2"(@1<@00 !!   x0s@00!{ T0XV P0t ,0CT D0>\ 0^>S04 0S00 0\0Z10m -LM@ 0S4p00 0 <@00 !!  0 0@@Km -LXML T 0 SP 4 @0UP PS00X0 Pd0 0S P(KRX0L4c cb SUaQUs8` 4p L0P h d0 \@X`@ dPQ\P H dD u` X0@P0b# c8! S Q3P< @0   0V: X`d0 ` `6, P0K.QThPP80K0@0Ud D0jh@HD0cS0! d`PS0!\ lLS@1@!L P0PUCL0ST> @0Wd0X@Pp@ lP L l8B \AQU<&`d0 ` `6, P@K.QdT0@K @P,KP8 K0lPP`0K,08KPpPUX^OTL0$  JP 000EC -L^M < 0 ,0 |!  |Ax! S04`a  QKFToxx!h d  0S! 1  Z?K0@zaxA`1|q2` 8#8R1 dAT@ 0`! \1 @ x1\ |qh!d0baZ_K`>KPU`X@X\0d A ՞50pa `2 PV1Q 0t! p1 0 W p!l1 |V/KS?KROK@P KH1VKwP PH!D0X! cQ!L! 0S> PR `Z?Kp`p Q  ha dq t p! l! L!A0 P0S 0@ `pR Rh d t p ha dq l L!A0 P0S .xa\} |!ahAd0faZ_K`.K PU`XX\0d 50pa `2 PV1Q W p!zp!rx1^K`PX`x1ZK Aq 0x0g0|d PQڜ1 00e, 0R#(Kx0s  ` \ !0x p40 40Ȍ< \ p@0D @ 021KlPR KK w1K1[ 08$0(@K0QD @PTA 0CL0PP\ ] PXPV X8 UA D8 0LT40l@Q  ,0T0\0(KY  LP\ *L T0d D 01 HDd0X0C03>\ 0C` @ < X8 9^ 0nSZn< ^ZRQVp l0 T 0\0 4 ^d0 ` RLDd0S*d0\ R X0P H` \0b@ 0l5 \ Qh0 |tTl0pP` P `5>VNP1V0hR3Q ʧ Ld0 0SXU H d0PpppŸ0 @Lk00Dp0t0|P`Sm |0s] HT\ dP`0iZ! /L d0Rp:LdP VP\00 LT 8\ Q,H0d 0S* 05L\0P00T \d H0XPRH 0Kd0 P&P\ 0,T0MQ0A0r@U];0s\0STT\ 2x0SH `0X| c51 a0 QV i@ i;0P0S0<0.P@(P%H0P0!0PD00P0=0"0OS$,t2`P 0S0P 0PP 0P00P0S0@0 QPH=0P0<0P00S i;0S1 0R 0R 00 P 0@S0P@.@41 @P  1 0 P 4000T :00SP0T L0T P@0T <0T| P0lPP080kB @~fmB fB{BlB sB@f@oB@nB @wt@|B@vB fB@hB yB}BzBjB@xB@gBvt<<dqB@pB -@Le D0S HQ\T0\0L \S0\0 -LMS00 Sp p@`0\P, 00  R400404 0@0 @ @`0 h0 封 ,00:0`S$P d 00S* P 0 0 $  (Ko(KHi -LMQ`/  P 0 PR@T% @T 00= 0 000 (pP Z4K P0 v<0S101@T(K4K 4?( -LL̠Č.Č@!̌K M0(K.0 01K (@ 1[!0 !K -LM@ 0  $K1K$@ 1[!0 !K -LM@TPp8@ ' 080 @T 00= 000  0(l`P X4K T0   <0S80080 @T8(K4K 010  00- LQ@g0PS00  0- L@70PS`  0R` BX0 0rpX0: $0S71 $ PQE :0S QH p P!$00S":`V. 0  0`  Z 6` 0 @ 0  sI0$00 pP` #P0S[1P S)`0 0 0 0 Hi: Q-Lp`V Q CiQ Q `QE ?*00@ T"r 0iTP0 ;Dr17`q @P `P 0iT& 0Y#Y#  ]wP ` pw Q0 0Q Q000000` _d 0 0i 0 -LCMq0  0 $ `1 @R` P62` P`$ 0R& K,IK J/K0_`P(p 0SPq(`D1(0@ R0#1K0@ (`XBxeU90@-00 \ PllP \@0 SP 000< 80P 000nS0 n00Q Q 00 84 004 <0-00 \ PllP \0 S P 00 000 048#0A S@-2*Qf 1@ 0S'xW(xW(W(W( W(W(`W(`W(0@S 2S K S 0S0S Q0A0@S. )ڀS S) `S 0S0 S 0S @S00Q00Q`S pS SS SS S0S:00:PSS 10 S Rd -LDM@dKP@pcT@D` @0S񟗾_(_(_(_(_(|_(t_(l_([([([([(d_([([([([([([([(X_(@_([([([([([([(8_($_([([(^([([([(^(^([([(^([([([(^(^([([(,^([([([( ^(^([([([([([([(](]([([([([([([(](]([([(|]([([([(t](\]([([(\([([([(\([([([([([([([(\([([([(\(\([([(\([([([([([([([(\([([([([([([([(\([([([([([([([(\([([([(\(|\([([(t\([([(l\([([([([([([([([([([([([([([([([([([([([([([([([([([([([([([([([([([([([([([([([([([(0 W*W$ KF$0S; K W0܇0a2W 0\ :0S b0 bS \* 00a``000 0 0 K10D`0 K10D00WW 0P :0S b0lS P*0 01@0 WG*W$ K$0S 001@0P:01V{ 0P:01vWgWj 0P:0Sc b0lS] \P010W:0 $("0P010z0S2 0< 8mP 01ff0S 010c][`Y01@S0P0 K10D`J0 K10DD`B@>0@-P@ R( 0S%\ ) \ ^ \@ 0 0\0 S 0  0S R 0 000@ 0 0  R P,  R/ 0\ 00 S 0  0S0S 0P@ 0S@@0  @0@ 0 0 0S00S0@ 0\@@  @0@- R 0S^ 0Sk0 0R 0SI0SD \  R0 0 \0S0  0S R( ^ 0Sm R 0S 0R 00 S00 S0 0S    R 0 000 0 \0S0  0SR 0S@0T 00 S @0  0 S 0R 00 S00 S0 0S    R R 0SP0U 00 S P0@  0 S@ y -`LV@3 ^=0S`PVPU p` 0S`` TPR 0T 0RU 00SW `PV p PU` 0S``P p P 0S0SP0SP0S  P 0S0SP0SP0S PQ00SQ00S,, 00S00008di R000  B i0 R0 Pd&h0y hc 0-6P0L6@T b@T1S kbl&0h 10P  R! !  110C0C11Qf RZ p-L$M`00 0P@T@T 6 6l8!#8R KH< K@T> 0RKp#xe@di \V9 -pL#W`P,PU) PU7 0SXQ 60@^)*0 0# 0 0#^ XP Q  XP PUP^ Pp-L`P p@Q Q P @P 00 0@s@@ R 0R p( -L`0pPUPU D1W6 @T@T 0 R0S =XP@@d -LMX, > 1`V@ `V; D1, R@T@T 0SPU 0 pR*0 0# 0 0# WY  P P P㨑 @d -P0LS@  CPP  $O 0P0ahm x(<Q -0LSp 00C0 SP@ 00BR0 SQP@T`U 0S U0S; 0`V`V PXP TXP0gS"\ 00L0 S0gP ^0P@@00L\0 SL0!l/@!b00RPXP0S 8dgfff p-L@`P PP  R 6pQ@ p-ppp p-LMK`e@PP lPP xPP_P 6 -LtMܫPU, `p@ ;U ;U^ ;0Sy`P ;U{ ``, 0R(KD;UH 0UM 0;UF P` ;崖U D;U }P0CU0CU*0CU 0U 0CU \ 0@ 0`0 6 0#80S @H`P````9Uz &N0CUW 0CU 0Ug 0CU`` 少B`h06 x@T P9U5 @0CU 0U; 0CU1`` 0 9U :0CU  0U 0CU`PQP` ȕ`J8U] 0UI 70CUn`P<1Sj  0`0 kH8US <8UV@1`` 0_ 8U 0CUJ`P"`P ` G7U x70S1m`PLPK 0K⣆`P 00 .t0`` 0)p0`` 0$p@R`P1S  p0`T ]500 <`P6  &q< 0 \&   00  `PQa PU^ 0S[0Xl0S S S `S S@ U0 U P`q00 `P{P+P3 @T#D1 R00  c6@/ ] Wm P0`D1O`PI8#( ht 0   h  (0B8h0 "00 jD1`` 0el 㣄0`0 ]b?P` P `S L@K U 0Kх0`0 Et`P `P d`PPK@ 0K⚅`PRO@ U@ tU` L`P0` t0j`P `` 61 -`@8#(hK {6h<8#(r@S6 @262UX 5UT2UV 1UR1U@KR@ U@ r01hh[`At@8#(.ih0@h`Vah# P!Th0@h`VLhbO` |:P{@P w00 o`+xei$ii$zi i$xi Jii i hV9i i i i$i i$~i ?qi i Fi@6i(Kii -hah!0L0S0T0P0@ PT 1S 1 RP< T &0S T$0@(0$@0Q!R<10 RUmT00PP  p<P !S p d3TdPd#!^ """!1# V9V9   -"LR@ \0700"R p-@LT`P7 T T   p/p0S 0S0S @T   p3000 00   00p@T  l߭d ۭp@0^  0@000X B00ȭpjdpd^ddd -L M@*PK0pK `P5BT+@T(  PP PP00CS0 R07004` 20C2 PP2 0C2 `$K  -L M@p*K0K` BPP*0[P$K00[ BT@T  jPP  dPP0007 @P!  6 200 p2 S0"00/B 2 02JPP2024P7P -\ \:6S0d0\-P@1P0p040\0\ )q2i 1i i i -L@᳊02< D0C2" @00/00 2 `e 0-2L@@1pSl0 P@m 1l pnPc(0m ౬020L 0hXP( -PpL`ZD1W(0 68#(^ 0!  (0 OPP  OP11<<88#8#8110 0@0@00@0@0@t04 !48#H) 1# 6  $3Td # TQ 3T00S 0Sj \i aOP i\-H1 2T& 2Th;p2@P p0St gHB@ D0RW@ 1 00Sa@`10`@  @ 6`x1@P pU0S? =A6t|1@P pB0SF *\A0S H1R0T4 Z ^`P  Ὣ kpZH00H0\P0Spm000 0@@0000 0@@0cY000 0@@0Xdhi5݆dikCji -L Mp@AAP`2@ V[(KT# 4 PD  `X 4   PD @  3@0< 8 SD RXA@@@ R+\((((((((((((((((((((((((Ԭ((((((( ( ( PP 804 0C@808-/@4K @.K  @ 7^`P7@ P @ Xr 4K 㲁P%Q; k;a@PI 1 01^n 0.K .PA@a.K 0wP 1  6  ?@TG @P0D!P`1 4 O!1R-@10!Ra@`10a! !/00@ 0@ 0 0@0@? @ zA@Z7@@ 0]P@i 0 7@aꐫd(:ʚ;Q0\0ᨁ0 Qp-LP`0CQ:pl0Q p%0CQ~6@@06 V 00p0p0p2i i Į( -Lp`P LP 6AUp 4 20S00 0@0@0O   R R 8,bZ/Q`1@ D0RH00H0RZ l7LQ`IZ40 3A0 3@ 1 00S၁@10@  @ ݈0P` @!0S  P`0@  0 OP`P`&000 PP,(:kCjhidi@: -00L @P `i p- L`@ PP(  084+0 p0&0 1!0 Tl0n m L 0p4@P p\:خ((`i -@Lhxd- 0  \  \ 00SP \`0S S S 0S 21C 0ᐸd p-` LPP0#U T u@R0000 0  BTpp -P`QppW@L hTf 1R' 1RP  0SZ0PS000000P 0S 0S 0S @P @P mP4   R01 Pp`PP`p \ P1P!p PU00@  01 PU@PP  @P0PP!${P5i 6i( -L@`p  PP 0` pP0  0,+d: 0-L @PP 0  T.*0P P 0 P+:: -pRL` @PPU@ -L  0P *뀸(di: p-`L@T P @T HP ct  @T phmphi-0S  0 00Sp@- 0@PcUe\5*0   0`Q  ^ T 0SQ 0S p?R00S eQ 0SP 0S pr3p 0\à@-0@    @ @0 -P` Lp 0  0S0@Q :* 0 RQ /  \0R 000Q ^f 2 @ 0  @PP0S:  0   @ 0PP00 -pL0S`0S 0@T  0 0S@0SP U 0Pl P 0 -p L@`T.(((((((4((D(((((((((n-` PG @ B` @ `0 ` `r`!-` 0S* yGc`?c`W @T8`0 0 0` @^\*c`'`P`9` 0S  0`: --`1LM@0 T, ` 00 A p@T3  0 P!0R!R 0SP 0 AP P  APW  0QP 0 cP Np@TW 0 cP N(KXXp(iʚ;0 R0%3 %'d< 00 \\0 X T   @0L0 H 4 0`c K -LTM0P,0 pNpKt D F>@lP 0P @P 0 @T ` 00` 0 0S D$>  0lP ( te,(K,@ 40 800800 S 8 ,0Kp`P ,@ 80080,P 40   z@i -LM,0 Q0A00S0C0`00`SP 0S0C000S9*  p/@P9 @0 ᎚W  ሚ`P 80S0C80$0`040,C RP` X00\ R \R\  0[ -Lp`P@T 0 R P@@P@!@P P 804 0C80 0 R @@T 0-80LS@P 4P 8 R 0800P 0SP 080P fP4P 8Q 844P30Q  R 004PPP 00 q4 -LDM8ǟPp, d @`P/`  000 0WN W W) 0`0 d%Ɵ, 0`R(KZ P 40  @0NK R4 @040  <0804 ,(0 00 00 {,4X0`0 (  @P7`  00Y40 100h0n0Pp 7`   @PO tP  6PE @0  @P< 40 < 0`P 80S0C80ŀ0`0d R800C80 d JP(40@ 0R40 0S $Z000 ` @k80Sf080G` b` _` \  PP OP40740 0RX0 d P3,P  0 W0 0@ 0<09 n0 X0 0 PT a PE0S Z@8008040 J  "|007 /P `P ]` h @ 0Sj hHHh h80n 080n dX 傘  P P P4040774040cTX GP\ 40 dP`P 㸵 ` 7P` 4X740 n0 X0 0 T \ 80S\0C809TQ`.@0S @J0@ 0<0 0 S h y 0h0 r o00C0S640040n04 < <4 n01xei,i0W9p:: -\1LLMp @1X PU 0/ ` W X Lp(KV R 0 0 0 R000 0 0 `V hg0S0C0Pl@KD:0 0h $n ꘫd0iTi: -LHMpPU$  R 0 0 0 R000 0 0X  `V '0S0C0|hPU R000 庴 Kd@KD:0 0` $n ~Ti: -2LxMP 0, T0 D  Q`pf @KD`:0W0h0 唀 dP 0NK0  b?Yl 00  T0KHW`2 WV'T@T$ 80@ 0CR80 @0S @ @P 0<0 0 S   T0n,, 0RD(KP T@T 0 \80S0Z @GWV Y$0S! ?HP7` @  P800C80~ @0S{ PZ GY3`A`080xe:` 0 Z0 PD 0`@PD 0 10 0BR0U ` P7@ TXU00  S@6 ,0S3 00S 0.0S+ 0T0 S, ! 4  R R000 վR000 Z0 P P弱 P 0 S@, 00PUP U 000004 @ (K 0o7 -LHMlKP Dd71pWX6R pWR  R@T 0 X P[0S `V 0S?0X0 @T/ X6 0ST 0`0 0 L P;0`S P 0S  00$l0 0fP 000@TT@ L@ `@ pW(K 6l0D1 0⾓l0 0 vfP0 00@d -L(MP@P`0AS`(KHK `6 0`T<0 H D 4 @ S pdP H0L 0CPS ) )@ ) )P )D@QP@L``L0а<0@ X < : 400hS `300  3`L@`U @%T R0P U`P  ``0h!$qBK K ,0K21C0b ?A1c0@i ) kgfff -LpMl0`S( @1 PKDF6< 00 P0   @0|0 x 60p0 JK0d  `90pS PU 0S ( 0R!$K 404 H n0(0 080@0< 0帠 0eP00000-xeDW9 -L M 0@0 S))))`P,P @XCP00S?X/ , @@  5,Pp @Z `Q 0 70 0BR0`0 FPP+p W@00P0, 0 0(KP,P C@P00S ; ;C1@BP@,P P@,P B 0-40L@0PP X 0xWP B8000a0h400400hL8dP`tc<P `/ph  `PK 0 `p\ KT0KpPT`80080 NK 000  d p 00 <Q 0 @0 60@0|0  |  0 K0P  ګ@P7p  ;㜫@  K0@w04 (0,@ n0H0 0(Y0 0R K T0KQpPT R} H ($T`800C80T n00 0T <060T 400P80080Q 0 0s03R0#SQp QKpPQ 0P 1Q   0PEpPa @P@ ^ 0S0 Z Pa @T @P P 0S @@@ 00 00 <0P 4 00 040H $(<060n   400@0S 0S p@T 3$0X 00X08 $n 0X0 L @P @P P R 4 0@P@T` n00T 80p080#P Q  "`V:pQ 0SS0Sxe kHdi8d(dhW9T: 0P 0CP>@t 0C!` @#2 40P 0CP$0PN=@ 0C! ̇ P P10"104 P PP10N  0\30S?000S \ -9LS@ 0CS9 06 9S06p@-@P`0#U@T$b0#PU0t0# ^# 0S0R  ^P0,0,P#p$Y9P0L0Q00P0S>S  -R')H')@')')H')D\ 1 RHX9 p-0 0 8LS@`) 8PS P()\()')()')')()')'):0 00CS$()()()')0:0p080p080p080p8S 000;08X 0\<0<0x8 8"R -41 \ QW9 Q-L QQ20@S))))))))))))))))7P"  P P nP P,$`0 lH l: Q-L QQZ$P> 6P? P? PG 0@*SD+)L*)t+)L*)L*)L*)L*)L*)L*)+)L*)L*)L*)L*)L*)L*)L*)L*)L*)L*)+)L*)L*)L*)L*)L*)L*)L*)L*)L*)L*)L*)L*)L*)L*)L*)L*)L*)L*)L*)L*)L*)|+)HP 0P   `P lP`@ 7n: -LHMDğ0~@P p`,0 . 0<K .p h h0S]h  h "-0S: 3"-B 0|8 Z ?0 "0Ql0 @l @0Sl0 P P 0 {|8 p<[\v;0[Sq< K0 R  P(K 0C< K0pQp <0[S%@<0[@S0Q0bC:: -"-0LS1p`o Qo1_AP 00S   R` V0 00S  2- 00S 7 17 ^ V 00S  ^Q 1GT@# P 1'R! 1?0Q w1GrT@k4h i)(0`K \ Y9:: 0-8L P& 08#QQ B0S108# Q "-0S1 0P0Q@@P0+)00 @ D0 -X@LQS QN Q` Q`  V`"-0S6  (pP VK  ,z  P<, P PP<1 R P48 S8Ĩ4S UX %00Sx8<x8 J4``V"= Q2 RPx8<x8"-0S8X p ``PJ -@LKP+"R2 22 hL -LMp1 ~2i 10#v +"-0`0P0P U` O0S KP? 0 P8PT  U `\A"= R!  0 Rd  d 10b 00 R" ->2pN, Jg01f7 1f7 = S"-000 0S"-000 0S"-000 >S"-000 *f:d0x:0 0000  0@-1 @T^* T(0T^  T00S 0 000008S  0S00 000S8 0C8 @0 R 00 0S0 :[0(0CR 0 8080 0̫|8.  0?/ 0 ? 0/? 0/? 0 2"|J)I)@P&:):):):):):):):):):):):):):):):):):):):):):):):):):):):):):):)  x8 01S^="!B10b>00 0 >= p-OLTP`@@T 0R! ?*P V 7*Pp -LdMP,!@0|  ,0 p` !*P.xK   rK *P&lK  LK0XXL00 0C 0 x )0C| P, 0R(KxK  Ά@lK Ȇ`4xeE)h@)$:Y9 -LM 04ab 8#8$0(S( p"hc S( 0R+$KV#NK Y0F898#8 HPK1 ᇆ#NK 8K₆  0xeY9 -LMP0a4ḑb8#8 0S, @!hc/ S, 0RW(KVpfN@H$H"00 G)@D@H$hOK  !("(0U08#_ #<" a0b1p "   Br@ 000S0 LPK OK <K  ! 0= pb gxeY9 -LM`V, @ p& 0PK0KI`V0[ 0p0K s  n jK fV@@K- ᾅ, 0R(K%xeY9 -LM`04 8 $#8(0"(S$ pP# S S $ 0R, KOK  QeOKv +QOK 8PK  Q hxeY9 -LMx0Q@4`KPp $0 T ( ($ 0PR KxeZ9 -LNMPPP$ `pVOK X   DPK  $ 0R KVOK  P DPK i gxe<: Z9 -LMO`TPp@@T 0S 'PP ׄ008S  1>H ^P @P ⽄0@0/@D ?@1.0o@ -LRM`V, h l p!  p2 K0!(KH@^K  `V$ 08 p#Hhl!0(K@ sp o  kYK gVL@Kb e, 0R(K xe8Z9 p-x8L`P@9 0K 0 9 ? 0R>:0 "#A10a>0 00CS/H),H)`H),H),H),H)pH),H),H),H),H),H),H),H)H),H),H),H),H),H),H),H),H),H),H),H),H),H),H),H)PH)0 0  0)S0 SCLR0S i4p1S^/phph phph  048# @(R"!B10b>0 0 0C-LSI)pI)I)pI)pI)pI)I)pI)pI)pI)pI)pI)pI)pI)I)pI)pI)pI)pI)pI)pI)pI)pI)pI)pI)pI)pI)pI)pI)pI)I)4h7hJhz h -0L0C@S pJ)HJ)dJ)HJ)HJ)HJ)XJ)HJ)HJ)HJ)HJ)HJ)HJ)HJ)pJ)HJ)HJ)HJ)HJ)HJ)HJ)HJ)HJ)HJ)HJ)HJ)HJ)HJ)HJ)HJ)@J)hA& Q 00CS$K)K) K)K)K)K)K)K)K)K)K)K)K)K)$K)K)K)K)K)K)K)K)K)K)K)K)K)K)K)K)K)h0 -OLT` @ RD0D0D0?@ D0H %㓠OT^Pp%W 21C! c. QpP@  %W h% -LHM(0` ,0  00C  0@p$@`P 0h d0 hPK`0@p0 l@ ,p@#$0@`P H#H$8!,pp`\ \` : \  >0>,3l080S* @4PK Ṃ %& X K0 80VKW0K嬂  PK⨂ JK⤂XK M  BD@KG Z%P  0`p唀@@, 0 R (K\@ >0>2xeHZ9 -L(M0p,0 @0 @00P K080 PNKO0K]  HKY BKU Z PK  B $1P 3PH 0 0 L0P 0 0 B0  `!4 0<@K040 "880 "4<0   %  !   0 0  00 0@0@<, 0 R(K> 0>W2\xe\Z9 -LP@F00 0-LP p@P @0 0 -LXMBP h d0 ^, 0 WK` W0Kl p 0 SV K UK @⭁ OK⩁ IK⥁0 0S 0C KB0KApK{ 0 S 0 0S00000p 09K 8K90Kd h"$d@0x WKlt0 |0 *|*X*4x[@ <2K.0K倠[h0[ lLXtYKXK1K/PK-0K$$h0pK9@K$Y0 0 W J40` ᘫYPK 0 0# 0Q`  ያ 0 0# 0Q  `}l00 .l000h@p `ln, 0R(KAK ;pK}0 SG0V0K`^^~xepZ9 -LMF 0 ,0 P  0Rc0@0 @a  0SPP  0@0 @ 0@ $H,, #H8P`0@pL#D< P0 `0@D p4R  *082@P@ (  %0P0Lj\ 0T@K 0P S  b K @DKd@K @ 厀DK @0@00t K6PK5@K˪0 0lS | 0 oڨx@ 儀@ | 0\ |  X< Pa 0| 0aUP!0Up`$@@U ( K L0Q 0#0, QY0#,0AڠTKT K≪x08#̠DK#8t K@x0 6K50K|U|eP |  @1Py 0jR 07 0R@ @ Y TKT KOPT0Ed@E 0TEP0#U 04@K|0 /TK "PU0KP0A, 0Ra(K; 01P0 0. >0>80 $ 0S0 10PP ;01P0 000S 000010PP 0S: >0>0000 >0>// /@ >0>/xeZ9 -LP@ٜ00 0-zLP @P  @0 0 -LtM 0  ,0 00 0P   .P 0 R 0 @ 0S p,0 .P`0P`P`@P "4 <00 `3 00 "8 80 040PP "40  jLK0>.. >0>.xeZ9G-p#00`400$M400 !0 0 0  Q0 @  "$""40  0 4,4 ! 0 0$ ""40  0 4,4!  0$ ""40  04 4! Ƞ,Ƞ0 0$ ""40  04 4! .0 $ ""40  0 4,4! X$ЍZ98G-#p0 Q0 B ("( 0!0##4 "0 "  0 4,4 !0 $ ""40  0 4,4! 0 $ ""40  04 4! Ƞ,Ƞ0 $ ""40  0 4,4!  0 $ ""40  04 4! Ƞ,Ƞ 0 $ ""40  04 4!. 040# 0'  040# 0'!h0 08#X 87 ("H0('08# )Ġ87_   `P@0 4#0#00Z9 -LMx8`p 8 rP쐟 0 3 `1C cR0堏?XU Ux85x8 0堏?O?,@:0,: 0 H:Hi0>!+| $X h00Sh000d`,XX.hE ;X~+1XP0 0pt>0>*X*X V+lxE⠐2pp>t0>*X* X 0S:t*X*p@>0>dKX *X t*X@ p@t>0>*xeZ9 -LP@00 0- LP@IؗP 8S0 0 1!1!0 0 -L,MP T p L +0PH0  T )PH0 0 gR H 0S TH < < z00 @0@H#4<<_  0 03 00 "880 040 @ 40L !R^ \ P`0@0LPCoS 8@K9 @ LT< 0bY[H@0`pD @0 D@b 00gT@! @;D @   dL0Y@`p @D 0WpD  0VP+Pg PgY P P U`` P   P L0CoP"88 JL0 1; B*1PP P0H@0 7( P*P3 0 0 0PLP!0<T @ @0L| 0@P 0$$$$ P @  L0jH 0 0 0 T)H(KP T>0>)H~)0H0  ;H)H1HH P0 0PT>0>f) -L,MT pPP 0P,0 L T0` 0R<@K x 9Kx  LT Y*0PD0 T F(PD0 0 BjR vD 0S D  xD0 @  fZTPITD@PH  0@a0h T@! L0H * dZH +P@ 0X 0Up `*Pp? jZ RPP`` B;J)1P  H P@@K 0 )(0L @0S"T(, 0DR,(K ;D&)D1D P0 0zPT>0>(D(D PT>0>T(D P T>0>(xe\9 -LP@{00 - @LB㥕P  -L(MP `0P L ,0 0H0 z)PD P g'PDD 0 iR 0 D 0S P@D P wH0\ 3\H01D0, ,400<@K30 w 9Kw  HP0eZHD@`P @  0@a0fT@! @0@   dH0Z/P`@ 0V 0`Up )PpN iZ RPP  B;I(1P   Dp@ >&P%@@ 0 ##Ƞ#\0PH0D 0 0 0 P', 0DR3(K00 Ši(P 0p 0LP>0>'D'D ;D'D1D P0 01T@L P>0>u' {xe\9 0 S00RSS   -0/0RL ? @0#200   N000N "" N04\0Nx8 2S0S H> 0H>0S H> 0H> -LM8@S P0  0S00 ?$   0 p-LȐ@\P p|8  8S 0S >0 >p` 'P >0>p 0Q 00S:` BV  1R0x 0| 0 0  C B  R  0 00@0!0 8Sh@`10 h\( \(0d 0-LM@KP %v >P P P K0@K \v 'P00CS))))P)H) ]9 ]9 0-LM@KP u P 0SL)4)<)Ȁ)D),)K0@K |u P0SL)4)<)Ȁ)D),)T) ]9]9 -LM@pAP,0 P0 Y 0 0帡t:P)0 Yl:0 $("10Y_:`A8!#8S,0 P `A @~8# P, 1 PI0SF  Y@: 048#8! Y03:`C8 #X00 P `C@8#8P 1Y: 04Y1:0 $ 20Y :R0Y:/0{(00*0s0\ H>(0H> LW0\ H>(0H> J 0-\PL0@  0S0/00Q 00;00 - 0L S`0 $"!@21C0d!P2Sp 2S? |t023S  Q o02 - 0LSp00 $("8k". bSf@5S 21C0bAP2S3Sbi< 3SV ㈅1h5S @h5@P$0f T0@f@hɑ0h5 -@Lah軑; - 0LSP@ x>Ȑ 0\p`x> \  8S 6hV!48 #880d: - 0LSP@ t>Ȑ 0\p`t> \  8S 6h(!~48 #88: -L,MPP 4>04>(K8S ^ 0$P 0  L } 8 p0Y40 `: 0Y:0D < H @ 0 S@`  S| `pY: 0Y*H>0H>H0S 0SD0H  p>0p>PL 804$@0<0H2 @0Q?q @Pl"000 2 R 3 x87x8 x87x81Q3#5y51 R\ x86x8 !000 o6 `1\XA@08 #8<8R8 S808`>0`>UH` 2SD` | SyRH>0H>s+@K /s HPhPf0Sc0< S < ]< R ZP D 000t0x86x80D < H @ Ldt;j;:]9 -LM@PP 8S p 0 `P:0P:0S` 1:2S P*V 0SX 0 SS : R X>0X>H>0H>;P0Sx88S 0 0  000P  pwPPPP p-`LQP@ P   vrp 0@S Џ p -LXMȐp\x |0  (K8S @P0"0S 'jPd>0d> t 0QX0 PP "P 00`\ \0 VT  0X5:l d p h ` SpP  SlP 0P`X-: 0X%:00SdP  2ShP  SRH>0H>+@K r P0` S ` l d p h ` H>0H>l0S 0SpP 0 S: R X>0X>|;PPx(0BS @P# P 0h>0h>aR8 tX 48#hl> 0l>00x0\ xHPl h0xpx86x0= d0S ?` R ?E(Bx 0 :G P 0xdL KaPx0d04[SC +x0K `qx S [qD"x0<0| P0T x 0|0 c 8xp p \ ,L K"Px00`0\ 0xx0 x7p>0p>nȗH0  4[S *d@0 <0Q)[A?0@#[ #[  0@S  ^ H!80Sx8 ^( Q& x ]aP7H @0xRR0 00#[A? !!20[0P0C0S20K}  x@PPg20[.]9 -LM `QpP@! \>(0R\> KČ Ƞ,Ƞ508 B#8  8  -LlM #R0 (K8 p !0&`0 " $PT #0P0 oX :% 0X\ %p:\0x0 t0 ` |0 p0 l0 h0 d0 X0 0 S pP  S xP  5|P 5:S P`X: p0X*H>0H>xQ 0S| R 0p S`1'R!L>0L> 8S `\ QP>0P>`010 / @ |0PP `P TP(48R# 3  p0S  :HT 0S :Q ;@ :0d|  o 'o0@ 0  -o?0$0#ḃp0X tt0x @8S  UR9 2S6  0R ` a0S hP ] *SYR 0X0 T2S tP P SMRH>0H>G+@K Do P<0S dP 8 R5S30lSl -|8 WO x t ` | p l h d X '8S x8 hQ ?Ud R ?600`8SP8SMt0XS ,1 R x86x88X t 30( ; 0 Q(5I13lP:  }6 >`P Px86x8 L K P00d]PH00@  <008 A?![ L KPh@ ]9 -LMpW( F`(K(0S(  Q 0  0@`W1(PU e @P,  PfjU; 1P (0S 000C `b 0r@P  2P ((  -LM`x, P 2S  `2R >0>o(0 0 @R0@ pXE L0P0W0S5x8 1R2  o 1R 0@*@P 8SX pQ$ k$P2 1 0 1  Z, ox* 0 pP+ 1<1!1R*@10!Rq@p10q! !X 0 0@0@ /00@0@½0 0 @0@}bꈎʚ; -@LH 04"48#hV1ھ 0R p PP # 1g)@ 0S"@P0>00>0S0S m `F0>00>mꪪ -LM` 0PSp :@00S ꠢ)Ȣ)Ԣ))"PP0>00>#2K 01R0S= 0F0f8#8 $#$"K  um00 fPP  $K2K  bm,K  ^m2K2K  Um,K Qm2K  Km,K Gm0SFKꪪ 0-@LrP000h豢 -LM`p!28#8N8 ,0 @P0L(K2?=Q 0, S PU @0 0@0@e`00 S0 00#   P00  P4 U 86` 000 @4``@P 0S00R0@P(o, 0? ޟ `  -LMP p@@T0 T*   ;P 0 $a8Pp@& 80|  `P@R X 0;P(K(Ko߉8S8S ^9_9:) -LMhpV80  PU >0 > X P  s(Ko@>0> < 0R40  ;U >5, %02 >5:0S@@TP0P  40 S00P 0 <0S 8S! 1T0#28#0"=00 40.  0S>0> 8S 80 0 08 hVa < 40R  <\l \KR>0>F8S>0> 8 S@ 6  TT T 6P  1}@ 80(Ko08S `' P:8 SF l50SU0  0 >0 >0 0@X0@F(K|8  8S0 u0S u 0008S+ꄪ)H)Ħ))Ħ)Ħ)0)R >0>R8S ' P >0>R8S `' P8 00# `0`S x8 ( 3 "0@. $>0$>8>08> P P  x8O 0@K0@(>0(>v  P,>0,>m P  22 "% ,0 (Ko\TPT4>04>00@  POu0SDu04"0C0 0S 0 BQ.0S*@0!0 8S@10 \( \(0S 80 6 X 0U 1 P>0>O K 1 0Rx |   00C00 3 2C 0%R &80  0 P) ,0 (Ko P 8 00+ @R P 00 0QPdXd -  jLMp 8#800  bY>*"*RX,  P`YNh20\`, 0 h%020/,000bV0 0j0Y.0 h 0R 0, jY΁h "0h00 0 0h*2 0R j  Y.000C:0(K -`rCLM gŞ8\P# &80 00  A?   - 00c:#: Sʲ00h:#: S>0>@gV @< 00h:#: S  0$KmI -0` L p' ^$ 048#N  10^:0BPU @ 04 #2$8#8"&0EPU@ 04#28 #8hy -LMآ@` p2 0 S/0  9280  $"" c("(P54  S0  m x8  A?   %80 040 2(K!0S81  &8 480 c1 Q051Մ5Y8  C PbV>V. 00H $H p,0 娾0D8S0Y^@0Ł04 0C0- :0(40 0 Ph @@3S  P(8  0b0 %,0V 0 A?   x 04 0b:#: S40 (KoW@0Q5šh%8hEv<''xp* 0S00\ \0S0S *'SS-P\2 ڰ\- ʀ\# \ |>0|> \ 0\ @\n\ \\ \0c/0T -LM, 28 40 cV> 0@p,  Ƞ,0 K- 0 0cʠ,ʠ \Nʲ 0j:#: S; 0bY.:#:SXP`YNh20\`  0 h%020/,000bV0804PeY.00c08#8:#: cp!  ʠ0Რ,ʠ840aYN0h00" R 0 0@0@,(Ko4, "00  h50P00 h5" Q 0  F84 bY΁h "0p0 00 0h* 2 Q804P e  Y.000C:0(K 0-P@L !g 'g0:0; B0 [0C\ %#53c0t0d D0u & 64 0&,0 l (p08t (780dfh -`PpL! @Kg' Gg:0 0;} p1p0 0\4[BCp R8-S0T e 3535t0c0u x0d 0p 6 h0&06(l 8p0(0t ȗ x05 Px00x08Sx00x0dfh -LM⤟?\, p #?\ =x?\ l?\0 `?\%x85`0& 00\ ]>\) >\ >\  0᡹`, 0R(K>\z x>\ 0\J >\|8@ p>`㳀ᴁ`>\1 ET>\ L>\ D>\>h5`P >PX  P1'R!| 1?008X98S8SK 8p R 4`=\ 0\ =\H=h`P80 ZT=\| L=\E D=\<h`P> RV |8: x8 ;4`x8{<\ <\ <\l+8`k<\ <\ <\\M@K! 8S#49 LKM0Kf! 8`MD< @R`pF`D;h壉`P>xȘ  0S774`4`x8x82t;h呉`P,@ Px8;x88S 8Six8   ' P4`:ho`P |8 0Sx8 <4`x8x8@<000=^00p0S l:hO`P0SS0`021Cc  M8`PpW@P`x8 :0 0?00? 000?00?000?000?000?S S S S00 0?00?000?0`0`  7`8S' 7e`x8`900zx8`#500.00q8S48SX`e@8hĈ`P_8S\ 6A0AS2`Wp( 8 p( Sp(  88 20C$(`=7h圈`P7MK! (7`P1M0[ SN@ MM [4)LKd4`!. 0`7hx`P|8@ 208S74``6hf`P8!S x84`20x8|6hS`P0S x85x8  d4`06h@`P|8 W 0Sx864`x85h.`P]@P 8T` 8S SX S` 0d5h `P+`8xS >`15h`P8SK @% PF PX x0 `~(R  x8KU   (d`q唿4\) 0\cPP@P 0{S`̠K|P 000P@PS 0|PSO:|`E  | 6`P BP  `98pLK:0; M0Kc`,x85x8 I4`" C`00CSN @` P R4 0S1 R b0a ! c. Q 0S0000(0ac 00 5`P `P P R @ x8 B<4`x8-o00?0o??0?S0?0 /0// /0 /0 /R0? 0S S S S ?0?0?0?00?0?0?00??S 0?x84`6x8  0c`yx8;x8 &cM1"c`kX0Qg 8p Q4`b0` 8xeii 6i(i8i4 ki i8i$i4i i5i iiiiii|i0p0 -&L @ 0S 00 P\]9 0-3L P@ 00C8#8S0 p0 d 00C8#8S0x8|(6 x87x80|8 8S ! 0-3PL@ 008#8S0 Pd(0R00x86x83 x87x80( 0000|8 ! - 0`00 0C00 Lp  | 00C8#8S0 X@P0PA?0000RP^/! 0-8LSP@B 0 ȕ0)R002! !!80C8 R  Rx |   000C0C00y 10xP RZ•\ ,0  0d4: p-LP`h%R @0@S Qh% TH|0h50`V0Pp 0-8LSP@h1 RR u0SV 0S 4x8Dt1 RR h1  C2S 40 9S  "101000 Rx |   000C0C00 10xP RZ•\ 0  x8 >C80~<0  B u[dH: -tLP@ {0t1 -L@h{ -0P00p00 0`@ \1`A00|L C 6;0SS0 hu K ^0<0hi -1LMQp +\1`V>X!^7 9 S02 @")("(0 Pȗ1 2 10S'  2S 00 08x(0C1200 0mmh d -PL@ p[` \[ ]V @[0S  ][00[0 mB <> a0<>[@ -@L`P᷑p@P @Ph -LMhP08pᚑ@PJ 8S9S7 В00 0b>J0>X@, |W(8R/0V 0S`Q  q30 8S 6Q !⌮8 &0W0"! 8 S 8  oW 8S S 8;SR 8S S P 8S S 8S 8;S`:: -(8LR@`(8R p-PLN`@q2P4Q phGp -LQ@ 08Py40Py J G hC$ -LPp`d@P 㺐p0S  0S 3 #0S R@:0S  -LpP័`㜐@@D@ߑT8S hב 0-LPr@P <0p0偐000đ 0d #=CH00+: p-@LP! ,\02 8  PDα <ʱY`808ph蕑_*r* p-L@`1PPT>0T>   ''[8p p p p-L@`PPT>0T>  p 0-@PL|#-[0t1tP ]0hF0#  hy p-08D!D1L@(88!81(8 (1Q( 1@(0 1Q0`0 >BCyPP# |8 p0`B 2y0P0P2  8  p3h  ph-XXPLDP))))d($)Lt*$)):x]9 ; 0-H/0L000000/0P  x8 00000S /000000001|(  A? ` 00000000 P  S"[ 0<0 p-L`pPp1GT@X)1@$R@ p0R@8SFF x(x10S: :  4)@R :0RE @x 7$ /0/0@@ @@)@@0SS S S@@/0A? @@ 1 S@@|8   P@@p @@@@@ 0'  Pxx @;P@ -LM\0p-4K , 80 Z4PK`Y @'0' <0 P/ T [P , 0Ra(KX@8KrP*x80x8  [@TN 8KcP/08 48KUP T1@!P@T P08PB<峫8@ 9  0`3!⦫ -'➫8 %<嘫 !⓫xXh @ P\|8KP <倫8 4xej;,;D;t;;;(:;;0]9; -6LP@hx80x8p@s [Y1N08 !'pY Y8Sx8 m'00'049 :0@;Y @@- )>0303x8 03x8      6/A ?0/ ?0/@!|8  00x800N@p }=(:00:, + 4x6 |8  0r00 ⢰8cq  WYN@0> >t<!0x,|<I6 ; -L$M␃6 p$  x8tt# l8.t8^Sx8P0x88@S~ P`GS08>U@ S8PSPV 0RU`@V(  Hp2x8 0108(R7   /8Sx8  49S&^Pp(0S  Т0p80Cp8ɢt80t8b$ 0RV K p8  DK`P p 0KQp$@U|0@$@E`P\  7 S1 0K $0RS1\ s}46\ 1' R! P:xe;L;;H]9 -8v^p`LpP`Vo`/1G*T@ x8 0  8p RhQG8 p` -L@ hG p-LP<`w@P =0S8;S08P@n ph' -p(L@'8 Sx8>00p(.x8>6 . x8XX  P8(0(00 (00t8hk;L;$; -0( @RppTLP`> T3 T 00SX Ӌ p@tPU. Nj000 0PS S R  'PJRM 00S`)l)L)L)W 0S008SX EPPX X 'LW[[ GW082S  R RR 'Kp34 DP'<p3|o]9Xd -8LS`p 0 XH000勌@@PဌU8SS@@PP [[ VH2S  Q0׈8SP 0.RP P PP 0.R 0.R 0.R<^9 R% 0S 0 $(, <4!4"<#Q#:Q@Q`Q Q0 0@S QQQ8S S x p0  08#Ƞ;8#Ƞ,40x00S 000C0@- 0000t 0l 2@ 0 0220 0 " 0\#40@]9*00 40 x R 0   .0 0.0C 0@-800p30C0"\"h"D@P` 0-|8L P@+  0 0S$0 R  s> 0S%@0!0 |0SxP@P10|P @0u0S 0 0S0 R40  0000d p--0P` 0 @ 0 #4AL0  U\\  0#40 ", 0#80 "$ 0A-000p<>8 0-20P0 @P@D@L kU0 p-$1L R> 0C0S0S2Q` R 0S0qS R0Pf  00 0 00@0@0SX0 R00H0@ %Up`0` (40,$ 0-0P0@PT@#@L U0 0-0@0@ LPT0 p-8L`#X@P   ;0 B 0P1 Tp -(Lp"hPP @  K0 B  0`T  T -(L"HkP  0 0 K -(L"HYP  0 0 K -LhHGPP&$x 0 $L&  p@帀 -LMSPp" +@Kp tT0 0  kT00CS ** *************.@K QT@00P@ `6?J&40`P0`T]Z&40`|&40`A  04"#400<00Pa|8 R(K00P @`  T00@`  S00 (@"h  S08#h&4  0`@0P`  S00`P  S08  #hP00P00P{ S? S0C0P 0 0S  SP S08  #hPw S00 (P"hi]9]98;T; -"0L@M+pK0`P 8S S00  0d0C0]9 0-00@0PL00C0d0C00 p-@ TL`PP T000p; .1ph;t; p-0L` P@P 00P  0#40 b p -L hP @P&x 0 .0"(0CT0;8#("4@& 0p 00b0 0 -L h@ PP&x 0!0 &W(0C0"hpp 8# #80   00b0 0A Y.038# #80% 5C40 -0L `LpP( @Q" e0 f0!0C0 03008##80’2 C40  0#40 b -R0 R S * S *SNȠN4 Ƞ,Ƞ0  @0!0 7Sȧ@10̧(0 6($K8S  PR 0"A笠p` pPt0 80d 'V 6 @0 @   P f^9_9;; -LM@ P 0iSS2 0 S@P>0>! 6K  N pP>0> x8! 2S3"[R>0> T4W ]00@(K00StP*(*P*(*08x(I0@0 P0`U  ```"[  @P>0> @0PS00`7 < "!0< S2 08# < 21C0b10"R`08#< 0<<0021  ,2  "[2R P < @ 1 "!8S} *** ***X*ptP&pPM 08puP00  3N' /N0K +Nx8  1  0@008S pT00' N0K  N  N00  N0K  N' M P0@0p+x*000mWa8 >0> ꈎf; -`LAAP@Pp Q22P PS 0iSSOpW0 |8  0S 㲁Q kPP 1 01#8P!1R1@10!PRA@@10A! !/00@ 0@ 0 0@0@6   0m7P; -LMpQ@P 㐁000ӂ@UG ڰUJ PU| Ug >P0>U  U 0U("(`P U9 UH( 0`P> P0>U `P 0 {PPXE`PH((8"(#8Y`P 8S ("(;`P 6 !`0 8x("(`P 6 !M0 80`P  ;L;; -LM8SS, 2p1S5  0@,Hp` 0@P DP`  0@  #Dp0>$K, h1S* 048#8 (0 >0>,0 8 P8  0@,Hp` 0@  PD`p 0@P #D p<P`0@!(#Lp4,0 (@hl! ,@0p1 8 R 1S>P0>F E0@$@Ap`D0@#D <P`C B0@!(#Lp4  $KkP -LM8SS0S (K  0@pH,` P0@00 ,@ 0PK` 0@  D` 0@ P #D p< P`0@!(#Lp\!4pR >0>`1SZP>0>p0   00C8#8S0 \ 00006 ! ,80 ;x; -L,M8S8 $K  0@,Hp` 0@P D0P`  p 0@ L#D(0>8 \1S*80 H P>H0>8@ H vP4 H(  04Sa b04S 044.J@"!Bb>00.D 00 , D dI8 ,@0h9l@H0l9F E0@$@4`D0@Ap#DPC 4 p0> 048#8 H0 L0 QPa b0cP4epX:d d`0X8 %< % *0PpX`*: 0X&:0SR+@K I P0S0>x\1S:<Qq L I<04  0Rh00X @0 "X` dIL0lh900l9F E0@$@`D0@ApPLC #Dp<P`(B0@!(X D#Lp4  tx)40p9<@4 xI L@ PD 8PUh 0S 00L 0  0 $("H0D8S21Cqpc>00 00  dIL`1l h9  8` 0@$P`D`P \` @P``0K8P 0@D@8#D<P`  D  0@D@!( #L4P`  p)8` |p I L0 PH  8SBL|200S|2;  0@p,H`P 0@pDP0  p` @P h@ dP ,hP$$0@`P H#H$8!,pL`@0\1`A& d0 L,uaL 02 ' !-$8 0^9;x; -LM8`SSP0S K/pP>0>E1 S p ^O | yH P' 0008S|200S|2 6 0S00Khp02!Ι L80@Qp 0Kha;x; -LMhJ 8S, DJ, 0R(Kd1S8  0@,Hp` 0@PD0P`p  0@ L#D <P`0@(!(D#L`!p4Rp: >0>\1S*<9   @C P0΃! lPKK1> P p@kP  @>0>@ G48#8Z0 P a b0cP4epX:d d`0X: S 0PpX+: `0X&:00S0S^ PP Ro@K G P0SP  S7 P xQD R 0S>  Q 1S `@2 tQ  0R  00 0    dP^  K/P 0S  0S8[S ? !  0@p,H`P 0@pDP0  `p 0@ L#D <P`0@(!(D#Lp4 0\`!d1& l \ş8T 0 PPk _  04S#  | P r@K F P0S0SP @@T@T@ PP K0Sp F E0@$@Ap`D0@ P #D<P`C B0@!(#Lp4p^O 1q匁|1PQ F  Px3#  `VX  0R@@"!Bb>00 0  dI0l)h900l9F E0@$@`D0@ApPL #D<P`C B0@(!(pD#L4 tx) p)0@ F  P@PU\ `0S90 $("H0D8S021Cqpc>00 0 kdI1l h9  0@`$P`P ` @P`0KP 0@L#D<P`  0@(!(D #L4P`  p)` |pE  P@h 000  L0  Q|200S|2r02lxe^9\^9;x;^9 -LPMtPPP, `@p00CS, 0R2(K!00 0CτlK1.KPV`P>0>00`@ \EtQ 0 R 00 0m`巠 aP6y ᴖ$8 07xex^9;x; -LM P` 0@lHP 0@p PD0p ` 0@ P`80 4@ 4`L8!D<`P0@ H#H$8p!,\1S  >0>(K`1Sa b0cP4epY;:d d`0Y40% l`KPP t6Etx 0  0@,Hp` 0@PD`0  Pp 0@ L#D(0>Ox t0Ko  CRt L80 <xx \1S>:4xe^9;x;^9 -P0o0@0@pL0P 0 0@0@WM i0bS 0bSB0S>0>0SA SC  048#80\a0b $("(c Q00\0S 048#H 0B8S0SS#R 0Q' 4'  4 8  czpP>0>0S0S1S 0SRapP   0S   f~  z v r n -"0LM'`K0p?0P0@ C B 00 0C 0 "40040 "880 "4<0 !D  B^9 -"0LM@'pK070P0 `0B B00  B^9 -"0pLM0 0'PK00`@ \B B00 @  1S0000 B ^9 p-@ TL`8PP T0 00p; W1phd; -L`p P PZ @2 01\B! XBP0  00S00 00$(SS"(08#( 1S{ 0S08#(u "40 0@ C Cq0CB#4Ac B a0b  4\v7Q: kpPPM /00@ 0@J w0S10#$ @ ⊻0S  0 48#800 0 7$v d Q!1R@10!PR㬁@10ఁ! !/7P10108#(ꈎ M-LM0, 8 #X40 0@ P( Z c @ ;8#(@#< 0 ,o1 0l!"8 0l!"4 0l lk14 0h!l"880h!l"4<0h! Z? 0@h1lA,@&,( ?$Kk400$D<@ #\#pT l#4<[@<8@ FEpDPCB040[A0!ʒ8 Q $K; -LM` pPL Pc c1 0`!"8 0`!"4 0` `_14 0\!`"880\!`"4<0\!!D 0S0 c 0 6 ?$Km!~ \80P 0#40  002<8#(#< $K;; -L M0 0S` 02="!Bbo0喎Sp 0 00  0 2P,  ,0Pc (W?0 @\1`A$< 0`!c@"8 0`!"4 0` `_14 0\!`"880\!`"4<0\! 0S\  10, "4F0E04D0 "88C0 "4"!Bb >S1 :!ő8 0H@ 0@ [(K 0#40  ,@0 02N=8Q#(@08#(#;; -LMP pP> `c xc1 0`!"8 0`!"4 0` `_14 0\!`"880\!`"4<0\!!D 0S c0  0 0& ? Kih!R @804 KJ@40;; -LM0 0S` 0pu0S^ S0 0S0    P l Pc  1CS br?W?0 @\1`A$< 0`!"8 0`!"4 0` `_14 0\!`"880\!`"4<0\!!D  < 00cS3 (0e)$ 0 0&  ?(Ko"!B10b>0!Ð8 0F@ 0@Y(K( r "4F0E0 4D0 "88C0 "4  >0cS  a` d 6 0$KmW!AP8 0@ %`8@40 $K;; -LM0 0SP 0\ R   pP \ `c 0w 0 C >  < 00cSF f 6)W? 0@\1`A$< 0`!"8 0`!"4 0` `_14 0\!`"880\!`"4<0\!!D  0 Ki!ȏh8 0XK@ 0@^ K0SSSX;; p-@LPdr0`S:S p0S1phsSND D0D 0< 0"n0 0C(8 0"2 * "*f*()Qx8x888x8x82 S-L -x8 6x8t 000 QL@  Q P0 R |8  x87x8x87x88S|83 0-=LS  21C! c.  @PP|8P]  >S  21C! c.  PPP^08S S S o0SoDo0S - L@ R' '  880C0C88 10P RZ 10P  R(  (  \8\80C0C\8\8 RZ -LM8  8s8pȰ 4 8 ? 00 [`p, ZVr Vo P\X00@  X0T @ V 80( 0, 0T , F \X 0P;  0T5 \08 8S= 00 S0 0F0Z[0[`٥ Y00[` 0 V0A 0Z\04 0R00 R0S, 0r0300 (K\ Q 0S\P0P  P\@ 5S40040 0 p- Q` `VLP0 0C0^S@0 0C0^S@Tt咾T`PP\䊾UDph腾V 8偾V@@$zTp@<;;@;u; -LMX`U@p弈 TCg*$h*h*h*f*U U:([0Ri6+ (5R'E@ 08F:;8p0\@)TUT5@0 @3x888%  5 0&x8 090EShi*hi*k*h*0ES@j*j*j*0j*x80x8 !; ';pሯ [;`4  UHk*k*xj*xj*dj*U U 0w! 8S S w S SpPA@P 00 0@P8q8S 0 9 R' '  880C0C88 10P RZ 10P+  R(  (  \8\80C0C\8\8W_ Wf00 0]6\!OP808M RZ0 0<W:00 018ux8, 00@ $8SX1Q @ x000 8l000 08'⎌8 Ho@PHP 0 R 00 0tp8000 8<<ս;;;j;;;;;;;XddD;p;0_9 -LMX ȠU@p.h, :U 8VS/ >0>8VSx8(Z4 6D8S808`>0`>8VS8S< 000 608  Ȑ000(8d^/  !ȗ \080iۋ 08ta P9pP  ''P:0 0  8p p MpP:(;0;X; -LM@480 0PpX 3S  21C0d1 0"iҐ 3S  cR@eV @h5S @h5@Pe0e T0@e@hYW0h5 -LMP@`$nV>04 @c4p  ' 0hZoꫪ -LMP@` n 0pS0C 0 S hEo?( 0c  ' 0x꣋. -p21C0g1@LMĒ o?X t0` %X 2XA0/:0O00 P̐p  8Qp* 0-LMT0@+;:0?"  7P 8h茐 p-@LPm2`0S2,0,  * phn -=pS  21CA@cPL` di8 l)h 孱 L@p ,|8  >S  21CA@c PP dY8 L@0h l9p 0   hzt* 0-LP2m@tn 0h- p-8LS@` p0S8P000P 000p 000p -LM8@Sx8 8S `P XU0S 2P wpP 0 p K8S 8 0<0hp@-P \S`0/ S0, S(p$ 00S 100 0P@J0Q@0SA PLZpV \0R*@p0 - @0 0000 L 0\ T)7P0PL @0Ba$!B30b0@/LP T耖C5010   [0 R!0S S01000 % !!00 p-0`00@L@LPP 0S S 0 [0Q *0 QR 20a0#20p -RL pP@pPT @t&  P E` -LM4@ ,Kt 0@ @ PK{*D_9 -L M0@ (KJ 0 @PK{*g9D  tQ 0 S"0!B D_9-<JQ !0 S0g90@-@ !X 0lS  1\0}>EN-E8 BS(00"S: 2 1C00 2 1C00d9GD  tQ 0 S"0!B D_9 P0 \ ; p-`PL @HSTP4M@T(phH FPphAH ;4v;P:\;@ ; -@PL D581,-$0 h%L ;X ;d ;p ; -LMH@0P`48 0 P 0<p<Q 8\@T@`D @D$K( ; ; ; ; ; ; ; ; ; ; -L㘘@0ҸT   ~ȸ0 ;|*H ; -LM 0,0 $P3 p0@ 00@ :Kc6=2K00<0<Po:00 P4KR6 N6 J60 < K;0K1<1< K 0, 0R(K契xeXdPi9 -LM$@ , D P6  p  D1@(0@ :K60P2K`00 P`4K6  6@ 5D 50 < K;0K1<1< K 0, 0R(K RxeXd`i9 -LXM4PK`p@ A@T@0 40K0` BK3K姚PP 408 0B S800 RD W$KQ x@KD  0 t0 0 p 0l n ՛ p-PL 0`P t0@T@T D1S1 00  Pppp@d 0-LHM@T$ 80S0Q 0S XPKD  0T0  L <0n SD0兛K0   400404\ ; -0LTM0p,0 `04"48#88#( BRp0  , 0R(K 0h TK d0 5PKd 5P TQH 0 R<0@\ ` \ <@ X@ P 0X0SG PPSF X T@(R@@0 PG YD 0PUA  R<0S L@KPK 0`((K000 0c0 0&@T 00S1#0`AqpV `V 0 R4S  p3R Q$00CS̞*؞*؞**؞*000l000& 0SB 000[000& 0S0R 0S QQ 0 R(0 0P P 0 R 0RP| ( 000$0Sy s:Sq0$0n0R 0S QQ 0 R(0 0PW PT 0 R 0RPJ ( 000$ RB02&> 0$0; 0 P07 0 0R+@T+ @T( 0 R(0S0`4S2 $` 0(`(0S3@$@0 `0(@0(0$0%000,0 R`igfff\i0S S  P0 0 BQ0S 0`000 RP0S1 Q p-L$M0`0C S @0  0R KpqPP 0 (0 , K+K< KPb R000 0 0 Zc68KAxe2i i9 -L$M\`0Q$0 P Q 0 R 0@RQ0001S@$ 0R. K06 :KpP  0 000004K-D KpP@a0S 0  0 00 0p`b6J@xe1i i9 -L@7L0Q 0Q 0D!P,0( 0StBj -0PLC 6p<0\`L0`@T- D0@T( 6<0\LD1 S^V0W  ߕ0 00&  ԕP 000W  ȕ000tBj 0-<0\PL  0@LP 0D0P D1^6 L0R0 0\<00 R U 0P 㐕P0000tBj 0- @PLIr0 R404 <040 0 40 hP 0h00 00hڐtBj -LP T @0ST -LM8Ÿp D0 , ``DQ_ "000040`8@1@<Q pQ'_@,bf`@,6X  p@#6O _j -(L"h @(P"x>,<4  4&$%<'$!8("8 0 01@T%@T" l0 (0U3S3S80 SZ0S R000 R 0@@ -LM(@"xPPŸ0  ,<'4(!"40 <0 001`UP P @V,@ @"`V l0  3S3S, P0S 0S$0S(0S安Y?, P 0 ! <(4"40 !<0 0 01`@V(K3S `V l0  3S,, P0S 0S$0S(0SmY0S R000 R 0``@k -LP@("h!xL0  ,<4 ,4&$ <'$!8("8 0 01@T+@T( l0   rP3S3S,  fPZ0S R000 R 0@@ -LM(@"(0  h p, 04&48#8 0APT 08 40 @TL ؈U3SE l0  ,0S00S` 0S0S0S 0Sf , P0S^ 0S[$0SX(0SU0S<0S90S6 0S3Z 0 4ZZS 4 8@ @T8(Kl0,(0S Y Y30S80S , R ,Q80YS, R 40S80S0S0S0S 0S 0S0S0S  Pe30 Sa8@ 0S -LZ R 0 0 0 #04"48 #Ȁ  1S0 0 0  0 0  04!48#(  0!0Q 0000l  | 0(@@$cSp04%4, $&8,$#8!8$,000Q 0(@@$cSpӇ04%4, $&8,$#8!8$,000!0(@@$cSp嵇04,%4 $&8,$#8!8$,000(@0@$sS`嘇04%4,' $8,$#8!8$,0001` `o2[(@cSpx04%4, $&8,$#8!8$,000!R  (@cSpZ04%4, $&8,$#8!8$,000!(@cSp>04,%4 $&8,$#8!8$,000(@ -@HLP 0H0 0-@HLP 40!80S0C8080H0HP$p@0 Q Q H0(P 0QTP0L 8RH00S 0S$0S(0S X0 Q0P 0L0,7H0A p-@P` PL100P30800p -LP QpI P@ 409@80S0C80R00T0 0 0@0  P <0S 6@P 80@0yoP0 P@0P100 0\@<0SS `V DAdT P P 0 RĈ100rotBj -LLMH@PT p``KHpD40P 00 \ 00X0  T <04 袔40ᗈKn 0削 p-L@` 0 \ P@ @w00@30(00pphS -@@00LPHPdl0  凎YX R 0 0 0 R000  R0 000 0 Yh>j -@0L @Q0(0 Q803@0 h9 -LM@p P@0`<\00 3 R 3SA80S>? 40 ^E 0PS5岐0S P 0 l Y0801 0 4)4 S*RGPq1S@40 bP @0 00 080ᾓ(K04  00#0l0H  !GP@xBϠt, `PUPE.10C8#8S1}, Sz: 0A3P04$484# 80P P0S P10  t1t!08#8,0 ,!XJ,@^9PUPE108#8X1,, R): 0AP04$484# 80Pm@ 0RPO @0!QJ 0a긁긁(Ko[S000 @Xk ftBj>jddػdܻd -L M@0P 0` RG l0 J 0S&0S/"\! `1Q 0S<00 s 0&,80S/  p80@0@P0 K180S Q0h!1P 0800(0`cSL0S0ha@@ 0 KH@spP 80S 0 P1 tBj k ; -LM(C^  ӜP7  2 @ h!0$10qV, R000 03 $#$0("ȃ  10S!0 0 0 #@D"DH$H00 1 (Pcpԃ $<&$ 4(!4"H%<@ @@1S0 (@cSp廃04%4, $&8,$#8!8$,000!(@cSp埃04%4,& $8,$#8$,!8000(@sS`儃04%4, $'8,$#8$,!80001``,W 0 Q<l0(K40 o009d>j k ; p-@``LP 0rYP  0jYP  apVT ; ; -L@Qp `V @TX@0S 0S@U l0P (0V -L M⌠P@8K0`pd ( 0P00P0#S ( 0R$K{|xej9i9 -L`M \,  0 \ Ÿ, 0R(K|K ]/0 (K!0 0a T0c1\Tp q@@ R |K1S q w Tp Rq w Ypw YpZKZK`,K 0S WX `V00P0#S w WV4 @T*:0V0/ |KPd0>00>0p 000U0S 0("(04"40 ;R!@` ^<@j ; ; -LM@P  =P h! --L\Mx0p,0  0p0 @04"48#XdU <&000, 0R(K 0$U$Q  0P %000IpP%0000(S(e10  @AQ(*t******* **\***** 5 R 5 R1  0004 R U0000x0 14 R 4 R TD#U  10UR \PKLK/@l`K ) %0 HKK0Kk0K[0Kl@K\@KL@K XK  hKx0K0`(LK 0{xP 3 RiLK^T@ڴ000T****************T@1O#U0 0U R 00S 0)SCU00Us000T@|2 R1 Y0013000tK 0 00Pt @@@@1 (0~xPvU500 5<@K v0 ;0K< K0s S80  080 Q FeP 00\  0S 063 LP0  0pP000  001 : Kph4p0uh0`N ;Cj ;Ajd\ <00<0 00pᗻW7/ <00<0202%|Bj\i -L8MQ 0, T X `P0  H KH`P P 001P0 0< 0Su DK@` cXD K`  P\ 40  0R 80S0C80000 0 00(  \ q \ \ L (19C8# ("(8S 0 Ӵ (B(R bA9C08#8(R00Ӱ0Ѡ =0 0S01AS0#!8#(B8 CP&8!̱P ü&,0 0 20dkBN|1S(  S < t0b? S Q Q c|0@ P1Pp0P 20Sp P(0p S1*(0P!̿d -L,MY0@S5 S Q/ ݵ/(K(0 40 H <0 <0*0S`` P PPɵpP7 PDP D T08 # R; *1 ᯵7 (4 H < 0 0 (0 ᢨY0S S  @ ` P0 , 8  <(4"4!<0D  <4("4!<,0 0 0 D ("(04"4000 ,:8#40* 00S <# <4!4"<0: 3 #0T0 <(4"4!<0P <4("4!<0Y Rx R4@0a8#8#!<< !8#800brEY 0S|RK R4 @0b8#8 $#$(0"0"(`0!0 Y Rf R/H Q<F@0 H  0z `@  y@ |t@ 005(P0<@@0 `= >0?@0 , 80 =^400q  x0 0 Y Y 40 c("(04"40Y `\0P0x 0 05()* 0@ 0 , 8 7+,1 < 0S;0H P\i d|dd -@Q`RLMQp % 02K R RP VPU00U0SRF R R @00`eV00S RU 0BP U 00 <( 4"4!<0  <(4"4!<0 0 6S-t0 ca? 0@X1A PFp0P0BPd @0 0@0d (K1|2H |2R(K  P! 0 0$ 0 P $ '{pP| X У ṭ0 Z 娀0\0g  Y10 0a aS0SD0Dp0P0P!= SB `0`S% 000  ! @P }d @0 0@0d P0@cP !}0q [0 20   0 p0R0P000:0:TP!Xy ᏰTdkԿd kd -|`崒LP@P |! 0P0"!U00d Un 101 < LP  yh`h``h` 0   (0 p?  R 0S0s4 0S0S 0s* R  0S0S0S 0S 00 40000O0@0@eƩh``e h` 0S T10cS`!0bSAڈP  `1R 0R 0R6 S &02 &'  = #P 00 0L R |0@  @|1Sd SP9A h@@ 0R0%p :W PPE UP  @@ 0S PP  9R      <(4"4!< 0  <4("4!<|0 00 0 00(0IPU R 0S:D R  \ 00@0 P1 #  @ 0< 0\41ʴ@T 0K0( 0 PlP |Q PǟX!0 b0b S0| |0 \ P@P a1 n0dPR ?S0 0,1(1\ \ \} Q 0T!R 00bSz0c^0ڼP !R 0B" “ N1ǁ h0^ 0O0@0@00 0h `nh` 1^0n Σ 1DZǡ0h` h`6VSʨ@ 00c0a0PU0U00L0O0@0@ RP 0R P U[t0 0t0P  00cS(10cS$ U = @ 0(xOPHKd`KQ Q 1P0P 1 h0(@|4$ 0 ?008yP70S @0PP0S*Q  T10bS00dSڨ@X1990l0 lK  Q101P 00cS10cST  t0KůP t@ 0R0%p D*G|0 @Pt0PP th0O0@0@t0; 0@@K H@KG0K*0\K d@KKc0K @FK0 ^  ^ ( Jh F00 0 RC024A@T9 \ 1@TH 0RN 0#3Rʰ@P HKK 0@Pps 0@H0KG K D d0KKcK0`0 K  `0Adkxedkd j9;@kPPPd#kdkd kddk#kH?kd<ؿdP T!00bS 0 @PR00U0S$ Q0SP `10cS 0\1Հ T!h`V'P 00cS0nS 1S:6S P (PRPU (|!PQ U 00lS0N00[(@6S7 1Ũt0 U@At@ 0 0bS000= "0<"? 08N@t0`0`SS1R!P1Q!781S 1'0 1h0@S6@0L0  ZB  P 6 Sʤ@4#00S^PQh` VhPe7PZ 8C(RT R ʤ=t 000t8C80CSB<{+xz+,{+xz+xz+z+Tz+T 0bS R 0bSQ0Qh0S 0 0R@P0U000H0^0 Hጅ t0Ńt4P3CCN0 |1S S  @hA <5@5t 0S x@ PV&T5P3CNȻ 06 0 ( 0 H 0 00n6 HP )0 00cS@h` h`@6S  " S ʨ0lS|ڨ&6S$! 1S !10cS000`l/0 P  |0S-08\ @ <10cS,l 1S  40d'@0?0M A$1T'P1#0Q  !S | R l0  HP 0 9x@ V*0bո@? 0 t 0p!0bStŨh1Vha 0 0bS 60CS񟗀@++y+|x+̉+68C( R0@S0S ᵤh0K @t0tP 劙 t写 0>HK 0PhHK 0PP u p 0DPo v &(@t0t00006@C2  a f00 cR 0\JTT10P\1000! 06*@0*?08Lt0`0`SS1R!P1Q!P1 00C0[\!0$0bST{h/0  0@hA ;Ya@dd _@P`@Ph`  P >)P 0@ ^2 ^ ⱘP101[h`V  0R H1 0c0cS000K 00cS 00C0b0SH00@00/L10L1h`8#P 0 0 Xh`}@ c?KP 0R^  P0n aS0V0000 @@h0|OP0@U0@| | R l0  HP 0 vt8> R  X< 19 0S6 63 t@0 @0S |0S P,!S0b.S:h (10(1 < @t0ătrt ,?0Sto lRmt`? R  X^ 1[ 0SX 6U th0P@@h|/0 U @ | | R l0  HP 0 .v0  t0ăt" t0t t0ăt0tt Q f ⭶@0f 0Su 5t ,K0@"Ấr5 ,A(Ae0 0R0 |0S~8\   <10cSxl$ 0Pc/00 S | R l0  HP 0 u@Qt 0p!0bStŨh1UhQe0 1R& P40h#0?0J ? 0  t0ătvt0t0S t0o@J2t JŸc ҷ%h"c fJt0Ńt 0S9 @T*Pf 2P3CeJT P b 1P3CUJ T 0  t!t0 ?0 P@J0 @F 0<00 f  @!608#868C8S ڨ  1'0 1oP0 GP!3P$1PI8a0'0 !<\0 0@\0`@<J$!0, 0cS P#kd<#kdkd -L -0-0L@08C8A9Q/h1 !S0 Q xQx<0 / I&8 S0Һ6 uBd< ; -L`Mt |0`U@t tPhUtPf -400`S:70 10 0h0 5t0VtPr 0\ P1P!R,nx Ux0xSP"P3 ! 13^hhX0W0U1!X x0d d @ 0\b0c3QX` . X hPt0 \:0 t0|1S Sd S .0t0 t(K1Sh r0SH1X:S0!0bS`Q Q(; 0b` R0a0aSTt 00aS  0Q ^ 040@ t Hx ^hhX|UyH40 @ Voj p aX pʃd XXp I r0 S X RW0!0bSp0ODH0@P)H0L@D}pP ,IX00S; 㝢1 0X0 0ᑠX0X0x u 00 0x 0S0 (p  h(t00t0DpP HHX00S 0X0 0X0 00 x0S 嵔x0 P @B t0 1R B X40 <(4"4!<0p <4("4!<\00 0`#P7P` 1Q!0\ a6`2 S 0S0S"("(\0 04"48#800 cQ0ՠ0 ڔ& 0Q 1("(" 0 0202r R 40 1 0cS!! 0|0 ( |1S S S  ("(04"40| x00| q005|@ 0R+ 00H l @t tQ*l1lX\l@0\0@0tP 00 0tPP  10cS0P`!tPdQQ 0 S   4X0|0 T ,< $8 #$,,p.T0K,A  l4TK 0T| p ,8d00d0$ğh00h0t0Vh tP    Ut0 PtP 1 0cS 81!S3 <8!0000@N 0RJ h#0?0 G40? GF;0@(0C8#,("(#80 0Pl 0|k2|0H 0PPet L0 p TKWp 0#10 " 0t0FRx 0;P[{7 t 1@0S0KT@K 04 4TK(K 0`)@:tP ' T#R1p < 4("4! 1|< ,|1S' |8 $|( K\0 :0X! 0RKph0XwPT 00|, | Jkxe8k#kTkk9 p-LD@P`P00T00S 40php -D@LPpT Pg 40 X0 00h0W0vP 7S -@ML0  0 @ @Kp+49#k -L,M4pQ, @` , 0R(K0S PPQ 0@SŸ5P: PŸ0 P- U V) 001L0 @ L 0t Pn @0@S D^ < ,$ !$0,0cS10cS 01 RV @ 0@PH DY <,$!$0$L0cS10cS`F0l $#$("(RD }* ch1DQ2*t05t0 p10dSmpA0^/t10 00bsI0 R\ 3PAP @PV<@K. P0r0j0r0p04h0a P * 8(C89H C1S01P:000<00fdkBd#k,d 0-@LXt0P0t070h -L4M`0`(0 Ct# |^ p!0 RJ70cS608#8(R62 &$  $ 0S8<Ca( 0R$Kr(0-0(00 t1C1 S01("(8C8S&ƱS0ü6,"0?0?2 R$ |@T! 6Sں6Q@0 R RP 40 X0 |1S (=PP X0S L6Qʰ0 G P!P 8QkPV$1 A@10@1|-0100tL [5t0K^?0 4KLK(0TK<0 8@KVㄋ|0 80K7 K(0`40 (0P[<C0X0xedkNBdT0 p-|0L@P@`P 0`V GPDph薩T0 Q`(!10bQ 0 0`V`!p4d8dd 0-|0L@@P厩P l0GD 0S 0he40 \! 0 `\!00dd -LM⬢pW`, P P0SR@ Q㖟K"! * @P 0S:QR K /ع@PW2[S S) @, 0R[(K W2[\ SF S  KPP <KL0KW X DP @0 5 <K 0)P  VKLK0)@P @\X# @ 0  0X0 T0 \/ @ 1T0 @ 1X0  KPP T1崾B W[0Q00 Q 0S 0S$0S(0S$ 8Pl0  0S  0S$0S(0S9P nl0@<4,80)0P00z[@>PUo3l(0SJ@>P !PPTᨽPO 0mql0 (0(0  w x =dd$$kh;9,d|d -QLM 0S K0S0S P0@ SAP T \  0 0HP30P @0S   0B 0s;0S R00d00dSP U 5PU l0  "A@(AT PUm @0 ^l0 #0RQ ,0S00S40S80S0S 0S$0S(0SY; ($0M@P4 \ l 30S@0   h K>V l 30S@0   hK 0N@HK h0/PRhPO 00 00h0 @0  YK ^ l 30S@0   h Kv>V l 20S@0    hK0M@HK h0P @Gl:@HKH@KGKdKK 0D0 ׁd@KcKK0`0 , 㯁PAa0000 㣁P5#0R1]0S  05@ (@  0\@P}> $00"!Q$00* ( +PUm000! 000Q!  0 98 R 0R( R 0R( h%P@˜BJK00000 0#kxe;$$kʚ;k9 -LR0傼d$$k-Q@P P*R 000P 0V!@$kd -LMP)0Kp @ឍ)0[ !#R)K R 2 (0/0(0(K%aVT 5,  , 001S %1S T5,  , 0701S1S1S ,1S Q ( ͐Pk$700001S41S81S 0SN S 0SD S00S S000(1S 1S  ᛐP @ @ 0 000 ("(04"4#0庐(1 0 ! 04 40)[Z Z ៍x#(0/0(0l00S 00S0 0 0``000I(0C8#8 $#$("<8"( #8"000 0B 0)@[T T` b"(0/0(0/ 00S St) +0Kⱌ@0+ K*K*0K  0*[48( <"4!<#,## 0000 1S S0 R0 0(0C@0@0@0 R00C@  00C@0@0@ 1 00K(`00,<$"*)0+ K00(0C@   00KH00,<$"*)0+ K 0嶐0+ K*K*0K1 *0[0 +0K1 0 + 04"48#89C40@$k|d -LMl4 8  +0K`+ ["2S S (00(0墌(K( 0P "2S S  _ 0PP`P + ["2S0 4* Ks0S000y 04 8<,<$"*4* KZ0SY )Y( 0S:Y )Y p 0S 653 R1 (=30 PU)PU& D10 R@T@T W 0S 0R Z 0S ~P$00$0w040`O0@Y0@ )YuPB8 R LP  0@ D0pR@ 1 00Sa@`10`@  @ 8固42@P `0Su 4 t 04 8<̠<Č,ʠ*K) K)K P>  048<!$!0!̠ 0)0[p:("#! !4!(0 Kp*K 0)0K  P  )0[R 0 0Q3K`P)000 00 0}iPt@gH00H0l 00 0000 @@F@$kt;d@dkhidiCj -\0LP1  0 ($ 00 0= d@$k --\0LM R1   00 0 d K 00 0d@$kG-@0 0P8< 0#40   0 ! 0 8<0# RM` ' s`BP0 .0.. " A1 "4 " "  " "0,`0 (V 0 Ѝ08 <0#40 (0, "V-00r`F0 0! #0 P0 .0.. "1 A "4 " " "0" 0 `# V  08 <0#40 (0, " V$$q001 !4 0# 0#(0# 0# # , 0 00 P.( 0. .A 1 ! 4 ( 0  .,00!80!$S!L`  [ꐓ99 -LdM`AT0 2P 0P0 0000 0@DU 0 N0Q 4, 0@P.,4P l $( 4 #l!<` 8 < p !Lp @ L ,!T P T `!a$|,.X |` l ap#Xh P ` qp !8 #4P!01@P@,Ġ Q H0 .P0DP !XPd 1hQx !|$D@1\P `Qa@ 0#pq "t  D@\0  H0@dP!x0At0 Qt`p "`!0',p !0p  "0# W,p  0v0(K萏9w9k9o9s9G-Mhp`@ h@$ P` L$`\,` , .\ p &`PX  ,$,X. .  lH$p th $d0i ̠x|P la !Q`#<`<4P, x0 ` *L#Ƞ0`!|@$0p $x@0P(@%P @,P0|`P#Tx0&D#d<0*!40 "0 #T4,  (8! pq "0. *@P 0p qS`A8` 0#!( !0  "0# l"p0tt唃l l@匓 la"< P !Q`p`T LDPp0`p!L##t0$`!t@0$X$d@ 0@l0@#D0*̠0 0T0l L0!D0, "0*Ƞ #夒  HP QP!$x`@P0Pp Lb@ "*0%PQ @@ a H儀 0# "X !  "0#x!| 0쁟쑟'x h@|P.<b0*( p `FA %40!!x!!,!P*? A10N@b@P, P0@ R?W@pG 0 ^?W@P0 W(K (Ko*v@, %v G,0!pc?WP -L,MT  1>?0@0c80 X1"0 @ D <0 08#8H L0 T^!\8 0!pT..l<@ #48 <, D[2K30KT80-KL[ C1PK4KP .KP /K0pKP4K  {U'DP  0#<0 "( 0#40  Q XKu, 0R(K-xed9< 0@-@0@ $0$ 0 0 0 #EgÉܺvT2 -LRM@ ` hKY```aD  h! \ DAhp\ 0"hQToD0#@ d0 `e[@̏J " 0%`0# ` flL i``  & 0$0#p苎dKp\ȅ0 0#X h 4D0`  n (T1 0,X0#pl1 fk{T1P  l1 'lˠPꪉ] 0. Th0#l1  `0 @  *g{ l1  @0<` !Pa n`PdL0%h` j0# 8nP 0 `ae[ #`L 0$` 0# X䝟0 hc;4p|0 Lq |Hp &ˎ }LdK0 p靊 0# pT PlP )fk` p|0, ,0# lˠ 'H |@PY 0.茊0#H@@|0nidIP0%0# l1  H0 g{ ( l1 a  !0`j` 8`|d`e[h0$ 0# АdKLa al͎ )0 0#  @0lc;`0 j0`p *` P X{` 0,pfi0#pH Plˠj[ &8@p 0 .gz "00'@  L0Z48y<0b-d1 LP0dLx n x0fk 0 ̀l1 d1l0g{P x雊0,0  X0 e[ 0  x lˠt a@ t艆X dʟ 00 @!@a@*L1idK 0L jȇ  ` 0 0t``al@qd n 0  h hYt  0P 0P P|g;@p <1  L1Xylˠ eZ @p  0 p T 0*fk jp g|ภ @P0 ਟ0 0 < e[꫎@   00 H1g{ 0 pmvmznܼNS @L❀fm 00@0#@D@H0g{  0  Pl PM舂0na0 P0#    P T0` 0fk00#̎00i$ 8Pl1 X0  P$0 PĐlq dK 0'b,p hQdp` P} 0P `p h 00lˠT1P $Z g{0q 隁 0ppfKXa0 $!@ 0 @@Pa018Ba  n @ 0@ a0g{ e[lp @  0@p`dI 00 0 nb)h0Hr `la p `0 01lip 0  la dKa pPcH0gy  `0`h P 0`l 0` P80hh  e[ 0P 0T P 0 g{XT˄  0 aP 0PP0a8@  0  hDL1fk e\ ᜐ@ 0@ 0h@ lˠ K Xp! `0 l! !0p l0e[p  ab*  pL0<` ༐  0` 0L!`dK 0}  Hࠕ00! b+ ! T1` ` 0e0i  0 `, 0``L0lʀg{Pp a  T P\vfl0   0p0p, pP0ig} @,1lA l1@Pn 1 @  Pfk @P@0H` 0Wl1 0P荁Pl1  00lˠP g{ 0 eZX0 pP `  %8Pj0$ 0#Wh0 PdKPHahnਐ0*0#  gT0 !P`Xj`@pì 0. 0#  (xT1 %`pmnpX` a0,0# @ @lL0 &pe[zlˠ dK 0  0# fk '88 h0  (` T j0$ 0#a`0g{dKHP0* 0# h )@Y@0 P i `LP !lɀ` Y0jfj 0. P 0# &PnPP ` 0,a0#@@ d0yflˠ ``dLp 0 0#]jX1 %pp`gz` `L꩎0$  'e[ 0#` H0d g{p dK0pin0* &0# P1h fk (  ሀ hpPj ̀ 0. 0# !0hq 0`[\b,0b;(! 0`Xq n0,lˠ@ a{  0#T@I`!  0P!` ꪎP$0 P% 0: HQ 0 (夀,`L;] 0p0Da % 0dc (K -0Q^q?`p@PfUpLpV@@Z* Q :@ @0Z* Q* ao@  @@Z`* -L,M01>?0@0c80 \1T 08<0 0!D @0 ^.L H0 T0#\pT<!!l##4<30K, 80D[@0-KL[80 .K2K8T N1PK4KP /K0pKP P4K  U'DP  0#<0 "( 0#40  Q\ `m, 0R(K%xedē9< 0@-@0@ $0$ 0 0 0 #EgÉܺvT2 -/LaM0 @ lK,0 m1Ahp PaA ad`lnDi4 i80|/0%1  d0 ac 00#l1 p `0(p0 nd-c Hc1@l ` 0(T` 0\,@1 P\0P Q\clD0%X0H@aqbacT\Οc< Ȑ X0' &@0 P,1 T0Q T "aDc, 0% P0H͌@`lcTc< 0* (0X A1 L0 PLx  "d Qc,lDnad<͟H0% &@ H0  "aq@cTcQ? `P0`?SpP`0L`@  go5g@@pb /g y?0YP@p q?0Y@P 0 -L M0`P(0 p0K  !62 b1 R<0Q0^ ~?@ Q R W 1  !1Pkf( 0R$K xe;99G-}1Ab_`>q弁^fAa0@408@f^P`P`,P0`- $( p!j?p(P`Pb?`0  . 818<4!,00 @$! p$(P,`0Q004@ݍ09 -pRLP`& @D1>0A W@;@ RpG`@D  Q*H0 0@WH0L@W耀cW.:P b@1@ T@D 9 `phP b@1 0S@DRH0 0@H0L@Pb@1 0S@DRH0 0@H0L@SH0 0@H0L@x -RL`p. @D1>?0A @c X2:PP wb@1@ @D  pj?X@<@H@ ?X@D @pXP Rb@1@ @D PEb@1@ @D 0-PPL 0@ 3bP-b@0@0D@H0L@09 -0L@$M80 4@ < @L H <HH8 4 @ p ` P8K 衟 80K @ 0!D#L"$4%T'\1t0 , &dp xAP H 0KL0` ੡@ 1L N@D@ 00K @ 0!H#HD8%X"('X<x&h0@ @DH0L@" 0 pPP0P<0PP <~a<H00@<@P`P`(KoPPp`a<@pPPa0P0< `PPa -PLM, 0 . U00@P0` 0 @ $#4!,<p,0$Dh@d0dP`` 0@(#8!(8$HP`0^``0(Ko` -PLM, 0 . 00@P0` 0 @ $#4!,<p,0$Dh@d0dP`` 0@(#8!(8$HP`@^``0(Ko` 0-PPL 0@ `P`@0@0D@H0L@0谖9 -PLM`( M 1A@pt1 lA0@$#4!,<$DH1@A <1 4A 0 @q(#8!(~8$H? ⨁@D( 0 8PP0)?PP@+8`@00@0c8( 4<"$$ (  Qo"`P@8`0P0P@8``P@@`` 0-PPL ( x`P@r`@0@0D@09G-: @M;0@$P$8$0$$ Q|4q aP,. .`.8.\0.$ a04p Q,@$ @$`$8$\0$$ a3p Q,. .`.8.\0.$ a3p Q,@$ @$`$8$\0$$ ad3p Q,. .`.8.\0.$ a 3p Q,@$ @$`$8$\0$$ a2p Q,. .`.8.\0.$ a2p Q,@$ @$`$8$\0$$ aT2p Q,. .`.8.\0.$ a2p Q,@$ @$`$8$\0$$ a1p Q,. .`.8.\0.$ a1p Q,@$ @$`$8$\0$$ aD1p Q,. .`.8.\0.$ a1p Q,@$ @$`$8$\0$$ a0p Q,. .`.8.\0.$ a0ql A=P0,@$ @$.@Ѝ  $(,048<DG-4@ M;0@$P$8$0$$ QqA= aP,. .`.8.\0.$ a04p Q,@$ @$`$8$\0$$ a3p Q,. .`.8.\0.$ a3p Q,@$ @$`$8$\0$$ ad3p Q,. .`.8.\0.$ a 3p Q,@$ @$`$8$\0$$ a2p Q,. .`.8.\0.$ a2p Q,@$ @$`$8$\0$$ aT2p Q,. .`.8.\0.$ a2p Q,@$ @$`$8$\0$$ a1p Q,. .`.8.\0.$ a1p Q,@$ @$`$8$\0$$ aD1p Q,. .`.8.\0.$ a1p Q,@$ @$`$8$\0$$ a0p Q,. .`.80.\0.$a p0qP*0,@$ @$.@ЍD<840,($   - L 婺9H0@-@P!0 Q8 #Ƞ 0 ^D0 -L M((K0`"x0i@P 0 8#X "U 0AM00 2K40 @4pK70 40 0X5@P)4 0 8#X00 U0@X(K -LM((Kj"x  <0 @  j@P <@0 8#X "U 0A]@2K40 00 P }@ 4@ 0@v4K0 00 4@00@0`V 8 8 `5P4@ ^ @ 4@ 0@W4K0 00 4 0 8#h00 V0P800S80 4@(K p-LH`P0$H phJ (-"xL` @P08#XU@ (-"xL` @P08#XU@ -LMR`* p0K 0(8,< 0$4 00 , a00, p###Ġ""H"TZ0@P `(K -LMR`* p0K 0(8,< 0$4 00 , n00, p###Ġ""H"TZ0@P `(K -LMS`4 p0K0 0#0P 0(8,< 0$4 00 , 00, p###Ġ""H"TZ0@P `(K -L0CMS `B0K4 pb`B0K 0  (8,< 0$4 00 , 00, ###Ġ""H"T 0 @P 0 0#0Q0S`F0 8<, 0(4$ 0 ,0 00, ###Ġ""H"T0@P 0 0#0Q(KG-P0X\P@0T 0c|àE,80a5, ,E娕0q  A `&0`g`0D`&0& as1LE#8##0A5 nP%0H P%0e as1#A#̠ #ğ0@@$@a 0L@$0 as1#a#̠ #|ğ0`&```0P`&0& as1#4##0Q4 n@$0T @$0d as1#Q#̠ #ß0PP%Pa0XP%0 as1#a#̠ #xß0`&```0\`&0& as1#0##0A3 nP% 0` P%0e as1#A#̠ #Ÿ0@@$@a$0d@$0 as1#a#̠ #tŸ0`&```(0h`&0& as1#,##0Q2@$ n,l0 p$ 0cgqA!Q!1!ĠA 00#0` \`#U0 p0 0cr#xA" "lQ"40  .`40t .0. bs2##̠#(0Q1 A aP&8 x0P% 0c er#@"1"̠ A" 0 0#0a|< p# ` r x@"1l"̠"d@ 0#0l0`#&<&(&' 'Ƞ'p0 `X9X9X9X9G-0Pp8` <@ W0 tTᰕW< |0 0cr#E"805" "Ep1  .c80x .0n bs2<ş#A0# #$$ 0! @@$@b40t @$ b0$s2##̠#(0 Q4 .l0 p0p. 0c r#T"1"̠"|T 0#0l0P#, l0 e 0cr#8ğ"0A" "4$0  @@$@a(0h @$0$ bs2##̠#(0a3 a`%$0d `& b0s2S#|# #$tS 0! .a 0` .0n bs20ß#Q$# C#$ 0! PP%Pb0\ P%0% bs2##̠#(0 A2 l.0X .0 bs2Ÿ#Ax# #$l 0! @$@a@0T @$0d bs2,Ÿ#Q # #$ 0! PP%Pb0P P%0% bs2##̠#(0 1 l@$ 0L @$0 bs2#t# #$h 0!, a0H ,0l bs2(#Q# #$ 0!PP%Pb0D P%0% bs2###(0A0 n,0@, a0s1|@#( p #A#d 0! n < ( ,,H,T0 @PX9X9X9X9 - RLxM0 00@X0Lp ^ p0XL< 0^P`X L 0 XL8 0^X L 0 XPL4 0^X`L 0XL0 0\@\p \0L,(8( 0X0PP(($.8  .%<!...Gg0.,A.40 %.( %4,G0!,,, ,4l0a,( !q, %8!HgA0!!!!0$P!!4A0QT0 " "! "VA!< " ", H 8 D 4 @ 0 < \` ``` Vd<,,,,,,,,,,,,<,840P(\F($ 8 P, 0 l% (Ƞ $6$& *|aq !40` 0`0 5ap %D q%ȠPQ` P U*d*  0儀 P0!P "0%P@ pUqhE`QX APe " ` !0# ! "0#  ` Xw꤈,,,,h,,,, ,,,,,0,4t(,X*̠*(48t ğ0 (4P !Q*D40d t@x lP !Pq#@4(h8@`| ,p q`Q8` hP 40&\l`p  "#`d0ß!$D0&x`@ q aQhp@0#| ! " ! "T[3|#LX[ Q!M[al#d3A0  0# "! 0  \\ 0  0 0  \ ^\ 8KVXKVHKV(KL2"!M[X[T[aQ|2|" AHD\2T"! @aA<2<",Ƞ9P[ 0 0# "!@9[HD1!!aQ1! ,Ġ A 0  0# "! 0  SDpa(8l 0@0XHP(($.H1  .%<!... Aa0.,A.40 %.( %4,@0!,,, ,40a,( !q, %8!`A0!!!!0hP!!4A0Q<0 " "! "@PA!< " ", X 8 T 4 P 0 L OX9X9X9X9G-M 0dğ 0@R$2.  B$,,$ ,8 1, ..4 4<.ğ0#. 0#,? H0죟  ܣ))a.4??0.Ƞ1 0.L? R!?! ?@q !8A?d @?0! 1?Ð 0 7  0@ 0#@##a0$4??0$Ƞ1 0$? !R?@! ?q !8?d ?0!  F1?Ð 0   7   X) "0  , "",$" !!1"! 8!8#8 !0##  2# " 0Ѝx|))a.4??0.Ƞ1 0.L? R!?! ?@q !8A?d @?0! 1?Ð 0 7  0p@t0#@##a0$4??0$Ƞ1 0$? !R?@! ?q !8?d ?0!  F1?Ð 0   7  H X)t3333UUUUX9 -LMP`@p TDXHL\0K 0P ,@ 00 0p, P`#@#"#8"Ġ"0 (KG-M R? H0|t l))a.4??0.Ƞ1 0.L? R!?! ?@q !8A?d @?0! 1?Ð 0 7  0@ 0#@##a0$4??0$Ƞ1 0$? !R?@! ?q !8?d ?0!  F1?Ð 0   7  X)00 0 Ѝx|))a.4??0.Ƞ1 0.L? R!?! ?@q !8A?d @?0! 1?Ð 0 7  0p@t0#@##a0$4??0$Ƞ1 0$? !R?@! ?q !8?d ?0!  F1?Ð 0   7 H X)X90 Q9 0-<@LP TP@ 0T00Ldd -2LM @Rp`0  @P0ČȌ̌!2,2! ) !0 #,# ,!T"0  ! ""4!4<$"00#"0#  ,8#0 , ,!0)!S0 -ቝ4 4 40( ር)# 38 0(ˠ <0 80S)v0 p, @^ 0 (KT 0SQ0PM HdUUUUX9997 -L MP@`pP DHL.$ . . Ƞ,Ƞ  D,, ,4..D, @.$ @$.`0PK p@$,4  0 ,@  v 3 0,40!0 0##$ 4# ""# !"!!" ! 2!26:0#`p4 P!@!4 ! $ 0 (K3333UUUUp@-0` R" 0@Tڌ0 P 0 U 0S 00\P ppdddd - hL0@ 0h $%k -00L0 @00 @0@ 0h $%k -L M T P0@L 0H<@!+0 ,80@+K;$%k;p$k;(%k -PPLD h0SA Z1p\ a 10 ^ 0S 010  \00 P à$L ` 0 0@0@ PciZddd 0-@PL0@S 0$ & 00$%k, -@QL^ ppW`%P0S! 32C0f0 !   \P0@0଀ 0 000ഠ  @ dd -0`QL\PPU@pp0S 32C0d0 !   \ 0  ฀dd -LM⸡00 SP@ 1p`^1 @0S% 0"0 V U 010 R010 R Qt 32C0d10 R @ ^t`VX p(KV ^32C0d(K @ pP ,P0@`@00 000 ddd p-@LP0` RSpQ 0ES32C0dA1 R U 00  Q 0 S Q -pPPU( 00  Pdd 0-@PL <PQ 40,<0D'<Q>'0h0(%kp$k -Lp'`P HPW PP<0U40<@ P'@PP8  p$k(%k -0L~q0SI RXڌPPU 0S00S  0 0ਐ)U=32Cel `P4 0@#"B c!GP0@c< @040K0 @@P@  00$@ @,(K| p-0LMQ`P KpL 0@00 ,bK KU0P,<U0  000\ $@  (00(0  00CS 0剮Ldcd -LM 0S0,0 0S8,,,ح,8,QR 0,0 ,QRL l00  0 p202$2h0 0,00S {Q0S$@PP0S@p,00a L c( Uء }P, P0S@pP,  X 0@0(0@S ,lM(LTL,QR QR 0 P, 0S,0 B0T1 ,0P` 0SP`0@0! *}P, 0,0 긮,; -Ls -8 8,0L0,#Q e000h&x -LMpH4Q P, 0S Q Pm` eM3#@0CX@@ 0C@WM 00@'0 3PRP 0,0 N RZ <Q4H3  9|P, ;Z  ,0 00<  @010Y 0 S 0 000 0 00 000$  (0100" 04`@ 00@8PP Y 0 S 0,@ {P,  ",2 Po&, , ,0,0 0S <0 L 0, 0 00S Z D0D0 0!000S *32C0bt!10 @ 0S P,  ,@000O00@0!b, 00 ,0S00S,0 , R, Q 0  |P, Q 0D |, 0 S Y 00 0 00 0ct \ h X Ю,dd;x -LxMds\, ^@$2 @3^ 83^ , 0 R(K3^ 1C^ @P 6P  E0S(, ,,,,,,,,,,,,,,,,,,,,,,b0StPK$P@KK$KVJ  0t0 p 0R0R+*hP p0QmKhLDP L0QaKDLLaHaDa@a 0( "(K 1  2F! 0 R!  0V00CS F <(4"4!<1 1(< 4!4 <1 "(K |@KK$\ D E%\ 1 <0K 0V<K1<K  E!<0K ZR 0TR <0KVxed9 -LM@ \,  `G PK  EYA 0 pW  0 =0SY( 1lKD EP, 0RM(K #,10S. 0S lK$ vElK  lK$Y  l0K3Vp 0 Vp   0S   Q ("( lK$lK$mxe9 -L\M,ɟ| |@, `x pҠPPxW 0l W x0# b1#  @ 0@^ 0-@P LX 0#40 "( 00  0#40 "( 0009 -(0 $ , 08 40< 001? -@Lz `?02 -LMT4PK0` p$0 O? $4[  Z 0R300%0[0%0K–\@ 4[  X 0R300%0[0%0K 0Q1 0Q11 0#P1@1!@0#T1 zS>$ 0R2 K1 0#P1  0R300%0[x 000#%0K  0R300%0[x 000#%0Kxe9 -pLP`@~Vz_1 0#P1`F }V@  -b0`R1!~ #20VS  21!0#P1z_ U`h@ -LDM⬀0dPK`$0 pD@1>!0>@0\0#0@@T )=$ 0R KExe9 -LDM܀0@R@$0 P`(p o 01dPK@=!=@060#0@@Te Ul=$ 0R Kp=Axe$9 -LDM⬀0dPK`$0 p@=\ =@0\0#0@@T ^ Z3=$ 0R Kxe89I -LDM܀0@R@$0 P`(\p 7i00dPK@~= }=@060#0@@T <$ 0R K\pc=@xeH9 -LDM⬀0dPK`$0 p6@L=X K=@0\0#0@@TU  <$ 0R K`xeX9 -LDM܀0@R@$0 P`(/Xp 00dPK@ = =@060#0@@T <$ 0R KXp<@ xeh9G- 0M0|l L\ ̠<Čh4x HX $'4%Č&'\(l * p$́  00Q >0  0$5@ 0p RT001Tx?>   cp i  0S0X d @JTb001^ pQ?>   cpG C  0`0CW^ Bb   R 01Q 0110l1X100`1$ő\ 1 0R 02S\0 P3Ѝ 1 >0   r  R 10 01 -L$MH L  p ?D0OO^P`1`>PL 0  BSLaeH L08`0?>   cpH 02ᠢ0!8PL0` p2RLH `08?>   c 02L!08PP| 00`1ɯ D @ QL,0S PQH 08 bS180 1, !1!40 L00 0,<0 h1< PoQLL `0Oς  1>0PO>p@P` Q 804 \0 0S. 04  0 S ^,@ 0O QD  RH  0| ?(KLH,0p S0QJ 0H 0 U d99;;;; -L\ML< 5 Qp< @ <`000 00 0<@@P(0PpǏpP @p8@ ?@d_K8 4 @ 8@`4!4P a, QU.QU10=P1@ 80<Q8 4 < @0@P @ ?  b<@. _@Pp@ȟP 4 Q 8 <( @@8`04 0<@<  B @ ?0@@ 3C@0 L" 00C0@@3\Qp d048S c>Q SPQ C` 0{<0 \3R 2<0@, 0PD0 Z= 0᱔d ` @娀ȟ 0ᩔ`@PdK ? |0 | <,,l0 h@  @ 0h@ H@ ` 0 F.lKP ȟ0),@@ ?.D 00C0<0, 2R0S @3CL#020C2 0z됫dU 8;X;;~ -LHM\ 0pSPo0@0T8Z0LOPo P` 0OVʶ <4 S?Ẓ0 @ \00 P4 'LP0O8P 0@ ?00` Sp 8'08S8@``00`Q8 ςX  !D 08P 00`4PR@0 0  R,6^88@`0?0 0,p0P@`W 800@$ b $ 4 D0@4 DL# 00 08P5DQ8p`0/ 80 0cQ@< P0 9`08X3%@_Q8`0  0aP"004(KoXeUF\ 080w \@ 00şp 0U(K8 8$ 8@`$80@_ P LÙ n 88P   ? 0@3CL# 000\@4Q d0@ST8p4 R 280PuW+@`'0:0P 30008l3 R8TT0 !000t84S`06C cB SWAQWS 3 P88`0 0rP 82 R8`0  0/ 08 80   ? 0@3C0@L" 000\T2Q1 d0@_X@ TP S c6Q SPQCX K 48p1 RZ 20, 0PP0 Z5X K ld ` 娀 ?L H0 d0PO`sdK&,L K lp h h L K ` F.lKPG `0', @?P00080 ,R8TT0!000\ 0 u`P8X 0  P , Pu8X 0 \ 0,Y(D됫dU |;;;;;T;@; ; -LM 8 0 L8`4 pP(K 08 P, L 0S 2 0/ @G00P00a0 S0"Q^a\0/ A I3P  d2`R\0/ =3P@ 42 ^\0`ϊ1` Y 0@ QR0 0P ?1^\0/ 1> R,P1^\0?0  0<0  B 0 ;0@0 4D00L#040 Q 00C00 ,Hc08 0 ZTaV1>0  ?>0 @0 3C004L#0000800 p[됫dU ;;`;; -L$M@ D DPAP(K@D P, L P0 $h0U 0 S 0S P@Q0N 0R P3,`02SQ0 @_ 0 <@ 8P wD @_P 80 UAO>@P `L H  Q  P 0@4 S 0R  0P  PU 0P0O0@`0D  `Yp 0@_@, 0T P|Q800cO  vU80pY,+b %ꐫd; -L0M L `LLH PPT P0 00S  L #PD L^U #0O0@00S T08U ZO 04 R40 p F0SFp W^ T K Dn@ < 8 Z?َ `0 , 0 K 1>0 108\` 2Rψ0O0K` 0@1 >00S_ 0@ <0 T Z p T K pJQ8 4 }Z8PK` 1ψR` 1> 0 #0P @` ^$  j$ 4 D0S@4 DH0L# 00j 040Z0C40  j! 400400L8@K0ADTa@@ 0 0 R#A4^ 0@ <0 S 0@ <0 @K(K80,@dYn \^ 1/X`0 0O0@1>0 AR!0 \ `! 400C40 i! 40040T0 RY3 1> 020$  B$ 4 D 0@4 D80L# 0 ^0C 0  0Rυ0O0` @1 >004:`0@ d! 400C4000 c! 400C40ꐫdU -LM ,  @_ 0Ό8  0Ȍ4  ?n40 0Ἄ`, p ?@ ,8P804@0\ BQLT4 ABQ0 CBĘ,0UPT@!4 V< ᰤx<0PQ`004!P`1`#Z ,V`!@V`YL#20T 0U00 RH3 VHY@0SJL#20T 0U 00 RH3 Vt\AZ@0YL20 8@T@!@`02 08\Y YPL20 80S@@2 08` BVPZ,(K004`୉~|h,@቉T, PL#2, P\08`V04`V PT PL#^08@T04`V P P  -LMP040 00 `@4pP @ 0  p(K  XO ,0P>* 00 ,0 . X= H#0S0C0h0 K P 4 L0 0pP+0匠0Q5h@T'dp@l0S 0l0@l0Sgl@l00S0l0 00 ,0 H#0S00 n_0 DP 0hp0 0$ ̦g9@;;P;$-;;; -LM $5S. @pd`  | 02 f V@ SQS K t@0@ P   10P|p7 K X\\\ (K^4KKx0KP0K Po0@@ 8K0KP4Q@K00(00 0K80`S 2 K Ze㼠 [Ÿ ?p^ Z 1P` OP`@0R P R80P0(0 Sn A0S] ,] P0S[ 0]Z&`pQ d0 c|> @SPQP#00d0  c6 0SQd "| 80O`p X_000K n `P' 0 S@P0(0SK ,[H K@00,K`P,0 L0@_0 ^,]0[0]00L00 f0@000 R0-d0 Rd M-L4M00T P S@0,0 00 S `3Qt 0a0S QARQ< D?@Ě@c.d 0P0@0S@TmT0! ( ?Q< 80 - \ 00,KTK"`P@ p,P $[0,0 C@(K,0 @ b4pǏL H0  0P@  <K?ᢉ< K @ D@ @P: 0Hh  h Q d0,s c4rc| SqQP   0SpLL-P0@0  @4ß @(0 T @ <4Sʕ 0@ Rm<@D4@D_@Ě0e.d A 40PS 00ŸD -Q4 0 w叵<K 0@@Uqʜ0Hh  h P d00@4# c0 !A `gPP@0A#O 1"1?0P HA`p-8PP`# P P 0 r3p1>0 R! "A@e0 0@A0#O 1#"1?0P01 FA` -LM 4 P80 1\ plWRl \R^Q V0 #400p004 00,K0 TPP80S,0@p4,85L 8 0  , (K,O 00@@^3  pQP485@0L 0p U -L;\%P0R 0 R40Rh0 S8P0!RTcdC-0 LS03Q% 5p00P5,5MS ڬ4S9Ӭ4հ4S@0Ӱ4Ѝ0t0/Oq,,REQ `PNo,P`PLH0` 0`O/0U4e85P,P, SH 00Rꐫd@-0` S@T,0 T:F@ -LPMD @ @@< TH0 M0 <00K PP @l0S \%0R 00H0h0ltHpb+Xl l00S0l000L $000,5Sʜ 0p00t0(;d&k;d%kdT -LM``@ -pRP =S>X< 8P 0` 4 @( X0<0 8P 0` 4 < Kf<@$0#= ,K ,0P@S  0s 0P@E@ =S  P@(K p-;D; p-00LS@P0 0h0S  m`P p0  <P mp -LM, `20\%R64d 00  8@_d t,`p`p<@D_@,z`Vp` p, ,0C@$0(@[`4P8`,P0`fhTX; -$0L Pp`  e@P`@0 S@`V e@P  Z0 0ὂ @吃 -LM$0`bp /PUMT500#0BPP00U00S@ $KPHu0@x @  0@@h 0Q ɁPfkLXUR$0`B:$0 -LfPP HKKZ ot8 Tx00 TC}P T~UQ ]PP@Z \B_PXZ Z \YOKZ \Z KZ  GPP 5H00#0㋑xe@L;d;d9; -<1LM4A0!00hqiPP1aiPP  P g KfjPP  PP 0   B qi Og 0P 0u/ 00 `2@  , SiCRdi kTeix;;:Di p-@LP`PQsp`p%k&k -L00pSr 0Sۧh `RI 40640 Rh@T ?EȧhP`U@6 4 1P0S40I X x0S0S 0S 40 P10S  P40740D N40640ݨY0S9HP Xh 0S" 0 bƨ>Pyh `R YIh%x00S $0 !ᨨ Q0i;; -LHM` `X ` \  D 0\d0 P \0P P P T05S*P(KDR X@0d0U 0T0  45 S: \XD 00KPPDXd8 0  H \4 @ < LP E d0\}L 7Z 0jSXj Z\XRQ{VsT0,0PDL @a T @X PP\8\VTP0 0SM3 Rx d d, $R0t03U0Sd000X\ TX850 p0c Y !YP0 PHH` H H 0dH,K 0 0PPd0X 0 R:0S*,F,,G,0LP0  UT0@P 00@b b3a R`QdRpVuUsTT85@0L 0l,4DX @0(D d0X 00 @d 1d 0S.X0@0X4  R` 0S 0S d 0;0X4 Q U D-X00X00\  L0Si~0X@0S PX4 Q8 R d0X0P 0S P`d @@K80@X40l@Q  X  ;8d; -L$M@ 8 < <0 040 45R@(K 8`P@ 8, @Tp <04| 00@@ \3.,D\KG ,K@ 0I@Th<$P(`,D0 0cZS_ 0 L 8 嬩@PU, D80,@ @T; <`80P`ppWXHP D` +4`850000 P c1P `^ PR\QZ!R` ?SHP<$0  S(0S,K@ 0H@ @@PL0$  <<000sW@R,PC@PL0$   <`0` <00\4P 05R[@U -LMLD @ `œP0< 0@ DPK`?O# $Q R<` @$0@PPQ0@ ,P ʅ 0@K0`0@TPpW0@ ,P ZP8P @\D K X8P0O0 K 80 S0c0 jD@Xd 4 <0$@P 0q`p 0K0q 8@0@8@ #r00T0O4PP4P $" 0@XDP@  R\ 4  $ 0@K0@TP7"0@ ,P 0pW`P8P  (K Qp0@VPwP`p8P V{@PY`4` D0Ky -LxM L0  @pT ` P@ |  00 4n@| UlPKT,@K 0@P i`V,` h 0 10X`FVɯ,` L xP 8T  QBx 0040 F 40  x L,`1V  ɯ 000 @T 0$ pǏ0S} x0FS,0 x x 0@0 APQ UB (0S c9R SQQC0@P0(K@ 00((0Q/ Q   00St p0  R 0|@Tڐt0@! (0,(0P0dt0! Y|^ 0,0( ( P@tKPt p ZR | PRz 0 0,0 Sq00Rk| Uh 0@L, 0 0Q^ @PP0$ p@0SO4( 2 b91 R2Q00@( "4| P(`80 0@80<@(, y\ h000@@P A@ EUQ120@:i k -L M P0  000S P K-\0\ 00P P 0 S0SH'kD'k R0S  0 -hpP L`@ 0 01P  R 0S0S ȊP0PH'kD'k -0儐h倠L`@p0 0PP 0S0SP 1bPP kH'kD'k - 0L0  0 P@; (p0\@ K08@haP0 `py@P (L0( R-0[.0[S "[0R4 0R R _(04L (0K@P ( T (Q|_$K@ (@ k..; -L0L(\;;H 8 s06D 048  s 00K& L@ @PH R U00@0kU? < 0qPD  ;;SPt0at00S L0 00KPD 0 o <0\k p0\h 00 p\c V[D h2@0P 04 0S*4"L0( R0000000@0 @   <  0qPD 0S0D0  L0 00KPD @00 H 0Q;0 8 Dr060 8 sP'0D@ 60 KT@ 0H @0R H8 r060x 8T@ s8  |s@P060K 0ZD@ fxQ `d 0LQL ` t d ;;S dP D00bt0t0 L!00C0 L B L0 00,^l8R\Q X\ 0T@!0@i=0T %T@000<L!  P H1S@ N=TX0Q "6H@P!00C0'P xe9$;;4;L;pd; -LMPq`  @p@pp0vt`SS #P0p 4 4h \t0ɯ00 , ? 00S,,  P (K,0  ,  t`0p@P-  0t04 p P,0 J 0@ h04@ ɯ , TtQ0 ᡂP,  0P, P ,  0P004 SR000Q 0S 0;0P 0S 0;0h; -@p0Pp LP` }P#P 00S   0tHP   0:0000   40 0L _O -LMP`( 0 R0d 0St0p 0LO02& L0$  K"P80d 0S 0t0p ,O 0-L MP L0$  00K00 R(  K 0 000 0 000 0 0 $ \0 0@\0`@   0ꐫd -@L80ShXo -L MP`0 Sp0s0s0s @(K0s(0sX0s\0sP0sT0s8 L0$  p0R ᇁ@P Rd0 h3 R@L0$ ? @dT 8#8R 88d0%d00d00"00T0 R@0"d R q L0$  0@P p 0 R000 ,@ @ R R  0@P$0,@Sb:] ,0sb L0$ 0p Q @P l0i  0/f@Pb80s\ 000,0sR L0$  0 0 008q? 0 @00,q3 0 4000@P4q@ L0$ _ 0D@% i"T0d0d 00 S*q}00s80s<0srr00s<0s0sR\ i -pP`L  0@0@ 0:0  0p 0t  0( X 0 0$@ 0O,00@ 040 0O80<@ 0@0 0OD0H@ $0L0 d0T0 l0P000S;(0 SL084 (0(  h0O$+4` \00 \0d0h@ -L80S+ 0-L^ P 00S \ R 1S1  01S  RZ(@Q[@ 0@@"00000 -L` pPQ @PQ @T@a 0PP Q[P@6S@S  0PP@ -L M @p0S Q#0 HPA(Z,6倢 0& 0,K6 3P2(Z,0aLPQ8 8000 ,  00* 0 R0,& 10C1,0(K ;<,0S$,. ;;;|; -LM;  y; -LM @`0PQ $0:  KbZ,6r& 0 K6 F3P$`fZ 0L \1 100 1 , 000 0 0.;i T;;;$; -LpMp @P P`, !p(K: S3 (@,Z (0X  0P , L0  0pP40PQ !R0 00S0805 0d0 YY ,&0Qp0 0^  \   0˄ @;P;-L'kd ;L; -LM @p ` RP ' Q 0R 0W p!:(@Yl6 ^Pڜ6 $ 000W $`Y$;8;- -LM @偂,Ɣ 0PQ(K 6 6,K <2PW,60 RR 4 $0`a00 ,0Lp_YY P b 00ab P 0S =  0S7  \P 0S P3 0S'  RU 400c#YQ`e ~PM 00` PR 0\T-P,,1 !P!000 , B 0 0C0&,.$0"zU 0X1S101P!P P 4a0X ` )PP ;40\ 02 P!E;;;h; -LM P,剢@P40 (K6 6,K p1P0 Y,0@TL% (X!\1@0! 0,0C040* 0C R0,& 101,=.( 0(0T0 0d qa P 00`A@ 0ThmdXp P0`  ;4^0I,,10;;;; -LMRP`0 0 0V0 8K 0KSP 8 0 B18 0XpW/ HK  㘐K + ,K60P ,80L QAB T  0y4K  0P  4pp40 06/0 63O|0@0 @L00 D 0-P  2Q(K 0 h  q< ,-T0 74K 0 P x4@ @80( K20h4  PA0 ,-6 PPP/0 6 3O|0@000(K,3-h UGA0( R 6,K ,0P w,00(0 4K 0 P  4 P(0006 I/ 0, &402O|0@ ,0@Lq,0D,*H0K S`# *@` z6Q` R0 `0P80SK 2@6 /, 40P;40,*80@SVv 04C0 00 0m,*j  0l4K  0P [40K0H0 6., &402O|0@, @L,0 D ,,P 3 D0K0 H0Kp "(K@6pD,Kl/PM, h0L  ,,j*  0K6 T/@P100 0 ,A,q4 X 0 0 0D0K 0 a 6 w.0 63O|0@,,00@L00DP0)*@ ,O|; -LdM \0  00 R x X 00 L Zt 錐`P|  00t04*V@| ,K/l0KUPx :,\:! (0( 1S@ Z* @ T'P|0S#ڜ10$ ,( P0p`e | ^ ,(0 ( 0P 0e 0@ Rx(Kd0 L10\X, Z L0Kxpp0 p Y@[ TN W)p 00t 40/-40p M p0L`,\00Y0S( Z& $0PU"*@| R0 ,0 S1 |0T L, 0 0Q@@$0PS,p 0L S,0 p WS)(0 30@O/r(P(04 3)O|0@4 Ja`0`h  (0 0@(0,@2(@P ')x@ j0@f ki@-0 : Sl0@@0@- : S R Q0 0Q@l L0S d  0 6d 0p0p -L4MH L HP T0 D PF D 0F$!0 S T^T THL0/,40D}8@ $2ŸhP0`00(80 0@80<@(, 40@< 9Q40P0O|0@` '@PT0LS࠳@ 0 < D IsD0< &@UD@&0"!h! B *0 <@ DL6 #`@ Xࠣpc4 *1@@4 PU  RD0&L0,K"Hc0P,040 4 H48 4 `FX p@DT 0?^00S <^( r40@(K@1S D F D-T 0B,KH %00P0400 <,0^4 40 ;40' ' p ki; -LM0L $0 00 X! 0000@(K 00P(` 0PEpS$S@S,6 6@C,K6 ,@P'0,00L LPR$@e`S0)P 9 10#870!TY ,)@,j),}'ꐫd -LMpRP P|00 0BRSPuRv D  W'   X 51 6` 67 c SXQ,K/ 00PPN -0 F.4,0L f,0@@/ ,F)V W0``1 aN0 ` PRQ0G0/,K0 `PP   ,)0 00 P(K  L0( 0OT R~0Sz (   f0O0 @030@ `2 PT1Q&  PCl n(K< d4 0OT! | `X 0 t,K/0;P H S00 ,.#0 000ȟY`%  / @P000.@`T`\00S4 0`0|0Q < @00S Vi<@ 0S p@ L000KPL\ Q8 pgZ06000D 00 z D0p Q/t R\ 0!RX p@L0$  @ 0XPH `l\ dh P0P t@4N40  x0 L0\;0H CLp8 #Z06H 09X}l@ p0XPH -0SH ' pL0 00KPH L D0R0  0;0p8 HY060 p_;p0D 0VY p~@ 0qXPH 0 T@t0dt00S_ p L0 00KPH 0  5 @0Q1 0Q. 00 Q* A@H@ 8 pY 00K& pL@ @PLP V00D07p8 SZPh0H@ 600LD\pL8 Y0608 p:Z@P060 0AH@ p:pD,!H@  K x K Rx0<0:0806(ߨgPe\Zxe9D;\; -LUD PkT8 P L 0S 0SX0 0;0U <0000O8 Q4 R XLPX LTK 40X80l@Q  V P$ ;;;x; -L@MX P 0T0 L 6 O/ 0@ P@(K PP@ P , 0S3 LT6S c8R SQQCQSP ,KX @0#@TT$`(p,@ D00cZS] L<0 P U@Pm,P,@ 0Sh TP0@0PQH D ?L64c cb SUaQUs8 4 P0&@ @0<  aZ!D 0O THPT$0  S(0SL8K,@K0 0KX @0 @5#@ ,@PaXL0$  gT000bHSHoPP0S[@U,@ -L M@pP0 0"&1S00:S/,0 (?`P 0 00, 0B?>@`0(KS40040Ù\( \` 2 1C0 00 \` @KS-hdd -LM `1 n @^RQV(Kp@/0"PP T(6L 0(  $K( 00  0d  - -LM0@P p;pp!`+LJU KKh -LMPp 6S, ` 6`S6& S/!&,6@LJX 6`S0z03Y0S  (K p-LM`2 ^@@^@TP` (0&^Fx 0KP @x0 R <0F0x0Sd 0Rx -L$MD @ @< \H0 0X<Dp`PHP@' <"00K?`P" 0h"`f00 ጠ00 00` Pp0`P 0>V (K`H @(@D K  08 40 8KP 0N$&?N `p08KM,6   `1, P.Q6,K!`PRL0, SL$&e?8Kp`pM@7"TPv@ I,10'080'180 R1<00K P`P 05d0S000S08050d00L0$ 000H {0 K4K L0S `0=@K.0<0K8 62K 0C3K L0S `01K0@ 0 0. 00 K/ KhA ,D K0@NpP L0 ` 00Q!/pP 0! B! 01000,p4~000  pP ,00q i k; -`@00LSPKpL4L L0R KA4pU  LpP-0!R" 00 KpU  L !0 00pP 0! B!H]KpK  >pP i -LhMP @, 0 L L0pR` K,0T 3,P3~KN50L5 (K\ L0R0 0 ;50   PY  YLP08h t !Ry 00qt 0 l0: S\ X  5,0P`0 hd ! !h 000PP Y 0 fKPd0S d@~3`{3\ Rh@ 0000LPh0! B!h 0d300S$ K[3,Y340400 0 0L 000K & 0_Jl0 .Rf 0KP  KK  KF0 0IP 0K`X 0R` \QS  Rp T0 l  Zd0S,3`h P0 9 ,K w&P,P` d d R d `0Rh0R@ n 0WI P,00P00S+R#0S t0hS 0 0 0t h 0X  0\ !064\P0Ql0 p T0  0J 0I d0h 0R ` 0   0 R `0R d0Rd0 0: S p0S`h Pp0TQ00S ` 0! B!`0q2d@p Q10C1 10C8#8S1g d 07d 000,S200 0 0J 0K %0PE h@0YL0 a p R\L R92Y0623\`0h 0R@l R `02!R !`000Ph RPG l R `0! B!`@000tpQq3p"{` d P d0!R\ Re ,ZfB^tbl0SrP 010C100000(N1sL@HK! B!00 00 0 0 h @0 0@KP60[S#[0R    0T  0X 0C0< hA 0 0@K$;;0;8;L;; k..l; -LMP 0pS, `0s0s0s (K0s(0sX0s\0sP0sT0s! L0$  0R bP 000 0T0   0000 0$T0 R0 0 @t L0$ t@ 0 y㘐ST bbP0 S R 0000R@ 0S 0;0Q 0S 0;0 p 00S S S  0P|,0s L0$ z 0R #bP l0j ,0 000 00 0l)k9 0-@PL, @ P0+k9 -L(M`eP@H8 <0 6vGU @PTS `0K$  0X ! W01,K P@ 0 4 `,@P `@PTV* 40 S 4 j{  0L <0`8 ` 8000 D08 0(K80   0800  -LO@L@@DT@d@ -L(M8 `P (K5p@4 P* 2P@T% 0S" 0S0$ ,(00 S ! 140,K0K mP ,  @0 0C"0" 8 4 0+$  04S0!0K,K >P0  @0"0C0 p-LP`0,(0@ `0 p(kp9 0- LP@$P .P 0Q0 0P0k;9 0-LM @PVP(0$ ΄, P R 0S B^R P5 P8 0B;9 - L@P3;9 0-LM @PP8 00 ;9(k,*kݱ*kٱl)kձ+k -LM Pp !P  t$0(,@ \`,K 0` `P P  (Kk -L$M@  p `nQ4 80  ":RE 0i^ ! \ʠ3hQ1!0l 0PP1Q: t@P `0S:`0V @T (K@ R 0S@(0$ ,00U: R `0V@@0ST PP#@ P$( ,0  0 R 1S0!,K0KP, 40U@:00U8P80 -LMPQ`p4 0^ 0^,:0^)* 00000 0000@P  K@ 0d P 0@@ @t ; -L$Mp4 W80 `PSXppx a@P3 $ (0 U.:,00V,K0K ' @T# ( $0 U:,00VR 1 S0!  $e P X@T (K,40W@:00W8pX080WxpW*Xp -LHMpH L0 uD p00,P(@4 0dP4`K004`K@K@KࠁS0%5R 0 UP0T@%5 P@ `0f S* P0KU (K@j  DH L0`@ @P -L4MPpU@80 { 0$%Q01Sr:0a bU,0 50 R 10 e>0 ```  0, 80P` P(Kf4   40 ,80 PP   0 ,80`P P  4800P, P -L$M` p@ PZf ^ 3: @g `@ PpK 0-@ MLP  0P刱 0P倱 0Pxxx 0Pp` 0TP@gDD0*0<0 K0Td ;+k ;*k ;,*k ;(k ;l)k *k@9P,,0 S 0 SP 0 S00:S -L !Q 1S 01 0AS 10 ! 10A0l!;!; -L !Q0 !; p-@L !ƌ\`"S  QP P 0 / `p Q0S  0  0 00`pݷ ۷ٷ!; ";!; -@`$0 L0b#6<@ SpTQ&0@ P PU/TP\P<@0!PR00R0S0 !P ;/\ -LP@!ƌ0C  0S0 !h4刷$"; -`LVP`PV@p$4 0SPP 00 0A S 10  ! 1 A 00CS0 UX01SZP `FPU -@Lb QP  0R000 00 0 p-"fL@P  00b0fS 0S 000  p  H";l"; -LM@p, ,P0, a@T; 0S"4PU(0 ( 0~,P ,P(K 80A0C0 ( Q  8,00,0 PP  0 =PE, 嵶";";";R -PL@APP) $F%6@Q0p0!a @ ppf b5QPP@ 0 0!< R$0(0$ (@PH,k,k -b@LP 0@sbPh+H,k 0-0L@1$ R(0(0(0  R 0 P 0S P 0PS0!P 0S 0CS0=0PS0000h&0"; -P1LXM@`TPpF pTK0K‐K( 0@ , (0$Q\ $ \0K((0$0^X0 $ ^0 !0SU000 0Rp0 P ^0\Q,0@(0,0\QX0(00P0W0X S(Km,k 0-

T`p`@0e,c(a$_dgdddh.k$; $;L$;$; -LM@< k Pd` P@ 4 0Z  4 < Z :@P`0s  /pP (0(I @@ p< Z40@S@ @(K0 0%@S@0P  0?4pP (@A*   UP0100@0<^`p <Z :@`p@TZ   &6ʃG0 , T I/PP( (0 0l!u@T 5/PP(0 P3PP<@( @P( @T0 00@S8 "08 Q/@( %P R@P (0t 8 [K( p4O P 8 010$;$; -LM`@$K/p 0K @ $p @ @@PP P  K I(f  $ /K -Lp`1PUT `}pw`VT@P'P@@P0W  X R`P0@Pi` @`T. P`P^ 1@P  W00X0S \P^@DZ (%``!`U `dd 00 0M0Ѝ -LMD<0 0 @8  @0@(K800<40 #40#"B P0 4 09 0cP` 2P0#0 e` p,0 @ :@P`, @0X Y@| 04 0 p  0H 0 P<pX@ @8 0e0g@08 @ 0X0@Y&;)4` BmO((A<L 0 c<000C0l4pi "101(04(0(4(00 <L 0 c<0(p T2PKh 0 000Ÿ<0 00, D0 LPPb0 X` ,K400p 0Q40KPPo U0!_n@ P6b(PK  0eP0gfm4: 10 14(0 Zm4(l4E(PK !0H0005@kGm4L  0PK9 5@_'(M4kPG((0?C; PK 0m4\/k9t%;P%;h%; k%;%;%;$i%;\%;PK`P@@Y00SVH4(0 m4'4(@<L 0<cP T  PK0ly'(0  !?(0 Q-L`pP#*@JV  0P T   @- 6@004@ 5@80<@ 3@ 0$@ 2@(0,@ 06@P0T@/k -LM KLH0#&R*0R*0a"!B10bdk0k -0L@TP" Pp` :S0x Q *Q@T (0" -0St0SP@pTV T0 RZ 0 0mS 0`NU 0iHd/k 0-@L P0 PT*,TQ0,d -RLP@ F T 0m{ 0 0.  . Q! 7 -L΂n^P`Up*S N@ Pe0,0 h  h dk,d.  . Q : -L(M@ .  ^P U< p#: (K  P e!fV8  @,K , 0S0R*@VX 0 $PP  @TF (18P  14@K0@ 4 0@ `'P)4 R @Q00000 0J8 4 R|T< e<@ xP 8080A$8 E 000d,ddk -@dPN`@ RL @pp .0  @ ,d -0LM R' 0+ KKX) = >뾝/ !X0@$ H 80@$ H K£/k k,dd%; -L$MD @ Xa 0H#Y*qZp1H`00X80 N J$J>00>0Sp1x# Z00 W0~Sp8  Wz3X@3 8 ,0K @P 0d,S0!D <0 X`  ,4PK@ 04@ 0P @a m ?Z<0cX@ (K,d -L M0`SpP6 0SA0SR4KP40 0 $*@,Kd P P,!&R*<(0R*0`"!B1 b 0 00  000 JU / &0 ^0S(K0"j@oV 0`S00PV j ,$0 60S dk0k%;0k>00  % -L(M@  pDL 4KT4 0 < 0 SRS@ 0 S: 0R  48 \= \: j`,K < 80,  00y0P!4@,pT 8 `,:,0 @T @ `\ 0 8,:,0 @Th4K%(KHAU0S 001@ Ok0S 0SU4K%0C! S, 0 0 h0Q @ T00 SiU@ 0@ `S  @0RV< "f @0 4K` %PS %;dk0k0k8; k -LPp눀`0t@kU 0R 10 P MU(GU*9(,d0k -LPM rHU 0RZf 1   'U Pq3U 0R1   UhK@h`Kt!p *\0@P0 pP`1X UP1 Q 0 hK!PR UhTZ hTU1h K@U@PQ x0*1(K0@p  P0 Zj00 @` P@TV0k,d# 0k%; 0:.k&; -̡LM T Q 1 R R AR   Q;* 0 1 S0P1* p X00W0S1 $1 hWp 0`$K0!&0@P0 `P?pX(10 0 Q *0h6 0(0  X00W0S X H 10  0 R0 0, S0, 9$K0kd,d# . -LMP$ Nl@T`p(KT,K, Lh0   P, 0 h p0k' &; 0 p-LMP h`K! ̃.' 0@P0 gPKpp0k 6 0 -LM\ ~h(K!p@ 00  0@P0 CP4 1W , 0( 0cP`8 0:P@zG`W h 0 &@P(p0x Dh1pS /WJ 00S,(K, `,,  app0k',d k&; -LMp@ `.` $PK @ 0$@ P @g K -.L M  8  0(Ǩ0!Y# 0@P(0 P0 ,(KZ1P ,0 `0ap`p T1ph  a(RP4K@  0 4@ ;#P7,P0U/88  ,0Z0S$ :@`p4@ P00000 0 %(Z0 8,0Z0S$ ,8 ,d/kdk -P`pWL @P( (0 o0 Hg|0@P`:P@`XW%&* <&%  Pp00Cp0$&;/k -LM>0`~0^p@0P 0` `P @P 000 T 0 00 0GP  K0 @Pޞܞ''d&;,&;&; p-LM1P0 @|`|0 h0  `0R0 P b 0K@P0 P 0`Kp媞$gp0kdk',d&; p-PLMP*@`Kp NP \0#&R*H卞0R*0a"!B10b %JUxdk0k&; 0Q-L@ 00SD00D0p@-x|0\ @!@1Q% \ 1 !R`#`3P Q#3Q030 "SaP^ Q0#02SQ#3T0#0 2S%ppP 0 S(0$ ,00\1P -L`$@0@PS:b V@cp V:E  f@U>0e S 0SR F@U0P@0F\2 lU" R!0e S9A U R0ST0l0U 0SS1:Q0P@U 00b S9R R0e SYD0S0e SI9@0S,  `0R 1P `0R 1 -@PL`@T `0P 0Q-L@ 00SD00D0h0@-D0DQ 0$@ 0TT0ST0SH H0RL L0RP P0RX X0R 0 00R 040c@P4@PP80S@Q 0S@ R 0S00 0- L@PP D0 0U:$0U#300 0 0 P00P0 Q-&:0@2 8P 0Q:0Q4(0Q*00Q:40Q:<P 0 R 0Q:0Q4^,0Q*LP0Q:0Q4 0 Q:k$0(0@-P Q0#03 P 0S @@1 Q#3PQ8Q 0T # 3P R0T # 3S RLQ T0#03P0S T0#03R0S<Q 0T # 3P R0T # 3S R\004T # 3P R0T#3S(P T # 3 Q R,T0#03\0S 0 0k-$ (,(0 R:,0\3400R:40\34000 -LpPU/ 0S,`@T1 T R& @TP @0 Q 0` {0S0@  0S@@@`mP iPU 0 00p 0 0  R P; X> P@0T 0` @H0S0P  0SPPP`:P 60SP0/0S0p  0SppP@!P0Pp0p 0 0 z0S@00S0p  0TppPP@p -Lp` R 0SPU 0SY0 0`R 0S0S @TP R0 0@ T`@0S0P  0SPP`PP@@ PRi Q 0S R 0S 0R 00  S`00S0@  0S@@@`9R 0S0Q 0@ ~0S0P  0SPPP@pPm@ 0R 00  S`0_0S0@  0S@@@`QPN R 0 00 0@ T`@?0S0P  0SPP`P1P.@y R 0S0P 0@ P0S0P  0SPPP@ P @ ` -pLWP8 @TD@0Sp`W`V p 0Spp U`P@ 0U@@ 0R@@V @@TX  p`W `Vp 0Spp` 0-PLP@" #3Q R  0 S R0P 0  Q@@000 0@0P  SP 0S0#03 P P 0S0SP0SP0S  0- LP@P'$ Q00R03SQ PD0$ T(0, 00\ H00SP 0T00 -PL@p` 0!S8@ T- P $ (0,0 0S*:@@P` $ 0S X:W WP 80P L0P sV@ 6P@ A-P @k P 0S0SP0SP0S PQ00SQ00S p- P$` UZ3@L<MLp000C`025 -0L @(5h4504 -0@L  A4p3P 0000h40 5 M-LM4 040` P @xh 10 Sp!z3S0CD  , , K00K0 PPFY`+,PU (0$ 0TI*,Q $ (0g (0R,T:00R4T*P* 0@P@T :,P,  ` h(K0g00T0@ , K00K0 PP  P40`@y z`, ,P `$0T* , @k 0-0L@P!3P 0! 000 D`00000(9 -QL M8 <0 4  0Q:$0R, ,(K /4 8 0PZD0 D0$Z(0, 00Q 0ZU Z , D0@000 00 Xk < h P2 Rd $08`Z p1p!Q`!V< @ ( l@@P PU < 00CS//,/,///0S]40S0QO jW 嵗$0 Z p1p!0 R <0 L0 D08pl ^0l 0l04P`@p0< 0A, P , P Z 4 _[$0Z p1p!4 U, O4 N0,0 H(0  00S @a00CS0a0,0 8d'; - L@T0000AЭ,'; -L` PP1 .@Y T #pN U $0R P@T,(0, 00,000  0@@ 0-L M 0@RPP x0S PK0$0( ,0 0 $ (,@ @֖ЭD';x'; -00h t@RLB>00 p-@`LP$ 0 q= UpPP+  @{PP@ 0/B000cStePPP@H0/B000cS 0p$';0(;<(;T(;VUUUP(;t; (; -p ML`8@0P(,0!0 @04 0P@V (0 L.P) \ K& Q QA ,(01 !0B@@0S!0S W@T PP W|p \@XLd(;49p(;(;(;);););0k*; *;);X);p);<*;p0k);<); -L M䒟p`$0 , (, 04 0 |$0@"Z78X 0@P4K08"nP< 0uU@ 0Lm, 0Rq(KP`d pt x| Z $PP 0 $04@ <@X@H0D0L  P0FT0T  XF T F0T0j(0$D ,FT@PF T `D0FT T  0lPPnLmxeh*;*;*;*;*;,;,;,;+;<+;X+;t+;+;+;,;<,;T,;p,;9 0- L M0 \0\0\ 0d R@P 0xPݍh 0`dP@ԍL 0Dd@̍(㩇K0h/p0ktgTd,;k,;k,;lk -Z%ZULp`e   ; < @$0X+*@0(PS$@d,P  << xD05 0P004 48 ,0S      o(P$$ bP!  b `h0@,408@0 dPtu00LeT$0 -\0L@  Dh艉8h腉D((\ P1\@0CP1h>Elkkp0k/k p-0L1PU C`P\@T P10P1\E0\0T0000p0 P @P \P 0 @Pd0. d0d0S0AKX00, ;GP\0` 00_S2\0 4?2cL0X@K\00, GPX0` 00_S\X 4?2cP0\D 0/> :)>/kQ kdHd -LM 0-P t1t x/QM K ۦD1\ @E -00CSK/J/J/K/K/K/J/ 1S x0S0T R 0S@ @ \ ePp0 #50a,#50 ^T h!\31C0a 1 0a&1 %\  @ `ꐫdHdii\ k9 k -LMRP4 0 `P p 0@00 S P(K@ :#:S (, d  Q 00S Pt00@T Uf,&nj,  0, 0 4 0 PPCX 0 Z00W P2 H40#&Rz\ 004 4 60Rn:40 0CPP 400 4  RT#00,0@7`p ,0 40 Ƞ, T 0,@Ȍ, `p0& 0 W0@0 -000 _c 0Px4 0  C@P0r Ux40   20@_ 00SP P> 05400 z P30,@ >0>009/k -LM ʠ,ʠ\ 0R lR >0. R 0^  0P  0-LM@ʠ,ʠ\ 0^* @l^ >0^ 0T.Ơ0 H R P 4d 6R0  0mP 88`0S*#8/k -L ' -LQ 00 ` P00 P00S#@-@ʠ,ʠ\  0R lR >0. R 0^ TtR/tR/tR/R/R/TR/\R/  0@/  0@,  0@!-0 " 0S  ʠS,ʠ\ 0R lR >0. R 0Q  0 0@-@ʠ,ʠ\  0R lR >0. R 0^  0@ -LM ^0 ʠ,ʠ\ 0R lR >0. R 0Q  07 -LM@ ʠ,ʠ\ 0R @lR >0. R 0T`V0TK p e 0P $PK0@ $@ P @  -LM00  0 0 , SpP 0 ed`Va0`0S0 Z > SW UU )YN>0^PUK  i:#:SD0QA0S>x3Q;,  C r  p0 h0!6@ Q 0@T; p@@1 `,K0,@P,000 R  JZ  0U@(K 0@pW P 5P @  0S  @S @$ 00SS@@ S R1S``/ 0 5  @ S S x0 P:00 z 0u  S0`  XʽW@ k 0K0 @P 0L 0S 0 @ kj 0CZ p@ 먠 p0 S -L,MH T H P :#:S0D >0 Z< *2 P08 40 \8 P L 4 S TD8 0P4 H4 PXP , K Pq ,P. 0< R*L10,<$ QS` 0R]:D0<Y!0000 ( 0 0 0 R" Y0 Y0,P,  0<Q PH T8 LD8 Lo4(K@ Y@  Y@ 0R0 , < aP 0S0000S 0S,00 @4` @dP bP00 PH T8  040 4  -LM`@00 SpP (K 00Q, KPP00@0S 0 0K PP000, R 00CS 0,0,0 00@SP 0 0 00 M-LM0Z,  (KYzpP` ,:p@ Q P`ZY M-LlM00S@#vzD0 | x0 p XKl`Kt p 0]0@ ,0 妡0  0 0 0, K0 tK0 Px F,Q *@@R (0 (= , @RRP@ZP  000000  ,@Q, 0OpW0 6OtK Xt p 0ʡWp@t0 K@Qx(K0@-P@ R( 0S%\ ) \ ^ \@ 00\0 S 0  0S  R 0000@00 R P, R/ 0\00 S 0  0S   0S 0P@ 0S@ @0  @0@000S 00S0@ 0\@ @  @0@- R 0S ^ 0Sk0 0R 0SI0SD \   R00  \0S0  0S    R( ^ 0Sm R 0S 0R00S 00 S0 0S    R 00000 \0 S0  0S  R 0S@0T00 S @0  0 S  0R0 0S00 S0 0S    R R 0S P0U00 S P0@  0 S  @ y -LXp5 PU?P0S `X`V 0S @ W`RP 0WP P 0RPPV 00SZ   `X `V 0S ` P 0S0SP0SP 0S  P 0S 0SP 0SP0S PQ0 0SQ0 0S0- @0 S0 UTR p-@LTP `P`@ @T@p 0-@LPT P@ @T0 p-@LT`P@P  R0T 0@ PP P@p0@0@ @P -LTM@ < `K Kp@-d0 P0U#F"``@ 0T !P01Rb`0^pLd0k 0-00LS@(0P PR0 00 0  (f00C0(0 00 0000000  R 000( M00C0 R 0  0 /kp0k 0-@PL(20h{ -@L('h -(0L@ & R4 000(  00C000S(0 R0000 0| 00  0@@ RH0 0 ($ $00000 /kp0k -00L0CS00@008@0 (000 00C 0p0k/k -@LPP`p  (00C0, 0 0, U ,00,0 `$pP( 000 0-(0L@ R 000  0(  00C0(0&0   @@(P\`0   (0 D0 0h[00  @ @p0k/k - rL\R2$ RP@L0R P U3 @0Q  Q*60 0 0R0 4 R0B60  B0CR0 \4 `LV`@DPV 0 SAP!@P@ 0R:P U|\ `LV`@DPVʹ||60 0 R \ `LU`@DPVLdp0k0kd.;.; -LhP \0*0  0P 0@ 0P g|/k.; -LM0  4 0  P, 80 < @  (2(b$ȟ. 0PQ<0 @_TO T"vMWC(00\Qh!D0R A0R @0 Uh!D0R 0R d (0 0R0HA :#:S 8 {40Z C$1P*VR, 4B  ,F@<00@ 8!"&0@(Ko 0@ ?SʭRD0@0@T P0U ?@P 0QʙP(KSi/ki0k kp0ki.;.; - LM z 0S0|,0 @ `0 PpT0 `pz0 0,  S, z(KozLd,/;Hkh/;/;/; -LMD`4 V80 Pl V 0S  0SQ21C  48  000(K 4 pi21C! c0 0 @P3 W,@ R ` VZ%&0RP08P@0D0H0L0 :80RZ@ (Y000`VT@Z( 0,21C0 T B 4 80 0&z4  (Ko zz4 0@Pl0z`(Koz i21C,8 c hK zLd0k,d,0;l0;/;/;0;0; -LM,a0PS  A* pW$ >0n`0gV@P0U,>0 N@ U $`KP% $J Uzhh@<0>0>0 0EU zzTd7i7ikdk0;0;1; -錒LM™0 @0 ,  0 @@-s^ p80 0b\0 "6!v21C!@cw `ך0SG 0PcW@"#<:21CcT F0 U` ` T 0P08@0D0H0L0 R 0S0!% 0%0" 0%^0 c21C cls0S 0pePcUgz 0, >0>00 00 >00[-0h 0 P00C $ (0 0, `\0T(XL(K,yp0kLdHk50k/kl1;7i0k7iPd@1; 0-L@\ $0X(P 0hQ(PA (P$ A000A -L$MŸ`@0@VPU8 4 <0 /<0@PPOTF` 1@ ?S,) Z 0s ,0 S(0 SH1H!hD0Q>P`0@K  0 @0 ,@ PP @(KR0D0Q Po0RO 0@VUp@0@< 8 K hV (w@0 Q(_Si/ki kp0k0ki -LM0.`p,@K 0@(@  , ,@T P000(H1 R000(0  0  0 ,@PT$K0d p-P(L`4@ T` (@l00C0, 0 0, pT?(`A AQ0 x10  Ǡ00C0( BQG 000Ȍ00C000S 0  00C 0 R0ƌ00 $0S0 (p0S (0``p(`00C0, ( @, Q 0  0 /kp0ky`Pd -QL&P`  pW& (0\`VP @0Ds(0 a?(0 (`pVP !(b2 -LMP0KS4 0P , :  .0 P0@T( 6P` P ` 4000pH(" R000,0  0  040@T(Kw1; 0-L0LP@L0E+0 0P Ed0 $0dE@d>0h$+d/0k -L`\p/@P(0$!  R (c!P\@P P W (0 > (0 R(0P@\((0   0p  !  -LM00 `pP@, 0 \     0 ,0  , 00 U~ 0 A,0`0 0W3 0, x 3X00S100v03 R0S ̠@w@3PVP, 00Q (0X 0) X0TU(K0 , x 3X00S R   00 0v03R0S , 00 0$# $X T 0  ,0`0 0 00 ( -L(MH L0 80K@0L0p 00K@ ,0 PS0 , 40 Sʔ 0K80K 0S @PoD#Q {x L 0 0S @#6:1Y<   *0D @0 L@DK P`P`Y ,0S<Y< 1@D0 @@ 40SE < R p(K5 H @P (    Q (pj( (pc 0S Y0@*A0DKP0`0D0 (pY00S B80SPL`0`0j00`Sf*a80@SfP`8P 4` a -`LPp@T6U#:0`V @@d\)$H04$ 00 F$0=0S |h:)@l06)TX0&h<>)0d#8 # <VTktkHk,d 0-,P& L@0hdk -LDM40< ;pBf 80S0l0 40V70#4@hKL0@TLl P0)R@(0@l  R00 S (@(PU@ Z0 ( LhKY 40 Pl(Ki -0@L,d -LMp (aP U 0P 0S U@ P4# @TPU@$  0>`P0S U@`0` hD0@Q@P404$0_( 8Y(HkTk1; kp0k -LM`@P V 0p @ZUJ 08 L0pMP  ,$  dk 0-PLqD(@0` 8Pd `@0@0S T0TkHkp0kXd0@-dd ,\O 0C2dS03S<0<<0!R?CQ@00@0,0dH00/kVUUU - LM p 4 X W00S7 R= 6& 0PQ0 P`@ R 00R0SE 10 1D `(0 R  01001 X W00S(KW  X_ 4 0S0S0K,0 000 \褟`p4@, K00KP @P4p@T X* (06(P@(0 #T`^ T~V (00`8!00 0X8!0 (0 ```@@ @r`:04 S0K,0 000 c040(0C40(0s$1 0$1(@00  p00p0F1Y0100^",,10,1O0@ 0SRH+ h p0Si l0RO (00 000Y| PlW0@Y Y1( K0 00' @ 0(10(1(0004AtK@P`, , K00K4A0 P``@.00  0$#0 @  0P:)(00 Q0F0T0  , 4K4 pP  @Bo00 0$#(@ 0$#~[0  (@ii/k -LM肟0rPo!0PU` V0P!@ 0eSB101w1Q d0Sop:P1L2d R@D0^`@ ",0 lh0Qr 2PU> 0O Q ,R0jaZ``X@@0 *W( Z``X@@P ( p0S; T  0P( V <1W0J<1 0$# P (HPP 00(|( H40(0C40d( p0Q  \ Rnoi/ki0kp0kx0k -0LMph!ԀL `%``V  0 ;``V 0I`0df%40< 0B6C0 PD#@$U`<d%,04@Z0 9(DI% kp0k/k0k0kd:0k0k,/k -3LMh!D b$ P*. 0KWi @:% ,0R0S8W 0T00000 0R0T000<0 0 84%4P(%"8p@Wm 0 00, 0 $ AQ4 0!@?CSD00D0W0 #0/Q R 0O0S@PoV 0a0c0KW,!,0 ȟ00X@T@0@PoPU`Q- D0Po0Q RO 0@Vm@mUi@iU` 0a0c@\0 p":18p0W1800 ,@ PN kp0k/k0kVUUUii1;0d 0-0LMx hD0@QP `u$\"80TH/P98@ pP (p$0 Q kp0k0k0k,/k1;1;<( 0@-P@ R( 0S%\ ) \ ^ \@ 00\0 S 0  0S  R 0000@00 R P, R/ 0\00 S 0  0S   0S 0P@ 0S@ @0  @0@000S 00S0@ 0\@ @  @0@- R 0S ^ 0Sk0 0R 0SI0SD \   R00  \0S0  0S    R( ^ 0Sm R 0S 0R00S 00 S0 0S    R 00000 \0 S0  0S  R 0S@0T00 S @0  0 S  0R0 0S00 S0 0S    R R 0S P0U00 S P0@  0 S  @ y -LXp5 PU?P0S `X`V 0S @ W`RP 0WP P 0RPPV 00SZ   `X `V 0S ` P 0S0SP0SP 0S  P 0S 0SP 0SP0S PQ0 0SQ0 0S0@-P@ R( 0S%\ ) \ ^ \@ 00\0 S 0  0S  R 0000@00 R P, R/ 0\00 S 0  0S   0S 0P@ 0S@ @0  @0@000S 00S0@ 0\@ @  @0@- R 0S ^ 0Sk0 0R 0SI0SD \   R00  \0S0  0S    R( ^ 0Sm R 0S 0R00S 00 S0 0S    R 00000 \0 S0  0S  R 0S@0T00 S @0  0 S  0R0 0S00 S0 0S    R R 0S P0U00 S P0@  0 S  @ y -LXp5 PU?P0S `X`V 0S @ W`RP 0WP P 0RPPV 00SZ   `X `V 0S ` P 0S0SP0SP 0S  P 0S 0SP 0SP0S PQ0 0SQ0 0S0@-P@< R( @0S%<4\ ) \ @^ 4\@ 804@0\<<0 S@ 8<0 < 40S48<< 4R 0@000@@0@0@8 R @P, 8 R/ 80\<@0<0 S@ 4<0 < 40S48<880S< <40P<@ <40S4@8@0<8  @0@@0@0@40S<80<0S<0@ <40\4@8@4<  @40@-4 R @0S8^ @0Sk<0 @0R @0SI0SD 4\  @ R0@08@ \<<04S<0 < 40S484<88@ R( 4^ @0Sm8 R @0S @0R@040@@S<80<0 S<0 <40S4 8 < 4 R 0@000@04@ \<<08S<0 < 40S488<4R @0S4@0T<@0<0 S@ 8@<0 < 40 S484<44 @0R@080@@S<40<0 S<0 <40S4 8 < 8 R8 R @0S8P0U<@0<0 S@ 4P<0@ < 40 S488<@88 y -4LXp5 8PU?P40S8<`X<`V@ 40S4844<@< W`RP 40W4P8P8 40RTP! @TV p80 #R 0Q:p '88 880 a0lS`1@P11TV@808 V0b#6P  Q00,000Q KpG0C0C+㔮@P+0M=D0GKL4  0C@PD p$ t4 xt Hd @P0d0CS//$/$/T/$/4/@00Sx0! @\ `PPV  {_P@ 0B@@P\ @\P 00@00Sx00 0000S1  N0\ $0P@P 00S| \\@P5\y@8]0 wxedd,k/kTe97; p-`QLP@@Tp -LMp`T0@,P@f;TK0$@K0@ $ @ `cPV@P$(P R000 0  U @0k/k0d -70#L0`M)x0 000p  t P| D W0X$80 S+:S %0 80 S :SQx  t`Q$ TPU$X |lKi@ lK ptQ  PS|@(K@P3P#hD0Qx0S,#t0  0OF*p#J 6|Z4 2"`00 L|d``i 뼂@`m6Q@0<0 t0SM d2d"hD4h2\@0`"040 @  Pp |< @0`6  l00l0xx0S0 k |Pp@`*`(VZJ|(0Kp# p倀| Kᙪ40x;@@P40 6|ZpW$`Yj Z *| 0`Su0S PXVR8Z p|lK|Z 0di kp0ki!Cei@ / -Lp@Mt0q0 t0 pP09LK pP00P00Sp00p0/k00  -L M0 S0d @\0!@@@I0P  0x@Th d0@TKhD0P 0 [, [i,k/k 8;0kL8;xkT8;4kd7;(8;0@- x0Sl061cQ*0!a"400@_#& U l0T -LM pP `@P; H1R @P3 <` H0 ,0 ( D0-H0 0 R 0R 8 $0r40 $000 S100 x0R :l061cR80 58 00R*0(0  < KP $KZdd8; -LHMH T0 D L P 㴀p(`9@P00pH H1R @@T i@ D0H0 0 R 02R `$vD P@1A#x0V3:Dl061cV`1TT @f0,$"(+"+(R/ ̠Č!Č"̌4 ,@ P@HL4 K0`  @P00Y00S@T,0@0@p<0 8@ 0OpH103<@K0Z `h@P0  0 P@H L0@iP fZ,00D pA<KTp000@@Tm (K Ydd8; -LM0 p>0nt`Q70 a@P$0S, d060>0. V  b 0 K@P0 P  ah Y K f 0d 0f#&Bd 0S* 0d 0c#&d 8; P-0L R.  . hqY8; 00 0 -L,M0P ` Zj @<0"0Z!0S_ P@@ SP  Z00ST K0R00} 0@0@TT0 C@ @ء0 h< L  @00KP0 H` Dp ,@ 8 @@ 4 W 0S/0 PK0 .0`@/ V @ T00T00S`' T A0 0C0 S/ V(K" S@f0 PK0 0`@h!4 X00R0S T0 `Fy0Sx B`Ph T {8; k -LM< -L M@H \?pP` 0 \p:@P`0s P,  (0  X 0  0\00 p0\P P(K(㌴,000P0\`p \:@`pPUY   U  R(,  (0 W0!,0 PU (F,PP 0 P[ R, PPU ,K 0PPP ,@(5,,000, (0 , ($,8;8; -0LS0S\WxpD0 0@`,PXW8; M-LM 0  0 0U@` | x t 0 |t\7zx0KpP` P(ij:@p Q P`|@T 0x@K0`@ P P,0 P ` KP a ( a  D0(@ㅳ( { @V 0Ql :PK`@P|`\P ` \ Q 0S @0000$@0S0 =0(KS`p00 @P`@P |` VPK`P`0xP t` ڀ0 |@ 0q|tP  (  0 S0@0   ("0"PK`2@P`P ` Ps~yp 0 S0pK p`K, K0 ,` 0 xPK``PK` P`XP   `Vm 0^\ ,0Pq (0S(@ڲȲG @ 0Q# 000^0 =ڐ,0Pq0 S@ 0R01 R00 (  0(@㢲 \0Ux QQ`VBy0!r T\UPZU@   i0pKj x@R,9;9; 9;\9; -LM0`p @0U `p KT0 Z 0-LM0@. 00H00 0 PE0S P0000| 0S 0 Sj00    Q$0$0$000 K0K0hU9;9; 0-LM 0@C^ 940 0P405  0   0 S 0 " P0  0 0S    R$0$0$0  0 0K0hK00 K0hx9; p-LMP8414a@0TH=L0S @T U0 0S3 0 0 R(0( 0@ @T@T|(@T 01 P 0S0  Q$0$0$ 0<0`(@TKph: 0kkk -0LpWP  `0V0 04@0 0h!m6h!% k -LMp 00@"00\{  0SQ 0 0 0  0S 0  0$0p0$<0@60\0< !h1K  P"|PK`| H000P`@P0 @0S 0  0$0p0$<0{  0 0@0 Kh 0x0 h 40  L( K0 P$0P0( @(`0 @Qd&x 8 0#40"!B 0S@v9;k kpddhd0 kk9;Q00R0 S-LP P00S00S0P002T9;Q00R0 S-LP00 P00S00T:; p-`PL@ POt00P30@ _p p-`PL@ P6t00P30,@ Fp -L0M PU, `@X 0S 0S0S0S 2TL HK0EUS  T 8(D#h"x XŸ@KL2XU`X p42@0TP0 V l0P ! T R ,0S00S40SO 000Z00S @0S p0:0 S8  sP @Ul, 0 RT(KE2L^@0S W 3S@0S<0S4 ,@K ~sPV3XQ PX s~,@K hsP 80SH0S 40X XsP \HK @h80S40S 3S+xe9*Ld499 -LM@`@ 0 :, l0< x P kAq喏+`PUPE_10C8#8S1[SY:A 0ǦP04$48,#H d,0訨P Cl; 0,0 l0 1!08!x#W7@X,PUPE#108#8W1X*qA 0ኦP04$48,#H p,0kP UPE1(Kqᾭ,0, @W kddػdܻd -LM@`h2P< P,0 E 3SD,0SA00S>40S;80S89 0 Qz 0@S.0S/+p 0P" R㲀 0S0s 0S! R 0SJ  0 P 0 1(K 0 000  0, X,  (Ko04(4 S :0  0˧P @0 ,00 ,较ᆨ0S0S P ,kk -L4M✒ 0 , P L SP"0S/0Sq 0S 0S0sh ,0,`Sf HKH@K@KL0K 9P , 0Rh(K 0 H0PK@PPp\ H R 40<0L0 Lw0S$[00S40S5 @0P@GP00S 00S 40S80SQ2 @p0@4[p@30 R100S40s80S p+,<4 4:00p08)P0S10P0 0h!xeLd9 kQ- 0`SࠑQ R0  R 0SQ0S0 P0S0 P Q 0S 0S Q1\ \ R 0S0S 00S0 \ 0  2  0 2P0 0  6A0AS-0Q"R 6Pp  p P01:0S S*S P P1:0S RࠁQ^$00Q@dd -@LK   h 0- LP @  P00 00 p-L M`0@P$K 0 9T  0R& KphOcpT00  \a00 PQ K0 S  0RKp|(z(xeP98:;99 R-L@p`pOR00Q pP /.00 S 0bS1 RSh:; -0LS@ 0P P S T oPP P0P P P9 -@L@Pԑ -L M0@PKDa@p$0 o8K0 @0K?Kp1P 4 00S 80S0C80$ 0R K<0S80S0C80ʮ00'xe9 0-@LTP@T Q 0S noP0 -LIM0p0C S P0 0R&KF"`P KkoJOK0 01K/!K-KT_ R000 0 0 6z'xe2i 9 -@LP6j -LIM⌡0 0@pT( ` @T 0 R BoPPT0007P0P01 86 p@P70P0( 00006 0NKR/KPP0S 0  0 00 0@p.{F( 0R$K6P 'xe1i 09 p-P`L@ 6 '0PP700  PP@ p6P -L4MPq0P 0 @` R0 10  0 Q 0@00h  BRh 00~/ 0R)K:_00S 00S40S80S h SnP 0N K.0&D M100S<0S&xek$9:;@9 -LMh0@KP` D$0 X Dn <1U  l0 0D X0K61pP 0R K.0U@ @ 0pMU X0S  p:U X 800C80$ 0R KX0S @Q . 0X 0 0@`X 80S080X. J:*&xe:;:;:;P9 p-0L@`T P0 mPPUʘ@TU p 0D!x/P 40 <0& 800C80phkk -L8M`0@ P 0 Q0 `0SP  R000 XP 0RK 3pP000 0N K.0F  80pM%xe;;d9 0- 0LPD!/@P 40800C800<0& 800C8000h -@LPV pR" 0S 0S RQl0S `t0$0P Xx001S T `P ja0S 2`P000,l1 i -LpPM 00`Q0S0, 0 P6h0H0SyUSu HPPoHK,Q-0S x |0S^RvL9 RUV H0S |0SV|HG@[T h0s @0@0@0s @0@0@ HP 7d00d  \(0@0Y@@gG0[S@0[S?0[0S[P &04"48#P , 0R(K P 7 R00 Y U  0 ) 0(0D'(00@0@&$ `00 |0 0 p0P0 P _S<==P d0 006SC2P d0 S0@0@f0@0@W-0S S / K.0㼧 K#@Kh kP0 000`$$0 K.0㞧| mKoKk<9KᛐK圀K&04"4$9K  $@K0 K 0KP 0S0 0001 D0KkxKdKကKKkğ\KdKcK&04"4L 5KD!dK@-@P   tkP 80S0C80EOKDk4( 0 dK0K  ! 1 D 0u.P z  KP 00S 003 d0K{P Xktß0 d0Kc K04 45KL dKD!,@P   $kPg 80S0C80ŰEOKD5k2( dKK  0 ! D 0%.P * K LPM 0S0 0010b(2 R DJ2 R  K.0 ἦ 80J6w s0P0 1 R 0 K.0㡦 pJ80S0C80f+c80S0C80Ů+ 1 R  K.0ユ 80 OJ  KP 0S0 0010QZ 0 R* 5J&+d0 R?  K.0T l80 J2&04"43K+Kxepddk<;t9,<;99ii9l;;<;<;;; -LtM`S, p@ n 8#QP 8Q _*8T!0CT*8T 0TI-P x8Q p8QU\  kFP, 0Re(K08T (8TL 1CTK 1CTF 8T^ w4T, 0CT( 0T% 0CT" 7T^0CTs:Z 7T2 7T 7T  1S  P`70S-P07T\ 0TZ !$7R/PUPU  0P|P "6T :60SQ 0S0S 00S` X6T $0CT86T0CT*%0CT0CT*!1CTM1CT 5T 5TPT5T| 0T{U Zq 0s % S $0s l% S 0s @0@0@0s @0@P0@4T [,0CT14T 1 0CT 0T:0s !P`Q R@ʻ 0A0@0s? PaPU`V@ʹ 0AP0@1P3T 0T@ i2.P3T| 0T6`P@3T)L3T& 0T" ,,ZPd0lL@ P#U4P KlPh ` fP4K Kp@KKK0P 00 P@0[d0@0K@ [!|x0 K@ KH0 D VP Z 0S00 h00h0X,P@h2 NPE(0P0>0@P0@80@0@QA0@0@@RP(RP$UC0@P0@P &04"48#P R 6R00&04"40K KYP>0SGP,xeliHMi iildiH=;Ni4WiHeiHii "i %i i i>9Ii i Qi dFiRi Si !i D=; -LROMğ  Sd1  0R,0 `  4Q 1CQ 1CQ -T, 0R(K0  0Sm0Sj1SSf1SSb R_3X^ 1CX[ 1CX0I dP P@QJ@0`SE0SBpKg  g Kg@T00   1FSK00K)` d1x , p\`K g\P<0X@P80T@40P00  \P X@ T P ugP <@K{g0)P2X  \K pgdpWGpWD 0SY L`K \gLP<0H@P80D@40@00 \K LP H@ D @ )gP|1X2 WOK;$>;>;P>;>; -"LM0PFK @8,0 d  d&04"r0`1KS@ALaPL 0RS00L0 S0SA Na0N 0RS00N0 ST`, ALaPL00 LQS  P`0 R-\QPNN0`@TY0.S 40S X*,` 000 04 0RfQ 0000 S 0C`00c 0Z "dV -L 0S; 1 0( 0*m qUP/xehkd k9 -QLM@PpU UTP0 SRL00SSHDXE,p LYA@> ;` ?T4?R2T0HP4 R0I\/ T& R$ T"0X0Y`P UP,0pcXj Y X`Y@   TP X0j S -L M(0(  @ $(,L<4,4"| W@P`( 0Rn$K1T0 10SPDKT0 C0KD K0S; " B?0@1 A00S- " <0@1A"0S " 00@0@0S " 00@0@0S " 00@0@0S " 00@0@0S " 00@0@0S " 00@0@0S " 00@0@ R0S " 00@0@| xepdkC;xC;HC;,d\9 -4#L0M0p,0 P0T0 0L0 R0% :Xz HK RNT0 H0KG KX  e2@T `@TH l0  v0:S,0S00S_ T , NP0S 0Sk X NPQ 0"0 # Vd !0 ^P] l 10Sf %Y@  L0pPI )[LPF %[DVF l h10S L K] Y@  L0oP [LP [, 0R8(K40S80S @*e P0K`P P 0R0% c*t-$0S(0S @e0L0 `jZT0@PP PT  L K xekʚ;;kl9 -LMR8 <0  0848#800 ` 4 pV PUPU 0 R0'0   PXUYF 0'X00SV `pS00S0 @ 9P@7 P1 P0  0 0  < R+  `! Q R40,0 @ ,K -M  )M00S <4 A < 4 `00  0   8 04<8#,("(#8 04(K100S00 Q q< 4("4!<,0 0,0 0 $("(0 0 `_4 ꐫd@d -L M4 !000 0SJPH 0 ,1`VC @T= p,p @T 0 RZ0P P& P' P  0   @pT,0S`V p(K000P BrLP0,0 rP    pp40`@d -L,Mlş 0  S0, L0 @P` K:X/ @T@ HK@@K`L0 TG0KHK[LHK(P 0 $("(04"48#88f#pAZ l0l0,0,0 R* Rp dY@l, 0R(K RWp`ZO Z* Z y꘶0ܵ0ܵ0P0 P0KE_P P 0R:0S W0  X@0[S S T KPH`Kp |3  0L K28` Vk^Y@Py  XPVD V:YY@2  <`@0[S?0[0Ss2 @P 0S 0S 0R0%0"` :V  0EP Xp~p<`8` ;?Y1 ` `( K0(` KZ 0ķ0 0000 00880!000 P 0S0 00s00X18 00 W0L 8 0000PK4 P0 PK0000W`p 4w?0[0S:17 0S&04"43K/?0[0S S)  P0KQ^P P 0R0%` h**GX>xedii9; -LM  0`,0  0RPf " 0@U-P>`0@ 8$H0S 2   X(M, 0$ R(K 0 S` p K:WY @: 0@ MP. ̟! !=0@@8DH@T{ JTe T TLP 2@0  @T^P0 000\0< R+P(8,H`0@(8,H0S 0K]P  0R0%p * 0* ;@P $(T5 T  :T TS <; R 0Ps0Kn00S 2@08 8< @T 8H 0@8H\Uh >0@L*084HT[ TP 2@0( (, @T` :T0ST 2 00@0@  Z K.0@妅 0Ps)MH T00S 2@0  UxT :0DSdqT:UT 0S 2@0x x| (0Y@P !S00S " @00@@0D@0SXA00S 2@0` `d @TFUS'0wYP  }3#00S 2@0P PT @T(U5P'0YYP  x>00S 2@0X X\ @T U&0;YP  g100S 2@0H HL @Th&0YP_  K@0S 2@00 04 00S 2@0h hl @T'U%0XP= 50S U U`%0XP ePP $5 8X`0@ 4$D8X  /   <  1 T  TC~00bxe kpd;C;9ʚ;dC;ii -ࣟL M`0@pA P0`p 0'Su1   V WV T(K0S 0SX 0S (0K  #* P,0:Sb @P 9PQ0MSp 0CW P4 r 0/Sj40  0Sk S 0Sn S  <( 4"4)<(##$#(`p 040  0 0@4(0@, 0S0S0S (XP0 0@0@ 0R0% 4:PP 00R  3 0 0@0 @jMcQ0XP4 0 R_  T&Z 00S0 0 000S000 00KYP 0 0R0% *l\&00S St 00S Sh> 0@ 8$H# kpd0D;W; 0-PL @R 0S0S R  P @0$ S00 00&dLD; -L $00 0dddd -QLM# @P`p, ( @P 5", K  pf`0, K $K -`L 4尀0@!0c48媀0!0c4<奀0P 0c4D垀0 0c4C@@D0@ 00Q0 00Q D܀P@10 R 00d  SH,0 0C# L0 tpPPnP@ꫪd -, 0LRP*L0 ORG, 0S*4@pD`@` K@X4<0,0 H8@H00 Qk,ꐫd -Ld(Q0( ,S  3S001 001 R0P -L MQP@PE0L,SEX0000000000000000000000000000000000000000000800a0 `[pP0S @]K-P2\0 P@Px0 Kh^\0 KhVTP000 PKhddddd9 kkx -L8Mlr@PP$ ` 1$ 0R KQ<R00000000000000000000000000000000000000000000T000000000000000000Q:N0K QVN0[0M0[ 01PڢQ: V0KP%[00SVV0[0(Q:L0K( PVF0[00Q:N0K PVN0[0M0[ 01Prpv #xe9lD; p-PSLMPK0C`@0%T  @0FPx@x -LMp0 @$("(04"48#8(``V`!3T (P  1T +T (KZP*0V':.0K P,0[S! -0[.@[01PY3T0V:*0K jP3T)0[)0[1001*@[PP<T000 -LM"0K@ pKP3T!0[!0[00QQQ@P00U00S ; IQ1` T ` `?OU* 0%P PP@ -L,M0@,0  Ply /  DK)0D HbPll 0 R 0 0( T @3T 0T6 T PP p3T0000aa 0V 3T T#T00T0 @jPgP2@P  t, 0R(K<T<T PP+T+Tl0 3  l0 2  )0aT0P0T0 @0P@@K B@0[S` SS ZZ 0SV l0.  )00 aPllfP@K4  ,1aPW 048< ̠<Č,ʠDK= )0D aPllT (@P  00Qwl0 1  )0a0SOl??0[0S SK?0[0S xek9 0-0L0@SP ڀS S O0S00 0@0@ 0S 1  O0T@00@ P @P00 0k -LM`Rp"@3 1:S? S VM*  hp  `bV @0SV;0 `bV(KV0PU:0 =0K B00 <4("4!<^00 >SM: 0V R*KA"[04"48#8 00@P  O+00h N`*0p@0@P0h @P=,0T0h `@0p@P@P,,00h k -LM@` 0)S0p(P 0 0Q( Q0%(":P*0@P  (K( ,0KTP , 0R:0( ,0KTP , 0R0% *8!0 EP00@k; -LxM∯0 ,0 ! 0S \/9I 0@@/9I0S @ ? ? #=0@8H0S " 0@.P`0@ ~'R!P00`S5 p.P0`0@0@0S 2   N, 0R(K (RP 00@X0@ 2  0-10`p  d-Pd Q0SW Pl 0Si0Sf0Sc0&d,P0`0@0@0S 2  $ 0P ,10@#P (^`,#= 0@D,8HS4,'= 0@,9IH,8H 0@+8H= 0S$0S00@0@0S` 2  $ VQ0So ^d P 0Sn Q0Sm 3S. KP' +P0`0@0@0S 28 8< 0S 2    0P 0S0S0S 0S0S 0S$0S0p@0 0 $("(04"48#8( 0 P`  (0BSc:(R 0S 0 (000S T  0S 0S0s 0S0S 0s )P00 @WP0T@ 2@ @D 8V X@ 0R0V0S8 K21C0x10K T8`P 0S @S0 R(P0`0@0 @0Sp 20 04 fQ Q ^ ^ Q Q ^  ^ p6 ^00S P 0@p00 G>00@0 A^ g0S 40R&> 0@&p^77PPl0l07l03^66PPl0l0,l0(^77PPl0l0!X8#R R R& *P>R=Rl;R <RP>R=Rv;R <R-> 0P 0 ">P @ PR BPPE11 1l1 110T@ 9P TK0H @PP#T0L@KS T /T000 = 0 /w R R!Rp$RnRl #R R PX_ Q0 0PKP pP Pl0|X0 0S 0 0pPm5RjPi@R 1RJ=0 0 P0P0"@R d1RQX 0SY0 @R 0$1S SPP@IGᝯPPDX 0S= 00:5R7R1R 0BS")X 0S)0PP P Pl0P00l0l00 0l0l0 00l0P^ P xe k99! (R-LPp( B(0>P @@0S1` =P  0 0 7a:P 000 0 0 0 -LMP`U<P1 @0 0P <(4"4!< $K= 0 . 000):P @ Z<pP ; <1;77 0 @0 0 000  ^.0@;Pp -LM @4 8 4<,$@a8#$@D  X00(@0 |R@y4`;PP@q P  h:@Pl1 (@pp  @ 4 ,0K0@PZ400("Ƞ0l08#8 $#$(",0^!"( f , 04<8#,("(#8 0 0L08#8 $#$("<8#8"(0  0=P!  R4 000,0) , )<)00`,08^8;@PP7@(K\i -LMϟ 00  0 <000S U- 0 0   000S U 0< 0   000S( U  0+ 0 0  P P0S|K`P V@ ➉ " B,  L,0S) 0S&0S#0S  P0@ |0K-`0  '|P- 80S0C80(ʩ&U I`P 0SX  X00@ ʟR|KX0\@   W 80S<  % d \ 0 $(:0S    R *8#4"<# #$# 00s 0X@KPU,0 PKW0K0X0K( 0 0K K0 ( 0`PPB H0 0@H0L@  0S " P00@P0T@ R 0S W 0S00  1<1 KR<0K @K@`P0 S 0  W h0S Q 6   R R Q Q Re R QY Qw R 1@0100 K ! B0K|PP`@1 @01 W l0 0S,20Sp  p S:0Se RcS: 0 P`|PꨀP `P```  1`PPDAVƟ0 0@0@0SB 2PX0 0@X0\@000 0SQ< 0 00S Sl0 48#8# Pl  \00@ |K-`P  Ptc0S1<<1P " 00@0@6Sş0 0 @P0@P3` 2P 3`X0 0 @X0\@v400  P|@K$*@ @ ]T 0SQ8 Pe: 04a 4P0 0S  ,00 0( p`P0S " `00@`0d@P007U l`x0p0@Px0|@ 2p pt   0 `XP 0V0 7P(`00S000 00S0 0 00S 2Ph0 0@(`h0l@00S S 00S Sv@T @T 0 R B**PT Q 0S  !0S 60S00SV7P 00S8 0 D1  00S2 00S S&W h0S  Vp0 0@p0t@Pv(V `0 0@`0d@70S4 " h00@h0l@)0S 0S ,00  xek90E;0d p-LM@P 0`R :P" 0S* 0 @0@P0f @P"x 0K<P  0R0% *TS D0@P0  x0 01 xk; -LMP`8 ,P} QPy 06pPq 7P D!( @@0( 0@0 0`0Y0 V 0* BVp  `0 0@80P0PPPPPPP 0S 00S P P24`K<2 $)80H!0 0@0@ 0 K4 2@80P S & S S Y00 @A(K ⻅2  2B  !2 !` 㚅6 k;i9 -@LT @T 0 R40S C R004   -000 @TCS0`Vh·@0$E D `0( #5#3 0N1Tk@ddMb P-L \  R @T 0 S *01 0 S00@ 0(B% xE;E; 0-@PL` 0S[ 0SQ P d1 RMX1P U 0SCP0 Q D@VT@ "0 00@0@& 28SS C8Ss Po/ 0   `VR @( `P 80< 0CR80A A@X T/`P@2 Z K.0]0 `@0 P  v D1`P@SP`P 40 `40@|00"0 0Ba0 `:@P`0( sP`40 `^p0t 0 28jP8C002< (00 28\xetdF;001 1Ba!0 Gi&P 000028!,10 1 Q! `V p p<00 00 P, pL 0  00 ?00l0 d0Ba  04F0D(A >Xd @TD1 S 3.00Z KS P801N0S0Z K.0 @S8@0 .00Z KS P80t0t  0D 0  H0Baxdxe0 0000 4 0000 8 0000 < 0000 0 0K<K0K0KT0P 0 0@00 埣K@ ᆥPޤUW K1 R`, 0Rc(K0L@K0 0 } l<L08H 4P0`D0P@ P`0`@00 0@K 0K<K00K@ VT0P 0 R 0  RL #310" cb ` l0 R Kz K.0M1 PP`8 0,Uxepd: QN@P;P;9 0-\0L@PT@T 0Sd d0RP 0d -LMԒ\0 P,  2 R v K.0Md0 o, 0 RT(K`2@T@T T \0 d0d R⃡P 㖠pP] HK @`K(0H0K @PL A L A GOKD 01 10 0 1 D 0KPP D!\00\0P800C801 R v K.05M$  K.0d@-MP K.0'M8 $!0P pW 0 R pWD0 R v K.0Md0 8$axepdxP;d9Q;P; -LMt\0 0, 0 P2 R  K.0Ld0 (P, 0R(KI0HK0 @ p @Kd`KGpKH@KPK (\Kd@KcpKDH0K0 ` D 0KPP%\00P\0 D!g<1@T T \0d0d R @T R 80S0800 R @K K.0zLd0 8PEqP `P P0 R  K.0_L8d0 8$`'xepdlQ; 9dQ;Q; -`@LT  D1!P DP 2S@T -L8MDSDs@0T 0  @T X0 P @@2 R T5X0 \0O P\00\0@T 0S00S@T@TX0 \0PUO X06@T 0S00S@TR@T 0@ P P:@T R 0@00 R 0R`KnP\0\00\0 PP T1 R N K.0Kd0 ,Ps`P 1 R\0@T 0@ P >P000000@TN K.0{Kd0 `H\0T X0 \00\0@Tk 0S00Sdxe4kkpd8R; 9 -PL㔠 h0@#10#T`p7 p@T 0 R0@ d0P 0/P 00Sp`0WV`h00Ch0i裡WPPh0`0h0MPPh0p0h0 -L K 048#8 $#$("(@P@PVL@ HP $KP  <(4"4%&LT0T @D0$%#5$L D%#3 000 0 4 8  <,$!$ , PhKPpQ% 8`Q 01`P:0SQH t4 R  |8p1l4@P $(-HQ 0S X\> 0 A< m0 00T7 3 R% <K K.0Em0 D_ M?KP 4 0R0%p C*w@TD3 R  `C83 R @: @ 0<K@ @u'0S~ Sx 0 S Kl 0 GK#1K$KPf 20! 00[030K 0["# 000KKK0 $ (,< 4!4"<0 0 $ (,< 4!4"<0 @ P !P8BK &8<0 $(, <4!4"\ U*X1 RP ` K.0D 0hE Rp0 p0R@1*T:0PU7 ?5@00S0 R  K.0D 80 R ` K.0D 0@@Td @0 R  K.0D 0\|8xe4dpdkpT;T;d6MbdT;9 kV;;HU;T;V;U;DV;U; -LMP` 7("B 1@W b`0`WK W300 0 0  0 0 0  0 0 0 0 0 0  0 0 pG0 W `W 0 R 0,8(2C"B0 cbR  0 R p0\d0LL'82C00c08 P @@ R,B B[q p-@PL 0M\("( 0$H,8L2C! @\` 0%H c@`R,B BR,B B,0QA>A0AQAApq90@-Q@; R,P0 0,0,! ! 1!4##!#$" " 1"4##!#$""1"4# # !@D#$""1T"#T (P0@T0,0!," 009Q  0 " p-L`P@@Tp -PLM0@`. 0IK$1  0K0R0pK Pd@0 Pd@0  Pd@0` `&$K` S-L@P`0 @R1SVPQ00QppW(,0\h0p(S\0 p,00L  P  %9$0( 4`,p$P0p@Y2Y20% -@PL$Q ,0S 00$0 -L@MPX \ `0 (K$pW 0 0,  P, P`4`< (0  0AS_1`11`1$1`1`11`1`1`1`1`1`1`1p1h1 U, `F0P U, V\,KX0`P@,` ,0H0PU8s, `F0PU, kV\,KX0`P0S0 8P U, `F0PU, V\,KX `P( 0P1:=0VPT0 # BL !0@UᲠ:,0`F,0 T 020CL01 @PT粠V\,KX `P `4`0P =("((8#R  = 0 K0̃"(<  \`d \(PERQh U, `F0PU, V\,KX `PH @< 0 h,̟0 \ 0 Q7h威PEP 0 000Php0P0 S.l0TL T l L T0H H/D DP L0 Pv  \; 0 < 0  ,0H,0(8S0b00l0 $0 #4KR4$p@0,0% -$PL4p^@F (\ 0@c T#*0 ``T*:d %R@T*00(0S, 00000R00#3,05$ 02,0(00@c T: lR (0,00 d Q`4d Q(0,00@$`0 (P4 -pPL`@$PU 0S0 S P#( T b4Q(0,00 04d Q,@0 S 8 50P 00 -LDMPT  8 8(K$X PH QL  \ 0 @D@ P0P 8p<`<@ 8 Sd!222,2\"2P"24!2(!2%222D22T 2|282L22$2P222 2h"2"2 2X!2L!2@!2V_ L`F0zL Z0Sp8 ? 0 0VK L `F0zL  Z0\"'`?P  Ud 'w\`Pd JRh? 0 0V# L`F0zL Z'4,<'<$00 0 p80 0Sx  8T\aH  D00L@P(08pS<0S  l@L0T l0 T/^p0P(P8 7 0 07 0 0`l0pPX0Xd 0P P8 < 8 0 0G-|M00\`0 S\ 0 |0  2R0 Q2B@P0 RPU0@ @@@ |ЍU p0 RpW@0 00SJQS03<X 000Q\ 0|0 Q@ 4T $D@0 ^U010!W0!P808 0200@(0@L @$0, 840p  0@ , `Tp$(ń0@p@`p0 4 01# 1 l!c0  ll 0S@BpB @0 D4  4Q40A0 0440|0 2R0C8#(@Tw 000|08"C^B4 0@ T< P`0U |0S (aR  00 cRU  0( 0 [S 3 "R< 080 0  0bC1 @000000d0U0P0S PZ $(,80>P00[P030"S @  7 4^)  P0 4 @0S80 0  04L0#04 0 @!@00 4P @0 !0084 0@00400@̠$0(@,|9<999P$ R 0SP-$^ 01 0C$ 0 B0P- $P | 0  !400  0-@PL0$Q P*UEU IU[U(0S 0,$D0S 0,$@0S 0,$80S 0,$0,qU0$00gUqU 0UG-p,l A?@0CR0Mx8|P0A?00`0`0, \0 00@ R 40 0 0t%Q!\!  00 RY*PUW  0 ^@ 0@ST@ 0R 0R`  0R' 0R" 0R 0R 0R 0R 0R  0R ` R 0lH0[-(pPW [-$p3H@, 0(8, 0(@L 0(D0  (8P3 @0S0 D0S- X+ , 8 H, @ @HL D DG G  00b&M·D0D @ `P0ˇ[$Kn` p-L$ 0PS`1`!V  G0$00   00 @0@$ f 00f0$0S00p -L M,`A/Ht B04 ,0 APpWq 80Z00 lt@ #*Z   j p$0 0Sb Sf 0  G0 0@0 @t@ ^t 80l X H0T<#0H0$1^80 R4 ,4l0<  `Sc:8 RGp0l \LD0h hhp0l \ 0P hX("^`@0, 0Q hX("ȠPaPpW(K8 88 8 -@PL`P$pQW 0S S; S 8 8U0,08AOC@DU0d@` F8l@\@ XH 0T>#PD 0@H08XT0 H4."D H @ H0D 0@@U*0*S -PPL@$`Q00V0SQ0Sn 0Sh  :TRpp Wb0S *R(0P(@ ES_ IS [S gS. Q TRZ:Q Rt0ST 9QN )21C00@S90PPpp,P~0(0,0Sq00 0S {8 0 80 #4 0 8q000S 8 P T  0] T XP ZB0SlS@ 8080 #4 080 #8 0; 0  0  "4< 0 "88 0 04 0BL0S0c00s3Y) 00 S&0B2l 0ĀRX'  c0#2c aq00aQl0S 8!JG H800SS@SP ?R 6 0S   0p W p  0 S,0S ^* n88 0 \p,0S ^:W0[0 p0$0S   0$ p0 0W p  0 S,0S ^b:u 0 \p,0S ^|:W0g000Se 1 R !"* 0   1S 0 S,0S \#= 0 \ ,0S ^* n880 R I00 0\U n88 n8|88!if 0SC{[00hg00kI00+ n8[8R n8S8z J8 000C 0 }0 0^a , 0R  S $0QPS 000 0 0  0#4 0 0#8 0 0   R  0S[   0 0S  0  0#4 0,0S6 E0 0  0   0   0  R 0 0S!0 00 q00L0D 00pCL   BD8 8RʟR0899B -LP@P$`V q@0 T00?Uʄp吐"!B 0h 0 P  0 T h 0 @ |P p89 -`tL\EPPUl8 H 0XT 1#D04 H00 @ H0D 0`p0Xd0x` 0\*,0lpA?C0ChQ 0BSU``0Sxlp\`0 SdTTT4aLD4A  !t@(4, 0! 0A9!0P933;ӗӅ@! 0@D00tx0l#3LPlptxpTlp:8 H 0XT 1#D04 H00 @ H0D 0lpxLQx0NUp0`0hlp= tBPPX_tPUZB UPh0S 28l  @RP 0C!@ 909hP\l P80 `Z00` l0\00 RtZ\ R80 b0L l0\00 Rh0S( ||18  0@R0`1  @9H!0900CQ lptp@ lpt0Slpt0 @hl0t \l P80 `0 l0\0R0 R S xp00c Sx0`0 lpQ`Z:9  -LPptDQQl8 H 0XT 1#D04 H00 @ H0D 0pWl` ,0l`A?C0CgQ 0BSl```\spDCD3a83L  !3, 0! 0A9!P0922;ӗӅ! 0002 t`0 BQl\t\PZ0L`0l08 `l` 0HX T2#D04 H00@  H0&D0 ` p BR` l``l`^j \ R80 b03 l0\00 RYxx1 8 0@0`1  @9H!090tl` 0CA`Rtl`l`8 `0`0l` H0XT 1#0H0tQX Q!\l P80 `X00l0\00 R XR5Q3l``-X:9  p- 0!PCUQL@`tP7l0\0 Stl0 P0`Qt08000 al0l0\0B0 R l \,0 aA?C0CR:Q800l0\0+0 RpOt0p03VQS \l P80 `V00fl0\0 0 RVpVp 01P? "# $P 00S P0S p-PPLp$`V (0S ,0S 0@0 @0@040  0R b R0q0*0R0,  #@8(@)L0D, 00 < @CL   BD`21C 0 0|` H@l@\@t@x h@p 89 -L M P\p` (K0@R1S  P(0 S0082(0,0S,2,0qV`f, V , `F, 0HSUV00V0S Y00é?Z00ê?40 0[-(V `@P@ 0Πh10 €0 $@B, 0A 4 TP 0`,40Xp00 L00(8, 0(@L 0(0#`D 0 (80!S  @0S D0S P 0`\ 00$P儐删(Ko404 00 0M_Y2Y29 -LM@ 0 0=K;0`9\ .] 0Q09  d0xQxA H0LQ40 , ,0 0 | \0p@-P0P ;L0`&N,;<0 @P` B[$0K8;`p@dd dG-X1p0\;^M0100110\[`1@ 0T'+ 0 P\[3P`1!0 \[\1!@0T:`P@0 R P0`T 0\+Ѝ0<0 R0 P\[PXA-\p10  W@? `P! 0 00P`  ^`  P0EW#10\^ \^ V P! 000< 000 \( +-Ӳ0Ѳ000²0Ѳ0| G- M0@SR 0 0`1V0ಐ Z > VEP 008#88#800 "$ 0 c\ 0C0PU0:0. \e0nPLuʰ 0PU00*Y   Z  0000C^ Zh \$ 10. ⨄pP0gUڔ058#88#800 "$ 0 c\ 0C00`F,4 pP0gUu $058#88#800 "$ 0 c\ 0C00sPUNڐF058#88#80 0 0"$ 0a PA~ VA$3pP0gU+= 0%r0P UF058#88#80 0 0"$ 0a P AM ЍTF0 5 0C4Ÿ82 % 2pP0gU/2 %qP UB F058#88#80 0 0"$ 0a P A T0 5 0A4D!058#88#800 "$ 0 c\ 0C0p0P Uʸ F0 5 0+-058#88#800 "$ 0 c\ 0C04p0P USF0 5 0 0@-0@P 0CU0 0 ! 9090 0@S0p p 0<010)EQ )<0803ӗӅ1(0  :9 G-4@ MP '!0t`P0fUڜ058#88#800 "$ 0 c\ 0C00,4 Q*04 0CⲐ Yp 3+ 0̣` P0fUڸ058#88#800 "$ 0 c\ 0C0 0\3QU" 8#88#800 0"$ (0a"(R#A IX223pӗqӅ!0` P0fU}t058#88#800 "$ 0 c\ 0C0 0$2QUq 2  e^`a`0>8#88#800 0"$ (0a"(R#At1  QN:0TkpP0gUF<058#88#800 "$ 0 c\ 0C00 0 Ѝ0 5 0S00 5 00x0 5 0X 0 >0< 0 >0Z 0 5 0::X:9:D: -LDMh 0& p`W6@d <d @0 SU 0 5 d  \ˁ\@ 0S0#d0Yd1!0Lşd \ @ ,5 B,UX 00b0 0S0d0h 00?@T  @TQ=0! ğ`K 10\ B ` Xğ` 0Q0CC!10 \K \  000@  0S 8#8  2 P 0 0 `{3p Rʠ`   B10 \ h pP T  X 0\0 \3 \㳐43 ! \ಐ0PU1> 0 L` A010 W`` 0 P0S0\0Yil 0Tl X0@pװ 0#!T R 00" PU`QO G@2 R 0> 0 0 Q0CRA 00 B 000`0 0C BS`0 W> 00L0 # L R 1> 00P!Q@@PE 0Sc0 N!! p^L Y BL pI H K 008#\d0S P@ 0^ `(K 0S08#x 0 ` 0R(K0 rC dPU@(KP=TX< 0@-P@0S S t0 0"$0C0 0< 0 #40  0 -bLP@ Uzژ058#88#800 0"$ 0a\à A882(RpgPPŸ+0Რ08#88#800 "$ 0 cZ"0C0 0!a0P 00eS' U:x0 %`Q XLL0>8#88#800 "$ 0 cZ"0C0 0a0  ;㳠 0 0 0 % 058#88#800 0"$ @P0a\à AX 0 >0:@-0@0Sڀ  0#4 0 L L000S00 0 0000 -@L@ ^pP`A 0>8#88#800 0"$ 8 a#8S2 A00  8#, #808#< U0 0 \  0 >0 -LM`pPP00 @2RU+t&(+oԅ@010> 0 R@DT0ş  5 0 ^ !0S  W R0QS38#88#800 0"$  8 a#8S2 A0,S@ T J048#88#80 0 0"$ 0a P AZ㠂P 30 10> 0 ("(("(  0#40 P0b\à B U  Bp P0 10> 0P U ,0P&M C@   00i00S(K00X048#88#80 0 0"$ 0a P A00058#88#80 0 0"$ 0a P A tJ0 4 0gT0H . @4A0 5 0 Q::X:0 ## p-L@MXPKX T0 H `l @0D ( 0 , @P KpP@ IT@D@00B@; -LMO- Y I* Xb$\(  O-`Q* @@ P@ @Pp$DL%T\ @pP$HH @ PpD%\TP ` RPb?in4_cksum: out of mbufs p pgQMW@PФP``$($,Q@Qx       x         @Q@ Q x        Q0@cA@0  0  0  Q@A 0Q@Х@PP484<   : Ta% c -LPx2222222222ȁ2Ё2؁2222夸  $(,04@DHY;( (0 -L0 hI$0  0   00#2+!  R222Ȅ2 00 K0"880A10 00  Kr8 0A100 0L0 Z;UU33 -3LMS`p3P:W) @P0@0PU (P (KQ < @@ l, K00K_P , P UJ U 4咶$C@$;03$ 466cR 80  "82<8\!l\<  0 R00L @U[ U; T8H"<0S(2@0 :#::cR80 0@0 00 R !p10P1\ R 04 K04 1hxp,0d1 R PpD!,P01\ P,1R' ,4 K,4 h00@0 R p 0P0\ P0R 04 K04 hplp` ,PL0\ L0R ,4 K(t,4 0h .) `S  `0$$ L000# $00\; :\;\;x\; -L,M` ʟPQ 0S @0S @Q9% (K @2S' %.9!  p@A0D0S, +4 3D 4 P0 D9L <)09 < 9 )TH 8 0 @ x #0DWS񟗤2ؓ2ؓ2ؓ2ؓ2ؓ2ؓ2ؓ2ؓ2ؓ2ؓ2ؓ2ؓ2ؓ2ؓ22ؓ2ؓ2ؓ2ؓ2ؓ2ؓ2ؓ2ؓ2ؓ2ؓ2ؓ2ؓ2ؓ2ؓ2ؓ22ؓ2̗2ؓ2\2ؓ2ؓ2ؓ2ؓ2ؓ2D2ؓ2ؓ2ؓ202Ȓ222ؓ2ؓ2ؓ2222ؓ2ؓ2ؓ2ؓ2ؓ2ؓ2ؓ202 222L24222ؓ2ؓ2222ȕ22ؔ2ؓ2ؓ222ؓ2,2ؓ2|2022 P0spA0A0S Q ,Q, 2 8@TJ%40S %%vD T |h4%0%(0 0@%$%%( 0 4 D1?3  ?#%{ u%odj`@pT 04 Z DW p@T w04p@TC ?%90!1 H*%t$%\O8OSp<#B %$40S 3  Z p%p1?3?3t3t#0JS$Jt %L30St 2t  W <%60S %08| thKA; @@ l DW!p `@,   db^LHYgU\THy<%(as5e' :p:H];::::::\;j;t;];\;\;j;\;\;;:8];Է:$]; ];];\;\;dZ;\;\;\;\;\;<\;\;@\;/;p ;:\;;\;<:\;;;:\; / :叱\;000 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 2 R 2 R 2 R  2P00 R@A0P0A Rbs_notimpl_%s: args at %p-(O {@mmap@r_1@r_2@r_4@r_8@w_1@w_2@w_4@w_8@rm_1@rm_2@rm_4@rm_8@wm_1@wm_2@wm_4@wm_8@rr_1@rr_2@rr_4@rr_8@wr_1@wr_2@wr_4@wr_8@sm_1@sm_2@sm_4@sm_8@sr_1@sr_2@sr_4@sr_8@|c_1@yc_2@vc_4@sc_8 -pT`@PL Lc8P$1( <0D $00HT!0C00wwww -tt0 hA (0L H0 RhYc( LP!0P1/k k(k k2-@tAPr?0RW` ꬡ2222` B`p Bp` B`RE0C`R9`D22222 2,282` B`p Bp` B`p Bp` B`p Bp` B` B`p @R B`p R BRR `2 222` B`p Bp` B`p RpPP2-BtAP00O0RW` ꤣ2222` B`p Bp` B`RE0C`R9`<2222 22$202` B`p Bp` B`p Bp` B`p Bp` B` B`p`p@R B`p`pR BRR `2222` B`p Bp` B`p RpP2-DtAP?O0RL` ꐥ2l2x22` B`p Bp` B`R:08`R/`(2ԥ2222222` B`p Bp` B`p Bp` B`p Bp` B` B@R BR BRR `ꠦ2Ħ222` B`p Bp` B`p RpP%t!$0000%t!$00000&t!$0000 k0-2P? @P4@54?3P0p-2`? h@tAPPP`5P65?3`pp-2`? @tA@0T!t1*4 t t!40L0C0$Kkik0kkdkdkF9d,d@`;(d,d k/kX`; -t L@Q00  hX8h0  "! Ld`;p`;@-@Q >0^ 00\R 00$0(000 S-LP`% S S 1!p $pU4W @ PH `@H `@P h`bbp@ PH `Z* ` Pj $@L dkk0kMp@-`R0 0@PU ^ 0P@PU T0p@ЍT -LPᠠZp` @ (0@Z -LP Zp` @ ,@Z -LPᠠZp` @ 0@ XZ -LP Zp` @1@ \Z p-LM ` 0  @K P`P@ Y,P% :8 ^  @ ^ 8: S@21C* "!B 0 :0^ 0 Kp -LM@`Tp*  R $ PR @0PS L   0 P  @R(K @ x -LM< \ 0P 00c80 0匢Xpw `tŸ Zy0 K40K  0 0S 40 Ro >*"*0L,  080< P @,T> 0\:00Q^ (KP 00b, :#: :cS1!\, ,8  000`Q!0S P 0pW@21C0,0,0X ` 21C0 0@T\ 8,0 0 S0@ p 0 , Kp p 8("(8Q, "*46*, (00S 0p dk  -L$M$( 8 R`4 080 0 VR"PpPP%4V@1,K080K  `V 00pR00SP 00 4 $00( 0(K -LM`$(p Q,0W80,  PP p 3U00S 0S  @,K(K QR , 0 00$( p0$K -LM\@P$(`3*KpȌ$  K$K pP$0 0 $P(0`p0. . ,d -L٦`; ->0^0PL@R`P) 0Y`p@00T*U 0U  0 J0SjZE Z p埦 ,ddk`; -LM0(KpR(0 $ '`00^*P0.Ơ\|@ : c21C!\ c050:00$00$  $ 0S`V * K0k00$0(000@ -Lp@@`  ,P@P `00  000$0(0  P0@-@P# T!00Q:P  RR*> 00 0 bR !. .0  00 >00 >a 0Q00> 000 -LM4 8 @<0  8 080S 0 Q 8Q22223p(K̥ʥ80< R,` T: `@aQ40pPW ^ U:>0 >0 S00P`8< 0pdWp! <00S<0 @8<0\,` pT: @gpW PV:`e PU4 00Y00   ^e Q:>0 >0 S00`8<pd Wp!0fWp!U <00S<0 w @`8<0P,`k `gpWPU@ePU4 00Y,0  Y Q:>0 >0 S00`8<pf Wp!0dWp! <00S<0 2 `@ tt 0Fc0 0 @, 0 : 0kpa;a;Ha;(a;0:a; -LM@xPQ $3\ b  S] 2"S0"嘣pӣУ1Eʣ1@8 ţ1 82XRR0S Z$ t"10@T ``"$Km詣P2 RJ D2D R ,, A0B%@咣Z$K匣1  凣儣 0!!dp5PPqLnZ2 : Z18ld1 0\_T$KmZH1 1R0 \a0@PLŠB%0P @`:14c1`.]+' $Km!AL:pc;kC;a;,b;Hb;t;kk|:b;PF9kkk:ktb;Pb;Xb; 0+ 0!0 00@S8hPpP\ L0R  K< hp80k\k0k2dkk p-LM0!>00P @+.  0;>00 0+. R| 00Pxl`pP\ P0R  K@ hp 00Px\k|d0k2dk0k@-X0@P R 0S \ Rk@-X0@P R 0S \ Rk0 0@-0 0  L@0@ 0A0 A0P0P 0 0 0 0 0 @0 0 P0?00?l0 00k k$kk4kkPkk(kDkk$:3,k 38kkk0>0S00 m <>D 0+ 00)@ 02@ @RsDD JZQ D0 @46ZS#PP @ ): RxP 8#8ZS#;4D )6?> 1@pPU@" WU>0002 R apP\ 1R , K, hPpU@DJȌZD 0(K 8)6 D;#;  1 0!@QD0:JD0 QpP\ 0R , KX, hptPpP\ 0R , KA, hp\0\ 0 <0 P04 080 7 <u 4r0pkk$k\k0k2dkk :#5p\8 Q8>0( &#&R+:0R(*0a"!B10b @PP 0T0U 0 D  D 00)G#&R:0R: 0a"!B10b @PP 0T0UD  D 00 0L1 R <1p01P1\ 1R , K, 0h0p 0j0$  0S@ 0 R0(|0h0p\0PH0\ `@0R , K0, hp0k\k0k2dkP-0!R0P  0S 0S  R00L00 08   0 000 kdkKi 0-0LS@P 0SP1000T' h1S 0 T 01S 0S 0S  R00l00 0X   0 0 00P$000kdk kKi - 0LS@ 0T00000k -LM@PP @ p4Q 0 pR Q 0\` @R^\fT P^ @<4\ @TV \ 0``` *(":1 ` 0 p^" 2C 0S0 :#5 PL  0S |3 R `3Q \3 R 0RD3p83P$3\ `3R , K, hp@T22U  \ R W TK*PI @ `B ^ d2W^;``(*(":1 `0"\3 2C 0S0* !" 0L0 0SS  0S 181 R 1Q* 1 R& 0R# @T :#5 PLd Ubh 0S 51Lp0SZ 08V`p P\ 0R , K% , hp0S t0( 0S 0S1 L0(-80Hp0Xpdk\kHk0k20k -@PpUL`  0S 0` RH  \Q% R U @T ^  \ 0h0hS 5S 0h PPU\  ix -L *t00t!t t1 $ 0R10N o葅1S 0S 0S  R0000 0   0 0 0h@00#! 0dP0  00#!00$00dk k$kiHkkHiKi0k -LMP8  80e S030#U00 4 %*4 %!*! %::86S1\!p 0"!B Pi 00Se Xd:#u@TY W 0S$&Rl:0Ri*0a"!B10b`"000ScV4  0 <%R55SSH0SL L R0R01"0ATD0`0óD0D0` 1Z]   wD0`00D00QE4  4 0 ZXpP80S{0Q 4 0SL 4 0S H14  (K0!00`S ApP\ 0R , Kv, hp0Pi0 S  0S x08  _0S D0(0S 0$000k\kL:dk0k2 -LM`t PP X "&R :0R*0a"!B10b0<0 < p@@@@V  Y g (K**(":10"P 2C 0S0 Y : #50P4 80  4>0S< (#&R:0R*0a"!B10b< R8 D0< 7\ 0  \ @ @p%R5 SH0SL  0R01X'0QUD0`0óD0`D0`] P` < 0@V 6 Z0 0 4 R000$ $004S VV 6 RR 0RO 008 00S <Q %Ry5S<SH0SkL R0R01&0ATd 5V2  < <<D0`00D08V  @ @D0`00D0W@d <D0^ @[008 Hu00S_,5 Z 0 *:$  0S@ 0S tpP\ 4R , K, hp}<0L < 5< D0`L R225S&&4< 0S 7 0S4  3L,0SW 38RCp8P\ 3R 8, Kl8, hp  @ @hH0S- (3((W0P00 0P V 2 Z20 0 \ P @ @p%R55SSH0SL L R0R01H"0ATD0`0óD0D0` "Vb  @ @D0`00D0 P`40 0S\  0S ^ 1LL<<D0`0D0%@ @Pp P I 0!V   E  < 0< @n 0PSt `r40o Wm 0Pg 0S^ 0XX  @ @ l0HK 0S H0X 00H0" k0kdk0kL:$kHk\k0k28p;hIidp; 0-LM \娂P0 04PT@h80q,0 0t8Hi$kTk P-LPF 1h1S 0Aq@p`T P 0S ` U  Q`PV Q 0 S- 0S0 S 0S 10#U@T% 0LT# 0D0 0 0S t0X 0S T0T0000H0P kdk0k -LM0DQ8@8p@y K@(@0S1[ a A Q88'`pP张\0 S ( K( hx@p0[ Q pP\0 S ( K<( hpk\kTk0kKiKi2dk -L M4 @PU 0L04 P0H04"h1S 0 2000 00  12C 0S0`= 40C4 : #%4p0C40 01 R 1T( 1 R$ 0R!  @\嚀TP0 Y@0 T 1T,*(":10"P` p0P0\ 0R , KZ, hp4 Y@@ 0S 0 0S \040 @H0(K0 0S $0$0 @ kdk\kHkhIi0k2 -LM< @ D 0@@0 TD n @ @0 08 0 40 8 * `(p":1 0\"X 2C 0S0O :#50QP `F @ P "`0 0P2ZH  < <L0H 0C L0H 4 R 0`00Sc 0S|  0S 42HPU 2P R)0S?  0SA@T(K 0S_ H@P 1Z < <5%0C 5%`Qp P\ H1R , K( , hp0S0S 0(08 0S  0S 0LP 0S 40S l0H 0S H0XP 0S $0X0P0kdk0k\k2 -D0L0 -D0L0AQB3B3B3B3B3B3B3? -L M0D S:(K 90D@ Q጖K#:8#*at@80 TH 8 Par0f0 R 0f0p,6@T) @T$ 0$"*>!00PQ pP\5\, Ke , hp@T0D6Q0D4@~:D5p:#:S,050%$PQ,K Pw '*(":10"P 2C 0S0 ,00*"%0㘤0@Q*7x4P :*#:"*S3*X4X$$@Q  0 P< 8000 %*(":10"P 2C 0S0 000*"%0㤣0@Q*t#0@Pp?t30 P<0 VP3X#$Q,KO P p8 0 P 8, <,!*(":102\"w 2C 0S0n < :#5x 0Q40 c<*㮧0S p<P\ (2R <, K<,*hp  8 21C <0f!0001 0+ !;0 0? P 80,0 0K PMppP\ 1 QR 0 K0 hpp4P\ 0R 40 Kz40 |0hpp)pP\ L08R , K(_, hp k0kdkKi\k2Jip0k0kKi$kKi0 )Р)0 ) ) 0-0Lp4 40"!B P* P(ڨP0 R00 0l1R0C00p1@C\PU T 6 @^@D H0L@0Teddddkk -3LM , 3cD#\0s C0S xC0S ( ("$P1L30p82 P@ n 0Sk @Pt OKK2~Ϡ K,2 ( <Po00 @pP_"0S? 0" ~p@g00^0P P=U@`L@ $@K00  $ 40>ZUzj K廄,ddkTq; -`1LM0800 0(0K tpP (KKcpP@0(4 P 4 Kp0p , 0  pP0@@ 0_  Kp0 pP0 00GH1- 0-LM   $ h(0 T!P + 0.Tf 0T!.@ T1:40  4PT1L@E@0T!L O$Q( 0800` E`0$0004 K0t k42A- QQQQQQQQ RA- 0@P`pQQQQ R@-M Ѝ@-MЍ! !P: ZŒŒ#! !P: `B!,aB 0>ZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0 Q@-: R (2 R R -PPPP RrPP B PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R- RP1P P1P RrP1P  B P1P B  R010 1  B R0q0`0q0`0q0`\0q0`0q0`0q0` R 0\6 R B0-81, Ġ%̌T$\D#L0P  R0 Ġ01#̌  R R B0-81, Ƞ%ȌX$XH#H0P  R0 Ƞ01#Ȍ  R R B0-81, ̠%Č\$TL#D0P  R0 ̠01#Č  Rp@-@P`R p0-@P0R0-@P \, 0L 0l4 @P0R0-@P \4, 0L 0lRQ@P0QP: p-QLM@P` S 0V pxpS`@rP`&0-@P0R0-@P \, 0L 0l4 @P0R0-@P \4, 0L 0l51@P0 p-QL M@P`S K 0V Kp  Kp K@rPp`(Ƞ 8!"(,Ƞp@- @PpS`b `c0#3 Q. a l^#(8.(030# 80 (3#0"P@p.8BA Q ! C2Q -L@P-S'pU#`S PW0#03d g0U f  e00#2 S06"l P@X t@P` r0(@pP@-` a@ \B@-@0@-@QP a0 120^0 0100 -L\M@P`p d5w`^0p(KS P  0W p#83K8#8ẃ[0 X$,8`K("X&3KK0<AZ0@L0"[[[2[x h[[$[3[xhdp@-c@bP`T !L2pQ:P: -LMz -L MKrK K0-@"P#040 $ R ((0"4Sd40 $ R ((0"4Sd 0d( (P08#808#80$0$$ $P08#8 d@d 0Q 00 -0L 0+R 0  hVl0l5P \0 RPh PD0D @}8}0 kAiipd\q;tdTi3ȍ<,N9C;dq; - LM0S @00P@@ Px@pp0 8`[Ph<P, @xdpdq;@q; @ dddq;p@ Pp-L 2R 2 pB00b 0-0l"S S00S@P P0S S00SQ000 S0 S BP }}P0-S SpQ @00ACSCm3m3m3m3m3m3m3m3m3m3m3m3m3m3m3m3m3m3m3m3m3m3m3m3m3m3m3m3m3m3m3m3m3m3m3m3m3m3m3m3m3m3m3m3m3m3m3m3m3m3m3m3m3m3m3m3m3m3m3m3m3m3m3m3m3m3m3m3|0Q00@@ T T0 H @0 8 ,0 DSBOikddq;q;q;q;pdq;q; -LMP .?)m0?`S P  A 0o|0S @   00FS0S| 4t p9 h9+R`9`)X9*  0L)L9 d4494)(ɟ000  6|Y 3|3 I@ȟȟ bx @``||Ĩ a,Ơ  0|P`Xpp8 @T:00C)0e0P0c1*U,0 I@9#9S @0^: 8BAD@L*E0 1P0b*U0`X I$ITǟ0 C\lW:00C *0%<0 C\@g:0 0C087*$ǟ 0B1\0a0:0 0C06*Ɵ0Ɵ 1B0a\0:0 0C06*pƟH00Ɵ 1BL0a\0h:0 0C0(6*͜Ɵ0ş 1B0a\0P:0 0C05*㵜ş0 10b0@{%<{t58{hşx4{ 0 C^):P5L*厜0!{$UA E2T PT?C ET P4@{D0T@ ğ^N@P`@&0@@|  0e@sXz :@i :@a :@Y :@Q, 9@J\C{o  @P: ?T@ il3 0?? 0S  p   : 0S l"0>0>02 a<2"&   0lziz+ !1$ D2@"T8PzN(Kz!1:z!1 1!1 /z=,z! 0 z,15#1( 0 00x\1 @0 (K<z8z.,z@dq;0kkAiPk` p@DWi$dz3d r;k,r;kkhk d`kPr;|r;lkr;kTk|kkkkpks;0s;Ps;ps;dks;k$k ks;<?k-9 s;$k dUUUUs;t; ik@t;Tt;pt;02Td2Pd2`d|t;t;t;dkir;r;q; Z-0  0L @R)  @ZD/0PU0  "! U y1nxytyU.R\yH1!mL|yo +B? SkxP0 c0\ 4x 0L .x 08 (xKi::Tu;u;,u;u;u;u;u;u; v;v; -LM80,$ Q0 Ix8v;@v; p-00P@LqT0`  0 5xp0D0S 3S@p 0'x5!x20940386<5 0 \1PX!X x70S9088;<: 01@P&>Q @ؙP phw 0phww20 @ wwxwpwhw20,Xw Lw20,Pv;j;w;v;;; w;xw;v;v;t;`w;Lw;4w;v;v;v; -0L0S S S@ 0TLH @Dڏ@P 41Cc/$iw; 0-00L0p0C0SPࠃ @^   0.020 ^Ԃ3Ԃ33h33ȃ33@33\3\3333 0$ R0@$0 @@@@X 0SC <0= P$RFD1R;B0CS0h<0= $R2 1R:BSV@< =04R SV@@ *<0= $R@@< =04)0h*ww; 0-@L*(0S08āPP*0 p-P@L*Q `3:Qlw R0 000 0 (0 B("(( R `00*p `R0000 0 6>`w; 0-LP@* @(>0h* p-`L@* P*PUPp p-`PL* @T R0000 0  k*p p- P@`Lt*0S@  R0000 0  @O*p 0-LMP0 K@0  T* R0000 0  0R Q '* R P0000 0 RK0H3 0-@LP*00CS000@@*0 p-`LP *@@@)Tp -`pL@P PP Z0P DPP  0-@PLP 0)P)0(0S|Q(0S|Q 08 R0000 0 0  0 0  0 ) -@L)8 0C8#88 S k)h< p-PL0@`` pi)0S000 `@@G){p -@LhH - P@`LD)0S00p0 0@@0p#)0 0-LM0@ PK00l0p0lP)l0S H0 >l0S(p K0,:l3 x; -L Mp0`$ K@$0 (  lR0000 0  0R00|Q P P 0S0SP00000PP P 8P0C8 8S P0 ;>8S($ R P000 0 0$ RKD3x; -LM@(0S ,0 >0S hn(x; -L,Mp00PK@` 0 pP KH@K$ 0$,:H3 0-Pt@Lk0hk -LPpX  `hl@P @C0 `P 0tpk' -L4M0 8PK( @`p $KXK  0l@p P @P    a,@T`,:D3 -LpP`@P P 0000 P`嬔 %%%Ġ_0 P0pPm -LpP`@P P 000 00P 00Cp0{PN -LPp`q@P P 00 00P `e@0V01#Z 0 pSP& -LPp`H@P P 00 00P `<V010# 0 p,P 0-PL&@P P D0U<0 0 0 P0P00u' 0-2P LP@P P 00000 0 P0P0 -LMP `pP0@P P 8 0 0 0 pqP' 0-LM@PP@ 0$ Y:㻓      $  @w8 0-PL@P P 00$0 P0 P`0' - L@eP  Krh1(x;-  & -PLu@@zpp\`iT W 0m6 tTk -PLpu@@x``Li T V i Tk -LMp`H@PpjP  `@P 05IKTkd3 p-LM`P@@UjP  P@ 0@IKpTk3 -L Mx@T K\ 0Tx@@k@k8 4 0@kKh{k(LiDx;kLx;Tk -L M0S` Rp 0@ 0SZ" S <00SO >0"0Q] 0PP7 04SP1Z00= 00S= ;<00S9  R00 0S 0 480 00S$ 08 <04@P(K  0PPP"P0 SP R00 0S 0 480 00S 0 480@P-: N -LM0*S$ SD AS S08 <04@  (0, $  S (S S |q08 <04@ 0$ $K0 480 @ P``0S<0S P` 0@,P (` ,H`P,0Kp0@PD0` p0@ L#D <P`0@(!(D#Lp4  0  8 <040Xx; -LPp`@P P 000$ 0"U0P  0lP? -0LS@`LbPP `G ^00 R00 @ ` 00  0#40   0 0`P=00;000` P`70:0 0p0 p%00( R00 R 0(Pj0 00 0 000000C2Cp jP 0 0  `P v` -0LSPpF 0SpB`P p=  00 P600;000p PpP0:0 00 @ @[@B Z (0Sآ33h3h3̢3<330[0 R 06P &jq \jP p 0 00[0$ 00b $0[ |Vo Y 0(⇐0[0 Y 0(0[00[0 ypPp; 0-Ld\P P1\ H1\00 0`Q! 0$ P 0ă \ #\ @ 0S@ S Q PT $xhjgTP P -:d -LM0R pO , 4 P`,  VP- 0`S0Sm8 ⨍P d4 ⟍P[0 0  ▍84000P 0R ,P ,(K Q-LZl; -LM< 0p,0 @P= 9`P pßp ^`KD PK=@KL \  0$P@-l2 u (l#30 lx@T ^ 0S[ 0CS23333Ȱ3P20  P X{ꀲ333@3H3P3X3`3h3p3838383x33838383838383838383838383838383833kx 03 0SP U0S kx 0PS@ QQ 0A0_S7kx P0@S@, 0RJ(K>0P!0Hk@l<l0SP$kx0P @Rkx kx kx kx kx ȠAĠ?=꼠;긠9괠7갠5ꬠ3ꨠ1ꤠ/ꠠ-꜠+꘠)XlDxej;;$;D;`;T;h;;;\;;-:L; ;8;u;;;|;t;;e;;;;;;;;;d;l;x;;;-: Q-L@=k; -LMpx`P`& PP` 0@00@0@L4| (0|`庠p000 0S P W``d(K0S 2W02 : e@P 3  T<` :  :eV W`2 |000 Q <0 @R yRz R   pwp30@P0S8p 2  xQ xP Q R 0S ! 0,K >0"0Q_C 202202  202,04@KS!2$022003 S2ձ02ű0 4P HpPX 80S 2 71 - 1H`2 `  ~X1 -\`Rq0Sm$ P 1!2:2A2<2  P 0S:%eP 000   뼠 :dxjxP7 50 Re7P`< : #P` X03d-:-:3D3<{30{3:0@-@QP0 2T?\0S 0R00@ -QLp`@0P/2^,?\0S& 0R#@P 2`$,(F`P2 00 0SxP` -PQL`0p$2U!2S 0S @ P 0@ P00P00S 0S  -0`L2SpPP@ P00"P00S@PR -L M P`0pQP  P 2 L 0S@ 0S 9P@(K>0 !0QdP 0 0P)08 <041S,0  p @,0@S 0pS Z [ P c c-:d' p-0PL2`S@2@Sp0Q 0Qq0s q0sF r  r 0Z Q 0-LP@᝝0h/ 0-L@P T,P 0hDD0 -00 LQP`p p@ 000P @pR -3LSP`p p@ 3P@pS0@-qr@P\^  0@00@0@0 p-0LM` Q08`000 2S020 23 0S0 0(h03S0 @00hhY040T!P Hhxh!4 h00$Ph0"0H@Qt0@uL  R  bpPm  PPe 42 0a0 p 0 @ @ @P P\s0@,0  Y0 040  8 0<0 P 0 8 <040P b 0@,H, P`0@D00P `  p4 0@ P#D p<P80` !(< 0@p#L4P` P`  a@0s PH K `P`(KY0P`0P`aP`aP`a N-: 0-0@0@PK@2L  0 0 S :;;S 0S (0@0@0@0cS -L@` aPP p# @P p 0 0p00 R0 P0  !40 00pW00  ca0u -L`Pp@P P 0000P0 P0VB000%$00@0P0p P 0-L@P P }>0Pu0 0-PL@P P  00}.A0 P0P]0 -LpP`@P P P 00 00G0P0p`0000hP; N -Lp_`P @  0L 0'̠''D;0(T @0pPE@@  p-L`P<@P P  0, 0f0C P0`*Pp@ 0"200 0p0C0S_0S 0@ <0= $$R 0A0 0' -pL@` `PP p @P p  0 0_0C p P0  0#$ 0 pW 4`` 0$ R pӆ0u -L@` `PP p# @P p" 0 000 R0 P0  0#$ 0 pyW 0 $ BQ p✆`0u -pL@` J`PP p @P p  0| 0_0C p P0  03 0 "4 0ip<W _+c0u -@Lp `P @2 OPP @) p$00 0` S$H33(33333\3 3h333[ 0  00 ;0%@T0#30_@@\0 @00 30 0  B0 @:0@T00 [0 0030 0 + @T [0 0030 0 + @T ҅ @\0 @00 30 0  BÅ0 @:0@T0000[00 0""Ġ " 030 0 + @hTr03 0 "#  0 #200剅b[0 0030 0 + r@ETO000K[00 \0#? 0_@2= [0 00 ;0P@#T-0#30 !  000  00\00    0 :0-@ 0u -L@PT ^`P e @P \ T0 0x10 R0 `0  !40 00XDP@hp0T00 T"" 0T00 T"" 0T00 T""  0T200 T  0T#20 TT T(0T, $ 0T T T8 T<040 TTT(0T, $ 0T@3T 0PT@^0u0Sh3l3p3t3x3 -Lp P`@P P l 00 P `哄 C0W0000&4 0`PR p-ML@`0 PPP0\3 : c 0PKp -L M`S@P VP K  ^p PP% T%J 0S0a0a010 @ B Q0B RJ 0 @P]P0D@T ;J -LMPp@`$@ ]P   $0K `@@@@+P $Q 00  00  h] K -L MP $ 2pL@1]`P @+ (K $0K@@@ p@P$ R@ 00$000$ 0S (0S T0 @&] K0 @ N -L,M@`,@ pI]PP @I ,KN 0@@@@ p@P7,\: 4 0 < 8  0K@@@ p@P, R" 00 0<0 ,  08,0 040  ,0 0Q t 0 @\(K@\(0 @\ N -L M@`,@ p\PP @( 0K ,0K@@@ p@@P,0S@ ,0 ,   ,0 0 R T0 `@q\(K0 H@ N -`LepPւ d0( 008,d 0z40" P T ㍃ 00 @⇃00 '7<@ h\@ $P0 0bQ 00  0  1R0\ \'88# '40$ 80 if  <00;0:WEV3; 0-HL!88#P!XA@P 0 @( 40bS@0 000h<0d -LM  0A33 -LM) 0433 p-0( LP,@l` R3333T33333t3 0S0C 04 @+0804 D4 $)a0E@KFphp0 0 00Cs 0 ph@04 $)a0E0K<0phq5080$ @D P8$0@D0 -L$M 4 ,000 0@P^4@2] 0, PS 0 |@(0D $@0 0DH0@ 020@iP@@p0DN4D24  Py6 0W*(( (h(%D P`@ W :;0@!0 L00@ ,1 p0,l00D -00 <02 (K (Ko-0 2 0@Q  R0@L0 H@ L@[L0@S<0 8@ T W<@[ 000!!0@0,P 0 C(Ko0ux3 p-HL!88#P!q@`P 0@ 08040@ ;40D  @SNV ph|;0"080 ?p aCphi;p@3.d 8 8-#TL%`1@@P 0@ N;0pQD ?PU FD<;.0" "2 K/4C | 2<2d Q- L Q 0C@000S A | - 88LM#DP$?`P 0@ :p0 ̠CpP@0T X,@ @@S 2Tp 0, [?pP202Q C:2T0-.2 Pp W T .)2 02 .!pP2T02P 2p02 .p0 3d 0-PL@D0ND03 p-`@`0 S00Ɓ0,( L0LP2  0\ 0Q000CO@^4 hK (I200X0phD|3-:t;33 -LMK 0 K0: -P L d M@4 &?pP 0@ %:@$K 9T ,9T| K0CT 0CT 9T 0S@< :9T '9T Xl9T :c@= Q@62T 0T,  0@& 0 @t20S @ 0P%A@P SC@A(2T 1T C@ 0@1T 1T@@ 0@P00S 0"  04"40  BR !׬@V 0@00 0S!Q0RPZ!  00002  <4("4!<0^LZdc@c Q Q@c ccedA c@qdQ ccc cmhdpd dc c c cQ`dc c k~rdA@-0Q0 ""D0@ 0p@-0Q""H"T *(,d @P` pA-0Q#l#x# 0""H"T 0@P `p0G-,MLQ.#L$@( #H#@@. 0@@ "$"h"DL h`@ ##x#T0. 0 @0 @0,ЍR\ \ 0L0_S BR00 0-PL2  0p@P  5000 +0C0 ^P0 000h-꠆0  -LM\BP<0 R,808 #t'"0R0y0!R8 t ` ( , Ps,4@P  0@ g , 0 Hp4 0 rp@P@0` 0@4K R=: Z? 0@@ 0@`p4K`pʌ< @<< @T 0X  `p8 Y1#,@PP 0 Q(K0 0,Lid' p-LM@`  kUPP @  0`@"Ux p-LMP  `@QU@P P @ 0PPP @Ux 04<S-P08 <041 (0, $! -LMP  UP=  0@Pd`P 0tTZ   UP& 0 @PM`P  T0S`W S Q 0S QP-` ` 0-L@PP 0qP0hQ -L M0  pLT`P  PP  *@K z%0*0K  000 0`X \T K08 <04@0 @1A 0(,0 $00 ! N 0-HL!88#P!X:@P 0 @( 40bS@0 000h50d -0L"@0, 0p0C0Sh200S70S<0= X$R L0R hh$ <P P  -L4MP `e, Qz 1(0!0 1,0!Q8d0804  <00SL H {5@KD WpKL FK0!pXP zz z 0@'<7X@L8*((0 "4#220*$ 04  0H^0, 0R(K$ z 2xe4;@;WEV4$;`1: -L M0,0 `[p-@ (K 0dP@SP @D D@ 0K ,0K @PPP@P,\@  1X ! 0X  $S^% ^00000S, , 00000000S 0` 0 @08 0 @0Qdvdud@ N p-LM@P $%S`ayD @L \ $ 0ZP  |$Rx  y$RxH; -P L D$`,8pP 0@ 3@  2V -2Vh <2Vm 0Vp R @32V 2V 2V @ @ 0@T2V L2VR82V8  2V_ 2V0"0 @1VW 1V e/@1V! :10S @0 B<@P  p>@Px1V@ 1<  @0S<@2 e@ 00e/x@~ 0"@w Ql@p 0 P@i @d%40$ H \@drdAud@pd Q Q@qdQ`vdhdtd@AedAmk~gd4 -LM  0L@34 -LM) 0?@34 p-0( LP,@l` R4444,44444L4 0SH0C 080@S08040D;404 $)a0; @TO php08 0 00Cs 0 ph@04 $)a0;0I00ph{+080$ @D EP8$0@D0p0 0 -LM8 , 4 0@P_82^ 4  , P0 R 400@|( < $00H0@ 020@i<Pp0L O820 4 YF 0@Q _  0 U0&!:0 0L00@ 1 p0,l40:4 0 00 /4 0001 (K (Ko/4 !;0 0L00@ 0 p0,l40:8 2 0@Q  R0S0  -,P 40O(Ko R 8#8 S  0 ;0   `L4 p-HL!88#P!`6`P 0@ 08040@ ;40D @B= V phk102008080p5p KOphS1@ d 8 8-#DL$`6PP 0@ 910p<: 5@T0 !22 022  I*O:1 f 2<2.| d A-L@Q 4X 4H 4 4X 4` 40 0 \0   H 88 30O@00꜈i 0-P@L(^: Q 0:0@4Xd -LMK 0V K1: -L M0   ,0 LOP * pP  <`Kv@ a0 P<0K0 K2 K1 K;@K/PK |1@0 P@ @\ @ uO@,, 0 RD(K 0@,Hp`0@ P D P` 0@ #D p< P`0@!(#Lp4 0 0@ ! 0 8 <04 1 #000000-xe Np1: 0-0L> h0 @\PeP 0P1S1S0hU0hv-: -L0M0P<0 ,0 00 40 80 pPF0F'OP P`p( @@K P 80K @@@PP @0S 0S 202 /  0 + P`p N@ 0 0S<0S< 0 Sk d Sh  Se (KP000NP P`p<00S S| @3<#0S 0?0S:0 0@ #D<` pP0@ #Hp8!,P`0@0@<Q0 P4`p<0  S S%0 48Pp 0` - 88@#tLMP'3`P 0@ .P 2 . P0 7PP p0W Z,p ppS 2WP , 03PQ0"42 02 w7m.0" W-.208#82.5PP W2"02OP 2P02..0 YPd - 8 8LM#T%3Pp 0@ p . P0" 2 p\  * 0P 20 Rp(PT00` @u(  0 *, 4P,d -LMp2p2"0 S2<24pS2ס(92ǡ n, 0D"0Q000OO( R" I%0" [ 2S PF 2>Y@ aN0 00 |0`Q0@J2KDQL0@K 4s$ P00S! !0P ' 07(K  _  0 00 hd 0lP  PQHQ @<Qd3-:t;43T;ud@Xd3vd;;; p-2 1C`L P hR0000 0  000 @Tphk/k p-P@ `L0S R0000 0  ph 0@p-LP`S$4444444\R@ P 28 1C0P `0p@@@;k 0-0@LP 0 HPPU@0k -0LP<`  "!0C>0 ,p00 ,W@ ~00 ,T 0 !!g p-P0`PL00@8 ,000T08 \phk - 0L 0<,hk - 0L 0<,hk -Lq@Pq P;; 0-t0L M@P00< ,Q 8lP @ P P  0 K0 'K0hk; -40L M@K0< 0\Khk p-0L@ Py0< 0`\00< ,T 00<0 \ph00< \hk -L`P@000T 4 4( 4( 4PT/ T* .y9 00 #00    = 2X0@`PT T .q1   D; p-L M048PK4 ` x 0@0 , (` .P 044 L p4 00 , (` .P KpPP@4@d;; -L M4000 , 4 00K(0 @0$@  @@ .K4 -1L!M4 080 0@0 P,0<000 P#p/Cb1L#`31C0!A}R?b1L#`31C0!AL`DMOx8 hu-(1P$/Phkd$d0A@Mb;!4;; k0LiN  0O   ! -- -i00~N01@pdIPP > 0d 0T05*JWZ/ Z,K00K {P`0` 0L000S pP\t0 \X E, hJpWZ 墼(K ,ddk\k0k2(0 R 0RTLi@0kG-0M  "!@Qr 40R PQ R f R0Π` 00P 0 R 0>! 00 Q0 ^@ 0 8 0 0 @0P@ `P$ 0 0`(0p,9) 0 0 (0@P `$ R 40 QR PL0L 0 0!!Ѝ XLiXMilkkk0 0lkkk 0-H LP0S 0@  "!@0  "!0k P-L 00 $ $M  yM;4Li|; -P@LP`p+0  "!0 8R  .@P 0` p400P Y 0@@ 0 x9 0!!fN dNX0hv@PpTX0 p  ,!0P\+  1P`+ 04 0004 80h /l2pt"tbx0$ x>;.!hd;;68; p-@$1$!@L`0 \00P5 `\10C A85@0 B< \0 0  0?1!58< @0 \08 C83A4 #:0 \p0x0 0-4P0@L8 , 08 \0Ni -@` Lp\P,;  ,@ \P,; D04S0D0D D @00H@0k@-0QH0/ 0Q( 00S@@0Q 0Q0@0 0CQ@000d0Q<0 @ <0  @D0@0_W@EWDW@AW@ -@PL M`p @H^ WD @0/R 80 0@p0 < KQ -H0LS 40RhHP 4"yHP 4y 0-@L PR000 @ H0 BS@  $Q 80 8 R80 00h0H040 0-,0P(0(L@S01 0( R  R d f|@  D00 $ 0[| 0/0 B 0C- .10,0 -3L,MP|3< 8``RPp XP H?=@(K02,# R07<0 00  (B(\00B0R0 !A8 Q^000000,0 0  @0(p$08 , ,@P $Q , 8 R 0 RD @8$0 0  D ,04@P $I^80 @D 0 P80$ @0,0@P, >4 0$#660 @0`A0<0Q 0 W. W, 0 <0 b# 0  0  00 4  00 0 0,`0,X V D0D 0SD0PDP @00@0J< 0 ? R< X b@  wD0'R0@Q@T0XAT 0S $P@T0 -0LLp3 - 0LpP3   0T@D 0 TP $40 T` $80 T $< T0  $0 "$ -L$M0pS !Sq S S (KS S S000Sh0 P @!Th0 h @>$10l 0S 0< #30 0R:l@TP nl0 X `lP @`1C`V @l0 Y  `0lP@K1C` V@0@,\ fd@0Sl@T 0s @l@d Pl 0 0l00 l0l00l h0l$!l0h 0$1l@a0S^h@h@P`@@TL PE h0P0h!00 1P`U50S2hP@F?D@hP@H=D@0SPdPH 0?`S@@C \ p0P6 d\ H0 ѧH0X0l TH  l0X`d 0L , `P@@T 54 | tT@H\ 㐧d@` VLgL  0SVH 000000@H 0 00H0 0H0 L 0S3H 0=0@00@H000 H 0<0 02H3L`  0Sh Rg @R  00HS80]`02 @0 0!D <0 hG/000H 80S0,0 P`@HD@<D0PhG/000@Q@ @ % Q @ R @0S P`@HD@@@<0S<0D0% S <P <Q P`@HD@w< DH,80S, FDPD< P DQ D RoYPS@MtH080@@:H DD<@P0@*H0DDD@@@L u 0SrH 0<0<0H 0;0H0;0H 0T0W PPM0S0S0SH00000@H 000 H000H 0000H00/d P@lI 00l 00l0Pl00l Ph0l$!l0h0$1l l@4hG/00000HS 0STH 008 4 00 $0PR P8Qd Q& @Qt00 0 0 0H00 R'4 P^@XD@OPI`C@=HD@L@1P+`%@HD@L@@ D@@H0DCP@lP@+H@DH 080@DH0D<@D0@0n@D@zD'1:; -LM `&8QI 9L< &D &P1=@0(S@ U'&0PS@x&> 0 q&XX  j&0 S4x4l4`4T44444444H4< |U&tR&p  N&`V.TH&PE& 0S780SNTQj$:&0lorux {@~    &X`V 0  &0S S &p & 0S h& 0S@PD\ 0<#0C 4% 0PS@80S %80SPp<@D@Ÿ^0" T0C@%80pS PTQ %p%0 %0 x%0 h%0 X%0 H%0  8%0@ (%0} %0 z %0 w %0 t %0 q %T%X`VoXU? R6(K%-~%*{%'x%$|u%!tr%lo%dl%\i%Tf%Lc%D`% <]% 4Z%,W%1 0@PXQ%U (KoI%<0S SB%?%;;$;;t;R4;`;;<;L;;;$;h;;;j;;;;;;;(;8;H;T;`;h;p;|;;;;;$;;;r;;t;;;;;;;;;j;;;; -LM0 4H`K4 8" 0 P @(KTK0 K` ;PH D0T p P L `0 \ 2  PhK7` S03h0 5* 84"PT00T  P(W` "R{T0K0K0 `;TT  0!"  `0  vPh 0 pP X0K0K0  0`\   0T  `0 \ UPh T NPd T GCPT AIPT ;SPTd0p00T0 "RU31(K0!R!TK !00K `; T00T P`0 T K00K `";TTK0K!;` T0@) Ph TT > PB T h 0Bd Sh<444t4444444444 44444Pf|3@"!10@Q^T d00\$ H R$"R; UQ0U PP2QJ PH ,0S42 RSXX P X@T@T0X1V/0\!,0  YP d 6@P d 㘠00\ )pP \ ㊠X0X p \1P@01 U\! P1s@P  DPDP DPk",p1=@0S@ W_"0pS@W"\ @P \ G0X0 X0 @0h@C"10@p ="WX2:3:@d;;t;j; -LPp`@4 $@ T`Vp @4 $@T4  $PP0044 p-L,M448`K @004 P !PKp44 0K40 K0 ` 0PP84  4T 48 #40 4T44  400 44 400!P@;d; -L,M@QP` 44@pK 400 P !@ K44 $0K40(K0p 0P@ !@@$ 0 <$@T44( @400 44 400;; 0-QLM@ Q Q 89P@Y8Q 448T8404L A8Xo9 Bq8Ir98@0Q9T" 0-04Ls@P PP 044, 40040 4004$A 4000 p-@L`Q PU P 1S BP 0$@T$ F? R 0S|0 R 0S0 RT p0 fBP0 Rp3:?: -LMp P4$0@TS X@T 0S0 S X@T| 004(K0 0 S0An `400`Pĕ;HÅLą 0 00 P } 44 400$- P C΅0@P |c l^  B΅ 0@w@P <Q 440 400  C WZC XZ Y* 0R WZ$@F? R 0St Q X P 1S APO  0R 0R 0  P6(2("4$2$ "32#"30#4HÕL 0TH3L $PPT 40CSC04!84O0S  P/ 44, 400y0 [AP0 RT Q. KPu}0 R 0S.Ktd0 4$0 3#0 3#H3L $pP0 4$x0x 3#;;;4;;P;l;3:t l d T";|;  4 |"h","\" p-LM`5Ps`@ Q Q Q xhh@Ql0h5lxl@ll( 0Chxht 0-`5Ls@P& lPP"Pl5` 400l%S 400dq l5 400l% 4000 -`Lp0S 0`V! R R 0S@P0!SP@ 00!R v@P UX `dd -LMp `l%0PU0XPU- 00CS0  0SQ400 @P 0QU  8Ŗ<Lņ P 0 400XPU0`5$K0͆  400@P09PgoP} 0D5VΆ Pl 0S0d5 ͆VNX5 @ @}Pd@D%U 0SX%Rd008C T1C]@0C@<0C@̌0CR2 d ,0X1@0 0R4 h 0X 0@pPP  0P` mP ,00 0t 40@TJ(;P;l;(`;'$< $j;j;;H< (; 0-@LP0!R 0S =P 0 !R 0S =P |0@TGD@T T \ 0 SQ 0SP00P0?:\D: -L*0 -0L  -@$0L $0 -0L -0L@P @00  h0( Q0 ,0 \00 0-L΂M0P @n n @0>2Q0 Q Dn0 0  P0 08; p-0L`P00 ,@0 \ph@; -L$0@P 0hx0h -L$0@ A 0-LP@T  0| 0t S0C1 $ 00P0#S@T @ @5$;<0; -LMp0$  0 P@P `1@Kx 00d +P L0PH  @ 0RK`7xe<;4d;k;D;\D:6 -L M0tSp!@ d00 0P 0(K0S00 \QJ1"000`p2A@P0@@$(P@0à, < 0<K 8 4@ 0P -* L0 0704uX(`FZ꼥:j;p;T;;4d4l4X4 0- PL$0$00. $0$0  $0  $0|~@{l0T $0P@} 0$0$  N' -LM@P`p [;0 ` p0@@ 0 0-P@L ?; 00000 PkAi  -40LS 0 -80LS 0 0-L<@@T0 \400 D0H 0X0< <0 < @0;<; p-LP@`T 0T@Tʢ?T QE Lp=pQ T 4p&+L; p-@LP0U< ㇿ0 04p\0@4 0\5.,004 \004 , 004 , 004 ,@ @d; P-L P P 0 hh; 0-t0L @(04 L0\0P 04\00500hd Q-L -LHM044@ 0P h  h$dpA;t;D0  0S S S 0 Sd 0-0L  0S%P0  ^ ^0 PS n @B21n@qP0(0e/"b0 0dQ0 0`dQ - L0S0@T L0 T,T 88S 0Y8h8L#8~4T6 \d@B -@Lpa`P@夿PUPV0P0 h -sLp3 -@LU^h -0LS@ PPP0lEPec0P 0P/: Q-LA  -LM@31C04`Kq@$PK4  T T4 1S R$ B1S R* P\1 R 0!@ KVUUU  -L` 㴽Z0PS @@\UpWPPU T1 eP S@ HUpWPPU@堠TFPX#0S9 0@S0p堠0W  P0Ӥ0 P00 o賾3P@QJP 0S T w y00Ǻ0S0 S@00@@PW QT00D<0h40BadG::PA-tr MP`U`2\2PODl28Ÿ1C 0P ЍR2r 2OD 1C0@l21C@ P1B00c"!B0cP0`0 \0d!S0SL?C  ba"!BA00?000B00c"!B 0cP0`0 \0 S0SL?C  ab"A!B 00?00wdNiVUUUpk1p@-Q= 1CQ x1Q p00p@T)^&Q# R `VPU1T^QRT Q V U 0SS0SSph  l00p  t0 0x  |00  d00ph@ l 0p0 t 0x0 | 00 d %W A W@ 0-PLZP VP@0dP0h2 -L@Pp`=P 9PTU@ p-L`[ PPPUp     @ T 0 dk 0PPPYp: -LMPPPK ㏺@ ڽP+H嵽101(pKa` ΏV3T0\ `S( $  `X( $0@@\*( $0T``0\ (pK~`H傽 00!00 cCa0 ዻV d0SlhQ tpp@W (0| 0``$0 0d( d$ <00S ``V<QMbdTk 0-LP@p0hP Q0-L@P Q 0L0S 0P00tH"0 u0L0S  mHH 0P00 -@L0S0P0L0 0-LMLP@U K00B HHP 0P0T L0  0H>5 0-LM P@0[ĿV῿QếLᵿD0D0 P Th 0(K$ 0[XK0@5G:t;d5R 0S p 0P p0 P p-L M8`K@P S(T080K@ 002K2K0 K1 K\08,0 P D 2[2[   Kp0u ;h;H; p-L M8!@0PSKp8`K (@3@  U002K2K0K1K8 KX08,0 ͶP @2[2[  0u;;; -L`8P P@ P P0pW  P ,''( 6H(@00;00000Evv8!00 ;B; -LPCFMHC\P, `<1  8 8ß#*pP 88 0 S 4! (@=P@ |$0㹅Qg<41 "0 9P@0@`  0O 0 @TPM D" \0(8!0 01Sz0@@ 0@P`衟P `00A@#T@!Qa ?8#808#8?@ ?8#808#8?4<(08$0q !n P P (1SH5 I5\I5hI5tI5S@, 0R2(K0!4 d0! R(0#<.0OP`< 0,1KKOK,8  0(K@,0 ɪPLŸR00 y00! (Ÿ0 00 c 0008 < 00i10 > 600F 3@C 8^@4@ 0  @@Sd@ ,0優P 00 00! (\ 40S 0  0<8@00i10 0 >@0400:@e3~3 0004 \XPH}<,(ȯj5;;;;;;;;;; -LMp 200l>@ TP 04 @`=Up20 P( 00  G0@6 0T R P0000r P 0 000tU@ 0@0@000]$KP 0  00 00000G000>0$ P` 0 0@  0@$ 000$ bQڰ08\{P000  0 @ȯ<;;h;; ;L; 0- L0P@K0h ȯ p-PL@8`偨P+ 00 00000 0 (0 S0$0@00 @ ,00( 40 ,0, ,00 4050ppm5j5d]5 -LMP \`Qp @p @T V4 0`D @T(  `d@dj;:j;; - 0L00S@ 00S00 00S0 0  -L M<`Kp@ P-0<0K0 60K@?4 K7@KSK00 5 KP3[8#8 K -L M@pK0@ `0  @ 09 K!@0K080K4  PP 0l3K0P ,` 屫P@ l K ^0@0K18 K40 9 K3[8#8} W 09 S" 6 04"40(Q(A 04"40Q. 04"40P,3(( SS! 'NEFX -LV 0 hҮl\;t 00K P00[!XG: -,0L0@,0 0Q ? 00 p-,0LP @$0T$: `V@* ~,0$ p 00Q@$0T:( R*Q Ch$0@0`V//` FY,0ph S(J( @$0  \P(@ `V  2 DHP @` `V  B   B   -,0L`@# p$0W5:  0R0@sPs0D0"U G:0 ,0,i 00Qp$0W:( R*Q C$0p00@_sP[sU0 :,0 S((p$0  C B -,0L@ =,00,0 -,0L0,0 @,00,0 0-,0L@=$ P* 0\Q0 S):,0 P0,0 : Pe0 00$ P* P: @W000 BP000 I0 00 P:$0L 0R $0PR0000 0$0,0$0 P,0*$0L 0$00L$  -,0L @ @hf,0t,0 -0p@PL`rr0@ESOñyr0 CR±A!W ,0{,00,0mmn -P, 0L@`p ^Kr0 0  $ B 00 ( ,00q0,0 , -LM,0@:@ @@0P4p0r` r ,0K P ,0 S  @ A @  `00 $( ],0F00,0$K ,0 - L0@00,0  00  $ ( QP,0,00,0&00,0,0 -LM< 4 0X< 0I#0S@0 8 B4Q7:@ Y4* 0 @4`0pqPq 00K P00  00< S8 0 @ mq@DP08 80  4Q8 * 0  (K -,0L@0,0!0 Pc`Sbc\02$05$0%,05 % @  h",0@  ,0 Q$!Q Q Q  b -,0L@h0S001 -0 10 @Q L< 0 -L M\ @T ,40#"B0Q ^ڈ0Q P @ 0@@K,88 #4 ,88 #$RR*te 0U1 0@0 00@@003Ud 0U0Sz 0  0BS0S 4 00@D3U <3U` 4 00@x00s030o60@@00S>@P 2 2Q"#  0@$ @PO h2 `2Q" 0@ @?Q00$0S-@7 4 00s030d`&t@@!800Q080 ~80@1  80 008 0 80  0$0dP ` ]@0@@Nk0@Fk0@000BR0 00 0+  0$ R0S1 t00,VW^WQW PW嗲`P 0 S0%Ll2@l 0 0!rT@2 !  0`00S0 W00P0S@T R@@1 Ɵ`@#`L; -@ LP 㴄0 0 - 0LS@ 00 0 ׄ  000000$ 00sS 0S Q<0Q 1S \0SPe -@0L R 000S 0S  0NiNi Ni -,L\ \ Ni Ni 0-0 @@ @ @ @RLP x0S tp 0x@0R Q0 0#0@00 SQ00  0000 00 S  0-\ LR@P 00Stp00 U -0@L0X@0X00 SX0S -L M \P =D+Q555555555555$5$5$5$5$5$5$5$5$5$5$5$5$5$5$5$5$5$5$5$5$555x5x5x5D5D5D5555l 9&l : |0S T1 R000l00 \PA l00 \P6 0T0  T00>0T0  T0010T0  T00$ /, xd*'$ -LMQ0 p`P= UK R60R30   Q@  0K0@0; S V \P\ 0l@L00Ta @>P ;; S"  0 @0E8 U:S00P 2UP 30E8S0E8#X8UP 00Q1n08#XQh0Sd00c@0 0U~ y0 00 00 00 00 00 @00 00 <0 <UD 0 ;\P Q 40 9 PUV ;~a  `=0SL00 RLP SBl0V ;_   0`(0Q 0Q!0S  p-0LM R3 00S 0S, @P`0S0C00  0AoQ*0 R>;  S0S0C00K K 4O 0 KpNiNideNi NiPH 0P 0Q `0SX0S  @ e -00 0LS@ \ @/ Ni -|0LS@PQ \`V p\`Vp 0U\0pP\P\`U   \;t; Q-L{;-00 Ƞ Ƞ,1XP e -L@M\@`  # 4\ :40S P 3\! 63\k D3\ 3\ t  0pP3\ 3\ 3\ t3\@< Sl$0< S<1S`P 9 P$3\= 2\ 0\m 2\0SIP2\ 0\x 2\2\ 2\H 2\0P       00  0P0 0 0 0t  0pP!0p G 4PPB o 0R 1  iU5BPP@]0P     00 Pl P$010J  0P0  ?t PP| 0  \bl$l 0PPl3W W WW @W W@WWW@ W @@eW WW0e -LM\ 0\ 0\ XP,  1 P0\ 0p XQ 00S00XP  1 r 00 Q}f~fvt|f 0-LMP@@0@0CS088@- @.@e -h0L Ƞ Ƞ,A0S 040000CS0Ϋe 0-0 (("ALXPU 0 X0 E`0S 0 0 P P e; - (L(" PP#0AT PP 0SP `0S%X`VP 4p0H0PP X`Pe p-X@LT` 0 ! PaU  " 10`◯P0S0Sp0  phL, ph0080S ; p-0LS@P`80S% U  l|PP\P l0!R \l 0$(QpPph\P  UQ 0P`0ph00␷ 0-@L PQ 0S \P l0 $Q0h= [ p-`0LSPb0SD|0S\1  X@T% 0S" ֔0`0CS0000 R00G0S40S+0 31C xP0Q&ڬ 0 S00 S P0 Rp00P`0  u00eNi<;d; SP 00SK: -L@Q `5x555<5000000<000000000000000000 -<00000@ L! pW`V 0S \ R P0 U*\ T@/",00 @0 bp p0 0,0SV P0(%P T @o P/",000b, Sf 0 0U ],PW 00  U`/",00` p@@ bp0@ 0^00|  TP/",00P pD@ bp0 |0P/",00 ba D!00 @& F@/",00 bn00  彦U@/",00@ p bp0 0Y p-`0LSPX@T% 0S" 60`0CS0000 R000S/0S&0 31C ؤP\0Q!ڔ 0 S00 S P0 LpL0  ڏ00ʣ< ;dlS 0 (0 Kd( 03.lR 0S0C0 00 00 K. Pd( 0- L!0B@SL6L6 6L6 6L6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 686 6 6 6 6P0 S0 0Ô0ŃP P0 d (0812cS<00<00 Q00 B00  000 0 \S 0-L@80 080 -0L6S@o 8 -0L%0C@5S86666666666666666666666666666 66666666664666666<6D6666666L66 * 8  0< 10,p<  -@\, `0L<0Y0CPD L0X8@ HPT  R 0S \0 Q0 t00 |l0 p xh  -LMP@`p00 p 4 $0 000 00PT0p0\0`0d00000(K000 0k -LM 0A^Sx66666$666666666666666666x666666X686666666666666666t6L6666666666666666666666666666666d6<66666666666666660(0 , ,p (d0:3iS<00<0W8\P ( 00p (<0  0@ @ppؐ$0L P1 DHp@tPx`|0hl ( (p (p< p (,0< l0< p (,0< l0< p (,0< l0< p (,0< h0< p (,0< h0, , ,pP, $p(p ( pz@@( , ,p (@@k@@( , ,p ( ^< p (,0< 0T< p (,0< 0J$T00cSf` 0AR$0Z 0SW (0 CYpp0d0( / ((0Ap0( ( p#<0p (0<0<0p (0<0<0$ L<<0 x0H (|@P@DpPt`p 1h l0  @P` 0ؐ (,0Ap0 (p0 (pd0, ( p-0@0CLS6L6h6666686t666666666666680 S 4( d>,0`Sc PBQ *0S  0 SQ:( ( d>b$>.P -LM@P`p 0@000 P! 0@@` 0@@` 0@ 00 000@p@` Q Q Q!R<00<0 ,R<0<00<0 0-AL@<)Q1$6$6$6$6$6,%6l$6$6$6$6$6$6$6$6$6$6$6$6$6$6$6$6$6$6$6$6$6$6$6$6$6$6$6$6$6$6$6$6$6$6$6%6!R  ,R  <0!R@P ,R@P U 0S0C0 00 0!R ,R!R ,R!R ,R@$ (0P -0LS@ S 00\P  ^ :!0000C9Q^0/Q\\0 0 C^\\0 0 C 0-QLM@D Q3 Q `P9 $0 R5 0( 0CR0d0(80S0C0T $0 0aPCU 0S0C0e `P  $0 `Q0A0+ 0`0P 0 0d08$ R Q0A0L 0 ^0N0* 0`P $ R ` }` D0P 8d( 0D3>b$>.P(0D d$0 < P D0P D0P -X PQPpp`gVL@0S0C0; 00 00S0C0) 0`0\ 0 VT K`T ` R $0 R0d0 0( 0CR0d0(T D0P T 0P -@XPQPpp`gVL0S0C0= 00 00S0C0* 0`0\ 0 VT PK`T ` R $0 R0d0 0( 0CR0d0(T D0P T 0P -L(M80P(0 0Q 8  4 gR@ ;RJ 3;R  ;R ;R ;R JR4 EPR sKR MRT`X@0$S 0 `fS0!aL\XT ^X@T`( 0R$KnR ;R <R rR0S 0S0!R CRllQ<0 0 0X$0( TBR CDR- HR<P T0RX 0CR00$0` R= $0 R9 (0 BS d (d0 03R R ! B0<0( cR0 fR XR}0\S d(@, 0C0 00 0@Rs ARi $0TR a`R !0bP$0V 0SS 0( 0CR0d0Q(o9RI 8R 8RE4 J`lR lhR:0S@`5ژ! 0`S@K0S@`$0`S@@! P 9TX0 $0R0`` 0CR00Q$0 0S0d0"4 d 0 3>(R lR`1`! @ dR0S0C0 00 00Shd>$( D.P\H`PLPp? 0/S52626,26,262626,2626,26,26,26,26,26,26,26,26,26,26,26,26,26,2626,262626,2626,26,262626262626262626,26,2626262626262626260@Ss `pQ @K 0D@K@P~@0D Pp@0D H`L`(pC`C````````0S@`[ژ, 0`S@q@TM4 Rh7 c=`d 0 3>(R lR@1@! bQ0S0C0 00 00Sd >2.d$DE00CS5646d,6d,6d,6d,6d,6d,6d,6d,646d,6d,6d,6d,6d,6d,6d,6d,6d,6p46X464 4 4 <0($ T0$  c<`K0#p  P 1 #44H \Q Rz(0 @0S 4\ R$ P! @\ @0S "\<`K20"@_p  P 1 #4 P04P ( d02 aS0 BS/0( S<0S0! c<( 7 @0S@`j0`S@, 0P  0d0t忣0 S0S0!0C$0RM h2>dD \ 01$ >.PZ[S>$0.> PJ>$0.> P>80, DL P0@H03xew$K?l?p$?h?p!c>J?u&;;;(; ;; ;;;j;;L:;DN: -0LSP`" Q"@0! 0@T2D 1C@p`@D 0! @00T\N:|O: p-0LS@P 0! 0PU0S`P 0  0P U0SH`P 0  0P UphO:P:("Ƞ,L(oR- :  S >;  S F/ <0 < <8SL$ 10;C  3=8S$ 10  >08S# 10  <  >8 S # 10   3\ ~0C\ 0C\ h0C\a 0\- #0%2$` @`0 V@P -LM@S A0 1 0P.#K<J6 -L@\00 00C0 ^h^ -LM@p `A^PP D @0 8^P ] P  08@0 S00  0D@0 R  0 0 D@  S1,0S1PQ 000 p-`L PR 0S0S R ]@ p  00@p00pe 0-@L0PS 0\ 0cS0?000 P -`L @MtP 00CS(pX \00 T00 Z  4@$0T48 804@  S8D h@0S@4 m >D$8>@1c!<0HL $ 1T0$ X0$(0P @0\`0d0 <0 1c80@ a00 2 Pl>d>>` c,2,"0(2 $"0 2 "02 "0Q0 0I(0F1 0 0A S4[6Z6Z6Z6([6Z6Z6Z6Z6Z6Z6Z6Z6 `>@$8\>D(0 |(pt (p  00!0 (1(!0 1 !0 < (0t]30 0 \  `8P @< 004  b8@P \0 <" `|  (p p(pR<\W6<@6 W(08P & 0c,A P0P0x0U  01x0   00x0  01x0  0 0 0L       T0L0W       0Q 0S  ,00 S 0C$0!0v03 K$ R PP0S pp<D00D0$0S0H R0 0P ph9100$0S,0 0S  D0%0 000S <0@ -Dw 00C0S 00S w -0LS@+0S  R000 0  B , P8eJ 0- LP00 @P 8Pl 30 -80@ L<0PD0< 0D0 @0 -`L@mP P*$ RP%D 2pXp0#<10# 0%0 000SI ,0PPD01 U 0 0PP1D0#D 0 D00D01\ap$0S 0 <2S!l xPP $0SU0000<0@ ,|bPL;4; -LM@pPRP@ 0`HČ <0 `eP@@o K6 0-LM@,0P0  K0KKK0 KKKKKK0 -L M8@#hPP @ pP@ 0Č.0 TPY0@0P $(K`} 02K*K2K1PK0PK/PK.PK-PK,`K+PK` `PP*0[  @01K `2`K0K/K.K-K,K+K -LM@0K p-LM0@SP Kp `PPV eI0  K 0K0 B0K K 0 KPKPKK0KP 0-LM@,0P0  K0KKK0 KKKKKK0 p- 0LS@ ,` P 31C  v 0SpXeAX0I 0X0 R0X0R \0 S08 40 L0 P TK 0L a@P \\e APX| \X0 AX0\0!m\ `0X5gWe@Ta >P@eAUk66(< -LMI0PS`@)pK (0[S$0[S I0@S   0pP K * -#0LMAD(0K0CP(K #@K'K&0K%K$K"K!K`@P  K p2 @P0 0pW@W  @ -#0LM`AD$0K0CP$K #K"0K@K!K `KKKpKP K @2 P0 0@TT -LM< @P0 `e A`PPv ,0 00-0 3,  0 P0? @./12 00 `Q 0XS b 0S^  R00 08 1 8 04 )PP98pd@ 0pP5 2@RT0 1 00, K+@D 0pP 2@;TP@D1P0@, K}. 0pPP  (KX! 90S%  PT0 ^0 0 S  Q 0 S lؤ P?0@S@0?0L弥80S? B4100 48 0PPPP0P  H P 0 1 0 <`48 0PPP0  0`"R 0d 0!< 00PP ,@K  \[:T<< -LMB4( @2pT TD< P-L 00 V:4v;POi -LM0K0K⠠P.KBD/K -KNL`(pK0,PK+@K*K)KPP(0S @ 0DĠ)K*@KpP(0 0$K -LBMP`Q@Pp P(K!rJKI: ,K 0P,0`W`?0@CT  R JK 04("8  00X00S" ! 01 R101 01XQY QP@S G +0+1X P@0Q0U0SU2G? P0U0T R 1\\ T 0\0  0S 0 4 \\T 01[OH 0KhP!  -LCMXJOKP@D`K p0,P 0  !@}W@ p = p<0d o@;E0:PD`d  Tdb@ d}Pep Tv@ do` 08 F, 0R(K{xe<<<; ~P 04  0 00  0`PP6 T0S  !0S00 0  ,  0S00, x 0 l 00 P00 <~00 ( 8<\<<<<< -LLMh0`,0 P 0P P: 0S=_0`KTpK`0K_K0 ]0KZKYK^K\K[KjR@[P00T00SbPT00TT⭠8Pf<X 0Pf<f;0T0, 0RR(K 4哠4f !<P @f <P 0\ 2TH0S 00S 0SkX KPXpP< 00S TX0B 0Q1 0CĠ YKZ0KG yB<f ;P8 <X 40 `P 'y f;qA00>0S Sf ;Pa T>p00  P0S}?d0 00  00>0S0 S1 C00 ^pT p 0pT  P s0 hן0 R0@0/T 00xe <<6<<1 g2S p-P`L@ ;@d0Pp -L` $Rp |R60h t44p0S* QG ^!1P!B00^$666X6|6<p0S:0 $ (U **0DS;d6\6666 0U T񟗾6666 6(606l6t66660 @0PU p T;666L6<6D6l646d6T6\6pX0 0C\ X0 d 0t4 4S 0t4x4#ptX0 0X0\ Te  0t4 州p[^ 0 ^8 #8t$,R10 tt$H^0 x40 ^8 #80:^ 0 ^8 #84.D,<*@(8&L$P"H d0(l0h h:h @dpp@ p@lPh [lP9plXp8 0 $@\0`/ h x4$S 0|4h 04Q t4! St0t4P0x4t40CP0110t |, h l0d 0 l0d 0,0h lhd0d@"tDl xDVCRz?C@$0 i>$ 4iSm0h@$0 [X00T0H0j^(CR0S ^@ T0 ?S $0R p-0 (L("a@0P1s s pD0tP<0@`K00@@Mp0tP<0pOeOeOe 0-@@PLKt R0t0 0S000h M -0L Ƞ Ƞ,Q@0`P@ KA p@ T0S@MpOe -LM⤑P0@, `jpPt1T h1T& `1T<  0p, 0RA(K 1T 1T 1TQ| |P0|00 |P 1 Q0K0P P 8 D0R0 KP0-00,|r000xe}fpUAUvtnU~f<\: 0-LM` @.Q@@v0@0CS088Oe p-LP0`PH0@T p P1OP p0P Pp 0-\0L Ƞ Ƞ,A0000P0CS00F0Oe -LMt0@`, p 8 D0@R@PK 0kPPD NP, 0R7(KJPT0S0.  T jaP0mP&U 000 KT R@0T0U0S T@#T@!PK T NPP $q K#PPxehcB80K1 0 !p0@ 0 1SWpp# 0P@Iφ  0 pΆ  0 pOφ  0 pRφ 0p p(K80S00 1S480K^Eφ0 1 ᆕ< p-L?L`@P€ / 00@0@p -LM0`S qWDq $ D  H PH!2@  D 0(KP0RFC Q<00D 0W@ !PA \> R \ 0S0S  QD(K0 0F?C, D \\ P \ 0S 0 S  QD( K00F?CD \ D1S BT\1S G`DP ]K0 \  sD@TI(KK D_W - 1LSPp @`1 1S`@ !db1S 2S a1S 2S h+_ PYhj_ HYhlj 0-a1LS@P \PqPP00X3 0 < k 0-DPLMXa@ $K 0$ P  *t\K0OeP5 -@Lp`PP DW30, Xb10Ya1P hC; k4 7 0  kQ Q 0S 0-@LP3P l1p!PP @  P@T0x: -`lp1pPQL @ ,P@T ix: 0l 0-PQL@ Ft00h`t H p-X2@SLTP`0GX2S0P T2ph3 p-LM@0PkPH0Sx`KP P  0Bx -L|M Q@pP` - Q `p 00P 0` KiW@ p-PQL@ 0+P` P`PU php p-1LS@`P 3SP php 0-@LP90P0Q P po -42LM@00`40p,K00( K80P(@0 ,PD0( ,JH0( ,DL0@,(P0 $@ P@Pd1 R7 X1R #Q<岓14AS20,!t K0 S #Q0At 呓1S 0 @KLP0$K,(| @P $0 \0\ UUT03L03 7St;px:w:Oedx: 7T 7 -LM@K K 0^PKY0S 0r0Ss 0Rr0 ZR R0S0w000S 0{ z0 0$S$0w00 p-LM8P00 K^X`!KED`!K K0@KK`K`K`KPK`K`LP[Kp 0-LP0@P1S01 1S A0 AT 0 1jP AT10C10 010C10 当< -LM@0P`pP  K 8#(T0 0 <000 <Q P, p-LM8`0@ FTN!0L0QPSM@N@O@P`RL0@Kp 0-L@0P~P0 00 P0 B 0 R000h0 -LP0p`_P 01 s@N=00 00 00 00 00r`{ >r 0@P00 <QA -LMP0p$`P800@0LL0MpQN`O`PR`S` L0@`@K -LM@0`pPP10@0<0NĠL0MQNPOPPRPSP L0K -LM@0`pPP  K0 08#T0P0  00 <Q PD -L MP0`@P. 0BS+\777D7t7777  0K@ RY0S 0S00S S S 00 b0K`kT T 0R0 R iD 0@@{P  RTXpWe  00 b0T T00 6T1  \<T%  00T\00 TL0Q0  0T800 @ 0  0fT5 T 00Q p 0@0 WPH 0PP^ TZs ؐl ѐe ʐ0Sh c00 04@ 0@G:S 0S < <8<`<<|< p-LM`0P@PE 0BSl 7 787T7T7T70!7X!7!70S zT00@0CS0000 0PP Kph5 R  0PR 0($ 0,0Kp 4RC@ 0AT\ @`840# <S  j i(h0$k0 0@S<0S =Q X0S| S~ 004 D0$PS4< @0PLX0St 00`@P`@> VX 0BSP2 X RW .:R,1T0Y 0BS7+70+70+7+7+7d!`!}@!{T!yP!w0Y0R0Y0N0Y0J0Y0FP< Bigi;X@Y@\@`@Y0PX0.B-iRi&>0S=}`0T04> H0P X<\00h@ -@L>0S00@@S000(0RR00(0(00 (0SP( P0(0 ~0(0 -LM@Q` $pSJ/7.7.7/72 %㼠 00 " 0>00 01 0@0 T0%(KQ( 0 R* 0Q'0(00 (0SP( P0(0 (Ko"`0(00(Ko00 0!0(00(0 .7 <@0S8@0.) -LM@P4`0P3 pW00 00 0! T@  0 P0(Ko0+ R  RW\庋0(0(KoT@$ 0AP(K.7, < p-L!M` 4 0PS  0RKp0 "K@Km PK1Q K1@K L4 90 GxdxeL >P F 嫊K0\h ?/P 7 圊\l \? @PP  T兊̠p34/ PX XK303'97 < 0-PL@X$P%|3S" 61S kiP8  P 6;601S kXLP E6 ;&600  BQr0C 00S: BQ  10R!!  10C10 -@PL XP Xh p-L@XP\ ;`[|3S ,3 030S 2 S|# ^ph+=p0z -PLX`p@P ;9W;I9 WW" 0 0@0@  h光W i<0 0@0@ ׷ p2S0@i0CGT*K" K)K(@K'K%PK$0K#K"@K!K&pKYP -L M`X@pP K@0XND)0K?0CHT)K! K(K&@K$PK#0K"pK!K'K%K4P -@L {  h p-L M@X`lPP Kp?0XF"0KB0"K K!KK0KPK PKPK`KP [0[ p-L M0PX`0KG@P Kp?0XF!0KA0!K K KK0K@K@K@K`KP[ 0-LP z@@T T =  ~$ f& ~b= (0he?~ V't < 0-9P=@L9 YC ? [pP Zp%P5pStP QtP20t3xP GxP0x3P *03P X03P 03P L030|30H 4孆B 姆< 塆 < < < p-T3LP%XX89`@L X[00S 0@;VT30CS39p ![l -L`  9 8#8  )2S<9 9  h@@ TP pp;QP@@0$vW -LPX@P L8po @^T9 1  R7P1 7P3 H D = 6 Wp3S 9@0;9W9 h[|  7P@ȅhB9,…h<9P h59 < < -`LPX@pP@ 701T 0CT!  00V@4T& 90T 0T0,Z@ @ @608#8@6 0 R @6@@@ g@@@0[@7i 5i 6i( -@LpP`p &s % (@@T ( T hE/ < -LPX@` pP B %l@ (h@@T ( T &@H$ < 0-@L B030S7  7036S$  , %XPP= 0 08#8 0hgc [  0- L P# @@T #C T !0h叄8 < p-L`@PP@4U0@p -LMP`pXS Q@P k K2"A3$CC DDcd $ K@P4 08 Ƞ,Ƞ#8G `D$=\!^0C p6.p0PS00Sh#0@S$Pf   0Pd# Pl#d3SP h3SM l3SJ G6*@K|}SP H 5414!9!,1,!1!0` h⽥1!43 1\0p@8#<3  A 0sX 06V$#R  Y`QT  pWF7\|ŃX lS"0aY"yYT < 97\D7t <|~:| < <|I777:7K7K7`L7574787 < <2S -@PL @P @hR -p3 @SLx#l# @Pp $Pt p 7 -3 @SL## @P $P 7 0-L@P ; $1P ; 00㗯0ᡱ@ -LM`4 @P@.P09@ U UU(KA|PxU} $$兤$\04  &44 ,0KPj,p 0 0@0@  pp&5@|P  > 9T`6,Q /08, #x$ Q%@ 0K[2[ :,: 0#AS, Qp0: 08#xQ30, 5:c, YPP0 0@0@= 墂\~\S7 < Q-L@ -LMP  0 Ƞ8,Ƞ#8" {P D: -L@sP h: p-PL9`=9iW\P \P6\c`P `P40`3dP dP0d3P 03P 03xP 0x3pP 0p304phC <(hC $!hC ` < << < -LM?`PB 0@8#8႒Ⴁ @ j"K2KT,K t@@Lt30 嶯0pP j@xS pt3`/  pp`P c(K0K2Kt,K pꂒႡ j t3 儯p303'Z7 0-PL4@S 61S kP8  P1S kLP <6 ;&606;600  BQr0C0 00S: BQ  10R!!  10C10 -pL@P`_P 3V VV& 0 0@0@hS JV i49i;9 堯 `2S 0 0@0@i40u`U < p-LM0 0@0@P`hXL30 K@psp 1SM4Kp < p-3LP4`Pk\PhdPe@5@233`0CS3|9@L RU00S 0@PN30CS3cD4pvUM 0-@L PR030,# 0 0-PL(3S $CT  U0@T ]R0 -LM`@PpP @0?0(0K(0K:@CJGĠHC6 (K%K#K"0K!@K'PK&pK$K&P K 0-LMP@0( P@(4S  0P@  H0P@|  08 0CP@ k 0P@<b H0P@Y 0P (0P" -LM|q0,K@p $0 @P $ 0RM K 00.Ke- [.0[48 !#8 ! (  "(2S<8 #8( "h908#h 0? 0808P#h PPO 0K Q 0 U A)Yxe$: <: p-LM@1_`/0b37Pi 7P 0P= 4( P 4 P4 EPf 0K? [0[ [ 0DP ?P hC Xe2Kp  4$4DT 6>PP hC J2 τ07Ph92$\3/ PB9@0;T92YT@3 Rh,2 < <a <\S7 < -PL@`p61D1T% 0CT-  00O@4T k20T 0T0,T@4T6@ @U2 @ J2@608#8@6 0 R0@@ C@@i 5i 6i( - p  0p00LM @9@ ,3$0S 00S S" S046?0 A0S  S 0 8P (hm~?  4 < p-@PL @XP\ 0`)P4S Sph1p -@L 730CS3h3 0 3E -LMP@@p#`PX $KG4%0K&pKh 0`u&K 0Hn @40`gT h~! P < -LMP@@`PtW K"`K!`K 0`@"K0| 9 @d0`2T ?!["0[X  h} l < -LM`P 0`"Kx 00\ `B[L2BKTR 0< `@($4Spm <`K @ 0@@0 @@K 0@@ W0 @ 0@@ H0@@ 04@@ y 0@ K 0`@(hp3` 0 0 308#8  0 0H`|@@ ( 0`s@7  " -LM`0Pph3@c @P  08 Ƞ,Ƞ #8"3ӯ3 SCC13S3CC/rP |$K!p3D p/pB0`<$40S@00ST#0@SD0P   0PP# PX#@# 0S;9$4. ˅0p O0qs ` *@KD0@ ˅ 0(v|?0T]Ml|Kg| 㙝 0Ph)1!91!1!1!43!1l0p@8#<3  A!1sQ 0N$#R*  QI_M ,O /V (|Q*@K0@||\00|"0Q"Q_pp8{x{04hD:f7 `P  vKph) vKph)vKph})3\/ ` x9?@0;9$KKphb)X P  uK0( ?PP  Lu̠03,/ P vX L$0 ~E 0-LMP 8#8,2S<9 0@\<3  ?8 0@Q<3 P @@P@++!<0T< 8d #8 )@< ?Z8,3@;;1<# <#Xd -LPeP9@@ "p" Sogd @MT9`   De7P( 97P z$ 6# 2" . *03S 9@0;9# h`E@"ph#,ph#P h# < < -PL`@pP@ 6"d1T# 0T  00@4P@ l#6@(@ d#& = S2 @S# @ 6@|3606b0 R @ I#@ ~0@@J|3  `$ `|3 ` i 0-@9,=PPL9Y ,ֿP4,S0P 0ͿP10034P 4ÿP043dP ۝0d3\P 0\3PP ϝ0P3HP 0H300 4_o Yo So < < < 0-LM@  ?P  >oK0$ 3>PP  L/o̠\,`3,/ P9\奿X ,}0 0@0@7T < 0-@PLXhS :7P \3S 嗽P\ 㤽P` 070 Q-L( p-|3LSPpM`@P fo0@39@ 00S 0@<;0|3} pW -LM0S  0 Ƞ8,Ƞ#8! P 褁: -L@ P/mP l ht < p-LMQ8#H`@0?0 0K 0KP$4& KPK0KKK@KK`KWKp -LMp P8 0 4S ,K0 K߹P. !0l(Kl <̠ČL8 ČD"̌#D!L  0@P( ` ol,,P 8el ̠8Č#Č"̌ 0P  Pl,P,<4("!4l̠ <($Č"Č%̌ 0bP L , G9<<<,<<hKph7,8 ?A`P I hKph'H3D4 - `嶶D"9@0;9Kph(1΄d ? @ۺP  ,hKphX < < 3037< 0-PL@0pP%3S" 61S kⵘP8  P 6;601S k⤘LP i6 ;&600  BQr0C 00S: BQ  10R!!  10C10 -PL0`p@P U=W;M= WW" E? 0@1Aᢿ dW iC? 0@ 1A Y pd2Sxvim3H0330CS3} < p-LMP0 0@0@`Xc0 K@, 1SB:Kp < -3 @SL## 0P $P 67 -@RLp` D ; 0 0P P3PPPc7; T1 wc֑7; 00$ < -LM`0pP_P&U& UU h0l0h0寲PCUK 0Ÿ0BD0  @]303Ƴ30CS3'(K,0K P嘱,0S 04 C, 0  G? 0@1 A R"A? 0@1A᪵h@夾 0ch3D03+30CS3ᓵ꿠0R P00 @0A, x@ @ =7P P    $4 KzA? 0@1A7T < - @L#7P 3S 0P ,P 787 0-LM@0唰PP K034038 D0P  bP30CS34< H0PP  HobP<D3,/ PyX    7T p-LM@PP` 0xPU xP @      K0 k* [0[48#x p-@PL 0LP_ 0`  }@0Pw6php 3t30 x300S0#R00S d2 S# x -L Mda0@0 0 PP 0RLKE(pK  l= 8#8  -D3S<=, =  0 !0[<<<P!0K PP0 K?0 Q0 U A+:xe: 0-LP0峮@P 0 [ ST @ 0h' 0-6@=P6LVP=5DP DŰP+DPHP H弰P0H0P Ԏ03P 03P Ȏ03P 03030 W` Q` < S4 0@S4QP/ 00S@8<0S80s$ <0s! @0s .@K 0pP ^ +C|^@`^X^.D^  xPZ1!=1 "!21" !|31#x` O3h#0 dc:3 0   0P0l#R  &4+/P 2 J"03"4 :X <7<7:H<|<<  ] < < < -LP`ᓫP 9@ V VVppp30p3߬PVh詮`C 0w]ps < 0-LMP  ?P  c]K0 ?P  T]@ 2>@ P噯@P ظ T=]ˠ<@34/ @G<峭X < -`LP@p"P@ V 0T o0T s0CT@ 606 @  Rp @@~@ @@ @@ ki Q-L 0-@L 9P@00S0(U0 -LMPp ᪴P ZS KWPP 10`S00S#0PS %P@   0P # P#Z 3S* 3S' 3S$  ; 00! 1>`!90p hI||0@0@p0 0P 1') 4hZ $cZT <| <777d7 < < -LM0S  0 Ƞ8,Ƞ#8 ?P Pe 0-@9,=PPL9Y ,s,S0P 0l0S4P 4e4SXP 0X3PP 0P3DP t0D3<P 0<300 p-`LPP p0 0@0@phY < -LP`P 9@ V VVpp3032PV,hxCf 0Ys < 0-LM@  ?IP Q YK0$ 3>:P B Y7( ? @PP + TY̠P,T34/ P嚧PX  1SLKp < -3 @SL## 0 P -P H7 -@RLp` D ; 0 0P PFPPPT7; g1 T7; 00$ < -LM`0pPrP&U& UU h0l0h0£P4Um ̠BD0 L @p303٤30CS3(K 00KP嫢 00 ;00SA? 0@1A̦h@Ư 0(*Th *KA) [*0[4  0 0@0A00 @0Cx00 0 0A T7P P    N% u3D0330CS3ᄦA? 0@1AP8T < - @L#$7P 3S 00P =P 7V7 0-LM@0峡PP K034038 D06P > SP30CS344< H0!PP ) HSP̠D3(/ P嘡X K ( C0?`% V Pq%-JF$K0S2*@KP0RK"K2K2R7 0R0SR2K?2K*@K02K00C SF888888`7888|88t88`78`78`78T880D"02K0"K*@K2K $20Sf 20SZ S08#*@KK!PK0`20pLK&kW?F K4K|ktP`V000000 R  Bckh]k!= K 0<@/\ P `0 0@P @ d0 R08#Q 0*@K2K0"K2K?      '$D(\<'(($,$0(',8/ -2LM ?Rp` 2RS 0RD BX2"p 0 00@0jT"=@ [0'(/,/D(/0(',8/ -,2L PRb  R 00 0000S]jCM0pO 00`S` 0@:1 ` BR x1Q 0A!da TAP0j0 10Q (AP s>P+00AP h3P,00@P ](P00^GW CM0pe XG_ DGY 0Gh(h/d((/,/8(0(4(< < < < -LM@P` ᇡP G K4pP8 1!@! 0 `C͠0C ``!(0CPX1p p p0`S @00S1 0@S P   0P0  P0 ^G0  #P SG NGPzP `BGT>GL0  @JT <((T/X/ ($(((| <(/ < << PPC;n# 0,ß  PPPࠁedß, 0R(Kl3 PʨX 4!R R8S S0 y q#H0820 00G\nX 484@D 0@D (@H$H@H$(Dh8 < 81S'\w? m74D( 0@0'PS@ @ HF͠0 0/.000b0 q PR `@H\000H!080 l<8\p '.0 |8@m! X 0@ @ 5砏P@ vmK 44@D+ @@H$Dh=$:=<0SdT[  "PP@ s$K8p0( MpF-0< N,H /cG( 0׺21C! c.  P08U1)1P@, !ܡB=,0  G@P O <<@1B}(p  02@P@P `<2 L<@<P $< @A!ˠ0C-0 镊P@"(R B 6RN n  08#(60;@06(R  @[ B@UTRK0!#R0 0@0@0@ TD D H! (jpPo ;H!Nj1 q;i1界 p00p0pD0T 48<#8:#:0 0@A@ 0S) 01  D< 1p 0 K p0C 0D<,0 $1 1 0H! 1 0@X1X!9!P1P!1!,0@ 0h;.1!1#3  !, ( X0 0 D0C @<0D BD0(K(Ko9 (Ko9(Ko 9<t8v8L8D<W9W9do8d8L]8K8`t8@w8\')tr<< < -LM0S  0 Ƞ8,Ƞ#8 ͇P 4:D p-H0PS0`0LS4 U @T@T 0 R000S PH@ppp000SHPp -@0L<@0D0 -L0` 4#APp0Q P88x~8~8~88~8 P2\@P 00@PPPe PP 0 $YP00P 00 0$0S000 0$S0C40+ 0$0S0000S0C40P  0$0S000 @P HY 00 0C 0  00  00  @ 0$0S0000S0C40XOi p-LM0@`R@ PP0 $RL  Rb R 40Sf 00 K]p2RGH0S0\B@@ @ 0 4 R 0S0C40  0 @T@@ @0@8 0 (@a@<8 N0@@1<UKpHP 0  $("( RL 0CR K$w70P 8t0R1 R@@ 0 4 R # 0S0##40 0R 0RwHP 0  $("( 0$0j~,@@ nL@`Qe8< ^Qe \Qe 0-00@L@PW0S R000H0 0  0h p-L`APD@T R000H0 0  v *PL0S k0D  D@T; -@L(@ 0"P h6h8< p-00L@@P0`S0H00H 0@H@0Dph3 0-LM0 @00P<@06T60L0K0T@!ʴ6D 0D0H 0P 60L004 0P 0 H60L0T@D$K0hꘋ:;;t;<<̄8 0 0  Q 0S3:Q 0A Q 0   `PibOi 0-LP@T00 0P 0T0C? T00\00S  00 R0#03\0S0 00sP Q AP000 P0 R0 RP\ P 0 R 0 RP\ -(L"HP T  -(L"HP T  -(0 0@00L0P,00 0,0 40 -,0 0(,00 L000 -,0L0@(00 00-0@ 0 0, 0 0.  , 0-00 00, 0 0.  , 0Q0-0R00\00^00 0-0L0 @PP,00,00,00 p-H@LP `0S 000 0@@0\ph] -00@L PH 0-@LP00$0 @$0P00@0@h0 0-@LP0 P(0  00P000hM㷉 0-L'M#R 0-X0L @! 8T0 $4T0P $84X0Q;+S  ; S80  ;0R 0 S0@@@X  (RPH0RA0R #R!&R #X00X0lmLT -X0L@lb 0-X0L @TP= \0 C K -  !`0   [ h v D\00L  00h'L0& \0  L( 0L0& \0L0"\0  L0# \0  L0# \0X 0@ X h00<0L 00X0L0 h X0+0 B`0  LX  0h0X 0C+ `0  X 0@ X h00<0L0 0`0 x 0-TL,0@ 0P 0P o0S|0 oP S | 00PP0S -TP 00LR`p @$<0 T ,00@h>, \00Q0S 0-(0LP0X0@08X0 T0$4P0T 0h p-X0@L$!;98 T8}PdU 8 T0$4` PL0S X0  p8;T$8p 0-X LP@$ `0   @08#  P=8#0T$8 8T$8 <8TDX04R 0\ <C308#(  ;8#(`0 ;8#(0T$8 8X0@ `0T*, <8#(0$8 8T$8 <80 X000 XI0@X}T 8 T0$4 @ @000l@X0 }0<0$T8 8Z0090 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sp -L P 而: p-`L@P  x((0pL0 P8 TP0 X0h T$8 40 \pphꀌ:DC2@0 0 X  8@0 SA S P0T$8 40 \ T0$8 4`ph X0  8T0 $4T@8$0 88T0 $4=8$T= 80T$8 8X0 T0$8 40 S@09T$8 8@0|:D S0P0   (0L0 T`8 0P X0T$8 40 \pph?( P 0 3L:̎:D<: 0-(0PL@  0ES88L880&r000 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sp -L GP : p-`L@P:  pa (0hL0 P8 TP0X0T$8 40 \pph:D<: -TP 0,00@T0L8 $p4T8 $4,0`0,08T0$ 4  00 , 0 000  000000 0000 00 -@L^$8T 088T$ 1<8 0-(0PL@  0ES08H88$80&*00 0 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sp -L uP  : p-`L@Ph  p(0hL0 P8 TP0X0T$8 40 \pph :D<: -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300  00000000T08$ 40000000000@660000 0-(0PL@  0ESD8\88880&e*00D0 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sp -L P \: p-`L@P  p(0hL0 P8 TP0X0T$8 40 \pph\:DC2@0( L 0P80TP 0h0X T$8 40 \pphȏ:D<: -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300 000 00000T0$8 48T0$ 4 ! $ .  0060008 T0$48@T0$ 4   006000006000006000@ 006000 0-0BPL@ S 8x888 L0"S0&z00 L0"S 0 L0"Sp8T0 $48;T$ 80 -L VP @: p-`L@PI  tp(0lL0 P8 TP00X0T$8 40 \pph@:D<4: -Tp@ 0,@00`L8 T0$4 P8T0$4T0@8 $4,0P0,08T0$ 4  00 0, 00 00300  00000000 0000000000 660000 0-0BPL@ S 8|888 L0"S0&C0$0 L0"S 0 L0"Sp8T0 $48;T$ 80 -L P 蔐: p-PL@`  (0L0 P8 T`0 X0h  T$840X  \\0 pphL' 0-L' 0%ꔐ:D<: -T`@ p,@0pPL8 T0$4 8T0$4T08 $4,0@0,0T0$8 4  00s0p  0  0S S S0pp0p"v0p00 p, 0p00000p0p0pp0p00 p0pT0$84 0p|0p0p6p0p 0-(0PL@  0ES88880&R0010 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sp -L P А: p-PL`@  (0L0 P8 T@0 X0h T$8 40 \T0 $84 0 \;\\@0:\ `0  phpT0$8 4`А:D<Đ: -dT`0LSP, 000,84!T0$4T0@8$!4p,00,00S ,0 00 KT0$8 4 000 <8 T0$48@ T0$4 000000000000000660000xTe7%<%<%< :%< -1`LQPp@(0 0GS 8`888 L0"S0&I "L0 S  L0"S0& `8 T0$4T0@8$d 4@d`d0h 0Sd0P0d@EpxTe:%<7 p-L`P@0 R$(0L0 P8 TP0 0h X0( R pph T0$84  \pph v0%@0S@ V0`S@!1|t  Q \HphL10 ` V$0&<$;;t;4;`;<;j;H&< p-0LS`  p  P  @p -L Mp F50S (K02*@R`  gYs `@PP00U0SS U0 !U U `Y[, ,@P0 U 0 0f P0 @  P!0P XP, 0I`Y `P@PD@P@`D@U  0Hy4 `  `od&<&<|&<&<&< p-`L @PT M  @PT400 ph=00 R0S| -LLMQp0@0Π; ; lK$PL `4;00 50P@800808400 0 4P P 898 EP8 -l'<'< -LLM`@pPP $KpKLF1<180 @p K) :R: #`)xe(<(<:P: -`LpQ0S| R0000| 0 @P≻@@@h|@0|0 `hK p-`PLW@T | R0000| 0   4p -@LP 900 p-P!3@L `P& `0 0 `` l l0sU 0@|     |\0pp`@9?9 p-@LT` ̹PP P PPݢ00p -LM` P @ LQ Rʨ0  QpP U尢㭢K0P 0:$@K 3sH`DPm(0< $ CP@ ,@D(?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~!#$%&'()-0123456789@ABCDEFGHIJKLMNOPQRSTUVWXYZ^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{}~Ͼ󨷵ǎԐѥ噞᷵ǎԐѥ???????????????????????????????? !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????msdosfs_lookupUmsdosfs_mount(' ''%L''%p'''%('msdosfs_createmsdosfs_mkdirmsdosfs_renamemsdosfs_readdirbpfwriteifpromiscifnewlladdrif_getgroupmembersif_getgroupifconfif_clone_listif_group_egress_buildif_downallifioctlifa_print_rbn; &C vkkMPG&"֊/aK+d 5ӆ1 q^h,`@yFgKrޔԘJk*OņךUfϊDx%K]?!HpcwucB0 mL5&/ᾢ5̈9.WUGz+2ўfD~T; ʌ)k<(yv;VdNtے lH]nCĨ917Ӌ2CYnڌdҜI%ϯʎGooJr\$8WsQ#|!>ݖa B|qؐ_jiX':'8+3"p3-"< IxPzY e1ƄÂ)wZ{m:,ieee80211_wep_decryptieee80211_wep_encryptPPPPPieee80211_ioctlieee80211_ibss_mergeieee80211_end_scan  0ieee80211_node_attachPP ^/ f ^/ ^/ieee80211_recv_4way_msg3ieee80211_recv_4way_msg2ieee80211_recv_4way_msg1PP;;;;;;;;;;; ;;;$;4;@;H;P;X;`;d;l;p;t;x;ieee80211_newstate;;t;3;0 ;G(;9$;!;08;0d;40;`;RD;UL;p;T;|;  ;5:X;R;;;7;6;7:7; ;::72;p:7;6;7:;6 ";0,;@;X;!T;;6\;5h;t`:7x:dx:p;l;R`;7|&;7 ;A;H;C;J;K ;$;(;@,;I0;4;E8;E<;@;D;H;5:L;7x;7P;;T;;0'X;\;!`;d;.h;l;7B;7*p;";Ot;\\:`x;J|;h@:7v;l|:7X;z;;;;;7;B;7:6;w;;E;6;6 ;0;G$;:;7H8:Z;E\;:^P;V;w;;7;@@@ @@ !" 1:7 25@608 943 @ A BC D@EFGHIJ K RSTU V X`abcdefgh ij;T;U;S;R;;F ;I;V;E(;0;G8;@;BH;P;XX;`;Dh;l; t;7|;@;5;;2;6;;8;0;;9;;4;;; ;3;h;@ ;;;$;",; 4;!<;D;:L;T;1\;d;Hl;@x;J;K;A;;C; ;;@;;;f;g;`;a;b;c;d;e;i;j ; ; ;revarprequestarprequestin_arpinputarpresolve in_delmultiin_addmultiin_ifinitin_controlin_lifaddr_ioctlinet_ntop4inet_ntop%u.%u.%u.%uicmp_mtudisc_timeouticmp_mtudisc_cloneicmp_reflecticmp_input}E#(Dip_savecontrolip_forwardin_iawithaddrin_ouraddroKgpqrstuvwxyzip_setmoptionsip_outputtcp_inputtcp_set_iss_tsmtcp_ctlinputtcp_respondtcp_respondtcp_respondtcp_timer_rexmt++(+|+tcp_identudp6_ctlinputudp_inputPQSeA~ä^':k;EXKU0 mvv̈%LO*ŀD5&bIZg%E]u/LFk_zmYR-!tX)iIDɎjuxyk>Xq'Of ɴ:}Jc1`3QESbwdk+XhHpElޔ{R#sKrW*Uf(µ/{ņ7(0#j\+ϊyiNeվb4ъĝS.4U2u9 `@q^Qn!>=ݖ>FMT]qoP`$C@wgB谈8[yG |B| H+2pNrZlV8ծ='9-6d !\hT[:.6$g WҖO aiKwZ *C"< Nj򹨶-ȩWLuݙ`&r\;fD4~[v)C#hc1cB@" Ƅ}$J=2m)K/0R wl+pH"dGČ?,}V3"NI8ʌ6 Ԙρ(z&ڤ?:, xP_jbF~Tؐ^9.Â]|i-o%;ȧ}nc{; x&Yn쨚Oen~ϼ!ٛ6oJ |)11#?*0f57NtʂАا3JAP/MvMCTMўjL,QeF^]5st.A ZgRے3VGmaךz 7Y<'5ah,4$8_@r %⼋I<(A q9޳ ؐVda{p2t\lHBWЧQPeA~S^':k;EXK0 Umvv̈L%O*D5&bZI%gE]u/LFk_眒zmYRڃ-!tXiI)ɎDujyx>Xkq'Oᾶ f:}Jc13Q`SbEwdk+hHpXElޔ{Rs#KrWUf*(µ/{ņ7ӥ(0#j\ϊ+yiNe;b4ĊS.4U2u 9`@q^nQ!>ݖ=>ݮMFT]qoP`$֗C@̞gwB谽[8y |GB| +2HprZlN8Vծ=9-6' d\h!T[.6$:g WґO aKwZi *"4$8,@_r% I<( A9q ؜Vd{a2p\lHtWBQPA~Seä':^;kEXK0 Uvm̈v%LO*5&DbIZ%gE]/uLFk_mzRY-tX!I)iɎDujxyXk>'qᾶO f}:cJ1Q`3SbEdwk+HpXhEޔl{Rs#KrWUf*(/ņ{7ӥ(0#j\ϊ+yiNeվ4bĊ.4SU2u 9`@q^nQ!>ݖ=>ݮMFTq]oP`$֗@Cgw谽B8[y|G B| +2HpZlNrV8=-6'9 d\h![T6$:. gWҖOa wZiK *"$8,4_@r %<(I A9q ޳؜Vd{a2plHt\BWQP~SeAä:^';kEXK U0mvv%LO*&D5bIZ%gE]u/LFk_zmYR-X!tI)iDujxyk>X'qOf }:cJ1`3QbESwdk+pXhHElR{#srKWf*U(/µ{ӥ70(#j\+ϧyNieվb4Ċ4S.U2ኤu 9@`^qQn>!=ݮ>MF摵Tq]o`P$֗齉C@gwٰB8[yȡG ||B 2H+plNrZV8=ծ6'9- dh!\T[$:.6 g WҖOa ZiKw *h8,4$_@r %(I>>>KKKKyyyy xxxxZZZZݨ33331111YYYY''''____````QQQQJJJJ ----zzzzɜ;;;;MMMM****뻻<<<q//^SShѹ,` @ȱy[[jjFˍپgK99rJJLLXXJυkл*媪OCCMMU33fEEPPD<KKܽa ppB>>|ĵqffHHaa_55jWWйiX':'8볘+3"iip٩3-"< I·UUx((PzߥY  ڿe1BBhhAA)w--Z˰{TTֻm:,ccƥ||ww{{ kkֽooޱőT00`PggΩ++V}׵bMvvʏEɉ@}}YYGG AԳg_Eꜜ#Srr[u=&&Lj66lZ??~ÃO44h\Q4qqثs11bS*? ǕR##FeÝ^0(7 / $6=&''Niuu ,,Xt4.6-nnܲZZ[RR;;vMַa}))R{>//^qSSѹh, @`y[[jjԾˍFg99rKJJLLXXυJлk*OCCMM33fUEEPP<!KKݽa܋ pp>>|Bqff̪HHaa£55j_WWiІX:''8+"3iiһ٩p3-<" ·IUU((PxߥzY e1BBhhиAAÙ)--Zw{TTm,:cƥc||ww{{ kֽkoޱoőT0`P0gΩg+V}+׵b׫MvvʏEʂɉ@}}YYGG AԳgԢ_Eꯜ#Srr[u·=&Lj&6lZ6?~A?̃O4h\4Q4qqثs1bS1*? ǕR#Fe#Ý^0(7 / $6=&'Ni'Ͳuu  ,Xt,4.6-nܲnZZ[RR;vM;ַaֳ}γ)R{)>/^q/SSѹh, @` yȱ[[jԾjˍF˾gپ9rK9JJLLXXυJлk*OCCMM3fU3EEPP!KKaܽ pp>|B>qĵf̪fHHa£a5j_5WWiйX:''8+"3iһi٩pَ3-<" ·IUU(Px(ߥzߌY  eڿ1BBhиhAA)-Zw-{˰TTmֻ,:ƥcc||ww{{ ֽkkޱooT`P00ΩggV}++bM櫫vvE@}}YYGG A쭭g_E꯯#Srr[u·=Lj&&lZ66~A??Oh\44Q4qqsbS11*? RFe##^0(7 / $6=&Ni''Ͳuu Xt,,4.6-ܲnnZZ[RRvM;;a}γR{))>^q//SSh,@` yȱ[[ԾjjFgپrK99JJLLXXJϻk*O媪CCMMfU33EEPPxD<<%K㨨QQ]@@?!pH88c߼wuBc!! 0mҁL &5/__5DD.9WU~~zG==Ȭdd]]2+ss``OODf""T~**; FF)kӸ(<y޼^^ v;dV22tN:: II Hl$$\\]½nCשּׁĦbb917yy2CnY77ڷmmd՜NNI੩شllVV%ʯeezzG鮮oպxxJo%%\r..8$WsǴQ#|tt>!KKaܽ pp|B>>qĵ̪ffHH£aaj_55WWiйX:''8+"3һiip3-<" IΪUUPx((zY  eڿ1BBиhhAA)Zw--{˰TTmֻ,:cccc||||wwww{{{{kkkkoooo0000gggg++++׫vvvvʂ}}}}YYYYGGGG𭭭Ԣrrrr&&&&6666????4444qqqq1111####''''uuuu ,,,,nnnnZZZZRRRR;;;;ֳ))))////SSSS [[[[jjjj˾9999JJJJLLLLXXXX着CCCCMMMM3333EEEEPPPP<<<>>>ffffHHHHaaaa5555WWWWiiiiَUUUU((((ߌ BBBBhhhhAAAA----TTTT @6MD5FinalRMD160FinalSHA1TransformSHA1Final؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHG"(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDlɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~[/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxqg jgrn<:ORQhك[ 1Ѭߘr/Ḗ~&jE|,G$l iciNWqX~=t XrX͋qJT{YZ90`*#`(yA8۸y:`l>w'K1/x`\`U%U攫UbHW@cj9U*4\̴ATr|*oc]ũ+1t>\3֯\$lS2zw(H;Kkē!(f a!`|H2]]]u#&܈e>#Ŭom9BD . Ji^Bh!la gӫҠQjh/T(3Ql n;zP;*~ev9>YfCoEå}^;uos D@jVbNw?6r=B$7H ۛIrS{y%P;LylO`@ž\^c$johSl>9oR;Qm,0DE ^J3(fK.WtE9_ ӹyU 2`yr,@%g̣饎"2u<kaP/R=2`#H{1S>W\o.ViB~(2gsUO'[iXʻ]=!lJ[-ySeEIҐK3~ˤAb Lw6~д+MەqՓkю%ǯ/[{AI~-%^q h"W6d$ cUYCxSZ٢[} Źv&ϕbhAJsN-GJ{RQ)S?Wƛv`+t恵oWk *!ec.4dV]-SGjnpzKD). u#&İn}ߧI`fqilRdVឱ¥6)L u@Y>:䚘T?eB[k?ҡ08-M]% L&pc^?kh >\D}W7: P tAu8/;21>8TNmO Bo ,y|$ryVw.?rU$qk.P̈́GXzt}K:zfC cdG27;C$CMQe*P:qUN1w_V5kǣ;< $Y,n<pEㆱo ^*>Zw=Ne)։>%fRxL.jxS<- N=+6&9`y#RnfE{7(2åZl!Xeh;/ۭ}*/n[(!pa)uGa0a4c\s9pL ު˼,b`\ndi#PZe2Zh@*<1! T_~}=b7w-_h)5ǡޖXxWcr"ÃF T0.SHُ(1mX4a(s<|J]d]B> EꫪOlOBBǵj;Oe!AyMjGKPb=bF&[$ti GV[ Htb#*BXU >ap?#r3A~_;"lY7|`t˧@n2w΄PU5ai Z .zD4Egɞs͈Uy_g@Cge48>q(= m!>J=+hZ=@&L4)i Av.khq$j 3ԷCaP.9FE$tO!@MpE/f m1'A9UG%ښ ʫ%xP()Sچ, mbhiHפh'?Oz|Ϊ_7әxB*k@5 ٫9N;VmK1f&tn:2C[Ah xN جV@E'H::SU kKмgUXc)3VJ*%1?~^|1)p/'\,(H"m?H܆AyG@n]Q_2Տd5A4x{%`*`lc´2Of#k>3b $;" r(-Exb}doITH}'>AcG t.no:7`L knU{7,gm;e' )̒9 i{f} ϑ^و/$[Qy{;v.97yY̗&-1.Bh;+jLu.x7BjQ满PcKkؽ%=YBD n *Ngd_ڈ鿾dW{x`M``FѰ8Ew63kBqA_^;Z4ٷ,Q+:Ֆ}}>(-}|%rZLZq)GW;()f(.y_xU`uD^mm%adâW<'*:m?!cf&(3uU4V<wQ( gQ̫_QM08bX7 z{>d!Q2Ow~㶨F=)iSHd$m-if! FEdlX [@X̻k~jEY:D 5>ʹrdfGof,ҏ"W##v215VbuZ6ns҈bIPLVq z2E{Sb%ҽ5iq"|˶+v>S@`8G% 8vFšw``u N˅؍芰z~L\HjiԐ\-% ?2aN[wߏWr:j?$.Dsp"8 1).lN!(Ew8fTl 4)P|ɵՄ? Gy ~tn,fy3jXDD1Zs"*ˁc8:$zi HIĀ@8HުL H_%A@N$A UeQr% 9jyMc@hV 틕Z Vqק)N-fcqw*7 5Wa"ɠBր[t!h!hl iwW~@PճMװx QV$AV ʔUWnྵa$ XK'aU{whkldMDfd~i/IO70j5,s@IvM;B(HDLns) _ɋ}oaOw.+rץ<}+FYYEEهTNoHm| ǥcs_DVj͈prͳ]ny` E`1©\1BN"r\,rN@%/N2g@#x\n܃"ukMxnXO DH?{vw#Vu*F_( +8=6 JRft;QZylu eX&hJpFS(l\v0k)h76*g$ k%ֿh,DUueI40" WIbuU~bڨv^FESGml,gHL|3ەCh\SU2` ߝWc9^28aI37~^b<#NygCHKJf-ۄoH Ja)Yfc(` 0qt&@3/C~A^ l( ؒ0~of˜os*`ژ46K-%#= %IH6Jo8C@TzWOpA:Z„TU|5YŗZ:G:%Sj~=eI&TwQ[P]vlDȨ!帊iX`[ŗY)L;]J5ULkD$5鰽bעT/I18T(q)9H[/u@g+3-fVo*ɛ`( ')dMP˲,\26K_A !PNhذy\CPIMAC8wn\e0Rԋ@+>`xT7}02m-yyS"wuXȃoxkcZ\3]ùzv٣Byqj3ƚ`'PC=+mvN%ύHf6AN( aϩI=߹_d: }+p?PO+Zbbyj.H@,Z@"ғ-ES4n)olIIBr~V>olbfLTq*+9)XLVRf.S9v.i硦>iFt+LVvuOx39]O#2]2=&K/~~<O^?vf)o=E4ӷ+4grN=U"g`k8=ü0}8QcÐӝXyTGָaYwSW-XVcNx.F~eyUڑ0@5㶼P?!@=LXI6QpӱڍyKoqK 0ݻ맕d5w$,ϩ/ tцB*v:-7ޚ, )p@ :$7ѴyN] h1 HZ޻Bf1畏?r 3uQB}\cmd!@ WS1zݨ]3CoFq"8ԚέiGb[UgfN G[oLĎnrWxzdD]Ջ` l_9 ]c2֋~ pIPӻߘ)* mS~H~X.t;/RG'~[!<8zvOB9`55'{ɸ6g {pqT3^-ZId, =4pBwbO&Ҹ$d%FN`7>͕xE_{ ۫v"{.1ן%$r_m L=mPO%os#(ĴyI%4aĘnzn|l6AT޾'VAJJ{` ,8I%vK$%Gv XY f 0NndQ& #Phꃢ@0 /kz%?/?!M@`Iɟ'Կ@uИcnafŽ"o;h(Yy#P_w@CV/|-ҢɡHl4ma/T"2*kT:V"AӢ@f/9/Mҹ-?JDvR7,YQoz Zh{.T"5Y/mKdPIf-徐"3;䎴]4K@E?1.eUʱծ-mԢP @"8On ׿r[O/LVSTIiFXEŅc]ՊSW9j7=T*_}x:vbj Bz)^'rgP8ƌDŽZ*'JkѢ*V`C u\B&Ʉq-ls5&5 M{n0f&%HVV^c ϲc|E pPr(pH# yM;-AB G&LjMG\^ |Y#јr8S#/nqFnEV 9q +A|iCHy}B{BIZݿe\ [ ~iC?9zaz UQry吝5rNcZպ60ę _}֡{/6Y DYD̃Aѱ* ;{ B[A%zzӤ0XޘN?wiy{$[Ĭ%5P_aT1bcKU !h]Yfsc=4·~!+g\ab906;Wd/`:5F- 'zy㠌l0^7%oo;j tE'4:NiOM>dY58EfCr3c%N? (Υ'R¦սTUdpfM w&ۄgC!`X0TroSUGڿ]bVhkʃ;n-Ӧ\= wL3{9+^S_aodC x^c"&gI{ڷ"%-U^7rRyL H[k0 cq/޹ S E!5(T<)c)A|-nRPf4,0P1`sY&D\dwR3A+ٺ|o!PaH?ek«dv&4{^% ;MM1$~I,;jx`]sVz\/1Co0TyXR^/2zj0>՚1B°I #ڸ(0q_`ɣaM/Ǚ."płNؼ40y;'ƸaiH?;(ZC/v7ܱӧßn>ƼB7Q(heRwj-K'5.n\ )^XOX{iT̨g&H`K`8# ~8lI `s5GƱVL>#8d^BFzk Od^AE#\;]>rC|m~ll9`qpsv#E@]%=`GK6DήPQH<p}}d^(O= &g.yr?U+HԼ?^!@WNFRWs3NɷdŸW1O g_?@k{C=K۵cUȗn-J(JqoCCl< _P/~׿PZG.Q>pX.0_|r *,]I鎸P'WIoyR}}Yr@EEt]>uOiVA#. '`vteyvvwHNma}/ 4H<0(Ow Vܒ M"7)}V'|@|硴f^aÝ <є`AFv\;x,WGl"}NC~8<=Q8d{h'فI]j~vh]9K9 ;#Im<Eub'z\aBΒ~Brrp }ȡ[(Ob<51)BSjO[}m(Ki\j#MŌ?,-ҖXRg[HJI \EkӉ7`:SRqDIK @sg4|~q6UO/Т`?mPьGnU?墼38Wg} =3{r3O̫]ňv{{uWBdBc+ri/n+_mazgaq%9̸L!gуb>ܷν8\ =Dmn`I:T`H'W+8$ ږ%Eh;}E `P/(b4 ٠m+1+dZ0RXBA\1>26F3S75 {s{OJWdCQz(~c5_ yCdcdJ$_(͸O@C " 0 O7-{$MgQLq_-_d !S^>'_aB%rqK=;&o~~TLmDl߫I&Ǡ36~?Pa w8Pr.PwWFgOT3ɏ1 i5M\=fȦ[]oڑo/"F}F9mOCCN!и  ?X(>nH&p׋wt|% - y#;(8itb߷@!{7Ȋ@ YVvO@/{U MVi35'#WȯVeka^u˅nwU2?-ɿ[%;з$;mc fÀ(82 Tɪס2Zb,gTzuw11&o6F HjyZVLj~CRv/ t,t* M|k .TA5B=!&|,aRe1i%& !\1cr ^Iy p1 d>>̶Ոî 0rlqn/kءDVÈ9/ű1(x⤣2}o~X$Ū{s0a!-!)۳*)e\,0?Б\,ԩT _w:^VxV޾\!uQųåҶw#)Ei/z毲p[v F98/gsD)k)/Ifingӛ/~p%Q^$Slj>!DYܷ)eyCy9A+MWN )zkS< ~U3rŅ?~                               A@@@A@@A@@@@A@@@A@@@@@@AAA@@@@@@@@@@@@@A@@A@@A@@@A@A@@A@@A@@A@@@@A@A@@A@AA@AA@@AA@@@AAA@A@A@A@A@                              @@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@                                        0 0 0  0 0  0 0  0           0  0 0 0 0  0  0  0          $$  $ $ $$  $ $             $$  $ $ $$  $ $                  0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0                            ((  ((  ((  ((  ((  ((  ((  ((          """"   " " " " ((((((((    """" ( ( ( ("("("("(  ##%%&&))**,,//1122447788;;==>>@@CCEEFFIIJJLLOOQQRRTTWWXX[[]]^^aabbddgghhkkmmnnppssuuvvyyzz||cryptof_ioctlswcr_authencswcr_authcomputeswcr_encdec66666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\aes_xts_cryptaes_ctr_cryptZAES_CMAC_FinalHMAC_SHA256_FinalHMAC_SHA256_InitHMAC_SHA1_FinalHMAC_SHA1_InitHMAC_MD5_FinalHMAC_MD5_InitAES_GMAC_Finalaes_key_unwrap H!x-ML.RN8D( `hz=Skc|j9{Б/Uڅ?AZX_f ؐ53eiEVmv° GJBnI[#Q")yq~ ruo7ӎbwO$26󦻬^lW%㽨:Y*F?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@ffs_mountT-p-Ds-x-\-Tq-`o-hk-k- g-h-Hg-p- ufs_makeinodeufs_readdirufs_mkdirufs_linkufs_renameext2fs_readdirext2fs_direnterext2fs_mount>.p-x6.x-\-84.2.x..-.,.E.,,.p-.w.!;x.d. d.w.$d.!;~.w. !;w.Te.,!;m.Dw.w.w.@!;s.dv.u.w.Xo.P!;}.w.\!;uaddr_pivot_removeuaddr_pivot_insertuaddr_bestfit_removeuaddr_bestfit_insert,dd0d0d0d0d0d0kuvm_map_printitvmmapbsyBUSYWANTEDTABLEDCLEANCLEANCHKRELEASEDFAKERDONLY ZERO PAGER1FREEINACTIVEACTIVEENCRYPTPMAP0PMAP1PMAP2PMAP3\sys_swapctlin6_pcbnotifyin6_pcbconnectin6_prefixlen2maskin6_prefixlen2maskin6_ifpprefixin6_delmultiin6_addmultiin6_unlink_ifain6_ifloop_requestin6_purgeaddrin6_update_ifain6_controlin6_lifaddr_ioctlin6_nigroupget_last_resort_ifidin6_ifattach_loopbackin6_ifattach_linklocalin6_ifattachin6_ifdetachin6_selectsrcfrag6_inputicmp6_redirect_outputicmp6_mtudisc_updateicmp6_redirect_diagicmp6_redirect_inputicmp6_notify_erroricmp6_reflecticmp6_rip6_inputni6_inputicmp6_inputip6_nexthdrip6_savecontrolip6_inputip6_forwardip6_setmoptionsip6_getpcboptip6_ctloutputip6_outputfill_prlistnd6_lookupnd6_ioctlnd6_outputnd6_freend6_storelladdrnd6_cache_lladdrnd6_rtrequestnd6_dad_duplicatednd6_na_outputnd6_ns_outputnd6_dad_timernd6_dad_startnd6_ns_inputnd6_na_inputin6_ifaddnd6_prefix_onlinknd6_prefix_offlinkpfxlist_onlink_checkprelist_removend6_prelist_addprelist_updatedefrouter_delreqdefrouter_addreqnd6_ra_inputnd6_rs_inputrip6_outputrip6_inputrip6_usrrequdp6_output0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-     A@!  @a`10  @`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O      A@!  @a`10  @`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O @@ !1Aa  0@` #+3;CScs(S2N2N2 N24I2 4I24I2 4I2 4I2 4I2`Y;pY;j;|Y;Y;Y;Y;Y;Y;j;   L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c            (08@P`p   0@`  0@`22Ta%22Ta%T];:X];:d];:h];,X; :: l];:p];t]; |];];];];];];];];];];p ];];p 0];];p `];];p p];];@];j;`];j;P ];];P ];];P @];];P P];]; ];];^;];];^;^;^;];;];; ^;;^;;^;;$^;;  P;;P;;,^;0^;@4^;0^;<^;@^; D^;j; H^;j; P^;j; T^;j; X^;j; \^;j; `^;d^; `^;h^;/l^;;op^;t^;0/h];;p x^;: 0y;^; ^;^; @^;^; `^;^; |:^; ^;^; ^;^; ^;^; ^;^; 0^;^; @^;^; `^;^; ^;^; ^;^; ^;^; ^;^;^;^;^;^; ^;^;0^;^;@^;^;P^;^;`^;^;p^;^;^;^;^;^;^;^;^;^;_;^;_;^; _;_;_;_; _;_;0 _;_;@$_;_;Pp:_;`(_;_;p,_;_;0_;_;4_;_;8_;_;<_;_;@_;_;D_;_;H_;_; P_;T_; X_;T_;\_;`_;h_;l_; t_;4];0x_;4];@|_;4];P_;4];_;_;_;_;_;_;_;_;_;_;_;_;_;_;_;_;_;_;_;_;_;_; _;_;_;_; _;_;eqnecsccmiplvsvchilsgeltgtlenv0.01.02.03.04.05.00.510.0daiadbibedeafdfasdeppmzlsllsrasrror_bus_dma_busaddr_to_paddrAc; :Ac; : Ac; :`Ac; :Ac; :`Ac; :`Ac; :`Ac; :PTc; :Ac; : Ac; :Dc;L:Dc;:id;: id; : id;L: $id;:0$i(d;: ,id;:0,i(d;: .i8d;:0.iHd;:!iXd; : !i`d; :)iXd; : )i`d; :-iXd; :Aihd;L: -i`d; :Aipd;:Aid;:Aid;:`Ad; :`Ad; :PA d; :pA d; :A d; :A d; :/A e; :?A e; :A (e; :A 8e; :/A Le; :?A `e; :OA te; :A e; :A e; :/A e; :?A e; :OA e; :e;e;e;e;f;f;f;f;(f;0f;h;>;>;>ħ;>;?;?<;?T;?t;?;?;?Ȩ;?;? ;? (;? 8;? X;? l;? ;?;?;?ԩ;?;?;? ;?<;@X;Ax;B;C;DԪ;Dq;E ;F(;G@;GT;Gt;G;G̫;G;G;G<;Hl;I;J;KĬ;Kج;K;K;K(;K8;KL;Kh;Lx;N;P;Pԭ;P;Q;Q$;RX;Sh;S;S;S;S;S ;S(;SD;S`;Tx;U;U;U̯;U;U;U,;UT;Ut;U;U ;U ;U ;W ;XD;Y`;Zt;Z;Z;Z;[;[;[(;[@;\\;\p;\;];]̲;];],;]`;];]г;];]8;]l;];]ش;];]8;]l;];]е;] ;]!D;]"|;]#;]$;]%$;]&X;]';](ķ;]);]*,;]+`;],;]0и;]1 ;]2H;]3;]4;]5;]6(;]7d;]8;]9̺;]:;];<;]<p;]@;]A;]B;]CL;]D;]E;]F;]G;]HD;]Ip;]J;]Kн;]L;]P4;]Ql;]R;]SԾ;]T;]U<;]Vl;]W;]Xп;]Y;]Z4;][d;]\;]`;]a;]b<;]cp;]d;]e;]f ;]gD;]ht;]i;]j;]k ;]l<;]x;^;^;^;^ ;^0;^X;^|;^;^;^ ;^ ;^AD;^Bd;^C;^E;^G;`;a;a ;a$;b4;cP;c|;d;d;e;f;f;f,;fX;g;g;g;g;g ;g,;gL;gp;g;g ;g ;g ;h;i,;iH;ih;j;k;k;k;l;m ;n,;oL;o;o;o;o0;oh;q;r;r;r ;r4;rl;r;r;r;s;s;s;s;s<;s`;s|;s;s;s;t;t;t;tL;tl;t;t;t;t;t ;t D;t l;t ;t ;t;t;t;t!0;t0X;t@|;ta;tb;tc;td;tnL;tox;tq;ty;scsibus_printlink;;(;0;<;j;P;\;j;p;|;;;;j;;;j;;;j;;;j;;;j;j;;j;;;j;; ;j;;;j;$;,;8;@;D;j;;L;j;T;`;t;x;;;x;;;x;;;;j;;;j;;;j; ;;j;;$;j;4;$;j;<;D;j;X;`;j;4;p;j;4;;j;;;j;;;j;;;j;; j;j;j;j;j;j;j;j;j;j;j;j;;j;j;sdgetdisklabelsd_read_cap_16j;j;j;j;j;j;j;j;j;j;j;j;j;j;j;j;j;j;5ldd5dPd=ldd=dPd(,dd(ddPlddUlddlddldd;;8;,dd;;z;; ;;;;;;; ;(;4;<;@D;L;@p;x;;;;@3 ;;;;8;l; ;;H; ;;;;;;;0;;`;;; ;;; ;;;HT ; ;GC;;;(;;,; <;D;;\;HTl;l;x;@; ;;; ;;`CGCZ)IeI;;;ZIZIIIIII0I0PI0;;I0;;I0E;;]I0E;;PI0E;; I0E;;FI0E;;@I  I;;;;@";$;;-/,;8;,;L;,;`;,;x;,;;;;,;; ")A;;u EE;;;;@&o@o @o @  @& 3BI0E@I0EHTI0E;;@I0E;;I0E;; I@(#0Vw,;;,;;;;;;;;; ;,;<;Pttt3V;L;<;VX;,;<;8Vd;h;;V;;;;<;V;;;s;;;;oo PM(;<;k&h= = s qPs&! qhd;l;l C;; ;;apxapcic_create_event_threadd, 5`h4n4i4 5di4Hi4 5C(.} ["$&'X4gklrE: 1! 2" q wW^ a z '3#&4$eE=sdD`x5%rR+tT[fF\c--@  6&!yY]"gG;#v$bB_% & (7')8(*uU{+hH:,n-,/<.09)1iI}2jJ*3m4.?>680~9o:k;lL|=>@ApD FPQSTXY] dK28G:<A50;5A5wddumpwddonewdattach   !"#$%&'()*+,-./0000000000:;<=>?@00000000000000000000000000[\]^0`00000000000000000000000000{|}~00000000000000000000000000000000000000000000000000000000000000ABCDEFGHIJKLMNOPQRSTUVWXYZ㡱vt100 666$:66X6wsemul_vt100_handle_csi@[\]^_`{|}~|^_`#@_^_`#_#^_`^_#@^_`~#@^_`~^_``#_#@[\]^_`{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^%% $ $ $ $ $%% %%<%%$%4%,%%d"e"`"  " %" #!#%# # # # ""*#d"`"e"+"4"""""<"C"!!a"""")"*"'"(""!!!!;;;;;;;;; ;;;$;,;T;\;4;<;D;L;T;\;d;l;t;x;|;;;;;;;;;;;;888@ `P0pH(hX8xD$dT4t L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}C#cS3s K+k[;{G'gW7wO/o_?t6d66X6usbd_set_config_indexusbd_devinfo0@$@c@c@eaQ@X@W@@0@ w@Q2@U@4@F s%^^uhub_attachDd66D66p66866 uu ; u%5E u%5E     uu%5E )u&5F 2 5u&6F 0 1 3 4u0uhid_do_ioctluhid_do_read6787=_:R*b: b:]b:c:d:If:f:Jf:RHg:7g: Zh: h: h: h:Kh:`i:@#ji:`i:`i:`i:`i:`i: `i:`i:H@`i: Ni: _Lj: k:nl:\n: n: n: n:En: to:mo:Kfp:Ap:[~q:4r:0Rr: r:s:jt:u:?u:nFv: "w:J6w:w:abcde f g h i jklmnopqrstuvwxyz1!2@ 3#!4$"5%#6^$7&%8*&9('0)( ) *!+ , --_.=+/[{0]}1\|2\|3;:4'"5`~6,<7.>8/?9:;<=>?@ABC D E FG HIJK,L.MN-OPQRS T/U*V-W+X Y1Z2[3\4]5^6_7`8a9b0c.eh i jklmnopqrstuvwx yz{|}~ mMqQ@zy2" 3#6&$7/{%8([&9)]'0=}-?\./0+*1#'2#'345 6,;7.:8-_d<>| .'`0+*~5^q,?azw&12~ "3#!'4{"(5[#-6|$7`%_8\&9^'0@-)].=+}/0$1*2*3m4%56;.7:/8!d<> bBeE hH iI jJkKlL|,?nN~aArR,sSzZyY2 "3!'4"(5{[#6$7%!8&9%!8'0-)}].-_/0$*2`@#3mM4%5@#7:/\8=+g= aAkK~xX}iIpP& eE ,; c d tsrqQ'?ljbB|oOuUv.:yY{!\"12< 3>!(4[")5]#@6$+7%-8&/9'*0, _-=^.%`/z0w123n4m5$#6gG7h8fd/ 2"@ 3#!4$#6&$7/{%8([&9)]'0=}-+?.|/01'*2'*3456,;7.:8-_d<>\ .'`|0^~2" 3"5%#6&$7/%8(&9)'0=-'?.^/{[0+*}]123@4#5\|6,;7.:8-_d<> 1!2" 3!4$"5%#6^$7&%8*&9('0)--_.=+1#~2#~4'@5``d\|2"#6&$7'%8(&9)'0--=.^~/@`0[{1]}2]}3;+4:*5\_\|-+?\0345d<>| .'`|0^~.\0345|d<>.\`0^~xje.> u i d c htnbrl'"poygk,<qf;:-[{.]}//?0=+3s4-_6w7v8z9: ;<=>?@ABCD E 1!|2"@ 3#!4$~#6&$7/%8(&9)'0=-'?./[0+*]1}2}34{5\6,;7.:8-_d<> q,?azw&1|2@ "3#!'4"(5#6^$7%!8&9{'0}-).-_/[0$*]1`2`3m4%56;.7:/8=+~d<>\ aAD$bB8cCA!dD2eEC# fF0 gG? hH@  iIH( jJ>kK;lL4mML,nNB"oOI)pP7qQ9rR:sSK+tT5uU3vV<wWF&xXG'yY=zZO/#6^6,$7&7./[{E%0]}J*3;:64'"M-6,<17.>N.8/?Q aAD$bB8cCA!dD2eEC# fF0 gG? hH@  iIH( jJ>kK;lL4mML,nNB"oOI)pP7qQ9rR:sSK+tT5uU3vV<wWF&xXG'yY=zZO/#6^6,$7&7.--_V.=+T/[{E%0]}J*1\|W2\|W3;:64'"M-5`~6,<17.>N.8/?Q eEzy1+|2"@ 3*#!4#6&$7/%8(&9)'0=-'?./[0!]1$}2$}34{5 6,;7.:8-_d<>\ -'?.^`~0!]/[34{2"@ 3##6&$7/{%8([&9)]'0=}-'?.<>/+*012345\|6,;7.:8-_d<> .+*/2\|4eE a`~}kj!1@-2_ /3#!;4$":5#,6^$.7&%=8*&[9(']0), -?+'.xX%//.{0wW}1qQ|2qQ|3sr4"5`~6   7fF 8\ qQ@1!2" 3##6&$7/%8(&9)'0=-'?\./0+*~1}]2}]34{[5|6,;7.:8-_d<> 1!2@ 3#!4$"5%#6.=+/0[{1]}2]}345'"8;:c.d\|/? 1IqQ@2' 3^#!4+$"5%#6&$7/{%8([&9)]'0=}-*?\.-_/0~1,;2,;3_^4i05"678.:d<>| /1,;`2,;`3_^'aAcCeElLBAnNDCoOsS[ZxXzyzZ|{ bB{cC& fF[ gG] iI jJnN}qQ\vV@wW|xX#zZyY>1'~2" 3+^!4!"5%#6/$7=`%8(&9)'-./QP01qp2qp3$4506,?;7.:8-_*d< bB{ fF[ gG]kKBlLAmMnN}qQ\vV@wW|zZyY1!~2" 3#^!4$"5%#6&$7/`%8(&9)'0=-'?.+*/a`01~}2~}3  456,;<7.:>8-_d<> mMoOpP1!2"@ 3/!4$"5%#6?$7&%8*&9('0)--_.=+/[0']1<>}2<>}3;:~4{5#|\6,'7..8d /^^[0]4``{8aAcC  eE gG#" iI+*kK76lL<;nNFEoOMLsSa`uUkjzZ~} cCmMrRsSxXzZ1!2" 3#!4$"5%#6&$7_%8({&9)}'0'-/?\.'/0*|1<>2<>3+45@6,;7.:8-=d][ .~/"^4'`eEqQ@2"#6&$7/{%8([&9)]'0=}-\.-_/0'?~1+*`2+*`3456,;7.:8d<>| 4^    7 7 7t7t777x7$7X75dd5(I*LCDEOMPJQNRK&7l'7%7h%7h#7777,7`7(  v      W 1 Q `  d-7@  0 2 A@ A   @  @ @   P0 P  A   h }  } } } @  85   -7  L+ L ,7L2 D   O  {X,7o  A umass_scsi_probeF  @@@ @ @AA@:F:FP 43W  !      @ @ @ @ A n@n n@n @nn@0Df @  * Q k k"k"k"k"k @^z BF 9 |D@7dN7E7$@7axe_iff B  w *w +w +~ W UP  < 1b0 0rk {&"79n= wF@W wn a- (V7,l7P\7U7t7L~7<7t7$$0$0$$$$$$$$$$$$$$ $Ĕ7777@ 'W W@ @EEE }WQ  k"BFFeeeZZ Z 0h7d7̫772V{%1" `"'`~%ZP `\777$70w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-udav_iff `77t77hF F hF fF t77778t8 88 888l8url_int_miibus_writeregurl_int_miibus_readreg@@9WP P Q@:5g hahh! !(3P@3vK #(-2>'()*+,-./@ABCF'()*+,-./@ABCF/@ABCDEFGHIJKN'()*+,-./@ABCFMNO`abcdefghik*++,,--../-@@A&''(())**++,,-   Pp < %d could not requeue I/O%s: sr_wu_enqueue_ccb got active wu%s: sr_wu_init got active wu%s: invalid target on wu: %p%s: i/o error on block %lld target %d b_error %d unknown optional metadata type%02x%02x%02x%02x-%02x%02x-%02x%02x-%02x%02x-%02x%02x%02x%02x%02x%02x%s%sOPENBSDSR %s%03d%s: %s: %s: invalid chunk state transition %d -> %d %s: sr_startwu_callbacksr_schedule_wu: work unit not in progress (state %i) sr_sync%s: invalid optional metadata checksumunknown old optional metadata type %u %s: no in memory copy of metadata %s: could not allocate metadata scratch area %s: could not write metadata to %s %s: save metadata failed sr_shutdownsr_down%s: roaming device %s -> %s %s: sr_scsi_cmd NULL discipline %s: %s device is being deleted, failing io %s: wu %p not on pending queueunable to allocate work unitsunable to allocate ccbsvolume %s not found%s has unsupported sector size (%u)could not allocate memory for metadatacould not allocate memory for foreign metadata%s: sr_rw: failed to allocate vnode %s: I/O error %d on dev 0x%x at block %llu failed to get DUID for softraid volumeinsufficient boot storagefailed to write boot blockfailed to write boot loadercould not save metadata to %s%s: sr_meta_rw: invalid metadata pointer cannot clear foreign metadatanot enough memory for metadata buffercould not read native metadatanot part of the same volumenot all chunks are of the native metadata formatsrc_dev_mm == NODEV%s%d%cdiscipline does not support rebuildrebuild already in progressvolume not degradedno offline chunks available to rebuild%s: sr_rebuild_init: can't allocate vnode %s partition not of type RAID (%d)%s partition too small, at least %lld bytes required%s partition too large, wasting %lld bytes%s is already in userebuild of %s started on %s%s: no offline chunk found on %s! %s: %s volume degraded, will attempt to rebuild on hotspare %s sr_hotspare%s: pending I/O failed to complete on failed chunk %s, hotspare rebuild aborted... %s is already a hotsparesr_hotspare: cannot allocate vnodeHOTSPAREcould not save metadata for %sunsupported state request %dchunk not part of arrayinvalid foreign metadatanot valid softraid metadatainvalid metadata checksumcannot read metadata version %u on %s, expected version %u or earliersr_meta_native_bootprobe: cannot allocate vnodenot enough memory for fake disciplinesr_meta_native_bootprobe: cannot allocate vnode for partitionnative bootprobe could not read native metadatasr_meta_probe: cannot allocate vnodesrdiscould not create discipline taskqcould not initialize disciplinechunk %s already in useinvalid metadata formatdisk %s is currently in use; cannot force createfailed to clear metadataone of the chunks has corrupt metadata; aborting assemblychunk sizes are not equal; up to %llu blocks wasted per chunkvolume level does not match metadata leveldisk %s already assembledtrying to bring up %s degraded%s was not shutdown properly%s is offline, will not be brought onlineno free target for %sscsi_probe_lun failedvolume %s is roaming, it used to be %s, updating metadata%s volume attached as %sunable to create sensor for %ssdwd%s: failed to allocate boot volume %s: failed to allocate device array %s: failed to allocate ondisk array %s: failed to allocate hotspare %s: found duplicate chunk %u for volume %u on device %s %s: not all chunks were provided; attempting to bring volume %d online sr_locksr_hs_lock%s: controller registration failed%s: bogus rebuild restart offset, starting from 0 %s: resuming rebuild on %s at %d%% %s: could not create read io %s: could not create write io sr_rebuild%s: could not save metadata to %s sr_yieldsoftraidsr_concat_rw%s: %s: too many ccbs queued %s requires two or more chunksCONCATsr_crypto_rwcannot open key disk %s%s has unsupported sector size (%d)%s partition not of type RAID (%d) %s is not a key diskCRYPTOKEYDISKunknown crypto algorithmunable to allocate CCBsincorrect key or passphrase%s requires exactly one chunksr_raid0_rwinvalid strip sizeRAID 0%s: retrying read on block %lld %s: sr_raid1_intr_cb%s: permanently failing write on block %lld sr_raid1_rw%s: is offline, cannot read invalid volume stateRAID 1%s: permanently fail write on block %lld sr_raid5_rw%s: %s failed to get read work unit%s: is offline, can't read %s: %s: invalid volume state transition %d -> %d%s: %s: %s: invalid chunk state transition %d -> %d%s requires three or more chunksRAID 5sr_raid6_rw%s: can't get wu_rDisk %llx offline, regenerating Dx+P Disk %llx & %llx offline, regenerating Dx+Dy +Q singleDisk %llx offline, regenerating Dx%s old_state = %d, %d = %d, invalid new_state%s requires four or more chunksRAID 6RAM diskfictitiousrdattach: out of memoryrd%drdattach: device name too longhfsc_enqueue called on hfsc-less kernelhfsc_purge called on hfsc-less kernel%s: insufficient message buffers %s: %s Not set. All breakpoints used. Already set. Too many breakpoints. No breakpoints set Count Address %5d the kernel did not panic Bad function Too many arguments Argument missing %-12sNo such command Ambiguous Bad modifier Count missing ddb> procscalloutpoolsmountsvnodesbufsallbcstatsbreaksextentsmallocobjectpagepanicpoolprocregistersuvmexpvnodewatchescrashdumphaltrebootpoweroffmachineprintexaminesearchwdeletebreakdwatchwatchstepcontinueuntilnextmatchtracecallpsshowboothelphangmandmesg.strtab[ %s symbol table has bad start address %p ] ELFbad e_machine.symtab[ using %lu bytes of %s ELF symbol table ] bad magicsymtab unalignedsymtab corrupted[ %s ELF symbol table not valid: %s ] ELFAddress missing Value missing : %*lx%*ld%*lu%*lo\%03o= 0x%lx %-*s%-*lx%-*ld%-*lu%-*loSymbol not found Syntax error Divide by 0 Negative shift amount () Score: %lu/%lu ^R Bad character in number Bad escape String too long Bad character Faulted in traceback, aborting... Starting stack trace... End of stack trace. -%#*lx-%*lx-%#*lo-%*lo-%#*lu-%*lu--db_more-- %-12s%s %s+%s [after %6d] [%s:%d]invalid symbol table nameSifting table %s: Unable to find symbol table slot for %s.No slots left for %s symbol table%s%s %s bsd[ no symbol table formats found ] After %d instructions Breakpoint at Stopped at RUN AT LEAST 'trace' AND 'ps' AND INCLUDE OUTPUT WHEN REPORTING THIS PANIC! DO NOT EVEN BOTHER REPORTING THIS WITHOUT INCLUDING THAT INFORMATION! Unknown variable No value radixmaxoffmaxwidthtabstopslineslogNo watchpoints set Address Size %8lx %lx All watchpoints used. Too many watchpoints. Unknown size %s = %s Nothing written. /mnt/etc/firmware/%s%s: device enable failed : failed to clear NIC buffer at offset %x - check configuration dp8390_start: no header mbuf%s: NIC memory corrupt - invalid packet length %d , address %s warning: no entropy supplied by boot loader RRIP without PX field? SPIEEE_1282IEEE_P1282RRIP_1991ARRIP with incorrect NM flags? RRIP with incorrect flags?isoinodefhtovp: lbn exceed volume space %d fhtovp: crosses block boundary %d fhtovp: bread error %d fhtovp: directory crosses block boundary %d[off=%d/len=%d] cd9660_vget: alien ino_t %lluCD001%/@%/C%/Ecd9660_mountroot: can't setup bdevvp'scd9660root_devicetag VT_ISOFS, isofs vnode cd9660_strategy: spec%s@%dOpenBSD#!/dev/fd/%d/dev/consolewarning: /dev/console does not exist warning: /dev/console error %d initexecinit: couldn't allocate argument spaceexec %s: error %d init: not found no initswapperfork initcfpendcannot mount rootcannot find root vnodepagedaemonfork pagedaemonreaperfork reapercleanerfork cleanerupdatefork updateaiodonedfork aiodonedscheduler/sbin/init/sbin/oinit/sbin/init.bakbqquiesbqqueuebqwaitbqdestbufq_init: type %i unknownbufq init failbqinitinitclocks: unable to register softclock intrfdlockfileplfdescpldup2: fdallockqreadkqueueplknoteplwaitinit died (signal %d, exit %d)thrdeathcpu_exit returnedprocessppwaitunable to allocate kthread_qWARNING: thread `%s' (%d) exits with status %d No KMEMSTATS compiled in %d,malloc(): allocation too large, type = %d, size = %lu malloc: allocation too large, type = %d, size = %lu malloc: out of space in kmem_mapphysiomawnusage: show all procs [/a] [/n] [/w] /a == show process address info /n == show normal process info [default] /w == show process wait/emul info PID %-10s %18s %18s %18s COMMANDSTRUCT PROC *UAREA *VMSPACE/VM_MAP PID %5s %5s %5s S %10s %-12s %-16s PPIDPGRPUIDFLAGSWAIT PID %-16s %-8s %18s %s EMULWAIT-CHANNELWAIT-MSG%c%5d %-10.10s %18p %18p %18p %5d %5d %5d %d %#10x %-12.12s %-16s %-16s %-8s %18p %s PROC (%s) pid=%d stat=%s flags process=%b proc=%b CONTROLTEXECINEXECEXITINGSUGIDSUGIDEXECPPWAITISPWAIT PROFIL TRACED WAITED COREDUMP SINGLEEXITSINGLEUNWINDNOZOMBIE8STOPPEDINKTRPROFPENDALRMPENDSIGSUSPENDSELECTSINTR SYSTEM TIMEOUTWEXITOWEUPCSUSPSINGLESYSTRACECONTINUEDTHREADSUSPSIGSOFTDEPCPUPEG pri=%u, usrpri=%u, nice=%d forw=%p, list=%p,%p process=%p user=%p, vmspace=%p estcpu=%u, cpticks=%d, pctcpu=%u.%u, swtime=%u user=%u, sys=%u, intr=%u chgproccnt: procs < 0procinit: mallocprocplprocessplzombieplucredplpgrpplsessionplpcredplidlestopzombiedeadonprocplimitplcpu_switchto returnedfork idleidle%dsensorssensorsuspendpausesigwaitusersystempid %d (%s): %s write of %lu@%p at %lld failed: %d /var/crash/%s%s.coreissignal sigaplhashinit: bad cnt%02hx%02hx%02hx%02hx%02hx%02hx%02hx%02hx%s:%s,sysctllksysctldlkthrsleep%s%s(%d)Timecounter "%s" frequency %lu Hz -- Insufficient hz, needs at least %u Time stepped from %lld.%09ld to %lld.%09ld dummynanosleepdenied attempt to set clock forward to %lld denied attempt to set clock back %lld seconds ?%9d %2td/%-4td %p %s ticks now: %d ticks wheel arg func boredunexpected %s wq state %dunable to create workq thread for "%s" wqdestroywqtaskssyswqunexpected %s tq state %dunable to create thread for "%s" taskq unexpected %s tq state %utqdestroysystqsmashed stack in %ssetrunnablepreempt: cpu_preempt not yet implementedfailing resume cannot be handled resume %s config_defer: can't defer config of a root deviceconfig_defer: can't allocate defer structureautoconfconfig_detach: forced detach of %s failed (%d)%s detached config_make_softcconfig_make_softc: allocation for device softc failed%s%dconfig_make_softc: device name too longexpandcreatconfig_make_softc: %sing dev arrayconfig_make_softc: duplicate %s>>> probing for %s* mapply: no match function for '%s' device>>> %s probe returned %d >>> %s probe won >>> no winning probe %s at root%s at %sroot device %s not configured not configured unsupported /dev/%s%s%ccannot obtain vnode for 0x%x/0x%xcannot open disk, 0x%x/0x%x, error %dcannot read disk label, 0x%x/0x%x, error %droot filesystem has size 0filesystem type %d not known.. assuming ffs use one of: exit %s[a-p]dkopendisklabels not read:root device (default %sswap device (default %s%s)root device (%s) not foundnetbootroot on %s%ccan't figure root, hope your kernel is right (%02hx%02hx%02hx%02hx%02hx%02hx%02hx%02hx.%c) swap on %s%d%c dump on %s%d%croot device (%02hx%02hx%02hx%02hx%02hx%02hx%02hx%02hx) not founddisk_unbusy: %s: dk_busy < 0 disk_detach: disk_count < 0dklkdisk_attach: can't allocate storage for disklabelwrit%s%d%c: %s %sing fsbn %lld%lld of %lld-%lld (%s%d bn %lld; cn %lld tn %lld sn %lld)%s: NULL extentextent `%s' (0x%lx - 0x%lx), flags=%b FLWANTEDWANTEDNOCOALESCEFIXED 0x%lx - 0x%lx extnt%s: start 0x%lx, end 0x%lx %s: region not foundextentplklog page %p, nmissing %d POOL %s: size %u, align %u, ioff %u, roflags 0x%08x alloc %p minitems %u, minpages %u, maxpages %u, npages %u itemsperpage %u, nitems %u, nout %u, hardlimit %u nget %lu, nfail %lu, nput %lu npagealloc %lu, npagefree %lu, hiwat %u, nidle %lu empty page list: full page list: partial-page list: no current page curpage %p %s: pool(%p:%s): page inconsistency: page %p; at page head addr %p (p %p) pool(%p:%s): page inconsistency: page %p; item ordinal %d; addr %p (p %p) pool(%p:%s): page inconsistency: page %p; %d on list, %d missing, %d items per page pool(%p:%s): page inconsistency: page %p; %d on list, %d missing, %d expected usage: show all pools [/a] %-10s%4s%9s%5s%9s%6s%6s%6s%6s%6s%6s%5s SizeRequestsFailReleasesPgreqPgrelNpageHiwatMinpgMaxpgIdle%-12s %18s %18s Allocator%-12s %18p %18p inf %*u %*lu %*d %*s %*lu pool_put of NULLpool_do_put: %s: page header missingpool_do_get: %s: page emptypool_init: too much uptimephpooldma%d0123456789abcdef%llo%llx(null)0123456789ABCDEFbug in kprintf: bad base%s: table is full panic: splassert: %s: want %d have %d spl assertion failure in %skernel %sassertion "%s" failed: file "%s", line %d*FOUND**UNKNOWN*0%o%3d free slot (for add) %3d %s count %d disable (pseudo device) Unknown devno (max is %d) %3d at ??? %s flags 0x%x %s [] ? Unknown argument command args description [count] number of lines before moredev add a device8|10|16 base on large numbersdevno|dev change devices enter ddbattr val|devno|dev disable devicesattr val|devno|dev enable devicesdevno|dev find devices this message list configuration leave UKC[attr [val]] show attributes (or devices with an attribute)[mins [dst]] set timezone/dst toggle verbose booting don't know--- more --- Error unknown state already%3d can't enable free slot %3d %s disabled %3d can't disable free slot already Unknown routine /%c/ Value missing for attribute Unknown attribute change (y/n) ?out of memory. flags changed %3d can't change free slot count%3d %s changed Unknown pseudo routine /%c/ %s ? Not same device type No more space for new devices. Device not complete number or * is missing No device of this type exists. Clone Device (DevNo, 'q' or '?')Insert before Device (DevNo, 'q' or '?')Unknown command, try help Argument expected Dev expected 8|10|16 expected DevNo or Dev expected Attr, DevNo or Dev expected timezone = %d, dst = %d disautoconf verbose %sabled Unknown command User Kernel Config UKC> Continuing... addchangeddbdisableenablefindquittimezoneverbosepollselectpipeplpipelkpipeclpiperdpipewrttckoutqload: %d.%02d not a controlling terminal no foreground process group empty foreground process group runningrunnableiowait cmd: %s %d [%s] %lld.%02ldu %lld.%02lds %d%% %ldk ttyrub: would panic c = %d, val = %d mbuf %p m_type: %hi m_flags: %hb M_EXTM_PKTHDRM_EORM_CLUSTERM_PROTO1M_VLANTAGM_LOOPM_FILDROP M_BCAST M_MCAST M_CONF M_AUTH M_TUNNELM_ZEROIZEM_COMPM_LINK0m_next: %p m_nextpkt: %p m_data: %p m_len: %u m_dat: %p m_pktdat: %p m_ptkhdr.rcvif: %p m_pkthdr.len: %i m_ptkhdr.tags: %p m_pkthdr.tagsset: %hb IPSEC_IN_DONEIPSEC_OUT_DONEIPSEC_IN_CRYPTO_DONEIPSEC_OUT_CRYPTO_NEEDEDIPSEC_PENDING_TDBBRIDGEGIFGRE DLT PF_DIVERT PIPEX PF_REASSEMBLED SRCROUTETUNNELm_pkthdr.csum_flags: %hb IPV4_CSUM_OUTTCP_CSUM_OUTUDP_CSUM_OUTIPV4_CSUM_IN_OKIPV4_CSUM_IN_BADTCP_CSUM_IN_OKTCP_CSUM_IN_BADUDP_CSUM_IN_OK UDP_CSUM_IN_BAD ICMP_CSUM_OUT ICMP_CSUM_IN_OK ICMP_CSUM_IN_BADm_pkthdr.ether_vtag: %hu m_ptkhdr.rdomain: %u m_pkthdr.pf.hdr: %p m_pkthdr.pf.statekey: %p m_pkthdr.pf.inp %p m_pkthdr.pf.qid: %u m_pkthdr.pf.tag: %hu m_pkthdr.pf.flags: %hhb GENERATEDTRANSLATE_LOCALHOSTDIVERTEDDIVERTED_PACKETREROUTEREFRAGMENTEDPROCESSEDm_pkthdr.pf.routed: %hhu m_pkthdr.pf.prio: %hhu m_ext.ext_buf: %p m_ext.ext_size: %u m_ext.ext_type: %x m_ext.ext_backend: %i m_ext.ext_ifp: %p m_ext.ext_free: %p m_ext.ext_arg: %p m_ext.ext_nextref: %p m_ext.ext_prevref: %p m_copydata: off %d < 0m_copydata: len %d < 0m_copydata: short mbuf chainm_copydata: null mbufunknown type of extension bufferm_copym0: off %d, len %dm_copym0: short mbuf chainm_copym0: m == NULL and not COPYALLmbuf prepend length too bigmbplmtagplmcl%dkm_apply: len %d < 0m_apply: off %d < 0m_apply: null mbuf in skipm_apply: null mbufWARNING: mclpools limit reached; increase kern.maxclustersrequested tag size for pool %#x is too bigm == NULL in m_pulldown()unixsoaccept: !NOFDREFnetclssoclose: NOFDREFsockplsbcreatecontrol: message too large %d sbdropsbappendcontrolsemi-panic: sbcompressnetlcknetiosbappendaddrnetcon2netconacceptunp_disconnectunp_connect2unp_attachuipc 1uipc 2uipc 4piusrreqCurrent Buffer Cache status: numbufs %lld busymapped %lld, delwri %lld kvaslots %lld avail kva slots %lld bufpages %lld, dirtypages %lld pendingreads %lld, pendingwrites %lld bremfree: lost tailbiowaitbufplbiodone alreadyneedbuffernobuffersbuf_get: dup lblk vp %p bp %pgetblkbuf_needvabufinit: can't reserve VM for buffersnchplwtf? leak?vop_generic_revokeallnameilf_findoverlap: defaultlockfplrelookup: null namerelookup: lookup on dot-dot vp %p lblkno 0x%llx blkno 0x%llx dev 0x%x proc %p error %d flags %lb AGENEEDCOMMITASYNCBADBUSYCACHECALLDELWRI DONE EINTR ERROR INVAL NOCACHEPHYSRAWREADWANTEDWRITEINPROGXXX(FORMAT)DEFERREDSCANNEDDAEMONRELEASED bufsize 0x%lx bcount 0x%lx resid 0x%lx sync 0x%llx data %p saveaddr %p dep %p iodone %p dirty {off 0x%x end 0x%x} valid {off 0x%x end 0x%x} tag %s(%d) type %s(%d) mount %p typedata %p data %p usecount %d writecount %d holdcnt %d numoutput %d clean bufs: bp %p dirty bufs: flags %b vnodecovered %p syncer %p data %p RDONLYSYNCHRONOUSNOEXECNOSUIDNODEVASYNCEXRDONLY EXPORTED DEFEXPORTED EXPORTANON EXKERB LOCALQUOTAROOTFSvfsconf: ops %p name "%s" num %d ref %d flags 0x%x statvfs cache: bsize %x iosize %x blocks %llu free %llu avail %lld files %llu ffiles %llu favail %lld f_fsidx {0x%x, 0x%x} owner %u ctime 0x%llx syncwrites %llu asyncwrites = %llu syncreads %llu asyncreads = %llu fstype "%s" mnton "%s" mntfrom "%s" mntspec "%s" locked vnodes: %p, %pall vnodes: %p, %p,brelvp: NULLbgetvp: not freevflushbuf: not dirtyvflushbufvinvalbufvinvalbuf: dirty bufsvinvalbuf: flush failedvwakeup: neg numoutputsoftdep %d vclean: deadlockvclean: cannot reclaimvclean: not cleanvgonemissing aliasvgonel: not cleanmissing bdevvgetvfslockunmount of %s failed with error %d WARNING: some file systems would not unmount retrying syncing disks... giving up done kinfo: vp changed VNONVREGVDIRVBLKVCHRVLNKVSOCKVFIFOVBADNONUFSNFSMFSMSDOSFSPORTALPROCFSAFSISOFSADOSFSEXT2FSVFSNTFSUDFFUSEFSTMPFSsyncer vnode syncermount: lost mountunmount: dangling vnodevn_lockspec_badop calledspec_ioctltag VT_NON, dev %d, %d spec_close: not specialspec_fsync: not dirtyspec_fsyncspec_read typespec_write typechkvnlockdead_badop calleddead_write: lockdead_read: locktag VT_NON, dead vnode dos2unixtime(): month value out of range (%u) detrunc(): can't truncate root directory, clust %u, offset %u deextend: file too largedenodedeget(): pcbmap returned %d extendfile(): attempt to extend root directory extendfile: pcbmap. .. doscheckpath(): .. not a directory? msdosfs_sync: rofs modmsdosfs: reducing max cluster to %d from %d due to FAT size RRaArrAatag VT_MSDOSFS, startcluster %u, dircluster %u, diroffset %u (LOCKED) dev %d, %d, %s msdosfs_strategy: specmsdosfs_rename: lost to startdirmsdosfs_rename: lost from startdirmsdosfs_rename: updating .. in root directory?msdosfs_write(): bad file typebpfattachbpf_mcopybpf: ifpromisc failedbpf_detachd: descriptor not in listbpfifa_update_broadaddr does not support dynamic lengthegresstoo many interfacesifaddritem%s: can't handle af%d looutput: no header mbuflo%difmedia_add: can't malloc entryifmedia_set: no match for 0x%x/0x%x ifmedia_set failedcan't establish softnet handlerrtmaskrn_init: radix functions require max_keylen be set rn_initrn_init 2rn_addmask: mask impossibly already in tree rn_delete: inconsistent normal annotation rn_delete: inconsistent dupedkey list rn_delete: inconsistent annotation %s %p at %p rn_delete: Orphaned Maskrn_delete: couldn't find our annotation rn_addroute: t->rn_p is NULLMask for route not entered Non-unique normal route, mask not entered next == NULLraw_usrreqrt_timer_remove_all: rtq_count reached 0 rt_timer_add: rtq_count reached 0 ifafreertfreertfree 2rtfree: %p not freed (neg refs) rt_timer_init: already initializedrttmrplrtrequest deletertrequest1 RTM_RESOLVE: wrong ifa (%p) was (%p) rt_timer_timer: rtq_count reached 0 rt_timer_queue_destroy: rtq_count reached 0 rtinit: wrong ifa (%p) was (%p) rtentplroute_init rtable_addroute_outputrouteunexpected mode %uUnexpected mode %u%s: invalid channel freq %u flags %x %s: invalid channel (NULL) Bad IBSS channel %u%s: bad channel ignored; freq %u flags %x number %u Pairwise key expansionPMK Name%s: Michael MIC failure %s: station %s disassociated by peer (reason %d) %s: station %s deauthenticated by peer (reason %d) %s: %sassociation failed (status %d) for %s %s: received %s from %s rssi %d mode %s 80211scanfreeing bss nodenot in ap mode, mode %u%s: station %s purged from node cache %s: number of cached nodes is %d, expected %d,possible nodes leak unable to setup inital BSS node%s: no memory for AID bitmap! %s: no memory for TIM bitmap! %s: tsft offset %s%llu %s: ieee80211_ibss_merge: bssid mismatch %s %s: my tsft %llu beacon tsft %llu %s: sync TSF with %s %s: rates mismatch, BSSID %s %s: sync BSSID %s -> (from %s) %s: creating ibss passive%s: end %s scan %s: begin %s scan invalid group data cipher!invalid integrity group cipher!management frame too large: %unull node%s: sending %s to %s on channel %u mode %s %s: no node for dst %s, discard raw tx frame %s: failed to queue raw tx frame %s: station %s deauthenticate (reason %d) %s: station %s disassociate (reason %d) %s: received msg %d/%d of the %s handshake from %s group key4-wayEAPOL-Key frame too large: %u%s: sending EAPOL-Key request to %s %s: sending msg %d/%d of the %s handshake to %s "0x%s: no recent beacons from %s; rescanning %s: bogus xmit rate %u setupassociatedsynchronized%s: %s with %s ssid .5 channel %d start %u%sMbshortlong protection enabled %s preamble %s slot time%s newly%s: station %s %s authenticated (open) %s: open authentication failed (reason %d) for %s assoc_reqassoc_respreassoc_reqreassoc_respprobe_reqprobe_respreserved#6reserved#7beaconatimdisassocauthdeauthactionaction_noackreserved#15INITSCANAUTHASSOCRUNauto11a11b11gturboaeamaratauazbebgbhbnbobrbybzcacncocrcyczdodzegf2fifrgrgthkhnhrhuidiqisj1j2j3j4j5jmjojpk2kekpkrkwkzlbliltlvmamkmomxmyninlnzpaphpkprpyqarorusasgsisvtntrtttwuaukuyuzvnyezazwAPL1APL1AAPL1_ETSICAPL1_FCCAAPL1WAPL2APL2CAPL2DAPL2_ETSICAPL2WAPL3APL3WAPL4APL4WAPL5APL5WAPLDAPLDEBUGETSI1ETSI1WETSI2ETSI2WETSI3ETSI3AETSI3W,ETSI4ETSI4CETSI4WETSI5ETSI5WETSI6ETSI6WETSIAETSIBETSICETSIEU1WFCC1FCC1AFCC1WFCC2FCC2CFCC2AFCC2WFCC3FCC3AFCCAFRANCEMKK1MKK1_FCCAMKK1AMKK1A1MKK1A2MKK1BMKK2MKK2AMKKANONEWOR01WWOR02WWOR0WWOR1WWOR2WWOR3WWOR4WWOR5_ETSICWOR9WWORAWWORLD la_rt=%p la_hold_head=%p, la_asked=0x%lx [NULL][ ifa_addr= ifa_dsta= ifa_mask= flags=0x%x, refcnt=%d, metric=%d rtentry=%p flags=0x%x refcnt=%d use=%llu expire=%lld rtableid=%u key= mask= gw= ifp=%p (%s)(NULL) ifa=%p gwroute=%p llinfo=%p Route tree for AF_INET (not initialized) arptfreearp: ether address is broadcast for IP address %s! duplicate IP address %s sent from ethernet address %s arp: attempt to overwrite permanent entry for %s by %s on %s arp: attempt to overwrite entry for %s on %s by %s on %s arp info overwritten for %s by %s on %s arp: attempt to add entry for %s on %s by %s on %s arpresolve: %s: route without link local address arpresolve: %s: can't allocate llinfo arp_rtrequest: bad gateway value arp_rtrequest: malloc failed in_controlinvalid argument to in_lifaddr_ioctlIPv6 pcb passed into in_pcbconnectinpcbplin_pcbinit: hashinit failedin_pcbinit: hashinit failed for lportinterneticmp_do_exthdr: m_getptr failureicmp_redirect_timeout: bad route to timeouticmp_mtudisc_timeout: bad route to timeouticmp_erroricmp lenipqeplipqplip_initaeshmac-sha1deflaterip_attachrip_detachrip_usrreqsynpltcp_pulloutofbandm_pulldown malfunctiontcp_output REXMTtcp_outputtcpcbpltcpqepltcp_inittcp_usrrequdp_usrreqipip_input: should never reach herelibdes v 3.21 - 95/11/21 - eaycryptocryptopcryptodesccrydevcuio_copyback: off %d < 0cuio_copyback: len %d < 0cuio_copyback: empty in skipuio_copyback: emptycuio_copydata: off %d < 0cuio_copydata: len %d < 0iov_copydata: empty in skipcuio_copydata: emptycuio_apply: len %d < 0cuio_apply: off %d < 0cuio_apply: ind %d >= uio_iovcnt %d for offcuio_apply: ind %d >= uio_iovcnt %d for lenSoftware crypto device cannot initialize!DES3DESBlowfishCAST-128Rijndael-128/AESAES-CTRAES-GCMAES-GMACAES-XTSARC4HMAC-MD5HMAC-SHA1HMAC-RIPEMD-160HMAC-SHA2-256HMAC-SHA2-384HMAC-SHA2-512GMAC-AES-128GMAC-AES-192GMAC-AES-256Keyed MD5Keyed SHA1MD5SHA1DeflateLZS1.2.3start = %d, len = %d, fs = %s ffs_alloccg: map corruptedbno = %lld, fs = %s ffs_alloccg: block not in mapffs_freefile: range: dev = 0x%x, ino = %d, fs = %sdev = 0x%x, ino = %u, fs = %s ffs_freefile: freeing free inodedev = 0x%x, bsize = %d, size = %ld, fs = %s ffs_blkfree: bad sizebad block %lld, ino %u uid %u on %s: %s bad blockdev = 0x%x, block = %lld, fs = %s ffs_blkfree: freeing free blockffs_blkfree: freeing free fragcg = %d, irotor = %d, fs = %s ffs_nodealloccg: map corruptedffs_nodealloccg: block not in mapffs_clusteralloc: lost blockmode = 0%o, inum = %u, fs = %s ffs_valloc: dup allocfree inode %s/%d had %lld blocks out of inodes %s: create/symlink failed, no inodes free dev = 0x%x, bsize = %d, bprev = %lld, fs = %s ffs_realloccg: bad bprevffs_realloccg: bad blocknodev = 0x%x, optim = %d, fs = %s ffs_realloccg: bad optimfile system full %s: write failed, file system is full ffs1_balloc: blk too bigCould not unwind indirect block, error %dffs_indirtrunc: bad buffer sizeffs_truncate: newspaceffs_update: bad link cntsoftdep_flushfiles calledffsinodino1plffs_vget: alien ino_t %lluupdate: rofs modffs_statfsWARNING: %s was not properly unmounted WARNING: R/W mount of %s denied. Filesystem is not clean - run fsck ffs_mountfs(): obsolete rotational table format, please use fsck_ffs(8) -c 1 ffs_reload: dirty1ffs_reload: dirty2WARNING: soft updates isn't compiled in ffs_mountroot: can't setup bdevvp's ffsffs_fsync: not dirtyffs_fsyncffs_write: nonsync dir writeffs_write: typecheckpath: .. not a directory First bad Second bad %s: bad dir ino %u at offset %d: %s bad dirufs_direnter: newblkufs_direnter: compact1ufs_direnter: compact2mangled entryi_ffs_size too smallufs_strategy: specufs_rename: lost from startdirufs_rename: lost to startdirrename: EXDEVufs_rename: same fileufs_rename: lost dir entrychown: lost quotaifree: range: dev = 0x%x, ino = %d, fs = %sdev = 0x%x, ino = %d, fs = %s ifree: freeing free inodebad block %d, ino %u dev = 0x%x, block = %d, fs = %s mode = 0%o, nlinks %u, inum = %u, fs = %s ext2fs_valloc: dup allocext2fs_alloccg: map corruptedext2fs_mapsearch: block not in mapcg = %d, ipref = %d, fs = %s ext2fs_nodealloccg: map corruptedext2fs_nodealloccg: block not in mapext2fs_indirtrunc: bad buffer sizecheckpathrec_len is smaller than minimalrec_len % 4 != 0reclen is too small for name_lendirectory entry across blocksinode out of boundsbad directory entry: %s offset=%d, inode=%lu, rec_len=%d, name_len=%d ext2fs_dirbadentryi_size too smallext2fs_direnter: newblkext2fs_direnter: frag size%s: nonsync dir writeext2fs_write%s: typeext2fs_vget: alien ino_t %lluExt2 fs: unsupported first inode positionExt2 fs: unsupported optional feature ext2fs_statfsext2fs_reload: dirty1ext2fs_reload: dirty2%s: file system not clean; please fsck(8) ext2fs_mountroot: can't setup bdevvp'sext2fsext2inoplext2dinoplext2fs_mkdir: blksizeext2fs_rename: lost from startdirext2fs_rename: lost to startdirrename: linked directoryext2fs_rename: lost dir entryext2fs_rename: mangled dir- uvm_addr %s: NULL - uvm_addr %s: %p (%s 0x%lx-0x%lx) entry %p: 0x%lx-0x%lx G=0x%lx F=0x%lx free: 0x%lx-0x%lx start=0x%lx, expected at least 0x%lx 0x%lu entries, 0x%lx free bytes pivot 0x%lx, epires in %d, direction %d empty 0x%lx - 0x%lx free (0x%lx bytes) contains pivot %d (0x%lx) %s: entry was not in tree%s: duplicate insertion: state %p inserting entry %p which collides with %p%s: duplicate insertion: state %p interting %p, colliding with %puvm_addr_invoke: address selector %p (%s 0x%lx-0x%lx) returned unavailable address 0x%lxuaddruaddrhintuaddrbestuaddrpivotuaddrrnduaddr_linuaddr_rnduaddr_hintuaddr_kbootstrapuaddr_bestfituaddr_pivotuaddr_stckbrkamap_unadd: offset out of rangeamap_unadd: nothing thereamap_lookup: offset out of rangeamap_add: offset out of rangeamap_add: replacing null anonamap_add: slot in useamap_lookups: offset out of rangeamap_splitref: split at zero offsetamap_splitref: map size check failedamap_cow_now: non-resident wired page in anon %pcownowcownowpageamap_wipeout: corrupt amapamapplamap_pp_adjref: overshot targetamap_pp_adjref: negative reference countanonpluao_set_swslot: uobj = %p uao_set_swslot: attempt to set a slot on a NOSWAP objectuao_flush: strange, got an out of range flush (fixed) uaoflshuao_flush: weird flagsuao_detuaoeltplaobjpluao_create: kernel object already allocateduao_create: asked to enable swap on kernel objectuao_create: hashinit swhash faileduao_create: malloc swslots faileduao_getpageuao_getudv_faultudv_detachudv_attachuvm_fault_unwire_locked: address not in mapanonget1anonget2flt_noram1fltamapcopyflt_noram2flt_noram3flt_pmfail1fltagain2flt_noram4flt_noram5flt_pmfail2uvm_init: page size not setkm_free: unmanaged page 0x%lx km_allocvakmallockmthreadvallocwaitkm_alloc1wkm_pgrmuvm_km_suballoc: unable to allocate space in parent mapuvm_km_suballoc: unable to create submapuvm_km_suballoc: submap allocation faileduvm_km_init: could not reserve space for kerneluvm_km_pgremove_intrsafe: no pageuvm_map_clean: weird flagsuvm_mapent_addr_removeuvm_mapent_addr_insert: entry still in addr listuvm_mapent_addr_insert: map %p entry %p (0x%lx-0x%lx G=0x%lx F=0x%lx) insert collision with entry %p (0x%lx-0x%lx G=0x%lx F=0x%lx)OBJECT %p: pgops=%p, npages=%d, refs= refs=%d PAGES : <%p,0x%llx> PAGE %p: flags=%b, vers=%d, wire_count=%d, pa=0x%llx uobject=%p, uanon=%p, offset=0x%llx loan_count=%d [page ownership tracking disabled] vm_page_md %p >>> ANON DOES NOT POINT HERE <<< (%p) anon backpointer is OK checking object list page found on object list >>> PAGE NOT FOUND ON OBJECT LIST! <<< page found in uvm_pmemrange >>> page not found in uvm_pmemrange <<< checking pageq list page found on pageq list >>> PAGE NOT FOUND ON PAGEQ LIST! <<< MAP %p: [0x%lx->0x%lx] brk() allocate range: 0x%lx-0x%lx stack allocate range: 0x%lx-0x%lx sz=%u, ref=%d, version=%u, flags=0x%x pmap=%p(resident=%d) vm_refcnt=%d vm_shm=%p vm_rssize=%u vm_swrss=%u vm_tsize=%u vm_dsize=%u vm_taddr=%p vm_daddr=%p vm_maxsaddr=%p vm_minsaddr=%p - %p: 0x%lx->0x%lx: obj=%p/0x%llx, amap=%p/%d submap=%c, cow=%c, nc=%c, prot(max)=%d/%d, inh=%d, wc=%d, adv=%d hole=%c, free=%c, guard=0x%lx, free=0x%lx-0x%lx fspace_augment=%lu freemapped=%c, uaddr=%p (0x%lx-0x%lx %s) exeany[%d]brk/stackvmspplvmmpeplvmmpekpluvm_map_splitentry: split address 0x%lx not on page boundary!uvm_mapent_alloc: cannot allocate map entryuvm_mapent_alloc: out of static map entries vmmaplkuvm_map_setup: rw_enter failed on new mapuvmspace_fork: no space in map for entry in empty mapfork: encountered a submap during fork (illegal)fork: non-copy_on_write map entry marked needs_copy (illegal)uvm_map_teardown: rw_enter failed on free mapuvm_page_physget: called _after_ bootstrapuvm_page_physget: out of memory!uvm_setpagesize: page size not a power of twouvm_pglistallocuvm_pglistalloc: Upper boundary 0x%lx not on pagemask. uvm_page_physdump: physical memory config [segs=%d of %d]: 0x%llx->0x%llx [0x%llx->0x%llx] STRATEGY = RANDOM uvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX uvm_page_physload: can not malloc vm_page structs for segment ignoring 0x%lx -> 0x%lx uvm_page_physload: tried to add RAM after vm_mem_inituvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: pmap_growkernel() faileduvm_pageboot_alloc: out of memoryuvm_page_bootstrap: no memory pre-allocateduvm_page_init: lost %ld page(s) in initsize 0 uvm_pagereallocpagersegpgdaemonuvm_wait emergency bufbackoff pagedaemon: deadlock detected! Ranges, use queue: * [0x%lx-0x%lx] use=%d nsegs=%ld maxsegsz[%d]=0x%lx free=0x%lx #ranges = %d pagedaemon: wait_pla deadlock detected! pmrwaituvm_wait: failed to free %ld pages between 0x%lx-0x%lx uvm_pmr_split: lost one pmr Flags: 0x%x, will panic now. Current UVM status: pagesize=%d (0x%x), pagemask=0x%x, pageshift=%d %d VM pages: %d active, %d inactive, %d wired, %d free min %d%% (%d) anon, %d%% (%d) vnode, %d%% (%d) vtext pages %d anon, %d vnode, %d vtext freemin=%d, free-target=%d, inactive-target=%d, wired-max=%d faults=%d, traps=%d, intrs=%d, ctxswitch=%d fpuswitch=%d softint=%d, syscalls=%d, kmapent=%d fault counts: noram=%d, noanon=%d, pgwait=%d, pgrele=%d ok relocks(total)=%d(%d), anget(retries)=%d(%d), amapcopy=%d neighbor anon/obj pg=%d/%d, gets(lock/unlock)=%d/%d cases: anon=%d, anoncow=%d, obj=%d, prcopy=%d, przero=%d daemon and swap counts: woke=%d, revs=%d, scans=%d, obscans=%d, anscans=%d busy=%d, freed=%d, reactivate=%d, deactivate=%d pageouts=%d, pending=%d, nswget=%d nswapdev=%d, nanon=%d, nanonneeded=%d nfreeanon=%d swpages=%d, swpginuse=%d, swpgonly=%d paging=%d kernel pointers: objs(kern)=%p warning: resource shortage: %d pages of swap lost swapdrum_addsw_reg_strategy: swap to sparse fileswstrategy: vnode type 0x%xswap_off: swapdev not in listswap0x%04xdisklabel reserve/dev/%s%d%cblkdev0x%xswapctl: copystruvm_swap_init: can't get vnode for swap deviceswapmapuvm_swap_init: extent_create failedswp vnxswp vndswplkuvm_coredump: user process with submap?sbrk: grow %ld failed, error = %d uvm_deallocate with null mapuvn_iosyncuvn_getpageuvn_getuvn_cluster: offset out of rangeuvn_flshuvn_flush: obj=%p, offset=0x%llx. error during pageout. uvn_flush: WARNING: changes to page may be lost! uvn_flushuvn_termuvm_vnp_terminate: io sync wanted bit setuvn_attachuvnsyncNULL pointer passed to ip_ecn_egressNULL pointer passed to ip_ecn_ingressin6_prefixlen2mask: invalid prefix length(%d) in6_are_prefix_equal: invalid prefix length(%d) in6_unlink_ifa: interface address %s has no prefix ADDDELETEin6_ifloop_request: %s operation failed for %s (errno=%d) in6_purgeaddr: failed to remove a route to the p2p destination: %s on %s, errno=%d in6_update_ifa: a destination can be specified for a p2p or a loopback IF only in6_update_ifa: prefixlen should be 128 when dstaddr is specified in6_update_ifa: valid lifetime is 0 for %s in6_update_ifa: the prefix length of an existing (%s) address should not be changed in6_update_ifa: failed to remove a route to the old destination: %s in6_update_ifa: addmulti failed for %s on %s (errno=%d) prefix ioctls are now invalidated. please use ifconfig. nd6_prelist_add succeeded but no prefix invalid argument to in6_lifaddr_ioctlin6_ifawithscope: output interface is not specified in6_ifattach_loopback: failed to configure the loopback address on %s (errno=%d) %s: got interface identifier from itself %s: borrow interface identifier from %s %s: interface identifier generated by random number %s: failed to get interface identifier %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x %s: no ifid available in6_ifattach_linklocal: failed to configure a link-local address on %s (errno=%d) in6_ifattach: %s has too small MTU, IPv6 not enabled in6_ifattach: %s is not multicast capable, IPv6 not enabled in6_cksum: mbuf len (%d) < off+len (%d+%d)in6_cksum: out of datainternet6icmp6_redirect_timeout: bad route to timeouticmp6_mtudisc_timeout: bad route to timeout(src=%s dst=%s tgt=%s)ICMP6 redirect sent from %s rejected; must be from linklocal ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) ICMP6 redirect rejected; redirect dst must be unicast: %s ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s ICMP6 redirect rejected; no route found for redirect dst: %s ICMP6 redirect rejected; neither router case nor onlink case: %s icmp6_redirect_input: invalid ND option, rejected: %s icmp6_redirect_input: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s icmp6_notify_error: in6_embedscope failed sanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d ../../../../netinet6/icmp6.cicmp6_reflect: source can't be determined: dst=%s, error=%d ICMP6 checksum error(%d|%x) %s icmp6_input: unknown type %d(src=%s, dst=%s, ifid=%d) ENOBUFS in icmp6_error %d icmp6_mtudisc_callback_registerip6_nexthdr: m == NULLip6_input: packet to an unready address %s->%s ip6_initcannot forward from %s to %s nxt %d received on %s cannot forward src %s, dst %s, nxt %d, rcvif %s, outif %s assumption failed: hdr not splitscope error in prefix list (%s) ndopts == NULL in nd6_optionuninitialized ndopts in nd6_optionndopts == NULL in nd6_optionsuninitialized ndopts in nd6_optionsduplicated ND6 option found (type=%d) nd6_options: unsupported option %d - option ignored too many loop in nd opt unspecnd6_lookup: failed to lookup %s (if = %s) nd6_output: can't allocate llinfo for %s (ln=%p, rt=%p) nd6_setmtu0: new link MTU on %s (%lu) is too small for IPv6 nd6_init called more than once(ignored) ln->ln_rt == NULLln->ln_rt->rt_ifp == NULLrt_llinfo(%p) is not equal to ln(%p)dst=0 in nd6_timer(ln=%p)nd6_storelladdr: something odd happens nd6_storelladdr: sdl_alen == 0, dst=%s, if=%s ifp == NULL in nd6_cache_lladdrfrom == NULL in nd6_cache_lladdrndp info overwritten for %s by %s on %s nd6_rtrequest: bad gateway value: %s nd6_rtrequest: malloc failed %s: failed to join %s (errno=%d) nd6_dad_duplicated: DAD structure not found %s: DAD detected duplicate IPv6 address %s: NS in/out=%d/%d, NA in=%d %s: DAD complete for %s - duplicate found %s: manual intervention required ifa == NULL in nd6_dad_na_inputifa == NULL in nd6_dad_ns_inputnd6_na_output: source can't be determined: dst=%s, error=%d nd6_ns_output: source can't be determined: dst=%s, error=%d nd6_dad_timer: called with null parameter nd6_dad_timer: DAD structure not found ???nd6_dad_timer: called with duplicated address %s(%s) nd6_dad_timer: called with non-tentative address %s(%s) %s: could not run DAD, driver problem? %s: DAD complete for %s - no duplicates found nd6_dad_start: called with non-tentative address %s(%s) nd6_dad_start: ifa->ifa_ifp == NULLnd6_dad_start: memory allocation failed for %s(%s) %s: starting DAD for %s nd6_ns_input: invalid hlim (%d) from %s to %s on %s nd6_ns_input: bad DAD packet (wrong ip6 dst) nd6_ns_input: NS packet from non-neighbor nd6_ns_input: bad NS target (multicast) nd6_ns_input: invalid ND option, ignored nd6_ns_input: bad DAD packet (link-layer address option) nd6_ns_input: lladdrlen mismatch for %s (if %d, NS packet %d) nd6_ns_input: duplicate IP6 address %s nd6_ns_input: src=%s nd6_ns_input: dst=%s nd6_ns_input: tgt=%s nd6_na_input: invalid hlim (%d) from %s to %s on %s nd6_na_input: invalid target address %s nd6_na_input: a solicited adv is multicasted nd6_na_input: invalid ND option, ignored nd6_na_input: multicast adv without TLLA nd6_na_input: duplicate IP6 address %s nd6_na_input: ND packet from non-neighbor nd6_na_input: lladdrlen mismatch for %s (if %d, NA packet %d) in6_init_prefix_ltimes: preferred lifetime(%d) is greater than valid lifetime(%d) in6_ifadd: wrong prefixlen for %s (prefix=%d ifid=%d) in6_ifadd: failed to make ifaddr %s on %s (errno=%d) nd6_prefix_onlink: %s/%d is already on-link nd6_prefix_onlink: failed to find any ifaddr to add route for a prefix(%s/%d) on %s nd6_prefix_onlink: failed to add route for a prefix (%s/%d) on %s, gw=%s, mask=%s, flags=%lx errno = %d nd6_prefix_offlink: %s/%d is already off-link nd6_prefix_offlink: failed to recover a prefix %s/%d from %s to %s (errno = %d) nd6_prefix_offlink: failed to delete route: %s/%d on %s (errno = %d) pfxlist_onlink_check: failed to make %s/%d offlink, errno=%d prelist_remove: failed to make %s/%d offlink on %s, errno=%d prelist_remove: negative count on %s nd6_prelist_add: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_update: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_update: nd6_prelist_add failed for %s/%d on %s errno=%d, returnpr=%p defrouter_select: called unexpectedly (forwarding=%d, accept_rtadv=%d) defrouter_select: more than one router is installed defrtrlist_del: negative count on %s nd6_ra_input: invalid hlim (%d) from %s to %s on %s nd6_ra_input: src %s is not link-local nd6_ra_input: invalid ND option, ignored nd6_ra_input: invalid option len %d for prefix information option, ignored nd6_ra_input: invalid prefix len %d for prefix information option, ignored nd6_ra_input: invalid prefix %s, ignored nd6_ra_input: invalid prefixlen %d for rfc2374 prefix %s, ignored nd6_ra_input: bogus mtu option mtu=%lu sent from %s, ignoring nd6_ra_input: bogus mtu mtu=%lu sent from %s; exceeds maxmtu %lu, ignoring nd6_ra_input: lladdrlen mismatch for %s (if %d, RA packet %d) nd6_rs_input: invalid hlim (%d) from %s to %s on %s nd6_rs_input: invalid ND option, ignored nd6_rs_input: lladdrlen mismatch for %s (if %d, RS packet %d) rip6_attachrip6_detachrip6_usrreq invalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchincorrect data checkincorrect length checkneed dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versiondb_fetch_reg: botchaddress %p is invalid branch_taken: botch address 0x%08lx not a valid page Faulted in DDB; continuing... spsrr0r1r2r3r4r5r6r7r8r9r10r11r12usr_spusr_lrsvc_spsvc_lrpcund_spabt_spirq_spframetrace: pid %d not found at %p scp=0x%08x rlv=0x%08x () rsp=0x%08x rfp=0x%08x%sr%d=0x%08xBad frame pointer: %p Bad user frame pointer: %p frame address must be specified frame address = %08x r0 =%08x r1 =%08x r2 =%08x r3 =%08x r4 =%08x r5 =%08x r6 =%08x r7 =%08x r8 =%08x r9 =%08x r10=%08x r11=%08x r12=%08x r13=%08x r14=%08x r15=%08x slr=%08x mainbuscpu, rrx, %s r%d, %s #%d#0x%08x[r%d][r%d%s, #0x%03x#0x%02x{r%d-r%d}^f%d#%s0x%08xcpsr_p%df%d, c%d, c%d, c%d, c%d, %dr%d, c%d, c%d, %d[%c - unknown]und%s %08x imbimbrangeswiblxblmulSnmsmlaSnmsdumullSdnmssmullumlalsmlalstrtdaWldrtstrbtldrbtdsbisbstrldrstrbldrbstmYnWlldmXnWlldrsbldrhstrhldrshswpdmoswpbmrsdpnopyieldwfewfisevdbgmsrpFmpF2bxclzdmbkptSdn2eorsubrsbadcsbcrsctstDn2teqcmpcmnorrmovSd2bicmvnadfPRfghmufsufrsfdvfrdfpowrpwrmffmlfdvfrdpolfpbopmvfPRfhmnfabsrndsqtlgnexpsincostanasnacsatnfpuopstfQLvldffltPRgdfixPRdhwfsrfswfcrfccmfPRghcnfcmfecnfemcr2#zmcrmrc2mrccdp2#ycdpldc2L#vldcstc2stcNo support for this CPU type (%08x) in kernelUndefined instruction in kernel real mem = %u (%uMB) avail mem = %lu (%uMB) Warning IRQ's disabled during boot() WARNING: not updating battery clock _bus_dmamap_load_raw: not implemented_bus_dmamem_map: size botch_bus_dmamap_sync: mix PRE and POST%s: curaddr %#lx not in range_bus_dmamap_sync: ARM32_BUFTYPE_INVALIDunknown buffer type %d _bus_dmamap_syncProcessor failed probe - no CPU ID %s %s (%s core)%s: IDC disabled IDC enabled DC disabled DC enabled IC disabled IC enabled WB disabled WB enabled LABT EABT branch prediction enabled%s: %dKB/%dB %d-way %s unified cache %s: %dKB(%db/l,%dway) I-cache, %dKB(%db/l,%dway) %s D-cache %s: %s does not fully support this CPU. %s: This kernel does not fully support this CPU. %s: Recompile with "options %s" to correct this. unknown CPU (ID = 0x%x)ARM810ARM920TARM922TARM926EJ-SARM940TARM946E-SARM966E-STI ARM925TARM1020EARM1022E-SSA-110SA-1100SA-1110IXP1200i80200i80321 400MHzi80321 600MHzi80219 400MHzi80219 600MHzPXA250PXA210PXA27xIXP425 533MHzIXP425 400MHzIXP425 266MHzARM1136J-SARM1136J-S R1ARM Cortex A5ARM Cortex A7ARM Cortex A8ARM Cortex A8 R1ARM Cortex A8 R2ARM Cortex A8 R3ARM Cortex A9ARM Cortex A9 R1ARM Cortex A9 R2ARM Cortex A9 R3ARM Cortex A9 R4ARM Cortex A15ARM Cortex A15 R1ARM Cortex A15 R2ARM Cortex A15 R3ARM Cortex A15 R4unknownCPU_ARM8ARM9TDMIARM9E-SCPU_ARM9EARM9EJ-SARM10ECPU_ARM10SA-1CPU_SA1100XScaleCPU_XSCALE_...ARM11JCPU_ARM11CPU_ARMv7wr-thruwr-back**unknown 3****unknown 4**wr-back-lockwr-back-lock-Awr-back-lock-B**unknown 8****unknown 9****unknown 10****unknown 11****unknown 12****unknown 13****unknown 14****unknown 15**rev 0rev 1rev 2rev 3rev 4rev 5rev 6rev 7rev 8rev 9rev 10rev 11rev 12rev 13rev 14rev 15step Jstep Kstep Sstep Tstep Bstep Cstep Dstep Erev 10step Gstep A-0step B-0step B-1step B-2step B-3step B-4step B-5(IXP1200 step A)(IXP1200 step B)(IXP1200 step C)(IXP1200 step D)(IXP1240/1250 step A)(IXP1240 step B)(IXP1250 step B)step A-1step C-0step D-0step ?step C-5step 0badaddr: invalid size (%lu)kernelFatal %s mode data abort: '%s' trapframe: %p DFSR=%08x, DFAR=%08x (imprecise), spsr=%08x Fatal %s mode prefetch abort at 0x%08x trapframe: %p IFSR=%08x, IFAR=%08x, spsr=%08x r0 =%08x, r1 =%08x, r2 =%08x, r3 =%08x r4 =%08x, r5 =%08x, r6 =%08x, r7 =%08x r8 =%08x, r9 =%08x, r10=%08x, r11=%08x r12=%08x, usp=%08x, ulr=%08xssp=%08x, slr=%08x, pc =%08x Fatal abortUVM: pid %d (%s), uid %d killed: out of swap data_abort_fault: Misaligned Kernel-mode Program Counter Non-emulated page fault with intr_depth > 0 uvm_fault(%p, %lx, %x, 0) -> %x Vector ExceptionAlignment Fault 1Terminal ExceptionAlignment Fault 3External Linefetch Abort (S)Translation Fault (S)External Linefetch Abort (P)Translation Fault (P)External Non-Linefetch Abort (S)Domain Fault (S)External Non-Linefetch Abort (P)Domain Fault (P)External Translation Abort (L1)Permission Fault (S)External Translation Abort (L2)Permission Fault (P)mmrwpmap_map_chunk: no L1 table providedpmap_map_chunk: no L2 table for VA 0x%08lxpmap_map_chunk: can't find L2 table for VA0x%08lxpmap_alloc_specials: no l2b for 0x%lxpmap_bootstrap: No L2 for L2 @ va %ppmap_init_l1: can't get PA of L1 at %ppmap_bootstrap: No L2 for va 0x%x, pa 0x%lxpmap_bootstrap: out of static L2spmap_bootstrap: WARNING! wrong cache mode for L2 pte @ %p pmap_bootstrap: WARNING! wrong cache mode for primary L1 @ 0x%lx pmapplpvepll2dtblpll2ptpplxscale_setup_minidata: can't find L2 table for VA 0x%08lxpmap_map_entry: no L2 table for VA 0x%08lxpmap_map_entry: can't find L2 table for VA 0x%08lxCannot allocate L1 KVMCannot allocate L1 physical pagespmap_enter: failed to allocate L2 bucketpmap_enter: no pv entries dump to dev %u,%u not possible dumping to dev %u,%u offset %ld dump area unavailable device bad device not ready area improper i/o error aborted from console succeeded vunmapbufvmapbufglassattempting to switch console to lcd screen ffuartbtuartstuartbootfile: %s bootargs: %s unknown option `%c' cpu not recognized!%08lx -> %08lx @ %08lx OpenBSD/zaurus booting ... initarm: Configuring system ... physmemory: %d pages at 0x%08lx -> 0x%08lx Allocating page tables freestart = 0x%08lx, free_pages = %d (0x%08x) initarm: out of memoryinitarm: Failed to align the kernel page directoryIRQ stack: p0x%08lx v0x%08lx ABT stack: p0x%08lx v0x%08lx UND stack: p0x%08lx v0x%08lx SVC stack: p0x%08lx v0x%08lx Creating L1 page table at 0x%08lx Mapping kernel Constructing L2 page tables freestart = 0x%08lx, free_pages = %d (0x%x) switching to new L1 page table @%#lx...bootstrap done. init subsystems: stacks vectors undefined page pmap Attempting to power down... The operating system has halted. Please press any key to reboot. rebooting... reboot failed; spinning Diagnostic Failure on Component 0x%02xTagged Overlapped Commands (0x%02x = TASK TAG)Decompression Exception Short Algorithm ID OF 0x%02xASC 0x%02x ASCQ 0x%02xCDBParametersError in %s, Offset %d, bit %dActual Retry Count: %dProgress Indicator: %dprobe%s(%s:%d:%d): %sCheck Condition (error %#x) on opcode 0x%x AT BLOCK #: %d (decimal) SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO: 0x%x (VALID flag %s) COMMAND INFO: 0x%x ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s DEFERRED scbusyunknown error category (0x%x) from scsi driver scsi_done called twice on xs(%p)unexpected xsh state %usyncxspendxsscsiiomvscsi_xfer pool exhausted! scxsplscsiplugscsi_cmd_rw_decode: bad opcode 0x%02xNo Additional SenseSoft ErrorNot ReadyMedia ErrorHardware ErrorIllegal RequestUnit AttentionWrite ProtectedBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare ErrorNo Additional Sense InformationFilemark DetectedEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnCleaning RequestedErase Operation In ProgressLocate Operation In ProgressRewind Operation In ProgressSet Capacity Operation In ProgressVerify Operation In ProgressNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Not Ready, Rebuild In ProgressLogical Unit Not Ready, Recalculation In ProgressLogical Unit Not Ready, Operation In ProgressLogical Unit Not Ready, Long Write In ProgressLogical Unit Not Ready, Self-Test In ProgressLogical Unit Not Accessible, Asymmetric Access State TransitionLogical Unit Not Accessible, Target Port In Standby StateLogical Unit Not Accessible, Target Port In Unavailable StateLogical Unit Not Ready, Structure Check RequiredLogical Unit Not Ready, Auxiliary Memory Not AccessibleLogical Unit Not Ready, Notify (Enable Spinup) RequiredLogical Unit Not Ready, OfflineLogical Unit Not Ready, SA Creation In ProgressLogical Unit Not Ready, Space Allocation In ProgressLogical Unit Not Ready, Robotics DisabledLogical Unit Not Ready, Configuration RequiredLogical Unit Not Ready, Calibration RequiredLogical Unit Not Ready, A Door Is OpenLogical Unit Not Ready, Operating In Sequential ModeLogical Unit Not Ready, Start Stop Unit Command In ProgressLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorLogical Unit Communication CRC Error (ULTRA-DMA/32)Unreachable Copy TargetTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureHead Select FaultError Log OverflowWarningWarning - Specified Temperature ExceededWarning - Enclosure DegradedWarning - Background Self-Test FailedWarning - Background Pre-Scan Detected Medium ErrorWarning - Background Medium Scan Detected Medium ErrorWarning - Non-Volatile Cache Now VolatileWarning - Degraded Power To Non-Volatile CacheWarning - Power Loss ExpectedWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedWrite Error - Recommend ReassignmentCompression Check Miscompare ErrorData Expansion Occurred During CompressionBlock Not CompressibleWrite Error - Recovery NeededWrite Error - Recovery FailedWrite Error - Loss Of StreamingWrite Error - Padding Blocks AddedAuxiliary Memory Write ErrorWrite Error - Unexpected Unsolicited DataWrite Error - Not Enough Unsolicited DataDefects In Error WindowError Detected By Third Party Temporary InitiatorThird Party Device FailureCopy Target Device Not ReachableIncorrect Copy Target Device TypeCopy Target Device Data UnderrunCopy Target Device Data OverrunInvalid Information UnitInformation Unit Too ShortInformation Unit Too LongID CRC Or ECC ErrorLogical Block Guard Check FailedLogical Block Application Tag Check FailedLogical Block Reference Tag Check FailedLogical Block Protection Error On Recover Buffered DataLogical Block Protection Method ErrorUnrecovered Read ErrorRead Retries ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block ReadNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite The DataDe-Compression CRC ErrorCannot Decompress Using Declared AlgorithmError Reading UPC/EAN NumberError Reading ISRC NumberRead Error - Loss Of StreamingAuxiliary Memory Read ErrorRead Error - Failed Retransmission RequestRead Error - LBA Marked Bad By Application ClientAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRecord Not Found - Recommend ReassignmentRecord Not Found - Data Auto-ReallocatedLocate Operation FailureRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorData Sync Error - Data RewrittenData Sync Error - Recommend RewriteData Sync Error - Data Auto-ReallocatedData Sync Error - Recommend ReassignmentRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data Without ECC - Data RewrittenRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With L-ECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteRecovered Data With ECC - Data RewrittenRecovered Data With LinkingDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationMiscompare Verify Of Unmapped LbaRecovered ID with ECCPartial Defect List TransferInvalid Command Operation CodeAccess Denied - Initiator Pending-EnrolledAccess Denied - No Access rightsAccess Denied - Invalid Mgmt ID KeyIllegal Command While In Write Capable StateObsoleteIllegal Command While In Explicit Address ModeIllegal Command While In Implicit Address ModeAccess Denied - Enrollment ConflictAccess Denied - Invalid LU IdentifierAccess Denied - Invalid Proxy TokenAccess Denied - ACL LUN ConflictIllegal Command When Not In Append-Only ModeLogical Block Address Out of RangeInvalid Element AddressInvalid Address For WriteInvalid Write Crossing Layer JumpIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBCDB Decryption ErrorSecurity Audit Value FrozenSecurity Working Key FrozenNonce Not UniqueNonce Timestamp Out Of RangeInvalid XCDBLogical Unit Not SupportedInvalid Field In Parameter ListThreshold Parameters Not SupportedInvalid Release Of Persistent ReservationData Decryption ErrorToo Many Target DescriptorsUnsupported Target Descriptor Type CodeToo Many Segment DescriptorsUnsupported Segment Descriptor Type CodeUnexpected Inexact SegmentInline Data Length ExceededInvalid Operation For Copy Source Or DestinationCopy Segment Granularity ViolationInvalid Parameter While Port Is EnabledInvalid Data-Out Buffer Integrity Check ValueData Decryption Key Fail Limit ReachedIncomplete Key-Associated Data SetVendor Specific Key Reference Not FoundHardware Write ProtectedLogical Unit Software Write ProtectedAssociated Write ProtectPersistent Write ProtectPermanent Write ProtectConditional Write ProtectSpace Allocation Failed Write ProtectNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedFormat-Layer May Have ChangedImport/Export Element Accessed, Medium ChangedPower On, Reset, or Bus Device Reset OccurredPower On OccurredSCSI Bus Reset OccurredBus Device Reset Function OccurredDevice Internal ResetTransceiver Mode Changed to Single EndedTransceiver Mode Changed to LVDI_T Nexus Loss OccurredMode Parameters ChangedLog Parameters ChangedReservations PreemptedReservations ReleasedRegistrations PreemptedAsymmetric Access State ChangedImplicit Asymmetric Access State Transition FailedPriority ChangedCapacity Data Has ChangedError History I_T Nexus ClearedError History Snapshot ReleasedError Recovery Attributes Have ChangedData Encryption Capabilities ChangedTimestamp ChangedData Encryption Parameters Changed By Another I_T NexusData Encryption Parameters Changed By Vendor Specific EventData Encryption Key Instance Counter Has ChangedSA Creation Capabilities Data Has ChangedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedCurrent Program Area Is Not EmptyCurrent Program Area Is EmptyIllegal Power Condition RequestPersistent Prevent ConflictPrevious Busy StatusPrevious Task Set Full StatusPrevious Reservation Conflict StatusPartition Or Collection Contains User ObjectsNot ReservedORWrite Generation Does Not MatchOverwrite Error On Update In PlaceInsufficient Time For OperationCommands Cleared By Another InitiatorCommands Cleared By Power Loss NotificationCommands Cleared By Device ServerIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledCannot Write Medium - Unknown FormatCannot Write Medium - Incompatible FormatCannot Format Medium - Incompatible MediumCleaning FailureCannot Write - Application Code MismatchCurrent Session Not Fixated For AppendCleaning Request RejectedMedium Not FormattedIncompatible Volume TypeIncompatible Volume QualifierCleaning Volume ExpiredMedium Format CorruptedFormat Command FailedZoned Formatting Failed Due To Spare LinkingNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorEnclosure FailureEnclosure Services FailureUnsupported Enclosure FunctionEnclosure Services UnavailableEnclosure Services Transfer FailureEnclosure Services Transfer RefusedRibbon, Ink, or Toner FailureRounded ParameterEvent Status NotificationESN - Power Management Class EventESN - Media Class EventESN - Device Busy Class EventSaving Parameters Not SupportedMedium Not PresentMedium Not Present - Tray ClosedMedium Not Present - Tray OpenMedium Not Present - LoadableMedium Not Present - Medium Auxiliary Memory AccessibleSequential Positioning ErrorTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyEnd Of Medium ReachedMedium Magazine Not AccessibleMedium Magazine RemovedMedium Magazine InsertedMedium Magazine LockedMedium Magazine UnlockedMechanical Positioning Or Changer ErrorRead Past End Of User ObjectElement DisabledElement EnabledData Transfer Device RemovedData Transfer Device InsertedInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetLogical Unit FailureTimeout On Logical UnitLogical Unit Failed Self-TestLogical Unit Unable To Update Self-Test LogTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has Changedcomponent Device AttachedDevice Identifier ChangedRedundancy Group Created Or ModifiedRedundancy Group DeletedSpare Created Or ModifiedSpare DeletedVolume Set Created Or ModifiedVolume Set DeletedVolume Set DeassignedVolume Set ReassignedReported LUNs Data Has ChangedEcho Buffer OverwrittenMedium LoadableMedium Auxiliary Memory AccessibleiSCSI IP Address AddediSCSI IP Address RemovediSCSI IP Address ChangedRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureATA Device Failed Set FeaturesSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorData Phase CRC Error DetectedSCSI Parity Error Detected During ST Data PhaseInformation Unit iuCRC Error DetectedAsynchronous Information Protection Error DetectedProtocol Service CRC ErrorPHY Test Function In ProgressSome Commands Cleared By iSCSI Protocol EventInitiator Detected Error Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorInvalid Target Port Transfer Tag ReceivedToo Much Write DataACK/NAK TimeoutNAK ReceivedData Offset ErrorInitiator Response TimeoutConnection LostLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureErase Failure - Incomplete Erase Operation DetectedCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedMedium Removal Prevented By Data Transfer ElementMedium Thread Or Unthread FailureVolume Identifier InvalidVolume Identifier MissingDuplicate Volume IdentifierElement Status UnknownSCSI To Host System Interface FailureSystem Resource FailureSystem Buffer FullInsufficient Reservation ResourcesInsufficient ResourcesInsufficient Registration ResourcesInsufficient Access Control ResourcesAuxiliary Memory Out Of SpaceQuota ErrorMaximum Number Of Supplemental Decryption Keys ExceededMedium Auxiliary Memory Not AccessibleData Currently UnavailableInsufficient Power For OperationUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change InputOperator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedFailure Prediction Threshold ExceededMedia Failure Prediction Threshold ExceededLogical Unit Failure Prediction Threshold ExceededSpare Area Exhaustion Prediction Threshold ExceededHardware Impending Failure General Hard Drive FailureHardware Impending Failure Drive Error Rate Too HighHardware Impending Failure Data Error Rate Too HighHardware Impending Failure Seek Error Rate Too HighHardware Impending Failure Too Many Block ReassignsHardware Impending Failure Access Times Too HighHardware Impending Failure Start Unit Times Too HighHardware Impending Failure Channel ParametricsHardware Impending Failure Controller DetectedHardware Impending Failure Throughput PerformanceHardware Impending Failure Seek Time PerformanceHardware Impending Failure Spin-Up Retry CountHardware Impending Failure Drive Calibration Retry CountController Impending Failure General Hard Drive FailureController Impending Failure Drive Error Rate Too HighController Impending Failure Data Error Rate Too HighController Impending Failure Seek Error Rate Too HighController Impending Failure Too Many Block ReassignsController Impending Failure Access Times Too HighController Impending Failure Start Unit Times Too HighController Impending Failure Channel ParametricsController Impending Failure Controller DetectedController Impending Failure Throughput PerformanceController Impending Failure Seek Time PerformanceController Impending Failure Spin-Up Retry CountController Impending Failure Drive Calibration Retry CountData Channel Impending Failure General Hard Drive FailureData Channel Impending Failure Drive Error Rate Too HighData Channel Impending Failure Data Error Rate Too HighData Channel Impending Failure Seek Error Rate Too HighData Channel Impending Failure Too Many Block ReassignsData Channel Impending Failure Access Times Too HighData Channel Impending Failure Start Unit Times Too HighData Channel Impending Failure Channel ParametricsData Channel Impending Failure Controller DetectedData Channel Impending Failure Throughput PerformanceData Channel Impending Failure Seek Time PerformanceData Channel Impending Failure Spin-Up Retry CountData Channel Impending Failure Drive Calibration Retry CountServo Impending Failure General Hard Drive FailureServo Impending Failure Drive Error Rate Too HighServo Impending Failure Data Error Rate Too HighServo Impending Failure Seek Error Rate Too HighServo Impending Failure Too Many Block ReassignsServo Impending Failure Access Times Too HighServo Impending Failure Start Unit Times Too HighServo Impending Failure Channel ParametricsServo Impending Failure Controller DetectedServo Impending Failure Throughput PerformanceServo Impending Failure Seek Time PerformanceServo Impending Failure Spin-Up Retry CountServo Impending Failure Drive Calibration Retry CountSpindle Impending Failure General Hard Drive FailureSpindle Impending Failure Drive Error Rate Too HighSpindle Impending Failure Data Error Rate Too HighSpindle Impending Failure Seek Error Rate Too HighSpindle Impending Failure Too Many Block ReassignsSpindle Impending Failure Access Times Too HighSpindle Impending Failure Start Unit Times Too HighSpindle Impending Failure Channel ParametricsSpindle Impending Failure Controller DetectedSpindle Impending Failure Throughput PerformanceSpindle Impending Failure Seek Time PerformanceSpindle Impending Failure Spin-Up Retry CountSpindle Impending Failure Drive Calibration Retry CountFirmware Impending Failure General Hard Drive FailureFirmware Impending Failure Drive Error Rate Too HighFirmware Impending Failure Data Error Rate Too HighFirmware Impending Failure Seek Error Rate Too HighFirmware Impending Failure Too Many Block ReassignsFirmware Impending Failure Access Times Too HighFirmware Impending Failure Start Unit Times Too HighFirmware Impending Failure Channel ParametricsFirmware Impending Failure Controller DetectedFirmware Impending Failure Throughput PerformanceFirmware Impending Failure Seek Time PerformanceFirmware Impending Failure Spin-Up Retry CountFirmware Impending Failure Drive Calibration Retry CountFailure Prediction Threshold Exceeded (false)Low Power Condition OnIdle Condition Activated By TimerStandby Condition Activated By TimerIdle Condition Activated By CommandStandby Condition Activated By CommandIDLE_B Condition Activated By TimerIDLE_B Condition Activated By CommandIDLE_C Condition Activated By TimerIDLE_C Condition Activated By CommandSTANDBY_Y Condition Activated By TimerSTANDBY_Y Condition Activated By CommandPower State Change To ActivePower State Change To IdlePower State Change To StandbyPower State Change To SleepPower State Change To Device ControlLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackPacket Does Not Fit In Available SpaceIllegal Mode For This TrackInvalid Packet SizeVoltage FaultAutomatic Document Feeder Cover UpAutomatic Document Feeder Lift UpDocument Jam In Automatic Document FeederDocument Miss Feed Automatic In Document FeederConfiguration FailureConfiguration Of Incapable Logical Units FailedAdd Logical Unit FailedModification Of Logical Unit FailedExchange Of Logical Unit FailedRemove Of Logical Unit FailedAttachment Of Logical Unit FailedCreation Of Logical Unit FailedAssign Failure OccurredMultiply Assigned Logical UnitSet Target Port Groups Command FailedATA Device Feature Not EnabledLogical Unit Not ConfiguredData Loss On Logical UnitMultiple Logical Unit FailuresParity/Data MismatchInformational, Refer To LogState Change Has OccurredRedundancy Level Got BetterRedundancy Level Got WorseRebuild Failure OccurredRecalculate Failure OccurredCommand To Logical Unit FailedCopy Protection Key Exchange Failure - Authentication FailureCopy Protection Key Exchange Failure - Key Not PresentCopy Protection Key Exchange Failure - Key Not EstablishedRead Of Scrambled Sector Without AuthenticationMedia Region Code Is Mismatched To Logical Unit RegionDrive Region Must Be Permanent/Region Reset Count ErrorDecompression Exception Long Algorithm IDSession Fixation ErrorSession Fixation Error Writing Lead-InSession Fixation Error Writing Lead-OutSession Fixation Error - Incomplete Track In SessionEmpty Or Partially Written Reserved TrackNo More Track Reservations AllowedRMZ Extension Is Not AllowedNo More Test Zone Extensions Are AllowedCD Control ErrorPower Calibration Area ErrorProgram Memory Area Update FailureProgram Memory Area Is FullRMA/PMA Is Almost FullCurrent Power Calibration Area Almost FullCurrent Power Calibration Area Is FullRDZ Is FullSecurity ErrorUnable To Decrypt DataUnencrypted Data Encountered While DecryptingIncorrect Data Encryption KeyCryptographic Integrity Validation FailedError Decrypting DataUnknown Signature Verification KeyEncryption Parameters Not UseableDigital Signature Validation FailureEncryption Mode Mismatch On ReadEncrypted Block Not Raw Read EnabledIncorrect Encryption ParametersUnable To Decrypt Parameter ListEncryption Algorithm DisabledSA Creation Parameter Value InvalidSA Creation Parameter Value RejectedInvalid SA UsageData Encryption Configuration PreventedSA Creation Parameter Not SupportedAuthentication FailedExternal Data Encryption Key Manager Access ErrorExternal Data Encryption Key Manager ErrorExternal Data Encryption Key Not FoundExternal Data Encryption Request Not AuthorizedExternal Data Encryption Control TimeoutExternal Data Encryption Control ErrorLogical Unit Access Not AuthorizedSecurity Conflict In Translated DeviceXS_SHORTSENSE scsibus at %sscsibusprint: qualifier == SID_QUAL_RSVDscsibusprint: qualifier == SID_QUAL_BAD_LUdirectsequentialprinterprocessorcdromwormscanneropticalchangercommunicationenclosure servicessimplified directscsibusprint: device type T_NODEVICEvendor-unique targ %d lun %d: <%s, %s, %s> ATAPISCSI%dremovablefixed %d/%s %s%s naa. eui. t10. serial. wwn. offline: %d targets, initiator %d, WWPN %016llx, WWNN %016llx%s: unable to register bio scsibusPLEXTORCD-ROM PX-40TS1.01MICROP 1588-15MBSUN0669DEC RZ55 (C) DECEMULEX MD21/S2 ESDIA00IBMRAID 0662SIBM 0663HIBM0664H3171-S2KZ-CDFRSS2FQUANTUM ELS85S iomegajaz 1GBMICROP4421-07SEAGATEST150176LW0002HPC3725SDCASSONY SDT-5000 3.WangDAT Model 1300 02.4Model 2600 01.7Model 3200 02.2CR-2801TE1.07CREATIVECD3630EAC101FX320Sq01GCD-R580B1.00MATSHITA CR-5741.021.06Memorex CRW-26421.0gSANYO CRD-256PSANYO CRD-254PSANYO CRD-S54P1.08CD-ROM CDR-S11.70CD-ROM CDR-N161.25UJDCD87301.14ATAPI CD-ROMSCSI CD-ROMcdNEC CD-ROM DRIVE:260SCSI opticalSCSI disk%s %s(unknown)%s: %lluMB, %lu bytes/sector, %llu sectors, thin, readonly%s: WARNING: unable to establish shutdown hook softintr_establish: unknown soft IPL %d addr 0x%lx intr %dWARNING: using filesystem date -- CHECK AND RESET THE DATE! pxa2x0_probe_sdram: impossiblepxaip_attach_critical: failed to attach INTC!pxaip_attach_critical: failed to attach GPIO!pxaip_attach: failed to map CLKMANpxaip_attach: failed to map RTC: CPU clock = %d.%03d MHz pxaippxa2x0_io_bs_free(): not implementedpxa2x0_io_bs_alloc(): not implementedcouldn't establish interruptirq %ldintr_establish: bogus irq number %dintr_establish: can't malloc handler info: Interrupt Controller stray interrupt %d pxaintcpxagpio_reg_write: not bootstrappedpxagpio_reg_read: not bootstrappedpxa2x0_gpio_set_intr_level: bad level: %d%s: unhandled GPIO interrupt. GPIO#%d %s: failed to hook main GPIO interrupt pxa2x0_gpio_intr_establish: Pin %d not GPIO_IN: GPIO Controller %s: Can't map registers! pxagpioclock%s: Cannot map registerspxaostendpoint %d already used by %cfifo full when trying to set short packet pxaudc_read_epN: ep %d, no xfer ep%d: fifo error : cannot map mem space : USB Device Controller : unable to establish interrupt usbc: unable to establish connect interrupt pxaudc%s: init failed, error=%d %s: Unknown depth (%d) : failed to map registers %d%s: unable to establish interrupt at irq %d%s: battery life expectancy %d%% %s: AC off,on,backup power,unknown, battery is highCRITICALchargingundecoded (%x)bogus new frequency 0 for rate %d maxclock %d pxa2x0_apm_sleep: can't map OST pxa2x0_apm_attach_sub: failed to map POWMAN apmlk%s: failed to map CLKMAN %s: failed to map MEMCTL %s: can't map GPIO %s: failed to create kernel thread, disabledapmevapmpcmcia_function_enable: function not initializedpcmcia_function_init: function is enabledmanufacturer 0x%x%sproduct 0x%x function %d "%s: error %d detaching %s (function %d) pcmcia_card_attachpcmciapcmcia_parse_cis_tuple%s: CIS version PCMCIA 1.0 PCMCIA 2.0 or 2.1 PC Card Standard %d.%d unknown (major=%d, minor=%d) %s: CIS info: %s: Manufacturer code 0x%x, product 0x%x %s: function %d: unspecifiedmulti-functionserial portparallel portfixed diskvideo adapternetwork adapterauto incrementing mass storageSCSI bridgeSecurity servicesInstrumentSerial I/O Bus Adapterunknown (%d), ccr addr %lx mask %lx %s: function %d, config table entry %d: memory cardI/O cardcard type unknown; irq mask %x; iomask %lx, iospace %lx%s%lx; memspace@ %lx%s%lx%s%lx; maxtwins %d; mwait_required rdybsy_active wp_active bvd_active io8 io16 irqshare irqpulse irqlevel powerdown readonly audio%s: %d errors found while parsing CIS %s: CIS checksum failed %s: using CIS quirks for SVECFD605 PCMCIA EtherNet CardV1-1%s: can't alloc mem for LAN iobase %s: can't map mem for LAN iobase %s: can't alloc mem for enet addr %s: can't map mem for enet addr : unexpected I/O space configuration : can't get subregion for asic : function enable failed : can't map NIC I/O space : can't map ASIC I/O space port 0x%lx/%d: can't match ethernet vendor code , %s: no suitable config entry AmbiCom IncAMB8002TPMX PE-200DIGITALDEPCM-XXPCMCIAUE2212D-LinkDE-660DE-660+RPTI LTD.EP400CISV100RPTIEP401 Ethernet NE2000 CompatibleACCTONEN2212ETHERNETW89C926Seiko Epson Corp.P/N: EEN10B Rev. 00CNetCN40BC EthernetNE2000FastEthernetLNT-10TNNDC004743118001TAMARACKGVCNIC-2000pR01Ethernet CardiPort10/100 Ethernet CardFast-EthernetETHER-C16Fast EthernetPCMCIA LANCF10Base-EthernetLinksysEtherFast 10/100 Integrated PC Card (PCM100)Ver 1.0DE-650I-O DATAPCET/TX-RDFE-670TXDLINKSYSE-CARDPCLAcorega K.K.corega Ether PCC-Tcorega Ether PCC-TDcorega EtherII PCC-Tcorega EtherII PCC-TDcorega FastEther PCC-TXcoregaFEther PCC-TXFcorega FEther PCC-TXDSMC8041TX-10/100-PC-Card-V2XircomCompactCard EthernetCFE-10: can't map first i/o space : can't map second i/o space port 0x%lx/%lu,0x%lx/%lucannot allocate channel queue : %s: can't handle card info Digital Mobile Media CD-ROMPortable CD-ROM DriveNinjaATA-EXP PnPIDEF1SHUTTLE TECHNOLOGY LTD.PCCARD-IDE/ATAPI Adapterwipwr: can't alloc i/o space : can't map i/o space %s: can't establish interrupt %s%s Wireless LAN PCC-11Wireless LAN PCCA-11corega_K.K.Wireless_LAN_PCCB-11WL PCCL-11ISL37300PWLCFL-11INTERSILHFA384x/IEEEVersion 01.02SMC2632WNANOSPEEDNECWireless Card CMZ-RT-WPVersion 01.01NTT-ME11Mbps Wireless LAN PC CardAddtronAWP-100 Wireless PCMCIACabletronRoamAbout 802.11 DSIntersilPRISM 2_5 PCMCIA ADAPTEREval-RevASymbol TechnologiesLA4111 Spectrum24 Wireless LAN PC CardPLANEXGW-NS11H Wireless LAN PC CardD-Link CorporationD-Link DWL-650H 11Mbps WLAN AdapterAllied Telesis K.K.WR211PCMpxapcic_mem_map: bogus kindpcic_attach_card: already attachedpxapcicevpxapcicss%s-%d%s: unable to create event thread for %s : %d slot%s pxapcicmmclk%s: data not a multiple of %d bytes mmcmd%s: unsupported bus frequency of %d KHz : can't map regs mmccd: can't establish card interrupt : can't establish MMC interrupt : MMC/SD/SDIO controller sdmmc%s: can't attach bus pxammclcdzkbdwd0: failed to map %s : PCMCIA/GPIO controller scoop_pcic_set_power: bogus power statescoop_pcic_write: bogus registerscoop_pcic_read: bogus register%s: invalid CF slot %d%s: can't map memory %x for scoopscoop_mmc_set_power: unsupported OCR (%#x) zssp_read_ads7846: not configured zssp_ic_send: invalid IC %d : can't map bus space zsspapm_acapm_bczts%s: standby command didn't complete %s: standby command timeout %s: standby command: drive fault %s: flush cache command didn't complete %s: flush cache command timeout %s: flush cache command: drive fault ST506wd_get_params: bad return code from ata_get_paramswddump: try againwddump: polled command has been queuedwddump: device timed outwddump: drive faultwddump: DMA errorwddump: %swddump: unknown error typeST506/MFM/RLLESDI/IDE disk__wdstart: bad return code from wdc_ata_bio()device faultdevice timeout, retrying %s: soft error (corrected) %s: IDENTIFY failed : <%s> %s: %d-sector PIO, LBA48, %lluMB, %llu sectors LBA, %lluMB, %llu sectors CHS, %lluMB, %d cyl, %d head, %d sec, %llu sectors %s: enable look ahead command didn't complete %s: enable write cache command didn't complete %s: freeze lock command didn't complete %s:%d:%d: bad state %d in _wdc_ata_bio_start _wdc_ata_bio_start: bad state%s:%d:%d: timeout waiting for DRQ, st=0x%b, err=0x%02x BSYDRDYDWFDSCDRQCORRIDXERR%s:%d:%d: not ready, st=0x%b, err=0x%02x wdc_ata_ctrl_intr: state==RECALpiomodedmamodegeometrysetmultirecal%s:%d:%d: %s timed out %s:%d:%d: %s drive fault error (%x) %s:%d:%d: bad state %d in wdc_ata_bio_intr wdc_ata_bio_intr: bad state%s:%d:%d: device timeout, c_bcount=%d, c_skip%d %s:%d:%d: intr with DRQ (st=0x%b) %s:%d:%d: read intr before drq error not notifiedno media/write protectedaborted commandmedia change requestedid not foundmedia changeduncorrectable data errorinterface CRC erroraddress mark not foundtrack 0 not foundbad block detectedwd0aboot device: lookup '%s' failed. boot device: %s wsdisplay at %s%s: screen %d-%d added (%s, %s emulation) %s: couldn't allocate copy buffer wsmoused_sleepwswaitwswait2wsdisplay_switch2: not switching wsdisplay_switch2: invalid screen %dwsdisplay_switch2: screen %d disappeared wsdisplay_switch2: giving up wsdisplay_switch1: not switching wsdisplay_switch1: invalid screen %dwsdisplay_switch1: screen %d disappeared wsrestorewsdisplaytty() on ctl device%s: screen %d deleted dmuxwsdisplay_common_attach: no memory mux %d: console (%s, %s emulation), using %swsdisplaywsevent_read%s: connecting to %s %s: disconnecting from %s wskbd at %s%s: can't attach mux (error=%d) %s: event queue overflow wskdetwskbd_detach: %s didn't detach cannot load keymap %s: cannot load keymap, falling back to default %s: console keyboard%s: attach error=%d wskbdwskbd_get_mapentry: %d(%d): bad entrywskbd_load_keymap: %d: recursion too deepwskbd_load_keymap: %d(%d): bad entry attach error=%dwsmouse at %swsmdetwsmouse_detach: %s didn't detach wsmousewsmux_getmux: no memory for mux %d wsmux: attach out of memory wsemul_vt100_output_c0c1: ESC in kernel output ignored [>24;20;0cP2$u/\P0!u%5\[?62;6c[%d;%dR[?13n[?21n[?27;1nOIOMOjOkOlOmOnOo[28~[29~[1~[2~[3~[4~[5~[6~[7~[8~OAOBODOC[11~[12~[13~[14~[15~[17~[18~[19~[20~[21~[23~[24~[25~[26~[31~[32~[33~[34~[35~[36~[37~[38~OPOQOROSOpOqOrOsOtOuOvOwOxOyrasops_init: fontwidth assumptions botched!rasops_init: font table is empty rasops_init: couldn't lock font fontwidth not 8/12/16 or RASOPS_SMALL - fixme!wsfont_unlock: font not lockedusb at %sendtaskusbatskusbtskunable to create usb abort task threadusbtaskunable to create usb task threadusbpalock: USB revision %s, not supported %s: can't register softintr %s: root device is not a hub %s: root hub problem, error=%d pre 1.01.12.0usbusbd_desc_iter_next: bad descriptor usbd_desc_iter_next: descriptor length = 0 usbd_desc_iter_next: descriptor length too large usbd_start_next: error=%d usbd_transfer: not doneusbsynusbrefusbdetusb_detach_wait: %s didn't detach out of dataiface desc0 lengthusbd_fill_iface_data: bad descriptor(s): %s usbdly%s: device addr %d (config %d) exceeds power budget, %d mA > %d mA %s: port %d, set config at addr %d failed %s: No free USB addresses, new device ignored. usbd_new_device: cannot find HS port%x.%02xvendor 0x%04xproduct 0x%04x"%s %s", class %d/%d rev addr %d port %d configuration %d interface %dNORMAL_COMPLETIONIN_PROGRESSPENDING_REQUESTSNOT_STARTEDINVALNOMEMCANCELLEDBAD_ADDRESSIN_USENO_ADDRSET_ADDR_FAILEDNO_POWERTOO_DEEPIOERRORNOT_CONFIGUREDTIMEOUTSHORT_XFERSTALLEDINTERRUPTEDXXX%s: illegal enable change, port %d %s: port error, restarting port %d %s: port error, giving up port %d %s: strange, connected port %d has no power %s: port %d reset failed %s: device problem, disabling port %d %s: hub depth (%d) exceeded, hub ignored %s: no ports, hub ignored %s: bus powered hub connected to bus powered hub, ignored %s: no interface handle %s: no endpoint descriptor %s: bad interrupt endpoint %s: cannot open interrupt pipe %s: port %d power on failed, %s uhubBAD LENGTH %d Main bTag=%d Global bTag=%d Local bTag=%d default bType=%d uhidev_intr: bad repid %d uhid at %s reportid %d%s: could not read endpoint descriptor %s: unexpected endpoint %s: no input interrupt endpoint %s: no report descriptor %s: iclass %d/%d, %d report id%s%s: no memory uhidevuhidrea: input=%d, output=%d, feature=%d uhidno usable key codes array%s: was console keyboard ukbd%s: got polled xfer %p, but %p already pending %s: CBI bulk-in/out stall clear failed, %s %s: CBI intr-in stall clear failed, %s %s: CBI reset failed, %s %s: CBI bulk-in stall clear failed, %s %s: CBI bulk-out stall clear failed, %s %s: Unknown state %d%s: BBB bulk-%s stall clear failed, %s %s: Invalid CSW: sig 0x%08x should be 0x%08x %s: Invalid CSW: tag %d should be %d %s: Invalid CSW: status %d > %d %s: Phase Error, residue = %d %s: transferred %d bytes instead of %d bytes%s: BBB reset failed, %s %s: BBB bulk-in clear stall failed, %s %s: BBB bulk-out clear stall failed, %s Bulk-OnlyCBICBI with CCIISD-ATARBCSCSIUFI%s: using %s over %s %s: isdata not configured %s: command protocol=0x%x not supported %s: bus attach failed umass%s: Unknown status %d in umass_scsi_cbumass_cmd: large datalen, %d %04x%04x%s%s: open rx pipe failed: %s %s: open tx pipe failed: %s %s: open intr pipe failed: %s %s: aue_send error=%s %s: usb error on tx: %s %s: watchdog timeout %s: %u usb errors on intr: %s %s: no memory for rx list -- packet dropped! %s: %u usb errors on rx: %s %s: reset failed %s: close rx pipe failed: %s %s: close tx pipe failed: %s %s: close intr pipe failed: %s %s: tx list init failed %s: rx list init failed %s: MII read timed out %s: EEPROM read timed out %s: setting config no failed auemii%s: getting interface handle failed %s: couldn't get endpoint descriptor %d %s: missing endpoint %s: address %s aue%s: usb errors on rx: %s axe%d: close rx pipe failed: %s axe%d: close tx pipe failed: %s axe%d: close intr pipe failed: %s axe%d: usb error on tx: %s axe%d: watchdog timeout axe%d: rx list init failed axe%d: tx list init failed axe%d: open rx pipe failed: %s axe%d: open tx pipe failed: %s %s: media change failed axe%d: write PHY failed axe%d: read PHY failed axemii%s: couldn't get ep %d no valid PHY address found, assuming PHY address 0 AX88178 AX88772B AX88772 AX88172axe%s: warning: Failed to write register 0x%0x %s: warning: Failed to read register 0x%0x %s: warning: failed to read SMSC_COE_CTRL (err=%d) %s: warning: failed to write SMSC_COE_CTRL (err=%d) %s: warning: failed to read initial AFC_CFG, error %d %s: warning: media change failed, error %d %s: warning: timed-out waiting for reset to complete %s: warning: timed-out waiting for phy reset to complete %s: warning: failed to set the MAC address %s: warning: failed to read HW_CFG: %d %s: warning: failed to read HW_CFG: (err = %d) %s: warning: failed to read ID_REV (err = %d) %s: warning: failed to read MAC_CSR (err=%d) %s: error: smsc_chip_init failed (err=%d) smscmii%s: warning: MII is busy %s: warning: MII write timeout %s: warning: MII read timeout smsc%s: cue_send error=%s %s: read MAC address failed cue%s: kue_send error=%s %s: warm boot, no firmware download kue%s: failed loadfirmware of file %s: errno %d %s: cold boot, downloading firmware %s: failed to load code segment: %s %s: failed to load fixup segment: %s %s: failed to load trigger segment: %s %s: loading firmware failed %s: could not read Ethernet descriptor %s: no memory for multicast filter buffer %s: usb error on rx: %s %s: too many errors, disabling %s: open interrupt pipe failed: %s %s: close interrupt pipe failed: %s extra ethernet descriptor %s: no data interface %s: no descriptor for interrupt endpoint %d %s: interface alternate setting %d failed %s: no descriptor for bulk endpoint %d %s: could not find data bulk in %s: could not find data bulk out cdce%s: udav_send error=%s udavmiiudav%s: upl_send error=%s upl%s: ugl_send error=%s %s: bad header (length=%d) %s: bad packet count (%d) %s: bad packet size(%d), length=%d ugl%s: url_send error=%s %s: %s: bad register %04x urlmii%s: failed to get interface, err=%s %s: couldn't get endpoint %d urlwiusbthrwitxlwiIDLwi_usb: received USB_BUFAVAIL packet wi_usb: received USB_ERROR packet %s: %s error=%s wiTXsyncUGH TX UGH RX write_record buf size err %x %x invalid packet len: %x memsz %x max %x %s: %s: error=%s %s:%s: invalid packet id sent %x %s: already detached %s: open pipes failed wi_usbRT5222RT2522RT2523RT2524RT2525RT2525eRT2526%s: could not retrieve Tx statistics - cancelling automatic rate control %s: could not write MAC register: %s %s: could not read MAC register: %s %s: could not write to RF %s: could not read BBP %s: could not write to BBP %s: timeout waiting for BBP %s: could not read EEPROM: %s %s: could not allocate protection frame %s: could not allocate tx xfer %s: could not allocate tx buffer %s: could not transmit buffer: %s %s: could not allocate rx xfer %s: could not allocate rx buffer %s: could not allocate rx mbuf %s: could not allocate rx mbuf cluster %s: timeout waiting for BBP/RF to wakeup %s: could not allocate AMRR xfer %s: could not open Tx pipe: %s %s: could not open Rx pipe: %s %s: could not allocate Tx list %s: could not allocate Rx list %s: could not queue Rx transfer %s: could not allocate beacon %s: could not transmit beacon %s: could not set configuration no %s: could not get interface handle %s: no endpoint descriptor for iface %d %s: MAC/BBP RT%04x (rev 0x%02x), RF %s, address %s uralset config activated %s: can't create task thread %s: can't establish softintr %s: usbf_new_device failed, %s usbf%s %s, rev %d.%02d/%d.%02dusbf_start_next: %s encap error cdcef_do_request %s: usbf_transfer failed OpenBSD.orgCDC Ethernet Emulation: usbf_add_config failed : usbf_add_interface failed : usbf_add_endpoint failed : usbf_add_config_desc failed : usbf_end_config failed : usbf_alloc_buffer failed : usbf_open_pipe failed : usbf_transfer failed : address %s cdcefOUI 0x%06x model 0x%04x rev %d at %s phy %dmii_detach: phyloc and offloc specifiedmii_attach: phyloc and offloc specifiedmiiautmii_phy_setmedia: MASTER on wrong media: %s, rev. %d nsphyDP83840 10/100 PHYnsphyterDP83815 10/100 PHYDP83843 10/100 PHYDP83847 10/100 PHYqsphyQS6612 10/100 PHYinphyi82555 10/100 PHYi82562EM 10/100 PHYi82562ET 10/100 PHYi82562G 10/100 PHYiophyi82553 10/100 PHYeephy88E1000 1 Gigabit PHY88E1000 2 Gigabit PHY88E1000 3 Gigabit PHY88E1000 4 Gigabit PHY88E1000S Gigabit PHY88E1011 Gigabit PHY88E1111 Gigabit PHY88E1112 Gigabit PHY88E1116 Gigabit PHY88E1116R Gigabit PHY88E1118 Gigabit PHY88E1149 Gigabit PHY88E3016 10/100 PHY88E3082 10/100 PHYPHYG65G Gigabit PHY88E1000 5 Gigabit PHY88E1000 6 Gigabit PHY88E1000 7 Gigabit PHYexphy_service: can't isolate 3Com PHY: 3Com internal media interface %s: ignoring this PHY, non-zero instance xlexphyrlrlphy_service: attempt to isolate phy: RTL internal PHY rlphyRTL8201L 10/100 PHYRTL8201E 10/100 PHYIP101 10/100 PHYlxtphyLXT970 10/100 PHYLXT971 10/100 PHYmtdphyMTD972 10/100 PHYicsphyICS1890 10/100 PHYICS1892 10/100 PHYICS1893 10/100 PHYsqphy80220 10/100 PHY80225 10/100 PHY84220 10/100 PHYtqphy78Q2120 10/100 PHY: Generic IEEE 802.3u media interface, rev. %d: OUI 0x%06x, model 0x%04x %s: no media present ukphybmtphy3C905B internal PHY3C905C internal PHYBCM4401 10/100baseTX PHYBCM5201 10/100 PHYBCM5214 Quad 10/100 PHYBCM5220 10/100 PHYBCM5221 100baseTX PHYBCM5222 Dual 10/100 PHYamphyAm79C873 10/100 PHYDM9101 10/100 PHYDM9102 10/100 PHYDM9601 10/100 PHYAm79C875 quad PHYacphyAC101 10/100 PHYAC101L 10/100 PHYAC_UNKNOWN 10/100 PHYnsgphyDP83861 10/100/1000 PHYDP83865 10/100/1000 PHYDP83891 10/100/1000 PHY%s: %s: enter updown%s: %s: link %s : RTL internal phy urlphymmcdiemmcdly%s: i/o init failed %s: mem init failed %s: can't identify card %s: can't supply bus power %s: can't supply clock %s: can't enable card %s: no functions mmctskSpectecSDIO WLAN CardSDW-820%s: CIS version %d.%d wireless network adapter%s: bad CIS ptr %#x %s: CIS parse error at %d, tuple code %#x, length %d %s: bad CISTPL_FUNCID length %s: bad CISTPL_MANFID length %s: CISTPL_VERS_1 too short %s(%sat %s%s: can't read CIS %s: can't set I/O RCA %s: can't select I/O RCA %d %s: can't supply voltage requested by card %s: can't send I/O OCR %s: can't read EXT_CSD %s: unknown CARD_TYPE 0x%x %s: can't change high speed %s: can't change bus clock %s: can't re-read EXT_CSD %s, HS_TIMING set failed %s: unknown MMC version %d %s: unknown SD CSD structure version 0x%x %s: unknown MMC CSD structure version 0x%x %s: can't set mem RCA SD/MMC Drive #%02d%s: can't allocate ccbs %s: can't attach scsibus kd'(3  `:h:`:l:t:|:::::::::<đ:ԑ:::::: -/,('&H% !$" 42<0<<<Pddd<<xdd<<dd<<dd<Ɓ<dd<Ɓ<dd<<d,d<<DdXd<<ldd<<d<<<d<Ќ<<d<<<d<<<XdDd<ʁ< dx<<΁< d<<΁< d4<<΁< dd<<dd<<d(d<<d(d<<@dd<<pd@d<<dd<<dd<<dd<< d d<<dd<ҁ<ee<<ete<ځ<TV:Me<ށ<l[: Ne<<4Ne Ne<<[:HNe<<\\:Oe<ց<+|x:Oe<ց<+x:Oe<<(:Oe<<:Pe<<,:$Pe<<:DPe<<(:XPe<<:lPe<<:Pe<<:Pe<<:Pe<<$:Pe<<:4<<<܈: Qe<<4QeHQe<<,dQexQe<<,Qed<<QeQe<<-QeQe<<-Qe Re<<- Re4Re<<-HRe\Re<<-pReRe<<-ReRe<<-ReRe<<-ReRe<<-Se$Se<<-8SeLSe<<-`SetSe<<-SeSe<<-SeSe<<-SeSe<<-TeTe<<-(Teshב48u+ zK*@@ X#%uLaGU L"-*㮭qO]m4fIwm2{QH?{ƀQm& RZ\,lV'hRz}Tv@VY7MY.5F$IQkOM.L#ao%Y߱ K* Q.z>\0xLNEf!lJ D@&m^@ PJj^y?c^oj1$ao@rdClxx;c*vQ]7zt'%wE!tN3KmDZYyOK<3\V@tmpgٱ5ɹ0"0Y "F؉1cuv ... export VNAME=$(sysctl -n kern.osrelease) export VERSION="${VNAME%.*}${VNAME#*.}" export ARCH=$(sysctl -n hw.machine) export OBSD="OpenBSD/$ARCH $VNAME" export PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ umask 022 set -o emacs set -- $(dmesg | sed -n '/^root on /h;${g;p;}') rootdisk=$3 if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES mount -u /dev/${rootdisk:-rd0a} / echo ! : > /etc/rc echo 'erase ^?, werase ^W, kill ^U, intr ^C, status ^T' stty newcrt werase ^W intr ^C kill ^U erase ^? status ^T cat <<__EOT Welcome to the $OBSD installation program. __EOT timeout=false timer_pid= if [ ! -f /tmp/noai ] && ifconfig netboot >/dev/null 2>&1; then echo "Starting non-interactive mode in 5 seconds..." >/tmp/noai trap 'kill $timeout_pid 2>/dev/null' EXIT trap 'exit 1' INT trap 'timeout=true' TERM set +m exec 3<&1 4<&2 >/dev/null 2>&1 (sleep 5; kill $$) & timer_pid=$! exec 1<&3 2<&4 3<&- 4<&- set +m fi while :; do echo -n '(I)nstall, (U)pgrade, (A)utoinstall or (S)hell? ' read REPLY if $timeout; then timeout=false echo REPLY=a else [ -n "$timer_pid" ] && kill $timer_pid 2>/dev/null timer_pid= fi case $REPLY in a*|A*) /install -a && break ;; i*|I*) /install && break ;; u*|U*) /upgrade && break ;; s*|S*) break ;; !) echo "Type 'exit' to return to install." ksh ;; !*) eval "${REPLY#?}" ;; esac done fi #!/bin/ksh MODE=upgrade . install.sub while :; do ask "Root filesystem?" $ROOTDEV resp=${resp##*/} [[ -b /dev/$resp ]] && break echo "$resp is not a block device." done ROOTDEV=$resp echo -n "Checking root filesystem (fsck -fp /dev/$ROOTDEV)..." fsck -fp /dev/$ROOTDEV >/dev/null 2>&1 || { echo "FAILED." ; exit ; } echo "OK." echo -n "Mounting root filesystem (mount -o ro /dev/$ROOTDEV /mnt)..." mount -o ro /dev/$ROOTDEV /mnt || { echo "FAILED." ; exit ; } echo "OK." for _f in fstab hosts myname; do [[ -f /mnt/etc/$_f ]] || { echo "No /mnt/etc/$_f!" ; exit ; } cp /mnt/etc/$_f /tmp/$_f done hostname $(stripcom /tmp/myname) THESETS="$THESETS site$VERSION-$(hostname -s).tgz" enable_network startftplist munge_fstab check_fs umount /mnt || { echo "Can't umount $ROOTDEV!" ; exit ; } mount_fs feed_random install_sets finish_up  . .. bin@ dev etc mntAmnt2]Ƣsbin]B tmp usrvarinstbin.profile- install.mdupgradeinstall  install.sub MDXDM=y md_installboot() { } md_prep_fdisk() { local _disk=$1 _q _d while :; do _d=whole if [[ -n $(fdisk $_disk | grep 'Signature: 0xAA55') ]]; then fdisk $_disk if [[ -n $(fdisk $_disk | grep '^..: A6 ') ]]; then _q=", use the (O)penBSD area," _d=OpenBSD fi else echo "MBR has invalid signature; not showing it." fi ask "Use (W)hole disk$_q or (E)dit the MBR?" "$_d" case $resp in w*|W*) echo -n "Setting OpenBSD MBR partition to whole $_disk..." fdisk -e ${_disk} <<__EOT >/dev/null reinit update write quit __EOT echo "done." return ;; e*|E*) cat <<__EOT You will now create a single MBR partition to contain your OpenBSD data. This partition must have an id of 'A6'; must *NOT* overlap other partitions; and must be marked as the only active partition. Inside the fdisk command, the 'manual' command describes all the fdisk commands in detail. $(fdisk ${_disk}) __EOT fdisk -e ${_disk} [[ -n $(fdisk $_disk | grep ' A6 ') ]] && return echo No OpenBSD partition in MBR, try again. ;; o*|O*) return ;; esac done } md_prep_disklabel() { local _disk=$1 _f _op md_prep_fdisk $_disk _f=/tmp/fstab.$_disk if [[ $_disk == $ROOTDISK ]]; then while :; do echo "The auto-allocated layout for $_disk is:" disklabel -h -A $_disk | egrep "^# |^ [a-p]:" ask "Use (A)uto layout, (E)dit auto layout, or create (C)ustom layout?" a case $resp in a*|A*) _op=-w ;; e*|E*) _op=-E ;; c*|C*) break ;; *) continue ;; esac disklabel $FSTABFLAG $_f $_op -A $_disk return done fi cat <<__EOT You will now create an OpenBSD disklabel inside the OpenBSD MBR partition. The disklabel defines how OpenBSD splits up the MBR partition into OpenBSD partitions in which filesystems and swap space are created. You must provide each filesystem's mountpoint in this program. The offsets used in the disklabel are ABSOLUTE, i.e. relative to the start of the disk, NOT the start of the OpenBSD MBR partition. __EOT disklabel $FSTABFLAG $_f -E $_disk } md_congrats() { val=`ztsscale` case $? in 0) grep -v '^mouse\.scale.*$' /mnt/etc/wsconsctl.conf \ >/tmp/wsconsctl.conf echo $val " # see ztsscale(8)" >> /tmp/wsconsctl.conf cp /tmp/wsconsctl.conf /mnt/etc/wsconsctl.conf grep -v '^machdep\.ztsscale.*$' /mnt/etc/sysctl.conf \ >/tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf ;; esac } md_consoleinfo() { local _u _d=com for _u in $(scan_dmesg "/^$_d\([0-9]\) .*/s//\1/p"); do if [[ $_d$_u == $CONSOLE || -z $CONSOLE ]]; then CDEV=$_d$_u CPROM=com$_u CTTY=tty0$_u return fi done } ELFa(4"4 ($$$$$gg(w(w(wSSDDJDJ44`TTTۣe(w(w(wOpenBSD -L0! MP@ -8AL4@ ` \p+  0/R R  /R0S000) \' P00<Q  A \ 00 W U <00S P| , h0-L` 0 R   1S0B@Ct1P @D0t0$<0< 0 R-L @ R,  0S00`,  -x@x @0LS ``00T0H 0S 800S$0h ,  p-L 80P `P dp-P }7@POU8 㪝 (4PP 埝$\K 0C8t 4 D , 塀P2>0-S) 吉РBKAL L P0 P0$RpB.K0 B Bxpppp~0Hj0<$2 $(w+̗0 -LM@pP4 kPP 0S nS6 =`P00QD @ Q? P 0V0S D 0 YppV 0`pY" 0 0 p 0oSP꩙00 ,K, ?R0S@p @ `0 p00ꍙ0"S 0(ވ$P 0 0ֈ]Ș -LM`PP( @(K,pK 0 g(0@S %$KZ' -LM0S S SL0 0@s0(( Khk0hfzHJG -LM0S S SL0 0@N0(( KhF0hAz HJG -0L 4+,w -Lp,P`K(@P 0 `$00$ (0@ -L`PVp*(@P  0傱p0   /m% h -MLMPa |`P E@ 'P $@TY  h1o\P P@ $@TYK(PEPE)0_pP00S0#3P _PPPUp Vn Vi@唐PK 00 0i$VT s  $@T(KDd@zG -L0 K M, 8$0@H @0 000 ?Pe bP@@  H$崺p#00#< 8 4 D 0a0@SM\tЪ0STcBj.@ P R r@P00SxRbRbRPP,`pWP 0  s00 2U" M0@ 0SP $@T 0KLL PP4B8n0P  ! < 10D0 80080 4 H!ps1 pR18 040DR0Q  R`Z00R00S< R 10S00S41AP]P ,@P@@ 0KH<0S 00S  00 $0SVPHPA0pK  0KrP  lP`Fv@T峓dU(Kz+y̙ęЙ+z,w -0L .%,w -LMP@`0p 5U@ 0S T ڢ 0(( ӖP p-LP@!r`P P@zp P@@ꨵ -2L`M2\Ÿ\[\ @ll2` g @` P0S 1 `D0V@ !8*g&$g(w$zhН (4<DLX`hxLIԝȞО$Hwh@TT 0$ -L)MMğ~KpG`pG , P@P #T@U i` P^ Qe@PP K@A@ A <0d Qd: D3qd A R (fd:S@fd:@S 3Ÿ, 0R(K#fp@r PeNK@Db@DO0"#@ᦫ뚍0S l 0S0Sx 8P$*`&NKkPaw_KZ P {K P1 R( @JoK=fZ PW{?K 0fKA P<h:#4(1 R0SQP@D 夻y᛻tP Ke 幉k&NK Pa჻\ ~|xyRh`e(wL"l@H{\DT|̑848n@ -AMLM6 `Pp, &tpJ A0@6S6\8 P:p%)p5 `bA0V84 Vm VZ @ `P PDs P $n PP PP (0JP@4 sPnpi4 RD,`t4 \HPW4pR84 RM pIpPDp?3 ;963 R `84@ 0@@Z00S oP; "`3 RZBKHHP (8PI [P@0 0   P ,P 0DPt0 0 04 2 0@PP B.K B BxKP@4PJp_ BK@@`Pa PP7 @ P  P  P 84 z`P⨑nDP`hftr P@T@h@XPx De֯PP84ѯPP84 zz⯯PP0D{K0S G84 z P@ PUO 0t^P 0Tp+(wПT z+ȟ pdP1L,Л8n -L. 04b)4 -GMLp1M ha d!@0P$4 @!冭p oP: !}p 0bSQ`A~K pG0pG4 P- $$004 4 =K 0C0C "qPP -P P| t0$\zA.KP0 B BD ,(w+dhТ+ -LM@pP4 PP 0S nS6 =m `P00QD @ Q? tP 0V0S D 0 YppV 0`pY" 0 0 p 0oSP>00 ,Kx, ?R0S@p @ `y0 p00"0"S 0(sy$P 0 0ky]Ș -LM`P}P( @(K,pK 0 g(0@S A$K -$0L0S  -Lp]00p3 P``0@@ PPkP P sP@ aP P Lph00STTTJ.DY<D ,SL,w \  -Lml@-0 S R@4 00 ӑR^ ^R-0S \ Q-0L Q* x xPd -LMp@`C $K7lP<0S 0S $0 UR#U 0xt -0L NE,w -MLMp0,0 /娫pI B0@3S3tD`0\,> >~> > .^p. 0b0CS/[>KQ0C 0C >p KAPD?@T 6: S8  S +anK`F`F@ pW@ܭP  P @TDP w= =(=a\= x=t= l= U,=.T=P=L=|.8= 4C<X.D>=:<,5< .<<,< << < X< << < (< |ʋ  0 &R06 \4VD'D7U v@@^6 %WU  & 僐 b I hF0F@$`@J#&R 036 5%:W!vW pU71C0eP ?I71C0`PA@0<6&C#00R* FP Q F 6 S 6 6S< 6 A6 S<^:;AP  0&"1. `` cc  &  &6 R R  &A60#r0P`6 1 H$0@T~ ^ P *&R6pp 1H$P`P`V  t Mu3 R0S3 R  P3T@1t K@ĕV%P  P p *p R00Y0S 0rS Z ``? V5  U @ P0@X S P P 0t Q  Yx^ \ P Q T e/hP 00B0R SW 00B0R SQRM  00B SQG `RIpRGqaPB ? R.R<t300 Q &R&  5S 5SMKx `pp u8PU 20 @  V t 6q0#0P` vtP(w{+t$اX0d(P, 0p480< @DHLĦH.x.T̪ H//@edA<ĪILī$,8@XdxL(wئPd`gfff\P{(0DAĬħ|\8(d`@P 0ᕫP &P嚿 S{V&\s6 S F &Ts 6!&a 0 . `& @P 0 2" p0! [ ^ 2 6S22S \< D2^0B0 & R 0@, & l& 6 `@P p! 0I[@@T@!^4: Q0 &R0:S P03 83Q2S*& RXC 6Sh3B@6 L!!  咀6R 00 T@\6S%%R006  P0xc5 0S 05 Q5 6 % &6H\ QX\Qd\l\Qx\%5\Q\6S%\\TDPy\w\Qr\ $PU , 0RS(K r (r]K@@5E K@@5 E pP9 &R%6"&  P660X*0 ^PPS00SB %5R> P;X9:@X &0ST#3*&p  6PX&  \ 6S X*cQP60U&00Q* ^ 000S 0@6 # 06U0$!4060 !40 4 06 0!4 0  40 ,40!̠!4!05#Ƞ##0  %$0""Ƞ"$ %@"̠""    $ !$ )0`X(00ST h8 4  (0p8 [NKR@D@D6( '0S66 { &hp 6P &GX 09Q  ( 520#$ 0 0 P0C"$ "40 && 9  0@!Nav. 4 0 %9R X2 5S X R 0SR0aA006 6 r0CC C C C CCCU B!!!Ƞ C CCC CC  0C0 [0C*00S @T &U0& U 0A Ah 68FP ~[NK@D@D6p+YP ݼ00 5 % \6 S(+h 5S,+` 5S0,X %?RB5( c02?  5 % 7 Q`<Ps 5P n @ S%<T E I @ 6S #CpPC&p<Q &Rp5F0%p%s(=R66  Qk T Ujd%ppp |0p pp0pppTq 0p p 6&0p&- pA 6(~0#0P`6 S ^ʠ 6pep5o`ps ZpTp -LM00PKpa@ 00p `pP2 `00PU4 @uT <T  0BS0^T0(@ 0 0 K?P@ -P0(P0 0( P 0`DpP:}$K P@$0 R 00(@< %}$ }  дش P-L oo됵 -LM( :_P( (( Q5 (Kܧ`P0 0S- =M@PS 00$pK [PcU% iU, lU3 oU: 1Q@ Q 0S7P0$ 0 Q (Q K( "P($00P($00P($0 0P($00~Pt ($0$0TP@ ($0(0b{ ĵ ȵеص 0-LM 0 P`XX0Q @0D0 X Q@u 8hX $,$0 C 0+ 0| B-00 $0 0 0+ -00S 0 $: 00 $ 00 $: 00 $ 00S 0 < 00 00 < 00 0$ 80 0 ( =K 0  $0 $@+0S  $", 0 0 $ -LM0@S 0 K0"0Z0 00 K0" Z0 0`t - LyZP ot D - LkZPnt P -LM K00"YZPt\ -LuhW0$Wh p-L MP@`0KP 0S00Kp Թp p-L MP@`0KP 0S00Kp 帹x -0LS@ h?U 0 << 0 -@L W0 0 -@L ∹0 0 D0$ D0 -LM Pp0`-S,0C000P(K 0(P n@P  0SK0 Q0zC$z>  {: p-L0 `RP @ R (P0 00 0 0 0 p01Q @ Q P0 000 00 p0Q @ Q P0$ 00$0 0$0 pp0Q @ Q P0 000 00 pp$< 0-,PL0@S 8000@0pt -0L0CSQ 0M - LP^0? 0  P@ ^00 ,00$0 hiشP1 p-x`L@PTd0 \SVpHP@KV8HVp$BV0ppt̑P@ -LMR p, `0 P 0LS < VPp@NsT   V@Q  V@T` @a Rb:          0 Ql }@!` y $T u L &q?QPP  ( gU b  ^U XU RU  LU @  AU   @ 8U x 2U  d ,U T    H #U 8   0 UP0  P U  Ua@  U@ U U  Ut 2h@  < S S @8 U $    U  U U0S k\0 `p \$ ^ 0 R AdPd␐K 0h'<0 ^K0p4'1 W IUGU pG\W K?UK=U, 0R(Kp0S i^0b ^ R@ |W0S  dP^  L/ E80A$=@061U4  +@3'5# 7 U6 i@8  < S1x 5 U2     @U.  ., 0 2 *0S2@T P`K0 0d$y @TO0xtld0-W  R0Q4@eU   L@ZU _ 357 9.@< 9{ [ wU8 @8pq:dm <Xi F LeU;  ;8_ B ,[U:   9S@ U S?  SsGp DX @ R @; 8  45 02  .stS@t$+\!"0 04 t  2gSPFcSPB_SP>[SP:WSP6XP(wԻ@PԹx 1AQ}ApQaȸ1ٺ 8DU%ͷ , Aչy 9H54$̷  I!@P|@qP`ɸĻT0غ0p|Td -0L .%,w4 -#L`M#0㘣p , 0x0 0S`pAPcUH#vp a0@Sp"!!!x"D"<"`0`K1`x ` Pxt KUP4Kx UPXq"#""BUPx t壴`0S0 t 4` l h 0SD PKx@K 00 Q/ PP;P `000C S61|K 匞|0`SpP Q W 0l0 00 Ql0S$h0S xTP(, 0R((K` t `` tP  0l0 xP&ux勧p刧ch`Xjh0 (wdlt@ht@+gtȼt -0L 0,wܼ -LNM0S( P@`2"IK\2A0PP2 R4: S 2"|2Q0T. ᎒pP< BNK@D@D0P"p PP1INK2@D2n*P0S9 2 RY0S$ vPP( 0Ri$KINK@DP4: S|L1c\ 0RP1OK 1PA! A P/$4R$4R$4R0 R tgPDx0S?x?00d ᧦6x00H埦@ᚦ0(wL}Lk|,xD4Լ -LlMP@"孚p1 F0@-SD0*))))) *)))*)))))))))))))))))))))*)))))))))))))41 0bSQ`( S+ S 10pKaP60: S" 0 0 0 0 0 0  о ˾QP @P PQỾ  呲lx| -LP(@`pTB@D 03T+++++++++++++++++++ t0l 0@8Pc 0 ,0 0 0p=>P?> *Q-L QP!00  0RK4(w\" t -LB0S007"0002"000-PB0S00& {2~T`(@TV;@TN1 RJ Df@0DS>e/P~`PI N0@PD0@08 ᱩD1 R 1Q0DS$@ e/Ph/@P @ 0A㟱0 0T  tp@ lb \^(}+ d820P#! 00"8Q#(-0 P`0@p` P0@ ` R VUQ -LMPP`0 ` TP4`@p080 00 R0  B( -LM@ pX 0P`PBT 0@B iBU -LM, (0 @B 0p-,s 0B`P 0p|B,K 0 XXX sB8S P 0< 8PS$KT  -l@LP20p ppppqPU 0S qP P0P <H Dt0P00 Khp<KL  Qp-LP4 *P. a`@V00?(V \9@ @0@0 @0@@|P@@ZAp(``` ph3 PDph.phy 44"P(0 ph!<dx Q0-LP0 a@Q00?(Q` 0h \ \\ \ \ 0h(9@ @0@0 0\0P!T0h HHP< 0 0h; $0hПпL   p-LM L`,K$ K0K0`,@ (P `jp $KKpS x -LXM`K@X pP=~PP 0prSPa,00Q} @@Qw XP1( K0T00C8Sp==!==q`1@ n;1TP`= T@T`0SP`00CS`0NX0  X0ll FPP \!PD ,@P2 @T < 04;<`0@ *;1TP`< T@T`0S x m0ሠ0C8S(K@@ mX m00 @h@D@(T -AMLM08 ,0 0S0 0^<4 1 \|, 0R(K P0p4t 0 `p@4T0d P@ `P`4T 0d 0 P` 440D0@pT44 0D : 8d0 c0c#"raa`  D<!@<8 08 0BKHHhQ  `.<@ ,DKP/ +4[,$[ SSa B RR8t20@8 <01p<4X SP0`@0D Tp4TU0 R `00CS`0 X0  X0hX lcX l^(w<T Dd@ M-LCMT hITTBK8PH0@0pHPT , ,4KePP E(0K 4R S 0C4BP,[?\8<,[?\3X 0; dPh,K0So02P 0Sxȟ0`00h`00CS`0 X0  @PLD HT X0,, 0LHR(K*\ \UL L H D @$  LD0t0   D\ P 09T$8 P`LH 4$  09 LH 09p5  B$ 0S @L4 HD 0T 7 R4L$H4);)P M&< 8$ 0 D$ @4 p-\+\PP `0T `6bBK0A0Aep,b0"S 04 R@TUTD@ 0<$84A8L H +V -V~LH$Y L H$ wHTu{{+4[Sg @0D @ LD HT g0E(@Kp4WS%000ӑ%0COS񟗣D̄ ȃXHa@P0LD HT 00@L4 HD @P LD T,5H$ 0S @L4 HD %LH L H TD( 00D @ 4Gh,[p< 8 (T$( Q Pq`0OO$  !5;BED4 @D 04GB,[p0<4 8D T( 0{0D @ 4G,[p2 <$ 84 $GTTp80",[D @ < 8$ T4( 0[0D @ 4G4R,[@p9 00 (Kq 070`p0 @P @PpLp p 0q` D0i70P4 0^7пtd -L`M\ l 0S (KP 5^7 00C <   /P L ?8 40 4 8@L0呄## @P0\((%`p0 `pp@P t Q 9p嘐Y@  ` 0 @@ < H0 D@ 00C C  \ (xT$0@X0 T@ 0H@S X K HK6XpKX0pW  W0 00 l@\P0 P@`PU`H K p`P弉pl0\@p`p 0p@ Y0 ,  h d 0 K  00 ,0 h0K0K` X K p 6@P`p 0pK9PW``@`hKPH  R 2 R l@\p0P`0 p@@Ws L2@T0XK48! LQ P K A6 P K C q1 1=6u* 146P%P R8 K 64 80S##`@Bl\Lpࠀ@@@!0NSnS 9Yᘐp@  ` 0 @P@ < H0 D@ P L 8 4 0DpS:< XD0 SruX 0XKd7k& @@ &A@@,dpH -LzM0 ,0 z'00'72 A P9`p@ ^ @00 0@  0@ Z 1R 000OO[P``4;D1 A 0@ 2 B   ! @00@@Te/ K( K2ACh6 P 1 AT^AvK 00@0 @H 0K0@0 @ K  Qژ1!4p`{?K! 1 A c 1 Z ! `  0 5P@0 05 ^y/K  R0! 1 1Z`yKd 04  @A  K9@ @00@0 Z^^1A0@1 A fYH R Q1SB ^?BT9^7Py/K  R0! 1 2(@K2 @἟@a1 A SW%; U U (K0L1 0/SL) ! P ! Ke/7B, 0R(KBQ 1K $ ,P*1K $ #0B 0L K 婃P PLZm 0@Sm ` / 1 P@`p0W`RO {KQ  !  K @ P   R0S    R@PW 0SP(!R ~V{KP`p  TNU0M0M $ @GU`p!1`S {oK0ST00AT v(w'Խ - 2L(M 4 R 08 R (KP6 00C BC1  IPɯ* /0 , `p 0h!4d@P `p0c`vp v 40(@PU 0 u3!  x 00 ,0 w 0k3w 0b3TS3@ , 0@0ᖄ## @84 0@DT5$ @@0$A@@<,d -L(M280 4 400 , 8` 9ᘀ@\\@P`pP@p@ P04xx! @P0@K0p0pp* w1 P8 84 0P`0 10Z  0 R00$/ ,0X%! 8P4@ p徉q 02x h02h L02(K0@W0 K $4嵖YT`d@ -QL M, 3 aIZ00,0(Z` (Ko菖,  20P` p0@ (Ko},0(, % 0 T4, (Ko6 88cP,0 (Koa2@\ -$ML4 `)p@@0P\0XX"`p `p0Pp] xi 2 R B0  00((Kf A0 SP40 @P 0P /0U T04 P ༙9@㘀p@ 0`Q 0 , 00K 0S@P`V00 ,@ :4@, 0@09 T 0 TSq 010Sy h01SQL# 001 U d -QLM`N aP@U00? (Ur \9@ @0@00 ,@K$P K(` Khn5PPcPPP H<KhN 44EP(0 KhC1 -LMPpc U a@Q00ϓ4 SQQ4 "<  0S 9@ @0@084\20    8408#8P8<0 0  @  0   P `   R0SRP `  hp dД(K. L2L0<048 \8 `P弙ᘀ4@[P:4yP580P`0(0 @ Q Pd&  V]Z V^[  Pʀ k! @<04P4P 4P4'P @00 0000*PK0@ @00@000\00S a0*PK*0K 0xx)0KLPP P0\L0x\ @(AoUU,T -L M<G 0PP@@P!0 `p0 `p0 , 0 rT 7<@ 0@,@Q0 PG 0PP@@PDL1` X0K0@TP !p0 `ppP`+ 7<@  0@ 00KQ V$ 0KP,0``|dTP00KP0(K,0s\\0 (Ko/q880 (Ko/U -LnM0e/ K,0 At6t610hFh!dP2 X\P: Lf@P TPD p@PT`U 1 5i/1P` 5_/0P@!`pV5 R`00CS`0X0  X0Ud000@@V UP`8#8@00, &P  w,@P0 $`p `p0p pw ,0@P0 $`p `p0p p} 08@P0 ll$`p `p0p px 84@P0 $$$`p `p0py pl 484C 0C`0A 1 A @TA R 0SSr 0P`@@0@0Q a f $0p`p@ p@ pQ  /,  12-1(x p1)-v X1l#-p ``@PZ (1H-d0S* 1(-[P0@`@w_K`0@a0@TḀpr?K 0S@ @0P ` K !_0B 0SKe/+S 08, 8w(w\x (8 -L*MgKJ0J e/ ,0 a0: wP rP lP ; KAA  R PP[( K0S@ (K0@ @0@0 5 S:5 5S:5  e/ K e/K u.:K@0@: J : ],  yP Ez@P |@zPuQUQ 0ApS t$pl<, ܹй|P\ ԷtȷC R0`p: @P 0STHK@ @H .p 4qPP  0+q  Q Ke/PPA ?P< NKKAe/J 37 RR -@    P ǟ, 0R(KT%- 47 Re , JP7ǟ e/NNK@D e/K e/ e/K x l X-UR l@Pl  0F `@0p`p @TP0,,@ P(0 0  0nU @@ 0 c5 R  [ ]WU $0N YK0 $[E PB > =: 7 3ğ$00s03S0|,' Ke/xP NNK@De/ vKe/ re/Kn B ? <1Y@B }P K 4  ,P0P0 !40 @_ 0v m4 0KϿ0, 0 K+PP ,04  ,0 `0WPV(K}}}}m@`< 0-0L@T 500S ᡍPڼ 0P0# ;;S 0@ ግPp0 @ L0P@TP5P0D >4 03@0}}} }` 0-T0L?M0S@00S ?KK0P@D?+UP 0K0}}} -lb0LPPP2 P6P@8"000"0P002PU GUE&Pڀ;;SB a 0vQ8pPď EP01@P1+O0S! O0S O0ESPO0 SD{3 $1 O0S O0S O0S  0@TT0 0 00TSPP T0 L3}O|00t 3 l00Q )PL63813}} }}} 0h -t0 0LSd0 \@ 0=v RPEP=O$ G3}}}-0 CR 0R0 SX00 p-43LM0S 3 3 330S 30S20S 20S  XB2 R0S p2B[LP 0: SH0D@@h2l>@\20SP20S D2P12$2PK În10S 10SAY1 姟1 0Sx1 p1 RT 1 0SP1 P1 !000<1 RD 410S (1(0S V "h"0S , P. "n0S S 0<K1 !000@0P,K R0S 10S 10S  Rd1  24 K,P 0S 10S 10S  R0 U4KQPPQPP`!PB V <004X H00S!(KH@, `8@  -bMLMP00S %P ;P ,00<Pb K @@ K@ -LM , 3S 0,Q, 0 SPWhPTp`P O, PPU@$P= P:W0S9 D,P p3S P 0!0# @ 1S#Wh0S X,pPEUH /e,, ~H p  -L M 0(K *P1`E 0 p @4 @0P 00p3P_PT+MV 00 a h0R d0R l0t ! 0dQ>00< 0 " 0(Kl, Dh R0-LP@  0dQ=D 0 0 6$P= 00h!0} -LMp`, T0S000Z PP0e00S @@T*0S Tw /0dQ= 0 $`&w* w@'xPP! `0p #P v= 0P !` eZ,0c @pW pt -@L!PR= 0hZ! -*@L"*c0nP== 0hE! -L@ dPd0d$P "=0SD00S dP =0 !l( -LM@0 c\Pd0dP <0SD00ScP <0  l( -LM \ 0  (0 $@ @ P00S0 0 @00S00 (K(kP<0  KL -L MpQ`:0P 0 00j 0P0Q0S 0;0Q0 100S00S a=0 800h Pv<4 0Kh} Kd,x M-LM0 0S   (0 $@ @ \00 S0 0 L00S00 c( K0,cPB<0 K KL 0-LM0PS@ 00D00S +8 00a0K0 p-LlM`@K"YPl0PU\0 0R |0R  x0R Kp -LlM0P/Sp`K/к@P+ XP# KP p/0p0ĵ 0S  [PXP 0@h b/00(Kd? 0-LlMPK@XP 00S0: SPU ;L 0 +P; 0K0 -3LM0 {=K0C 0C`$ '{4 P$ #00CSKhpp3pNP"`#0S ( Kp@0 A;0$#0HlCTKHXP"0: S 4S <zz2 !W+   <9x  P ;8"@[P 40S4 ("0S20 P0!l1P 10 A0P0Q0Sp!0;0Q\1P10S9D1tùP3 ZPKWP : 00!d 0]0S 0  0S00S00S  A00S0P ;80a- 0@@(Kl\40d,d? -LpMpPK@mWP*410SE 0R  0R 0R 20: SsP )PX'1:0 :ꔐc 0aP :0`S ,P X 00 @(K(0 P0C 0 p-LKpM @`KPVP9000H 0: S ( 0lKp @ -0@0Lk&kP P!0P pppp P90pS  P0$ ,0p0 R00~ -BLP K00儢r"@Tfx"0Sp2pP` &`"0S 00CS00@Ӥ0L9.9@t0Xy $S0`: V0`0H ]Pc  7P@'!0S0  qP ``qHA0S 00CS00Ӥ0 98P p %U(20S@ 0S0* 0S 0(P9   0 VPx800x  H0 ` < N0Pc }~D~, @D -d#L M0PS 009Pb { p kM3P 80S 8"P40C S7'P''P'&('P'P'<'<'0S H00K080KPT2 0000K@8K ,E0"` "}0!V0@@L LHl >0 `: S*  S%  S  SJF S*  S@  SCt1  T10S; a=0+8 0 @1+0 $1 ( $ "0a- 0 00+P8 00T0 L   p0 L@p 0߶ P;00 D0 (K}} (DX  0-t0L0Sd0P@0S0S 0SU,P r@T0~tGd0 R00T00SL0  D00S800S,0Q 0 I~< }} p-PPL` 0S@PtXp @P0/S00D0< S0P `@@@@p~~ -0 0LS0000000S 00000S| 0@00x00S lh0PX PD00S ]P\hX~ @-@P*00S S R  PA0B0B0 Sa0B\7B0W BS0@S: P*0/S0 C7SS0@-C@C  R̕0̅ N 0 S0W0* 0L 0\00*0L00\*PG- \*00S S Rpp* 2P0L0A@L S"'.pΏ"'.aLZ`P0  pPo0@pS  0Opp0@ S: 1!>p \*0/S0C7SC-p 0RP`C!CR00 Q0%2>&B P`L 0S W*` P0@ 0P!00*0@00P*-S0!P \P0307 p-t0LM0@SPUCP`K 0TŅ0S ἅKp@ -LTMpK6Pa=0`P`VUTSd@`@a pPK 0@᭴<0PpK0@K 0K$0-0 CR 0R0 S?00 -LlMDŸ@Ÿ^ \P`p^q Wp28KJa=0  RQTSAAa ⵤ 0@xKN1PxK0C@t1P[ 0P8 KP Pp8100CS (1 ,8,$8 #4pa=0 pxK00S y  ?0 0BSR  h00S [ >+$K,$,0<4T`@hp p-4L0S$1`@ PP>000-S 00 00 00S  phW 0P0P! P P00:U0S ll00:SLQ10 0 $(0p?Pp+x P00 0P-L 0S,[pPАРP(x,ᝳ`P=㘳@P  P|f@P0VPPS0    Up 0S -L { -L {$ -LlM@P㐀K/pg>@P`0@LP K40pS P  P 0: S 0( CVp$K" -LM K`Y 00s@PIrF 0SC kR bR&mR wR!$+%$+*$&U*T'0@P 0 !$/UT0 0 @P 0xS S *S d1#pUT@P@P 0-LMK@*sPP00S0#3 Pp0@ 00S S00 0P@80     B@0 0 C8@ -LM8 8 4 /tz/P800O0傲P|op , 00@JSh>p>>>x>>>>>>>>>>>>>>>=>>>>==>>(>>4>=@>>>>>>>>L>>X>>>>>>>>T<<><<>(>><>><>L<==(=0=H=(=P=`=l=>=p^NP 040 = ? = 0-S0S, n 0,0 h= 0m= ph-00|-Px=  @=cPYW H-00?<= -00-7 =0F,0 00=< Z  [@P Gp< I00< 00 < < x 0S80S50S-10S(  0R# 0R!  0R S  0R 0R   0R 0R\pp,=0 -L@ƿp  Q.SW}p 0S0C QWP `᯿Pm 0##!>C=S0Hcp0H S^efefhef,efdfd 0 <#d !>Cv.B B 0@<#!>C0   0##@!.CDR  k?C0  0!!!.A0r03 R0S )0B0@ 0#"!.B0r03R0S @ 0##!>CS0@ 0#!>C;S0pq -pPL 0Sd&/o`P00  S,UXB .UQ  a w PR00EU0߷@PS ZV 0SP00MR CR cR mR00000X5 $0` R( 0S P 000X% 0S" P  Ᏼ#000  0R  0R 0p y\0P P0@@@@, #8#\#####$ 0-@PLD 0SA Q0SP4 0#S \S0#S@sP@   # @|咼p0Q0 R 0S  #P 00@ 00  0=D$x$$ 0-@PLD 0SA Q0S姶P4 0#S \S0#S@P@  b # @Z|@p0Q0 R 0S  ѶP 00@ 00 = 0=$$% -@Q@0@L@ M@!Qp$`K 0^0\$0 QT 0 K0.00P:$0  -h LM0S T`p0PU 0 P` V$K -LM0S. 0p0`C 0PS1S x `F0S0S  08pGw 20 (K -L@`Tp# PU 0S 0S0S 0 PS 000 0= -` L0S `Lp0PU p@߲TP` V ' -0LpW- 00S)00S% S# S! ; 0`"@T h0S 0S 0R 0@S 00売i蠲 (  -(1LM0S`@ 10S 0/S BKAWVP` ! 0@0Q P00庵P  000p0 d0@LPP T 01,0 0 0@嶡000$K<%T% -L@L0S < @00P % -@@L0S 0ϴP =% -@@L0S 0㸴P =% -@@L0S 0㡴Pl (& -@@L0S 0㊴PU   \& -L M, P@`T 4 00 0 "qP 0S 0S0 S $㰴@P ,KP P `4 K  080 0 0@ᓱ(Ko (K=& -0L@pT` QP 0SW u@P@00 0` 00@=& -2LM0PS0 { ; 01pW@X ,  00,0 `P 0 S0 S R30`+ 0G0 0@S@,00I 0!`P< 0$00 P2 0@ 000 0 xP 00 P oP@00S0x@0SP +0 080( TQ(K&' -0L:P -1L@`Tp1 Q@@T WPPQP' ᜰJP  㗳@P JP JP @0 00@}{$P'|'' -x0L@`TPp X AT  P  P:0E0@ -1L@`T_ 10S] 10SY; 0hᛸ P @U, L0S 0S 0R 0@PS  ! 嫢0  S;00 S00000CS000PP 'JP t0+0 00 @L00040 00P(a (  ' -MLM1@Tw pP!@T; nK`F⼑`F0S!0 `J 0S0S b#|!  `P  T#H!^FꎢP @T a= 0R0S:41㊲`P% @ 0&JQ  P a=0l0 00`#\ #L <V (KG''(0(P( 0-@LPU 0Pld0d@` ø嬢P0P"08 0h0Gt(TL(( 0S P  PR00S0-SN S S  L0 00N L0 L 00N00N L 00L0B 0R00*0B00R*Pp@-^P`@L ^ ^ A0 00LA0A 00L 00LA 00AP @0@ 0P!00*0@00P*@ pp@- @0R\  0R: -5L~MP0C  Pt50SVPP P p-L`\ P0  @P@E"00pphN  Qp-LPY1S0S  D Ş`P  Q@2Tpp -L$M P 0'徵,78 `0`0gSxS  |( @PT< Y pǏWX<@PP; 0@0 0 d0@000C Sl;/0,K D,0P0` S"0"S0A0U@tsVUVU 0f,0 @=0r P 00000 0S S T<00xQC T4 P48<%徝 ,ڝP4@%峝 pWXW  P*0S YP@ V/ 08s808@  /00@8 0K0C0S dd8d$ 0<S 0KS LS  d  $0  da4  | a=0 Qa- 1@a=0a= 08 0H1p30SJ0BPt -830(1$30SB,Pl 2b 0@ 2@@4^3^$*1^t:C6^ :K0NSmSt"`0:0 =0TC 0 /SP2) p0C `` @t4^  2** R @ 40@44!0`0R2^x!`0 :0 t1 GTh1   p0` ;@Qa=`00@ Q b͊K^1    `"a=0PHp D ` <@0S@pb0 @P  0HK``(K+<+\++++ +pt$0,4(  Q0-LP0S  P 㷜P  C@$T0 00 -LMpP# 㪳3  `0C`0K0C0Sd@"0@ "0@  d2   l2 tt2  |Ia=0 BQa- 1@a=0a͊b 0[  08P 0F5^9 1^ 2^.K0NS*1  *px1 )p0C CTQa=0`b 0 @Q K^1    *0< <0/S 0 ) p0C  Pa=0`@ <0S@pb-0 @ T0   0/S  00C0( pt,0 -LP4P -LP0P -騠娀Lp P]P`WP  0hdd T000CSH 0pu@P++,,+\, --LP0M0 |0  t00S h@0S \0m P00D0D 4BW $ K48l, --LM(@ P  lK -0- LP0M0 0  0P0S @0S |0l p00d0d TVH U`8 $V xK048l, -D0L @R L@P  0 0  0-L@Pp;lPP \ ;X0P Zv<00S , K00,dH,_M 0P Q0A000  B@ Ѝ 0-P`L p 0}  0O?0@@c0@0S@ 0 @TpS 0@S 0S  O0 R 0 S -L j6b, -l1LM0l  y 0D8S  YhK0 0(0 0,00$(0480P@`p $,00< 0 Pp 4@`p߱PPp e @ 1Q0^l0  L00@ @l4@T '$(K8D-p-X -- -|0LM0 K p@PKD0@ @屰@K0 姰KX x!-0 CR 0R0 S<$00 0-LM@P0 !P2)), 0' K"KPhQUTPE@H00S< K0h( K0h#--.$.8.-@ -@L0 0Q 0 $0Q0 $ h@.l. -L@Q񟗤T\PXĢ$PX`hpxLWQ6ꬡġ̡ (08@YWUS0SO #SHFDB@><:864;0Q xxttlhdmJT!PhH0 $#$(,"(hY Q Q  0SEhC <8#"h,..../H/$/`/t//////0@0d0000000181T1d1t11112142t22222223 -3LM,MQ (K@ 30S  l"dj K(@T*T IK@3(@D8#0  K(@*K(HJK0#(@Db*0"*20S "*ݗP% `V"߹@P۹ 0C L2 0k 0("Ԯ KK(@(A*㴗 K*(@寗1 Ra 10S] 1K@1@P 0͇p` 0Ƈ6(J@P/1)K0 B0/0᳇9K00C/0>/0᥇/0>/0 ᙇ/ 0 >K0L/0㌇)K0 B0/>K 80 h K(@ *IJK(@D® (K@43T 83 T3` p3\ 33Y@3 HP8@3 -@LT  p3Qp36_`  -L$M@H <KL gIH001@0 0T 070  L\I @PH @e0SD@ &0 S6 0 S pO 0 K0,0,<4 ,!4$ !$4 <,,c<0K0S@ P< 8 4 0@ =9< 8 =40 <08 P @@$4 pWş` P`^`0S%0S0S*0#|5 9l R0 T,0 0 B0 00 0406  pL`H 04!48#8D+H '40S /0{/@P0= tZlD0dD C0RX5 ;T4p0 S A$@PR  PD` T#*0T@:D Q* Q:\30  0DP010UPL`LD l H\@`Q p1:Q2 Q(P@U@pA*A 0@$4,<4("4! PEU pGlWQ "0S3 g 0 @R !@0PRpCV 0U T8 uP 0l00@pc@'U` Pg^@*A 0@$4,<4("4L! pFPUh pG Wd=H!0S,  40@p(,0@PD Cpb@pG@p @@P^`0000S  .g00  (KX 4`  @B8HP@\ $@4`4h4|44 4P44444@554 5(5<5 -MLMR`p2pp ("(082800310 01堪!00010S 8K=G80@,̠<Ȍ8(2Ȍ18.̌$< ,K, (0 夫41@PJ 10  P8#8 A$#$ :`00 '/P00S` RLBJK$@D0@D0 `讫 H00PT   000$K   X  t @5T P5% -Lh@:c@ 0-L]PS0 R 00S* 00S0@  0t@P@}C\0t X00 c0BQ T T0 0 S@  "P0p  ` 4@@Bh(X @<5 -L@eM0   )0K4@ *@K\(]P  0pO<|0lDK 1   /D0@3S*|T88xĸĹй1 9D ;R 0}0 ;! 0@00090:PW00d 0.0@KP 彗P ,0 R0<ʟ@P 00UsP*:&oP  :IsPCP Y hJ 09sP00X: *K )P X,  1L9D R k 0x00000 ]00z0 0w00t9 )9D |9RG 0lˌ 09D )KR4 0$ 09D H R0|(H0Kp0<11 8D 8R 0|h(O6p\8 0hSHXg 0@ 0@J 08 Ww@a 00@P7`PP  0fOK00 T,Nh7@6 0ST   DF0S47 0080 媢P F x60! 0 Q:<60  6 60<2S<&000 FP ᅩ50000 0P]NPD'E0@ 5 40K;0 T5 40K0   50<2S\%;0000U B>BS3  % 4E 40K00@000 ' 0)[R00@ 0  0 00  0400T40 ! 40<2S@K(P #K K0 KPPtZ?30 3@ *0K@P030 X3@ )0K@Pp30 3 00KP}BP@KP#<0K@P 8Po< 80Rd#80KPPTa0;CS08XTb,CP$#0PoP 3QՀ"ۘ"`R0S@C 0 @p a0 pA0 02qbPPHpKPKL`KD0 @0`0 \@ 2 X0 P0    `K0/PT TK8 0;@P0S >:  P0  @ آP R ,0S: X t5 +X {Gz? 55,A5?5 6606D6!\64t66.At T 666 d  77\77777788X88x88hpD8n'8` O -<<0SL`p@V( = T 001`P,*X# L0S'0S 0 T$0/S \0S /S   0S /S  \ 0S* 0` 0S3\-& - @L R000#- -LM )AL0&`S B0 P!09 `0004 L0S, |1` t1&  Pp(0@S, , 嵦0 0!U A, 00C0S 0000V q0p    , 00 0S Z1014q0, p 000&|-- M-L >-=H-8 -JMLM0S 0, 00,0@ $0: S S@  S> SQ7JKII g 3,p&0BO?  D80 hSRQ Xp<  0R0 80 S p tB, 0R(K| BnK`F`F@0 040($P@b&1C1/o1p@Y XP Pq\&T 21COP  pǏ R380S00  BnK`F`F@00 $0PP) P 6 #1@p$Q  $  R  $41 ~ x;PGvlG@;dt`Pp ($0P`(w&=> >-8 -LT-,-@>9 p-L@M P`K|F0S 0S  OxT> -0L W?NK,wl> -6LM tf@P, 900T&&p" b0@S`$L$@$$$$$$$$$$$$$$$%&p5`@TU aP \딥0SE1p`0Sp`FV T @ 0S 05 Rp P 0SL0S P$0S 0S0DS ,0S E 0S 0S p4|D xT0t & 0S @4 P4  aQ$6S@  0&@R3 3 hbQ0S 83@T 1@T 됃0S &@T p @T X#00#LS000Sq,3倏$3}3z0SR 0S 2 Rz PH &K *P`"0S 4;"00028"000"000l2h2m `0>0P"Sn@00!0002  0b1  d1 RPe 1PIKAh2@000 00] |tl d\N TLzD8t0q1(a(?K P j (w-?8QL-8-&`?,?T-@-L@\--@@H&@@------"P-X-+`>hD->h@ ?.d-?,@@??? A@L?4?|@tC@A> -@L`pPXPU#!1S<000!0,!,0PU0,0 @W gP ,0PU0,0T!0>D!0 S00EYP7 @Q 001 R 0S R0S0 0S 0 0 S00ڄn x0 R l \p XPHH D-@-E -,xW XAL-tAAAGLA - LTM6S `R0,2$0T9(&Rژy,1 01`9(&R,6T ,,AA(BPB8BhBH&BAGL -LK0CD0C4 4 p< 㙔$01 $0Y44Kh$ W*(0* RWQUPt60CO fN^KPEPE u4I( K@(4(0 0d4 `D 0\4 XD V XpX `@0  ( ,0  Ti rk  m`ß  @$P  PpXBn, 0R(K"72V␒@(0,@ P|(~BnK`F`F@0 00Bv 6t( D0SkV(0EOo 0 5" @(0,@ R ` PkG(IcU rs   ~pE P 0!000p0C0@0 @$P0PX[{40$ P/  0:P ec P v 0  0p0CX0)I P||=x?(w-@C:\CP&X&&!0СP`(0K\ XP T` 0AS<X#"#"##!0QMt R PP R 0S0S00幅  0P @`R*$K&   0h 0@ 0 P0SR@0 R*AL4 Q-8!--H&9EEE -QLp `<P@@(T` XEE -LzMf0,0 KPHP00UQ     6Yf(pQ ,6& } P ,6 0&s &$&  K( 0R01K1Kl1Kf   0S*1  11( \* P00P0S 1  1pG1( \:6Q&00R 0 >.9! Q ! E 0!R!0P52 5:1  11^ʤğ0S ,6 1R 0l p +JKJH$ 0 k,6 1RK K P$0Sh# 0 V& PM0S{ 0# F2&P`1!0  1 +d3 0AS<&l&(((l& ?,1   1pG1[0S1 S,6!0  ,6!  iK ?P l2&1嶍001&姎P,B H4 iKP 1&ᓍ00&ᄎPA{ "o,6KQ01,&K p,6hAQ000E0S%\!)0 R !Q0 S  1C 0`S KP ᬃ᪃h, 0R(K! |@1! 0 w000SL_H:(w&-8-FC"PP R R4144!!0 00B S c.i P 00C %`fĉP0Fx3 @O&6F n  P尉 @06੉  Ᲊ?P00`C9P0S@ ( 80 000$ 0 K86\6H66i(\4\ -L M0p$0 00|t0$K @ $0PS` 840  0 . K86,\X\4\ -`L MPp@Kp P$jd1 @P  0S 0,0 $PK3\6\H6i \ -LMP, 0P ,`p0  R100 ӑxRP 0G`p@TR X ;dPPJY t H0 0D 0s 0D0 V Y P8 P4Y 00D ST00ӑW0A 200B SR0000ӑW0C00P\T00X0S c0PP0,0 @cT dI{@(K8\\\ -QL(M5K ! 5{00 0K  # eP D@0@ 50Kc00 (50K0P/K3\6H6i \ -QLM@ K { uPP= Kz&@K4 |c(0 p K]\6H6i] -|0L0@S h ? R00S L00  Xz,0T, @00 0 0 0<6L6@63 -\1LKMp@DK Qz0W@0 < /GcP RoK`F!(cAP /8c000@pD K$0KfmP  0$0 R  z0S 00S Q  R ("(04"40$ K̑,]-0 CR 0R0 S00 Q-L X6 p`@ -0CU3@% R 0S,,0SR00ӑR00Hӑy@ 4 R @0 S0S@ -@RLP 0S 0{ vTC 1@0S<p `(<D0C3@ R 0S,x ,30So|*@ l R @0 S0S400S(>hT>h<]D]@ p-LM*@KxPx` yh @嗾pP  y0 01Kቾp 1Kp3H6i L]i X] -L M K0, @>$0 x\p  0g06@K|P`x  `]yd @TpL  @rKKp0 K(d]$3H6i L]i X] -LM"@K 5yTT0 L@*p [Q"0[S "0[ S 堻K3H6i t]|] -LM0@KQ y! y  P a0 P - 0w`p@P0S l0  g 0S-|-;0lS v P1PU@KH/\6H6i]]]]]@]] -81LM@8Kq`P  xV@! V/2)P  0〟p@ 'PK 0\xP !400`Pie@P 0 x /bP s m$KP1^,] p-L M.@K `]xP0 @Rp'  `00SA[T0K  0SK X6T001K,0H *p4Kp3H6i L]$ ^(i X] -L M K@,0 $`\p  0 0@0P0S ph`P\0@Px`h@lP @`P,0@Pp@tP|` K@BD^@6X^t^p6|^t^|^ p-x0LP5 @@ T 10S T ph-rX(x0r< S`RV( 0@\ \\W d0S B0S 0B00S  5P "X00SL  8x07D ph p^@^^^^B^^^^h_ ->ML@M|10ld@K P4wL _ 8(pP 0S=:>[KD@K$PE@PE >kw w ,P 0` _ P 40S >KK$@D`@@DP߹z*0tS  XMP|@40HUZ<M$KT6`H6\6i _i|_@___ -LPp`@P0 Sw P 0S@ 0-@PL0 p0 0Ā_ -L`Ld00XTp@Pp 4 00 0  2 86_4 ` 0-@PL0 p0 r0U$` p-PPL@0S000p d00X LV<8@P`RPPPp686D`l``4 -@pL`@1P P@TZ p-L$M@`P x! <@K$ dPv` ^T P@ 4` P$Kp`H6\6i$Zi$Z -Lp`PP hd p0 @80 0P(@Pk`X`] -L@rD008 ,$0086a,AT 1S1S1S(Q$!000C S0:S Q $ _P`T 0S,+,Q,V@P T "R0S x@,0S,P,K 2S*0S' ,,0  ,0 е,0 ,0,Qh,L"Rd0S`2S |[`1P|!A t墵0l P01S H10S  k|0 10S  x\00S 00S `p@Y(K3H6\6i i8i4iiiii$8bDbLbXbi|lbBdbtb|bbbbbLb]bbabbbbcci @$cX6D6 -ML MPDDp4<5< 850%,5Q$' 5Q"5Q 50S 6 U 0S 0SS0mL@KAd( zrP Zx nPW P|,P<ukP   ( QPδ <0 <0R$ 30S  30St((`0 D30S8))$30S   u7吴Z20SP` pA00S UP{ `,0V pWP`gZh20S`B`R 4T0@$0$@SFNKP@D/LRKLQKq MZ1 ῶPYK4[S SoKL[ <PPlP,3ZK[1K[!Q``P?K@ P@OK@_KL[K <lP,Z0 S/KT$0@ wPQt0 lP0Q $K,\63T68c46c3c6c@dH66i(d$d$\8d6Dd_@642:42642242@.42*Z &10ST OK.n\ WK(1 p劳P201S: T7,"(2 4"02 / `@ PK0 UTP|K0 UTPfаͰ j$KH6LfT6\6"i ff%i ffIi fgg g,g8gDgPgdgQi tgggg5 0-LM 0 0 !8 a Pp8  P`!$0 Y,0pW @40Sڠ!0S`0 CR` #X0  @X0`!0ST`00CS`0<X0  X0000 S00 (K @ p0RX @0 R0 R ` 0BO? 尢l fY@P 0P 0@kX 00V$ 0@@0+D7@Dd7(7@7p -0L ,wq p-LQP@4 `@q 0  00 R?`0 CR` X0X0@Q 0S q l0  0X0 R?L@"Qpp0R0 S*@8<7D -pL@P`nP`  p00pT@P a@TVl0 P @ %HP@0㕓#PU`pW*p7PqDLt7 0-LM@P  K0K PP^p (00SС ͡K0p7lq -L MP@ `$K 0PP^p $.XpP 0 PP^p ,00S   Kp7lq @0P0 R0 RP > -L,bM00  Cr r r0T0 Cr P T1 @,K@NP3,PU 0 @  0 R% PUQ XPE <14101 R Q @00@S,(KJ00PY& FGP @ T0 RWP` \0@AP 0004' $"8ss0s` -p-M L M0` R P  0 R 0RKp  \mT ANK@D@D08  ^ $ (wDsq -LM0 0PT0<0@0D0RH0!K800 S80[T<`p0Q80<`@pA(K(K<` 0D81 PHL P0@ =9@HL =CP00 R0 w40S)`p<`@p[0Ϡ Al $!B30b ` 0<`@p@DTQ 0H` UX0 R0T0 `p<`@p`p<`@pqLs?Bs@BCps -Lp`PW PPJhV@PV h ]`  D`P/ `VPL z0Vd0PPPPPPP$0 ( (0S<0 0P000 P0000/ 0S0@ 0m0 CS0dh PX 4S0$8 +S)S >qtqsssXt -@PL 0S@R 80 D]0PdS J 0 txt -L,M`@VPp 0S0((H0  :pH 10@<S< p'0cP1@ QP'W0S7  0S '0S  )K :G )C\7P 0Sq PZPL 0L <0 0D 4KP0Sz&0TP@ P"P㸖4K_PU  `T0SH40KP Q ʶ  Rk 8&0S0<<&000SUx`44 6 +%00'%00#00 %00%00 H lP) P* :P, )Ps P5$5Pqn@@T 0$q0004 RT0SHV] P X0\Y 0SR`pPUoVz 4KQ R0KH 0S| 80@  S0S00$ 1H R; P R 00S \0S3 R(KP F-P000 P000040SV000PW0Q0QP ,0R  P  > RN$/L#b DKPEھ3[ L4KQPU`|"QkP0 S00k,0@ cW P0@=9 =0v"00040A Q> $0< 0bS$080$00/RR,0Z00R0S i L0x!/ P  10SU0@O[0PdS 尐0H0 0:P )PD 0p V X P @ J (t D  u܁qu >r^ K.080K@n0@ @U(w`==,rPwvw0wv=wtw w$xrw -L(M⼁A0@K$0 `q@0KP0d@0(P D0 `0@0 ) R ࠓ 0 .@0@@@ PP00 00 P0   DK+ BXP0 00 婢P`0P 02S 0TX 40$040 Q K00 R (w|=8rLx>px r -"L,M0P Sz 0Sd "P@PPP PPPP@tNP`\: TPqpDD"P0KpP_(@K`$)$ 0pPU0)% p,` P`@ : L0K0P < LP HP DP @P 8P 4P ppW t!10@Pp!0|1 0t1@0 `P `(K0QP,,!6p!0/p0Q0P~ #p70 V -0 p#p0 B H0\ x>!|==7`===Drxxxxzyy0 0 >=0S GS  -L$M,  (K  K0K,@K$ @(  WPK -L M@   (K K0K$ @(  @WPK 0-LMPKsPP@@T @P 0SP0P @ wWUR@8 -@@0LS  GS ,, i@0 hVWr8y -LPM☡0H@Kp⌁P `(0 HP DP @P  d;p@0@У 0R Kٿ 0 (wi r|ztr -LMhß@KpX 0,0 岀X<, 0R(KP`K 0PPUP1P NP4 0 PP~UP0 ` Y,`Y2S0S 00S!  K.0,`0TP"dY Ku5$0$"Wl,0"N 0@ 0 0PKX@ T@ W0KXKP@ L@ H@ D@ @@ .U X0K0@ @0P@ ) R ࠓ 0.@   @P0PPP  0 000 P0   K+ BT0 K~<K@#0 0 彞Pq <K@0\` c(0(  ;K1,r(wrzzz=r{>pxr -@L0S ; +0P%㽓P000 0  B 0 0NPll 貾rL0L 訾h$0(  >==sPG{z P P P4 000$ 000 000h_D?@?@00   0  l_( 0,48#8 $#$0("S ?p@-` VPU \ 0 0)R @ TpQ \ 0 0)R @0/S\ pp@-` VPU \ 0 0)R @ TpQ \ 0 0)R @0.S \ p@- 0 cR P0=)@ -  -L 0{ -LMq0.$0 P<P `e?V $ 0RO KHTgK 0 KS |!A q 0  0 Q 00ӑ0S@KX SgKA aKx 4PKsD@KX ,|P8K  <}P O(w8h|({ -LP`p gR@@04 @TV- 5Tp`WVH'0 S 0  Pp`Qp`%Qp`%Rp`|| p-LxM`\ |J d1  0DBs@ 0D< 0SPKLKHKDK@K  -AMLM@pT0, 8$ 0M*PU 0S  5;ZAU4 0S@G8?0aSF^40dU1^PE7WBnK`F`Fq @1  00! 0$'R 1P ;ZPEu@ WU 000 R0P, 0R(KT:?Q BnK`FBKX`F@ @04 P  :Z(w8h|8{ -LM$M"KŸ(HKH0@)K(J(PK0J "b,@ Q* :lr0h"Q* :L0H"Q *:0SBP `P7b.@P^. 01 113 02!0Q *i: *e:Q 1 R Q  㮡K0Q\E  Q, 0RB(K4!bQ,!]Q *?:.@P 01`p 01 @P02 01w0 00  @P*Q * :T(wd_||_x_T3t_p3Y@}_3|T\DL}D{ -L@-`(zT 0p3 0p3x_ p-`L VPU ^ 0 0 )R @ TpQ ^ 0 0 )R @0,S,^t B @~QP R T00S R @0   -$hp P:pP_H_l_T} -L XQp3_ -L M4 J1`   0l @40VG*0 48#8 p40QPf=0E S[*YU @,K *P, <( 4"4,<  ,0 @Up  0!48 #8(p`" "[04"4858#40S(KU 0KO3[ $#$("0U:"[Q04"48#710S`ӒВ|}l_}}} -L8M 0p1$ 庒`P.峒尒VPR@K .0]yP  P⟒U P`P┒U$ 0R  K4. (兒 (w}} ~(~~}L{ -LM P0a0m@%K,K0pK  0p`@t% %0[S S , V0( K02[d#!H4 K00C4 0 8#"9$K4~~t~P~ 0-LP \P @0)S 0 00 0S@0Q 0)S0#0CS$#############x$$\$8 0  z~~~ -4L$M Rßp3S00@@@@@@@@@M "娓0 0j0m)Kgp3Ƞ ,Ƞ("( ",D3!, ̠( Ƞ"(,Ƞ! 0^0 `a2 pt0 0````N8#8 $#$2p` 22@L0KL LP H 0 D@ @@ N/W00S@ RC02 (0b0P (K ۞ t00@@@@RN8#8 Ġ#Č HN p|1@<K4<@,̠<Č4("Č!4 <$̌0K 0 ,0 0(1 @t00@N8#8 Ġ#Č N p0t0 0@@M8#8 $#$pD0@ i0Rʉ_|_$?H?l_ ?_(__$?H_d_~-P_~p_ 0-LMP 0 R 0@ 0 @ P0@,0 (@ $P P ],K !K0H0 0j.80 .ԍ0  0@ 0 @ x_@L@@0` 'S0-LP@啐 0h(@0dS<Q<4+(+(+(+(+(+\+(+(+(+(+(+(+(+(+(+(++(+(+(+(+(+(+(+(+(+(+(+(+(+(+(+(+(+(+(+(+(+(+(+(+(+++(+(+(+(+(+++(+(+(+(+(+(++(+ ,0hIG001@U 0$ 0h4 0$ |0h)pl%0\0h肐T001 80h, X@.l.( T04 -CML Mw@0 @ 0 PR񟗋..D/d/.........................................................................................................................../////0 00$000.00,g 0RKQ񟗜11|1p1d1 048< ("#IQ{ Q >;Qt *t5 048< ("#<&4#, $  kNPK .0uP  .0uP  048#8 $#$("(RCX2L2@242(2Hڎ<؎ 048#8 $#$("(R2|2p2d21'y徎spmjgd嬎2  @ Q32硎8垎p囎l2  / 0`S fC -*Rb L华$<劎8凎0儎(偎 ~{xuroQ j3ʎd-SRNPK .0uP 1 Q|MV( ppMKH @D K`@D @@ 0Td P 07$. ):. $+NPK .0tP!(w\<Pd1.ĀԀ(@L\lh<1d/.lȁl_{T01x{؁X{ $ -2L4M  , P@A 0Sp Sԍ 0gԡ0S[`00CS`0cX0  X0TTڜ1PZpK""2! T`` h`00CS`09X0  X0@DT$PV @D <4("4! .0OtP ᓍV x ግ0S @DdT, 0R(K{. mX f dMT`͍XgPdX T8\l_(wȁ@D̔xpd{ -LGMMK@0C @"0C D :Pp$0S ̟0 M 00 )Pp宎,0 ̟ 0S  )d+0 R 0,00$- AN?P | ̟0Tt+00B0S ПX[T+0 00000000`@D`@ T @D0XD @0˟@ 0\$ SE>K0C0C 5  \ )* 5\ 劮pA M.K B B0% L* R44:0  4 4 ɟ: 5fPt0 ʟ$0R pspW@$R$ 4S P P0s 00) /0:   ,)00P@@X04 .PH 00) 30 ) B0bpP UFnK`Ft `FP@  09Pzp4 RPwPpōU@ȟ0) h$R ɟ0RFNK@DP((0PP7|x)0PPǟ@)$ 5\ @׭P[7)% 5@έPO#(@! @uH4to.ΈQ @y%@Tǟ0@r |g00 wlKIGK I0JPUW@T0S,0 p6@6x (K @FP KAPP(6P\Ɵ 04 H0K4 4KL 4 D Д cP %5 R `Ɵ0RP&p6 0 aBQ6 50SѫPU p5 %0:;:0%0<0%0:;705EKAA 8P6Pş0 R `4 R$Ph>%000`ş|5   W$080R$ $ NP,%EKAA P7ş0 R2 `4 R. 7$EKAAJ4`p0SN `4 RJ 3 Pោ0P@0E 0% 3Q&&U@t3Pڨ#000 DEKA A3@ R `4 R0 S ĝ4#0:;80SEKL L @0~d$l R4"F>K0C0C"tptHK.K B B@@@@@@2Q@ N"0 \7P0 D02  "090r!070L2 0*4 !080!050!0@00zaEKAL L0 P d$0Ri 0>Q0EK0AA `4 Ӑ@h ׭0S 0 R `4h$TQJ  (w_$??x_d_ -?_ ? <@? _4@P,??.A'X!\65p__X'5h_D?l_TDLx_? 7d$?$8|_H_P_'u0,P_6Є+4pDt5D6$ЅxȆxl܇@Ȉ|`(_81 *++ 0S @A0C2SFXUTDUTTT0UTTTTUTTTTTTUTTTTTTTTTTTTTTTDUTTT0UTTTTUTTTTTTU P "0P00巪@"060104 0S"0<0"0:0"0;0"0:0"0;0"0900S3 3 0 4.0@>@$ 4 %FnKT2`F`F@P)' 0pD PP2)( 0PP F30%ꠐP k 3P-4@( 3P!(0  8fꋬ0S Pƛꂬ0S pὛ4p3M>K0C0C 5 B$1 0`PAy?$4 Pd Y,$)+ 5\ vp4Jh$E>Kt 0Ch 00) 0p   0,0Q @@$ y;5P @p5F>K0C0C@)& pD :P ㄩIKK,6NLN L >X6 Rwu刨$0p4 E@P6| 4 &S00  4). P 0 Ps `) 0`P0s 0) `P TQ 0)3 ѩP p$rPF.K B BPzႏ   ޚۚ p$E.K B B % ) 5囩pTo\ }/t弚|幚 崚 尚 嬚LIF00ᚚ0喚<00ᐚ ㋚ 刚$0゚(0%8"@HPX`hgp x ^$Z)0 S Ŏˤ9ɠE>K@)0CX @4 0-8P8@L4 aA  0,wL - Lbh  -BMLMpP<J;8E04`00 ,0 6rP dP jP5`- aP* uP zP# tP#P, 0004 }kp 000C S0 L$p00S84@,0S 0KP lZ太pq 1 dR 0+S 3L4  L$ H@TPp00F S.VWppP`V@\W0P 0p `@P_ 0RR!>C 2#=S0V@@ PRaalaa8aa`a`a`@ Td0 T?#d00@0 TT!>C0 2#0@0TT!>C 2"0r03 R0S 00C0@0TT!>C 2"0r03R0S @0TT!>C 2#S0 0RR!>C 2#;S0$x1@PQ0GT1pW*@10S HKpLJ 1HPK`<K0S@<0 8@ 4p p( <K<@ 8P 40 P/f P %©HQ 0+SL HXä Y ` pjPP|՘MK@D0L$2(ᯂL+___H48LX$hȊ}ЊG-@ =c?0Π $0 c`BΌ!Pq \ 0@BAA1BS0㰀-\0`PE 0V>0@-b=D 00APPQ=-C0D 0 L0@R 0 -0L 5,,w -H0LM<0@K*00$>$0 DpZ _`_LW -L@0@ 0s0 000-P 0h迌h__$W  -L p-LM@ K``"p% @ 0P0PT@pL 7<0P0*{>Kp_LW_8`8n -L`M0P@p&62 F?%t5ş <0K5PK `lV dKR><`,şfpp5@Pg 0l h <ş80j|  5|@ Pl 0@P 0lK 0B` p@|P 0 t 00 0= P4g `p 0lK3 (4] 4Z 0@P( 3N 0@4Pl 0#@3Q ; 0zP x3 `3d Pp` @gG03@`Pf@ 0t p ŸLDjx 22x@ Pl+ 0"@P 0tK 0` p@xP  0  0 0 2 `p 0tK 1 1 0@P 1 0@HP 0qt!@p1Q  0P1*6= 20v0  u>l  0T* 0\ M#X XdT`  ͠\0Πx (K@_L\_l_%W Ah$W e_Vl?@{Gz?~@C0 S S  -`0@P@@T0 LV <00S 000S.99`0 -L[5@PD/d p-L@<P `'%p p-2 B 0L`@0PP 0S00L|2P $ -8L2@<0P/S @P,%P$2 B v30S ,,,, 1R_P @$P`F +V 0+S-S0SP*PM*P *_L10S I*PT1  @` PP_$P`T@D00S4PMP P100S 00St0Q. !')9s8P)PQ@p (|H$|( 000e 00@`L 0-L@PU0 0 "`e* -|@L0p0h `0\0L `0D00 `0,0 `00,te*ee|e -L@`0X _P0@ _<0( _(0 _0@xe*eepe, -L@$000P h, 0 0S00_X*lehe 0 _he*0 0_de*<00S 0 _e<* 0 _\e* 0 _Xe* -D0L0S (0@ThVh{,0 0k_Te*< 0 c_Pe* -h@L0S X00SL0L H0P_@00S40$ 0F_000e*<e - 0 @L0 02_<er p-0PSL`0S <0 S @Tp(00Sg,ꨊ 0-0L0S0 0^|00Sp0` \0^\00SDP@o,0 T@J$0 0e*<eԊ0 - 0 L_ h^`e* p-LM`[P& 0S0@ "P& @T Pi:@}0\ 9H 00P (@K 0" "'Kp̍4 -L@P h800Sh_e -L@P 0S0S00Sh_e 0-LP@P00S0hQ_0e -L `pP@P0000P0S00xL -ALMP@ # P PP P P P P P (P |Kplhd`\KP 00 0000d  -LM Kh~P![A[R0 @bP x0t8d P00TX0@POP l804%$ PP00Kht@<$pxp( -LMP3LE0PHKP @P@^P00 P00\-5@K 44444P4P4444444ŬPŨ40$4P 4 P4$0tP`4h$0\P@4P$0DP<$40,(P 0S$0030 K30S P 0S#0030 KP 0S#0030 K#P 0S  30 \C\S\3c pK LL0`444#43Pp   # 3Pp # 3 Ppze"0P00IPBYP 0S20 KNP2 PP0PS@  \|"  `  @Z800 0 P"bH2 K@-1 `P0`S@ 2  B\!  `  @7800 0 Q >1 @K1 P  `PPPp0P0ASP `100ST1  K,e84p|8x<\@XdDhP4H`ltLH`Le+\LeLeLeehe(PleجdeT`epete8XTxe|e\xeeee`de4elh<dpPe<43XeT\etTe8 -2L,M0P t2pPpLPK `2`bK0S HB00P2pR nP2 2P+ KP+ P1FP+ PA%P' KP<& P. 1P$ KP2P K P- P# K P' P X1P!              0 09[7[0@H 8@[0G  @0@ H ,0K1K+K.KX0,@L KY0 K<DH8 e+T@ -PRLp@Y*pq P U* ( P pU P@DTUt`l`@ P@ P@TZ<U  i p i%)x0؎0@-T0P?0" 0@0S0S0 R0e00P $00SCep@-@00Sp($$,F6PI`peP<0 5-=?0S> 06S000@,0 0@S200 e 0Pe 0- L0S( 4 @ 0   0 ,@0Q@ DLP 4 0T4+0@0h,0e  -0L p0q 0 -0LPU5 40 0@044D 0S%040P`0$44p Td$T(d,t$0@044D $ 0Qpqh;(e -0Lp`PP#:.0 4@0$($,T044Dt T$F P 404(0$00 4si e8 p-L@ 00s'0@D -4LpMP7 Q $$0R($0R,0Q00$:$($? 20€0 S 0S0,$R030 5: Z02Z00 L R 0s0s* 40S 4 3 R 4S-P3 3@ 40 400@000  T3   0 0 0 $4(D0@0 00 2$($6F`Ip\ 20S C. rs SʡR4S4S 4?  0Kp@PqD4'W20dt Ÿ q 00010*b%pl P'71 4D0O4D0P0030d4tp10S) 0S6+K X&NL10S@1wK☶P(0 S 0S1 0S 0 +00 00S$00 S 0 0 0  0 0  02 0 ,0PG*0(Ke܊@ D D 0-0LPU ,4S0C$(QP40@aP $4(D 0@$4(D0,40h0e -l@L0Swp D0,$R0,4$4(D 0@$4(D0,4e -1LpPW`` 10S CVYqr V0U00I0O,?   69F$4S4S  P4S* 4S&p" 0ꀀp 4S4S:AX0Q$(0<0@00,00eD -LP l0 P 0R 0R Q0$4(D0,4e 0-PL@T 4 m 04P X00S Cpq 0hH0 0@ p0eDp$ 0 010#8Q0S4:Ss0p 0 00 8 p-L 000 x 0Pd `?P @ r 0 04 (0$ n2 8h e$(00 , (0$0 0 0 gegggg0 0 0 ggge -LMp@P `@_00C0 S%"0 .S0K0 $ K Ke p-RL@Py0` p2TUp -LM`p$ @PL0 `pe -L|@||PM$pK(`K  ](0S0C(0 0$ 0b0 0R 0 000 Kgggge -LMP@p`$2   e0` p-L@LMPK@%2`@@00S xe -LMP@܀,pK(`K, 0(  R,00# (000 0S( ,0S(00#D@(`K,PK 0S#@0 S$Kggp -H0L0S00@@Y$ 0@00eggg -P1LMH!0SK$@K0$p,`K0PK),0S(0S 0 ,00R$ 0 ܠ p@4`K8PK4  80@00l?T 40S4 h0 c\0@d0 ]H,0 ( c,0 0 h00S C$Kgegggp 0-P0@LT0 0S0 <@/800 0P0s300geg -0L M 0 PK Ѐp %@(`K(0@00l?T $00S, (0S ,0$0 ,PK(@K$ 0S$ (0 c,0@0  Kgepgg p-LM@ 0S0 K K 0P 0 0 R0AR00S t 0 d@0000"`K PK 0S ʋ"000 0SKpggp - 0L00S Lg p-PL`@00 Rpl00 AP@*D0P0A0Q: gpeg p-2b0@S2LTP00P P} P PS PMP $ Po  P> J1PD eP PyN{yJB00S SAA00 S nrQA0S0S S gQA0S\0S SXx1@@`1pDA00SG?/=-p1 1R0R S P@0S00S S ,P@0S%0S S!, 00 S@ #h@00 S 00 SS 00pPphpHgggeg -LMP/|||p`,K  ,P }@TP!,0PT@:0S0 0 0 0SHgg0PPg -0LMK0 ! K0 -LF#P x0pq  T0 hH00S <@ N*.0S.0SPK !>P 5 P H>g P p>0S H P 9D>X P 8^0S= @T3$@%P\T 0S::PP>0S 0Sh->(0P 5A;}>`-0SD0eSKpd](4-@TD0eSe @D 0S Sf Sc S S/S 7S[ S00G.W S}dPx @,0S P0!W@  +W W R0R00@0#0<0WT <0WP <0WKF+Po@ @K0@0SP +aGQ0+tx;/$P%W} W W W !Ws W*W @W07S,g 07S+b07S ]*Z W W LP 0#0CS<P9&0S <P P )0K*pK*K 0K0 @0PuT 0DcSس$ܵxT\ h`t̶4h$HX(t $tL  0ȷԷ$H@\\  \\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\ 0IRQ|80S0SL80S8t  2RQ80S0Sf +0S0S0@W70S 0S0S@7@  B 0S0S0@9 , 0S0S0@)60S'0S!#0S 0S0S0@0S0SnP60S6 $6  5@T 0S5 %0D020D0 50S 5RQ45t50S85 5{RQ44~ %# k0S0S0@!0S0@40S0dSd0@h4\4p EQP < :{0S0@(4 ; /,m!8 8KT%f{"00S0S00S00 0S0@# a0S 0R<00S0@52P0  0S2P0   ,Sl2 0S0@02P&0S0S0@JP iP P !r 0S0S210S0S0@P 0S0S1x18K80 b0S0S0@Pdzw0@ P P k{ h00 1! j X0H0p0PN 00PJ 00 PPE PC -A<gggDg0Th ggďL   h<08TD@܏DplP hg0L X0p0P h00P t00 PP P : 0GRQ000S00գ?0O0 R0S0,! 0c0RQ\1h10Sp10գ?0O0 001 0S  0 `p10S !1 !0SY,00"000SH -LMS0P`pA)p (K0`!00 40 0@80 < K0 40P00S T AQ:0 6 R0S 08 R PP,00,0  ,0 P ,0S:<0S r 000 R00 ӑX 0e!0S 0f0@,Y: T00"! 0T S@D0Z00e0X,0 e0f1(K8 -L@0 !0S@-P@p`E5 p-0SS%0P gP' 00dP ^S0gS 0S 0S  0S  \:QfPd 0` 0\ -0LM0@P3 00P/ 00P`+ P=pK,KUF@@ PP`  0@Sd`0dV0S0E@U@DPE,P `(KTD@ 0-LM@PK ^P8'P  0S NP 88 -LM@R,  r P @- R P`Pp 'Pڤ`0 C @R`0P R0  0S0@  0R@S  TP1:, 00p - LPh\t - LPh` -L hd$ -LOph+ 0-L MP0S& @Ki 0s0s flP@T T0XP0 -000 0@$0 0 K0 hPN -@LPF  -L|MB0PP 0S U N0,K0 K00 `P@@00SpJ@P82p0,0 A P8  8Km8X 0 {E Z g kP, 8 8K10SP ,"P T8K8` yPYP ,;tpZ(1 w10 @1 P0 , KŨP 0K 0 0P@ nPF0 0R0 @yy0Ul00S(8K8` T(K h,( 0-LP@6@P \P0h#0 -`LP`pW!&`V@ZP PT 0 D 0  0   0  0   p-L@P`P U  P V  P php -L@~h P-L 0h  -00LP S h$ -L@% 0r/S@ R -LlM|K@P8K 08K -L0P -LAMPP2  0pq) NK,hPKp@%`@ 0S PP  z 0S*# P cP` 0S:VK -HHaLp@P#R %RT0TS 0S %R #RP IY%PP@ Rg묐0ਠ`P@#R %RU0US 0S %R #R P ! d ,%@ P R   0-D@L0PS0P(000 P04$4 -L M`?, %@pP@0S 0S P W @P RX Y"$@XP@ d \00T @k$ P  d,! @000S0(KPQP -LM@pP 0S `PKh蕫$@$@@L0H P`/$[ ~@UKd$X -(1LMP, UAR*LpP; p$@m$@,j$~@`PZ0%S00sSZ,    N$ ,J$P@00@B$T:@T o(d -2LM0S4 8 2@TtPP 0|S0P0@ 00 0-SP < P  $@ $ @p`Y0%S 00sS  w #@`00@#T:+PUV 00S h10S@ @)K P ၪB)[280P40@p9d0p@d0S 00CS00`Ӥ0` V g0H v R @ a#p@`00@0Sp(K(p@ -L@{# 0 pS` R0S000S_#`PU P@000S 00PQ 0-LlMKPSP@0: S@@K0 p-LlM0`0SP %#@9 Px  K(PPl00S0: S #*@ PY , } PKp$<00S,0P 00S00C8Ԋ<'00Snꨊ 0S00\꜊ -Lp@P`WV 000CW`K@tPuZ 9X`yoQpWZVX (00S@ mU < -LMp`p@P qV i 0 0-t0L0Spq p@Pq0T0U0000脊 -LP  00SR -L@pP`\T p200CW `20SWD200CW @w$200CW uUV iUVP@ x1P @1@T@ ZZP`!hpP`qX9p4q2P P AP!<T 0 0S0uv 0 0S 0S0x  Up 00pWZYT+00 oZ 00Su<؊Ԋ<| -LMp`gP P @;P9  Kihp@P(q&V 0A8P 00S BP@P 0p@Pq Kif 0 K<0PP@0PP@< P000S SP000S0@0hP0000000   -0L`Pp@f P `VV'(` W  00P`p0@ 0 @ `000pW 000@h 0-@PL tP 0T T00 00C0 R( 00C0`0h]0 @h p-L@Pq P`pvp P P@P40`0pi@Pp P P00  -LMpXtWr`#0S PHC0S <#0 QPW 0@PNP B0S "!@ T T "06 P P p/ `B0* P 000 ,0 pu0 , 0KP0K0PK` p@ !0040  6` P P=ڄA0S9x!0S5@D 00< 80  @P(!0S!0S4@ 1@M P ` 0P`@DTʵ0@0Y@XW40K@Pp6T00S  000K@P*(KĊlD -LMpwx 0S P#0S t3tC 00S@_ 0hP0p , @P0p P70 K  00 ,0 80K0KI0@K00  i @0P`Pڲɯ`V* @T PXW5p@q P P`pR0gt T"@lTP`80S4!P00PUo-[  ) TPPx1@Tl0ST!0; Pp@@?41P`@ 8 P?P`@0K@PpA00S 000K@P*00SZ 0 P` D@ P P pY(Ko(KĊlD -L MP`~, )P,0@cT D dqt@P X(Kopw0x0XW0@,@p(Xy z  V0 U00 1 ,0@c 01pP`q @,0T (1(,0@d@ 0@7pP`q XW 000S (Ko@00CTy h00SeD0@@\$0 0@@(K茑<Ԋ p-L`@PP } P p @P$00S ph -L`ppq|Ap@PqTh 0:UT0 h갑̑ -L MKWK  K p-LP phP`pqP0  Bph4@  B@PQ php< -LM`pp@Pq AP |00Sh0 W V @P,0 $K!nK(P\0 0TSP0 H0 D0 @0 <0 80 40 00 00Ċ(hhhh h$h,h000 @00d00S X00S P~0 @P 00 000000$hȊ0 0 $hh -p堀0L@PP `PP  `] `XP`@l Q-L?P=0@P60 `Cp) PP 0p V@P  @P@P 0`d0`FP@PZ<0000Y$000C0f0@PlD p-Lpq0 6PP-p@) 崠`t T 0 }@P00CV]P r@P@P0@`@40W 00 X`@PlD -L0<0  000 $00 00 `4tP -L0<0  000 $00 00 lHLh Pp-LP@1 00S PP@&` Rڔ@00SP 00S@@P @0 R 4000SP@pHh P-L0P8h P-L@ P0P @ T 0S0S: p\ 000  P`0 Rh0P0 RQ0@^0 00 @h`hd Q-LP`pr1P PU 0 S0S:Q R`\ x1U 0Q 00X@R%Q#@yPE(`@0 /0`p9pq7  0@P Y0$X!VP"`@0 0`ppq 0@P U0T 0/`p@hD$$0S0  00mЊ 0-T@L0S0dS0 PP(000P>000hl -2L0`Sp pq WVP2 X 0S0S:0S 0S{ 1X1 0 0Q 0 @0S@T6S4P[1刡@0n0@P3pqI  0 W0V  0U5T30@. P'0帠@00@P Jpq R 0 U0T 0 Z Њ@hlhD -L@P`p@Pt 0u 0 X00S L0XR@P*TU0@<0 50Sခ, -50 S  R䀁a0@ S-00LA0@S0Gp{ 0-L MPP @K0 000K0  'Pp-L7 $P'.P ^P"L1L!@00 0%bP 1 !1L0 0 0  P- 0s0sph0^ ND3s H3s 0@D3HCP0 d00@#L3800 `P0 -P php p<tԒ -L M@KC0s0s ?00@3K老  -,0L R000 <@B -,0L R00v0p@B0P 00<P Ps 0  -PL M P P"P00  R 0ShX0RH0  80< (0K0 K0K0 0K0K0 @ KQP -PLM@) T TV\Q@p ` "00C0 S10R!@¤0,STT901 0b 00@0PK  0Sp` T1` *@0|T @KaT @K{,0`04 0$K$@ Kp(P1]4@ -@PL ThL0 D6@4<2804.0,,*h@PXē0P, P P0̊ 0-PLM@& P P*0mS MS hS =S sS wS pP hPdP`P\PXPTP@.808 0K10 dK08<@ P-L (0 00Sh" -PL M0 " P P>00K.S K 000 0S0-0S $0 0 00S00K,@Kp E@P0t @0S  K0 4 CK,0K0 Kdh -PL M0 " P P>00K.S K 000 0S0+-0S $0 0 00S00K,@Kp R@P0t @0S  K0 4 CK,0K0 K 4Q PPP0SP 0  0P$0$0S0S -LMK i K\ -Q0LM00SK0 X Kx -Lp@P000C0 S @ h,,@0`0 C0 ST @DT  0@TU0 `0 p-L`P@0-S000C0 S ph!!00 C0 ST00^ap -LM 0R0*, ,"0* 蔕Є -0Lhd -LPPM0 pb @`V0@ , `,KWV0  , <,KM 0S SV000S`B V? i 8 fV V V 0 1 0 0s03 V V V&@  00 0FSPV V V 0K$ KO$0S0f90S V0V 0 @00SSS 0010,K0,0 AV 0 \0   000CSP K訕ԕ -`LPpP`$T X P$T T T-T00@f  00P@T -L@0 @ -PLM8 B Rp,K4K 00S S 0 8K@h2 @9P8@ 0Pz`#80 %5*$P  P P+P -PnP! `$0+SX080 p!000 l, 8 0+S0,0 G1[X!0Sn`z`@YPPT 4@ q,p 000CS9#4######h#X@ 00s03X@ 00$aFQ 800S8 80 S  08 800SL0P8K @0S,80Pi(KD< S 0 Q $ 0S C  -LxP 0S0  @刐匠匀pP`0S dR`P PP pP R000 $@$ TRt< -p@!`PLPQ  0 0 -LM d 0 K p-LMP`d@ 002 0@?Kp'@B -LMpxa`@@@/0 P`̑ -LMKx K -锠PLp` ῵0@SP0000STdx0S^x0#S 脊x -L P P Pp h -0LMo@p@`!0K!PK   000e @PV-00e  K -QLM@Pp@tPp0%0K%`K 0d00 fD0@PW-00f $K -QLM@Pp@tPp0%0K%`K 0:00 f0@PW-00f $K -\0\0L@S L0 P$^P p> 0 0 謑 0-L L0PS000@00 R+0 P00 0,0 -L@0@S -LMpP`5K+%P0 p`$ pnR sR dR @`0@SP    06 `P K 0-0L0PS@ t00S P0@0S @00S i$00S0 Z0p 0-L@P\D 0 0|, p-0L0 S P` 00S 00S 60@@ct0P0S h00S ph1XJP0 @@@400T,0 ph(hPp -0LM0  l0 `0Pp `K  0T0LPa@PJD4p3 -LMP @`  \Q  0R QW@X@T11: \ 40KzGp3Q 4 ,0 0 0 00S0!P$K -@LPne00 -0LM0@SpP  q 0Pn@ @d`P z4@P  0{0@P4 p 0q-  + Q 0%P#Op@q 0Q 0r S 000 KP nP808 PHZ0P:jԉ  Њ,<LL(0$0 0b0c0AVphP -p0p 0LS@ 0@s@3H0H0@0<0 80b0cA6$0 8phP,0&광 -XLBP@L>D;<8804400,0(0|8ċh@-p^ 001`0S10tu 0S 0Sqr, R*Q'00S  0S qr 0S0S:\^00H00S 0S000s3Ċ ԑ؉ 0-L@PF<0  0S0S0 R0 -0L  0SWp3 -L  h-  0R 0RQ^  QP 0 0S  SR 0 0 0R 0R 00 0- LP@ R  0@ 0܉ԑ -@LP00h.$00S0 0   -@Q 1LMPp@  PP0T0  `Kp@&P@ p 000  0S : L0R  @00S 00 0 0 8 0-@LPT 0S$  0 0 -LM` 0 , R\4 ԠP 0R0pK0 0f 0O 00f0pK0O 0@ @T U @  0d 4PP(Kԑ -L@MP`X T0 c@P <` @p < P`00X r T0s  T@0TX\00 Q R` 0@0C 0 , K00K p 0@, K00K p 0@P`wx R@0K0S @ 0bS0c S  0>PB0SH 2Q H l20SHH  S H  H QH ,B00SHH Hi@L H@D ,LD 00K@aP  AP 8K00L 4@K @sP ` p\XPB H008KL 4@K@ WP3 PQ 4H@8D00L  @"AQʸ00S C4H@800DL  @LDQP 0 `LD@@(KDЊ  -L4MP43@(3$H D @ < PP Z 08 40 `8 4 8 4 V8K0`2pq tu Q P`2YXtu 42 0@_` pH D *tu UT@P1 0@_ QP1 0 QP`p` p`VpH` Dp t u  80s04q 00 4 U80T8@K0t u U0T00" 0 0K 0 )Ph0qr ,0S00S0K@ < 0HK@K 0(K܉l -LLMvwJ 010 @0R0 , (Ko00S )p@Pq , R00Sp q Q0P 00 }8 00CXZ (Ko(K8 < -0L0@SPTpW"0000S `{pI@tPq AcB`00CV0p蜊؉8< 0-LM K @K0tu  0K0 -0QLMp 0S#BP 0y:*R B0S 0S"0S002 d P\B0S vH2 V0S YP `@P1p@Pq@P$10S S  1 ````KV@P 0@PLa0Z @Pt u Z J@Ptu t,@ (P u(y$,K  0pP h00S00X0S  D0,K r $0P$Kԟ؉< -L 0 0S0 h؉ -<L<P(h+ 00s030hԟ؉ 0       000D 000D 000D -LM0 $ KK0 0 i,P$ K -@PL \TL hHT`TxT -1LX@ @@ 6 \,~0  @`Pp0S0S 0` 0?0080  W000S iD`Tp<  -LMLp`KP p@P0[SPKT[H - LG P00,H -0L 啧㌳,w -LMP@ᠹP 0S 0S1 S K R3 xP 0B?S►P (KjP (0Sp`$K $0(RpQ WP` uWQP00 -L 0KM#+* -LK0[S pW` lQ@` @`T 0THP2$!1Cp`W9  0 LK %5P P P@00 PP000S P@ %0&P ILL@0, 0CQ0(K8>0>(咨 (w\<Lp 0-RLM@P ~8VP  080  !T#P TP @(0K 4R S 0C4B,[\ *\ 0@(KP4USx#000ӑb0CSvhvttt@vtttvtutttttu `@ -\+\T$T 0  eBK0A0A h@PeV 0`p+Xr -X "YY P 0PP 0PI 0PB04 Rv @ 0L=y04E,[s0`@4 H04E,[`m@ H \8d H`04E,[k@ H~04E,[g`@ 04E,[Ddc@ 04E,[LP`Da: @2@ Tp  -@LMh LToo`p20p0`W` KU -LM @`, p%` poO&>@P2Ό P, 0U@(K -GMLM䐟0,0 qoK 0P@Et K@PLL 00npK`2@PΌ  0`0Vp, 0R(K忣(w -P<&> Y0L\"]280` R0<2<… 0S30@20D2 叏00CL2 0 0CH20P20Tr( $@S 0X2g0`TX2i=ST0S0@2U D _R 0S2! 0 Ḥd0S0?S4 0S 0S0?S0S -!0LS PU  0 0       0@P@c@@cPE@@PcPPcP@ -`!LQp 0 P 0CA2$,0 %@$U00e0PDq00e0P004 -LHMpD W@ !!8 2@  `0 @Pp1C4p 0V< 8 `*`p,0 <040(@00@P 0z@<P 0`, D 800$8(K 88(Ko8$X M-Lx0\@ P7P3!0SS`p P4 00 ,?0"10  !00  0,?0"100P0fY(Kx0 P0\0 0     !0   Pr8` -L @ p ?  0 1<00 `! 0! 0 ?  0 1<0PP0 P`| o -L M58`Hp  p7`W` 2QPY.EEwOE B1 @@P@7^WP, pMh`W` K 0-LM <\PP | p0R dK8p P!|@P D0D 05{ \8d4 -LM040K00  ,K0 @娃,P\`  S7(K0pP 0 咃,Q 0 >7x "10 0 d17 @T1"0 0 0@1!T$7H( -LQ @  7 Qp -@L  &> Z7U| -L4M0t(K(0 ጅ(0`S $pK0 p($@\P  6 K170( p$0`Sp ( 6P# 2pL`K2A@ @N P0LK000 6 -LԤ -L!M(1`"( S92RS]2S\@&ZAP KP Z6/0p gA 00`( 0R $Kg]@0ҋQAa]@4(w,@\$ 0-PL@V$60p -L MP$K@p`0 Z$0S  6 K"100!aRRl@0S`VXV6L5D5@_ ?05t| -L M`(K@0 (PpU  `5$K A2@ @ 1P p-`L|yP @ ;`P 4 8$0 $04 @4 4 '4 $ 4!00 4 $0@P lP0PP DgH<4 ,4@0`pSp@0 @HLD 4@{pP3H 0c40l@8T473P)`p岘@P 0 S 00K9PX#0S0#3  PP   “Η PU<0@S@X00SX00LS  %H20S\"0000SD"0000S 10S`\B\TRD2p` (",0QP "0B1 CFP !<H!GAnp`0Wp10S~<X 10S00S1  XSp3 0P @P PDPHx@U1 P 00S0SI,w p+|, x<4ܓԑ đ0ȑ̑d@Б(8ؑ 00 0ᬑ0P$ 00C0 R0 ᬑ" -LP -LP@P-  p-PL0` 00 0@ 0T0000D S0`8``0 0 0S0ڬphp謑-0 CR 0R0 SGa00 -h1L0`SPp@D @<10S T (10S  a+0@00S T 00S`0@T 00Sp``Wc80 T.400S h  h` @P1 -LP  0s -LP $ -LKP 8n -L 30S:S0S6R) 20SQ b 0R20SR 9/p2 2R T"&p2HR 0R08 KPK:r D2b PKR8 K-i00C020S 0S0`KH Z\ 0S00R0S QPK000`` ``` `P 0S!0S D10S`10S h10S`@{. X`x.`0upJ 90@?S?( @@"tp4r00S5BK0H@HQgPs 0D0 5 05 5U `#P*% 0HYF Q>K 0C8PZ-RP -P PI #R0%dsA404 oL1 i404 eB.K 1 B B]1 W404 S05 0 L404 HIKAAjp U44 V44 Y40D;0D;4 d0%H,A0!8Ό ,ʌ(wȞТ+l -LM@pP4 +yPP 0S nS6 =`P00QD @ Q? |P 0V0S D 0 YppV 0`pY" 0 0 p 0oSPiQ00 ,Kᣓ, ?R0S@p @ `@0 p00MQ0"S 0(@$P 0 0@]Ș -LM`PwP( @(K,pK 0 g(0@S l$K p-0LS`p@ P P0P@T@T  6PP0  r 3R p00 R P TX 0-LM@PP 0S TU80K +p봝PG -PL`p@0   0@ -4LM@4T, 8 <( @  @T  P@C BK3APAD  0`D#D80x3P| T  YゎKH p HPdp4  $w@P 0GUE0S -SF 2 1APw@Pp!8R00  @2P"< D8)W@@)T Y(p@( P" Y om@P1 @@, 0R@(K2p`A=P0P0P0, "000s20K )p `B0 0cX2P R^ :Py 00@Td@Ta  P  C1 Ήŕ!00070SQQQ4 F 0SC nS 1 4@K t!,huPPHP 01{D10AD0 @@ <0 8@ 0oS1 4@K 4 r0PoH0S @H`K0 0 (K P=E=|= p=DXPTL+l,wL]\PGЛt00 ἗0἗0ᰗ -L~tP 0G Q-L@ P T@@G P-L ;P PG 0-/LP@P 00+8/00,+ +00P`G p-LlM/Pᢔ@P KLfP0: S Kp0`rS@*  P0-L@P0 R 0 R 0h&0h#}#t0 R0h0lX& VH0 R <0<M&808I&㖔0C&괗dG,,wpG --LM0 0 } --LM0 0 K --LM0 0 K -L@6M h! -LQMH0@K0ePP`pK<eP0: S V@@ S00S F`PeP$K]qP T P`0 R000 ZK@eP h1: S 8%((&%갗"GGG --LM0 0 { -LM @Tp`P0S ; 0P P 000ė -L,MD H &L0 0@  0 40 oP @q@Pl HP U@ `0YX 4\{ V 4 R08  C@Vp<@ 0S00C S000C S BV0VPpU @ P0S PUWP80 0 %0 00 ğP0P00 @TT@TQ %PHp@PX! 4  Y4 @0T l`VR h$ @T P$@T zU`V$`>SVXg 0 0(K4 $k 00 U  0L P0 I @8 <00  0@@30f0cß`D0S D0XX @T` LP@ 0 ,K pq Ÿ@TM@TJ 0P,@,4pp PB ^^I R0000 0W G 0020 0  0PP2  A R00C0VV X0Q1 `V` 0S 0SLP 0 YtG 0`$, ^^  0(4Pgp~0\/ @T3 0Q  0N P 0A@TRf LEPa 0 ||G0 F/n0 h`<lėL 0hL@` -L@/P م ` -PL` @Pp 0eS P  0:W + P#%+@ pPt  00  cP H 9 8 pP, el p-L@lP`~Pdp@w %p$ $00 ip|$ -MLM pPNK@D`+H 唇p 8G  0pia.).$K< P-L   ]0 XOG,wL - M DLM`pP % $% % (nP& cP# VPeP  mPqP pP sP xP  UP 0 5  $% D#lp830V %0y03R0S P LK@D@D" 5 P1:9U 5$%RS 5 S  *K&Gp|  1: Sd  `KWV< 8P@  ؆p c @P`U r-ZK* $0%KR  J0P50 `V p5  J 5Z K0K :PL@@@PPtq K  @ - @)Z0K 0K0 p@x %R  eP  /p %&`@`T -5ii(K+<(Xx@-@|0  " 0|0  "4\ 0 ^|-0,0C/1Q0#0C/00CS00 c0 0c|0x0\0nx0A0 0b0 01 R|00|0 0-LM@K P 10 RK0 p-LMPK`FOK  { 0RQKp -b 00"00#0\ -LM@K TK00 !0 S0 0S-0 00\N-0|v?M0|0 1?01 R  00b0QЍ.A-0MP`  0S3 0 ##\0 ^+ @0!" |\|0|0@|0  " 0|0  "4\ 0 ^  pAЍ -LM⤀KR^KPEJNK@DpIoK iK K oK |`@@ TOK/Kf@``V/KQ`@@ TOK/K;}@y@u2TBNK@D/K%jg@`b`^dVB.K BTQ`M`I2V/K@=:74 i/K$K -LM`KJNK@D# I_KiK  oK P@@TOK/K@@ TOK/K@PPU/KP@@ TOK/K@@2TBNK@D/Ku@PPdUB.K BePP2U/KW  M$K -LM@K V0| 0C00CTK -LM K0 0 R0 0S K K0@- MtP @0 0 c / QB @ 00#00# Q0 Ѝ0 -0L!M`PK  0BS0KK 0SK 0S| 1##@0!\!P?1!K#$1! "41 00 R5 T 1##@0P ^+JKK0 #$ PKKK0 0`0b/40Q$K8协Kp@ KKKnK@\ -LM CK01 R 0 0SCKy K 01 R -LM CK01 @R c K 00 @R0 0S@  10 R 0 S R 1 BS R ! 1LR*|-0 00\ "4\ 0 @-@  00b0n  #4\ -0LMP@K  0 S  1##\0 ^>K0 #$ 0K\ K~K` p-LM@KP`d Kp@-P`pP@0000100 "#  010 " 00000#200 #  000 " 0#1000 200\x0@0P0x010P0x "# R |0100#R0|0340P0|0#20P00000 <- 0@0#1C0T\T00T00@-@P0000 "  010 " 0#100 #  000 "  ""  020 " 0000 "#  010 " 0100\x0000x " 1 |0100#10|0#10000000 <. 00#2C02\200200@-@ 0 010 0"!#1 010 0""#2 010 0"##3 01|\0| |0 01|0| |0"!#1 01}0| |0""#2 01~0@-@ 000  |\#|0| 00|0@-@0 <0b0  |\#|0| 0b0|0-   00|Q"Ġ|0 00|0|  00|\"000G-Pp`& !0\.@0 .Q@ TPG@ G-@pP`&! 1B$0l\:  !0LJ$ ^: 01 @ 0 0:#P`@G0@-P 0@C0  # 0"00 "  \0 -ML M HK00 R)0[H [0 @0;KH K)0K A 01 R;K KA00 R02 0/K0S0H4 =K0C/KSY0HK 01 S20>  KK-K?K@A BMK@D% KK @A#mK`FK A)}KMK@DpGK A'KHK A+K- K%KJ@A1]KBPE >/MK @D%-K B 3mK5 K `F@ K%rOK-KA  RK04ş,"00|Q"$L1,"0  RK  0 0|P"0-MK@D0 K]K0 PE+-K B K K@rK!MK@D5KA;mK`F K@K  KI 0@K yXK H00 Q9}K`KpG_KROK rK oK !MK@D p`@@ TMK@D!-K BX}z@v@rT-K BChe@a@] TMK@D!-K B,QN@J@F2TMK@D-K B:7@3@/dT-K B%"@``2V-K B  9MK@D;mKr/K`F7 K @@ 10 R7 K@p rL=K!00"0 0#P1 1@0 R(KA` M-VMLM@00 Yp @h?XfKPa 00 P 0 Q 0 @ @P 0 0Q R@K 0B_KQboK` @ K 0@KH@K`KA 3P ?  ?  ?00RP` 0@Q5 R 0@Q(K -LMpK@JK‐joKP 늏K J= C HP C 3  ;  7(K -LMp`ᨠKPOK  တ&  "JK  =   j_K 0-OK+t ',#  2  2 2 (K -}P`L@    h 0-L@P ,0h -LMM KK(@2 " P" K(@ K(@}K! K(pG(@OKzK,(J p-L M A`*Q4|<0 0R000KpW*@K0P `0@S 00  Q 0S00000AP0K _@PP 0L@  ;0 $* *넜,ܛh0 -LP  0R S S0RS  P0 pZ -L Mq0PQ` 0 4 l冹P 0RKKD!0@004K0 _4^:0`\0 0 Q0 B0lP0   0S  0S 0S0S0SlP 00 S 0C$0 00 ,0 (0 (K P,P( } 0)(wX0 -L\MpEp0S, p`( P5G @ Q.!!t!!t!t!t!t!t!t!t!t!t!t!t!!t!t!t!t!t!t!t!t!t!t!t!t!t!t!t!":P$$0000t6)p`4  XӸPPW W , 0R(K @ P0DS#""""""""""""""($#""""""""""""""" X(P(^PK2 e1P/wP00@ L Kd0K | x@ t@ p@ l@ h@ Pfd Rj0SBdJ0Sc Ss 0S+W  00SB}Z00W% @ P }Pr Z0 e$00^\00 0R1PU@ 0Q P P0  8 #"  S7 Kd0K$@ .P  R( 00S0S 8#8 $#$0 0{ 00S SP P 0 R  |*( p&(  P(|(wx\ ,]l P-L 0<5,0, (s$? 0,w@ P-L@ L0yvp UW,f8P~}sh p-L@P`@DT'0-S;@P0(''' ('''''''((''''''''''@DT!`h0h ph`@T ``(0 `~{ht -pQLP@S \ 0LW3@ \ \\PB T1 RG0 CR F0>  0aP0,<S*0 CR )00 \ 0 CR 00 \0S A \0 R \AA0R PA>hvA0R>hA@ -pQL@ᜡ0S:`00CS`0UX0  X0hm藈`PuPP!o0S@0`00CS`0BX0  X0 Q 0 CS  \  XQ &AP` X U& t90 CS @` VP0 AX AX A@D@ p-LPL`@LD8  0 $  phtę -LM`@ Q (Ko3Q P 0^, ` pP , Rp RP R0S0C000 \  R  R  R,  R P @U@00R T B0P0 hPW 0~Z  @X z $Y @ p   @ {y!s @, R m0@00pD(8<0 L @L@t @Vd1 R+ 0 (KDK@!  E41 R-(`00CS`0,X0  X00Sc0S_{ (Ko2 2:(Ko6ppW zP (Ko?X (Ko?@xT|,@D(h -L$M@B@0 S$ P Q 2$ 0Ry K0A0S0 0CS22(2L1x11 QQ QR  U? x 0 d\X!0S 0`0`p;8 <0 L @L@( @q4@KP z sxx m xhpehax5`Vp(w8T `lx -LM@e5e&.aT, P cT , P gT0,0 P t(@4P4 00|4   l4h$d40$` 0 $4 ,`P $40S0C0a P  dP0S#0 30S0C0@@  0PSx0 30S0C0@@  0PS(#0 @304S0C0@@  0PS0  20S0C0@@  0PSx"0  20S0C0@@  0PSh80  \20PS0C0@@  }0PS@f@2 R 0@fS@ k1 RQ PN, R\A&.qP 0S@ 0Rl!0S|;  7 /(BRbr0S, Ph 0 T 0, P00 R btbꈜxܛ|h PDl8@HPX`t -7LM@ T0 P`0gS l7`w?>>><p<X<?4?4>t>|>><><<><?<x???l4 @a"PU  8$00031PU 0 K0<0 'PU !PU  p#000PU  #000PU  PU T3 !R, 03 L33 43PUz 2 3 2 2 !R2 PU` PUZ  ,K@?0W, R4 ,2 !RzL2 2 2$2 80! 680 PU* !0SSV1  PU l1 !RD1 R7 vt01 !R)P1 lj ;! U00V0S 0 R0c !Wy!!!|!y!v!s!0o!؛L|uXXx|@l@T -L@$M8PK pK8 L 04 ( 0@ ,@ $@ @@P PK(`P 0 @@P 0PV*@0@U lll8n  p-MLM!0@P` 8 @DT0-SAH@PXCBBPCBXC@DT` HQpK >K0C0C@ @/p> 1 R1 1R vx`9 8  0@/p[lnK`F`F+np@M10S pIl1( $ K@p H 07l(4l(whL`l0 -4L0M@PT`4 PEU50-S@PF0E0EFFF0E0EF0E0E0E0E0EF0E0E0E0E0E0E0E0E0E8E?PU  ,K@?0 V, RPEUʤ30L0  0CLpK0PKH <0 4 D @ 8 _P  0@@p00 S@ 0@@p 0QPr0SX X *0@P0 0S" @U(K2! {2 wp2 s`2 oPUt _Pi 40SP 20S 2  Q 0QY 0 SZ 0 S0S 1 R00P001 00l1`PNP00P0 `1 R0S?0 `7 ( 0S0C0 e  00Ps[ 0 Rq lkk] k`0|\<\Xg^PY؛h| 4@0s -PLM`P0`V#mRp1 T0@"S"HLTJTJTJTJTJTJTJTJTJTJTJTJTJTJTJ8LTJTJTJTJTJTJTJTJTJ(LTJTJLTJTJLTJ\J3 ";Rp2p2AV"P >"P0`gSX@@bP P 2 Ri x p2p P"0SXb 0E1SiLLLLLLL,MLMLLLLLLLLLLLLLLLLLMLLLLLLLLLLLLLLLLLLLLLLh1 ad1 ]X1 YL1 U@11 MP /  j 00 p0 @008:*  0@Sp  "" V D< <@t RTP02 4<KT#p0@0Kl,$<@T 4,'@ @0S 4 5TB "<0S; {E@ 0D0 H0 P D0SD,#H0S  H&#  #[0D0 @0〛@WP " @ #\`H :R0O@ p@4 SHwP P0P0`P0 P Rʼ 0S *0S ʟ0S#g#/0`0S0S*Iv(<bP P H":0S/ :0S+:R&Q$90OTS 90S9#-9#.90S9  x9 .h9 vP@T h{Si@90SD|"PS0[S ]kP 0 :SSp`  :k@P00 K>7T00 00 7PK0`K 0p70X p@K l'P0 0P CR 8R! 0P$0oK<0 B 00   0FP,ǟ0S' _ < <0s# < f P$0S $<0@w$h0@<0  00p@K00@ 0PPU0W<0S R0<C6 0S6 _ںP`@*P@PU✳P〕@PlB_"P00  0R@PUPP8@T 50S58 P_ "R ğğ $ 0nEğğ $ 0d;ğ$ 0\:P rJPPd %P@H$0H9#0@X ߢP0$5ß3#.h40ST4   P tp@/RP " P K(P K0BP0 P R 00 S S  㘢P P,@K yLK> HL0SPKPP 2P "0 S00`ڜ `ï"0@LKP KP H0BP0 P R 00S S S R  nNPP@DPP0 fHL0 "S5 V2  SNPP,2 @TPp I@P\ #1PP0S18 G^\ #b<0s<4 %PUTR|PHX,X'hHP1̑8$0p@D|TL 81@DP3lhTDxt@0D4Xd00 S 4|| @ @0S 4Qt00S0XB@ 0D0 H0 P D0SD H0S H P0D0 @0a@6ŮȱP L0\P0 DpǏH B8"b0OPP @ p@4PHPP `P`U"0S 0S 0S#8#+H"0pÏ0S0S*sP0SH20S/ 20S+2R&Q$20OTS 20S2#3#+ 30S 3 43 +D3rPQ hPP.x3qr P0S0S0S 30S 3lq30SD9P O0P2 2 GP\ ` <0s <`%2 P8 (K -LM0T ,0 X \$ @P 70Sj,0 冷PH  0 S H$ |PD  0SD C.K B B`$ ,0X:OP ,0X$G0PP4 D @ jLP P, dLP Ɵ0PD\$0Xpa^P TL@PH$R P\$HpNP4/p:`@@P00T00S/ T-*P0#03V0S& H@ P@@PTT*W P$0S,0X pL  L$ 0[S]џP P0#03V0S @T 0:S*0p0@T# :ḟ/Pᴟ U P00S P:R V  R0305P1 :P:㝟Pt`PL PW 0S V @@V 0S /vgP@@@`@ß0Sk(#U0 @0 T/00PpM@+j 1`0P.000dX0n9V`0pT ``P>pP 0V0U.SE 00EPEW "p -L 000h -L00 (@(0 m7ohl-0 CR 0R0 S'00 -Ld0d0S  '80o0 0(00 00Q@\\hl -L`0`0S  '40n,,0 0 S -@hl\ -L0 @0S0S@ -0L(M`0@0V$0 #DK$ KHPPpL00C0[PS (  (0KP(L0= K@d ( -AML M< BK+@س$|,$ )0Kl8 4 p@4 `BKP$AP0 `T!44@P񟗰ꀓD  0#C 0xX?nt<4S  30S dCxl(nh#H3 TP/ @ RR5V(U&4TV 0V04V0S30S0S U UR2 2X"0S&U 00D S\2X 000C00W42 0BSpRdppU00W0S 00D SW T)T,000p ,!pQ,45@4,4 5dW(TpU-T4$R4$1 4$ 04@V`S@404 5T!^ P@?H0SS5V4V010S 0!0S ^ J&mXBK04A a R+#d4Q 84@T S8D 8D1V00   P d0 TR t00S 0ZZ 0F(K`D4L,p@h p-AML M20, S P 10S1  } n`BK0@!PE10S|10p1;BKA 0`PlJDAd >WmD10SD1081;,4S( K 10S,4,;0 1K(K PZJ00S0  / ,4S 1[ BNKP@D0S,4,;+YPDP800S= ;>Kp\D@`' -@L0S) #  P`P?SRdpd0 `@ `Il0S40  x| --LMP@p0T0`0 P !0 @ 0 tkRlh0 `Sp30PSTKhL p-DL0 M0 4 0 8 0 .P$@ 3#3Q0$0 3@T 30S 30S@@S0S P 3jt30S \3djT3 0S44rP(.PP7bc008 0 bP@ Ul g 00 0 $4 NP`B0008U47N<24 \80PU}*82 0娙P 20S 20S 0Q0S  @T$4 PO A1Qp30S @T $4 pP  0S5 (2PA0S"81p30S 10S10 1:0,K , 2K?PH00S0   00S00SD0  Kp( D\\lld@`'\ -,L!M 0R,0 0S 00SS  0KDpKK 0pМ ! 1 q ̟P <  ><Px NH0S S A)P<0S D<0S8L0P0 0K(< 0P0CS< ci!R ; qW, 3ԋ ȁ  -; 00CS; Fi\   ^ p[@T 4K~$ 00 < M!R PP9`V E: 0B S@@R@T :0K  p 1DK lPJ ᳯ [0[[(,[ D0[@[$Č<4 4"<,`U @PP: 0B S@@R@T  9`hR^  ^$>K  8K DK0 K40KpK! P 00Sd40Sa80S^ ] [0[[(,[ D0[@[$Č<4 4 "<, 0 K0 p @P`$,0( 0( ,00 K0KK4 80< 8K4 80<p@DDKP0 K40KpK@P`$DHůP 7Xh00S40S80S  [[0[`[ [P[[p[@[h1 [唠[lXᤀ[[[\`@p[D0[H[L P [T d4@1 D|<, ă $x q  1,(p,4Ɵ&<.  01*$t$%,.t0pMDN@Po86D@ 00CS, Kq4H K1@GP ,5g-0[ [R~[Q}0[S q5 @ Ƞ,Ƞ0 4,400S le@T $ 00 ptF`'D  PP0S((0K  # P ZF`K` |ğt\hğ\pD +8$P,;FV 0t0p0S \,0KPL4ȓ0S S ß,  ,0KP |, ) ,0KPF 0RS 0S Q00-S ? pQ R>`QX>0S D0S   D,> 04 S< 0@ D00S0H0 {PN0SpNP00<0S<80S8\= \= *tl0<0 08 SHPQ 00|SM 5P>0S 0 S  aD<k8hh= /\@P000T  T 5T/00P<0S0 S PL<0S 0 S (<0S  0S DQ;0S  ;;0S x;P PTD0S ;0 PQ  ` T PvH 0 00S6  R'sP;,0 :)00|S @ 2, ,0S  D*0S00<:: U, ,0S:8 C40 `:0S,0,4KP0S;0 $j0 SJx{P0P0 CP0: S H)0S00D9  90S G9L90S 0CS 49 00 @90S,0,490;Q0hpK KP@O<`K<-PEd@d0 勠00S0P *P@K P(K4.A?LI|@ 0ALp|@ -pLMpL G;77'4K;70S 7`V77D @ d D"d @ 0!Gyl7L0qH /SdRdQ #P t077 0R42K7PU qP@Ɵ`@ PƟƟ!` @`0K&00pK&px60Sl6`V M PPT PUDDpPÍOK@0a(&`֟0pK & 0Ο60`gVdzOKP%şşea0%嶟p_K`pP`%VF% 0U0W00SOKD%0 \T B$%a@P荟4K, p pW^Z0=Ɍ@p ͌$@0S0DS*40KXK W(4p   p4  P`^Z0=i@ my@P| 4 0< 8 LQ/K胁P@PoK ᔟa0#+ዟa##ẝ_K`<@̝<pᮝP<#Ld0n2ZYK 0gPژ2@"R D2SOKU"a X WOKH"aB2oKPey@P `y/K ` 0[/K *Py@P $a0!廞a!峞J_K`<@\<p>P!Ld0᜞p1p0S0P 0(POK H^ (!LPH 00S 00CS0 0  0 H@P 0005Y(Kp4L43@H.AXD`p@ -LMH@0s0 Kbp 0S wt@ -L@P 00s@ -LANKM @D+`5P݆P ~K pG7@Pp@68[/SN@ P K08SS/SK 0-0L0M0@S DPK0  0]PD0SH0? 40 .PB 3K0< -AMLM4 p@8 T2 0S2@ P 0S 0S4 00P0SxjPP 0S`R֝0 S0/R0 S? L0BnK`F@+(0K 4R/S@/04B+dP5h!X0080 0\0 ,$ 0BnK1儑儡4D`FP t1p3\\ PPj 0P @,100CcSX108P 0p30$0, BNK0@DFvP X000{VP m+@PE@h00(Kl<""4t 0d< -LM0 -PQ00pR0LMSF ,20SB K"@,^KP-PPvHPQPOK@D^K30!啜Qp$;-PPa3P PU  0At APd!*P TP(0KP@x0[SPuM0Ax`KU `@ PW!pPT!@P 0x03T0S P V0xPS ` h00S`0  (K!dptD p-2L0PS 22 A2 p2 R22PR x2P 0S\(P 420S 8FP(20S 12 @1@ @叄1 @剄1 @僄1 @}1 v10S1@1 T!0`0 PV | u@Ph p@PP 0T.S@D0P008,!@TP$$ 㧄P10S 1 1  V  d0 @ R00 V   ㉄P0T 00`pp8,48`DlLL, $(t| 0- LM0P@0P P K*0 R r X0000 T 8@,T 0P848 -2LTM!0p`0UP^1A0 @0s 0 @0s 0 P |1|XT000 0000,K0K4K(0Kd@K@$ K$8K 嫛, 80$ d0 40(`0 00v.B\0 ,0A BX0 0T P D0 rpP@uV00S 0| ?@0@_ V `@TT @P(0tpu0 K48\| -00L((\ 0 0r?iK,wL -5LLM % , 0-S ``P@&Pp00`lp $&p d0@ S xpdLDP$&pD4 U*@P ZY $vW 0p ` ]#pL Qp@H P9up *p &pP UX@KVT00 T0 ~,,#3"0S0jl0 `pl}`K h#0S `0#40Sj@\K \@ 圔PS WV  p@ @ T  pn0S *1p ^ h d `KN hK0P`@ 1pTK0-SP 1MeU *@P9 Q 0" Cl0S$  @^=00S (1J" / M, \1P 9x15u15ʒP@@G S*T=h=(w,wDLsXD<,4} -L+ 0Ix -GML1M a |!@0P$4 X!Q%p oP9 4!H%p 0bSQ`A~K pG0pG4 2P3 $$004 4 =K 0C0C P"P -P P @G0$tA.Kh0 B B\T0$8I ,d=(w+dТ+ -LM@pP4 )PP 0S nS6 =2`P00QD @ Q? 9-P 0V0S D 0 YppV 0`pY" 0 0 p 0oSP00 ,K=D, ?R0S@p @ `G0 p000"S 0(8$P 0 00]Ș -LM`PB(P( @(K,pK 0 g(0@S $K<0 @-PQ @p`0N S3. P P 0 CS @ Tp@-PQ @` Q 0 CS @ Tp Pp-L@P6 PQ5 0R14 40 0R+((P P% Q# TP ,,P`@PP Q EP 808PS <<P`@ Upp -LMP00K/00BP a@p)T'Q 0,<4("4!| ,K0 `V,0 0,0 00S , ,#0 `S:(K -\LM`P p 00Q 0 " 0@T K 0-LM@P  $ K@ @  $K>00P $0"K0 -LM`0P!PD $pp`E hg A $pRE Z  4P 115S ;pD~>E0 dE $ (p DTn.E 0$4 hR  $ H t   -@̠Lp`.0'.TP! .U.S Ut! 000t0 00000s03-T0S _T _TX0 0`@T8  -L]KCMPE쐟MPE@p ` h+~ P:$0 0L0P < 00 8KLp H @` 8P 4 , D pD 8 (K   ( H  -LAMJ_K, ,KOK&G'p`P#0S @ *P @T T } R 0SR( K0ACp <'`V440 JKp, s(KhT  0-L Pp@AD8 pu5D 0h0p   p-`(LP㳋,P㰋0P  80PS< U@ph蠋@P -DLPCpP`H 00 @0 0@4 40 0040404 00 4 ( 0$ P` 0$  %P( ,P %P, 0P %P088P< <8 @TP @`8 -LM, P BR00S ,P50\%,BR00S (P(0O%(T"P0H<`S 00<S$0 (00S`A< 8< 0V 0Vd18S_lPa@80S<01800Ea@80S<, 0p188前P<B 0!f0<8 <0q`80S<NJ,0@188kP<$ <8 J< 8 0!a@80S1S 800PP< 0!-PU `X$Y \`  -LM@P4K ㈔0S   Kgp0 0 $ 0S/ 0S  4@K$ $`K P%P 0S Ept @T `P{4pK@0PS t@ UT $1 1P h@/`40(K  p (WPʌ`P ( |(  | @4pK0S  |@ T<0 80Q |K L l  X  < X  -L$M@|PPT ppd @@K$ ޓD _|8 p z0S u5B0`gP, ~  pa!Br,P@QlPUT@D0 (|PGB`X,厉-@0 |P,JK|  i$      P-L@`Pp\i.. r 0000SR 0 #ᄓ``P'R"R $R `R \R `F0 `F P@T:V0084|TXd p-0L0S00@T,``0@p Pp 00\-P*D'8$,! php ,l 0 -L Mp@ p P lhp` \2\ oDы@P< ᯰ,R,,Ka( 0,0 0 2KWp h0S d$A P 2[ pUAB`P $0S tA10S p:@ 8&a0S D@KP გ  {0L 04 000  @T00P06@00@@ tH0s TC$Kt" (   $ -L M`*/24 PB2 @5-r P0"0p P*J`P$%-0"ؑpP*,0``Sp! `"̑pP0*,@P``&0 ?pPv*@`P"峑pPm*``p(0Sj !姑pP0`*(@P``0 pPQ*@`Pl!厑pP``0p0H:E1=U80 80S ,1 AE0 !spPp``+*P UVj0 zP @`PKj0 yP @`P@j0 yP @`h FpP 5:L P(K[ L0<l| p-ML M00@S`0 ZKPE*RP *y P%*P  K@*y P\%*TJK@DZ 00.@Kp Dlx p-DAL0S8 K:$1` P@00S 0S 40 P EJ@T00Q P 03J}h@Kp00S0@ =@8P" 000S0.ph { @ -LMM@1~K pG`pG@P+PK屐_- ⬐1!0x6 p& V !0K @QF t6 l& =8 46 p@ 06S L0 ; ;KSK?; 05%0&$0&6@0 & 0 00& a>0K   -LMMA~K pGPpG0`+0KU_- P0Kt6 ,0x6  t1d& 0@h6 0S1!l6 p& 0SS 0 ;0& 6 0ˇ 0S R0 0 PK @@ p@ 06S 0 ; ;KSK?; 05%% 0$ 0CS\0&0 0606 6600 a>0K ,  -MLMq`KP @@+@@KՏ_- Џ`1V0K,t6  H1d& xF 0Kh6 00+06 k1f 0 AA+ ˁ0SP00 Q K @@p@ 06S X0 ; ;KSK?; 05%0&$0&6D0 & 0 40& a>0K X  0-TPT0L@x* @04 48#8 0 0h   p-LM,B0 KP0@0Sl0SCh 0R, 0R( E*0 R 0R0000 0KQ 0h!0aN00LH\  00 000 00*0 R 000 0 0 0 000 0 Q0|000 00S UPL`PPF00 00<0< 0<,0&Kp `.$(* -LM(Kx2t2, (0 b0/S0S*L4 80 <0408@ 2 `4@0 0@P4@8P1AP08 ]=0R40Sf0 ]=0 i0O?0@@@c00@408@H1@!0 <0,0(`K400@T SP0@48X("(04"4 0 0p0 `020@>)04!4 @8 #8P4@00@0 R0, 4v K   \p' 0-`PL@$0 00 00@,0 0@408@0h5  -LM(K(`K3,0PPch3@_0,< 0S0S*00 P 0S0S *R 2 L S2 004 80 20<0408@ ꕋ2 `4@0 0@P4@8PXRX208 ]=0R40SyP 4 }0O?0@@@c00@408@10S (`K4@00@PU T0@ Q 48 8K \X10SS $0 S (0S 10,< 0S0S*0040 070KC,080K#K0S 0X P 0"P8#8 $#$0|0 l04@*( [ @04 48#8@8K C0( 04f K  * 0-t@LP$0@ 1S1000,0$0 @408@ 000h  -t0L0PP P P0S 8@8=0 00 00h  p-L 0P0 @00S 40` 00phꏊ$08 00@~,0 0@408@ph    -L@၅PPlT"~p0S. 8 `0V (2UuP y 0 GS R 2 P10 < 80p W@x1xt1  018@T R0 Da1 SL0 0P0$0 10h0S AP@(R*@ h♋( 0@0(W@P(((@1S 10t`00S P@,X  u, 00 8$  D\ -LME0P 0@  0@ p50 @`50 0S1@0 @<50 0S0;S<0@0 @š5\ 0 @ 00O?0@@c00@š4\ 0@0pPo?P P` a`P`%1?FA   ,KN,Kß000@0 @0(0 S ,0S1@0 @ß,K000@0@0(0 S ,0S1@0@,ß,K000@0@0(0 S ,0S1@0@R0000 @0000@0000@ 0! 0S3@P0 0000000@00 &0`0@0@TP 0X\AqL AL @0SD0``0L0 014S08S 0L4 P0ST0vP 0 L00 <0 0 o0 0L  v@1S00LSP0h@0000@T Ḋ 0i/@ l@0P 00 00 00X0  0, 0 $K   `. 0-l0L0P0SS S S@P40h$00@ 0hg0  -L 10PU R  00 0 S   00`Zq`@TUh1S#P0@P010@P 02} 0@P02p 00h00 00@,0 0@408@vh .' -x1@L0pSPL` RHPO PU  .PPi+6 P=1S400400 0<40,0`p\0 P + 0S 00P0P0000 000 0P0 PHfWVi: i \9 -0L =.4:,w -L0MpP T+D0p@0S P0T0S0 0CSp=>4@ AXT0 $S )P EPQ P$ d P@0@0 ($0`0@0@TP 0 00 00 0 R,pK $B@K }q$T0  Y#08 0\S0 $S P P ,K SP$ "P00 2 0 |2@T0S 0P#hM 0 (@ H2! fQR,pK $#B@K #q2#0  }e$#0 0t\ꔁ 4R@0 ,KfN2@K  ` @P ` P00P081 50H 0C0S00S H0H0S 00@  0S 0$S ,K 00P 0@T b 0i/@"~p` \, K(   ,D T | $ -88LMP(8` ` H pK⤠ ;iP8 cP dP71 LP.qP㤀 + uP$ lP&0' 00p 0: Sx+d|p\p 0: S 44,'00M'p7p0gSBTQ솟Pg IFP_ 0PP 000P F0 05PL 6P&]=00$0S0X 0T&fpL6 DFR@6  P_ m0u000 6`C<0 PL0L.p0L@5  Z Ipp 0SH 5pKXp5L70\K@0@T-s*d@U00S50\ .pt5 P \0SX0S D P`"` V < 8+B(A0,$ `0@_S0S*ls倃@ 0P.H0 Vڨ @ 3p^5x xnt媀pPli M w  40KpH50Y4 40 0044!BPA R0^2.|p`@4 ./2P@4 `B Y@Bp4$ (0K* #P Pp4,a0L0 Pp4(p  p  Fpx  *pd  pL ~@ 0H0S \0 00I(K,w+  $   ,d<PTLTl xX0Txd ( {8(Ll"t5 -LM␀pP(K` P  ~@Pdf (0`0 000@0@U,P,P T -LMp 0 充,Kh;PXP; 0P P0pP ,`@0P @T T00X s R 0SR@  ,PP 2,PP P;U(K( -LMP$@Kp A?@0CS@P@ T ;P% :P0P $`4 R@X ቄ  @4;T $ B@<Tp -BMLM`,KL  D4@P P0pP,Pp1@smP p WjC.K@ B B@D P$ D 0K@4H4 AQ SQ^ CQ BQaIQ/ LQEfQd XQlQ5 tQP$+hap ,K{ 3@P Y,Pᵄ@0 S P4  D$ {4KP 4K @ TP4j  }Pl  uP Hp   hP    ^P  ,K( !@P P1pPI ;T] ,PP P0 00KpP `P  0KD9KP7 9 [9K00B1  H$ H$ H4Q? H$0AS,P H$0AS,P- ]P D4Q`|L$P@| CKAA ]L4p(K@d8 p-LM@PK <@0C`SZTtTUUUUUUUTUUUUUUUT TTTTTUUU U40040BKs 1PP ;U30 $lP0 * P(x$P"x,x(xxx x8fx0f ;V xx8 `x -PL# {P@ PL ;T i8)|`P0 $"(40 0 4  0s/ }S X "1R0 Q R$元P " =xp i2h1 P T 0   00$P 0@RXq 00S0` `0`00000S% @0QP0  0S0`0S0  000  000 0 00`8  p-LM@{ <@0CP&SY<[[[[[[[[ [X[[XYYZZZ[[[[[[[X[[[ZZZY0YXY0[[hZ$Z 3sSnp 0 1Rdp 0 1(RYp 0 1ROp 0 1d2F_K,p ,02 , F_K,py 1 , ╁nF_K,xpf 1 , x1$`1}PD1,,141<0]0:/+ (`P0@`P0@Pw0@X0D0P 4 ;U Kp  \` p-LM@`Ks 0PP 0 'jP d {PP l ;U xP' 0s4~ x}S H x8 4 0-l@L\*@P PP3 0s S ( 0h)0d X p-aL 0<$0 <0, @ 0,4 @0@<<0 K?,,  0]- @ 0, @81 , (A 00 0   000   000   y00 0P0 P0   000   00 00 A*@P | p #phr)pLd0 0    p-L M` pPA/TR 8@K 㐀 i (p@(@Kp|zi -L M@0PSD0 p` `,KP& ,@"P iP 00SP0 0 00 40  Z R4 @T,(K  -LHM` /pP <@K ' h p. 2[A0ASp0<Qd@K(   h \p 0<0 L0  Ki Ty 6i( p-L M` p@ 8PK  Xh ps3.2[0 2Kpd$.\ 2[ 0@2KpU.$ =Kpi i H p-@LP`|0@P0`p 0-LM@K,K:pP@*- @ t @00@0 ;P <0S @0S , % P [(K0 | -LM,KPD ,`B0Z=(!P gP6 @0S!pW/0 4 ~0P=S=S  wP  ~0=t 080S x@P\  g< 08@`V$080S  ,k  -xRxxL M{`p0SX0 L@DT@ O0S 0K00KRQ0PQ1P/20S qV?!0 H @0 0K80 KKA0S #K HK9pJ0#S% F0S! B-/4[ R H0S 0s3[ 0S 3[~3[ 100@S 0S 00 7l0s -H-/(K   ((  HT `$ -LMPap@K 0@ 0 2T [P 㼋@ H$H08#8T K#0pL0K0T[K0K0T`KH0 0 S0K0TKK5K4K4KDp @H$H Ġ$Č(0K Ƞ0,ȠKd0;h` 3K0$,$  2K0K2K _^ P  0@K  0 s(0K!0K`d0h@dhPpKP0  p@K J} 0l p hp dP $ p@+(K  p p-LMP0     "p@+` 0K`pw+T0L0@ `ph+ 0$@Kp ! -L4MPNpK02 | `PP 0S C+XP@P08 P @t4+ @0 K lB  p-LM{p(Kt -L pR2XyP|$ @0Rx1 10Wp Q^KPE+[yJ yPKM.\P x6S 6S 0  MP 60h@ Dx6S 0S S SQ``P`P`P PP` <0 S0PP0``"@;t 0$Kp VKA$ $nNK@D[0S Pn@T K  Pd!8\!;p!.|!!!!  -0L0 S 00CS00Ӥ0]@ \00! P 0 000p0 T0 p LPQ(0  B000@l\X -PQ@`Lp x x x0|0 `t0Pp0pl0 h0d0 `0 \0 X0 T0 P0 L0 H0PtX\lhd`p -3LMؓ ԣԃp@ 0`bPep 0  0#PWp P "P9X3XPT3`L#'x@8@`"U00ST P@`\U@@ V 0pP0$T2 00d "8u 2P"2堂 \00A S-Q5T"d2PP"@C $0CSL @ᙊ$K'  67747L7`7p777p@-<@< `P 0000PQAp( -$0@LP  8 -d@LP PHGDg0,0 ( 0@ 0 7  -L 0LR RP 0R >7 |00-PPp0Ll Pd6V\!Wp@ LH0P 0(,02@d788 -DL@ `P(0( 00000 SDh( 0-@AL81 PP,1, 0P  R0 L\00P  BRʔ00 0 0 QT0@0<0UP<@00{00 Hl$T 0-DP@L0000@@0 0 0 0l -`LepP[{0 SPfu% ࠟ0S @ OPB000000 ᱭ`PV p 0@*\Jb@P`0 @0O' 808 H81 P-L`h 1 @0Q0S 1 00P\DX` Q0DQD0 Q@L00epP00CS04@0U0, )0@0CSp0@0B0@p00 \PP \, 0O00 08(H,'T`8G-鄠儐Pp0 0S0 0 BS00R \P@`A(8,-D0D@00  R P (08 p-P@0|`00t0L@l0@d0@`0@a0@0CS0 @@00 ph&pH8,0(4T -1q00SL-P`0L00d P100CS0#@00 0@0CS 0`@0x0(000   (4H8'T -LMP@0 2TPB ,K A@P zhhhrhb`"PYm 0 P40S0`00DP, 000S SPp PSP aP SPTAZ,KPPU 1 ,0Q.0 Q@L00Yd PvH00CS0<0A004 [100CS@ 0@00I,  zj@p0P@ e P P \0P 00S Pp(K\LLD4H@x8880'T -LMP0@ T T4pP- 弐0帠S0@0+@P`P 0S  0  0Bp3PPP0T@\8xdP-0 CR 0R0 S00 -@0LP`rPe׬`Z !`0Vh#`c0SUJ L0SF I0S\\@U`T xRP 0`!Sb/*0S@,0@0w0US8080h0US00[`zUSPX*\00S` lP E U 0@0^S00\P0S@8xp88 -LLrLLL`~@0S 00CS00PӤ0I+PuG  Q/0 Q@L00b P00CS0^A0w0V S0`0CS@ 0 L!0d800 S0!00 U`!00000 +0S0#3 XPP 0S0`00F` 0S0`00<V @V00 00 0 <0 `@DLHp'Td88\ -3LM, 0 0 S@`TA9P, `3@, P00T$bpP[ {00CS00P0CSp0R00:R2 jh0 0@D0R|  C@DpP h"000S S TJ02`V00 VP\00aP600CS0qA00i f0!0CSP0 !0{|!0h1 hWAP 0 0@FR0 @D C R0P쀟0 R@L00apP00CS0"@0@0 0@0CSp0X@0-0,000,0`(K\8H<'TLx8 p-L`P@ P pP@T*p8 -LPp` \ P  |@0UPh0S \0S@ Pp `0U0U0Sld@ -LP!\@`RP@/ pP0!S|P H;<0<80P , V0f9 9PL - c L@p)"pW0 WP\00` PW 00CSP 0 "0a00 R0 Ch"000S 00CS00Ӥ0x0S0  ;P 0S0@ AP X R/ڈa刡0 RP\00s` Pd00CS0J@A0 0B u?0P0CS 0P00d X00p 00S0#3 PP YyW d0 00l0 pD0 00@00S <00SWpGp@H<DTd'<9@ -L M4 pSŸ`2 0BP00 p30!00P `X`1 P00CS0\A00T Q00CS0 P!0q0S p>0`>PsP0 nR pR lR 0P0P00PP 4=  Q =0S ==~PI==QP?P0 nR pR lR 0P0P00PP d<  Q <0Sz <<JP,0 0SS0 x<0S <0S( p<0S r ;000 8@P P0 nR pR lR 0P0P00PP 4;  Q Y;P+ $P\PP0S!SH +E0S, 0S @P ; ::;0S[ rc T:000] P 0!S4  P0 nR pR lR 0P0P00P\ 9  Q 0S+ EE U9`V 9sPaGTPPgTPXVTP P0 nR pR lR 0P0P00P\ 8  Q  P(00090SP0 nR pR lR 0P0P00PP 8  Q ) 80SP0 nR pR lR 0P0P00PP t7  Q it'00cS0 `'0S TT70S. P0 nR pR lR 0P0P00PP 6  Q 860S @7@c(7PP\0 nR pR lR 0P0P00PP 5  Q H60S 66P} $0h&@ 0R P0 nR pR lR 0P0P00PP 45  Q 5&@5ZPH 0 nR pR lR 0000P 4  Q $5 55/PT`pP40Se @Tk40SgV`pT P0 nR pR lR 0P0P00PP x3  Q j30S? h3P( 0 nR pR lR 0000P 2  Q >d3 \3H3P 0 nR pR lR 0000P 2  Q 2 220S;P0 nR pR lR 0P0P00PP x1  Q 10S |1 Rt1 d110S  0 nR pR lR00P 0  Q L10S d10SqT\ P6q 0000 10S1  1 g@P" P0 nR pR lR:0P0P020P\8ܥ::DG:+`H::8hHT:7`8t:`9H;4:llT`:\XPTPx0oP 00  Q X00S- 0S0!S+B0S0S @0P 00P 0 @$q,Q`0gS  S &:00C S#pS rS` 0`0`0`0 1@sTP000`00V FwV 00 S 20S@ p02  1 0 S 0 Sp pRV000|2@  @P00CS0MB0y0E BRT P KO 3 @ #00CS0,C0[0VPP?PT3h#0$S0000W0#00#0#00# 00 0nS pS lS0 00 00 0 0\ 3PP0 nR pR lR 0P0P00PP X4  Q N40S# 444 ~g4PD{P40S(0pW50SH'P0 nR pR lR 0P0P00PP |5  Q 50S #50S,P0 nR pR lR 0P0P00PP $6  Q PTRpqW QWPd6 Pt60 r 6000}`P8 60S6 R6 6  68P&0 nR pR lR 0P0P00PP \7  Q 0S0!S+@0S0S`{7WT7 70QP7(0P00 0S 80SqWP<80S0 nR pR lR00P 8  Q D B8 8 P010C0S  I1@s qP00 0 nR pR lR 0000P |9  Q 9)00Q0 mP0 nR pR lR 0P0P00PQ (:  Q H:T 0S8:`:Ml:0Sx PCP0 nR pR lR 0P0P00PQ :  Q \;S;⾖ ;0S, I4; <; P T;  PPt P -LtM  V5 jWPڜ0000SrSh5hehhhhuhU@sP xP pP00 @ j0  5%Tp0 10 00b0 0S 000-S 0@S@ʜ000 00C0 TP@K P0: S  0040P  展@P >7*#000S 000S 04P 0oPX30S 000!S 0+L ?0S 8000S  20SsRcT0S S䒟䢟"P PB-"0S& <"0S"p820S  p2Rlh2 0)IP20SH"0`0089"0@09"000 S 10S!@0`00@00@P @P  @Pt t t$ @!00X,00S  1R 1 00 S 9h00Sc 0R0 0V;LP$;+d<;X D;H;\`T;:DG`HX;Lp;@DLx80^S0]S[S 0.R =R:R  S0Q]S0]S S]S -1L`@[S \S`P t0 S\`0S S,140 pcQ0A0 QP\00NP00CS0-P0/0% 0P0CS0@00\@DP T H0 0`S  0o \;;ĥHȥ'Td p- L P p P 000 S S@0S~ pk`Pp0P 00S M|0P@Cpcp\0P@P PYP 8 800JPpp\8̥;h'( -L Mğs@, 0 40 0&S903` 0hQ0 QP\00M P{ 00CP|S 0l#0uX0, $3 0P0@ 0Sv\SC00S@9S>400CS:0 2`2 0hQ0 QP\00M P5 0l0CPdS 0T"0/@0,  2 0P0@ 0S0!`V&0 VP\00dM P00CS080t0CPlS 0 \!0H0]01 00@ 0 0c SC R/`p0 RP\00*M PGg00CS0@00 ,0P0CS 0PP00(0 00@(K HT' -LM  @$" (2 P  Ld0S  0@_K  0 B JP$" b  ," (2S  S ;#rPU0 U@L00L P; 0ß0CS@ 0 h0KT#00ß0S 0B R K 0P 8"RpW$0 W@L00yL P00CS0U0pŸ0CS@ 0 X0D"0s Ÿ0S 0 RK`0S 2S ,\    ?K孍Pk  "向0pf 0 Q2 /hQ`0 Q@L00"L P?<_00CS0AA009 $60@0CS 0@00W "1 $ 4p00S 0T@ /R H)RQ"(KdHT'; -L M0P䑟0C0 4 , 0Q000 400pP^A QPX|0`00pPY`P UDA  MPP!00CS0:A0*02 /V00CS0  00 P,00,0 p@0d 0b, RZPP  P(KPHTx(: -L0  0%Su0 SqB 0Sp  Q.0 QP\00K P;[0@CT@xR00  0<0CSP 0000  Q@ 0S.@D/\Q)0 S0 @!!0S 0S0`00 tQP d!000S SPFq@a$@00 S R0 a䀟0 RP\00JpP00CS0#@0?0 0P0CSp0XP0,0$ H0@00\ :'T`@DLH -@p@@0LP` U0@ P0 R00R00 10B0S 1@s @@ gR0000\4: -`吀L p Q0@P @FT00Cs0,0 (0000 0إХlܥ -2LM0s22080  20s.xB0Sl2  +`"0X0 @0A0 S6 , L L  000  0' 0 00 0 00L000 000 000 0000 0 00   00#0\L 1   @Bp4`K07# @D0 0C0n##0 C0?^NPnʬ00S:t0x@C d0 \0T800@ \P00 j(Kܥl<إHHХ`T -PpL0` Sd 0 1I@P 0 P 0 5$m 0 5$g0 % 006(VE@@ԥإХ'k -/L@TP  0 ST @T 0/S 0/S @T  -LxM  $P  - PP3 40CS% $$ $ $$ $ $$0SB <0Se 0$ p0/S0`c<4@ 0T/S/00$0h0 S" 媵  PP0S (K@ 唵00 厵  #00`Kp4 4ST H0 Sp * R2 0: S  R, T R{  RV QP  0S. O@dp 7P$  $ p4Sj H00* Rd2 RX2 Rd 0Sk  PS("$ 0 pf0: SF1 Rg0S? H0卮: R9  R/  R1 R q3,P) 0S 0S h@H 0: S  00 1 R q3/P-@  ܴq3DPrд  00 0: S /00tP +H l庴 HMPP@ 0<̑Lpy0DHT<<|<lp -LM@PԓH01 p0#p5 H0@*S*+)))+)))p+)d+)))))))))))))))))))H+))(+))))))+)+"[p2`@fT"0Sa 0S!001p2`D9x2xB5Q+y6 P*NPDd 0 0!K pPw0SkVu8  '!00}1 y 1 1 q1 1j00g0p1 b p! ] p! X0S 1SX0 0S0S 10 KO1: S0S K. 0 . B0 )kp 0S pthq \ Pi0: SL0<D8@H<4<=X= 0-,@,PL( ! ,wl== -0 L8P۶0S C= p-0L:#:0 0P( `/C#b ,0 0@4 /C#b KP@[V  ?PP0V* PP*0V0. XPP.p PP0 0S @0V<0~PP l0V@0dX崜PP _0-SX0S 8(@p$@Mb=> >= Q-L@ hԥPT ?PD0P4(hXH$>> Q-L@ d宥PPPD0P4(xh3pH0>> -LMMpA^K PE0PE`@ 0 儐p% 0K T04B P0P 0RK`gP XL;H6H,.(wH>L><>$< -LM0S  @T  pp H Q! GD0S>4 R, D$0S PD00CS0 0`0 Pp@@ 8$0S0($0CS00 Pp0@@yVYV 㺐`vH{0S 1 ,㥐`v K⽲PP$1:( SPP@P0?8 0 % :. 偛p  0T00(d@PU 2 KP/0p8 t  00 dPm0?PX @DH88n@ -0LM`0p 0gSR :R'P 0P 0@ @J 0|| PjX\ T0P 0\P ^4P 0 0(,UL,wtLHpH$I\I M-LM00, 0S  (Ko00SP $ 0+@P$ 0*, 0dld0 0 S0@ `p0  ,` p(Ko|IY@II -D2L$M04 SP$20S_!40S0L 0S0(K@ "0 S0 00000 u P` 0Pp -Lp`P@Pp  10e0@@1Pr00a00  1Pr0000DJJ p-0@0LS0 P.  00S 00CS00@Ӥ0ꎲ@d`dP0S 00CS00Ӥ0ᗲy PpyTp@DX> -LMpP`PP D10SL810SH,10S  0@9 000 P w0S0;0ۋPXQ P( 040 0@ ,G,0, 4(0 $@ $G4K P(Kp JJJJ - LͮJ -LMK xP[ [4 0 S0S (0Sh> -MLM8%pQ |cPP50S o`640S P 40S  K P$ 40S yѕJNK`@DdK@@DK 0X P (40S 8ᷕ`40S 4[S /P `+0+03 3`V KJ3@T )Kd!K-P0D#:  SK RP Pq`)KD ӌX20S K  0$`x P p20Sh`[K(PEPE9K) 4@P `?V00S 10S ?0S : ɭ30S`` K DK0$P Vt10S d屭``d0S X1 R D0S0 @,00@ 0$@4 ( V ^ x P V-00S)_%V00S D0)KS,0D0 D K d00S<0@K08K0 9K4VS ``(Kl|JKdp8K̑h -ML M99 , 0igS0,0 xY,@ 0P P( 00L/P 0L( 0 0uS0nS0 0, 0,@/P }/P0L8 8 0@KT8 O/~FP, 3 P 0@K \P`@p@T k?PPR,01, B, ,0SU 0 0 !0@S07CK 7A 0@pK0g帗D8 A 0\ H( `8 dTL STu 1T9T-LT NTYaT- VT}bT* cTnTI gT4 fT.hTz lTz2rTp oT? qTrHtTY vTm_L lT .0@DPH ezbF,K ,00SX l000>\&G T. P( I< 0 00(00 >%P;0075\+. P 3H( 5.:0E,p 00.S.0@0K`8,0 , g b{.0,0 0x 0 0E000 ?H%000!P P D(5P p@P5@Xj>P 4@0H8S 40TS4T 0HST 00 R|š$0s400s030 P CK.KI B BI`X( L(00 @0-S 0SH8SCC000S40C S;LlMlMTMlMOTMlMlMLl30S|墫 }0S.P,  @K-P @KX$#0E P *XHPH00: S  JH00: S S0S2P" 8XH0S d"0SP d(H8S)0S @+-!0S  +P10SP9 @pK !0pD P: +V`<H!0S t0S<10S  H0t\0l10  P8 P P`0S00S 0S P |0SV`PPX00S r,wtDKLK|PKh>hKllpK+K|hKx>KpK8L̑8LLDL\LLLL@@L 0-D0LS@ 0PUPHP)UPP0D00 0C0 0 -L`pP@@PHpD@ R-LP` q@0@P T@T ˭O0 0VX1Xq 00 @0D00 00 0@T:p VOp@@0P00 V4vpV00 0P00 d@ep _]8 000DP  sO00 >H@L@ -鈁LMPpH,  F@T Z@ )PD p` pG 00;P'  gIp:0P 4 010P 000 <@PD`  (PD0S0S(@  g0, cP@L@ -PPL`p/ (0S 00wSp rS"ppV 000x000p000 0 0@00@ 2W忐p廐9T@H@P@L@ -`QL MH p0rSwS ?R@@T Wڪ00};Pw 1,@@0@0@4@@@@@@D@ 1嬑0 PwS 0 !@0q`P 8TH0090x` 0HwS:XW@ W@@0 #020Kt0"̠10K"$}000K- K0 ` )0KX20K/K,K+K*@KD0 . K@  < B 08 0X  DKp  05P  KP  0(P(KX@H@P@T@ML@ -RHL`p$H X 0P @@ R,B BQRQ0Q@P`Fvd2TLDX@D@00 0 0 0 0 0 0 0  0  0  0  0  0 0 0 @^Plm@d@i@V}VmFP0p0`F@@ VV1E0\\0\ 0 \ 0 \ 0 \ 0 \ 0 \ 0\ 0\ 0\ 0\ 0\ 0\ 0\ 0\ 0 @`FPV 0 0R@P`Fv  @@@P[ -PpL 0눀H`$H?%XL\8@#8P@'XPfTPLD@DTLD@D(0U[E>^E0PEU\EPE@- 0S  00 0 0cRÌ`@0  0"0Q1 P0 0S>h -0L0Sh -`QLp@00SP(0^ ^0 01^ 4# # !^#$""1^"4##!^#$""1^"4##^#! ! !@D!$""1"#T T $0@T0 01 #h 0 "Q p-L`P@@Tp -pLAM0`, . 0J/K(1 |00R0@KJ_K   Pf@0    pd`0,1((K 0@-@P $^ 0 SΎ809P  L0  ( , 0 8 < lPP0P@-@ $P Q < ^ 018 0C0,0<8 0 Rp-PL@4 0@Q1S``.Pp(0 `S00`(0,0S0 ,00(PpUE20Pe$00E`S0,0$0p040$Pphp0}(}0%0  -@PL $Q ,0S 4Q00$,0$0P $P 00  00 0@-@P \00^ ^l\P:0 -LMpPL $`VI 0S<0S0S < 80 0(K08< 80080< #4 B80< <0 S0 h0 hh0  `h0S @ 0 0P 0@P0P $P 0 S<0s3 -P00@Q0SLT$PUQ (\N ,0SK 0(! `P 4P $ 0(P0,p >LS.Q :%<,0Q P0b0bS.00 L P0l0S.0b0S>0Wl0 $0 #4>4p$`0% -$@L40pS` $P0 (P47 (Q$ 02,(000( PcU4:b > (0,00 0e0`U`1`!  q>PU 4e j>(0,00P00( 0S00, (00PR:0,0 -pPL`P4 $@T1 0S 0 S+0 S  > ;0P P 00( 4Ub&>(0,0e >,P0 0 -L0MPP  $PU 0S 0S0S0 S00D < , 0H0 8p<`@ 0S񟗗`iwwwwwwwwLijjjklDi`mopq`r\ssttwTi8i,i< y< !  ;< 0S  0  Z  0RJv`V0'<P0S'r0$ 0SH͟`F 30 `  0 0p8Z  0RJv`V'4<'<,4<0`80 00p 0S < H  D00<`8p k 080P\ 0S  07s`0Z  0RJv`V 0 S\kdkkk 0 0T0 0+X0 00LP 0; 000!q`F<07s` Z } 0RJv`V@˟("('8,Rc`0@ 0p@0Sg DQ01 S@1 @!T`  H=@0D H0d d dD H @0Z M 0RJv` V"'5t  0 0Q\0`d 'w`FR0 0h Z + 0RJv`Vʟ00 0'hq`Fh\0Q* h00h0S S.0L T0l T/p l0PZP< 00<0h0T03L@ C 01QZ  0RJv`P Z  0RJv`V:7q 0`ah UP  Z  0RJv`V:^`a7q< 6 0n00'q`F(P   Z  0RJv`V:71a q`AZ  0RJv`V:71a  s`AL 0S \7 000 h0 0h P*d `0h ^L x:0S! S>/΅T 0 l@L0T l0p` 0P< Kl0`P00X0X 0  p0d P0< 0 h6 05T030CL01 P0 Z . 0QJv`S4  03 @C403<1 R0 Z  0RJv`7|`lS``@ 7p0  0@ L% 0H000HQ Z 0RJv`V:1H0C07q@ `a @ 00X030CP01 P0 Z 0QJv`8 03 @C803<1 R0 Z 0RJv`7|`l@``7p'0H00D 0HQ Z 0RJv`V: 1H0C07qD `a D @,0DD 00`R00< jD Rr @D0 bSH @c 0 bR a(00b@40bRD@0 Q10l@0D0H0lD0 0 R0@0HS 0L H DQC @0H AD 0H 010S4  Z 3 0RJv`V@0Dl00@0@0Q00 H0 a8'4<,'<4 <S D@  00D`@ p0 0< H00D(08pS<`0S 0@P @P0< 09,0@ pc`b0 00@ 0@0 0RV0 f q8 QS@00<`P  \ 00R40 <P<  < <(KG-|M⠀P00\ 0 S |@0 2R02BQ0`\ @00S@T@ \0@ @@@'@\ 00S@T 0 sJ QR0Q0P0S< # 000 Q | 0S4Q 0$A\0P P 3ß(0,  (,0 3ß(0,00S0!Tp!p1' PP#0 \00LS`$P08 8  8 800@0i^040@(,Ŏ0@`@0ià0%3l l 041 R @0@# R@0B00|0 02S0C8#(@  P P@@a800@|0T"C$ \ YPi0 \00cSPR :  0<Q00SA 0P0 0pa 0bC1 0wY $ 0S0`4 @8914 @00Q  0A0000S@010p|ЍGGRFFM 0`H?/A2z -0L R0 R P0 |P0 |@||0SX@` @PQT0D0L 0S 4,wM$jMMN -L M0@SK+1P K0 R 0DN 0-L M0@SPK02P K0 R U0̑TN -L4MP@2'唧0匇oS000 `gR   0P` mS000 HfR  pT` H` $'p= H0@0S0 H ,&p 0P0 0S 10 -R% 0bST0SL  H0SOWppV00Lp L0 `QV< (  8 000C0Sԡ004K 8DŽ@̡0S540 R- @ D 0@  T q`pnp`kp`hpW0S `: P p @ ` D < Lq`Pp GPP+ 40C SPl,,xx@? p0S Z 0P PPpe0S a0SH 0!R0S0S Z@Xw VP P R 0S0SH0S[ D@ <PP PQ@ pT RJ 0S0S@000C0SU4K` RPPl0S40 R| @ XP D c8K0K, KPl0@0 ,00D ,0 TH0 X00X0H, X00X0H X5PL sD@ o{P KH0\塁0P0S0L00@ D0 #P\ 1 0@0 D0 .pP@  p D @  @ `ꢠ"00|t8 d8 X8  H 8L,wdN̑lptNNNhp@-@P0S@ 4 p0S\ /+0;;0b @ fu0S V,0S -P 0 R-POu0S 00f0hH 0Sl0 0 PHh o4"$ %99h$9:@#999 -LFMM <t;6*D0T0C0 :!6+P( 衟00 PuTuM 0000 *0 00pg!$r2 $Xds)000@0S SBKJJ`+4KjQt p$  00C0tp \0@ 0R գ4s~R (w9 :h$@#$T(: %`:::: ::$;4:T:L:y0;H;N -LAM p`@PBK( H .H 㕣 0)W   ( 0R $KV 0S: @x*P 0T: SD0P 8 0S: (w<\;$9h;N -LM0  -X2LM 040p  4 ;;S  0SSYEPPV 0SJ4 Y, P` ,40+@+PU`RP ` YV4 "P4,/+0;;0b\c/00S@\40 @ + @,0 T0000 00S0SU,0S x* @f40 TP0PPP4@ 040P<  40~$p; -LM⸑<0Qp,0 [8P 00 4P* /00S@0 @P, 0R(K0Q`0@0 P`0OO 4D;$+4 04P  K.?K0P  40@ hK.0 0 0<+ 0SP0SP(w$N; 0  $ p-d`L0S TPT 0@1@P$0S$$000p##X% -@LP$00 M0-LM0@0P0f '00CS T<44'00K0''00(R; 0-|0L @?P}od0 P 0S P 0S0S00S0 \%#; -LR(M00Qp h0b43X^u  0LQ OTUi H 8\J0@O /00@@D @ /T<9 H 0Po 050O<0 8@ H, 0H< 00 8<  5ɯ @0O 0 @T40 0@ 30 ,0O$!D@K0@P U`] S1 R(K  0@OP`0 @pP SWSH@DPK`0PO` 0 @VU1 R 0 40kp<0Op  0$7p%$P$8RdR|RRR 0-PL@T0FPT0 0S $( 00S:$ -$ 0LR (0S  - -00!0@S0L1! ! 85H:pp\0Q 0'TP@+Ġ``+ 40P0Pp0;&P|<d0SP@+L``+88 30<%D%0%$8%T@%L%(%,%< -LRL@2\pPs 0 0BO?m PZ14,%`Ps 1 ?m1 0W0`  P 0@0@0@ 0$@p@d1\%R00 Z P1 P#U 0(  $1\%R(0 ?p  ^, 00 Z  0\%RX0 ?  ^ 0@嘀0Qp 0 aX0@0@DpdP%PP$ $T\%#X%T%#SR -2L0M`0p`pT  0TpiUD"0S: 4bQT P | "P@PP0TKpǏ 0Lp H m1D @ *dP0 p< x118 `@4@ /T0K 0 O, DKDǏ/@ .DQ7 <@pǏ pL K p`TKPl8@ ?l44@< l0< T$>Q 0p07 g20@ W,L4 Rw0S04 R# pyğ0 ?k404\ 1> A0 10408 j  B V V  V p(KI#0S:B# 4 00083@ @U(ß4#0P\Q (pt"0#\Q t0p  0S80Ÿ00"\Q "0"\Q ^xŸ"00K\Q00d0X0˓L"0T"\Q00000K 0$@ Ÿ,"0\Q00"0D00"\Q00000K(0,@!0\Q00!0@00!\Q00 000K004@!0\Q00d!$0H0d1\%RB 40O0@41<1\%R404h0 404O0@ 0@n"F60N"00Zq"p00=(00s03ix'(Y0Sz Spg40O0 @tg,pl$$$H$U |ST$PS 0-PLM@ |kU K0T\!0S:N i@Q@<k04!\Qp"P# k k1 R(0 \Q, k0 \Q0O(0K  k0 \Qpxkhukd0 R \mk04 \Q0S:`=$$l=T<x=h$==t=, -MLMDEH <\, 0X P( L8 D > L(RH80 )P D, 0R (KX(HH0 B8( 0 ]'48HT00tpǏ Po t Po8"5XHpQ0K@0@ 0T aQTʑ 4 H8 4R 4(R3^z  10 8H^ fHD(g4(Zk >K0S@P8 LH pCt#0\^K  1   RHHL<0S00^3 0 nKH(`F`F@0 00!"PH8B\0"\Q 0K0S@0@j|2@@000QPQ0 ! R H8.K ' 000<0 !?0003Pk4 j4H\la@ 0@  r 3 H"P 0\Q <8! 0@0 00 #0K0S@0 @q0<AHD (w$T=> >%=h$d$N -LUM,0S 0, ,00806 6\Q 00 @xF0P: S S\ ST6^n 0(ŕ /R \ 6^i  0 RKAAh ,h&($R>Kp l 0 \5 XE 0BOhE?DE gpU\ed ` 8U 4e @E Kp l lBnK`F`F@0 0\0 PL!P,C3\%R 0 L5O0@Ui3 R @U(0/08 20 \P 0 \UXe21COPU`p2TU Pe P`hpǏHe 3 D 0  R/ $2PX0OD%0T%P5 H]aHDH D Pt0r OS(!\1pTP%Q PT P% X0 S R<0PES00T1 0 BnK`F`F@0 00z  P( 0\Q) 0TUPe0S@0@h0 (0TUUh0S*W.K \% X5 m0 L5O0 @MD?0TP%0S@0 @(w$T=> >%O -L@M\@KP`@ % 0 0KL @P <` p(t0 p0\Q `,%pH  0@K % $TH#$" -LpP@T% @0S Dh 0`@P``0 0\Q ,$c00i*P 0: S`0P\ \ @ $0S h$H>$$TH#@>9" -`LMXH RS, @4ȟ (0S 0Sp P ǟ'0S0@0 G0S ǟ0S7 R ng|0@S K 0S 0S 0S XX 80   O  $ Q ?KP``F0`,_K`P`P`B2 MP`K 0u2/R 0O? 0@l& @Ācp 0b 0xB K2@fşu0S %`PU`0P@`P`%`M5 R 50,PO/Q o 5 p@PELş@_@P004@"%8Po% "2"_K`PU`P@`P`D0`ğ0S f|4@T f@T 0T0S8 tf@T `f@T *#0S84Dp q00Dp q00, 0R(K`" (?K sPS3T@@@@0S3 R2 ,ß 0S. p, R*D0 O  & _? d0 0< l21 \>Q,ʠ0p, @RʰrH"0TBS8000, Rb xb@ 10qŸ@ ,0SHR@g@d@0L_\2Y!0S tA0S 0Sh0S6fPx &KPf 0S8 qXc/9xfpf 0S^\f 0S\HfY@ fJ @ 04@0 0T eP e eee eh$(wP$X #L$@#??$$X$SS$%@ T"@@?#d$"$%D#%H$%# AG ?@?@,@?4?`?S@AL?T O p-L@M P`K0S 0S  xT> -Lb@P{p00"p~ N0@+S+llllllllllhllllllll,llllllll|llllllllh1w!0001m 0>0!Sdd00!000|1 c 0|t1PdK@1 T 0bqD1  8d0!000 1!0000z0pIP`g C0 R<V 1P@@ 0T0Pl$\$T,w\Th$+>P$(TD#$$W E P%G > -LM`0 HP0pW-"1> R.#` 0@ 0. 80pW080 0@P`Z  P 80pW080 0!`!0@0@Q ڠ1 R= pd / P1 ``Q 00L1 R R 0S0S R0S 0S0 0S P OPPH0| `Wt 0@0@QTY PW%X$ETh$tA$L$AALxWXA -\LM,0SPڼ0@Px@ tP D x 0, xPK`@P`RxP t` 8ڼ0t/x@ 00T 0 PoPpǏ`pT 0/ XP`1> 0P@`UVW4HTLd@;pǏpXʠ @ hK =@P-m͟00,0KX 0-0=0, R|ڀ@ |P @0 @ PoP ` 4m|0倠O *Q0   0OP`Ǐ`L 0T<\%R0ɯ \0Sg < Rc l< R\0/ X 0 0@ @1>0P  1  |00@@P$ `h̟0 P,@0[0  0, 0PK`@P`QP |` ʄk00*(K0@0 @ pPK`0@0 0P@`P`ȀgpYZt˟0   P 夐 U 8;`  p l JQ K GD Ka0pK@p l K P l  R@ T DR @ӕt0 BR @P  0@!K000S00S  R K00KP!%601@P00 K hKL H0 $,10 404 10 \Ph0O0 /S x1APh00LK 0S 0U`KP,!0\Q00h0 00O0@FQ pp RPm0Ws0 0@#1?@r$X$$Tl$Th$@#U %PUP$T8BB@>H#B"A#$"(BU" UB%H$$TT"BALhUW\D1> 0P@`UVI K60`0\%RF 40O0@0P0\u Z=0PV=@Pa V0 8Q`0@0@TAT!0\Q  0  0S2 K00K 0 40O0 @=P 3 U0  a  P K4"00K00Th0S1 Gx |Pw  A -D0 ML8 , 0N$ 0p)PK$U -L@M@ hKR0 00, KX0 0 ,0S+ڸ P`Rp Vp`Ui@P LP H` C0hKS 0 P@`R,0 S 00(KL$$0T -D0 ML8 , 0N$ 0pPK$U -L M0 0Z , :0쐟쀟,0  KP, P U, 0U PU 0S\0 | 0U R 0R Z 0@`p0,0 ,(K$E@-0,0,0S@TTS -UMLMP'0,0 00CS񟗎pp  PP 0:0090J|F>K0C 0C t5 66*@ tS|0 1p6 bB! dd6 `4 X6X&Z4K0d0`00 0SZ S;;SV~KpGpG,(5)5(K \%5R 0@`5 \E ( R01 0#SP %0\Q,0(0,0p0t@(  R01 0# SP R P(%0(%\Q0X000@\0T4 PD t0L4 HD kZ4$p0Z0 "0`00@0 0S T r  Pğ  @$P%DPpZ#0P1`0U0:0@0PV @ 0S0SPV@, 0R(K`#A< 0 PF $#0\Q: 0@0 @L7 0@h5 dE GB~KpGpG@0 002 RSB 0̠  0SS 0?044 0 R|P p4"04"\Q 0@0@U{ rjsw  h Ÿ Pj /0p00(0!0C0@0 @$P0PsZ1SpA 0̠ xd 0S `\H Dr {P( 3 0Pr  ^ gP  Y0p0CZ0NPQ4(w@C:\C#X%T$TdCC@#h$U::CyU9`C(C CBCLAO -LM$$ @0 @KP V -LM44 0, @8Ph R*A R P) R 0S0S@00V T pW 0@P`0:0 @   0@pW,Q%L$X$ -L@M@ hK8|"0t",0KX l2l"0, RڸX 剁0S\ڑ pPoV0U.LP H` /00CSQ , | ,  !QW R P^ R 0S0S00 hKp x p0S0@P`!0,!\Q0  000S hKX p0Sʸ0 ,0 S$ڸ 0hK ?hK :AhK 00 0S Q 00(K$ ( TH$"9TEEE -80 ML0, 00p0FPK%V -MLMXXXO0 KPK(JX!J,0 HK TQ`? R KH!8KX1Lqp Q[ PhKXaXQxKHŵXKXQ$ETnTTʠnxKXqQQ$PPpxKXq`0\3  BqB00B"1K1X0 000SXN0S  KX$@QPPӼhKXa`0^3  BQxKXq0@%0 B 00B!!L0   KH @ 8KX1 LqHKXAt0XK  Ba?0\a/PŔbL8KXQ`AKKT K0dhl!P5K(@KA/@8KD`@KXKpxKp!xxa pKp0Kx@ 0<0|0XKXQ808t< Po 0c O`VP' (K0X!0,;+HK;XA ,0SxKP`}G4K`tKDKX0XK @OxKDhKXa,HKXA 4 X 0`OPǏ`XKXQ 0 hK5TaH+0S 3S K DKXK0@O8T 0p@W(K4!R7  R\0?00 10  B\ HK8QLAUʠ KX$5S.pPl h0U`0&p@ @ T 8KX1$%T  1@01pP0SUT XKXQ$%T  101$0hKxaO0@0@0KOx0@0 @P`(KD!  8K/x1  0hKO0xa@xKXqPL#@ iPKH^ 8KX1KT Ea0 0XKXQhKDaK,L0 p@R HKXPPL5hKsKd!8KP%X1x?N 7P`, 0RP(KXK 0R# 4  R`0?00 108KX1p80P@`PW7 W"$0#0$0QK`0X800cPK0ϊ/.Q00b\Kt!0KKX80O(K8! R8K<1SHK0APHK0Q0HK00XA$%RhK80l 0 0 08WKA`KX8XKhK Tl!P 2 RQKT2xKQ\01h!\XKTQHKTA\0yP Kp@! P KT1 DARKT \0|1R\08Kh!g0 0KTx0 R0R0 )Kp P0 0K`Q8KT1 `0Q\0?0@0RxKTqXK\0TQ0?00SH qP#(w$l$D#WV9W T|STH$E%@#W|WWdWl$TU @Wh$V$VVV0OPU 05 D0RKTK\0T0?0S5KX(K04q!8KT1PU HK`A`VXK\QUA`0RKTxK`0Tq0?@1P`0?000S' qPPU 05 X1RKTK\0T0?0S5KXK04q!KTPU 8K\1`V xKpq2 P KKT l!00 0(b@"0\Q\ 0T0xKXqXP 0\KX\ K00B` `0XK  Ba\ad$5SAh$501l `R 00Bdd0(PlHKphKKhQlqdxKp\ P KxKX0PP 0(KT! BKX$5S0C0S$ PKH KX0$54 KH! HKXAXQ,0$EUH P 0SS Od0Sxۼ -LM$$ @0 @PW00 PLH0P0D -LSP ״0G Q-L@ a P Tƴ@G P-L  P 年PG 0-/LP@P 00+8/00,+ +00`G p-LlM/Pw@P K!P0: S Kp0`rS@ ^ P0-L@P0 R 0 R 0=R0hUOROt0 R0h0l-R ɂH0 R <0<"R808Rk0RHLPdG,,wpG --LM0 0 R --LM0 0 K --LM0 0 K -L@ y˽ h! -LQMH0@K0卑PP`pK<ᅑP0: S V@@ S00S F`PoP$K2P T P`0 R000 ZK@VP h1: S 8Q((QQD"GGG --LM0 0 P -T L@HSP4TxGW edAGG -L0MpPg@P"  Ta0B0S0 T00@ S0 00a>C"0, ,0 ,0 R Rt3tt#!2(K0 00B SH' 0#,@ P 00C 4, Q0 0C#4 4 4p48@ 0, 40 0C< 80 0@( D |,0P@@`0D@ ?)O8<00夐,@@8嬀 ? 84 <P%0<,D 4@< 0B$%pH /T P @DL@ X 夐 Y 00S  0I 000DL 4 0B 40D0< ,0P@@`0 ?NT K <@ ?ND0 S,d 0S d H\`0H P3  B  B00B11X@00@0 SY0  0040(  , L A@OW8 Hd% P-L@ 00 R$hEz8Ph$hH, - 6LM , RvfFXS$3S Pu  0ȟʠ 0 Pş5 \5 SS SU us :0,\ڴP\%85R h0 S0 0B RR40NRR00^td0OS),`  ?#t$0ttS} \%h4R& 0O044D $0O84 R P 0Sl> 4OpKN0S `p ϟX.p 0P`@`` pp pp .N 0^St Pr mP(0--<0000P@o = RD0  TJ$N0S ^hm84P :H08<%0OQ |J 0hZH/8<%P $P 8:L]`0OU  0L/@D%)PH P 9L]`$堀Q@Pu`0\3  B‘B0"0B11 00 0@0/@P`PoU i$QPU@``0^3  Ba@5 B0  B11L 0000ȟ RP l\7xP0 0 "DCQ Q ,h\`P &RT3<Pb F0 6 00`pWU p0OO  Q^Pa `0O?0@@ c@P5P e0,x5P 0h%?>T 0 H5HU  ,5PE 5P <ş 5  44  O+4 E4r嚷 K, 0R(K40Sğ@T" 0(ßP=HD0SF ,|CK+P) K% SV 3-K B BP P S@Td 000P c\54 S0 `5S@Q@=4ZEur5 HKD2[V ß0>K+DLMPbR  0<0 iVfV$:RFTS8*06pKl2 Rb `BdR0 0 0a<rK82 R ,0"0 0 0eK2 R AQ0 0 0XK Rf a0 0 0eLK1 RD !0 0 0Cp?Kl1 Ri hA\Q0 0 0k@3K RF 480 0 0\0 E%K1 R @0 0 0(w##d$$IA$I% %T$%P$%$PYKYY\CYZ8ZZT[H[l[[T[[`$L%H$\%X%T%##@#III@JOKIIDYxYYh$$d$#LxK\8\[\\8OJJ$Y ,<K0K40Q5F@ R*0 4@T@ ` P0@_4 0K@P ɔ <0K0@ hF0@@ T (Ko4w(K4<Kt <Ko%%MM TM -LM 0@S `V 0n V up̐ pp d T 0`V0p8d HDLTL? 0<` @\ l2>4Q,h\pC00p`V%LN\$d$ -LM,00K, K00 `0S3\%RX` B2 R7Br @T T `U@ | PrpU`Q\"\0Y00/H2 RB0 !A `gPP@0A#O 1"1?0P HA`p-8PP`# P P 0 r3p1>0 R! "A@e0 0@A0#O 1#"1?0P01 FA`5 -LP`  PT  P P@  P8  P( $ 0 r l Pt v w c $0 000, Rh%s 0 l% -@LP  P $h 0-L@%0PP HPEP@@jP9P0,] -\0LM@(0K( 0 @ K$ K0 P K$Kp% -0L@T P  hn#L --@0L M,K0,K  | K0] -`0LM00 0@0 K P @h{ Kp%L] -t0LM $0K 0  $  K K0P $0@hX Kp%\] -0LM0S P h@X@0 @00P mh-p%l]] -LM  K K0K 4p@Lh  aK] 0-LM 0PS    KK0p @(h0 ;K0] -L@<@0VWQW^ 0S00ꔪ -p-LM@0`P0 RgP0200  0S CKp -0-L$@KM0 0 :0P@$0 S000 @ 1' 00 0SK0 --LM0 0 gg K p-PLP`  0Ap rP@@p0S P P@ PpUP@$0  @ppl^8^P^ - 0LP`p) 0S& 0S# 00 @00pll 0Ap\X PP@ V0,0(0(`@,@(`@謖lh% -T1L000,Q,p5@p 0`$P0 ,@T"0 0R0 0Hp 0 0S 000IP 6000B& ePPje@000/& ,@T h%p^^s 0-|0L@0S,@TH0@?PP 40PP@aeP P7e0h%y s --LM0 0 ffU K -LM@?p`PK! 끍P4$0嚄$0 U^^^ -LM@f0pP0Kpt P>p`lP Uh ,SJ0!K 㪣P 0KJ`\0GJ!0[ 1S000SU% 0@2 : 0 @@00@0`:   0 S`l:   |(0@S`Ld <`KP h30 0 0 0@ 0 @@*0 @@0Y@P X 20Sl` 0PP|2|`0O?   4D;S##t`2^`V u2 (2 R P 00C  + R |*(0 S;30 R 0S1  0#R ʄ101 S90!0S`1010p10S xA0S d10sZ00!0S00S00#1ѣ10L@Kp:  x* `00S  P |*p8,00Sp A x A,w't'ddd+Le'(e8'T@eXXe,'ePehele0'f\ fphd`$8ftf8fff8n<̑fħff gDgpgg 'g80@Sꬒ Ȓ t Ȓ Ȓ Ȓ h 000 10B 0# 0 10Zh80@ST 4 p  p p p  000 10B 0# 0 10Y4h -L80LS$ < ܓ < < < ȓ 0S01S 00  00 #A10 #1 0S YLh -0LPA@`|  `   0BOpcP VB?㖃! p    ' -LMp`Q pD4K iP00SDDT[0 PBP 0$ݗ'(''L'dh -LMp|`Q D@X4 iTP8D0 P1P 0"'('H'h -LMxe@D lUd  0 L5QD60S 0@p4 00 Y@040 0@ 70PS`08 `?4K P04K80Po4P 0` 0P0o ?S4 RlX 4 0 @4@84 `R`0_P 4K7 ß 0S0C0 ?0@3C  00C0 000 ?>0@3C 000t30SvL3 Q`0P0 20D080U00@ d 0 0G4K(KD'@'U hhhP'L - L0R  PJi -2LM00 S8 4 h0ld0 P2R@ d c 0= 2P)eJ 00C 08P4`\\0`"1>\\0?0 80(R0! @ d :2 0; 0@4D1 00C04P ,0OT8`S8 K #J0O,0 (@ 8K 010 O Pop@P <` @S!.Ǐ@ 0@W< !@p`p, K 8K1x `?1` d 0 0@P0 0S 08Kx ?100 08Kx ?100,V$000 (00$KkhLD'@'U hP'0i' -LMK@P,0 K`0@ P A P @ P A  0!C p  0 K4 0@ 0 @ ^K`pL =0@0O$+41 ! d q004 0 KAD'' -LM@PpGK,`b$1@ 0 A SA  9 K00` 0  0K  帇 ,K01B00@S  0K42P L=EK0@0O4;0 dH04 0GK DK'ALD'' -:L0MP0OH0 D@ P `HL` ȟH08d 10S70܀80P)0p@xpl@`x0W0HOH DpP,0 /0Od b00 0 080P0x `RU(KD' ' 'XiP'@'U Li'T -LM  <<P ,;P4KW;0S ; 0t{WdV 00ϑ: @P0fo:p   㾄`;:Q: `: Sr\ mQ (:  S4Z@ ,0EttJ @P@PPjɟ 00T 0L59 0$: 049 0B90A  E`0UT T0PD R@: R08R0EY00 8 04 000cH0 400cL0 H00O85hllll$TTl <'ht@xp ''$mT' Tt''L@mPmP'D' ȐY kP400S40|  00 00 ,00p0$@QPU``0^3  Ba0B 5 =0 B110L 000@x0`Sp0 0OH4LD ,L=2 000`1Pg P=LV>00h0 h0 S:h0<2 0<0H2 0\ T2 0 0R0PT0XT0P0P0HU 00 400@0PP40@0, 0a84 0 =(0 H4LD0 ?>0 ?0 ;0 4 D0,40S0 ,d@8t<64P`r 4  4d U0O?`@P$+4 K ФPp }+@p4Pg`dE 5UP`8d, 0a+D @ , DK< K,0K]P<KQ  P  K < 80 5,00 `d6F8< ?Đ r)Q  P33 5 5  08q@ Rܠ #㑊(d&0  K@0@1K>P A0`@ @c0 0@` R pQ 0帐崠 J)F#Z **0PN70S@P'(*0\% 8R8\5*03G*0P$8l(t8Q0\5P80S+ d8PP 0 ?0 ;0 4 D0P  r@K*0`PTH4LDVlKd M00 f0 R P000`P pV`0 008P40  @@A@p; 008#80(K 0-LMPX0@K P0,L 0P< PE 7PPK0D'<'T'`m -0L ܋ӗ,wm p-LP`@T 0@T *0P/S @0P/S00@T:/pP@0.S P@Tp0S .S0S`V (0  0S0Ll'm -1L MС`V( p1 R 0: S 0pP8( 0RX$K ddq\a\q60SB@F00CS0A0P0 Pp 0S0!0CS0 0 Pp0YUyUOOP0 S7K*. [0 R@@AjP j0d6 KHP(@FOPOP(Œd'(w`'m@DLlm|m -RLM`p, $0 W @P L  ,%6P `VpW V@ PVQ -LMq0@QP(0  0: S ( 0R:$K0S 'LoKlP`% P}s3D1  ( *p` KLP  03S ,3S iO00@7 (3S43: SKفp T2 S!3 P D0`P uP*3 6(wml'm4n -LlM`@T PK6lP 1 R O0S }0 @TK0 Q p0S  Q 0 R>P 0S x0 RhKT0  P 0 Q(+X'l'h'\'@n -bL0Sp2 R p dPP tc@P# 0A S5 < @ 4 WZ 0Sj P @h 7K1 Pc@PN0Sch`0SH %P _0 00SB 0AS)L L @4 0= 0S 'P 0S|0 0 R Q AH=P 0S KN0Sl0 Rpyv 08`jlS<  jlSE`[~ [~jlS`@@<@TU lShhblSAmlS1qqlSY qlSY `+oAmlSQmlSQmlSQaܪfAmlS"rlS-rlS- AmlS؇>.mlS؇>.mlS؇>.c~AmlSf.lSN'lSN'dJ&CmlS߿j2mlS߿j2mlS\3e^|AmlS:4mlS:4mlS2e5fQrdlS{&lSj'lSj' ( 0 8 @ H P  D|,uZӺ V~z ܉;%k9ܝX^"JT \2⳻!!A! 1!Ptu[6W3}l@,SR!'Cf I @ ̷z?؟jC-X0t'p{oaWh |'MuK,_gMEG̦W^8>u H5g-: B, qʳaPqO3( uvA2_!48E]\TʧV ± lZory"hKj60f3Ku5@z}/@C Q^mdHE2(t tIT~ٛqRotnlT!6mwl| 1&f>UTA?Uȕ41[,F'9.TZ| /CHhߏg?y҇ӳY"?rKi.%h Th*D(o]O-lnM =KKep@ z]dēdI/ . ..arch>z catdate>zchmodzchgrpz cp dd df edexpr>zhostname=z ksh sh ln ls mtsha256sha512mkdirzejectz mv pax tar rmsleepzstty>z|sync>z ... . ..chownzdhclient=z disklabelzdmesgzfdiskzfsck>z fsck_ext2fsfsck_ffs=zifconfig=zinit>zmknodzmountz mount_cd96602< mount_ext2fs2< mount_ffsz mount_msdos mount_nfsznewfsz newfs_msdosping>zping6zreboothalt>zroutezrtsolzumountsysctl ... . .. tmp dbF runemptyƧtzlist ... ...H Pt 52X'd'̑l'h'`'lp -L@Pa0p0!pp- P0@"S" 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 pp0 bQ!@+60S 0W 00 0|0 t0h0 p0000ݔ(0 RLh'Tn`'l'X'd'\' -000 0LS    ň㼔԰'\ntn-0 CR 0R0 SLW00 -@RLP 0S DF& 4A&TH UF 0@SB 10S<p `(< W0C3@ R 0S, ,V0S|V@ l R @0 S0S400S(>h>hV<]D]@ 0-PL@0S(0h%BQP x%t d\00SP e <V 0% (0h%ذnn4n@nn - L .(Pׇm @p'o "(m -LM@/娓"P0002Pp2 lR dr`XT2T"PPPfP tP  6op2 10 bSP PP P 0@SX :tP}10S Ya@a,@ pQl 4  PP `@a0<S 00K@P SL0S 1 0S0z+0S% 3KP ,K } 04 P,00S ;040 8K[P @00S d% 0X =B' ԰\+LooЯ,o`а@ȏP -0L -$,wo -LlMp`@ V,*U&/00U@0 PsP3U @R$P KKedP0: S K0 0 $KAP K " -Lp`7@&[[!>np mP2 pP X!2npL1 ApPE @`~ 0@S 0P/S @0P/S00 R:X  xPPᓒP,@P 3,P#P00 U030"S \APHy` 0:?P` Lo+h -`LV@pPq \V Vfb[RC[VS  0 ^S0 0]S0 $0[S0.P =P:P 0SE  0]S0\\S0nS  0S ]S00]S*@P"\R0[S  S nSP \SW0R0000P R @op; -`RLp00@P0@ s0@0S S ;S s0@0S S\ 4F0gPV@v @[8Dp -L`?0rS aS bS6tS {S1-000, XP & 0R0 S 0A 0Sp GP 0  @T0S04  ` VP*'Xp p-L`@P @P 0S0  T X0 R 7P 4 0$ 0S5Lp<*ppT* 0-LM0 9SP0S*$S /S\S @PP 0@00 00 K,@@8pp -LBK@tCM @ P T L$ Lt TT1P@, L4S4nP?@/PLt ,0S , ,0 r p000,0 R#R ;R Pp0000Pt 00,0qPPL j,wP,  , ,0 r 000, 0,S0P0-0S,0  , ,0 r 80008,EP, , ,0 rP 000,00S ,0 M00,R @0 S0U,  P0 SK  t  @ h 8  ,00S,0  , ,0 r 000 0"0 00,00S,0  , ,0 r T 000L ,0P$ 0S0L0P0z L0pL4 ,00S,0  , ,0 r 000,0 ;R R  X,00S,0  , ,0 r 4 000,00\S <,00S,0  , ,0 r 000,00S, !0P`0K00 ) 0eS * e 0`S01:-`   \S0S S@000S0lQP 4K@P0w 00M,00S,0  , ,0 r ` 000,00S , M PU00B,(S#p;,@G嵌 0t1,00S,0  , ,0 r 000,  ,00S,0  , ,0 r 000,0S 0| , K w,00S,0  , ,0 r 000,<, K 0S$V `  0b0 S01@ 0S 0 P ~P 9 @Tj0 @, 2, 0,0 0\SSh% Y,3P, @ ,0@,0  P<$ R<H l 00  `84 @4 D4 8$ 0hS * h 0`S8 01:@@ @4 P<D$\SQ# RD `@T`FD + LP \  0 S0@B 0T0S@\T&T\00<Si@`Hd  S 00`0Sd`P0iH$0, P4 ` 0p40S 4 40 r 800040 gR 9R1R*Rj R;R_epR wRZVk`UpSVb44K ߈0@s@\X`@0S40 4 40 rT (000 R  A40 40 0RT0P0- TlT"@TT@@"!p _F$0T$40L40040 wS,0  , ,0 r 000, 0;S}0,0@,@ 0\SS ` @PiD PP`0 HP0s 0@T E 000 S 0 0Q645(*''p'ppqqLq\qqqqq@* ̑rrr(r@rr0*rrr''r$sTs|ssss tHt8tttP*T*H*L*PU,P  , ,0 r h000,0 ;R0,0 R P@ 0`S0 E @TP U0 0n1!00g1(K -"LM0S>̂r`P y @R"2 0  #PP@KE  0ld"0S 00CS00 Ӥ0EE r@ g900010S 00A,K1P0S00#3 [ PP h1@E0S E‰ 0H 0 , P4! 0qa00!0P 0 0S 0婄PP@D呉 0| 0S 00CS00 Ӥ0DD r@ Yg))4*D8d̑@,*0* -@L 000@\ 0-PL @ 0P@000X -LM0S`p00S; :SiP 000S S,6"PP 0@\D 0l0 00T2 0DD"iP<< "$"0 00001,K坃@P# Q000 ,0S:y, , ,0  RO0#SL0nSt1 G0H00@$!0S 0#S0nS 1  0,0 ,0S ,0+;, a0 @\ \0 0 0^0^ d 0000H000 0 00,00CT))0*d)̑4*))tD* -鐁向吡L`Pp@)fP aP eP EPrP uP nP 41 @@p 1@'&1 fp0 00@pQ @0S@Pd0x@gP TC< t+@*8*<*D*t(u(*4u --LM0@``0 ڒ0DSL0@ D0D0Z~  ?TIK@u0*4*Hu -L@PCӇ 訵 -LY@PCÇ 訵 -P@Lp`@8 02P 02)L -LP`p/0wS {S& sS'0 p &P 0@B切 0p0 pp &P @Bv 0(npPȖ -P` PLpK y@ W000 n 0 0 -LM`0PPp@0S1 T 00S S@D 0@0V l0 l00 T00\0P S  0P$ h$*TuL*T*pp-0 CR 0R0 SK00 -L`zK((MP$pG!0 0R R0D@P <*0d  P0` P0V00S06#3 d= PP A0S A妆<  00$ 0$K*H*d@D4u * -/LPM<K0t 0N00l 9.00l0Q0Sm l@PT 0" R 00$P RTΟ 0SH0SPL l 000> D R000P RM 0S͟0SP) l0Q|M 0Sx͟%!%*ll000 R000 R$͟M 0Sl0 p3Pl  g l@0=0C>S񟗭          P       X                        @         4 l    P  h   [k0SK0000P 0 0 0l0 0 @l @ [Sl  l L00l@000S6 ˟0S= 10S? R  B Pd 002d 0` c : J0S 0 ʟ 0 0 l 4 0J`0s P n P KP4[S 0y䙟䉟PD9< 0U PVp )000 \P 0S JP" P 0S\ \tI@V 8P 0iS@0IP P`0VS80S$$I80S  IT80S`86#3 YPP~ @0S @„ q880S0S 8! }P 00] tPW70S0S7 0SH 7B0S? R  B Pd  00bh@ 0 ,7d\h& 70S0S 6 xhƟhf 0SXF 0 zP4 0 0 0l@0 0 @l @ PP6l 0p0 @T\@ X 50S  0S0xl 00 " \X0P< E0l0  @` `P\0 HX0T4   00 `Q{l D0p`Z&Up% \U 000C SS p0&S\SpPğ0@0S :K@ p0@` X$P0001 @D"0T 00tu& qr ßPd0@00S :K@ 0@` #T@0X `000PUl0@0S :K@ @#0@` `0PS@`@  ß0 X0 `A` "0XSX00X0 0S @X@0 SS S X0` X0X0 @`0 /Y00 \X 0P'`@TVYXX 0PK  @PK l 000S 1l @P- PU* 0s< 0 l0 $0P l0@%> 000p 00p@0S 00ll 0*)(**,*P**H*`xpht@@puu8xuD4u *$*u*L* ̑)0*~D*PU\l0sH L 7lp @=嘂 0xl  ($0P? l0 @=冂 0~4@0S 0 t @t 0,  00S@Tl0\ 00L^0Dd !bl00l0 l@T10S0S 1 L P(K$m00 P0-LP 0@@S0S T R0000 R000h 0O0< 0-PLP @T000 0-LP@P 0R0 @@0N` -LPp 0LP`@P U@@V@hN` -pLP`@ rp lP) mP ?P`@ qpp0AP` @=ϻ0P +P`Q`0 +`Q H_| -RLM|"@q?P>@ 01p@Wk `PVk 0S0N K0S2 TPr 0S0PP 1S0S@T 10TyNtA ppq0_? P .U?0#K"0KR0(0Y0@ ;0-Q6  ݕK #Kؕ0@ RU t3AN=N0+0#0K"K!pK  0| , 0<t<MzdH_|0`@`_Ђ 0-PPL $0$@QoPP0_@` -LMPP 0-S- `pC#pp lP sP ?P`Kg`PhM`PCP#pppV OA0' #0@| 2  0 =`Px @T3 娺P @, 0T00S&R+PppT] 01P` KsP@ pKP=@T 0%S\TP`{tM`T; 01P `K0S OM@T' sPw !0LSLL 2Q0 d8MXKM`E; 8BM``%`T6M`O0 R @[$ R @MT M`GQ 9G6G02G0.G0S0D Dp$Gh!G040 x<@H_D|Xd̅؅^_x -LM0P eRo v `F jp\ ?0@6S5 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 d6 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 \6 4 4 4 4 4 4 4 4 T6 4 ,6 4 $6 6 4 5 $K@P ( KEP( F``(K EP(F``0ht``4p RP 0-S R` nR eR ER RP 0-S `R`3 0 00 , 5P00U080 4 0 @T% 80  cR 8K~g\T000P fQn VaQn \0Qn \Q QPE\ \00@TPU 00PpU 00w24P0 @eSXj pT`T yP@`PVV40SHqV TpV? ;P Pp` `rQ  nQ bQ) cQ`tQ  vQkA 00C R 0B0S00C R10Pᰀ굀4Pp`P 0004=4,=0  1pP' p圲P 1p 000C1!pp0`~(H_<4q_0`l_0_ p-D1L`P8A0!hp LP PP ?P>@p@ xhp`0QU `Ep`0@ R V"T .SP4Ep}f@P `*E\0p63w44Epn@_H_H_G0`L -L0M8dP0D($)hp LP PP ?P(KC#hp0S EAL H X PU 0S xDl3p0S\D@P X`UT @gT O3p"P  "0 @T0 D P 2 ; 80 4 n80 0x@0 < 坊0pK@`K,K0 < ,0@OP)00S "0 mZP<l<@OU ~DD0Sh !bp20w mD.t10S<<@0/S4ZBT0 MnL P  3D0S> !D7 A띍1P+ 0D0 P0 7PH厍0P DP P |.Dn<@H 㯋"DxDm@P<@XD_H_Hp_Ȇ0`;|tG0fP p-PLU pCpd0 R O`ML@JLT (@(T CpMp_ -hAPL`!f`pp mP <1 8 C0C@ `P- {@p fp01 PR @@1ST TVp ! X c@V  XC@0 pR@D c@H_8_ -`L0 R$ p@@ T P 0@P?0 s 3T R @0 0S  @ T 0 00`_ -LM@PKp@Dd0@0  6fp ?P pP :P8WC 0008OC@0S  ڄ`P@ PR1S0 01 0S00S 000@$KH( 0` -LMQp@  VL0ϠAl  0 Qq(Kt0V< 0 `< 0W 00B Ln 02qꭋhLL\ -L^MPpLK`bKRKP p TT0@@@@ U/0S] XKaKlfKip PK`b0KPU`Q4P 0` , ,0 ß `40KP` R4P 0` ,  PK`b0KPU`Q@P <` 8 80 ` @0KP` R@P <` 8 PZPD XPK`bL0KPU`QXP T` P W^ BŸX K0@>C0XKPaK fK  0p@!0TRK0K \4 0 , 0@ =9L4 0 =C,0 4 O_K`0KP`Q@P <` 8 0P=)A@` -BP@P <` 8 W A4 K0@t@ K0@`LX K0@D4 K(0,@ K0k (K0P@=9B` =C4P 0` ,0 N0P@=9B` =C@P <` 80 _0P@=9` =WXP T` P0 e0P@=9` =@P <` 80 <0P@=9` =4P 0` ,0 p|^l^?Bt<^| -LXM@tPK`ሀWhK 0lpx 0rF 0i 0c$K ^l -LPp@ Ndp fP/ vP ?P>@@ ?dpp01@T `P0 [P`@T W,@TpAH_ p-LM 0S@P1  KgP/0S"  D 1`0P @g0P0fC10C0 0S0 ,0 R$0xmxx0`_\` w 0-hALM`!Pc?PA 0AT00  KfP5 \51 R= 08S9 R 08S S\ 000 R\ 0 S Q0000 lp0*@0bPE\K0@h@ (0@H_|0`̈,] 0-ALM P]c?P80AT KKfP%  0 0 rR P0S @[\dDP0@0d0 R R 00C8S@ 0  ?H_|^`0` -DLMKP`@0 0=00 0<00^L@D,00tP@T@B>FD>A(wH_ `` PvG p-AL!`a?P8 0Q@P `{P# PZ{P@ NzPp@B^ 0S > `l>T @pT>pP@U 0-S0S>@pH_|`b,8 -`L @a?P@ hp4N0T 10 00PS<0< Z@ H_|0`_\`^ -0L8MT0 0\0 0CPX0 XEP%rap2 rP ?P pP,K<PT ,Q>(KsP uP@PT  , KN=PT , 9>D0$X0 ?ap01 `Rl40&Tx=`$Tn?@PP 00T.P  v=X0STp 0 40 0 40P0<0 8 `0IVP0 8`u UD 0S C0 P0U u0  $0S1xP 0;0 0S ClP0\0 hX0S L0 cRLK^pPp<0  cR<K^`Z4 UJ uPu U0S8V  Vx 00S 0V0 R`FV00厃0`D2 R98 Pg0\0\U00Su U 0!0  80S 0SPr1$ RPkTx~P LP1L PE][  0圇qgP0E=igX0S@x@3u00#T uP0  D0 @ D0p0H L0 p` 000HG5H@T<H_H4<!]0```_ `_ 0-PLM @ `?P0 01P@PK +C0PS80S08PKCP0H_| p-,QLM$!@_?P5 0aV/ 1 0K&P+ 00 R 0 0  Q  0S  0YPx*\o X<xx>@xP4  <xGoH_|^0`̑ p-0LM` P@_?P 0AT K0V4\0\  00 0l x4W<xO<0`H_|P R4 5:0Q|B -0L` Q\p 0PS @0S 0SP00@S,ww - LR@:Q0AS Q 80p3P000 lx -LM0P@ @ P&0 pP#0:0S0: pP]  `PG00< !@@p@3{0@ `P4!@ \P `P  P. @ 0@@ @ P @ 0@L @|4 @u @ntH\4 p-L@PY0`PP p P P` `V`p p-LP@0`PP p P P``V`p 0-L@0P 0 P 0u30 ꐊ p-LlM`PH@PT0 RKpKsAP@ : S I@@h_ -LM`PP@p1 0A#Si i ,i i h h h xh Lh h g f g g xf k j j j lj @j (j j lk Dk k g Pg Pg Pg Pg Pg Pg g f i KbP0#50#0# KK$APKAP|d 0Rh 0RKAPK AP 0R 0R $K 0S2P"000YPKP|@VTKP0: SKP0: SKP0: SK@T\J`@pK T; 4P` @TJ4PP*T 04PP<<00C<0 4P`<  @D1`P 8$K@pK 00 RsP @ 0, p3p3@pK 0 0  ,@0 ` _ l l lЊȊ_Ԋ 0-LM@P$KmC $Kp  ?S<8K0 Kpq8@I܊ -@LM`P@Q $K 0/P $P 0 08 K0C4pK%C4@ 0P ,@ (P ,aP%@T @%j (7 7``$ -LL0PS8H 0 S S0 0   0#  A0A0 S00p`B"Zp?@C "P8s 4r 4r 4r 4r 4r 4r 4r 4r s 4r 4r 4r 4r 4r 4r 4r 4r 4r 4r s 4r 4r 4r 4r 4r 4r 4r 4r 4r 4r 4r 4r 4r @s 0SV0SR 0RQQ  OP A!zZpp?@0!R a7``oXhA\!bZp . ?0B"S8s r r r r r r r r s r r r r r r r r r r s r r r r r r r r r r r r r s 6W |Q @x7QQ@T  8P$X*xH_8`lx0 ]0@-@^ 0#S^ 08 S00S0 0#S 00 R00^P P0 SPR R^ J0Q S0 B00Q B\0AZ# 00000 -L@`>|T- p@PP 0`pc@W P`qP kP@W   -LM@R00?P`p@ 0pUWlŸ (0K P{ T0\\S@DLT\"0'P "P `P =P :P @DL^m0 g'Qe "Qc `Qa =Q_ :Q] PP^0 'Q "Q `Q =Q :Q \QP^TJ q7 1  01 0D@q* 0' \ZU-0/S '0/S PPpp0PdpU@{ Wl{y0Sp(  0 0 008客PpP} ``8 $ Q-L@' T# AT *0Q/S 0/S@T:0/S d 0R /S @T:0/S Qd p-`PLP@VP 0R  0RQ^p^p -PPL`@p 8p@@P Th0` -@QL.0  V]00X p`@[T*T ?T $T P(U /TpU @\T0 SP` U~X 0* 0 P W0`, -RLxMJaApPD0pp0G P P4`$KP10Kt!( , 0 0(0Q*PP, 0` 00 @P/ ``QUV ;V& @`, @`DA xA@(@ , 0 K?P0 R7`T (0`0@0`_0,`  0-@ 0PL]P 0c0 -LM0K` m mPp   ZP P0xU*oZP omPp  (K @`DA AP@P0` -L,MP L T @ᚸL 0 40 0 H 40T0<0 8 p P:P8@w  YD  0< 0 bR<KU@Y R   P /00D00D0 H<0  cR<KT@PH 峷T 80 T0b CAT00jC1T@0 $1`p@pW` 0,0 , K~P LPQD p@( ᇸ@`WT 1 00 R P80$(K,0S 00` -RLM<0 ; @,P`4`KH#-8#000 40 , ##0@T T@T"0 !>y|2P 0 0p400gCz @W `2  @Y8 @ ` P X`P @ 00kV 0P KP XP @  81+8 80 1 RW 1 !0 04 4,0Q8*00040 ` 40 <  (K !VIZ0 P`` VP @PA0L<x D0X0@` DA A@,@ 0 4  407 8+0`_^_^L|L -/L`ngHPDp`@P祟P@ T iY(y~ -!LHMp0W,0 H PM dpK PLAXK@0[?[ 0H0[XL0D[1EP[C`[@b0X KX L 70K`:K9K8@K;0S0S 0S0 S0S0S  P H, 0R (K40$ ; ' bp*(w]f y -@TLPL x0S C x  Tp0@ p0TP`[]@](x R p0 Bx p0`L]] -`RL@YPPT^ Tp ppTPW o U 00 S/R  0R B/S PUjW10@  `1`0V0 T@j DA  f1A` 0V@0T00  oP@j DA  AA 0`[<^ 0-LMPK R@PP0SH0 R lm R@PT[8_ -L M0S 0 0@Q@ K0 KvP1[S S|ࠁ ࠓl 0@d{P[,y1[S < 0W{P [y]<`_ht@xp 0-L@P}\ 0S0S @p00S@ ᷈@_d0 -@L! @@@ @@44okP, 303 0 h ]$u e`b] P@p 00 8 0-0LSP @P0PS0 0 $;<0404 00, (0 |::::::-l 0S ^S 0000S$ >R@0̗?R!00u20 0 ::0l -tLQhd0d @pT *T0`VPUzTP@00::::: - 0pL`P@0 ^000@S@0C@0000`ጴP  r 0  @8t* 0p-Lp0s TT 0RHHr P@4bUᱲ0c00D0c "S00!000o!0PL 1pW)a0 S@10`PcU]0 0CSX@0 0CS@ TT 0R( 0R <qt Q!0@TtP0S:00 0R>*@DVt Q00 QP>d\@P d0 R} X0 >w/@::|:::::::: `4;0; -\0LT0L0L0@DP 0540 ,0 7h::|::::: P P p-P0P`0 0LR@ 0 R R00CRphp!0DS ꐔ    00C0000::: p-08`PLP @0U@Pp: -L - L p0   : -LM`@p0Pd K"d@P `00`H0H T w|:::::,0 (0$ 0c0AL_4`:: P-L@ p D 00 hK^IT?@hv88 -$0L x v] -Xp@LP P <`0T: 0S0UP:: 0-LPP @@ T0 0-0 L\+ 0P @ @T!:\$Q \ q 0_Qq 0_Q $Q\@T*@00::8: 0-0L@Q 00P:|0@0hlP P: U T00B0R T*0B0R T:::: -1!L@P\j q``VE:\ 0$R \ r 0_RLUD r 0 R0@!0 ӑ  T q 00 _Q $QUU q 00  Q 00ӑ\`V* `yq 00  Q` 00r 0 R0, 0 &:::8CL}U{ -4LP $0 A :: -0@LQ 0 Q 0 R 0`S Q0S0S0S0 SS CCQ0y0Sv0S  C|:::_ -0L|: -0L: -H0H 0L S 40R ::: -H0H 0L Q 40R `:|:: 0-0 L P- 0P  @^!: P$Q @ P@ Pq 0_QPq 0_Q $Q@ P@^*0H@:|:8: -L -L.0 g: -LD0<0< 800 00@@K|:::::: -L> -0L `R0 PhP0@z|0 p d@`0@嘰TPT0T @@@Th _4`|::::::: -T0L R D0404 00 0@:_:_4` - 0 0L:: -0 LA:: -0L4` -0L|_< P00( 0S P0CBl,;0@ Q-L@!00@0@ QP =D0 @<0 40V 000::(; -LMpP` ȀȠ04 <0 8 0 00 , @@@@ݯ4 0 b00Z<08 040 00 ,0 0DȯJY Y (K:|:::: p-0L@`0 ^P :ϠQAQ 00S 0U^@*pp::|:: -|p|0LP R`*\@  `ܯ د0 0 0 ::: -L@`P嬀`@P0 ㌠ 0 |pS030#0j0V 00@0Ttw0S:00::::: 0-1L @Ts 1 RD0S S S "S 'S0S  B0S0S"S 'S 0S S S S S "S 'S0S B0S PU "U 'U PU U U00zP0ۮ D0T'* P P "P 'P 0CT: P P0_0 P P "P 'P 0CT:"P 'P4`:: -l0l 0LS`\00000C0P 80 40 -$;: ;::T 0-PLM T@00Cs0 0K0KPK 00Cs088: p-d0LX RT@T`0PP8f8 1?1c"10c Qp:x:;:gfff -tpPlp@LX`d@D0 <0 40,0p p:|:::::: -`PLP LPD < P0P0f 50%QA!V0Pfp p@@Tp e` PSP0 0 B cRW@@T P 1U@@+T00T0 0@Pt0S:\::::::: p-0L MP 0 K$KK a0a(@K @`PKp0 !$0 `xV P0AP፭H aPU$P::|:h  p-P`L@T @00TPc@PdH@p:: p-0 LQ 0Q` 0 pl`tP0P A`0@d0S00CP 0p:X ;;h:: -0 0Q tt0 `L X0R 0`@RJ@d:|:::: -LB -L -H0H 0LQ 40Q,:::000 0Q 0 R :|:: -T0T 0L Q @@0R `9:|:: -1L Mxx 0,K n0nP(K4@K0K @`P3 U (4 ) ($K,00 (pcVW00S@ X (0  0R/S 0!U00SQ((4 0,-(0 v::|:h -L -L -L -Lx -Lp -Lh -L` 0-0L^S@P Pe0@ ᮔP0 -0QLp @aT`*@DT:PPX`0@Ϋ@0@^SDN(0P  :_|:4` - MLMKK I0 , -1KZ<p`P@1p@0T-9K.yK@ ^KPEPE@T9  P0V 3 p1R5 h1R; `1RK-0KS20Zp0'81 @nP 0i-![ ^R@Z /`P, 0R*(KV Z ^Y *00hY ND bZW(wd( |:4y -@0 PL 0px@`00Cs0 V U }PPxPPV::|:: -L,`p 9\ 0S  2 1C P@T@T 0U QP0@T @ W0@0 P: 00  0@@)&\yd:x: -p-ML M` 0 R0 $ P#  $ 0SQNK@D$ @D NK@D$@D $ 00\ | 0RKp$ V(wDy 0-PLM00 @R 00   Rp0 RP0 R<0 R$0008: 0 -h8LM \ 1T8  %@P 8喒P,8  $ȟ@0 i0 d 0@^ b0@X <0@R0 M C0@G c0@A #0t@; 0`@5 0L@/ 08@)0 $$ =0@0 0  0@ 0@ h0@ d0@0  B0l@ L0X@ l0@@ >0,@0 0 0  0@ *0@0  C0@ f0@ g0@0 <0 \ ?0L@ ?08@ 0$@0 0 0  .0@| _0@v0 q 0@k0 f0 |a 0l@[0 XV0 HQ A04@K U0 @E u0@?0 :0 50 0 y0A@) [0B@! [0C@ [0@D [0@  O0@ O0@ O0@D O0,H`@ [0`FP@ [0,P@ O0`@ O0P@ 00@@ 10(@ 20@ 30@ 40@ 50@ 60@ 70@ 80@ 90hPE `F5p@ [0@ [0@ [0@{D [0H@s(K厐P :x::k_d H  < ԛ ԕ ̲ L 0  ܛ ` P  `  h l , H  h ( 8 X  -0L @ 0S (<5##,h/#0 h'#輌Č - @R0 000  0L Pt hdx: -MLMŸ帢@^(@ `Pp: S B_ @T Q 0d @"T( 0R$KP" }낎KHH0" V^ 0S2@T@S ܏PP0"1@T r@TUpAp t1@T @S ṏP0}< 09P9U @8 P ᣏP0@T @S ᗏP0[21C 0@T @T PP"|TP L`"t@HS<p"m:(w\yGďd Ly -3#ML M3#3#3 `3 S3#帓K@A A@`, 1P48#`0e0||#Pp@@0c00 F cDCD3  h10S$C\ 3" #0l0cCP00쒟002 `-(K CP40( Ks`(0K A2B"| R# @Z@Vm PF Pb PQT0, $2@ $0 -8KR000```P01@T p@T PVʂKAA LPVpW@Z@W00S 0`!Q P0 0c, 0R'(KW! R 0S  ]F=gN0b0 0C07P0J3R::::|:(w:4`: `:::0;::4;:::__::$;:(;dd ,;Ty -PLp&`P- @eT:  PR 0gXR@ @ 0gR00@  LP Z 0gX(00W  ٍ -LM` 1 pPM]V 0U/00ń/\@0@0cS AP@P/\ /ōPP 0 0hCPN 00`3T %P _ 8'PP 8 0.S0S .Si 0.SmFP $0 0cS ںA@ q 0H0Y 1!0@&PP $ f00 lRA@ d*1 `Y 10I(K@0S `0Vሁ5L* ` kH1`0S KM+PT U0U/S0: S SK&P1: S  0 SU0U/S 0: S SR 1: S/0 0 ႤP 1H@` DA A!`@`K&P0` -0LM<p00 , BP@0U @PP0 8K(K8 4@ P(@ 4,U `jcFa@f$K0` -L`pP@PP0U*- kPX0@` DA xAP@Pd 0A0b CahC0` -L$MpD H0 0{S nPMP0UO*DH `0P(KPQ  z0C RS R {R0 }R0C ,RS  RS0S0Z0SP Z  Q8P ,  P U Q0P{S0P O }S ,,SQ 0 PD+(Koe1@` DA AP@P,Q, D0H0  @cj804 PBPc4 0`` D@@ آ0 8<0 Ң 4 <΢@00< 40 @pZ0 P8P ,00,0 0` -tt`0@Lpw.@@PP0 P 0pQ0ms0`_,` -LMPHK @  /0/S000  0S0 S 0@00 0  00 , O00 (0`K ``@   80 4 L 80  cR8K?P0 X  Z   0S PD0Q D0 D =ZHP  _ Q    00 ZPY 0 0 "" "Z  R Y ZV Y 0 -0  00C0 40S  00 Z !  0儠 0C0 p Z p P (   D@T QA  Q0 R00S 0S0 `,0 R `Q !0J]S񟗀         D                 D                                                           R0 B 0Z Ze  RnL  000 00 0 R 00   00 䨐 0 00  R0 S0    R0(  0  x0 t x00| 0 R  pz0P/S@s0P/S W :S 0 cR ڀK> @ 0S 0SS|p0S" +S2 -S  U V0P PL8U |tQU 0S 80 cR8K=0S00 00 STd X@ , <`` X> S`S0@P {Z @K 00 Ep N)p |0〠 p A00 p 0 p 0 A   00#0CS h  0@Te  #T  Q00  0 9 00  000 RQI@T*T000 #0CS #450S:00 R 0@T@@@  0 @PD0   0@ U5Q00ST 0-S=S ?S@ 0S 4P 0S0   S0S 0 400c0 P 0P0 0#0C SH H  p ' `p  !0P  $00(   0S @80 cR 8K<0Tp00S) 0  `p  0 $0( 0 0S @80 cR8Kv<0Tp00S)00 `p  p p Yp 004, ` `@TQ 0P0U*៟  PZK 1 ( 000 ``, 000  80 4 Yc  /0S  Q   0SzczJQr0 t 3 0@  0  0 a P0UM*` ZP(K|_L\`̑_lp_8`` _;`|  T0` 400c0 0+40S /pP 0P0Um*p0 P I@ 0@` DA SAP@P !P11 @`DA ?AP@P<@|  0S00 0R+00 %` 0` 40ᾞ!0@P ac R0 00    00@"00@040jcpP0%S! ڣS S `V0S   0S` p  } ?P;PEW0 P40@XC \  0<0 ` X#Sk)pp@`R3 J`P( 0S K& J`@|P  4| 2f=  0D`     |` ` 4 0 | dPK@K0 f b0S @80 cR8K:00 R `0`PV 0S|[AP 0@S*S0]S @V*Vo@ 0Q  0S00S T  .:&00 Z?  P  0  SD V` A\P?0 00 c[P 0@S*S v  =R e ^POb@ 0 :S 0  00S     0 R  #70SS P@V @` @0'Z`0 R 0@T 0S 00SGg 00PI`PP Xp3X@ 00s03S+P@ 0 ^Pa@ 0]S  #0BS 8@pE\r^PP@ `aPU 0 T @g DA :A`p@#SRW@N`UK:0` 0>P p`@0` 0>P`EW20` (  N2p/@ PP`F  U  Q22p 0@P 2U @ -;X  t2000Y @ @ 0"00P00 Z4^ 2P 0 P 1 P  0@D&10; 0 8 Z P5 0S0 l .NP@@ 0  Z PU00SP NPP 0 q"P 0 00 00010  -PP 0@poZ]h0P@@  0_ 8XN0P0y_D_^8;_0`L|_` -LP`000iM  @0`|;X nR0 00P;000 #QXPMv30꬐ -x0tp00lL @`0PPD0D05 @$>00008_ ^__H_ 0-@LP M ,dM@P 0h  _̐0PR000AS | 0-PLM0( 0 , i AF/$ 0 0 R<   0S41  b/@PA, R  (>. CpB K041,Q/#( 0 0% P H0 0. >$0 P0R@@i)F0  0S UC h0  .A`8$0@FF 000`_,`h<ܐ$ -0LM  00  P,0 0P, K  0 .\? R>0 R@ 00 0;0  0S O@P 0 @ W0 R^ 0 RY `(X >$Q \KP00>X #,QT X 0HS񟗥     0-S 08 KpP<0S! WN= P @0SP  YQ  :P3X W 0S 08C80CS4| <  \ p   p | $   l < R  ,pWw 000 00 S<  0S0 00|,0-000S 0  P 0S!N< R0(Kxpy; R 0@H  (X[M @+\0KS C\K003Wr\+BmPh 0Se 8;Ra0 [0 R  0H0 R 0 RKzP0: S`0Sz M0 Rt: @@d:  A4 0 29# R& 40 R" W [P .@40 R @440 0\9 0@40 @Rt ;40 R| 40i x0 O0 0 R  C0  * (\0K GS@i)D 0X MXH (8XX@@SD 00  0 0 0 0 p30 0<P0 000\0  7X 'P0 L 7'\KH0 D 0 0 0 0 0S00Q0#S0<\0 000 0 080K 0Sx 0 64 006@P t6 ("( [0DSXT0 r00@ 0Sg 0 Rc0 4 40 R 40 qP  y6Pg40040 4 0S0 0SB0 R> 0 dP-0  [0 .,5 5@P 5 ("( 0DST0 00 0T00 0 @ 0 @ 0 R@@K <0@0  @I000 00 0S C0 A0 0  @{00 0 4 00 0 @Y4 !K++04 0Sx|@4`UYYPP 0S0SLS 0 0P0 @B0  8 Kp2 @P@"0S 0SH,R{0 @% 0 @ @`K1@PVTBP<0P0PT ?8K 㹎1 00 07 0 0g+4KR\0K ,!^Q 806*R+P+0 00 60 0  -0  @I@0 0< 0< 0 0 P0 0=PPH|PJ_0`_ ^<@<^\C \` _HpXh<\ !  ! ȑd_l_^$|`!|̑0@ 0 Rd 4@80[ R`  `0`SQhTXX0SPPlTNXX PTAX0S ^*P00V00SP 0DQU000 t0@ 0 0 0  0 S00P0#S\@8@K0T @V0 y0 40 RH 0T40 40 ,V0 e0 40 R48K 㡍)e*JA LP -L$M< \@0 0,0 ` 0S<0 SH < <0@T8<0<) Q <0,) Q <0) Q- o/PpP(_1pP pU H  8 R=0H0 (01@PTs H0`< <0SX 0S <0S <0  xY<0S <0 R4 0D0 7 0R Ru Pp"0'0Q70 <00 R   0GXD R I p Q0SO 0 47@# R WDS5W4 V<@PTP  < <0S  `H 0PS @0 0H @0 0SE @\ <X 7U7 D 0@pW Q0SPU <0S < 00CSYL  ( l ( ( l 8 <0  005 `0S 0SLe0 <0  8ş#000 < <0#20#0 ,4 <0<0 00q@P 850$<<#04 <00< 0< S T(  @0,(KV7. XH XLD <0 `<0 R <0? 08 ~0,0 < 0@<0 R <0 0*Pq F P 0< l< 0 0,0 <, < 00D0  `3 , 3 R /yP  ( 0,0 H< 02Ģ@X`D@ B\ @0vŸ<0  @  0`, s] ,p n04M  b l2 , d XM 0,0 ]'g(<0@J?0 ; 0,0 K0`H0 <@ K<0 RS <05? 0' ~0,0 7<0  < 000<<0 ]I< 00<0@  L1@ H@ 00 0P01@0 0S @F Fy <}V<0 Sk`   0,0 , d0 '_$A \C 4 H_H@<^<_0`\`HX;^`@`bԑ8" 0-L M$Q0 0 @R! ^0\ 0A|3SQ/ P 0R+K00xp3P000QP ^ K K  L0S0K\ K00r~<(wĀ| -8@L b?0000 0` -LM0@00Q # 0# D# X# l# 5 T' &0BS# # # # & !  | 21Ch 0 X 0K 0 K 0K4T0̑@X4|ؒ -0L(S 0S     "(0!B "0!B 4| -`L@t `2  @t 0T(0`0< (Ÿ00:0R _T{ 000#T0Sq 000#P0S _PqPA f  3@;0<000 @ TPP _'0`0`@0 [T5 0S(Q ` 2@PC&00`Pp+0 0pS T21C   wP0p`040)00`MP`(  8``0`4|Ȋ 0-L$M@8 0 0K, 4 $@ @ )&1@P  R050% T+40S)K00PK1(0(S }#(0(S8 0 S4 8Q% [cS0C(0  &f  0`| -0LS@P 00S p `ASP @0u@050\S0 050p c -`Lp@T  00@@0A   P  SX @QX @ - QL M`4 .@TPP!0DS00STk #T T&0DSpQh(K4~!T 0p0 0 "T^ U 00c 0400C00 @pPDU%21C0 40RaT  , \ 0D,0 Q, p RSTT T 0B0DTST Ud. P. , , 4. . . . . . . . . . . |. D- ,- - , - , 4. . . . . . . \- , ,0 S(0    aRp@PDUT$21C0 40RwT ,    0  ,0 ST  0S 00 008 P 00C 0 0Rö 0R 0R 0PSPUv  p0%SU 00 0  00C 0 0S 00 00 0SL 00C 0{ P [ lt P P m 0Rh 0Rb 0R\ 0X 0"T 0P 0RL 0H 0cD 0@ 0S 0SS 0 0 P> 0S. 00 0  0p0C 0 0S q q  p,{!p 0Jp 00s03 0 e0p$S {  00p, 4   4| 0-L M,P0@4K4 0@ (00K00;-D0D 0lCQ  /10 004`_; - @L00x; -L ,Pp -LMP@- tP00PT"QaA0 10Q*(K90100CQ*00 0!  BR 0P!` pP4 ) P 0@0pP 0 R X3@40 c0 0C0. 0PPF3 `E̠E-K0 ED,K+K-0K*@K)PK Ћ0  0:$0[_x;8`4`_|;; -RLM@PB `0S  U@PERH4 4 4 4 4 4 0U `0 d0 h0 lX0 p W:0FS 0bC1AVV0a1,0 PL @-,0  ``  4`__ -ML3M 3R, , 0R(Kh#00`#`LPTP H,2EP-@PsT 0؂P  0@P0. p` 0S0SZfJp J@ @0S00P :S7 8 x8 p8 h8 X7 P0*2PI P PEV.*0S PEV:U&  RU! BKAA! 0!6- P$ cP@f @d T/ P[ 2@t000^@0 J01* 09-P 3IKAsP$00P86_(w;;;_ x;|;8`<`~ -<@L0S (0}/ }啶0 @ _8`_4` p-0L R PP rP l`PdphpL0@D@@880( ,0 B @@;;x;;|;__4` -`PLl0V ``p0`C!VQA8 Y0`0Qe @X8`4`__ 0-L L0L@P  P 0dCPB00P0_4` -LMQ@,0 ``plj PhEQT00?@AP*Z:a@ rrP X@0fPZ :,0S GrP 0hC4`_ -D0D 0 LS:PS0C  04`_ p-LMPK`@+P P11 0 b! PU3 S'x0P?S0 b@@0 @{0P 1xS*U xVSTxD 80 x x;4`_Г -$!$A0LS`: q Q0 R 0B0 !00C0 V pP vqP@ 00 R0 plP@f!@0 ,TP 00D_4`;t_G_ -:LM$ `R pp p p p I)M'pV 00@CS@C @C @C @C @C @C @C @C @C @C ? ? ? ? ? 8C ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0A ? C ? ? ? ? C ? C ? ? ? tC LA PpPHx(&p0XA P YW pW 0S㰀 Q Z0S0S  @TK X : 77  000 , q004 080 pP ^00S  8  bRڷ$P@ n j0 PppP `g 0 .8KQ}yu(K6 3^ # Z 000   Ӈ$6@  q+ pKpW  l0S0l Z o S[Qo @Y@X *P X  "X Z 0 r 3 Yy H%H5^ppQjZ00 ` & 0  fB!A|1@y1@ oPP0 d k1Q00`Z  X 3R-h|dp`d\^ 00S 0Y   ZJ =oP 3P(00c  Z  `0P3F/P`U RoZ00 @  $10S00@Z  X 3Ro2pZ H IBWPbPP 03PP K P`0T20 (0,0 00@ `4 8  1P08 @d\400c00b S8KV#8 @` RP _Y   aZ  @04 2004`#4`$@4 41{80`@ cR8K#P@ Ʌ4, `²>q@4 gb40(([@ _H_ 0`dКx;4` ^G<x_0     l_(0$0PQ00l_8 -0L`0V`Pp @@KP,@ p0PP 1Ao P O2$0  00_H<` -@@L :20 620 D22 0  ^; P0-LtP lPP 0SP,@0  0,@P#00P00l_ -(@L0SS 00l_ -8@ LP0SS 00l_ -0@L0SS 00l_ -@Lh p-0`0C QL@ R pS0S T0P0Ppph,PVP0&P00S 0P0&10P0` T 0 00P0P0T0P0 ꜕lX -LlMxKPx0: S K --80LM R 0 0 I, * K;<^ P-L( `@T PU prmPp0 -R  .@T PU 0 S0HL. 00$0$  -R  h.__<^, --LM4@0 0 + +_*K<^ --LM@HH.0 40 +( +F*TKȕ<^ --<0LM R$0 0 + K_ܕ ^ --LM0 @0S*0 0 R   p0  KUP0 R 4@S.0 0 + 9+_^<^__8_, --LM\0\ @0S<))0 0 g+ +_^<^ P-L@ @P 0 S@  -LM@K+P0Pf0P_K 0-LPM@P0a0 S U P0-LP@ T U  0h60o)T0h.<^0SS   0SPS00Q00Q R 0S 0S R ; -LM@K 8~00 R000 ~ 0d_;; 0-LMPKD ~<00S@ @0@S }8d_; -L`\M0V,0  0p#@00d3 Q\# Y+0x t0  0 S 0-0t0 8PUR  p R TX W hW (V 0"#4020lK@ k@VR 80Sn x  -Vo VG ŸR2 T l K0 -p PU  R0SVb V$"Q$2 0  ,PUp0S ,, 0Rl(K0 0@:V0@60 SS@@l K/l0[S x!Tt1 0|l K,0p0 V0@l0K 0#40/lK@@ k@80S $ t0,V  ,lK@ ky 20lK@ jr @Q 0@ x P@,lK@ x.@ R x,<hP  z,T.(w;4@`b|xPdpHX~- \\00S^(0080S 0 R00  p 0Sd 00C0X0X L P000P00 $r;;<`;;;; -LM pK` |@T P 00CS0<0@T 0S 0@ d X' |PT 0@  ;d__<^ܖ -Q@LP 0= S; 05 @`p<0 0^@Q Q 0  P  0RQP tK0^0   ^  <00,h$4;;;;; -@P#0L0F%T0?S[^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ _ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ @_ 32P <0S 0Qk R0S Q PZT1`@T P8 iPUSP@TU D1P(1 P 0R@0R P0PU p8@T `iP Wp@TPUW |0P P00Q 00Z 00Z 00``; -LM,Kp`P\ 6{WpV@ 0K@P> U4T P@T ,40#00 W  @ 00CS0<0V 0P T 0@   T  z(KU<0@  z0$0!d_ ^;$~̑ 0-0LQ2 0 @P ^ T\ Q  P 0S R pp0R`  0  H0H0 P 0S 0;<`__L,4<D -LM`00Ȃ000pSp Q  Q2 R  5P 0@`00@ 00|70@00 00/ 00 R 2 R 0S QZ 1Q;P̑b 0SX 1P 0S3 ! 0S0;00< S 0S, h,0\ 0P@ 0S 0S $!%/% 0S 0S U 0S0  <PP 20 I7x0P0p;00D 00<P@- 00_(`_;;f|^l^<^`b\ -L M0K pxy,KPP  RI Wx8@T `0S0C00$3`\# @Tz$V @HW. 0SB0SU0000 U00 0S W@ 2 R0x">0@  ry(K ly@[@ 0S9PKW`A00 R ܑVQ=PY  Fy, 1@0 t- p"P0 -  (y0@ pPP,0  @  y,0!@"$k괐D 0S0n  x 0S T0P@, 0Ld_| ^;;;~̑f̗ -LM$`K@p( xPTP  KP0 0S$ @ xT0d0K0P 0 P 0S 0S x@ x@ x R@ $0!o@d_<`;~̑ 0-LMPK mxx0P h  bx}@8008, @ Px8d_;(@X p-8@LTP` `@T P k@P`Tp -LM$pK` P%x K@P'  R 0S P @ xKP+ \@UUӿ  w 0! @d_̑~0800 R <0S0 ;<` -LM@K 8w40 R 000 wd_; -LM0  Pi@(K,K ,w(%`V00 0 0000S D0S $p0``0$00U:PP@s0#SuTs 4@ Rn۾PP@@T zd$0S Q  #44 R  4JZ0$(33 -T<Z @  Fw#pW00| 3P \5 0S0 R  + 0@ 0$@,00@D34(  , 0"0002@8`p`{   w,A. @嬨`T2   | @ 0p00% o(" 0S DD H&8@T $(A&@T  *#!@}1 ,ttp}!#@l :#Z E vX!0S = @!0S 1d`1@!@ 1@ @@:B3 0I$HR 0S 2 2_@P  M @` PD@D 1Td_;;;5__;;;<`x^_l_<^ؘd;bbd0~`b -RLQ5 0S^ܢ܂P0Br `D@D 1T0rS Bb0S "PxP d2 00U P@ P8m8 0 "S Br `D0@D2 T 0S m\9! |1Aq `D@D q1T 0SdP90Sh1 R80P0Hj00偽aP @20S#  I10R PT) GP00lI) <00P`}=)x 000xs3)T &P00K_;0~`b_;xffpe0P -1L@TX pQpqpa@T 0Q 0S S0% P 0S @TPp 0R 0S 0SP 0S 0 R0Q`0  hT@QH0! P p `;<`__x p-LMxa0S'0@KP $KP P $P 9! 20$aS 1 R Ab!P#0P&R8Kp@P QPF!Pl( _d(h WP[(H NPR($ E;x_f -1QL@P` @t0Ǡ) 0Vpp 0S00 A&0 S0 R @` PD020@D /T0S80 R h7h;(`d_d(| _;0~`b -LM. R 5 R 0S04 00(K|K,K  @PpK`V 8PUPU 0T04H,0K\,040@=L,0 L4t |0K bP\,04(  0K\ $(0@=L $ L(h p0K bP\ $(P x,00, 0S|0C0 0SS0000v 80S  R R 0QS< 0Sx S000000 00CSt@\R0S2 c 0S 0S& 0 S" 2 R  0S 0SA RA $ pz 0S e0S30 0S- x1 V E d0,0 000`V(P x 0@=9 = $(0d0@=9 =,04080#400 00CS@0V @ R 0R ~00CS0uT y00;<`;?B_0`;ܖ;;ܙl_ -!ML M,̟, p( Pt8 h ; 0 SX  @X @0Ph( d( `8 , d\b XQ `\( \ \Pr !P- @`XX00SH t8S hx R p0 Bx p0d0, \Qh( h( Pt8Sp\, 0hR(K0!S@ :LPK 0*0#wX@ Xd@@htQd(`0" \Qh( h( @ P P0h8  `\8  P X8Sd,`\ d `\ \PPU 9 RZ!0EVSV 4 4 4 4 4 4 4 4 ؈ ܌ t P ,  ċ p X  d  KJJ0 @(vp QwX@  Xd@6@ht\d`(0! \8Shh @#@ `\h(`00`\ h8 \ @x'` ` T'd(`0" 1!MK@D @DOKJJ0 '<_p6K J0J 0&vp p00B0S00A0SwKJJ0 p&}vX6K J00J0a 0&ovp|KJJ  pt @l( }4_{@T@P@Tp!]KPEPE+l_}#_P@!MK@D @DeDOKJJ0  ^l}_pG!MK@D @DQ0OKJJ0 ,%^p6!MK@D @D@OKJJ0 $^p%7M;@7I;qvP^P 7?;^PKJ~0pJL4KKKt ^P  ^P KJJ+ ^ ^P 0p0KJJ +^p!MK@D @DNKJJ0 #c^pK3JJ +z^pKJ 0J ph( L4KK$K`3K JR# $ 0pJL$KK4KKJ 0J ph( L4KK$KPu APKJJo + G^pjKJJ0 KJJ  .M^PKJ0 pJL4KK$K{!MK@D @DdNKJJ0 $"]pjKJ0 pJL4KK$KaK0J`8 p0CJL4KXKJ\0 pJL4KK$KOKJ0pJ`8 L4KGh7o:@\7k: ^P+ KJJKJJ +]p,KJpJ'KJJ +]p!1K0J1J0  up67: ^P0/SX6+:KJ0J0 \ tp(w]_P1_<^T`;"^5_h_H<~hd 0 0 0-0LMPP)@690 0 U ⲳP 0  K0p00`]P040P(o690<_0`l^ `pt 0-00P @L $@= 000` p-@L@`0DSt0 P    $ < (`8 , 0 4 p<408`B400,p| p- P0@S0C0 p0LPT`` 0P0@00p( @` 0<0;_| --`LM 00CS< 00CS,@@k0 0 %_|<^ -0@=C0 0 L i]0` -<L@Pk RVꈓ D D ̓ d0P 0S R  p, ; bR,P0W0PP} P0S0So 㝾0PP0@0S <4  `0a0Q Y 3 R 0S  Q $0 P $0N <00$ $ $@} 00S44000 00  0R 2 ⿟<@@[2 RY0,00e \ P `> 0R, SK 0 , b  nR,,PL 0 R [Pq 2  0 <@@$00$0"<0Q0$ $ $Pa $00$0000<0@ 0  $0S `1 R, *,P`0S7 W@5 * RH  00S< 00S60 S6$00p p0S Y)0t |0,n<0   f@__^<_<^|0`8_`` ` p-1L R 0 0P0@0 p`0SP 0  0P0@0phyx@\T0 0R0 P 0 0R@0a P 00p;_; - 1LM  0(,0 ( ,00P40 0 p@`T`\T00S 0 R00 @``40 cRP4KP[T@p ]TpGW00S T000( `w3$K0`_; -LM0/K,0  " ?@ 0@ 2 ! >K*.KH! 0  B 凞101 ? @  p@`00`" <` `X/ P\PH @ϟ0S00B P P #PL f? $0 0$0.0S, 奟Kb  P\P Ο0S00 X V V00.01 cRKp VD  ( ğ ` ؞ ğ 0S0C0  P\P ͟0S00 )P \X[ `X $X  00p8= R X-!X  $01 P\P (͟0S0@0 @ TT T !Tc 00D-T S}t  l 00  " PK@K T T% T# @-0KU t  P\P \̟0S0@0 n@TPKhPU+1PUO 0 !RK 0(n0˟00; 0 0< 6}Xm |X (Xw @X*X ?X+X !X 'X \X= "Xm000 Y 0 p`0)X |Xt (X 0 0 0 Y p 00"X \XP* P\P ʟ0S00 $X> "X; X9  \00 p2\X 'X "X, 0 `0 p(X000 )X p}X1 IY 0`0p"X1 IY{ `00 p'X00p1 IYe ` V 8 00 p B `X0u \X  P\P ȟ0S00$P "P? P \00py)X (X000 'XI 50 V0S0T0 0  Y * 0 p`0Y0S ܡ 'Xx @T~1 IY, `@ pB"Xr \X@00@0C0(X@@@ O"X 'Xd  000@X' P\P @ǟ0S00(P 000 Y] 0p`0(P Zt x00 }N[X`  .P [00 p` P\P HƟ0S00P00pP00p0 Y 0 0 0C%00 pS  `0S CCR 0S BR 0S0C`0L% P\P 4ş0S0P0 P(U| {U 000@ X0 0 1@ cRK @P P\P ğ0S0P0 yP00  0 X  pV $ P\P ğ0S0@0 Y@$T "T  1 cRK pT3 0\  p@) 0@0p 001 IY ` p00 p1 cRK p P$<XPP>X V`  Af V` 00 !`T0FXbSB(@T0"0PQA  `nT0S   x#@  #@Pz 0w 0S  0To   0Tj < 0S (  @lh0 <0$1 ⵚO 00 p0W S WV奚(X* ;X |X>0 P\PK 0S00EX^ |X&PF+ )000 p`0j\TA `T?  $ ;(w8_^^^(w``,`0`__ ;_$`H~0`_;xX, 0R(K0 Y  0` 0  p`000CS0^0 P\P 0S00)P1 IYm `00 p P\P? 0S009(P:0 Y 0 1 0c0` p  1 cRK p X00p0P@0  $PJ p(P 0 Y 0@  ` p 0 0 0 Y  K0P0Pp @T\T 0S00 @Wꨬ Э #Tp9 D3 0p2p/ p+W)00Xp P\Pa t0S00[:P\ %P#Pn VVS0 Y 0`0X$0 1 cRK P@P`$0[TKP @0S @1 cRPK P00 R$54 P\P 0S00 ":P@00 P\P 40S00p%P#PK0 Y/ 0`0\P `Pf\X6 `X4 X2 )X@@D@ \X@00  &00C0@@00{ X &X|<<0008& P\P P0S00 P P00C00S0&0 0`00C06 P\Pe 0S00_X >P00S00 &P Z00 0|P0@00 000 0 傘7E`KPs 00p0S @1 cRKp00  0pSP(YA0S p:K@00E  KKf  K  K`$0 0 sp  K  K.!p0 Yc 0`0Y` Q@ dfl00( 0C p( B`0 ! 0S    0B)000: < 1 ! 10 1  `0P pa P\P 40S0@0 @T W T p0T 1 cRKL`@`P P\P0S TT @ UC 1 cRK+@P@8  P\P P0S0P0 P U 1` cRK @`P; R P\P+ 0S00%(P( D  K0pPC  K  K~  KM  KH;9  K?P  K7;XȀ |Xㆀ =&XK00  K#AH   PP1 " h=R }R(d= |0(00 00 < ^0`!8000C02 S " :2,,tx  KP  KWh.>X00`0  KF  K>X00) 00 P\P 0S00 -P0 00U000,0; -LlM℁P`U @Th P~H{080 `PG K:RpP000T\S/Wj j%R@PPD0 R ㊖00@`P PP0: S 0@ 0@0W0P `?R@P 00d0K 0@0W0P$K;__ 0-LlMP@PPpd 0T  KP 0@ 0@K00: ST0K 0@;_ p-LlM  | P@@PPR@ X1PUC P K`P0: S 0@ 0@PUKp@ <0 XK  0XKS `0S& * @,0SBa)XK0S0SD+P 00Pd0S;;;G; 0-@PL 4P@T  0R|@T0<` -$0L@T @T0` p-t`LPU R @0@8C8Sڱ @TO0 0PU 00p0` -(@L0 01h\0` -laLPp0S  0R:0 R @@ T 0Q A@+ T 0S 0S Ws 00h `V0 R 0 xP0@CTT WR}HP'@0 P42 ዑ0`<^_^_`b -P`LpGP@pP⿔ P00 Q @0` P-@L 0 RP0S 02n T000e+PPh0 R \0 RH 000 <| -pPLDM䀟00PQ0S$ @ $ 0R) K^`^T@P0e@@Td`K ѸGp3 0 0Š` (w0`~ 0-LM@P K+ 0S  P00Q0Sp008 0-LP@P0 p-`PPLP F^@ᆊ PFp 0-L,MxP0>Kp0 @Q X0 R%\<000 0RK0m (w~_0`~ p-LMH@P4 `0T0 @ Kp_8ȝ -aLMpP0Pp' PPR 0000p U0HS0 0Q$pP PSQ U00R0S00QR R. @K$ ,0 __<`_h_ -LMT0Sp! j W4|1  DK+x t DK|!p@ 40AT00#`9 oT" ?T WsT0x1  @$PP%U 0T0  s%U (K<@T  PS0S 10   VV<00t1 VGpdS@0PS PQ@%T<4( E+]C* PE#]䂟Jψ0S 00 Q0W002|1 t0-S /i P 0-S`RLŸ | bd@aPpA `AT \1(K! 0 DAHQp1`Pp P%Up!>KD40D !R 0-S+S00S 0SQ h!0S#0D0 \ t1S P D0! R  t1S 0S w0S  7x\ D 1  Q 01 0Sl t1SD D  ! tD1S1 0D S D<"<;~ _dН؝ ^   0-@QLP╈0 00h0@-@Q$ /Q``V/Q P Q7 .Q \ /000S/S 0S/S/Q00/^^ 0 .^0p/SS0&\00S \/00 0 P0 \.00\ L U*0/S -`QLM`< /QpPy .Q8 | < X 80S40 00 ,0 , 0S:S00S,0   0S:S00S Q00,0 P00<R04 0 ,  0/S4  0  000 4 ,0 Y 0SR0,0  0c0@[ P0 bR,@ Z80S<0(K40@ cR4P@4 Z4 0 S/R/000@80 00< .S0S/S000#80 Xy8 4 0 , M[0@ cRP@ Z 0 S/R/00P| -MLM0 c1\, @ TPA @/T@/T T9 /CP `eP V9 V:  @/00 0 0  cR@B^K pPEUZPEp P@'( K0tC,$[/R0  0a P PZ, 0 R(K.T.T0.S Y0y/SC0SZ`(w -LM@Z0     00 K 0  fP 0Q/0000 `K0` -`PL@$ ZP0Up YT t0T l0h耆LpP PĆ YT0@P@@__|0`_ 0- L @ 0  0 0S[ :Q0 a/ 00 0 P0  00h t $0 0ꌟ -`L p 0SL;z ( S , 0P@aT#T ةPP@`w0S[` k`n 0Q$ 0% ` 009 0~`j`0i `0` #Z000 0= S,  @0  d0d`0 0 `$00ꠟ -P L`pM WP@T 0P Wd@ X0 0 dX`0 WXDp X0Q@ W@`Td#T! )P`@`0S#0 ;0 00$ \WL ~X X 0 0h0 0괟ȟ 0-@PLP Y 0h0 p-LM @`, v  0`KS' PK+ ҨP Pq0S  ;0h0`$0x R 0 B `0xT$H M$0`0p`   -LQ@M0\ ,0 H H X  P %P`  R 0 B 0HH P0 H00H0 @, 0HR(K0pT0 P0 L0 W 0GLSL          l T  <                                                                0 ~ @0G0 P 00D@SP 000L0 X EpUpUX `T P plWpL0L@0  `L0 L {L p `L uL0 ` LppL lL p,0 `L P0 dLp `L ^L0p0 `L0 X\ L \0 X   pX `\ P JL p `L DL p `L >X0Sp `\ T0 6 pL\ X  b `L T ) A0G0S 0LP pc0G\L S X                      L p L L0;@L0 \\ `d0GSX     X       8     x   8 V0X0 Pu`X ,Kh  0d d0l 0d  P`duWt XQ -00lh lL  XL T L T XPL0TPh p L Pe= S L0 p0pUX@0C0 0 @0T 0S @d TdHH US@0 B @Tp0  R @TH  H >L 3#,Kh %2> &BP0`lLT ^x0X00L L00B0Bh0l,Kh 1>A P0 0` lL: 0R 000lhlx,KuL  0\0\  P`P`\ \ &L\ 0 L \ CKC0KL!40#0X0S^ \CKCpK\0\0 02\ d Vdh lA-P+PR PP 0P 0pT0Sf 0C0 00 HHXH 0xS0SW 0C0 00 H  H0pH 0L05 +00lhl @`` 0 B p0` @0T  R d &` @0TdH00ePH0 0S 0C0 00 H00H0pH0 L E 00lhl d d d d d d(w``p   --LM0 0 4 K 0-@LP" 50u    P  &P0 : @0 P@ 00 00 0S P0 X0PS 0@0 0p  , - L @ 0S# & -*  P 0S0 0S0:0x  $00Np 0+ 0 00$ 0D - L@ R 0 B 0,p RX -P L@3 T6 pD `Q!   P 00a0S@@ }TpW   0Xd0P0 `\p Q V`KT`p -P Lp! X `$R9p R V@@ :T 0`d d0Vp0 V f4X ` 0;脠 0-0L@P 0P  0000   ,嵀00 0- 0LS@P >P  0P 0P 0 0- 0LS@P'P PP0  0,倀0,{0 -L^\`pP@%T㼀& 0W, pE <  p0$ (P PPPB0BSU@P?ppE{k(}0lo@0` --L4MD@K0B 0 0 SVK -p-`P00PQ0 L4MS P 0LL@K0 0 0 2P4KpĠ -pl`LP@)# T P (0V0W< `0``0$     ʓd T 㼓P PPp P PPpPp -l`LPp@% T9 V`+0 0,0$ (` p ` P   vPPP P PPH[P 0\00@00`$ -@`L#0p00 0,0< (0P @P T00ӧ2 0 o3Q00 !ᄠX@,"0`@- 00d<_0  d< -<0@L 4  @     0` p-LP`@@P`p p-@L0`S 0 P p00P@0T * 00p00@[X0T0@` DA A000 0@@Pl<p<,`|0` -RL0pS@3Q0@A00T2 P- T<2P``V 0T0 XQ P@0T*00T+ T4 T- T: 0DSLQB`1 P1 R|1@` DA ~A000 0@@P41P``(P``Q 1:`p`3)P``0  0:`p`3TEP0  0BS Q` L M`P H040R@0@ `wl<p<^0`,`Ā؀݀ -PPLML H00@!@1  Q@ - EQ5 Q 1P AQ 0 S P0AS0KK0K@K0  /P 0  QP 0x  X\ 0KT  0p @|= @0@40 8 < |ԭ@0l S` 0P0=URʨMUq0KU t tt 0KlpP `p1@U@PBPUt  t 00K00Sb h7 7P_ {P0Cd0 N0 Sh \ i d0P 7@Tz`0pSr 6 (P0@@P0 &00P 6 |P  U:t@f DA @z&A0P@0`P||P T1@@ f %z)]%0S d0S  O\Q\ hp p0\p Sx5 J ED5@f DA yA`P 5 %h t0K 5t P<@40PT*$! <@ <@40T*4lp  `<@ S P0 ylpP`t E@P $y  0 0 4 3  PwU*00Pp3@f DA yAP`@@3  &0U0;0g0S7<80 0c0S783 RC0S!3 P<- `X :2@g DA LyA@p`@ 00Uap0PZ5P|t, <80 0c0SX2 R40\?*(00< f d P;PppT;p f yd OU8h1@` DA xA @4@ @8 < ,8(1@` DA xA @4@ @8 < 80 @` DA xA @4@ 8 < 0@f DA xA`P)P806`t w0U4P} 4Px |4PLr0`l<p<     _  ,`^_Ti kġ (ț -LP@Q 0  *=Q&0  "=Q QD1@P U0`0$ 岀00$Pp  000n{ 0 @+x0@$x P0P0 :00 0p0 p@ x 0p P``_0`ءl< 0-0L0@  PP0S p0P0S 0 P 005,00_$`d<_l<`<p< 0-L| Gt0@T P@T 0S  ,0 00 0 0@T0__ R 20 R00 00 0BS 0 0P0 00BS 0 0-0@Lmw0 S@P0SL 0 0 R0S0eCA 0000` 6 }3 -L\ P0L `01P@U 1pT@P4U 0S \3P0 -p@L wTP 01 R1 0d?A1cX0@ P. Z$` $ ` V AT 0 K 0B0S 1 P00S@0`0C V0mvvgfff -LMZ, 0 , 0 0J @01P`U ,  1pV`P6U 0S,2P(K0Szʊ xw,NJ@v000 @0 0P, I00C0PPR    T8 0S 0  0R 0`bfT0S R 0S 0  R 0P `bf 0- L @P 0Q0   Q Q 0 00  0< 2 0Q0    0000` p-L M@`!PPP4  "   0 R)00 `0`S 0` $K$` 0 0 rKpT$ K}r$ 0R    _B t<P d -P@L1  !R 11`b 0-D@LB^T @ 0 ! T @0`b1 0) 1x`bD -0L 01!"Q0  !Q0 $4($B0TPt`q40000嘠@0P`0  B@phTPt`q4=  L9  @5<  o0`blt<B <bb@db 0-P LP@u0T̃ 0 0R0q03 00S  H0 R00 0h00Q00 0000_B _ 0-t0p@l l0LB^T @ 0 0S 0S T @0_`b__ - pWL` % 0S !RRP, 0@@   p <00l0d@PPLt  @ 0  0  ^ __ p- L@PT" P0@Bn0 0S T @0S UTp@80 000 0a눲_`b__0 R _ |0p-"L@Pᑱ`T0 @ H0  0S40,  Ry`p`b___ -LM04!0`p Q 8kP GP0U) P@T WO0P GP 0P@0P| WP=P L0UP K5P R R0Ղ"P```bf p-LL`P@T PpSP 0@0PpIꈲ_ -pPLPH Ps0S P @sP0zs0S P @qsP0js X @T `P_s P[sPWsTs@TNsiDs -L0ML`K@ B 00P SdG F F G F F F G G G tG G @$((P P))@$(P P)'K|@(@}P@$p{P PP @0TPS@@ `0-L@P^$?@0h0S 0h^$?0h p-L`P0@ S I I I (I (I I I I H I `I `I VU@ PEP@p0P@SP T0TSU S 0P@SP꼢 p-L`P@er phE -LMP`0  r0 00  S  00R  0Sb@er0@0P PP00 R00  0Sb@Fr0@0P PP00 pW7 @Tg@)rPU%  , r ,@0,0 00 R s 0S m 0S oPU0 0p0 pj0 e0000(KLp -LM`pPG %P?;0@:S:O M M M M M M M M M M M M M M M M M M O M M M |O N hN M M M M M M M M M M M M M M TN M M M M M M M M M M M M M M M M M M ?P(K0pP @2P p?dP00S b -00@@@0SppX @80CST pT S S U U T HU TW R XV U W W U U HT 0T T S S S 0@,0 0P SP lQ X"0@0Sb0"0 0S! 0!@ T! ! !0PU 000 !  0S @\)| t!}0S00T!uPU 0H 0< 0Q00S 0`8Ԥ|``Ȥ -LM@pP` 0[S P 0㔐0 @ @᠛P k g  p0,KZ, R j场0`ܤ -LM0 RH80  RX00  R(l0  R L0 R^FPfP ^@D@TY00S@ =88M`` (0 R00PP0_ P-L@ 0 p-D`L0@ PR  a5 e 00b 0p= p-@QLP! R `0 Q 0Q 0  5 000pT`  0Spp0 a5 00 0= 0-hPL@T\@D P0R  P 0,0 0S0C0000lM$=,E= 0 0  g5=UM 0-4@4P0L Z50 0 0=MU `,0R- 0B54M=4EP0 0ࢿMM ` -pPLP@`0e R0@0Q~0U0C0P 00 0b@A~0U00P 8~8 0U00.~0U00PMM -PL@4M<$< 0,4<<0 pP@p WV0`@T3`VG3 Vb 4 у 0U{3# @<0S 4 _QQ„ V^00@0!0<0pWS0N 040  VP\ 0SYW00S4 0 Q 0 V0WP ژ 0?, PÐ @ 0 ` 0f S,0 0P0@  D `~@TD b$2`?ÐY 0@m 0` S PPT M0 V0 0C V00@p40 W0040  V080   0Q00l 0C 8 00@!V@8 0P 0 qS 0S  F}000PU@08 0S  +@R<@ P0S | 0 $}0@0004S  , 00c0(KP @>@M=MMM_MMM -`0` \0@L <3T | |$0$  0 MMMMMM -,@L0S V_0000M_ -L|hT} 0- P@L?_0h;__ -L0L @R TT^|@@$h| |@_ 0-@P Le2 0 00h p-X`@L;_P7_ L20 0 p_ -LM@Pa0SW P 00|q$K(K0 @,K @w`PJ (1 ($9 $0V0 P,0AP2 wP#U0( bQ P0P00Ť0 00 @@ K lP P4Q (0Ph@@6P==8 xMlMpM|M@M -L MK0 K @KK @qw@P {|xK -L$M@PPb0S S P 00吢U0 ,K0K4K8@K @լ.Pը^0l0ŠnN cR0N 0NRtN lNh.0XP.X  ,  ,0  c> B > . >.@@LEvQ4  P 00 S 8v@t) R ] 0S 0S 0S# RPX ܵ l 0 0 0  \ 8-0 0 @[00,QB T00^@  T  0 TPPU Qb Q < R B 0AL c0  ",P< 0S P"0S S S00j000S 00LPm@  $ T00e ˟0  @0 000D S` `˟Q\;X;  H;  @ T " +0000010DS 00D 0 1:ʟ @ T  *0 00D Sp 0!0000C00 T T`` 0(*TT 0T 0T :'Q{  :@ 9 R 0  R)l9@ M0 0 0C0 TT70  R@9 ^0 0@0$0  00^u@t }t {tu R8 0 R0W $8PȟȟH yP0S cQsQ CQ d8P#P8 po8   0 B y T TPP& '10DSP00D P 0iǟ`@` P 0 S0@ @@* t t ttH0 SD Q *6D 0 0 (Kt&0SLƟ00*Ɵ0 ( 000ct P$Is\@T] P6 D 00`0 0Ɵ 00@m5@T5 R@0T 0T 00ST  R %PTdp  $ $ 0  b,P% #@E! 00C0>0 R84 0@ L4 P 3ß P @ğ@$a00@yP P. pc00v3! R|S0 0CR4#@0#Q@3 $ß0 @0S 0P0 0ż/ 20P~ @ R B0 0P0 0 з0C 0 0QH2P0" @0S 0 ` a)1 0 f0b 00R0bP0`l"2`<0 @0K0` 0PFP @ `v}PE`X@ ڰ 00z P  ag) 1 0Pc 0/T PP  XPx\b,10cSsS8 CS6 2 rP aX )0  c/) 00 0;M,EtM|MxMpM(E$ElM= ` ==MMMMMM_MMUMMM]<<<<0E<_@MPP V$ ^K!PEPE0+1PZ 7(`4(VP +'+'H '( 0pYHP0+', 0R&(KACՀҀ ΀ˀȀnk忀|开tbp6h崀+'0孀(whd@$\t$8@ܧ0 0-L MP@P Q 0SP R:00 0 0 K00u(r o ki련Ȩ -LD0"3 00Q@0P 00:v f -LSM✀0YOKp $ :lp `IKPK@dK 0<@i$ 0R K(wtd@A$@ -L$M@0P0 , 0S ,S0 0,SS af\ n\ 4@K | XS 0R KS ](wXDL -LGMđ0Pp,0 g 0S@`KS@' ,S0 0,SSBKHH j ; 0/FpP; IKAɍp: =t|41` V,0@SV1S   Q RQ\ ^00\0S l}`, 0R(KDr 8t $e(wĩ|h\ p-L M`P 0(0P`0,P 4@0 0 0 m$400 PPKp9 p-0St0``QLP @3!   @h@Q0S pQ,w -LMMMNnK`F0`F@/㸀K,0 p%[K %"K % % Kp!0,2 0 (2 $ jPP6NK@  0= 0 8ONK@D0@D ,2 ( $B t t j@ % %  %T NK@x(, 0R(KN"(w(Bp p-LM`0.^K@/0 %h0 ,K P0 HjPKH 0RKp(wh'B( -MLMD0PQ,0 p H  YP +Z% |CTPJ cT N~T0UCTUCKHH/>%2"2CT(K! W`` 0( K@V0@  1 吡 W00 S[K=00 j@ %tg  , 0Rb(K0[K PK`% $10 x1 pQ |a i@PJt1S* 0 |1 x! pq  0ZDp@8 JKAAp6 gr@4[K 1 $0 D1 0Ch! |A x1 @! lA pq 0  $}W|}tQp%h}`I TE0r @?(wth&BĪ8PԪ| -LWM 0`(0 pxipP* OK/p$ ,` gi@P"YnKK`F./a$0$K0 ᳀ r RiPq( 0R $KD,  40A}($(wBhB$B -ML M/NK0 /`q(0 "$0 2 i@P0K00S$^^KPE PE2K P 00@S,$0x 5 @C hP V( 0R$K($h(wh B"B$ p-LM@a0_K@/0 # !0d0C S x x x x x x x x x x x   |0$0 0 hP-Kr0gS 0R||f 0RKp0$0 0$0 0$0 0$0 (3$(wh,#BTH -\LM0OK /,0 q#4&4Ɵ0 (3 eh@P 0Sw ş, 0Rv(K;K!0SjKA AI  I , K#%ş0e6 9u4 (K0P)|0P6h@PO)R K P9S (K06PK8C8sj@K 6K %"( K0S3SD < 4 , $  dQt $4QppA?KK $"3s s 4 R K Kj>C^ c^ KP6KjK 0K@K pae3S b'}KpGpG`/"#09 9 g 7 gP7S  p G 3CSL GW`3 Rt  K >L#(KH0( K<#(KFK(#_"6[SW V@K  6[SI PK  0KχKe2 RK3`S)0 S) "儢 7K p"/"3CS GWK@H"H2#"@<840,b=a;b9b7b5a3PK V@K 0K@!P!T  0PdOK0K0@!P!C^+p 0KKjKX!!PPPP!P1d 3S0C9 $  0KKK6KjKud3S9 b(wh B(*"BäȫLh`!B ȬhثЫܬԬ l<$̦ -L`M0xpKP `(0 ) := P @@.P5 P @|K< \|\ ( 0 R$K|K< G|\< <|(w,Ԧ -MLM 0/KA A ,0 + POKℂ/P!;lr 3K; TK00 ?fP2Sd St ZNK@D@D/5!0 5 +f@PvZK@2SXڊKJ`J, !0 8 e f@PWK@Y - P95S6/]KPE5@S// 04 ; i I eP)1( K+Q0(K+\( K0+Q8[S  +S, 0R(K2`Stp.K`X=Pd0+@y8\(wh$B B"B!BtT$D -L M0K@P`/$0 6K΢p 03KD300 0U ,P "  Qp(  0 xePKA$ 0R KKP2"3K2#K3K< 8 ,]y0 Xy(wh%B D -0L 0,w -H&LM0@Pp,0 B VC P`C C B B B B B %ip> C0@3S3 t X 0 ` L @ $*p$0cP1 @ P`T ?K P?tp0 Q"#U U U U0 @ 0@0 0@0 x4 {#0 @P`0# 2 q3 m1 K@["3R_ 0x Xl3x#SX#8 @P`# K8303 G0@P`B(3 >0@P`92@ P00@ S` . 0K@ 2S8#82 "0 @# P `" `"0@P`D" 0@P`02 02 " 0@ P`" ! 0@P` 112 1 /x, 0RB(KbV=  SV08Lcp= 8..K0@ c@P2K1" 0`V V"h 0@0 P #U@ww|wtwl0 D0w\4 U(wLxh+0hhBhl -Luw -0L ]T,w -L M@P㘅!ᳪp1` fRp0`S.S0C  " P5 A1!O @_@P 0*P (KQ0`S.Sp0C  .S W000 4K4` 0p , wP Ї00CV꘠@0@* ?Tᚐ)Ac 0TPS0C Px0T0Ct0PS0 C RY  þL gfffE 0-,@,PL(  ,wد -LM  y]P: K Gp* 0#4 j]P; K 8p 0#4 K巵p岵d@dd d0zTᢵqv @,8 ,0lꈰ\ <0H( -L$Mp L mbPP= -gbPv 埮PD H 5b o`0S㨂 B@P *ڀ2MmT p Z vPYj j(KT000/P@E@L?ΆD H hjH0SS /`PK00X ٣P8(40!Ϡ @0`,`?AlN3c @K@@ Llm@D8Tȯ$ -GMLMl2 P@, T"p fP- iP$ ("֧p2 PbaU4I1pJQIKA⻝P4: S XB1 11 1qBKAA + P: DUta{$ `0V/S /004`04 X p5 p@/PP 0PST @T 0/S 0/S @TPM0 S`XpHX  mPp(w8,h(h0hd@-0@S00-\Q\ 0 00L S0 ^!00 000C\0LQ0c0 -Ls됱 -LM0@S K( ^p 0 dP1 -LM0@SKP  00  -0LS@0s30 RP 0s3 -0LS@ hwu -L@sP 0 0-LPf@P ᇪP 000 0- L0@T) 0P0Q 0S =S 0S <Q >Q !Q0 0l0 \0 0XPP <0 e 0,0 00 0 0 08hI`$ (0Rpp31<`$ (0Rpp&$/`0D S񟗯 h 0 9h `d,hPpp`VhpPp`IhPpp`;h`/gppp3`" K\P <\00S \ 0   \PPe40[S  5[0Sl|告t Y`@L0VU D00S8 W ${(K+ H@ -0L ޻,wd -0LAM @Pp  8p sPp  .p0` fRAT  oPNKPP WY.fPPmj(wI -@LM `P 00 Q03*,  0,, pW00P0 U 00 @ep 0  P02@0P5 :0P *0@@,0 PdW p$ 0-LXM@P% @\@0P00 lK-`00\0P0  :C K0)@hPh -LXM@%\@0P00 hK-\00X0P0  :n K)@hPh -Lp`,P3*@P04`0K*K0C8M4>K0C4A=K(0C4$QK 0B*K44(I C:K$$P0B*Kp(I4 0 S9           P \ t 40S0000 0 0*$(p 0%  (00?0bS fS)0S00 < 4<̠Č8#Č:K"̌,K$,4, ,*K 0$880S~0 0000 0 0哾:K P$ Z0`<`:KdK G(p~0`04Z@`B0  0K|P T d K磩P @T`P d "p@ d0Kp @T `  `v~*K@傽q~V@m~0SS h8+P 080(x0 0S$k $@`PO dK %,dK<K-.3[0C3K:K3[dKS3dK H. R)0S S S"Z  Z:Kp0S   p ,<4("4!< 03[0C3KA3[SS `$P V}0 0000'0S<0 00S 0S; 000 0T`0 000 00S0T0 0-0 000 000 0(Kd p-PPL}@00*`,(@P L00040)P0 ''@*p -L@M` P 0 \13000 55:W00000 0 S,0 ,, pW0000P U>*0  0 @ep 0 <P02@0P5 :*0 3P $*0 @@00 PdW p0@ TP3 : 0S 0 0@ 0@,0qU dP"(K( p-LXMP@`"0 |P0P00 pK*}d00 `0P0 @@ :f@ S T  00|@Kp)Pxdx 0-LXMP@"u P|@lK*|`00\ \0P PP :1@ T (0 |@00SK0)Pxdx -L@"000  Ph)G-M T 0 $0@(@ P,P`0`p 4p@0Tp  <0P<` 0Ԣ($ 0,($0P00P4@ h ! @(`$, <@0g\ P. 0@!g.,P(@T<@`0$ 04@, p$0( 04$(0Dp4pHXLP @ @0 ! 0@!0@ Q18 P!@`!@08P! LPpHI$PDHpf.. 0 p 8D0#Hpj!E$ 0#j 0P%@@X@ 0H @^LP@D PpX  `DHL@PPT@00P0 00 pD0 00H000000000 L@000 PP`000ЍlG-M0@ Q0@0@0@0@0@0@0@0@0@0@0@|0@t0x@<0@@408@,00@aAq@P `(p08! AQaq ,0d481Q   0p^P0Qp nt ^Q nt /tP@ t ~ %tPp t t0P0L0#,0 #(8 , 4 #@ H0 < D H #",#,L P H .(#T X H "D0\ #<`0 D d "(h D0l #4p0 @Dp.\..40[8[T@[?  08^P0Q8 n< ?^Q@ n< y<P@ < n8 o<P8 < i<0P0D0#<00 , D04 #880 @0D#\#.pT.l0[#4<8[0@0 @P劐pP0(Ko: 0-PL@ 0#<00#800#400 R0 0h" -pRLPw D@A1>0O `cWP: @1@ T@D SH0 0@H0L@pf.x @1 0S@DBR@H0 0@H0L@@00 @TpG†@0D@ S H00 @H0L@`W W  P? @1 0S@D RH0 0@H0L@ \00-PLP @0@0D@H0L@0, -RL`? D@A1>?0( @PcXPp: @0!0@@0D@e` @0!0@@0D@T@00 @@0D@@H@?X X  P @0!0@@0D@ D00-PLP / @0@0D@0l -LXMP`@vp 0+Pv0 S 0v 0p xK_$d0 s000vl00d0 KQ`0 S0$00DS$0 0!$0D -MLM`p# PP' 0V0 BNK@D@D 0PP0 Z P4 W\  K  `p  P#$KP2  -L0M`PpP) K.0 Pe 0S K0C*KK0C*K8K8R-K( B( C:KԨبpJ( A((0B8 8PC 0 SdL3 6 6 8 6 < < < < < < L: T< t< 00S0,040S l0SJt0SGp0SDx0SA\07"0"S000=`0SS S0004d0SS S S000)S4 PB`0S S d0S S R  h0S S R  r 000SS\ 4  <h0SS\ 4 88q < r qr h0S r q0000000S26ddgdGP\0  D' DK0#DK 0P0p0S,0S0 #p DK P0sDK0S,0S\0 000p0$0 00$0` R$01D0s{,0S000 0r0( 0?0bS@$@|`|@V0@ V0 0S  0P.S 00 000+ 00 .S0S00P 0K0 0%# P)K !0 P 0 0100:K(4y00|0 0K$ PK pn P000*K劚P 0|00 00(00?0bS fSU|P0 0 } `0S$01D0S 0 P 0s0 S 00P崳P3 ``KX0$ 1D K hp` @ 0K0՞P  )"p@TT \0"   P s0 S 000 0 0 ὲ/0@!P 00( r0 `@K$p!K"2$:[0C:K:[KS88@|`KP*K`K#:K8K :ZRDK!(K0 S< K^ 4 | Kx0  0{ K7K ^(KtK0|K{0KK\0 :K*K4P0P@ P740舏 -LM8 Y< pP rx4 2n EP!X20S002 9PP 20S00#30#9p3Ps r0m,`  tP00CS00 Ӥ0[r R r ,Kx80SW00S ^P<,Kי0,Kә@P 0K JU00S p00RQW00S < P,0S  ω R ,0,SP SS SP00P,00,0 00r04  0(K茏@` p-LM@d`Pw3P@ 0  ;,0@0S f3TKp舏 rS-@L`P"@3:qp 0P@q@qp p-LM@d`P;3P@  0  ,0@0S *3TKp舏 rS-@L`P"@3:qp 0P@q@qp 0-@LP 003,@r.0 2 0hsꐏhd 0-@LP 002,@r.0 2 0hꐏhd p-LM 0`|20tr.@l2PX2\00SgP  0`P@2Kp萏hd 0-K*K0C M8>K0C8a=K(0C8Q=K(0C8(P 0B*K88 C:K((40B*K88( C:K( 0 S`X T_ xY T_ T_ T_ T_ T_ T_ T_ T_ [ _ 4_ 40P0 P 0000 SL0SRL0S 000 00S0  .V S:V` 00FV08 K*Pw40p@P  `p 8K pP@2k0 00kp 0x (00?0bS fS0S4 0R  0 :K(45<*K 0880S 0RPX傫:K P(t 0S<`:K(05`P0`0*K84pL*KpK )pk0`0>:K8S@ p K玖P@pH K!*P TpH K*PHK HP`P l p@p0Kp @ T HK 3p`Nk*K@ZIkV@P`Dk0S 8P 080(pw0 0S$~0P04 $`B@P  pKpKHKnK`F4[0C4K4[pKS:K"r_*KpK:K8"`VR0S SL- S SG6Z:K %<*KP8*K$"2Z0*KP**K Gp#:K ZY:K 6*K Z Y :K (*K p 4[0C4K4[S@$Tj0 000090S <L sp`j0 0+0S00 S0S0P@00 00 0P0S00 00S0P0 0 -0 000 000 0'`(Kd -L@`pP 0I@{ -`PL@048 oP@ 0Ii0 0Fi0(S 000,@P. @p0S( 0S%$ 00D0 0 0S00< S00<000D0s00 0  00($p-0 0 ?(K -L@`p6P 0@, -0-LPM@a?KC/_K@0 Q Q =06Kp@ `@ a,0 pK\ L0 ,P l  K0 e -L1M`0pPKA4 8 0 p 1S01 R rP 8 00000C00S^P0 r [000%R@QgQP'eQG*GQEQC*9Q0Qk*%QA *QP Q7 AQ6 DQd[Qq OQf XQj LQBcQLP aQ!pQ jQ3 hQ4 iQKnQ LlQ1tQ6 qQ1 sQ xQD zQ. uQ=PP0SP 0S0 0C rK@@0hS@@0lS@@L@@ 000C @0 w 0# t@K0lKl"K60^S  0J_C0 S RJ!- JK0P-S ]S S@Q00]Q0SJ_K0 RLP8"K @0 2  0p0p@  0p p @p p 0Oq '000 @ 003  P0S P0SKP  00CS0>P0 r T000U񟗶Tk k l n p X  PT0*0PdP # 0hP P 0.P 4p4 X P0P0CU  SP U/0(K 01SSU$@P0X0C000  0SըP Ti (K001SSPTd 43p043 HX @ 0@ B0T0  RᬨP 0 r U000 'P@ 0C00X0  0SᎨP 0 r 000 4 0d p4 dT0HʏKS8SJS0 9R 8R%*0R +R+ -RH(XR+ A0BSAaR>:fRxR:0PI0 J"00003 J000S03 03 S  :J   60K0UI0 0 0CS0000PU  ?K0CUUUXPxPPE ;-0 80#<80#?   0p@  0p 0p @pp4# 4# 8 0`_ H?K8RPPJ,0 9R 0RJ#*-R .R +R!ER eR  J  J9S:J0 0CS0000ᢧPX   _K@PEt{T-xePEP qxn;0 87i0p@ 8Oi0p8:0p4# 4# 8S 0e4P4 4(K8N -DpL0`S@PK 0@SK@ -L M0`Ⴠp=X:0S 0@P0~p @ d0P0}p@  98@  b$K -Lpp p'  @0S1'*p7@ @0S1 8CX0 8CXp@  P 1 A P<70  c`<7 p, 0R<000`< & 0q40 0db4P`V U00D< 0DO/K<' D %2 <>&B aP`< <'O?KPbdU87L7 Z 0K⠡K)0KL7 < P)0[Lp'PS*0[H H SHH  t' ,h7H@lT`$H` \0 R0\0 ` xdK PK@DT 0@` \0 0R\0 ` xdKPpK)0[S )0K000`  \0R0\0 ` xdKPZK*0[S 00+0K+0K000` \0 R0\0 ` xdKPBKtP,hH'@bTT`$H` \0 R0\0 ` xdKP'K@DT 0@` \0 0R\0 ` xdKPKL7@eT`$H` \0 R0\0 ` xdKPK@DT 0@` \0 0R\0 ` xdKmPKp <!` \0 0dQ,7d `'R80S\:000`  \0R0\0 ` xdKDPK87Sp 00d`  \0R0\0 ` xdK+PK80@cTjP$(` \0 R0\0 ` xdKPK@DT0`@` \0 0R\0 ` xdKPxK8808 a<0<'XG0bT@T` \0 R0\0 ` xdKP[KX? @cTkP$(` \0 R0\0 ` xdKPCK@DT0`@` \0 0R\0 ` xdKP.K<8X'P< p7 00d`  \0R0\0 ` xdKPK<0<8G0`T@T` \0 R0\0 ` xdKPK8?@cTlmPʡ(` \0 R0\0 ` xdKhPK@DT0`@` \0 0R\0 ` ҂{8'Rp7U <d01K01K>K000` \0 R0\0 ` PxdK9PPK<T'0B0` \0 0R\0 ` PxdK$PPK87T@iTܮ`2H` \0 R0\0 ` PxdK PPK@DT 0@` \0 0R\0 ` P <00`  \0R0\0 ` PxdKPbPKXK\` \0 R0\0 ` xdKPOKp'* h7H@lTaP"(` \0 R0\0 ` xdKP4K@DT0`@` \0 0R\0 ` xdKP H'hl1R 0aR\0Sl  xdKP 0㤐K`0 \0S xdKP0`0 x'0@0l7 bZp 00lw PY O@P 0KP D:8 Ml(KP -DpL0`S@P?@ f0@S9@@QRP000S0 -LV`P @ 0S\00R001S @  T0p@ 0\ T0Wp@d 000XlT00S <0@@ \ 0 0i<)@ -LMGPPX 00z`10>CNKTa@D @D 0P3KHH k p* T0S \PT3 4`K Xp7K0D@K0@3[<3K03K\ Tl  (0!"(80S Y00 @3[P3<8P@<0X0P(K踥  0- L@?pP  /p  /p  .?p XY0$S TY@@=PYP@0 p-`PLU@`P`0h`  h0S0#*P0h``0p -AMLM8pK`d P(K,0SF"[3RB2[S?2[p< : 8 CNK"[ @D0@DD0H  ,0S+#[<0R'#[80R#@P2[  XW0 02["[[AmK0`F@`FT@D,Pd 00S  X00 K -L0MP`XKS-!@ T @!  8 8 d, X100,0 00`VZY`w 0S0%5,0 r<040R(0 0ZY (K, -LMkP"{`@p{xb"Kq 0Sn"[0hS*1 0Q Q Q QD1Q Q6 Q=  O4!Y;   !O! J&" 00S   0S   [`0 $000 0S 0"[0hS,0 0 0SDw D 0-< LP@ P0 -0L.S@P#P*QR00)0P00X0`dS F>R`V@1@! WP P0@0S.pJU000U -h3LM008 ,0 0s ,0 S P R P u@0+S  -S00  ` Pp4 0 !R ZZZ Z5< I$`VN"0I405<A$  4 0  0L.\  0 S00S< P 4 0O0S "4S 4P 0` `0` \8@4 K  V d1d0@0\ 0 R \Ap ,P0 vN00<110 0ᠽ`pꜽJ W  0Vd9#Zp ꇽ`p X 00045# 80 @T8N00 (K8P -?@p##pWL MX8 0O?   BE!5;t l@ N"0 01`V#U!42T1,0  4 0   0Bt4 0  0"T 14K1 4 0 @T0 4 00 0,0 4 20|A$p0OT?@ 00@@#U[ UDe VZ00@@P` @ 8 3, 0r03Z cY 0zdyVUZ00@@l ,@ 08X  D , 084 ` (KP p-H8`LP@Pp0Sp -LP@ R@00 00 -@L,1p- 000s00 (p-"XL`  p@pp -LM   PM@"00S0  @0  !K00 @P K p@K$ -LMP p@ 0^ Ƞ,Ƞ0@P` ("(p V`00 p-LM ` Ƞ,H@PP  p 00nxx -1L`PV@7 s0pA("S*L"0 0(Q% 00P  000 `0 PP*@` N$0@0    ? - 2L L0S L0#S 50 !S0S0` 0C# @U  000PP P/@` T0L 00P00 R p LX0 Q dp  PpWU% ,0 dS(K(w h ȹ 0-@LP0 (0P0CP:0@000 $0 R00c 0 0 00000000 -@Lh 0- R00 0P0Lp@f/00C00h -L@0S - L`@p 0QP@150` !!@c + RT -LM0MJK1@D00@D`* 0 LK P Q  0000 0b00@sPU:K0C00CUD0 @ 0s 00K<0 0 ,0 00 (0 8 0$0 LpK  *p@ K0S K07SJ#00PJ@ U p .00 0 SK(wԹ -LJKM@DP*)`  V@  0`000 0b0QzKpG eJp@ J0S J07S J#0 0 PJ @7 K 0- 0PQL@J 0 0P0 0 0 0 0-0 0SL@Pp00  0 p-0P 0SL@`p 0 6000p p- L`E0PP PP@P0 `0`p Q-L@*P T@ -L M`p<0 J 1! /8 P +e%@,WP@& +V%p@ 4PK  N,0 0,0 Z,00,0 ,1040 0@ ;%pP-I@Yt2I0S. a8 0p P*%@I?00tI0S8`l d0p P*8%@I?00< R00(KLdwd  -LpM`10@W,0   @K}@PK cp@K@  {`P060#0P@U@Ky}   ރ B  {P0\0#0P@U@K\} Ń   %0, 0R (K(w -L\M` @ V^PP, p t x a 0Cs^0l0 oPX   hKTpK| :(< 0|0(((  lp t0@iD0@00 hKp t0\X0D0 @0A 0@A0#Q 0@ T:V@1@# x@Kx `d x V@@PKl , ,hK,@K, ,0 S (K(w -L@oP $p !!!T,at -0LMM0 ,0 #PPWoKJ%T1[S   @P UK,MK H0 deo ..㯅Pp O, ,0 S1(K(w,$ -LAM0 , 4$ 84 `@ PBH?0004A7pP 0=>P 0H0Sdd!0UH48$"PD "H0S@ 40B^KPE@DPE (0K@tD^P?p%0 1H%@P P 0+4J PGhpl 0H04$84c`PF^ ,0 S0(K(wLdhX|y< -LM8 < ᓇPg `,pKV4 D0 S `PT 4 40@#P0S> 4 lPP8 $ P@ l@P8 00S0 KP 0 R ;;S wl@P"0 G8rP 0l alQ<  0 4Kdž@PV j$@(KXdLRA Q:0S  -LŸMS 00 8 `0 40 < @ Y0,K00<勆PPU ,00SQ@00 S  P80eS\,0 @,00T:, R 00S S0B,0 ,4 QR 0E 40R P,00C,0 ,8pqp3\pW  q@P8'8@ Q , ,08@  pX00V00S< 8 R9 P4 08pP@"0B 0S S 0S 0S4  S0 S S 4S S R`00 0S 008 @ R8(K躺 -aMLM20$0 pP" !p` ]KPE[NK@D +? 0K 0 E 5 U\e !pT?*cK^PXGk06: S  S [NK@D+ K@@P[NK@Dp1l!G 0K@@X@9@UTSaD[NK@Dl!`PF0S  K0UC^!`PX% lt!n/KN!PX[KA`t)) K2SPX [KhAwB\00S $0 S4 K(wwd (0edAHd̺ -LM  K K0K P K 0-L@P,PP0.S 0a C00C0  SRQ00 -LM  K K0K `P K -0LM0`p  $0 PPKBPUOK /e SK+e,KK'eJE.+P_K\;9) $0 S K(w -@PLp@ 000C S 00 B00C S 0.S 0  00B S00EP@000C S0*S@0@SU T0 0B8 S8< 74`@T@D++ -PLMb2 pP@, %Sp{0BS| 2S- +SI .SI %Sm3S >S7iSb DSp dS nS rS , &`*`( UcU V*dd000eP V* y0 V* X0,00c,0 , RPE PC0 U0ppP;0PUU U,0S!0S ,0S Q0 u PP U V{*PP Vs*0 / BP>10CB>A#>A0BPE0Sj8@@f $PW*輻++hF p-LM`0`@K KKK`KPP +0 000KpH -0L: PH -$0LM K4PH p-ML Mh20@0 \2`)PPDPPAK@0@$0/S PAK@@ P 0S AK@0@! P :AK@@AK@@+A.KI>K B0C B0C$ :S S S:S0S QA"*0S0U0 0S /S P+AKIK@A @`A d PPT00S +]:bP 0S` T00S <0Pu 0 S(;Kp(wH̻Ի;,Ļ ,"-L Ÿ  RP`@ 0 0Թ Q 10m Q 0᷹ 0P`bN Aʠ^   0b< 0BcA4H6&? `? 0S_ c`\  pQ @^00P00S PpW00Q n B2`@? T P  |0 ` 0:5 6!ƠP `5* -LDM \p, 0 \P0QF0XSxSB >r< 000D6 W @`  Q#00ӑ iPhh#h3e00T02@0 pW: @QP q "000DTpG- u00A SrТ` @ Sj Pv"2$TaQ 00A SpWa:/QQ@ .QQN00A SKP/Q!D00A S00V0S< @ j P$ T9Q *00A SP&Q@"V t0S SS0h1P@@0h!0Q  0T2A@0(^PK2 1PA@(0/@P00 |PT@ dK0 fd0S@ A@00A/00@ ,0 S,(K(w8L`,@ -LM 0|밼 -LM0 |w -0L⼐MP`,pK,0KyP i 0 ##SVPU`0.T00S` U @ TU ,K A$ -h2L M0P,0 PD  PD<@K 0:S0:Sr ` p@ H >(PP1!P 1@ RY0cr1WT @ %:TXZ I0SF H 0SB'$0 p`p@ .T5`,0KV1 iP,@TX  ,0KR!0'$ p`Z<K 0Vj  0\0 l^A0VD<K @/00 ,0 S(K(wD0%%%* 0Z --LM0 0 K..* -L M` @P4K0px $@ PPP00P0#S @00 Z $0 SL K(wpX -L`M\,  0  \ |K ! BB/A?/A0(K B 0bT 1#QT ` |K1Sr @@r v T` Qr v T`v Z`ZK p. ;v W 0WW10SG*:*W @T>*: W VZ Zh0L S   dNP@ m@|KPd!1PPpW00P0#Sv 0S ,0KR*:00ZK .0R:?0a @S@?00 叾?/00 ,0 S|(K(w85d -0LM@P 0  0S 0 S =S00SR ?0 0 0!0S0(pPd `K VP P$ -0LM(0 0= S S00SR W?0 0<Pj(@K  1P (0 `@(  (0!0S0  P  00pW0bXP@P  4`0S @@0 0pP$L -0LM`P@,0 8  0S 0 S =S00SR >0 0]8fs 4 , KP T,0M HQ00@K00  00!0S0  P0 00Q< 0bCpQW@P* 0S @< 0@,  40p ,P@P ,0! 0S0 =S=0080S8 0 (KP$L + p-LM@P`iP0fC @\000C S 0 cKp -4L(M PK<KP0 L@ Ple/d4<@0 @ @ R*0S0 |S :S00$  $<: <P#X0<0X0D KUpD0C<DPK (0<KD0 00<ED0 ,0<?D0<@ K40P@l  <P.pD0 8#(3 D K0<#p2B, 00D0 800D K7<p8 40D 2KKN0CBK 0CL|8 LN B;` Tx ( X8 d\  |P U%XPD%0S@ d  0P7 h< 8 ( 0 p P D8 R@ <8 @80C88 RppSPR`P1  P.`(\8`%TzPd p P |xHx PPH(W:|+d87Plğ0Sd02@ d @P(RdyT+|8H p0 SU!0U@E\S 0X@ U:;Pf?PVP^ dy0fP@`XX d @T0#SS hPl(R PP0:S@l{P@T80T8 T0S*.K B0 B0CL p( t8 x = FpPn @0S :S@DxptT(d8PPP uP(RdUypvU u0:DL8 DLX 4 0S :S08 i b0( 4 00SPG:S:08008 0(0ecX(0hZX;0f pPVZP^dy )f0f fpPXx `0H a@40( @ DP(RdxX8f`S0A0 vP`V )9p 00 L\(p^p`Ypp ,0 S,|(K(wȽd@н -MLM,30(ß,0 $3$C0 <8 3R048 0@ S0nyP 2X "0S00f  P BnK`F`F⌢{8h PP8Q(: +0P`8 P"0S00#3@ @P@Tetx1 @00P@Z *yPS8(0 S8( U0U E\S 0U:;@hP= 0hpP000S#S 8(81f/0y1 h 1 NK@D@D Pࠟ(K0pxC0`KA PA@0pt@T 0^y@8l 40PS H0<( @T 8 P,0 S,{(K(wd@Խ 0-L@P0h -LM 0  K0 K 0-0@L0PS0@S0@ 0-0@L0PS0@S$0@ -LP@ : 00S0 R r 1S010pS0 `0a000;?C0C,  0K2 J0 , 0#2>;3Sa SC S- Sy'S- St4So S Sj Sj:SL Sb Sa^S\ S\: SW "SVH&S SQ 0 L!L1WWIXF0!W(1W? W< W8>32 0 00 0->400 2&0aPC E 00>  >3 0>3 S0 >01 >3 S00P@ Us -LMp4 Q00 Q@, 0Aό  F0Zl` X00 X00LR,@P@ V00  V 00"U00P@T T 0  @Dʰ1U  XD x 00 000s03_X0S  V vd 0  0 _V00R08!SP X" x 0  0 _X00R0S U  V v 00  000s03_V0S PA?E0CS 0  ,<00 40 Z\, 00  @\,(K8 -LMPp, 0A>#R R R >3>3>3 SR8  R R R R RR RWp, 0@,  0,0 DPP`I 0`P 0 `pw, 0`,  0,0 FP@IpP 0P  P00S0@P R@ 0rpE, 0,  0,0 JP0 E0`0>3@ 0` 1>3@1>3"S@D0 @~ PP0 @<p 0 >0c"O 0 >0c"O0 @ P U/(KG-M(,@H`pIP>3Sg SD S. S'S. S5S S S} S=SW Su SvqSo Sq@ Sj "SkV&S Sf0X !1XX]YZX!XSXP XL>32 00 C 0 > 0>0 0 `0 S004S0``C/ 0>0 0 0 00$ P >3 0>3 S 000 0>0 0 01>3 S 0     0 0 0` V]Ѝ -LM4  0p 1>#R# R/ RR4 R R~ R&R8 RT |4WW 0RS4 WO 4WJ >32 0 0A pa0W0[ 0W6*0W0W0P -,*0 S)0H% W0 0W*0W S0 W Wr 0_R  0W * 0W0 * R0r 0_R 0W Wr 0 _R  !>3 !>3 S .Z00S\R 4W 0J0,0 Q>3S9 SF SM SS Sd S0>S0P "0st `@S dR 4 0dW  P,00 !0S   4  0P>3 $0 1p 1WA  >3 q 0c 4 P\ @>30 @C1>3@1 >3"S@D0 4 @P<0 1>3 S5 @>3@d_4 0 0 P0 0 @>3@d_4 `@ P 0 ~P0 0` p(K8 -LM4  0p 1>#R# R/ RR4 R R~ R&R8 RT |4WW 0RS4 WO 4WJ >32 0 0A pa0W0[ 0W6*0W0W0P -,*0 S)0H% W0 0W*0W S0 W Wr 0_R  0W * 0W0 * R0r 0_R 0W Wr 0 _R  !>3 !>3 S .Z00S\R 4W 0J0,0 Q>3S9 SF SM SS Sd S0>S0P "0st `@S dR 4 0dW  -P,00 !0S   4  0P>3 $0 1p 1WA  >3 q 0c 4 P\ @>30 @C1>3@1 >3"S@D0 4 @P<0 1>3 S5 @>3@d_4 0 0 P0 0 @>3@d_4 `@ P 0 ~P0 0` p(K8 -LMP8 <0 Q`40(@04 0  V< 00, 0Aό< @0Y|p Z00 Z00b,@`@ W00  W 008"88V00`@T @T0< @D1V  ZD z 00 000s03_Z0S  W w 0  0 _W00R0S` Z" zP! 0  0 _Z00R0S 1V  W w 00 000s03_W0S `A?F0CS0< @0@\,0 04 ,0 8 YP  00 4< 00aO,(K8 -LMPp, 0A>#R R R >3>3>3 SR8  R R R R RR RWp, 0@,  0,0 DPP`I 0`P 0 `pw, 0`,  0,0 FP@IpP 0P  P00S0@P R@ 0rpE, 0,  0,0 JP0 E0`0>3@ 0` 1>3@1>3"S@D0 @h PP0 @<p 0 >0c"O 0 >0c"O0 @ P U/(K -LxMp 0 \  >R(00  l S$0 0    0 MY:<`V Ph@ 0R0@ UP @PE Tʠl0 \ Tp 00 ` X0 D0 P L <0 80 40 P0AϠX0`  `Xl0h p L0pXph|\ Vh `00 V\0`0],@P@ W`00  W \0<U, `0P00@T ` T 0  @Dh U  VD v\ 00 000s03_V0S  W w, 0  0 _W00R0SP V" v  0  0 _V00R0S U  W w+00  000s03_W0S X[A?E0CS 0`   8<>  X00S  0p`  (`ZhRH  xX-DPH0S `PKH 0@PH00H0  ^H0Sf X0S`0D X X0S  X02  `0D0RH0S \0 `KH 0>LPD0SD L0SD0SX `KH 0>P``PKH D T 0 0J@P 0 ( H``%PP" TH0`0`O/\ @P` `0D0TX02P`P`@TXPヹDP      0  | | | ^*<`V| @Pi 0R0@ UP @PE| Tl|@\ Tp ` X@ D@ P L BP< P `0@0 8 0 0@ 40 0 0@ 00 0 0@0 ,  /P00Y408@t0 `0x  |pY!00AϠ0 `@=`0 td L0``Yt dP  Wd 0 W\0,@UP@ Z0  Z \0``ş`%U00 P@T ` T0 @D U  WD w 00 000s03_W0S  Z z$ 0  0ğ _Z00R0S P W" wx 0  0 _W00R0S <U  Z z( 00 000s03_Z0S SA?E0CS0`  0| Y00R0S`0 x`0 t` x0 pNdH 0S yXHDF<DQ H0S `KH| 03@PH00H0  ^H0Sj X0S`0D%X X0S0  X02  `0D0RH0S \0 `KH 0!LPD0SD L0SD0SX< a`KH 0PPH D T0`K H@P0 `K@ HPPPP" TH0`0`O/\ @P` `0D0TX02P`P`@TXP㗷DP㔷<咷 H0 SH0|S(KeE8* M0-LM0 0 0@ POhK0 P*{* 0-L M0KK p0PS ](]D]X]`](] ]L]@ 0$0%K@*"00@@ AK0 1 xB 02 #4xB 024=> 0&롻@-/@d4xB 02d @-M)Ѝ@4=> 0|  -L 0KM#(C -LMK  K㓻P K -LMK  KㆻP K -QL M@ 0K00#0  0p03T0S00#0K p- 1LMP4K8 K70! K, S:p` P  K H$ KC0 4K2 i'P'$K@ I ` K+''v$KpP$  BBp*A 0- L0@PP d0߈P0p0 (0姄P00C - L0P`ˆPp h0勄P X0|@ <0v 0DpC=P4M<P81#8181:P02410!0 < 8#" Ѝ- 0-Y+ ̌!00@  0*\\* -02LM0< @  p@t 0-T@  +T000 @ 0  z 3Z00S 0T0XSxS@p R 0T  ȟ 0X 8 4 0YP, `00D S t1 !000+ W070c P%\!40V8 U 80U04 V0, P00S )P"0`0 6#P o@00\00S Pu`@ R \pGKJK\1 0Q ,Q @ 0K 0 KP |  0 cKx1 1 4 p@ 1P|P |P ѱ0|1 00~% 00@ 0 SLhKp(wB*<<*::*: Sb0  Sc0  Sd0  S  Sl0  Ss0  S-0p0?0 0r0-00w0-0 00!=@S S-0  S ! Sx0S0s00 r0-00w0-0 00 \ \-0  \ 0\x0S0s00r0-00w0-0 00p \ \-0  \ <0\x0T0t0000 00 0-L@PGp P Kp TlA U` p@ T000"d66***R0@-@P \4, 0L 0lRQ@P03P3wwwwwwxxxxxxxxxxxxxx$x$x$x$x$x$x$x$x$x$x$x$x8x8x8x8x8x8x8x8x8x8x8x8xLxTx\xlx|xxwx 10000000001001 0014001|001Hl0d0 `00P00@00 000$00L 0PL$ 0-@LP8P(000P000QRP000S P0-PL@   01S S  R 0^0#T0 0 ^  RR11:000-P S30S10P P10:00 P-L Q#T0 0 P0s3 -0LS # 0P ( 0 $ >0S@ !88S@ ::S e# T00@ 0lA?0 B<R<00  -L@\pE#0+Qpp RU \` P%WPH P ` 0S 0S Pk 0S Ph #T00/ P`|3U 1 !0S?0\:\0lIPL06+@P00 R ! 3R(0P WP L -PLP`&RZ 0S00S)0 R  d 0ppD pB P@ @@pT:6SR 0S00Sp@""T00#  00S d 0=p00 p00 P @pT X1:00 -L M`P0 40  i"P00LXP=@Pp,K0QQ=  pP6 P@0 T/00SS0&Y p@  ,K@t,K 0P0 T P400 q ZU1e@:0 10(K 0-L@PP[YU@0//s* -(L"x H!X` P  h᩶ HU -LM(KS2 2R $0 Sa (0S]:|2t" 890h2 \ (084"#H<208#Xe@ 2@ r X`iV@ T S XZ!A 0S1h1 " ڰP"4KP4Kd0@0   S9001Q1 0@ !0.00 !@R0 \ ( <@ 30B320 0 R0#@$@T0@@K 4/uy86P0p -0LM @ R R R0ᓗ0 Pexh h0 R@0@0@ 4( 0000K0p$ -Lh}p 0-LM0@ K R10t!p PLH1 PL`R5``|ee 0 庶p P# @`R01S 0 ᦶ | 0嚶pP,T,yPD@ 卶K0$p̑Կ P<> -LhoP0 !  |[pG* 0LS\\ 񟗕4\ԉ @\Q0000aQ@ 7Q 0Q'*$QH -Q00 QK@MQ EQE7\Q =rQ fQ, nQ bQ8tQ" 3 03:vQ0G00A00000 0 00600 0 0 00"-Q0 ^Q0 0000?Q0000 0A0S010000A0S0001000  -LM `K00&p@ 0FP@@00PU$ K0/P@hP -0LRM p`C@)K0K0  C  0P T)0[505@ T)0[505@T00ĕPU)K0 K0PT)0[505@T00ĕg(K@-A@0gS -S0 XS1 +S50oS uS0=#80  0 30100  0301000T 0I@@-gQ@ =Q +Q -QXQ1 oQ uQ, 0R0- 0+\ 00\00  00  00000+T00 -T00 =T000 -L$M@T j4@K00K 00 奯&`$ 㝯ჭPz 0`00C S8` P0`< ( ,K p,0`0S>0S Ẫk "00\ U@1:`@PP 80H%=k0 0Gp0gS aSoS uS ~p'}C~pp +RH -R=R 0 0H@0=\0@0 D |0sS gS# XS~oS rSyuS :wS xSqIW  W 0 |ꒀIX U:<⌡ < 傭@P 0f0 D P`80H PHD +Q00R0@=QS@  U:<⁡< [@P\ 0f0 D P`8XD0 PD U:<  ₡ < @@PA 0f0 D P`8 H0PGXH@ =QRH@0=\0 U@0 :<⁡< @P 0f0 D P`8H0 PDQ! U:<  ₁< @Pᴩ Y0f0 DP`8D0X lPID -0S ,SpX+-0S2 `0+S -SXS@0-S0 @ +S0 @XS0 0`T@p\p^p (K -1LM0`p,  P@t 0-T@ +T@ v 3V00S 0T0XSxS@`P R 0T ``㚱ㆱ00D S t 000 W070 cR\ Q00 R00S!! "00@\00, SaR \,0pEp8G-1M0 p `00B Sn0R  XRxR   P00B@@ S<, Е^ Q r 0D A0a00c ƒ.R` VC  R Q;r9 06 0mC10S%|P̗\)*0Š$\"*0S R<8\0SP R<84 X ,< $8 #$,, Ѝ8 -LMKyP|*x*Q -LP`pPp`p00 㸓{@ᛒW1AX* -LM= K$$J* 0 0Q0  {\Q@-@  @Q*Q?Q [Q#Q p 3000#"10# Q00S10# Q00S"20# Q00S  0A QSp 2000 \Q@S Q Q# Q> JQ QF& Q*  Q Q>*0\  n00\  r00m0\  b00\  a00\  v00\  t00\  f00\  s0\00 L0 R00000Ε< P   ?Q*Q #Q[Q \0010"#0 000 0@\00M00| \0000  0^  Q?0@00-  008 p-LP`@00 S  e0p -@LpP`T0PEU0 @U 00g0 -LM4 `4#1!0#  "@0 -K @p80 < @ V\Q  @Q*Q?Q [Q#Q q |000 80 Q00S<0 Q00S&20# Q00S   0A QSq 000 \Q@ T4@D"p#*p0-K @0pcP U-K 2@ HX HQ T:4\000 SP-pK0lg@0S i(K8*bb** M0-LM0 0 0@ PJWK0}* -LM K[Pwt@ -LM K"Ivt -0-LMP0U0 @0 0 0Q a0`0 |P@T$ (K K 0K @( @夯P000(   K0$,w,$<""*==*aa** *pP0000 P8000ӑP000ӑ80 S000( -@L $$ R*00 C R00T0SQ00T0S  @-0P`p @ 00000l0P20C^  00C 00S 1>3 01 -L` R*P*0S0]S`pPhQP0Sp@T U} 0- LR@#r+ R!*0S*0[S.Q00 PR *0S*0.S0]S00 N0 0 p-0LS@Pp P`P 7pP `p p-0LS@`P 0S0?0 P  0 1 p -@ 0SLP*  ȗP &  㿗P 000 `0 00Vp&@@P= 0!0P0/\ 0 1#"0 "\00g ឮ0Q  R V001@B#"A2A` B 0V 0000@q0@0l0 @o R*0^S00 R*0]S 00 ]00]00]0 -S00 -00-00-00-S [SR: {0:S =Sw 0S0!#Z+00-S]SS R*q Ɵ000ujP0S p@ T 10 000000P#p -@P@ Pߣ @   @  ge00S R!#+ R*0S*0:S0]S. ] 0S0!#+00-S]S =) 0000 R!#+ R *0S*0=S0]S00/; pR*0-SQ*0]S -P00W@ @ 0000000SQ*0]S  R*-S0]S  -00-00-00 R*0]S  i0Sb 0 0h@Cp0 t 000 4P 000000@DT Y 00C  0N@@000`00^00  00 00 0C0p 0 0P\ 0 0PVo* 0@0S00T0S 0 0 00Q\ \ @T:`0  bB"oM$8@ p-L KM0P0^00K 00KS0`0K 0@0KP`x -LM0` @8P pw 0000 zP 0KP 0]0@ 0K0pK0Kq@P N0S04  48 -`RLP@p "P 0!ī000 -LP\`@# 0 q$0S0$0L0S0L0 Q   fA! B⡬ 0p -LP`@p0 ST TW0 W000StԲܲܲܲXXXXXhdXXXXXX(@`  f00   f  f9"  B a0  .@0 f~  f  f"  B a   KpG`@  f0Y  fi8@DpG2@D`vi -LM00  \@, :P0^S00 W (00(0 ,00,0\Qp0P!#u+0 0|4W_ .W *W|w[W JWwlğ W >G0CSnNL$WjF00  e a2^ 70D  D 0DP U 1   R *0S*0\S0)S \) U 1H   R *0S*0\S0)S00%  !<0`CQH0S   H  0HU  ; R*0*Q 0 0 hx  h   h0l  hPSw*\Qu0{Sr00 `R*0,S0S0 *000C SVP \P 0a R *0S *0\S0}S0 0  R*Q*0\S0}S x u  P R *P*0 S00 SQ 0 0C0+ (00(0 000000, S(KoL$W (K){} - L M@, 4 G ?U pe +U*U`*$UM (U.U~\^U7 [Ud \Uvd{Uk |UqHR!#+0D  D 0DP U 1  R*0)S ) U 1H   R*0)S I    (00(0 ,00,09  (00(0 00000+ #00P   R!#+00 R*000C S  R*P*0E0?US{U0S*000C S0Q0 +U *U?U' {UzB 0  g  gB   g0   g    g0  g*T 0  g  g  g " B a  E `R*0,S00000C S\ 5VP %P 0 R*0}S00  R*0}S   Q* *0B0?RS{R 0S*000C S 0S*P|U 4 U0 S R/*0|S,0, 0R    j 0o 0 ,   i00 aC 0" 00 0  a  i (Ko|, R (K -0LtMS` 倀/  PPa *(ᙨPf@P $ 000 P  O 0K0 |@ `   P(0 PHPP0|P40 pPP P(P,P0P3S S SS S SP`B B>3!>3S S "S (00(0@0P@P >3S@P ⃠P<@@  >3S BR000S   0>3S SPASQ(00(0d0L0D 0 L0 @0(0Ku0S p(KEe -t0 LR @T T0R000P!PP<PheE0* -PLM 0@0 @ K0(K0 RP0@(0 $@ (K --LM0 0 -D0@L`P4 0KT A @ W,w, - LM0 K  Yp K33* * * -Lp`@ P@D`@0c%T -L8M\$ p`<@ 7P @ PU@V@K 02R R @ RV@K 2 ` 25ᖦWP  $0 S R K(wP1i* -L M@000@00 0 R10K' -LhM Q 0 000?/0 S @?P046S d  X  0㈀ 儐 mP0   D [K0 K,0KoPP Q ):**R K46oB`FT 0 ,00C Q@0a3 A 0a8CnA✰`FAT h>d.d>>`.`>@P\L.L>4 0@Pևh 0\nP hG 0PhAh h R0d0 h=K1 CnPhࠣA d h d ,0h0fS0SaBC\ Ux0 Ux E\ E^\ \ X t x0h0llx0 t X  R @R0@0CŒ0 Ō@\  p l ` # ` 0  `p  l ` 0`0 \ ` p l ` h 0`V0Fp` l0 `p` 2PD  p\00S2 h^+; NB1`p;K z@@ 聆P`tT p  0a"h @bT ; 1 KcDbP@p` W@PV pd0S :  zmpP00\00S@ P l^  P:1hl A8 4 p0h40 8 G 0 :4`^ p@ UA 9 ф 0p`OlP4 H p 17mP`4Qd)1A 0 d 0᱄D@ ᒆ@ 0ᢄ0@ 0@`Pm@P@  08 h  0mP 8 @4\S p8幅`p0 0᱅ | DT@̀ 0d 0`P4P 4 40@ Z 7@ 7K^ 0kPlʀ K @ 0lP 0x0S 8h Op`pꈀK0 h0?Q0Sl p R00Ӭ61 R 6R 0WhPhpH 8 @D P 0-` 08 0000 0@P!P ,6 p Y' 0 0@P^kP8h  0P DXh 00 h 00x9S 000@P`0SxPH0  T\,0CN@6@cnPH  \x\ Px \0RS`\0x\ S 0c\ Pc `ctQ` R Hn0PH0  P n@P PlP@ PtnPP  NnpP X\ npP `@^00S X 46S 40 S \P\ X R0 01Hl 0`\ 00 0cS0C\ S\0\ P`UPmPP ^ \QxmpPW d R P6lPP  nPP H T H  mPH ? h0l0Ch0 p p^&ʌQQ" mpP- p R P lPh080 H pDh L D100800h0 T VH(mPH  ZHHD< L H H Il@P H0  ! $ mPPLPkH`l@P 0SPPkPl0@ \ U00S Y9T* V1@ V00S YP0S0SUPlPP kP @:T @U9T0{900t'ؽ?aCoc?`(?yPD?x(?$@@@?< p0@RC P  1mPP w LH\  &mPH l L L  mPL c H  mPH \ << nDPP_0@P@P0  \0SL ,p UPlPP = L PVlPP 4 kP  D X100h00h0 0x9S 000x0S IkH\ L^ ^AkH?kP=k 0hS00 D D(K -L⊄p3 -LM< 0 S<B !0 0<0  4 P8 <, 0 / pP`08 R0@ 0@s 40Q PP`0 @p ! 00S0  I00 BR0S < jP58p08 , 0P, ` 0@0s@4 ,0Q @S0 p ! 00S0  I00 BR0S 8(K 02@ j - L@@ 0SjP@ 0-L@PP  0S0U 0 -QLM@8 P<0 R 0 0љP4 8 e yꕘ$*`< P@&<0P  0Q0p 8净XJZ p8 e║!, 0 0 040 R0  0 R08`A8 ꕗ$*< Pp@! 0 R0`80pWV㕖' `ᕖ$4< P 400 R  0 R00 8,0Q 0 4K (K;;e*a*( -LM0 G K p-0LDM0PQ`0 *P P\@Kbh 0#200 00@R0 0 SLKp(wd -LMT0@K`P$0 p\ ב$ 0R qL K(wp -MLM@lK, l p`=P@ VKAp g;$U eXW 0a0Q U)K ᖑV U PUo0 ONK@D@DV  U FpPD @ 0@ W@lKV ,0 S  L(K(w| 0-@MPL 00K0jj**0(0 -0LP000@-Q@ Q QP0P0P0P0 0-@L0PST00SP,0h) -LHM` h p$P \\B\pX 0000hPP B`X 0000x0S h 0dP@Pk04,"400S0 aUP bP0 TA 0000pD "00@0@@4K9뺜P`\ hd 04 T X `@ TdKuSP0S! MT0T0L0Stl0\0(RP 4@ 00@00ኔሔ (K00 -LTMP\ p  t0 Q40` pP`h0 p   R0` R0d0 4 L0Kx |0 P ( h 00C,̠Čh 0("Č# (K FP6(0 R% 0SMR GR KR R kR mR gR`PA`VK 5` @ `[F`Q@Pڌ% TpLX`0XX `堙P0P00(@$K9L  2@ --LM00  K 0-<0@LP ,,>T   0h,w,-`00S 0 CR 0R0 S  00@ -2LIM0TK(0 `@NVP:KPP50z WeV?  0P{@P 0lp h0 l0Kd0 0`0 dK0\ K PPX 0FR\Θ/@P*1 0R& 0R" R;"" ᭘ _PP @1R <1R  81R" pFQK`4P (0 SE$K(w\P 0-PL@A/D0PP PA/d@P P@0LH55* 0-LMP@ KӘ E0R @ 0 0 r004003200  K, KP,K0+88*[[*Q  ; -RLMP` ?R0Spf10S<R00P @0Pႎ0 000 R r0 11@pppqNZ@ (K, KSV@(` X fPp(0Vp `\pX@00000C 00 0S (0VKZ@0@`0  f00 ` 00SS$K@P&iiB*99>*R0S0S0  R00EE(*&"R!" Q\R0"S0Q0 #Rp0 00 R R R H0 000 S S S  R00L0 -,@LP@004 -4@LP AP  r 000 00 0] ,P  r 000 00 P  r 000 00 P  r 000 00\ P  r 000 00  P  r 000 0 0 P =Q P@pWyx00#S #W0 S SHP@0 S0nP0  0 48P08x(ط 0-LPZP @P0yy*800 S00CS0+00@00CS 000 0-X0L0@S)00CS00PӤ0P00S0@ -0 LR@ r 1S01AP0 0C0 +0P0C0HC -LM0  \C\  p-LM @K`Pn0 ~Kp --LM0 0 K 0P0 0-L MP K1PU 0K KK00@-@0@000 00000#EgvT2ܺ -L@M@ hKs ph( 0 @ 00# d ,0*0 0#`a0"00# \@dȟ0! 00#X@Dlŀ0 0 0#T@$(0, 00# P@ b* 0.0 0#L@0"00# H@ǟ`0! 00#D@̀0 0 0#@0n)+C0,0O B0#  <`G' 0.@0 0#@8@@dE0"00# 4 0$00#0`ǟ` 0! 00#, ǀ0 0 0#nd@& 0. 0 0#  -P@0" 00#<@|0!00# ` h@\Ɵ0 00#lƀT@<0,00#@@& 0. 0 0#  +,@0" 00#aX@0!00# `D@ş0 00#̀0,00#\@% 0. 0 0#  b)H`E0"@ 00#@@dF4@0$00# ` ş0! 00#ˁL0,00#n$ P.0 0#  T0b&P%H@`0"0# ğ<0 0 0#lȁ0! 0#d@d$0, 0#  HX0b. 0.0#L@, 0"0# ğ@0a 0 0#4@ā0! 0##h0n 0,0#\@  * 0.0#P0`0"0#D@ ß0 0#ll΁0! 0#P#,0 0,0#`@ 4 b( 0.0#h@000# L@Ÿa0 00#lˁ000#T@"0 0 0#  % 000#\@|` 000# @@\Ÿa0 00#d@<ȁ000#H@"0 0 0#  ,Ab- 0@00#@@PQdK0P00# PP4aX0`00#``Xe000#<|` 0 00#` \lˀ000#D@<1  0p0  "0u 0 0(KxjVp $ν|*ƇGF0FؘiD\"kqCy!Ib%@@QZ^&Ƕ]/SD!7Ç ZEogL*B9q"am 8D꾤K`Kp~('09|eVD")*C#9Y[e }]O~o,CN~S5:*ӆ -P`1>?0@@N10@j@RLp0@P:Z @  aphP\@P@pG?W W   oʒ -L(M< 1>?0@0c@ S80 D ,0@D0 @@ 4p 4 0 S S*S? +S -S S t 0t0 040 0S,040 @t@ 4 00Sx 00XS xS!t@80K4K< K@V0S@ Ss SV t 8 R =LKX8[0DKLK< QC4 040 00S S; x 4 P  p Qp@Ւ4$p@ 00@Q:*040 4/P00@9P0P M0SI RQ 040   @@ 64 @040 0P 10@S 24 P @0P@ 0 PPp0p R  \BSp  0ӓ"p R 0ӓ*@4 040 00@ S00 တ @EPeP:x0 y 4p 4 0+S -S```040 00@ S4 040 0P 10@S4P0@ <,404 /P00@9Pڨ*0e\S 00V0c04p 0XCx R9NP IP4iP nP/4@K$WP( 400C 40 WP40040 H:@0 04@KWP 400(S L KYPH046@0 L0D0 L0D0 @0 H0t0 4p DX``Q0ip| T0 VD @ 891H C r@ P 0gqD @ X,ʋUP)T@T T8DK؄1 PhT0\ʤHDK1 wrT 0eA rrD @ T0s`(T@0##DK SqT0f @TW  8DK1 VrD @ 0 MSh l d ` (8@0 0D0 hQ 8`Zl^Zd\ZhZZ`XZ꘧CbpD@K0p` -r@PV!D@ @P @056C@0 87DK1 rD @ @\'7 R6CR7 @0 560@ D0 @ @0 RO@d  6DK1 pD @ DbB V60␦j0p0 D@K0` q@PV pʄD@ @P \ @h60#:kcQQ04QD0 A0276@0 D0 1D0 DK 0P h l d ` 0@D0 @@ m `5P| p00WPh Y ` d h0YPl S h@  ! ⸏DK, K00KZP8 D %[Pd ? T,0\T `0 ࠣSc00CD0aS6b \ $ cRb0 B"00\0 \ @0` @T00 S 0S p pc@c`c^ d#[Pd  8ZPP 8eY8P T8KZP8 Xl [Pl Vl;ZPl Wd3ZPd l8YP` 0 0dXPZD0S@ 46S830kS` 0S0Sx` Z0P`0 dXP*mfZ@ 4"6S5@DT 20jS#:k0c&B# P&\2Qp l206@0 046SD0S\ ,"@0 kR7R9 @ 206C#::@0 0D0 .\P @0D0% ZDKD@K0 c 0xoD @ Y 0\o @P0D@ @P P `dU 1@PWPHZp`ZD0S@046S S@0S p吐`G t0WP t0`pA`p3<8TN@x(|?|A?55?5?P9 (09pZ@P@Q-SP`p l0n`p@0p QX (56CDKDK@0   0p 0DKnD @ @ 0A0S56P@0 <$\q 0VS+검VX7 0 pSY@0U 0@ S 1Pp0 SU0Sp#@UpPd0U W 0VS ` TPF:0Vs3?*!:|-]0PP000P R* p- LR@ 0`Q0PS☁`V*唁000SP 01PS∁0U僁00p -LMPq@ |   t00  t%`pDAP P_ 0  0S 0S0T@V`P L00P F0 0!, ჄP  pR 0S '0SpZ 0p < ,lP  `R 0S &0S`ZX`0 0 0l 0  R:0 0F@0l@AP<  00l ㄊ 001  0S0 i@00`P  'P ׀0 0a0 @0A 0  0, 0St @V   -MLMğ  ` ,  P8 @T g@ 0  (0 S00:Gp/0@@0BNK@D@D+P 0K@A (BP 0* 0U/S' 8: S S!BNK@D@D+P 0K@A , P 8: S0 S/ 000>K(0Cp   R0B0S/S@@Q P PU0E0/S |(U@@K0@S@L+r+ZP  0K@@@ $ P0Sm B^KPEPE+APb@0PY 0VW 0p@ ! ( = 0  d0S00p0/ 00 10.S0.S%@ 8T*0 S0 T:p @0|P  D8` pP (P 0@  ppp ,0 S6(K(wj? -LM:KM,0 K~S0 D 0 A KK@,^@`P*K0A@ Q p 0S /S000S P P K@JP 0FV 0`SR*0S0>K0C K,0傎KPH?VPv [V *V00u@!TP0S p]RP!T`PEr!T||#@ @[X:0:S7P:;P1 0]S.0e,c 0^^  R*0S `PU  Ÿ0l10 0᳀[X@p0 0 ]X 000-S 0]S \Ÿ 00p@0]S 00< 0P 0< 0 0.K B<X 0 X1R ! `Vo1`(K0S KLK*KA KKA(@0 0 PO 0 P < SEK:K0 ,0 > P;Ipi - @ `P0 AP 000000P  0$  00 00@QP7~ 0 D0 (K;[!|:-]?**EE -LM0@{S0}S0Su {KP>K0Cj@@C@Tp0 @P` [S   0]SSSP {S` }SVゞKIC `FP0SK @@0[S ,S2{S }S-   0]SSS@ `V`FV0 CQ 0:0S0 P  00 @T (K -ML M`(KPp@ PQ 0 000 <Q 0pA R>q< r: 10aR6K @  @ 0\`*KS   0R\S0L0Q09 B0@\*0S @K @00 @( K Koop 0 008p 0 008 P Pp 0 00 8p 0 008p 0 008p 0 008p 0 008p 0 008p 0 008p 0 008p 0 00D8P @  QA 0SbG-Mp(0`SPP0`00b@070 S:!^ ^5*.000S0*.\ \\00S$*\00Q*0`0SZ0Y0? 04030#Q0#S 0Z RYh Ѝ  R P*0SPl0p, 0 00P000ӑ8 -SL(M @ D0 4 80 <0  D\D D < 8 < <00<0 <0S8 p @` BL \e D0H,0 =,P00 / QN&0C0H0 .S+ \SP P@P PPH 0aS0S0S00l.SP 00? 40 R0S0 l 80Z:Q4 PL*8!A4 =R#= B0,@",0 a = R <0LS 3`5 5<0 5 .Wp \WpW 40R*ppW0fSW`B 0A>S\ 8 00`Ws40V:\ 80000@ b(K. ".Q  .RA Aa0A \.\A Aa0ARS 00A S  RS 00A-Q S _Q  Q0*S0.S S -0S ]S.R00 S Q\R !R!0B.R]R0S! C00 <8 < 0 <0 Ġ 80 R-$L 0 0 -L@@zT p- LRP @T@z <0Sz$0``PPzzzvP PM@9I@p -$0P@@L`Pp}0P@  @ጄ0(P004$0L0000H0 L 0- L<Q@ *Pcz00?0 0 }PPP PRz P0 -LlM$0@0`KH`  P p PP 0PAp P 00l / 010  P%L 4,00.R80M0S L040. S  ,0S00S40\0   <0S0 P 0  P000K -LlM$@pP(R` `PP KPP4 0R, 0R0 |0R yP00PqW@\l@K -0LR@`p (|PPPPyPP0P0 0pp 0^10 -L0MX P P X Rl04$0, 0pX R0<0  $ 0S 0< 80  8 00 c<  8 <0X @S@R  0T D0 H0  0 XP0H D0  T  00404H LD $000S/S$0L 0/  0 <0s@0 @ 0 @ Z, L  piL , P 4 $0  0.S0S 040. S  h@P Q&: pP T`x, 04$0 :, $0` W $0 00  40 4 0pi@0<00000 S$0*x,  $$0 :, $0l?00H0S < R 04 0H 40 0,< R 80S P P $0 0L00$$0L 0( 0 0# 8<0S0@8PS<  B< ,0  SP0,@ @L P@  L `P]fQ00c00 RL0,  Q00c000S0 <0LS$0 0L RY000C00 0 00D0S# X L0SR<0S $0vP 0:PP  $$0 :, $0L0ST R,0 04 0L SR,(KoQ0,0  4 R ,(Ky -pQ00 W@@TLP 00;`@$0 4D T1 T.P  W$0p:$0<0pS00/S $0` B\ @P6P TP 0-L@PׁUP10@S0 -`LVp $0*0Q4: Q4 0C8S .P$0 P4֡ 04ơ0 $04SFQ $@ 4 0R 4 P 0004P   :$0z000S  0OP 4 04  000 R P$0  `00P0`V\ w<0S($0@SP$0`( L$  坁/1P P0S @-P ⋁(P04 00 94S S P$0  P4֡ 04ơ0 $0040$  0R/S@/00(  LU Pv<0sve``60$ `<0S$0$4 $0  P K@ 7G@ 2   L0P $0P:$00`S004P`y -0LM@p  00 0{(yPP0P u 0P p00$@0 0$0  P @P^ PV 0`<0'uP00E @P? L000<0$  P $W``Vp,0`@,` ,@  ATWY Y` vP `0 $$0d P$00$0Y u %uuu000 0(KL p-\PL0@SŁ0` 0u0S0Suphk@ p-LlMK@`P%0: S kP00 xP P"<00@000xP uP @0@`0@``PKp 0-L@ɿpP  00R00S 4P 00PP 0 㪿0 0-Lsp@P PP 0S- " 0\0  0\0  -L`Pp@P PP@@ PP@@ -L`,M D0 0f@ P T0 P R0V040  4 @0S'# ff<0 H 40S 00  40H @pH0 TPD P<0X*@ p@ 0R㖣' (R0B▣( @  1D0P  D0d|d pD0ev  D0pp40S 00   40O@ p0B▣)0@ P80  4 R 00  409p@T4 D0P f0  40S 00   40 fp0 T0 00 T TP D0P_ 00  40Pf@W'8 ff, L 40S 00  40L @pL0 TPD P,0X.*@ pjph\\  l400i PefQ!Q 40aW| D0 U |e@ 4 R (K 0-L`P0p Rp0S   P   @!R  000lRڏ0 0  0  00@ 0-LM4P0@SK0S8@&&֨*LLҨ*ooͨ* 0-LM 0@0 @P$K0G-HM@pP0 #2b P"3 UpG1?7 (1 L0LLLWW& 0 00000 R0 S` h.22 1 W00&#!0=00=00P U03107:Ѝ -`L@pPUq ("000L=QN eP| UCmm0nnT P< Vp*1 P0c104T Vf*!0 bB2 Q05:PX` PT VQ*P!0 bB1 Q05:PC`P T V<*0 0c  `PQ/ U-oonn0000r 0  PR=R  r 0  PRTV*0SU `8 p-L`QPPp@H0S@ z~PT  0Rppdd* 0-@PL PU0. @ |@P0/S P /U l0@P  Q0r/S0Pa U:@?00@ {000耦 c* ?0$ -L0@S`0Slp0S s00EtPZ 040 {$@ d蔪L ?0$ -L0@S`0Slp0St00ouPZ 040 {$@ wd訳L*))*0 !, -LM@R$  ,  `y0A XK00C 1 儠K─K0 h!0!S @PpP P " [ ! 00P 8P L00L0 60[S0 60KQ Q , {L0 0, L0 {x00x0 00 0 \3 K0 } Ky Ku,K q Km Ki Ke Ka K]T{ VA p ! # T *!R00K [r d000 1S R@00 ӑ KW [R 00 ӑ K0[0K "P  0[ S S00L0   , {P  wp0ST!X0S K K K K K K K K ߣK ۣ1S j1S ṣT4P@!TU!R e10 qQ P@p ,0 S(,'(K(w,,r8L 0꨼P 000ӑP 000ӑ 0-0L0M0P0 @ DK<00<0 D KQ Q QT Lg@ 00 0 S&K0(wt,t,t,`i*e* -`PL @0S /pP PUP "P -L 0P谽+ 0-PLP "00@ p@@ p @@0+ -LM0`SPP{#P ,K0K#@P 0 R 0#S S 00S# S0B00 0 6P0d00 0sPPk 0 cy00%P@@0 S SPP h%pPP  %,0S ?R0Sp 0SOrP PW@Pp)+ S S@" 0@1UrP;@k7 @00000c0P@LY%P p@T 0S0 0 (Kd -LW0P+ 0-0LS@P$$"-# 00 00d+ Z*((V*GGR*N*##J*''F* B*$<*MM8* p-0LM0PSz0@0S @T00SzxQt0 `0 0STz!`K ipP0S nux@Ƚ p-LM, 0( rSwS@T }`00{ q 0S`t $K P`10Sz`p@ P :10Sz$H F`nUd1XQ@0S07@T, 0rS  @$-T   $$P $(0 jd00SXz, 0rS$` , `$0LP`0@0S8>z4 000 S 5zKp@Ƚs$ -0L P$ -BML M20PP ,0 T$ 0S /`PP0 L4 04 J\wX2@P@Px00 c]0   0| `BKJJLT `0SPa 8xP 5x0 Sp1KH4 0D4 1A84  0@d 0@S/ L$ P$1!S 0 c@] P40T$aBNK@D@D`PL$R N 0K0SG00 ,0 S,$(K(was0 CP$ --0LM00  00  0  0S10 c] 00 00 0  0S0 0 S # K(w --0LM00  00  0  0S10 c] 0000 0  0S0 00  0 S # K(w --0LM00  00  0  0S10 c] 0000 0  0S000  0 S_# K(wP$ p- PLM@y 0K `P(  PP" R 00R d 00' P 8#0 <000@$0(0 ,0 0(00 0 xUTpThT 0-0@L0PS90@S7@0@07R0S0 0A R R!!*;*; -LaM ``, ptP@tP@T itA \,0 c 1   ^@P -LMDCDß`4 8 0 =< @0 ^PpfMvp0C 0C 000z 8,Kc0PD,@@ LUP0 S 00K$P00<<, , q ß000 GQ, +Q7 -Q4UQ ZQ  0 MS, ,0 TR,0  SB @0KL#0, @P 00K,(#@P 0 0, <,0L CA0C0  RS0,0 0 P0 ,00L Q , 0@ R:\ , 0 R@R RdPj;P0  U ~, ,0 r 0004Q1 r 11QDRd0 0v>C 0C0!000t1@R 0vn `djPjp3 0ST10 2) 00C0000 0!0 000 0R0 0% PF@{F@i@@eiP0000 c 0 S 1X0 0,(Kl$ 8$0n'|00@-DP@P 0 0S 0Q0c0!p@-`RP@ L 00S 0\0cpR ^p!2*P0 -$0L! 0-$@LP`P`$`P`0h` p-LM$`0PK@.05 P P8;,0,00S0KKpL -LK0C< >K,BK0C0CI B< I0F, < /mNP PP"@iT  Me( K0Z (Cpd  If,0 /S \2Xm/00  ,8[Sr (ONPm JN@P Xf<@/(0f@]+@N!PIKAG@P /0STZR)<0U<: SA, R>01L!屩PP>( K0LC,<[/S@ X<@/0@fZ ( KI,RA/P0 , 0K$ K0K bp1 $@K0 ?h;&@p K, /0K0K 0@ bpD &000 0 00,0  K0K0Kap   D  +!+ K0,  i0@-@0@$00 0000000 0#EgÉܺvT2 -/LM0 @ lK,0 a1Ahp PaA ad`lnDi4 i80/0%1  d0 ac 00#l1 p `0(p0 $nd-c Hc1@l ` 0(T` 0\,@1 P\0P Q\clD0%X0H@aqbacT`Οc< Ȑ X0' &@0 P01 T0Q T "aDc, 0% P0H͌@`lcTc< 0* (0X A1 L0 PL|  "d Qc,lDnad@͟H0% &@ H0  "aq@cTcL?1 0 @?Rp0@`P@Pl@  G[@@P?0S@@:  eo3[ -0L M0P@ 0 (`K  !tf@Tx ~op` 0 P Qn/B(K 0 SK(w 0-LP@!1 1 !320Q\ 0h][$PPm* --LM0 0 -L@PpT0` LLT  0j0$   ,w,G --LM0 0 {j Khh0*,*  10BS)00 0 00S  0S0 0S  -0L)S`p-010CS)\& 00 0\:@PT0 P 00@ 0S@P @T:00 p-0L)S`&010CS"\ 00 0\:@PT0 P 00P:00pP pp PQ 10C0 -QLp' %R`@@PU@ UbP@ [ P 0Pg0 B T:00 -QLPp R`@@8 P 0S0B e0@T:00 0-PL @Y0 0-PL @Y0 -LR0L0@@P T@ lR0  0 R B0 0 Y -0LMS,0 P@0Y.0D0TST' T%0 `7XPpp``UVZ W@@ W G00 Y@, 0  00`QQ00 A00 Y -`BRVPL@0R,U*p Wp00jW d00`W`p P j0@0@@b00P0PjQ0PE0P -BRYpL@`0R6W4P UP00hW d00`W@0000 S0ppP X h0@@@b00zP0PhQ0PE0P4*-R 0R \!* -@L0Sp ZP.0Q 0 ZP"PN000QP0 0ZP 4`4P4协  @R00@<Dك*RRԃ*G-$1M0 ` p00S0 XSxS  R!! \s  D A0a00c0PP@S @0 C .S^ s 0 0m C Q171Q Ѝ8II*6*6 -`L P@0SV @P /pP @TP @ - L0 0PH+ 0-PLP 00@N@@N @@0+ -LM0`SpP ,K0K@P 0 R 0#S S 00S# S0B00 0 P0d00 0.QPPz 0 uW00P@@0 S SPP P P  ,0S ?R0S`1P8#8 $#$(@"( @0S VPP PPP/ 00@% S S@! 0@1UPP=@[9 @00000c0P@H[@P T 0S0 0 (Kd -LF0P+X 0-0LS@P$$. 00 00d+ 0-0LS@P 00400Sަ0 R r0 110 0PS PP೼0M00P @0PM0 00DP M0D0000000S0@ 0-H0LS@P:0D3PPDHP0 -1L0S@Ꮶ0 R r 1S010SBPF  P Pe0 :0 a100P`PP f+DAVP `P 0`cpPD )V0P0f00P@0P0DPS P 0PPP 2@ p-LMPK1`P@' z@P$  t0P00ı@ S00@000H0`$0@0@,080(040 00 0xUTpThT -0LrS wS aS   ̠߿00 Ϡ0+S bS0+S 00 - L@(00S0`0000@ 0-8PL0@S㬥0`000S 0h覥0@ -LxM@T P ( R  0Nu0SZ ZG ZE :C0 PP` 0  pP`q0S  k 0 00 0PUoS <0PUo R 00cPo K  0 0 40SDA 00P`0S 30S 3\ 08CJK✼P0: S 0;00@ ;L 0ZpK K↼PPpK K pY0 P  0 pqz 00 0PPoS <0PUo000 S 80<0b q/ 00bU 0R60#0Q  P`VU0 ab00 0P @0PK0 000 00+L00cPo 0 pq# 00  P @0PJ000PW 00 KP R :0 e00 00S0 }-;P K 0 pq00S g00P @0PJ0 000 0P080$0S P  (K/@pT0/ 0-1L0@Sg 0 P0X- 000@0D PG0P00P00000P @0P_J00P<0S0 80000S 0 90088  R0  $0X P  0 0000@000000/0 0 S SB0SP -R00 H"R00LMS Q00~1`0 Pu 0-UP  +U0,0 P ,  x 3X00S 0U0XSxSP` R 0U ,0SAA2RpHR, @R Wph@pg 00E S u4 000. W070 cR(Q$,0S \ 00R00S b F"  \00R00S,, 5"00PZ QF 8 0- LPM0 dK P6@K R 0<K <0 N0 dKH@Kn \S0 D0 @0 H0 V|5>|5(w -@Lܠ 0 0  -LpM 0 s`  0p  [0s Q@KjP  Sp`h PKpK; 叢p@p奠@ 0 SK(w\4 P-RL@  ?  000 -- LM 0  8 K -ML MğPL,  P, pP, LP$\L4#0D$P[%[0 S2 iH 0NK@DP@D0#|R3L,PR@[` PEP`@ 0 D<0RD< 3000S p#YRPEP`@ 0 k0@#KRPEP`@0S UPEU:00 00PEBKJJ-%V'0mS@ L,R H "0 "H< RPH` %S00X0S 0`H`@X`H`VB.K` B BP<P 0žKEI I @i DK 0i0c8< 1A4< A0 0< < o0S  0   0lP$07S p 00`^K®KPEJPEJ=  0L`P07S p 0  ݖPPK@>@r:0i0cK8< At0A 4< < 0 [ ,0 S@>(K(whLl,wPLD 0-LM@00 PUP8 -LMđ K -@L th -L@LPp? 0 /T #R 0 1 9 P@36:/0 9 P`$*?XQPdP0@ O0P@X P*0`@@ O0f OPP@D"@X-00@ : -LM0@!  0 K\ -LM`p@ṺP0PP@0  pw@᩺TPPK<\ p-L@ 0 0P  xF  p-LP 0 0^p@,<4("4!<C `J,<4("4!<0cS= @ @,< (l<4",(.̀%"4$<PA `@,<4("4!< 0cS<,$ 80050SL`K`PK`T0KXL PU`QZ0=@P`  L2K P0= @@ @Q R@P00Y0X00Sz0<K@ K@  d 0LP0SPPf 08 40J`0h 0RYx@K h0`Kt P* 440S@0 @ 0P0400800S 0@0 !\ 0 0 P  B xP@x@ xP 4@4ꗵ0#S  ,0 Se(K(w/?B -40LQ< 0(  p-LM@PU@_DP" P<\00`Kx0 @ 0 0(,0<,00SKp/0S S. R R4\4d4l4t4|40 0 0 0 00 000 R0 R000000 00000S00 S S00000 00 0-00000LSP@[P 6P QP  LP 0hF0 0-LP@P 0S S 3P 0h-0h 0 0-LMP@ P P 0S 0#88  0-LP@P  >0h0 0-LP@P  P 0S S 00P 0h0-  @ -0Sࠓ 0C0,<4("4!<0 00 00S0C0 ,<4("4!<0 00 00 c0 Q0a0  R %3 a 0 0% %  0-0LS@P*00b0 I 00 00 0-0@SLP*00b0 I 00 00 -LM0@S0C0K,<4("4 <0!  I 00 0 0-LM0@SP80C0 K I,<4("4!<0 00 08 -1LFM0PQ,0 p@ K_K<N/K81 pR 8!+A[IT081 4A `T041 081 `)x.005@81V0OK@  >KKsK?KU N/KkP?@ ,0 S (K(w4 0-L@PrP mP hP  0hb0 -0LM $0 $K K 0-LM@PT :T80K0!080KP 0088 0-LM@PT :T80K0!080KP 0088 - LR :R00 - LR :R00 0-LM@PT :T80K0!080KP 0088 0-LM@PT :T80K0!080KP 0088 0-LM@PT :T80K0!080KP 1[088 0-LM@PT :T80K0!080KP 1[088 0-LM@PT :T80K0!080KP 1[088 0-LM@PT :T80K0!080KP 1[088 -LM0@K0!P00 -LM0@K0!P00 0-LM@PT :T80K0S00!080KP 00S0088 0R0-L@& P0PeS 0P U  0h0S 0 P U  0, 0S000 -LP@p`P 0@S RV -LMP@U` :U) '0$PK$ 0 0P 0$pK0P 0P $0 @@00K -LMP@U` :U) '0$PK$ 0 0P 0$pK0P 0P $0 @@00K -LM0PS`p@ ST- PG  KP' 0S$ R :R T  @P@TTV 0   <00D -LPp`@P( PU0S"0S :SU T ?P@PP iT <00` ; 0-LM @Fx0 0 S0K(0 0$0 G0 R r 1S01(K 0P0S8K0@ -LM0S@ 0 0SSP  0 0 0p Wp  W 1+#,Pp`00`S0 000 ,0 dWp 0B<B S0S*0P`` 0PU:v?P 0 0b00P0P  UP! E0 0e P0 #0PW  E000{P o W:,PP e E0 0g 0 P00eS0[ pe0p00 W 00S   P00h0,0 000  ,`0V`!PP00V0S  RE0000P $V ,PP  =E0 0f 0 P,00S,0 P0 00eS0 pe0 @00 (K p-0L@ `V  00Pf`0 ,Pʼ0@00p`P` Up p-4`L0PS0@S p@ 0-@PL\0hT00S0P 00P00S0L@ -P`Lp@P0X@SpPUZ`VL 0-0L0@S 0P,  00P @0P;00P0 $000 0000S0B< S @0  0 0c0 000000/ p-LlM0@8CP`JKP00 ; 00  Q00R0 ;0  Q L ( 0R   KppT p-LM0@ C 00 !K K`=PP0C0  0D 0 SPP P RPP000KpP& -L MP`800SNFp@T 0S @ 0@P0p 0@0  FB00@ FP0 00 F00S KiF K@(/ -L M1 @ (` P0E% 0S Z 0Z E 4KC  0,pEP   E W 44 PE`VZ@TL Z00C0 S40@ @T  0@(K(/ -L MpRP`@H(10SE1@T 0 0S EP0P 0@0pP" 0@Q0 C00 F "Bp 00P0 B  pXEP@ @00SpE$K@(/ -X LM^   K0K  Cp 0 K  -L@pq0:00PT:0 p-0L @`P 00: 0phT 0-LP<PP00OP0T@00:00 -L0M0@0@K0  0R K(w| #t,@R 0S@ R0 100S 0C0R: 0-0 RRL@  P  100P:R0 b320 0 0-0@10 L0s00R: 0Rq PP@  ! LBH @0 1 0 -LM4 80 P0 K,0K@ `P? ,0 i00R000 ,  R5Y0S @TT T  BR \ 0210 32@@,Q&) ,Ppp T( `P 0@0y0@1 @d P p X0~ 00 p000 a `P 0@0[ p00Q8a Z00 0S 00 pP008PJU00X0S XQ4 21@0PC B 0T0 -`P`p 0@0XPp  Q 00000 娫 "00p 8K 0  @000@r (K -LMoPpU 0 K PB:P@ A S*PA8?0@P0 L@ 0D0 40 @p @ 0 S S*S +S -S S  00 0@0 0S 0@0 @ 00S0XS xS @KD0KP4  P  @ 0@0 00S S     @0  T0 QՒ<,Ѐ 00@Q9)0@0 @/P00@9P0P M0SI RQ 0@0  @@ 6@ @0@0 0P 10@Sࠃ 2@ T @0P@  0 PP0Ѐ R  \BS  0ӓ"Ѐ R 0ӓ)@@ 0@0 00@ S00 ᰀ @EPeP90 y @p @ 0+S -S```0@0 00@ S@ 0@0 0P 10@S@P0@ <,@0@ /P00@9P`+0e\SVl@p ZDQ:NP IP5iP nP0@@K8P) @00C@0 0P@0 0@0 0 40 @@K#P 0 @0 40 0(S  J 4 040 @p   h 0\  R040 00c0  R   r 3 Z ``Q  K VP L ڤ91H C !@ PK 0 P L 5^Z[\P 0PKF4\^ P  9RQH HK 5 5@`L06H0 / @`\ 8PK1 !P L 05\PK!Pj\0^(ʈHPK1 {!\ 0eA v! \~L8 2#PK Z P L 0PK4K<P 40S?Q\  0f@T=  7PK1 I!P L 0y GCb46 56,ʠL0 LLPK 2!P L `FVHǟLp4656L0 P@K0` !@PV >F@d  6PK1 P L 09 FCb46 56,ʠL0 LLPK P L `FVHƟLp4656L0 P@K0` @PV 5P@ LP 0#:?C0C PPPK< K80K9 PD  80@a<0T0<0 w<0 08 <0 <80 Pn0Ug U0 P 0 4@lT D P80D 080  R8 r D0  D0 P040 RD 080 00dD8 Q<  0S00 $4T 0Pp [ \`  p Pt L p0 ! l>D0Px ? D  ! _>8P<@ Pl 1 \i\ pp  0Pc@0 n0R0j0 0b`PU00S0ScPc`c\ l  0Pl0  xO @P x$x@ iQx Px axWt Pt  VtPt  XlPl  xtPh  0S0S? h ` l P00R00S4 0030 040 * V 00 P040 0\40 D@ 0 S @DTT50DP0@D <0 wV0!0PV00!  Z0S4 0\0ShPh q lFP040 AV9 R4 8D210 Nx(PAV瞯<??0 s R: 0 1S0 D0 B !08 < 40 0Z!04 PD!040 0SP<0 0b<0 8 PD 40 0,Z00SxD0t V PD  08@1@ @d@P80080 !0Z q040 ZhlR 1@PPV 0Z00SP  D 00 P0< P 00 P  p X J D2V l"l2PPp PX 2VX  0fQ Q Q  2P U U   0PX 0 00cX 0 Xp <8^d `  Q @aDxPD d 080 <00d<0 , K00KP| W ,Qa`P| L UD`5 01D|PD ? @^R0@DS A0@PUDڌP80 0C 80 :D1PD  00C0 <0X 0C <0 *|SPD  0 0CS A0@PU^ 800S80   D<0 0<0 0 X0 |  \R< 80`d0X Q00R0S3 %5 @P6  1`pP  0P40 0 0P 0q 0 P400PDxtlh< Q80 @cT DPD ~DdA<00d<0 <0x0tlph<0 S: 00S S SP" QDz 000020D0  040 R:0 0 b320 D0  040 y"00 000^ PD00P0  40R 004  @040 ["00Q@00 R40D <40 R =D&4(K -L00( 0-@PL0 +@0 -LMhp8 W< @0 P;l4P@p ; #p700S @008 40  40040 0Q `70S 44 `@ &Q `@0 B0 R@60S`00 030 0R `60@s3040 @ 0S0SQ  0 SQ@H @00SQ0a10c00 0 0PS pS(0+S -S 00S SP C >"00SC S00X b000 4 80R80F0ZCP0f0CI X 0 S S R0S OPP000'S S SQ  R0pbPP@@0@0P 0P @T0U 0g R#1 0<00SPP  , 0CP0,@  q0Rh ^000Q@ @dDA@k`Q@hP D21 03pQPppQ00000 @aPP 0 d0 , p00Q뺣룠/0 RE00`cV) 0S S SVX HPQ  R 00,0@ bP0<0卣h뉣P"00`W@FpTp, 20 2p0f00 W? 0S S S70 2 ,00, 0bS( `PP* Z 00CX21 030S@ 1 0dP00Q0 p @ P0<0 (K,/0  0@RZR R \000A10 00 R0: S:0 \ 1 21R  10 02SR -LM@(KPy,Kt0p, c(0`0b2SzG  0k$K -Lp` @7 00RʢP! 0 V0 0@ P @@ P 0 B PP@ U @ @0 BP U P 0"Rp@-"1@ 0`  00 3$ Pd05003$Q:R 00Q :0 0cC1S00p -LM0 10@ @R*0 S K0 @0S" 00          $  (  )  *  + , ! - " . # 00/ H0S <00 0000 00 0@-@P 00@ b@-@ l 3. P: -2LM008 S@ 0 2100 000 4 0 0080BP0 S SP00S p @ ,p W0 XSxS0 SP"`V< S$,0S T0#03P0S  T7`$,p P0 S0S+0 XSxS&0 SP")S00W0S8 00 )Q80B 0 S= PpT  $ 0200SW* T0#03P0S  bT  0 T000 R 40S 4 0 b 21000ASQ00(K,/-  0S -4@L,    h,/   -L ` -L` -0 PR0P`L`@PH 00010p 8!#800"( (!( 0( \"x:0 0b 0("( #8!80#x \:W  0RPP@  ! 6@0 1   0"108#8S"("$"""!   88S00000P 00-0 S10 0LRA 3#\ -0L100`p@PC 0` P0 `6>03U<U@@5 P 256 b42Uࠓ> 0S0 0-@PL 0 S0he,D0C05 `0 C>@0C01B@`@ K -LM@P`PxPC 00`0P@``kP6 p0!1  0 ``, @P0Q Q @ ^ P@:0t @  P@,  0V: pG02S p -0@0 LP` V pP 0!R 0010P n0>00R3:Q`0R0:0F0 -L M0 @R0@PP` pWP9 10040 0 4S:1 ! 00 `P,0 0 Z 0 @:0 0@^0:@P`,0U:4 pGW02S p(K -@L P00@ -LpPoȟ0@)"0@ \0P`0 0Zz@Pp  ! U4Qp 1P  -@L` 1 1`P@ Dq> APU0S6PUPP+ 000S|6 B@P `p @T0S\f6@T.P@ 0S X6P`0t@q0 S0 Rp@-0SP`P` D4%LP`\p0S0 C,S R-S+S0SSP0@-P  00L S @#0C^00L S^00 0-LMPK@ 0P  >00:S 0P 0<##00:S  0 P0 008 0-0L-SP@ +S@P T00c00 -0LJS@000 #MS00  0P& 0.S" 0P 0.S 000C S00 [?qP 0/Sh00m  -LMPp@,  d1P0,0 1p3, 0S# S Sf 1,0 2" `0F00  1:C=C,0SO ;RMX1@H0@!B0ß00 QV@@Gd1dP1 @ 10 @1T  U0B0C@10P S,0 0 \@ B1Q \000 O0O(KLQ 0-PPL{1dEAw1`00 R10bQ1bQP00 -L$MRL0 H PP 09H0D LR L=Q:S0T.U50S4 ( 0 5  00S9P0 4 40040 U0L SPE 0S 0<0R 4 0"4 8 PUZ4 8 DğP 0, ] D` @ < !< 9$0 O Po0@0S@T SUQPRZ ,00K00 ^P,0pß0Os/< PL$ `GPU`<@H9@`Uį,p Z,@ d0P0p3`1 Qʭ P,C!r ,3V, `0D@ 0n00a8H lpz}HWzG}G2WPd0,@U0P0O00p031T,K`PX U 0 d;0P0500p03,KAPndؑ`,@P  d!0P0p31XL@PPLp,@`DP{D@0PfP/LP000L /<@0L0</4L ,@  d/P/p3 00 L00bL 0L0!0X0 00 0H$L L(KP@D@QnmD?QL R10bQ1bQP00 -PLU`p@//0c0h* 0R 0R 0R 0R 0R 0c -LM0 00  hK0S hK< PhPK`< P  PXPTpU R/ N/ 0(`Kp&0cX0 |PswP msPdhX ,0\`RPP/P /p3 10\0 XEp\0 SX ,0RPP.P.p3 10c\0 8P/DĔp,K\`dV ʨp` @,K,Pd .P . p 3X0\2"1Q c P\ X X` P ,K Ph,0;Q T0 v># 0Sh hK:EPh ;0 h0 0 0 ?S p 0O /?0@ @  `cP@a0P`ZP*Y`< -RLHM`@ +,6l@ P01d0 @0,0 0<S @>U0>Sv dl@ d ?l@ @d d@ 0Si ,K@Pd  RpP00PU& <U @>00 >SP dh@ ` h@ @d`@ 0S,S ;S 0KiP;,0>C00 0 s 3W4 R0;S,SDK hP& 0,S#XK_P PU|ğ @M00@H00 \ d,004 b 0a 0004}0Pp0(PPG,\ D0K g0P@ \ X0K^U T  G0  G0@ P 0G G0\00 \d=)P\7)p3"1p QʍP\  \ 00KSځSB0`"0Sh20c Q0TBD  0c#0S ,rR( R0 0h!00 0S, 0 n0O0@0 Sb0 \| @M00@0, 0d081 b 0a 0 0 00C00͆@0, 00 bhP  000P0PhP` d0` R `00 0 0 S l`Q d `0 h (KxH*L*DQ%X* -L@ P  hO p-L@P`U 0S00l"h0PLUP0@0 V40T(0(0p=0(0pB  - @L -3L$M\0p , D H 0S 0S0S 0S~ 0!0Sx0Su*8p 4 Q@ < P@KP010P0@"0L Y00.㓒tR@@*<5Q`E$L@ R0@80 4@ pW8p 4 08KS{0Sw00Sr0Sn:D8KH L H0PLe0, S 00R  Q  0OHSITGG^  0S0S 0 R 0S0S0S 0R0  0M@ H00K@L H L 08 010H0((KY`X% -1!P1UL00 `@0000" 010 \p@_JP 0`T@pm` 0@(PH=P0-0 Wp%H>8 -hL0SX@0 0R@!P (@ @PYhB -@LyShvS p-0L (@PphQ0S P< n(PP,P0S P% PQ0  B B,p P` 0:S  ^P ph2pHBP* p-<`L@S  @PSpP P0 0 p-8`LP@R @Rp -@LRuhR -LM8 4 8@K08K@_(`K0&8KpTR0@ Qp`0@K0@P0@ ,P r8KT R 0 @ QQR* 0KP'T"S `p0K0@K0@P0@ ,P N8KTZ 0 @YQR 00K@0K(K 0-LM  K00* T?K0 -L,M@<Ke K -,L@, 0_RP hp -,L@, 0NRP hB -Lh p-QLM@P`p`S@rP`& 0V pxp@-`@Pb0 <250^@ 0<0p -LLM@P`p 4M%`^0p(S RP 0p#83K`#[ &8R! X.(,Ƞ3K0#KKKsK3KẂKSKXLT 9X0t @h `@ P P0\P l0 p h0` L0 RᴠX H`$`P{$`!PPE\ 8Rl0p@Xt 0  c a"88c !^@NLh00a#0X0 000#Q@DAJhPE000P d0 RP P\ T^ Xh 0Bn0T 3><A0 Q@h0"[[[2[x h[$[[3[xh(K Q -L`p`ppZ0 <0@PS00 X0AAQ Q0!0a0PR- \1,0l00 ?\0 00R- 0bR12<0 RQ ?R0̑030S@-@ 0l\4<0̠ \ ?\ 0 0@\ P R  0 00-R ,0l0>àS-0c02Ì.1 0 000 S 200 0 3# R02 R02  0 bQ B2c00 @- @0cR#3n P0C2Q0C2 d  l 00@- H. !Q, H@ ,P2\Ƞ3# 0 -LM@(pK` ,0K$PK 00K$0 (00, ($ 0 K -L$M4pK0`K@D0  80K@K 0,PK<@K0@ 40o  0,< 00`d D 0<@ 40Y,0 <0`S08 40, 000(K -RLM@`P&"xZ᐀"0 K40Kh(@K,PK0 400Bh,H0 ( Q02[Zz"$KP1#3P1 <2lPQP3100QP3100Q#2QP ;; ;Sp@-9`T@L0 QP R p(@00@0000#p p-L`P@@@`@p -LMPP`p P0`B53A0Q B"A0E0U00` EU0 @@ 0po@d@0@-@_Z@@P  @P0 p-PL M 0 o@a@[ PP5Q0 U0S 0 UZ K e0KAe  0Kp 00",$ -LM( T"`@pt3Z,0 P T  W TTV1("SU*0U(!,0QsKPI T 0W0T0SWT  !0Vt0RU/u P (,8!0P(K,K 0e(,X 0SZ0P W T T0SP0S 000P (K 0(,K,00,0  0,0 ,0( 0P( ,0%$K(, -(1LM0$ s3Xp@` S P SS``$8?S@!Q vZ-?45VCQqP0P_a$ K$0@Q T8 000$0@T  030? (, p-`LP@?@!aph -LMP`pf0, `, G  0sRq0P0, 0G  -L8MT P0 PtP0K :! vおJTTV  ,0K⨊J4P 8 0 ,p `Pd40K8K48 U2M&X , 0004 08 0HX4 ,0@RQ:S(:8 00RK:S":2 P0T8 40 %&00hX,0P1,0 0K,0K e,0A40140 :X X X  P g0S@@t-[p@Z0S XP@ O0SZI00@(K -L @P  - L@p -@L ,0( P00 -(0 :1LXP(0  XaAUpP+   dRE q`AP 1!0 1!( 0  P1D 1D , Z00  ,0o P-L@ 0At00 -L~M41Sp 5 000  @0 T ` `a pKKlq D @H `PLa 0P1 pX  0\! `d h 0 p!  p`,K+KDHa*KLqP)aK(qKTa `Xq\$qK`10dahq aKpl !p1@! 00a`0|a pq 嘑  01! 00at1 `xa pq 儑   @A  p! P Q 0(@2 `0a a4 `p4q$taxqaKp|,P1a1K`qp向!K 10a堑4qaK!( 1 1K`a pq Б  ! 嬁 01 `a  $pq ,pȁ @崁A ( P4Q , 8@" 0$ 1 ` 08q a ā0p8 P; pa6 W}p 0-PL@ P TA  P }@}0@0!311Q00 0-@PLP P 0 -`LCMV@, P}0 04w P. ,0P 1A  ,0 Xp0}@ 0 TKzP0T P0 V 88@0: 0 0000840, 8  8@0 1 D0 0@ ,0Q AKP0d 0 0Y" P 0 000S 00S400S 10SQ '7QQ $}0084@0 P0@ 1D 0$0D @ 00 WP0P0&2#5 0C@,0< 0(0 00 Q0 P0@? |@vY 0S50 1 A/0 !0( 0,0 )0[ 0*0[0+0[ 0,0[ 00,0 )0[@0*0[P0+0[ `0,0[$p00(,0 )0[, 41 001 410*0[41 401 410+0[41 801 410,0[41 <0 1 410 0 ,0 )0[@ 0*0[ 0+0[41 0$1 410,0[00,0 )0[0*0[0+0[0,0[00,0 )0[0*0[0+0[0,0[00,0 )0[0*0[0+0[0,0[00,0 )0[0*0[0+0[0,0[0 0,0 )0[ 0*0[0+0[0,0[0$0,0 )0[$0*0[0+0[0,0[0(0,0 )0[(0*0[0+0[0,0[0,0,0 )0[,0*0[0+0[0,0[000,0 )0[00*0[!0+0[0,0[040,0 )0[40*0[0+0[0,0[080,0 )0[80*0[0+0[0,0[0<0,0 )0[<0*0[ !0+0[0,0[0@0,0 )0[@0*0[0+0[0,0[01$D 1, ) [D0 * [0 +[ ,[   $ K+0[ ^0,0[ 0 !  ! (1s0 {0@h(A^d 1R`00CS\0   0@0PS(00 @P0P 0 1D 0!0 BR#N!!0 0Y Q  0 ,0P10A00#,0#04$1$0 PP0{0@ a{ 0 0000 0|0 0x00t00p0000 O@\_ j{ @ (K4a$  !4! -pS00LMW00S@ W D{00,1$!W00/L 0(1 !$! aV$Q `Pp a0S 0P(1( U 0(0$QU0$1ZW(10(1 S$10$10 (1P` B 0(1(1 00Q R$1 !0$1^ 0S (1 8#0PS  0P  1S 000P Q 00c0 1 0000 0b0 -L M@  @4 < 0 D0 ~ 0 8`P 0 00P@8 7pW 4 0b\0 `P: P$W 0  4 00P'xS ,K,@ P,@ , 0 @PE 0 8 P8 X<0LSD0 @ 0P0<:<Q3T  0/ 0S  D0FD00 00b0 gP @ D0^P 0  WP  000(K -RL@z01y00,1 0h; 0-LS00\00SP@ y01y00,10\ 00h -SL0@ h y00,1 0 0C0S2-S0!1!0 001 00 00  -LMAPTpm&' R0 W 0 0P X@ P   00 AT -L MR` X 0SR @ < 0 13 B1 40 0@0 < 010s03<0 8 XQ 1U   01 0Q0PQ!0Z0,0 R00S 0S S0101S 1Ua0P  Pa YPO V1S0C1\0   P0R 0S00S00 0 0WPs 00<3 Q B  1 001% p # 00S0S00S00  0p'PC p00 p 10!00@0@@T,0Q00001P0Q =U0 P < 0 Z00 PZ@8 041  01 0ā0P(K &("(30b  -L 0  -0@L0 S+ 000  -0LHM0P@ 0 7x0p4`Kd 0` \ 0X T0 0P0 L@ UH D` @P  0x :@ d0dK <0 080 wxD0p0S 0 S$ۺK(w,wЕ,0 -H LQ080 000 0 BS w 00|@ -LM0PC@ 0 0 b 00刡 0@ 0 `0D @1p0W,0  T P # 3TX0#03,0 0 p  p-0LP0  0%R@`@80\ lLN@#1A.S R00SRPp -LM 0`^, 0 F~[rP \1@0鎐pPIK 8 000 p 1@T  0A !0S0@0pW:P  01C0 0 P0 00,@C0  BP,!000  00C 0(K  -4LPM0,0 t4 @  ,@pPlKX X X`0 ? ~QP( K0 `DC\P `3`<0C>S{././/.////./// //////0//@/`//|////////////.////..////////(//8/H//t//////,00 S,,0, 9,00P4p2P p (P,(*P(p&P$p"P pPpP P(P@0,0p p(,P P p P p$P$p1 \`V 0SuXV!$0@S00 P0 pP` x1p`֎P@<  9  5t :B< 00 1p`龎P 000 R@00 0 Z $%Z:U0 @   t00SD0 0S\u 00 ,0 S4(K(w,0H @'< -L M2p0 0'P`80\ l{>0>0V LrPp0&ZP 2@0GpP"000uH@F1,L#tPU x0t S 0S  0S xtp0Y0jp0 *0S 0,H00! Q@X' A0 0jRV g 0S X0Y0j0p00jp0   0S 0S  h0P@0׍pD P000 p0, S (K   ->0>0L MRP`4 v1", Y 4P4!00f0ip00cYp pc@, t0S x0ԲP`txtp0Wpap00ap0!0(x000h0, W 0, 0BZ0 A:0, BtpW0S4  0S 4 4xtp0 0p0,Z00A@@,0ZD\ p ,0R,(KoS(K ,D\ -83PLPf `*"*R@ R B0B@ Tr@( 0b S:VoR T53$;2 PU (a e Pxt`"0( 0b0L0S 0S. (0.  c . B. iS0`ST  0S01t(tXPUd zP`@ 0St00CT :#:30#" 12 (i2!Q 1(1"(@0@R!0S00@@1S$ R00 1Sl0 0S  *1S1100S00@@t -L`sVp# P0S 0 @|0T 0S dhUX@00S0 h0 0CR0 sp@ - PLM`0 4 Dv^(0 0:CR*004 >0N@pP`sP 00u0 `P  2PsP(Q a S P5(  de0S ( 0b S*0S b (04 c:b0PPA 0S> :$0S9 40S(0( c h b-`0 0&R80Q 00@S00 R 000C10 1@PU p Z:3*, 1 ""  0 X, p# 3@P0tp' # 0,00 @ 00S0@@p,0@P 1P R000,  0U 0 *^Z# ᰡ01 R1J438#811  P  d0S00PP`8:3: *8#8!1Ს1 !2R0 B101!2 Q   @0@S0@0P@00@P0  0PN 0R|1Sl1@@T0@@$20!0Rp@ >8#Ƞ@T@ 00001!0C8#8 ,S!1 R00 00x 00c0!2QB !RL0P4 RU 00S  ?(K 0 -LM`P4 q0F80 0000 @V@T, P20S "0S2 P"00S0  V$ U!1 &@l(0:CU:q5>0~ Vp:00S Lx0Vu p@o 80 0fPU `dP6d@a[P-!U0@0f0gq@ 00,La 0PP  8Vq@(Q a Y P1(  0S Y(0(  c j b0 0 BS X T p0 0S $q 00 q,0P040@qPq,00@(K@<T ' -LP`p(1p0S" 1!@1T PP9VU3:U P *00S 0 0SpP@0Q P L\ 0 0CRP0U 80 0S 4xp 00pp@|' -LPp0p0S0 @0T PP#@00S0 Pp` $ X 0 0CRP0U  0S 87xp 00tpp@' -L$Mpdp40< S4$@4T QP'$0@T@ S@Z  @dT P4  T4@(0:CW:1p@ 0040:#:S@ S@ 0CC T8@ T53;3(00c80  W38 (0,p 0,0  W R40ZtY,>.0 ^nP`VZ(0S@`eP 0@ @ tP:@0Px0˭Ptt0x0p  cp  x 00h0@",0Y:@ 2@P t2@]@TP02 0 S  40 @pct4 ይP/ \+*(Q a P O(a P Fx1 fd 80W0S (  b g, 4 @ ,80WW !0S 0SW 8 g8 W00S  @P 80WS  R ! ( @t`0 0 BS fT @0 0S \2o 00.o<(K@t ' -LM K 00!0 @"00ST 0S@0S QD0  rlK .^(/0100U0*2'Q-0 84 0<00 84 0<0 0 84 0<00 84 0<0 084 0< 0084 0<$0 0 84  0<(00  8 4 0<,0x0 0p04 0h00 0`0 00 84 0<8008 4 0<<0 expand 32-byte k -h9LmM0 <@T ! A xP @ P` p $`(p娀 尠 ,4)80 @ P ` p  1 , @ D $ 8 < <?P  8A00 0A?@P$P`(`p,p04 8<  @0A Q4@0 ( 8v(0, 0R 0/ (K (wH H$ -1L@M0@ 0 ?[` R 00S 00S0d0* HPK` L0K%p(@TKP Tp L@  0Spg( HK-P0+ @&< $0  0 S$K(wL$  H$H j p-LM|`0SpP0S9T@ aKKD ` 0 0CR0x@H$H$ P0-L@0`;PP:50 -0L0@SPg똀p`H0S U@1@!c F `  0`0dPd0P U00S m}@H$H$@-M Ѝ@-MЍ! !P: ZŒŒ#! !P: `B!,aB 0>ZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0  -L@hj)++*+@-a@-pP`P 0@T00 S R B \0dC10P  =\P$ -0LM0 0S=S` K --0 L^M0`QP 0 paM_KPE`@M?KC/KKd1 4A 0A l0F`KppX0 peKQ Q < 1@0 0RK(w-R0 0c BSR48 R p-@P`x BRpR0 BRRR 0SbQ@  0R:cdclctc|cccc(" 2 02 02 02 02 02 02 02 0Q  00S:R B 0\R! B@-Q:@- R (2 R R -PPPP RrPP B PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R@- RP1P P1P RrP1P  B P1P B@  R010 1  B R0q0`0q0`0q0`\0q0`0q0`0q0` R 0\6 R B0@-81, Ġ%̌T$\D#L0P  R0@ Ġ01#̌  R R B0@-81, Ƞ%ȌX$XH#H0P  R0@ Ƞ01#Ȍ  R R B0@-81, ̠%Č\$TL#D0P  R0@ ̠01#Č  RJJ_)*OO[)* 0-LM 0@0 @PK0Π0<)*cc8)*``1)*22-)*11))*%)*>>!)* -L` pP@H1B@A01  P d 0200 0 0崜8q -AMLMŸP, p p8$ 2KMPlP`BNK@D@D0H" P:bg?0|BnK`FBK `FA0A 04 fp V = W1sa 1 <4 1R& Y 0CA 004 -4[.$[/[0[0L LLL^0H 0Q( K0/4[0$[0A A PZ<` W @00%BT  @ F : : @8$P0@<PLp 8$P fO00 ,0 S (K(w" -L M`pyQ 0P00 00 0 ? Q< R @00%BT v@ H : : 0 P0@ Pg;p G P 00P fO0 0<Z 0S 0 0C0pp/ 0R* Z 0CA 0,0 )0[* [+[,[0L LLL^02K+0[, [0 002K+0[, [0  P (K p-LM1@QP aP8 0,0ZP8 8sKp p- 0P8-`#1@::0CL0$ 0\\1 8!$ BP@  T00~AB2AA 0B 1 0phA -LM400  SP, 00S400400 000 `0$0!QD AQ! 1 BN?p @%PP T 01C T 0 ! 0$ 10C0S  "0|X 0S@p T!D0V$0@00@c TD `Vu F!D1DD0 `0CD0@ 010CX$0Sc pPi!D0@0 TD0"`V1 KmeR F!D1DD0@0CD0 ` 0 B Q~AB"AA 0B 1 05:    RQ00~LB2A0AB <0 0$ 10Q0A $0PD0 QP1@0c0Q51 vKe008#8#H! 00 00P 0,P00 00000P0C0@P, 00(K -P0@0P@cH$HX`pL %X0@@bH$HPX%X0 0C@0P0@ -LM`P@ OXX 0S0?pQD NR7 08 00Q4 -:<0@0F@bH$H, @u0D @cH$H0 @k00,80D0< 00 0c40b0C 08 00< 0@G0 S@0PU `尀X 0R<0 00S0S 00 0S a0 @QP1 0S 0 0 0S I 0  0@ P000 0000@ Q808(@40P0@(Ko(K -LpM@ 0|  PP\ > |0Pd 6 \(0P 00d"0  0@ `px 00S\@` 0d 0C 8tp dp#X`l 00C8Sh   0XK|PTX Xp0W P`V @l `` (^#t0`0C8#8 I 00h0ἐ 0|)`P~ `|PP @|c8 @#`` t | 0P8#8p0 Up0@  b< 0|0H0 00 0lD p ;P0S D <00 0S @K|; 0@KH K]000l 0S <0D 0 0Sl@K|=pP 0@Kl0 H K?00008#X0S0S UH:`P |`DB0 00c ,0  0f P0K8 K8x#8  08# l  0 0b00屐 0080 00l40 08#x`0|X0g8#8 I! 000ഐ\000d 000(K -@0pL\Po0R 0080S#80l G8U#h 0  b000 R C CCC0^(1U0E(10 00G000 000B800C80000 -PLp Q0`@\ Q QVPP P0S -LM@pQ 0  P n, %`PP> Z) 0(10S$1 0 ! 0S 0P * 0P$1 0$10 0S0P  0 `P, 8#R a`00 0 0 `(K -LP@`QtPPq  Q0 Q000a0`P^ 0 8ᲀ#xP`=0 R  0S0 ` pHP(E000Y0n0@ 0S$10 (!$1 50S 0,P ) 0(10P%$10$1  0h8(#h"x 0 0p 0S sa00  P10 -L M@pAQ 0  n`, PPP- 0 QP #0 0S0P  0PP, 8#R "aP00 0 0 P(K 0-LMP @p108 -LM<0 @ 80K0 K `@P^0, <KPwP 0< wPJ 0@ pUpW 000ᴠ08#8 P(@"(0ᱠ00 @0@0< @0@00Q<0A 8#8 P0 00<PP W000(K -LM`D0 00C8 D4 D 8 0 @ g8 S0<8@#8@cH$H ,0 L   8#8 @@0 0< 0@00 @\P 8,P8 0+p@0T # TD0X < T@PH$HPdX%X 0PC0 0 0d0d00< 0P00B0`004,04 000C88 < P#84 00;R008R#XD 0X0E8#X0 0@@eH$HX 8#8 B @0 00@ 00 @P `00 0 0 00000C8X#(p0(K -LP `  a("Hpd~0P pP5`PP  0 0b8#H0T ʲ0S T0 [P P -pLP`@LQ\QQW@p6T0X  Q00SP ô 0@00!0 0 0C2#00 0 0T00 WW800C80 -L@P/ 0`p( 0A 0P-L 0- L@0@P¹P $0t\0W0A -@LT 0tA -OL@POyKGR0@-@P l^0,00n1C3\NP0 0-L@ -L,Usage: %s ..., where is one of: instbin%s: %s not compiled in mount_cd9660md5sha256sha512dfmountmount_ext2fsarchsyncnewfs_msdossttylndisklabelpaxtarfsck_ext2fscatifconfigsysctlrtsolping6dateztsscalelessmoremount_nfsfdiskgrepfgrepegrepumountmount_msdosfscksignifymknodreboothaltmount_ffsdhclientcpgzipgunzipgzcatchmodchgrpchownfsck_ffsnewfsrmmtejectmkdirksh-shbioctlsleepmvexprdmesghostname4 t$LoH,(@@48x<@ (D@@D L܉ T\unknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs cannot be zerocbs meaningless if not doing record operationsbuffer sizes cannot be zerobuffer sizes cannot be greater than %zdseek offsets cannot be larger than %qdnonenoxferunknown status %s%s: illegal numeric valueunknown conversion %s%s: illegal conversion combinationcbsconvfilesibsifobsofskipstatusnoerrornotrunc%s: end of device%s: short write on character device%s: short write on tape devicefiles is not supported for non-tape devicesstdoutinput bufferoutput buffercase conv and -DNO_CONV%zu+%zu records in %zu+%zu records out blockblocks%zu odd length swab %s %zu truncated %s %qd bytes transferred in %lld.%03ld secs (%0.0f bytes/sec) skip reached end of inputmain<HTX`ljt|usage: mount_cd9660 [-egjR] [-o options] [-s offset] special node session number is %s: %segjo:Rs:realpath %scd9660%s: Filesystem not supported by kernel%s on %suserquotagroupquotarwautoaccesstimeatimeexecsuidrdonlyupdateneedsdoes not need-o %s: option %s a value-o %s: option not supported%s: illegal value '%s'%s ("%s") = %s %s (%s) = %s usage: %s [-bcpqrtx] [-C checklist] [-h hashfile] [-s string] [file ...] error encoding base64cannot open %sstdout: write error%s: read errorbC:ch:pqrs:txbase64hex%s doesn't support %s ,unknown algorithm "%s"SHA256SHA512usage: %s [-hiklnP] [-t type] [[file | file_system] ...] df: %qd: %s 1024-blocks 512-blocks%-*.*s %s Used Available Capacity Mounted on Filesystem%-*.*s %*lld %10lld %11lld %5.0f%% %s %7s%-*.*s %*llu %9llu %9lld %5.0f%% %7llu %7llu %5.0f%% %s %-*.*s %s Used Avail Capacity Size1K-blocks%-*.*s %s Used Avail Capacity iused ifree %%iused Mounted onempty type listonly one -t option may be specified.hiklnPt:-h and -i are incompatible with -Pretrieving information on mounted file systems%s is not a local file system%s mounted as a %s file systemffsext2fsprmountmountfsmainnfs:@ufs%s: fstab uses outdated type 'ufs' -- fix pleasemfs%s: fstab type %s != disklabel type %susage: mount [-Aadfruvw] [-t type] mount [-dfrsuvw] special | node mount [-dfruvw] [-o options] [-t type] special node -o%s,%s on %s type %.*s (%sunknown flag%s %#x, ctime=%sv3v2udptcpsofthardintrnoconnrdirplus%s%s=%dwsizersizerdirsizetimeoretransmaxgrouplistreadaheadacregmin, %s=%dacregmaxacdirminacdirmax%s%s=%lu %smsdos%s%s=%u, %s=%uuidgid%s%s=0%onowin95direxecnorripgensextattprocfsversion %dlinuxstatfs %s on %s type %.*s: %s already mountedexec: mount_%sfork%s/mount_%sexec %s for %sno mount helper program found for %sforceAadfo:rswt:uvrqnoautogetmntinfounknown special file or file system %s.root_devicecan't find fstab entry for %s.%s has unknown file system type./var/run/mountd.pidsignal mountdasynchronousasyncexported to the worldkerberos uid mappingNFS exportedanon uid mappingexported read-onlynoatimenoaccesstimenodevnoexecnosuidwith quotasread-onlyroot file systemsynchronoussoftdep/usr/sbinmain<HTX`ljt|usage: mount_ext2fs [-o options] special node o:specified device does not match mounted devicefilesystem not supported by kernelmount table full%s on %s: %susage: machine [-a] usage: arch [-ks] machinezaurusarmOpenBSDmain@@@h pp p ` @  $%s: no default %s%s: illegal %s%s: bad %susage: %s [-N] [-a FAT-size] [-B boot] [-b block-size] [-c cluster-size] [-e dirents] [-F FAT-type] [-f format] [-h heads] [-I volid] [-i info] [-k backup] [-L label] [-m media] [-n FATs] [-O OEM] [-o hidden] [-r reserved] [-S sector-size] [-s total] [-u track-size] special [disktype] %s: bad FAT typevolume ID"*+,./:;<=>?[\]|%s: bad volume label%s: bad OEM stringbytes/sectorsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsfile system sizesectors/track/dev/%s is mounted on %s%s: block devicewarning: %s is not a character device%s: unknown standard format%s: can't figure out partition infoioctl (GDINFO)%s: can't read disk label; disk type must be specified%s: unknown disk type%s: partition is unavailablebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %u-%c is not a legal FAT%s optionblock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectorstoo many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs=%#x bkbs=%s: can't read sector %uNO NAMEFAT%uBSD 4.4%s: can't write sector %u16018032036072012001440288008 @D dLTX `h Lp x $|: $,4<DL T \#d3l#t3|233#@@9@@ķ̷ط (08 @ H@P@X`hpxȸиظ  Ĺ(08@HPX`lx@@@@̹ Թ    (@0@8@H P lC$XC`C$hCp|Ⱥкغ  @@ (08@Hprintmainoption requires an argument -- %sundefmaximum option value is %d -- %soption requires a numeric argument -- %sdiscarddsuspeofeol2lnextminquitreprintstartstopsuspflushrprntillegal gfmt1 option -- %sillegal gfmt1 option%lxcflagiflagispeedlflagoflagospeedgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d TIOCSTOPTIOCSTARTTIOCSETD%d %d rows %scols %sillegal option -- -%scbreakcolscookeddecekeverythingextproclcasenewoldostartostoprawrowssanespeedttycs5cs6cs7cs8cstopb-cstopbcread-creadparenb-parenbparodd-paroddparity-parityevenp-evenpoddp-oddppass8-pass8hupcl-hupcl-hupclocal-clocalcrtscts-crtsctsmdmbuf-mdmbufignbrk-ignbrkbrkint-brkintignpar-ignparparmrk-parmrkinpck-inpckistrip-istripinlcr-inlcrigncr-igncricrnl-icrnliuclc-iuclcixon-ixon-flowixoff-ixofftandem-tandemixany-ixanydecctlq-decctlqimaxbel-imaxbel-echoechoe-echoecrterase-crterasecrtbs-crtbsechok-echokechoke-echokecrtkill-crtkillaltwerase-altweraseiexten-iextenechonl-echonlechoctl-echoctlctlecho-ctlechoechoprt-echoprtprterase-prteraseisig-isigicanon-icanonnoflsh-noflshtostop-tostopflusho-flushopendin-pendin-crtnewcrt-newcrtnokerninfo-nokerninfokerninfo-kerninfoxcase-xcaseopost-opostlitout-litoutocrnl-ocrnlolcuc-olcuconlcr-onlcronlret-onlretonocr-onocrtabs-tabsoxtabs-oxtabsonoeot-onoeot tablet disc; slip disc; ppp disc; strip disc; nmea disc; #%d disc; ispeed %d baud; ospeed %d baud;speed %d baud; %d rows; %d columns;lflags-extprociflagsoflagscflagscchars%s = %s;%-8susage: %s [-a | -e | -g] [-f file] [operands] -aefgaef:gnot a terminalTIOCGETDTIOCGWINSZgfmt1illegal option -- %stcsetattrTIOCSWINSZlinkitusage: %s [-fhLnPs] source [target] %s [-fLPs] source ... [directory] %s/%s%s: disappeared%s and %s are identical (nothing done).FfhLnPscmplabelduid_parsegetasciilabeledits$mpsavehas_overlapgetuint64editor_allocspaceedit_parmsedit_parmseditor_resizeeditor " 8  @ @@  @(@ %(@" 8 `N@_"8@d" h88@`  LLLLLLLȞLLLLLLL 8@DLTD\dlt|TT@T$@@(d,040\s6㿂;{vc'9O8'm:="! 5Ei[HZqv8E>}N.{7{iXiz^T ]Z|ת"4.yw'篒W;}&167M*Qd *OUwit{Uvj_ɿEr>yϒ3y?'0,&in_2YfӫJʫ\%/)*y.LJ(}qUJt3[_5Ƈ?7(>S‹dDy|H>\SCf .gTSͼY#j{^g!a:x&Q?I-7nOt{UJ^N>-=;UQTw;?h+  8)Jf_ZtúV=LU*x\\%ޟ]%')JG?x$x > aO bC{d%rsV:[ ɚZkb {W%n$9l܀!dhIuj*{IZD2 11˵j]RR hgN jW20Ȁ pqf](#SYgW~gQAWO 9MH:_c(̠IfQV-M5pag5;m ?kMQJaqVJ!sӐq/fzwnE"ӳKw;8zuz[SW ZjrfryZ<`b" #o\4Ut+Nj2;,&}C0_¸aP}؝ȫ5J=n: a?8F5͈V̈U2f`HACڼ$w&P*)f•tu&=<9;#0 :MmA*&x"PTp'okm7 Q@*U=kQh%w(DVG٠HA_ㆁ}hSEaP3Ay:_rB"2Obbg%9A#) M6Es 4/[2NiJ Yҷj.dйmЭ/mP;rqt}%_0Jb蟄4Zy)bJ! (F!0"c "6<owًH? X4 [='jW$cKb<jC>j .)hTB=Ƀ|Q͝)kԈvN8a6X7 7B:=-Am$a'>ݔ0"D]4![ 8ź}\, pUoqqo>%yC F'.!ApekK"("bܣa6$uδPslU 9&AVْ7 psXjD*%# a^H֡]_w9/Uij-[~k+sd˥IP>8fqChB03N{r,M0"ksem,LdD5daYx#64pYJv0:[8Xm%Q"lX6`qW:_PcRf5l(ۮ~fRDxx2<hS y(֠Amdirm… Z9EFy!G *S vzPpsB:&LIV9nҍpiE+o]u×<|Rsyj L"~`0RQCDSbEɖZP7`F'~uMV74܉<:FͪZwNwS|UxC*`}!#,Cqm6nLTʩuӢAn|*yT:IJl<O,u{Ќz&t9<z^0! YV=ٷ5H3Vmd]N+}>|>_Pu0c_U\5U]ay|yZ8 qZQ#j7b;+ 1|DH-moM. T1 p16NG1fJY<ހ|+m8[e*Db>!93q@Aqh|j-ŞJZdܝcz4ʚ2rTxvR1*ח`vQ陁%)95'J9EOZ;/VT\xɥi4Q;YQ'v/cX؀Z'cdz6[UA6,ӾVȘp$ ``'0u_#GXUv%dێGׁ2덂K:w.~3=bxܻv\$f=`&vHIQRܱ49 .(V-n5½c*I5x@(Y BL wfX `O:/Pqa޹W YV69x)L? rx4UF d3jkr뼇Q ;X(g:D7wWv5ӈK`4+Ʈ "YP]-f`Jz߉-k t2ƻF? A F_*W*TͧBwW`4"*}<ka̬egﺮ0x ;BTzi_}Vo3WqQ^5S7\=CxD kQzD y{<*Mi@̂B8ɶn0, \B-_0żdmgQœP &CO C2u}|:B93MR6W$p9֙Q'P`roolT3sWNizr0*Ldܰ*21y6xi%ejsL[1%і8M1.ȴt\%KK'7>5{O,ȲE1oT)? J>E2gğ\w0')y'2E&3b6dܼW e\יoHiUWg<ܵB G 9'HF5Q&P.Uj\M{~ ƿ; SY43eJCX"nQ[&KA; iT~Q%]l$68"k<>5g.PCqsSYJy9E#e3f ͹ 7ӋKl@"MӰSOvο&v 㲅01\IB&b4* gka7^gI)JIZ##C-K8i)wG`l10E};]bc9C †6>9: -M~oրDh͞H 716yrIr$>}=6M?7eWb1yA/z bQת3pW$(GQ?~ty\>,+L%0\]5L6KyJ0ʕ02x#x]\}y6VOn`ǎ B\vNt4PL/ϻuqs͘Z~VMs=vP~#0Ư RM {mo\թ5^%J0-6dkprc]@aJxBU9F`ij$c_3-ȸ;$B[4O#a[a=%2hZH?(]/[rDA?>-)/>zV;(҇TҨqiᆳ\@T0||JXH>s6,?PAM+M%%&AajLWsb~H~*׋Kwx7-/ҕi `F_Mkf&uÿhwꆚUzyϟ<2ڽC-Rusage: disklabel [-Acdtv] [-h | -p unit] disk (read) disklabel -w [-Acdnv] disk disktype [packid] (write) disklabel -e [-Acdnv] disk (edit) disklabel -E [-Acdnv] [-F|-f file] disk (simple editor) disklabel -R [-nv] disk protofile (restore) `disk' may be of the form: sd0 or /dev/rsd0%c. `disktype' is an entry from %s, see disktab(5) for more info. /etc/disktab`packid' is an identification string for the device. `protofile' is the output from the read cmd form; -R is powerful. For procedures specific to this architecture see: %s fdisk(8)sector size %dsectors/track %dtracks/cylinder %dcylinders/unit %dboot block size %dwarning, boot block size %% sector-size != 0super block size %dwarning, super block size %% sector-size != 0warning, number of partitions (%d) > MAXPARTITIONS (%d)warning, partition %c: size 0, but offset %llupartition %c: offset past end of unitpartition %c: partition extends past end of unitwarning, unused partition %c: size %llu offset %llu # line %d: syntax errorunknownIDEESDIline %d: warning, unknown disk type: %sbadsectvendorline %d: bad flag: %sdrivedataline %d: bad drivedata %s%d partitionsline %d: bad # of partitionsduidline %d: bad %s: %ssectors/cylindertracks/cylindercylindersrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seektotal sectorsboundstartboundendline %d: bad partition name: %sline %d: too few fieldsline %d: bad partition size: %sline %d: bad partition offset: %sline %d: warning, unknown filesystem type: %sline %d: unknown field: %sVISUALEDITOR/usr/bin/vi%s %s/bin/sh%s: No disk label on disk%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of disk%.*s|Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:nc#%u:sc#%u:su#%llu:d%d#%u\ :p%c#%llu:o%c#%llu:t%c=%s:t%c=unknown%d:b%c#%u:f%c#%u:Bootstrap doesn't leave room for disk labelioctl DIOCRLDINFOioctl DIOCGPDINFOioctl DIOCGDINFO/dev/%s%c%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx.aioctl DIOCWDINFOunknown disk type: %s %c: %16llu %16llu %c: %15.*f%c %16llu %7.7s%7d %5u %5u %4hu %19.19s# %s# %s: type: %s type: %d disk: %.*s label: %.*s duid: %02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx flags: badsect vendorbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %llu # total bytes: %.*f%cboundstart: %llu boundend: %llu drivedata: %d %hu partitions: # %16.16s %16.16s fstype [fsize bsize cpg] offset # Notes: # Up to 16 partitions are valid, named from 'a' to 'p'. Partition 'a' is # your root filesystem, 'b' is your swap, and 'c' should cover your whole # disk. Any other partition is free for any use. 'size' and 'offset' are # in 512-byte blocks. fstype should be '4.2BSD', 'swap', or 'none' or some # other values. fsize/bsize/cpg should typically be '2048 16384 16' for a # 4.2BSD filesystem (or '512 4096 16' except on alpha, sun4, ...) No changes.re-edit the label? [y]: bckmgtBCKMGTValid units are bckmgt ABEf:F:hRb:cdenp:tvwSMDMSCPold DECSCSIST506HP-IBHP-FLtype 9floppyccdvndATAPIRAIDunusedVersion6Version7SystemV4.1BSDEighth-Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSHFSADFSNTFSUDF-cTreating sectors %llu-%llu as the OpenBSD portion of the disk. You can use the 'b' command to change this. OpenBSD area: ; size: ; free: # %16.16s %16.16s fstype [fsize bsize cpg] Can't stat deviceAvailable commands: ? | h - show help n [part] - set mount point A - auto partition all space p [unit] - print partitions a [part] - add partition q - quit & save changes b - set OpenBSD boundaries R [part] - resize auto allocated partition c [part] - change partition size r - display free space D - reset label to default s [path] - save label to file d [part] - delete partition U - undo all changes e - edit drive parameters u - undo last change g [d|u] - [d]isk or [u]ser geometry w - write label to disk i - modify disklabel UID X - toggle expert mode l [unit] - print disk label header x - exit & lose changes M - disklabel(8) man page z - delete all partitions m [part] - modify partition Suffixes can be used to indicate units other than sectors: 'b' (bytes), 'k' (kilobytes), 'm' (megabytes), 'g' (gigabytes) 't' (terabytes) 'c' (cylinders), '%' (% of total disk), '&' (% of free space). Values in non-sector units are truncated to the nearest cylinder boundary.%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx.%c%s%c none swap sw %s%c %s %s rw 1 %d failed to sort partition table%s: [%s] [d]isk or [u]ser geometryEnter 'd' to use the geometry based on what the disk itself thinks it is, or 'u' to use the geometry that was found in the label.Command aborted BIOS geometry not defined. Note: user geometry is the same as disk geometry. You must enter either 'd' or 'u'. Where to mount this filesystem (ie: / /var /usr)'%c' already being mounted at '%s' Mount points must start with '/' The disklabel UID is currently: %02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx The disklabel UID, given as a 16 character hexadecimal string.Invalid UID entered. partition to deleteThe letter of the partition to delete, a - p, or '*'.Partition must be between 'a' and '%c' (excluding 'c'). Partition '%c' is not in use. partition to nameThe letter of the partition to name, a - p.You cannot name a filesystem of type %s. can't get mem sizePossible values are:"IDE", "%s"Disk typeWhat kind of disk is this? Usually SCSI, IDE, ESDI, ST506, or floppy."%s" is not a valid disk type. Valid types are: Error, partitions %c and %c overlap: Disable which one? (^D to abort) [%c %c] %s: [%llu] %lldRounding size to cylinder (%d sectors): %llu FS typeFilesystem type (usually 4.2BSD or swap)FS type (decimal)Filesystem type as a decimal number; usually 7 (4.2BSD) or 1 (swap).Invalid entry Unrecognized filesystem type '%s', treating as 'unknown' Size of ffs blocks. A multiple of the ffs fragment size.Error: block size must be at least as big as page size (%d). Error: block size must be a multiple of the fragment size (%llu). Align partition to block sizeRound the partition offset and size to multiples of bsize?Rounding offset to bsize (%llu sectors): %llu Rounding size to bsize (%llu sectors): %llu fragment sizeSize of ffs block fragments. A multiple of the disk sector-size.Error: fragment size must be a multiple of the disk sector size (%d) Zero fragment size implies zero block sizeSize of the partition. You may also say +/- amount for a relative change.The size must be > 0 sectors The size can't be more than %llu sectors, or the partition would extend beyond the last sector (%llu) of the OpenBSD portion of the disk. The 'b' command can change this limit. Sorry, there are only %llu sectors left partition to change sizeThe letter of the partition to change size, a - p.Partition %c is currently %llu sectors in size, and can have a maximum size of %llu sectors. Starting sector for this partition.The offset must be >= %llu and < %llu, the limits of the OpenBSD portion of the disk. The 'b' command can change these limits. The offset must be in a free area. partition to modifyThe letter of the partition to modify, a - p.No space left, you need to shrink a partition The letter of the new partition, a - p.Partition '%c' exists. Delete it first. Starting sectorThe start of the OpenBSD portion of the disk.Size ('*' for entire disk)The size of the OpenBSD portion of the disk ('*' for the entire disk).Changing device parameters for %s: What kind of disk is this? Usually SCSI, ESDI, ST506, or floppy (use ESDI for IDE).label name15 char string that describes this label, usually the disk name.The Number of sectors per track.The number of tracks per cylinder.The number of sectors per cylinder (Usually sectors/track * tracks/cylinder).number of cylindersThe total number of cylinders on the disk.The total number of sectors on the disk.You may want to increase the size of the 'c' partition.Not enough free space to shrink by %llu sectors (only %llu sectors left) partition to resizeNo such partition Cannot resize spoofed partition [+|-]new size (with unit)new size or amount to grow (+) or shrink (-) partition including unitAmount too big Partition %c shrunk to make room No room left for all partitions You need to specify a type for this disk.can't run when there is partition overlap.No 'c' partition found, adding one that spans the disk.Label editor (enter '?' for help at any prompt) unable to get default partition tableThis option is not valid when run without the -f flag. PAGER/usr/bin/lessgunzip -qc|%sunable to execute %sIn no change mode, not writing label.No label changes.Write new label?Write the modified label to disk?unable to write labelResize only implemented for auto allocated labels Free sectors: %16llu - %16llu (%16llu) Total free sectors: %llu. FilenameName of the file to save label into.Original label and mount points restored.Last change undone.EnteringExiting%s expert mode Unknown option: %c ('?' for help) /tmp/var/usr/usr/X11R6/usr/local/usr/src/usr/obj/homelfsadosntfsudfsdrzwdFLOPPYxdhdCCDVNDsvndabcdfiklnoprstuvwxBDEGHLPTUXYZ0Cannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specForward positioning operation on archive failedCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Reverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %d pad blocksUnable to backspace tape %d blocks.Failed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDUnable to truncate archive file%s: Waiting for tape drive close to complete...done. %s: unknown format, %llu bytes skipped. %s: %s vol %d, %lu files, %llu bytes read, %llu bytes written. could not pipecould not fork-dccould not exec %sFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed chdir to %sFailed stat on %sCannot write an archive on top of a directory %sUnable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Ready for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sUnable to open %s to readCannot identify format. Searching...Sorry, unable to determine archive format.Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot mix current archive format %s with %s%s: Reading archive to position at the end...Cannot chdir to %sCan't fchdir to starting directoryUser specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUnable to append when there are archive read errors.Archive read error limit (%d) reachedCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Write block size %d too large, maximium is: %dWrite block size %d is not a %d byte multipleWrite block size of %d too large, maximium is: %dWrite block size of %d is not a %d byte multipleWrite block size of %d larger than POSIX max %d, archive may not be portableUnable to allocate memory for group name cache tableUnable to allocate memory for user name cache tableUnable to allocate memory for group id cache tableUnable to allocate memory for user id cache tableFile changed size %sFile %s was modified during readFile rewind failed on: %sFailed seek on file %sFailed write to file %sFile seek on %sWARNING! Major Internal Error! GNU hack Failing!Out of memoryCould not set permissions on %sUnable to set file uid/gid of %sAccess/modification time set failed on: %sUnable to close file descriptor on %sUnable to copy %s, file would overwrite itselfUnable to remove directory %sCould not unlink %scannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCould not create: %scpioCould not access %s (stat)Unable to link file %s to itselfUnable to remove %sCould not link to %s from %sUnable to link to %s from %sA hard link to the directory %s is not allowedUnable to create %sIgnoring unterminated pathname at EOFIgnoring too-long pathname: %sCan't chdir to %snext_fileFile system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %sWARNING! These file names were not selected:Invalid file name argumentUnable to allocate memory for filenameUnable to allocate memory for file name buffer%b %e %H:%M%b %e %Y%s%s %s %s%2u %-*.*s %-*.*s %4lu, %4lu %9llu == -> %s: unknown option %c %s: %c argument missing Invalid option nameUnable to allocate space for option listInvalid options formatusage: tar {crtux}[014578befHhjLmNOoPpqsvwXZz] [blocking-factor | archive | replstr] [-C directory] [-I file] [file ...] tar {-crtux} [-014578eHhjLmNOoPpqvwXZz] [-b blocking-factor] [-C directory] [-f archive] [-I file] [-s replstr] [file ...] usage: pax [-0cdjnOvz] [-E limit] [-f archive] [-G group] [-s replstr] [-T range] [-U user] [pattern ...] pax -r [-0cDdijknOuvYZz] [-E limit] [-f archive] [-G group] [-o options] [-p string] [-s replstr] [-T range] [-U user] [pattern ...] pax -w [-0adHijLOPtuvXz] [-B bytes] [-b blocksize] [-f archive] [-G group] [-o options] [-s replstr] [-T range] [-U user] [-x format] [file ...] pax -rw [-0DdHikLlnOPtuvXYZ] [-G group] [-p string] [-s replstr] [-T range] [-U user] [file ...] directory Invalid block size %sbzip2compress/dev/rst0/dev/rst1/dev/rst4/dev/rst5/dev/rst7/dev/rst8b:cef:hjmopqruts:vwxzBC:HI:LNOPXZ014578-IUnable to open file '%s' for readProblem with file '%s'-Cwrite_opt=nodirTAPEInvalid -p string: %cUnknown -x format: %spax: Known -x formats are: Invalid write limit %sWrite limit is not a %d byte multipleError count value must be positiveab:cdf:ijklno:p:rs:tuvwx:zB:DE:G:HLOPT:U:XYZ0%s: Invalid combination of options: -%cDestination directory was not suppliedThese format options are not supported %s = %s ustarFile name %s/%s, too longWARNING! These patterns were not matched:Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Removing leading / from absolute path names in the archive ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Pattern select out of memoryPattern list inconsistentEmpty pattern stringUnable to allocate memory for pattern stringEmpty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sCPU time limit reached, cleaning up. Signal caught, cleaning up. Can't open current working directory.TMPDIR/tmp/Cannot allocate memory for temp file name.Unable to set up signal handlercan not gzip while appendingEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [[[[[cc]yy]mm]dd]HH]MM[.SS][/[c][m]]Unable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryCannot canonicalize %sUnable to store mode and times for created directory: %sUnable to allocate memory for directory timesCannot allocate space for directory access time tableCannot allocate memory for device mapping tableCannot allocate memory for interactive rename tableCannot allocate memory for hard link tableDirectory access time reset table ran out of memoryDevice map table out of memoryUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedNo interactive rename table, links may failCannot update rename tableInteractive rename table out of memoryHard link table out of memoryFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sUstar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sFile is too long for ustar %snobodyUstar header field is too small for uid %lu, using nobodyUstar header field is too small for gid %lu, using nobodyUstar header field is too small for %sTar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sInvalid extended header lengthInvalid extended header recordInvalid extended header record lengthExtended header record length %lld is out of rangeMalformed extended header recordlinkpathwrite_optnodirUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.%s: /dev/ttyFatal error, cannot open %susage: ping [-DdEefLnqRrv] [-c count] [-I ifaddr] [-i wait] [-l preload] [-p pattern] [-s packetsize] [-t ttl] [-V rtable] [-w maxwait] host patterns must be specified as hex digits%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0x%02xVr HL TOS Len ID Flg off TTL Pro cks Src Dst Data %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %s TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Echo ReplyDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set (MTU %d) frag needed and DF setSource Route FailedNetwork UnknownHost UnknownSource IsolatedDest. Net Administratively ProhibitedDest. Host Administratively ProhibitedDestination Net Unreachable for TOSDestination Host Unreachable for TOSRoute administratively prohibitedHost Precedence ViolationPrecedence CutoffDest Unreachable, Unknown Code: %d Source QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect, Unknown Code: %d(New addr: %s) Echo RequestRouter Discovery Advertisement(%d entries, lifetime %d seconds) Router Discovery SolicitationTime to live exceededFrag reassembly time exceededTime exceeded, Unknown Code: %d Parameter problem, required option absent: pointer = 0x%02x Parameter problem: pointer = 0x%02x TimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask Reply (Mask 0x%08x) Unknown ICMP type: %d --- %s ping statistics --- %ld packets transmitted, %ld packets received, %ld duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/std-dev = %d.%03d/%d.%03d/%d.%03d/%d.%03d ms packet too short (%d bytes) from %s%d bytes from %s: icmp_seq=%u ttl=%d time=%d.%03d ms (DUP!) (TRUNC!) wrong data byte #%d should be 0x%x but was 0x%x%x %d bytes from %s: LSRR: 0.0.0.0 %s (truncated route) (same route) RR: NOP unknown option %xping: sendtoping: wrote %s %d chars, ret=%d setresuidnumber of packets to transmit is %s: %sbad interface address: %sbad timing interval: %s%s: only root may use interval < 1spreload value is %s: %spacket size is %s: %sttl value is %s: %srtable value is %s: %ssetsockopt SO_RTABLEmaxwait value is %s: %sDEI:LRS:c:defi:l:np:qrs:T:t:V:vw:unknown host: %s-f and -i options are incompatibleNo audible output for flood pingsbind-R option and -D or -T, or -t to unicast destinations are incompatiblerecord route not valid to multicast destinationsping: record routesetsockopt IP_MULTICAST_LOOPsetsockopt IP_MULTICAST_TTLsetsockopt IP_MULTICAST_IFgetsockoptsetsockoptCannot set the receive buffer sizeCould only allocate a receive buffer of %d bytes (default %d)PING %s (%s): %d data bytes PING %s: %d data bytes ping: recvfrommakeentrylinkupfileerroriblockckinodemainpass2pass2checkpass5setup88@`  catchquitNO SPACE LEFT IN %s (EXPANDED)EXPANDUNREFDIRLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTUNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORYlost+found IS NOT A DIRECTORYREALLOCATESORRY. CANNOT CREATE lost+found DIRECTORY SORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu NAME=%s %s=%s DIRECTORY CORRUPTEDwrong type to dirscan %d lost+found%d %s I=%lluBAD STATE %d TO BLKERR cannot find inode %llu bad inode number %llu to nextinode Cannot allocate space for inode buffer bad inode number %llu to ginode blk %d < cgdmin %d; blk + cnt %d > cgsbase %d blk %d >= cgdmin %d; blk + cnt %d > cgdmax %d LARGE FILES UNSUPPORTED ON REVISION 0 FILESYSTEMSSETTING LARGE FILE INDICATOR SET LARGE FILE INDICATORTRYING TO SET FILESIZE TO %llu ON MODE %x FILE I=%llu OWNER=%u MODE=%o SIZE=%llu MTIME=%12.12s %4.4s cannot increase directory list PARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDSCLEAR (CLEARED)-%c flag requires a %s usage: %s [-dfnpy] [-b block#] [-m mode] filesystem ... Alternate super block location: %d bad mode to -m: %o ** lost+found creation mode %o b:dfm:npystarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system** Phase 1 - Check Blocks and SizesINTERNAL ERROR: dups with -p** Phase 1b - Rescan For More DUPS** Phase 2 - Check Pathnames** Phase 3 - Check Connectivity** Phase 4 - Check Reference Counts** Phase 5 - Check Cyl groups%d files, %d used, %d free %d files missing %d blocks missing The following duplicate blocks remain: %d,The following zero link count inodes remain: %llu, ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW *****EXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEEXCESSIVE DUP BLKS I=%lluuDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%lluINODE I=%llu HAS DTIME=%12.12s %4.4s (CORRECTED)bad size %llu:HOLD BAD BLOCKbad size %llu ndb %d:bad direct addr: %d bad indirect addr: %d LINK COUNT TABLE OVERFLOWINCORRECT BLOCK COUNT I=%llu (%d should be %d)UNKNOWN FILE TYPE I=%lluROOT INODE UNALLOCATEDALLOCATECANNOT ALLOCATE ROOT INODE DUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYFIXBAD STATE %d FOR ROOT INODE DIRECTORY TOO SHORTDIRECTORY %s: LENGTH %lu NOT MULTIPLE OF %dMISSING '..'BAD INODE NUMBER FOR '..'BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' BAD TYPE VALUE FOR '..'CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '..' EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEUNALLOCATEDDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORY (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%llu ZERO LENGTHBAD/DUP%u: %2x summary info for cg %d is %d, %d, %d,should be %d, %d, %d SUMMARY INFORMATIONS WRONG FOR CG #%dblk_bitmap:bbmap:BLK(S) MISSING IN BIT MAPS #%dino_bitmap:ibmap:INODE(S) MISSING IN BIT MAPS #%dsummary info bad in superblock: %d, %d should be %d, %d SUPERBLK SUMMARY INFORMATION BADstrdup failedrealloc failedmalloc failed/r%s (%s): UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat rootCan't stat %s %s is not a character device ioctl (GCINFO): %s %s: can't read disk label %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A EXT2 FILE SYSTEM (%s) BAD SUPER BLOCK: %s MAGIC NUMBER WRONGBAD LOG_BSIZEcompat 0x%08x, incompat 0x%08x, compat_ro 0x%08x INCOMPATIBLE FEATURE BITS IN SUPER BLOCKsuperblock mismatchesoffset %ld, original %ld, alternate %ld VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATECan't stat %s: %s %s is not a character deviceCan't open %s: %s ** %sNO WRITE ACCESS (NO WRITE)cannot allocate space for superblock LOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO FSCK_FFS TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ext2fs(8).USING ALTERNATE SUPERBLOCK AT %d state = %d ** F%sile system is clean; not checking ** File system is already clean IMPOSSIBLE RESERVED BLOCK COUNT=%d IN SUPERBLOCKSET TO DEFAULTWRONG FPG=%d (BPG=%d) IN SUPERBLOCKBAD SUMMARY INFORMATIONcannot alloc %u bytes for blockmap cannot alloc %u bytes for statemap cannot alloc %u bytes for typemap cannot alloc %u bytes for lncntp cannot alloc %u bytes for inphead returning to single-user after filesystem check bad file type 0%o cannot allocate buffer pool INTERNAL ERROR: GOT TO reply()%s? no %s? yes %s? [Fyn?] (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %d CANNOT %s: BLK %dProgram terminated SEEKWRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN: %ld,PARTIALLY WRITING %sZERO'ED BLOCK %d TO DISK UPDATE STANDARD SUPERBLOCKSPanic: lost %d buffers MARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEANcache missed %ld of %ld (%d%%) READTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %ld (%ld),deadlocked buffer pool %6d usage: %s [-benstuv] [file ...] benstuv`hh8ihrandommalformed link-level addressSIOCSIFLLADDRSIOCGIFXFLAGSSIOCSIFXFLAGS[#%d]SIOCG80211WPAPARMSSIOCS80211WPAPARMSSIOCGIFFLAGSSIOCSIFFLAGSSIOCIFDESTROYmedia mode %smediaopt instance %d"%.*s"0xSIOCGIFGROUPgetifgroups groups:usage: ifconfig [-AaC] [interface] [address_family] [address [dest_address]] [parameters] invalid channel %s: %sSIOCS80211CHANNELprefix %s: %sSIOCGIFMEDIA%s: no link type?only one `instance' command may be issuedmust specify `media' before `instance'media instance %s: %smtu %s: %sSIOCSIFMTUbad hexadecimal digitshexadecimal digits too longstrings too longSIOCS80211NWIDmalformed BSSID: %sSIOCS80211BSSID%s: bad value%s=%o%s=%xSIOCGETVLANSIOCSETVLANvlan tag %s: %s vlan: %d parent interface: %s SIOCG80211ALLCHANS %4s %-8s %s chanfreqproperties %4d %4d MHz passive scan%d: bad prefixleninvalid vlan tag and device specificationinvalid %s %s: %s%s not allowed for the AFvltimepltimenwid chan %u bssid %s lladdr %s %u%% %udB powersave %uMESSIBSSCF_POLLABLECF_POLLREQPRIVACYSHORT_PREAMBLEPBCCCHNL_AGILITY SPECTRUM_MGMT QOS SHORT_SLOTTIME APSDDSSSOFDMDELAYED_B_ACKIMMEDIATE_B_ACKCACHEBSSAUTHASSOCCOLLECT no permission to scanSIOCG80211ALLNODES none restoreunknown %s media mode: %sonly one `mode' command may be issuedinvalid media mode: %sunknown %s media subtype: %sonly one `media' command may be issuedmay not issue `media' after `mode' commandsmay not issue `media' after `mediaopt' commandswpagroupcipher: unknown cipher: %sstrdupunknown %s media option: %sonly one `-mediaopt' command may be issuedmay not issue both `media' and `-mediaopt'only one `mediaopt' command may be issuedmay not issue `mediaopt' after `instance'wpaciphers: unknown cipher: %spsk802.1xwpaakms: unknown akm: %swpa1wpa2wpaprotos: unknown protocol: %s ieee80211: nwid chan %u bssid %s %u%% %udB nwkey persist%d: wpakey wpaprotos %swpa2 wpaakms %s802.1x wpaciphers wpagroupcipher powersave on (%dms sleep) (auto) %ddBm%sHIDENWIDNOBRIDGEUPBROADCASTDEBUGLOOPBACKPOINTOPOINTNOTRAILERSRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTTXREADYNOINET6INET6_NOPRIVACYMPLSWOL rdomain %d metric %lu mtu %lu lladdr %s status: %s %s: no media types? media: supported media: tunnel: inet%s %s -> %s:%u vnetid %d ttl %dpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEYunsetifgroup: group names may not end in a digitunsetifgroup: group name too longSIOCDIFGROUPsetifgroup: group names may not end in a digitsetifgroup: group name too long SIOCAIFGROUPSIOCG80211NWIDwpakey: invalid pre-shared keywpakey: passphrase must be between 8 and 63 characterswpakey: nwid not setwpakey: passphrase hashing failedSIOCS80211WPAPSKinterface index is already filledgetifaddrscould not determine link local address inet6 %sSIOCGIFDSTADDR_IN6 -> %sSIOCGIFNETMASK_IN6 prefixlen %dSIOCGIFAFLAG_IN6 anycast tentative duplicated detached deprecated autoconf autoconfprivacy scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime inet %sSIOCGIFNETMASKSIOCGIFDSTADDR --> %s netmask 0x%xSIOCGIFBRDADDR broadcast %sSIOCIFCREATEinvalid carp demotion: %scarpdemoteSIOCSIFGATTRSIOCGIFGATTR carp demote count %d%s: no such interface SIOCGIFGMEMBprintgroupinterface name '%s' too longcreatedestroyinet6'%s' requires argument'%s' requires 2 argumentsSIOCDIFADDRSIOCAIFADDRarp-arpdebug-debugalias-aliasdeletenetmaskmtunwid-nwidbssid-bssidnwkey-nwkeywpa-wpawpaakmswpacipherswpagroupcipherwpaprotoswpakey-wpakey-chanbroadcastvlanvlandev-vlandevgroup-groupanycast-anycasttentative-tentativeeui64autoconfprivacy-autoconfprivacypowersavepriorityrtlabeltxpowernwflagrdomain-inet6descriptiondescrwol-wollink0-link0link1-link1link2-link2mediamediaopt-mediaoptinstanceinstlladdrinetEthernetetherFDDIIEEE802.11TDMCARPautoselectmanual10baseT10baseT/UTP10UTP10base210base2/BNC10BNC10base510base5/AUI10AUI100baseTX100TX100baseFX100FX100baseT4100T4100baseVG100VG100baseT2100T21000baseSX1000SX10baseSTPSTP10STP10baseFLFL10FL1000baseLX1000LX1000baseCX1000CX1000baseT1000T1000baseTX1000TXHomePNA1HPNA110GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10GbaseCX410GCX410GBASE-CX42500baseSX2500SX10GbaseT10GT10GBASE-T10GSFP+Cu10GCuSingle-modeSMFMulti-modeMMFCDDIFH1FH2DS2DS5DS11DS1DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72t1t1-amie1e1-g.704e1-amie1-ami-g.704t3t3-m13e3e3-g.751e3-g.832e1-g.704-crc411a11b11gfhmasterfull-duplexfdxhalf-duplexhdxflag0flag1flag2loopbackhw-loopbacklooprxpausetxpausedual-attachdasadhochostapibssibss-mastermonitorturbohdlc-crc16pppframerelay-ansiframerelay-ciscoframerelay-ituno carrierno networkbackupactivekeepalive downusegroupwep40tkipccmpwep104displayprinttimeprintlong %s: %s: %s: directory causes a cyclefts_readCOLUMNS1ACFHLRSTacdfghiklmnopqrstux%b %e %H:%M:%S %Y%*llu %*qd total %llu %s %*u %-*s %-*s %3d, %3d %*s%*qd %*s ls: %s: %s usage: %s [-1AaCcdFfgHhikLlmnopqRrSsTtux] [file ...] usage: sysctl [-n] name %s=kern.osreleasehw.machinehw.modelhw.producthw.disknameshw.ncpufoundwarnmsgrtsol_timer_updateifconfigmake_packetmainrtsol_check_timerrtsol_inputsendpacketrtsol_inputsendpacketsockopeninterface_statusinterface_upget_rdomainlladdropt_fillinterface_statusinterface_upget_llflagget_rdomaindefrouter_probedefrouter_probe:sendprobeprobe_initmultiple interfaces foundreallocprobing %s<%s> %sillegal interface state(%d) on %sstop timer for %sset timer for %s to %lld:%ldfailed to get link layer information for %sinterface %s was already configuredmemory allocation failedlink-layer address option has null length on %s. Treat as not included.memory allocation failed for %susage: rtsol [-DdF] [-O script-name] interface ... rtsol [-DdF] -a usage: rtsold [-1DdFfm] [-O script-name] interface ... rtsold [-1DdFfm] -a adDFO:adDfFm1O:kernel is configured not to accept RAskernel is configured not to accept redirectskernel is configured as a router, not a hostfailed to open a socketfailed to initialize interfacessetting rdomain %ufailed to initialize %sfailed to setup for probing routerstimer expiration on %s, state = %d%s status is changed from %d to %dNo answer after sending %d RSsthere is no timerNew timer is %lld:%08ldselect: %srecvmsg: %sfailed to get receiving interfacefailed to get receiving hop limitpacket size(%zd) is too shortinvalid icmp type(%d) from %s on %sinvalid icmp code(%d) from %s on %sinvalid RA with hop limit(%d) from %s on %sinvalid RA with non link-local source from %s on %sreceived RA from %s on an unexpected IF(%s)received RA from %s on %s, state is %dsend RS on %s, whose state is %dsendmsg on %s: %smalloc for receive msghdr failedmalloc for send msghdr failedff02::2inet_pton failed for %sIPV6_RECVPKTINFO: %sIPV6_RECVHOPLIMIT: %ssetsockopt(ICMP6_FILTER): %sunsupported link type(%d)ioctl(SIOCGIFFLAGS) on %s: %sioctl(SIOCGIFMEDIA) on %s: %sioctl(SIOCGIFFLAGS): %sioctl(SIOCSIFFLAGS): %schecking if %s is ready...socket(SOCK_DGRAM): %sgetifaddrs: %sioctl(SIOCGIFAFLAG_IN6): %sget_llflag() failed, anyway I'll try%s is ready%s is tentative%s is duplicatedget_rdomain socket: %ssysctl(ICMPV6CTL_ND6_DRLIST): %smalloc: %sdefault router list contains a non-link-local address(%s)probe a router %s on %sshutdown: %snigrouppr_iphdnsdecodesummarypr_rthdrpr_icmphpr_nodeaddrpr_packmaint|/usage: ping6 [-dEefHmNnqtvWw] [-a addrtype] [-b bufsiz] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-V rtable] [hops ...] host ff02::2:0000:0000-%uVr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->\%03o --- %s ping6 statistics --- +%ld duplicates, %.1lf%% packet lossround-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms path MTU for %s is notified. (ignored) NodeInfo Supported Qtypes, compressed bitmap, raw bitmap???nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu HbH Options: Dst Options: Routing: sendmsgping6: wrote %s %d chars, ret=%d IP6HBH DSTOPT FRAG RTHDR AH ICMP6: type = %d, code = %d ESPUnknown Header(%d) No Route to DestinationDestination Administratively UnreachableDestination Unreachable Beyond ScopeDestination Unreachable, Bad Code: %d Packet too big mtu = %d Time exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option Bad code(%d) pointer = 0x%02x Listener QueryListener ReportListener DoneRouter SolicitationRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sNode Information QueryNOOPSupported qtypesDNS namenodeaddrIPv4 nodeaddrunknown qtype, subject=%s(%s), oldfqdn, no subject, subject=%sDNS label(invalid), invalidNode Information Reply, %sBad ICMP type: %drefused truncated no address %s(TTL=infty)(TTL=%u)invalid peernamefailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!)extra (%d bytes %s)refused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luinvalid socket buffer sizeMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %stoo small interval, raised to 0.01Must be superuser to preloadillegal preload value -- %s-R is not supported in this configurationinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %da:b:c:dEefHg:h:I:i:l:mnNp:qRS:s:tvV:wWtoo many intermediate hopsgetaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface namecan't initialize rthdrbad addr family of an intermediate addrcan't add an intermediate nodeUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP setsockopt(IPV6_RTHDR)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> pollrecvmsgnew path MTU (%d) is notified IPv6 addressIPv4 addressSuccessRefusedusage: %s [-aju] [-d dst] [-r seconds] [-t minutes_west] [-z output_zone] %-*s[+format] [[[[[[cc]yy]mm]dd]HH]MM[.SS]] illegal time formatUTCcannot unsetenv TZad:jr:ut:z:settimeofday%a %b %e %H:%M:%S %Z %Yspecified date is outside allowed rangeCould not get local time of dayadjtimedate set by %stoo many argumentsconversion errorusage: %s ioctl SMODEWSMOUSEIO_SCALIBCOORDSmmap/dev/ttyC0open /dev/ttyC0/dev/wsmouseopen /dev/wsmouseWSMOUSEIO_GCALIBCOORDSmouse.scale=%d,%d,%d,%d,%d,%d,%d ?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for data?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?m(%T %i of %m) .?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%tCannot allocate memoryLESSSECURE-G-L-XLESS--WARNING: terminal is not fully functionalLESS_TERMCAP_DEBUG<%s>LESS_TERMCAP_krklkukdkPkNkh@7kDLINESlicoTERMhcxndadbsgpcticdcmsomdmbvbbc|^srNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketseek error to 0ch_ungetchar overrunseek errorESC^%c*s<%X>less %s(P)+Non-match First-file EOF-ignore Keep-pos Regex-off &/Pattern not found& [Press space to continue, 'q' to quit.]There is no %s optionCommand not available(N-th) No %snext fileNo %sprevious fileNo such filemark: goto mark: Brackets: [Press 'h' for instructions.]Warning: some edit commands disabledWarning: some commands disabled"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETAESCAPELESSMETACHARS; *? '"()<>[]|&^`#\$%=~%c%s%c%s %s %sLESSCLOSELESSOPEN...skipping... Cannot seek to that file positionDetermining length of fileDon't know length of fileCannot seek to end of fileCannot seek to beginning of fileCannot seek to line number %nLESSANSIENDCHARSLESSANSIMIDCHARS0123456789;[?!"'#%()*+ Line numbers turned offCalculating line numbersInvalid mark letterMark not setUse "h" for help-" must be followed by 1 or 2 charsquotes %sTab stops and then every %d spacesless Copyright (C) 1984-2009 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less #Invalid column fractionInvalid column numberHorizontal shift %d columns.%06dHorizontal shift %s of screen widthjInvalid line fractionInvalid line numberPosition target at screen line %dPosition target at screen position %sValue is required after %sNumber is required after %s--%s-%c (--%s)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric option-%sThere is no %s option ("less --help" for help)LESS_IS_MOREBe less helpful in promptsBe helpful in promptsSearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numbersprompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linesDisplay underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file namefakeInvalid patternNo previous regular expressionPlease re-enter search patternNothing to searchmain<HTX`ljt|ȟĐ(,4@ (@HPT \@dusage: %s [-23bcdilsTU] [-a maxreadahead] [-g maxgroups] [-I readdirsize] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-w writesize] [-x retrans] rhost:path node hostname too longno : or @ speccan't resolve address for host %sNFS PortmapCannot MNT RPCbad MNT RPCcan't access %s: %s-2 and -3 are mutually exclusiveillegal -a value %s: %sillegal -g value %s: %sillegal -I value %s: %sconflicting version optionsillegal -R value %s: %sillegal -r value %s: %sillegal -t value %s: %sillegal -w value %s: %sillegal -x value %s: %s23a:bcdD:g:I:iL:lo:PR:r:sTt:w:x:Ubgconndumbtimernfsv3mntudpresvportnfsv2acmainUSER_print_diskUSER_modifygetuintask_pidask_numask_cmdMBR_pcopyunused DOS FAT-12 XENIX / XENIX /usr DOS FAT-16 Extended DOSDOS > 32MB NTFS AIX fs AIX/Coherent OS/2 Bootmgr Win95 FAT-32 Win95 FAT32LDOS FAT-16 Extended LBAOPUS OS/2 hidden Compaq Diag.OS/2 hidden OS/2 hidden OS/2 hidden AST swap Willowtech ThinkPad Rec Willowsoft $NEC DOS 'Win Recovery8Theos 9Plan 9 @VENIX 286 ALin/Minux DRBLinuxSwap DRCLinux DR MQNX 4.2 Pri NQNX 4.2 Sec OQNX 4.2 Ter PDM QDM RCP/M or SysVSDM TOntrack UEZ-Drive VGolden Bow \Priam aSpeedStor cISC, HURD, *dNetWare 2.xxeNetWare 3.xxfNetWare 386 gNovell hNovell iNovell pDiskSecure uPCIX Minix (old) Minix (new) Linux swap Linux files*OS/2 hidden Linux ext. NT FAT VS NTFS VS Linux LVM Amoeba FS Amoeba BBT Mylex BSDI NotebookSaveFreeBSD OpenBSD NEXTSTEP MacOS X NetBSD MacOS X bootMacOS X HFS+BSDI filesy*BSDI swap Solaris CTOS DRDOSs FAT12DRDOSs < 32MDRDOSs >=32MHPFS DisbledCPM/C.DOS/C*Dell Maint SpeedStor SpeedStor SpeedStor BeOS/i386 EFI GPT EFI Sys SpeedStor DOS 3.3+ SecSpeedStor Xenix BBT XwriteXreinit[[s۸~EWflO)Ŗ,aO9vr:I=gv*5%C$$qL&9ɤξb+Fw 7W׷:fWWvkrU:;0tU|.{xws1E  'VYQȕ\'* \g"SNV.~qQ|~_Zh<(D?I 9Tl"h*BOE6FR,d dž>c "SMC݊_ǜE;G&/*!:+qiavbw>`$2_jOR%LqI(A^dtUɾLRYjkTY(@b\6~ou-9R2R 4۝։[5WCbi)hOF{-5Sq3b*>Lŕy_r,85@2l]<~M/I%C#2J6(#ϬEtv2նa7a) kx舃Y+ ?P_L,CƉ ϖfti ֖;_z->p0ȟ2ic5.f) حqRG"ЭZWdvC-?5~O@K|މkq})./;NWxq#n~7 JHB,i]_oϦe&QNg[{'ߞp0zѨ7>gp4OQn|\z~W(:-Y}^#׈}%}.[y+_Hw#q|xp9{x~+{%~AHH~cs28;þC%g#SZQnv}ۯѸ5 p5t:狱@_G'vvnFOg'g!L‮5sqEó?_Nh(:t_Ɨmoiloߩ(9RL4b6>% h4UCwhdFp S"k+ _ _- )>&֎Bq;c>OVхR {]#!EYy.@d~N^Vo/j|㺐n |cx,Q%[",S*bdaU E2&ף-0̨/ڝbFbp=AəB2,UB1E{dvyڗR8J4"<[EtӦgwNV 7R^n rE-ٟx ?nܼ:oo}McD<`}NfedI|x=P_*k|=Jf&oK3*P]HX6(I҄rT|K0V#tQ+Qy[HR"x&[r}ZD4̃8kϼH]FYg*Nޛ)#8av @]0sy{y{ݩFA+ys%~W/ƣwOQOd<VǥHl*{.+{&dNgHXKqy#nދć+@AS{ #܆ yN(ٷiK*=_)b \8uyj46Se7/wi&ˆs}JjQcq:F4ӼC.dz TK R.GL=(gec^ណ]jiN01%.#rC[ңv6xfKzt[je _WTVGoSյ(uU!) _`",K,568SHj- 8X;M+b kEk߶U0:^3O6&sѮ7JPH Q<\9^SZk(d"g ߹ȩ5WAɍLer^!QNS [QK7vEQZmh=kXt`A5\QUS-$?.&(ocUħ{E@rAgH f>l7\դu-LI 0>|?C|@_./ܘzm:ٳD6ʇ(NJ/El.*2'2۝T3ZspjI2_'HTbjr[ExKY>[NرR 4i &Cqy!mFFJZӄQ}Getns]UT <"Xq* G(6-pTWW{u5K̿k+ xd߁oy`xt~|:0vw8=RG&[(4v9dg/eaԋ~:sƥVLR':IAyL+C߁fkK OjS݈ l\1-] {1jh"3/+y >s̀ !A<حD*`93j,ﲳA{BVo7ԊI<)j@Tf͙ƲHŶ(Uja?|@$m>Yq_/>Ն'gW*wЈuw&fHa9V4]􍇧̃<4 h1o;ΞsQXџ!~*=]R x,ɩZi[,byudLtJ<\=9g w⮜[ SneX.tjў!99)8$u rF\2g翍? ,`w3;\ p6ᧃd2`*6qC[%ˑyOG+5U2@30usage: %s [-eiuy] [-l blocks] [-c cylinders -h heads -s sectors] [-f mbrfile] disk -i: initialize disk with virgin MBR -u: update MBR code, preserve partition table -e: edit MBRs on disk interactively -f: specify non-standard MBR template -chs: specify disk geometry -l: specify LBA block count -y: do not ask questions `disk' may be of the forms: sd0 or /dev/rsd0c. Cylinder argument %s [1..262144].Head argument %s [1..256].Sector argument %s [1..63].Block argument %s [1..%u].ieuf:c:h:s:l:yPlease specify a full geometry with [-chs].Can't get disk geometry, please use [-chs] to specify.using builtin MBRUnable to read MBRerror initializing MBROffset: %lld Enter 'help' for informationfdisk:%c%d> Invalid command '%s'. Try 'help'. Aborting changes to current MBR.Do you wish to write new MBR?Do you wish to write new MBR and partition table?Command help listShow entire OpenBSD man page for fdiskreinitRe-initialize loaded MBR (to defaults)setpidSet the identifier of a given table entryEdit current drive statseditEdit given table entryflagFlag given table entry as bootableUpdate machine code in loaded MBRSelect extended partition table entry MBRSwap two partition entriesPrint loaded MBR partition tablewriteWrite loaded MBR to diskexitExit edit of current MBR, without saving changesQuit edit of current MBR, saving current changesabortAbort program without saving current changes%s: [%u] %s is out of range: %c%s%c %s is invalid: %c%s%c %s [n] Partition id ('0' to disable) [%X - %X]: [%X] (? for help) '%s' is not a valid number. '%x' is out of range. %s [%d - %d]: [%d] %s is %s: %s. BytesSectorsKilobytesMegabytesGigabytesDisk: %s geometry: %d/%d/%d [%.0f %d-byte %s] geometry: %s is not a character device or a regular fileDIOCGPDINFOdisk too large (%llu sectors). size truncated.Signature: 0x%X Start of partition #%d after end! Starting Ending LBA Info: #: id C H S - C H S [ start: size ]-------------------------------------------------------------------------------%c%1d: %.2X %6u %3u %3u - %6u %3u %3u [%12u:%12.0f%s] %s Warning CHS values out of bounds only saving LBA valuesChoose from the following Partition id values:%02X %s %02X %s %02X %s %02X %s partition number is %s: %s. flag value is %s: %s. Partition %d marked active. Partition %d flag value set to 0x%x. %s %s Machine code updated.partition number is invalid:partition number is %s: %s %d same partition as %d, doing nothing. MBR contains more than one OpenBSD partition!Write MBR anyway?Writing MBR at offset %d. error writing MBROffset: %d Partition %d is not an extended partition. Loop to offset 0! Not selected.Selected extended partition %d New MBR at offset %d. Change disk geometry?BIOS CylindersBIOS HeadsBIOS SectorsPartition %d is disabled. Do you wish to edit in CHS mode?BIOS Starting cylinderBIOS Starting headBIOS Starting sectorBIOS Ending cylinderBIOS Ending headBIOS Ending sectorPartition offsetPartition sizeIn memory copy is initialized to:Use 'write' to update disk.Dinvalid file type(standard input)(fd %d)usage: %s [-abcEFGHhIiLlnoqRsUVvwx] [-A num] [-B num] [-C[num]] [-e pattern] [-f file] [--binary-files=value] [--context[=num]] [--line-buffered] [pattern] [file ...] ^\((%s[[:<:]]%s%.*s%s[[:>:]]%scontext out of rangegrep version %u.%u binarywithout-matchtextUnknown binary-files optionCan't use small fgrep with -wbinary-filesline-bufferedafter-contextbefore-contextextended-regexpfixed-stringsbasic-regexpwith-filenamebyte-offsetregexpno-filenameignore-casefiles-without-matchfiles-with-matchesline-numberquietsilentrecursiveno-messagesrevert-matchword-regexpline-regexpunix-byte-offsets0123456789A:B:CEFGHILRUVabce:f:hilnoqrsuvwxyLine is too big to processBinary file %s matches usage: %s %s umount [-fv] special | nodeumount -a [-fv] [-h host] [-t type]%s: not currently mounted%s: not a directory or special device%s: unmount from %s afh:t:vmain<HTX`ljt|@usage: mount_msdos [-9lsx] [-g gid] [-m mask] [-o options] [-u uid] special node invalid file mode: %sunknown user id: %sunknown group id: %ssl9xu:g:m:o:stat %snot an MSDOS filesystemcheckfsfsck_%snostart %s %swait %s%s/fsck_%sexec %sCan't get resource limit to max data sizeCan't get resource limit for data size-b %sInvalid option stringusage: %s [-dfnpvy] [-b block#] [-l maxparallel] [-T fstype:fsoptions] [-t fstype] [special | node ...] dvpfnyb:l:T:t:%s: unknown special file or file system.Can't open checklist file: %s/etc/fstabpass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s: Unknown pid %lddone %s: %s (%s) = %x %s: %s (%s): EXITED WITH SIGNAL %d THE FOLLOWING FILE SYSTEM%s HAD AN %s UNEXPECTED INCONSISTENCY:%s: %s (%s)%s, )c]!!\cX%`-V%`,i\1Sn6i!XfffffffffffffffffffffffffffffffmRQw }dNfev_gY&V0V$xYMuAAM pywy@so+lRJ'x/C/=M+ O$+malloc %zuuntrusted comment: invalid comment in %s; must start with '%s'comment too longmissing new line after b64 in %sinvalid b64 encoding in %sEdunsupported file %sdup failedcan't open %s for %sread from %susage: %1$s -V [-eq] [-x sigfile] -p pubkey -m message CGISVc:em:np:qs:x:must specify sigfile with - message%s.sigpath too longneed message and pubkeyfstat on %s%s must be a regular filemsg too large in %sverification failed: checked against wrong keysignature verification failedwrite to %susage: %s [-m mode] fifo_name ... usage: %s [-m mode] name b|c major minor %s [-m mode] name p node must be type 'b' or 'c'.non-numeric major number.non-numeric minor number.major or minor number too largemkfifoinvalid file mode.m:sodumpinet6_makenetandmaskgetaddrprint_rtmsgmonitoroGooonnnooo8onetname6routenamep_flagsp_rtentry0123456789abcdefUGHRBD M@dmCXLS1@2 3cPTdefaultconnectedstaticospfis-isbgpbad label: %s is %sinvalid table id: %slabel too longprefixlen is not supported with af %dprefixlen %s is %s%s: link %s; %s: inet %s; %s: inet6 %s; set_metric mtu: %s is %sset_metric expire: %s is %sking bula sez: set_metric with invalid key128internal error%s: resolved to multiple valuesmpls labels require -in or -out switch%s: not a network%s: bad address%d: bad address familybotched keyword: %susage: %s [-dnqtv] [-T tableid] command [[modifiers] args] commands: add, change, delete, exec, flush, get, monitor, show setrtable sockaddrs: locks: inits: route to: %s routing message version %d not understoodmessage length mismatch, in packet %d, returned %dRTM_GET: %s (errno %d)destination: %s mask: %s gateway: %s interface: %.*s if address: %s mpls label: %s %s priority: %u (%s) flags: label: %s use mtu expire%8llu %8u%c %8lld%c sockaddrs: [rtm_type %d out of range]: len %d, if# %d, name: %s, link: %s, flags:, metric %d, flags:, if# %d, name %s, what: arrivaldeparture, priority %d, table %u, pid: %ld, seq %d, errno %d flags: use: %8llu mtu: %8u%c expire: %8lld%cso_dstso_gateso_maskso_ifpso_ifaso_labelso_srcwriting to routing socketread from routing socketmust be root to alter routing table-mplslabel requires -inet or -inet6-in requires -mpls-out requires -mpls-out requires -push, -pop, -swap-pop requires -mpls-push requires -mpls-swap requires -mplspriority is %s: %snetmask missingnet: gateway %sentry in userouting table overflownot in tableroute-sysctl-estimateactual retrieval of interface tablesetsockopt(ROUTE_MSGFILTER)setsockopt(ROUTE_TABLEFILTER)got message of size %d on %sno such interface %sactual retrieval of routing tableExamining routing table from sysctl(address family %s) write to routing socketgot only %d for rlen %-20.20s donednqtT:vrouting table %d/dev/nulladdblackholechangecloningdstencapexpiregatewaygethopcountifaifpjumbolinkllinfolocklockrestmpathmplslabelnojumbonostaticpopproto1proto2pushrecvpiperejectrttrttvarsasendpipeshowssthreshxresolveRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics or flagsRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_RESOLVE: Route created by cloningRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_IFINFO: iface status changeRTM_IFANNOUNCE: iface arrival/departureRTM_DESYNC: route socket overflowPUSHLOCALPOPSWAPlink#%dillegal prefixlen%s/%d%u/%d%u.%u/%d%u.%u.%u/%d%u.%u.%u.%u/%daf %d: %s(%d) %s%-6s %-*.*s %-6u/esp/ah/ipcomp/ipip//use/require/acquire/deny/bypass/dontacq//in/out%-*s %-5u %-*.*s %-5u InternetInternet6Encap Protocol Family %d: MPLS%-18s %-5s %-18s %-5s %-5s %-22s SourcePortProtoSA(Address/Proto/Type/Direction)%-9s %-9s %-6s %-18s %-6.6s %5.5s %8.8s %5.5s %4.4s %s In labelOut labelOpGatewayFlagsRefsUseMtuPrioInterface%-*.*s %-*.*s %-6.6s %5.5s %8.8s %5.5s %4.4s %sIfaceLabel%-6.6s %5u %8llu %5u %5s %2d %-5.16ssysctl of routing tableRouting tablesspd-sysctl-estimatesysctl of spd Encap:Extra `@' characters in usernames and passwords should be encoded as %%40 KMGTPftp://http://file::/Can't allocate memory for URL decoding <>"#{}|\^~[]`receivedCan't allocate memory to parse URLurl_get: Invalid URL '%s'No `/' after host (use -o): %sNo filename after host (use -o): %sNo filename after directory (use -o): %sCan't allocate memory for proxy URL.Malformed proxy URL: %serror in base64 encodingCan't open file %sCan't open %sCan't allocate memory for transfer bufferWriting %sReading from file(unknown)Trying %s... r+Requesting %sCan't allocate memory for URL encoding%%%02x (via %s) GET %s HTTP/1.0 Proxy-Authorization: Basic %s%s %s User-Agent: OpenBSD ftpGET %s HTTP/1.0 %s%s GET /%s %s Host: HTTP/1.0Can't allocate memory.[%s]:%s %s%s Writing HTTP requestReceiving HTTP replyError retrieving file: %sToo many redirections requestedContent-Length: Location: Relative redirect not supportedCannot allocate memory for URLRedirected to %s Reading from socketRead short file. Auto-login using ftp URLs isn't supported when using $ftp_proxyImproper response from %sftp_proxyhttp_proxyCan't allocate memory for auto-fetch.Invalid URL: %sCan't connect or login to host `%s'*?[]{}NLSTRetrieving %s/%s mget file fetch aborted. http fetch aborted. Forced abort. The connection will be closed. local: %srunique: can't find unique file name. receive aborted waiting for remote to finish abort. acceptsetsockopt TOS (ignored)%c%c%c421 Service not available, remote server has closed connection. Lost control connection for abort.%cABOR No control connection for command.QUITRETRSTOUSTORPASVproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s use of scoped address can be troublesomeEPSVwrong server: return code must be 229 LPSVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u%c%c%c%d%cparse error! setsockopt (reuse address)setsockopt IP_PORTRANGE (ignored)setsockopt IPV6_PORTRANGE (ignored)listenEPRT |%d|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dlocal: %s remote: %s REST %lldnetin: %slocal: %s: %s%s: short writeWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sftpgatehttp%s: bad port number `%s'connect to address %sfdopen failed.Connected to %s. usage: %s [-o output] ftp://[user:password@]host[:port]/file[/] ... %s [-o output] http://host[:port]/file ... %s [-o output] file:file ... %s [-o output] host:/file[/] ... FTPSERVERPORTFTPMODEpassivegateunknown FTPMODE: %s. Using defaultsgate-ftpFTPSERVERNeither $FTPSERVER nor $GATE_SERVER is defined; disabling gate-ftpdumbemacssukeep alive amount is %s: %sretry amount is %s: %s46AaCc:dD:Eegik:mno:pP:r:S:s:tvVnmap: unbalanced brackets. CWD %sCWD command not recognized, trying XCWD. XCWD %scan't get cwdSkipping non-relative filename `%s' a+winternal error: unknown type %d.TYPE %s %sTYPE %susage: %s [ | Using %s mode to transfer files. %s: unknown mode. asciiimageebcdictenex%lld byte%s %s in %.2f seconds (%.2f %sB/s) ETA: %02d:%02d:%02d %-*.*s%s %-*.*s%s %3d%% %3d%% |%.*s%*s|************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************* %5lld %c%c %2d:%02d:%02d --:-- ETA - stalled -%02d:%02d ETAUnable to determine real path of `%s'%s: not foundunable to create temporary file: %sftpXXXXXXXXXXLISTcan't find list of remote files, oops. can't find list of remote files, oops.anonymous%s@Name (%s:%s): Name (%s): USER %sPassword:PASS %sAccount:ACCT %sLogin %s failed.Already connected to %s, use close first. gateserver not defined (shouldn't happen)PASSERVE %sConnected via pass-through server %s non-printstreamSYSTRemote system type is %s. 215 UNIX Type: L8215 TOPS20Remember to set tenex mode when transferring binary files from this machine. SIZE %sMDTM %s191Y2K warning! Fixed incorrect time-val received from server. %*s %04d%02d%02d%02d%02d%02dCan't convert %s to a time. mainusage: %s [-dn%sq] dlnpqhalted (with powerdown) by %shalted by %srebooted by %s~SIGTSTP init/etc/rc/dev/consolerevokesetsidopenSIGTERM processesWARNING: some process(es) wouldn't die(can't restart init): main<HTX`ljt|@Đȟ|usage: mount_ffs [-o options] special node filesystem must be mounted read-only; you may need to run fsckreload5Ti ""("8"@"H":T"d"p"'x" w "&k"""#"@$"`"""" " "!# 'L''4v(','('<'('P'('d'('p'(''(''(''(''\' '\'\''\(\(Դ (Դ<(L(P( h(hx(((( (Դ((Դ(Դ )Դ )<)L(L)Դd)x)Դ)h))Դ)\)(')(') l*('(*('<*hP*\`*('p*('***h*h** ++\ + 8+L+`+\x+ l+ l+ l+\+('+\+\+(',(',(',('(,('4,('D,('P,('d,(',\, l, l, l, l, l, l, l,('- l- l - l,- l8- lD- lP- l\- lh- lt- l- l- l- l- l- l- l- l- l- l- l- l. l. l. l(. l4. l@. lL. lX. ld. lp. l|. l. l. l. l... l. l. l. l. l/ l/ l/ l(/ l4/ l@/ lL/ lX/ ld/ lp/ l|/ l/ l/ l/ l/ l/ l/ l/\/ l/ l/ l0 l0 l 0('<0 lH0 lT0 l`0 ll0 lx0 l0 l0 l0 l0 l0 l0 l0 l0 l0 l0 l0 l1 l1 l 1 l,1 l81 lD1 lP1 l\1 lh1 lt1 l1 l1 l1 l1 l1 l1 l1 l1 l1 l1 l1 l2 l2 l2 l(2 l42 l@2 lL2 lX2 ld2 lp2 l|2 l2 l2 l2 l2 l2 l2 l2 l2 l2 l2 l3 l 3 l3 l$3 l03 l<3 lH3 lT3 l`3 ll3 lx3 l3 l3 l3 l3 l3 l3 l3 l3 l3 l3 l3 l4 l4 l 4 l,4 l84 lD4 lP4 l\4 lh4 lt4 l4 l4 l4 l4 l4 l4 l4 l4.4 l4 l5\5 l(5 l45\/etc/resolv.confCouldn't open '%s': %sCouldn't write contents to '%s': %sShort contents write to '%s' (%zd vs %zd)fchmod(fd, 0x%x) of '%s' failed (%s)fchown(fd, %d, %d) of '%s' failed (%s)warning: hostname %s contains an underscore which violates RFC 952write_file: path too long (%zu)write_file: imsg_composev: %swrite_fileInvalid option name: '%s'fcntl F_GETF: %sfcntl F_SETFL: %sUnable to clone leaseUnable to apply defaultssearch %s no memory for domainnamenameserver %s no memory for nameserver# Generated by %s dhclient no memory for courtesy lineno memory for resolv.conf contentsegresssocket errorno interface in group egress foundioctl SIOCGIFGMEMB: %sget_ifnametoo many interfaces in group egressInterface name too long: %sInterface name too longoption_as_string: bad code %udhcp option too largedaemoncannot forkchdir("/")%s [priv]no memory for priv_ibufpoll error: %simsg_read(priv_ibuf): %sCould not unlink '%s': %s%s; restarting.RESTART FAILED: '%s': %s%s; exiting bootp; %s { %s interface "%s"; fixed-address %s; next-server %s; filename server-name option %s %s; renew %w %Y/%m/%d %T UTC; rebind %w %Y/%m/%d %T UTC; expire %w %Y/%m/%d %T UTC; } offeredcannot fit offered lease into option dbcannot make offered lease into stringeffectivecannot fit effective lease into option dbcannot make effective lease into stringlease file not opencannot make lease into stringoptions do not fit in DHCPDECLINE packet.options do not fit in DHCPREQUEST packet.options do not fit in DHCPDISCOVER packet.DHCPDECLINE on %s to %s port %huNo acceptable DHCPOFFERS received.Trying recorded lease %sbound: renewal in %lld seconds.bound: immediate renewal.No working leases in persistent database - sleeping.DHCPDISCOVER on %s to %s port %hu interval %lldDHCPREQUEST on %s to %s port %hudhcpoffer: no memory to record lease.option-dhcpoffer: unknown option %dBogus data for option %sdhcpoffer: no memory for server name.Bogus server name %sdhcpoffer: no memory for filename.bound to %s -- renewal in %lld seconds.Unsatisfactory %susage: %s [-dqu] [-c file] [-i options] [-L file] [-l file] interface No memory for rtmmsg%s sa == NULL%s, not %s, added to %s%s added to %sActive address (%s) deleted; exiting%s, not %s, deleted from %s%s deleted from %s%s downLLADDR changed; restarting%s departuredno memory for errmsg'%s' is not a regular filec:di:l:L:quifi callocclient callocconfig calloc%s.%s/var/db/dhclient.leasesasprintfsetting routing table to %u: '%s'/etc/resolv.conf.tailCannot open /etc/resolv.conf.tail: %sCannot stat /etc/resolv.conf.tail: %sno memory for resolv.conf.tail contents: %sCouldn't read resolv.conf.tail: %sGot no data from resolv.conf.tailShort read of resolv.conf.tail%s: no link ... sleeping got link cannot open %s: %s_dhcpno such user: _dhcpsocketpair: %sno memory for unpriv_ibufcan't open and lock %s: %scan't open %s: %ssocket(PF_ROUTE, SOCK_RAW): %ssetsockopt(ROUTE_MSGFILTER): %ssetsockopt(ROUTE_TABLEFILTER): %s/var/empty/chrootsetresgidsetgroups/etc/dhclient.confno memory for reject address!expecting option name.too many options.expecting hex octet.string constant too long.expecting string or hexadecimal dataexpecting ':'.expecting identifier after option keyword.unknown option name.expecting string.option data buffer overflowexpecting signed 32-bit integer.expecting unsigned 32-bit integer.expecting unsigned 16-bit integer.expecting unsigned 8-bit integer.expecting identifier.truefalseexpecting boolean.Bad format %c in parse_option_param.out of memory allocating option data.expecting interface name (in quotes).wrong interface name.expecting lease declaration.expecting left brace.no memory for lease.unterminated lease declaration.Obsolete client identifier (%s) in recorded leaseexpecting a statement.unterminated interface declaration.Corrupt lease file - possible data loss!getifaddrs failedinterface %s already has the offered subnet!Can't create socketinterface_link_forceup: SIOCGIFFLAGS failed (%s)interface_link_forceup: SIOCSIFFLAGS DOWN failed (%s)interface_link_forceup: SIOCSIFFLAGS UP failed (%s)receive_packet failed on %s: %sInterface %s no longer appears valid.no space to remember ifpNo interfaces availableInterface %s: rdomain changed out from under usNo live interface to poll onpoll: %sdispatch%s; restartingsend_packet: %ssocket(SOCK_RAW): %ssetsockopt(IP_HDRINCL): %ssetsockopt(SO_RTABLE): %s/dev/bpf%dCan't find free bpf: %sCan't attach interface %s to bpf device %s: %sCan't get BPF version: %sKernel BPF version out of range - recompile dhcpd!Can't set immediate mode on bpf device: %sCan't set filter-drop mode on bpf device: %sCan't get bpf buffer length: %sCan't allocate %lu bytes for bpf input buffer.Can't install packet filter program: %sCan't install write filter program: %sCannot lock bpfcSc"'$`\\%cpretty_print_option: bad code %d%s: Excess information in format string: %s%s: no size indicator before A in format string: %s%s: garbage in format string: %s%s: expecting at least %d bytes; got %d%s: expecting only %d bytes: got %d%s: expecting %d bytes: got %d%s/%uUnexpected format code %coption %s (%d) larger than buffer.option %s has no length field.Can't allocate storage for option %s.Can't expand storage for option %s.DHCPACKDHCPOFFERDHCPNACKBOOTREPLY%s from %s (%s)no memory for info stringeof in string constantstring constant too longnumeric token larger than internal bufferappendbackoff-cutoffbootpdenyethernetfixed-addresshardwareignoreinitial-intervallink-timeoutmediumnext-serverprependrebindrenewrequireretryselect-timeoutsendserver-namesupersedetimeout%s line %d: %s%*c^ %s: msgbuf_write: %sRTM_DELETE write: %sshort RTM_DELETE write (%zd) DHCLIENT DHCLIENT %dcreating route label: %screating route label: label too long (%d vs %zd)default route socket: %sRTM_GET of default route: %sget default route read: %sno data from default route readdefault route read rtm: %ssendhup: imsg_compose: %ssendhupadd_address: imsg_compose: %sadd_addressdelete_address: imsg_compose: %sdelete_addressadd_route: imsg_compose: %sadd_routeflush_routes: imsg_compose: %sflush_routessocket open failed: %sSIOCAIFADDR failed (%s): %sSIOCDIFADDR failed (%s): %sdelete_addresses getifaddrs: %sRouting Socket open failed: %sfailed to add default route: %sroutes buf malloc:sysctl retrieval of routes:route cleanup failed - %s %s (msize=%zu)opening socket to flush routes: %ssysctl size of routes:%d bad IP checksums seen in %d packets%d udp packets in %d too long - dropped%d bad udp checksums in %d packetspadsubnet-masktime-offsetIAtime-serversien116-name-serversdomain-name-serverslog-serverscookie-serverslpr-serversimpress-serversresource-location-servershost-nameboot-sizemerit-dumpdomain-nameswap-serverroot-pathextensions-pathip-forwardingnon-local-source-routingpolicy-filterIIAmax-dgram-reassemblydefault-ip-ttlpath-mtu-aging-timeoutpath-mtu-plateau-tableSAinterface-mtuall-subnets-localbroadcast-addressperform-mask-discoverymask-supplierrouter-discoveryrouter-solicitation-addressstatic-routestrailer-encapsulationarp-cache-timeoutieee802-3-encapsulationdefault-tcp-ttltcp-keepalive-intervaltcp-keepalive-garbagenis-domainnis-serversntp-serversvendor-encapsulated-optionsnetbios-name-serversnetbios-dd-servernetbios-node-typenetbios-scopefont-serversx-display-managerdhcp-requested-addressdhcp-lease-timedhcp-option-overloaddhcp-message-typedhcp-server-identifierdhcp-parameter-request-listBAdhcp-messagedhcp-max-message-sizedhcp-renewal-timedhcp-rebinding-timedhcp-class-identifierdhcp-client-identifieroption-62option-63nisplus-domainnisplus-serverstftp-server-namebootfile-namemobile-ip-home-agentsmtp-serverpop-servernntp-serverwww-serverfinger-serverirc-serverstreettalk-serverstreettalk-directory-assistance-serveruser-classoption-78option-79option-80option-81relay-agent-informationoption-83option-84nds-serversnds-tree-namends-contextoption-88option-89option-90option-91option-92option-93option-94option-95option-96option-97option-98option-99option-100option-101option-102option-103option-104option-105option-106option-107option-108option-109option-110option-111option-112option-113option-114option-115option-116option-117option-118option-119option-120classless-static-routesCIAoption-122option-123option-124option-125option-126option-127option-128option-129option-130option-131option-132option-133option-134option-135option-136option-137option-138option-139option-140option-141option-142option-143tftp-config-fileoption-145option-146option-147option-148option-149voip-configuration-serveroption-151option-152option-153option-154option-155option-156option-157option-158option-159option-160option-161option-162option-163option-164option-165option-166option-167option-168option-169option-170option-171option-172option-173option-174option-175option-176option-177option-178option-179option-180option-181option-182option-183option-184option-185option-186option-187option-188option-189option-190option-191option-192option-193option-194option-195option-196option-197option-198option-199option-200option-201option-202option-203option-204option-205option-206option-207option-208option-209option-210option-211option-212option-213option-214option-215option-216option-217option-218option-219option-220option-221option-222option-223option-224option-225option-226option-227option-228option-229option-230option-231option-232option-233option-234option-235option-236option-237option-238option-239option-240option-241option-242option-243option-244option-245option-246option-247option-248classless-ms-static-routesoption-250option-251autoproxy-scriptoption-253option-254option-endexpecting semicolon.time string too longinvalid time string%w %Y/%m/%d %T UTC%w %Y/%m/%d %T%u %Y/%m/%d %Tunparseable time stringtime could not be representedexpecting unsigned 32-bit decimal value.expecting CIDR subnet.expecting '/'.Expecting CIDR prefix length.expecting 'ethernet'.expecting '.'.expecting decimal octet.filename must be a stringno memory for string %s.dispatch_imsg: imsg_get failure: %sbad IMSG_DELETE_ADDRESSbad IMSG_ADD_ADDRESSbad IMSG_FLUSH_ROUTESbad IMSG_ADD_ROUTEbad IMSG_HUPshort IMSG_WRITE_FILEbad IMSG_WRITE_FILE (%zu)received unknown message, code %ucannot close temp fileinvalid address/tmp/ed.XXXXXXXXXXw+cannot open temp fileline too longcannot seek temp filecannot write temp filecannot read temp fileunexpected end-of-file& no previous commandinvalid pattern delimiter\  \abfnrtv\cannot read stdincannot write filecannot open output filecannot close output filecannot read input filenewline inserted newline appended cannot open input filecannot close input fileshell access restrictedinvalid mark charactered.hup/ed.hupno current filenameinvalid filenamefilename too longno matchnumber out of rangeinvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioncrypt unavailableHOMEcrypt unavailable ? p:sx ? interrupt? warning: file modifiedscript, line %d: %s usage: %s [-] [-sx] [-p string] [file] unbalanced brackets ([])trailing backslash (\)no previous patterninfinite substitution loopnothing to undocopy_link%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).HLPRfiprthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too longusage: %s [-fip] [-R [-H | -L | -P]] source target %s [-fip] [-R [-H | -L | -P]] source ... directory lchown: %sutimes: %schown: %schmod: %schflags: %sunlink: %smknod: %smkfifo: %sreadlink: %ssymlink: %soverwrite %s? LLLLLMUHSxPTMMMJJ      A@!  @a`10  @`Psp0  ` @ X ;x8 h 08`jlS<  jlSE`[~ [~jlS`@@<@TU lSublSuuA mlSChltlSЪ*tlSЪ* &,AmlSL&mlSL&mlSL&a `~CmlS!!mlS!!mlS!!b w<AmlSL'mlSL'mlSL'c vCAmlSH(rlS!+rlS!+d XlAmlSZ -ulSulSe  k!AmlS6mlS6mlS6f tlSrlS'rlS' -Ň!slSR"slSR"slSR"PP!slSR"slSR"slSR">!slSR"slSR"tlSK`v!slSۥ"slSۥ"tlS4nT!slSۥ"slSۥ"slSۥ"!slSۥ"slSۥ"slSۥ" ̾!slSۥ"slSۥ"slSۥ"[T!slSۥ"slSۥ"slSۥ"|Qa!slSۥ"slSۥ"slSۥ"Y:!slSۥ"slSۥ"tlSv!slSۥ"slSۥ"slSۥ"j3!slSۥ"slSۥ"slSۥ"Ny+aslSۥ"slSۥ"tlS e!slS4b#slS4b#tlS jYaslS4b#slS4b#tlS z!slS4b#slS4b#tlS iaslS4b#slS4b#tlS ,K!slS4b#slS4b#tlS QaslS4b#slS4b#tlS  !slS4b#slS4b#tlS @aslS4b#slS4b#tlS uy!slS4b#slS4b#tlS aslS4b#slS4b#tlS ҫ!slSÕ$slSÕ$tlS MaslSÕ$slSÕ$tlS tZ=!slSÕ$slSÕ$tlS _?aslSÕ$slSÕ$tlS  !slSÕ$slSÕ$tlS  aslSÕ$slSÕ$tlS 'w!slSÕ$slSÕ$tlS ?aslSÕ$slSÕ$tlS T!slSÕ$slSÕ$tlS XuaslSڴ$slSڴ$tlS ,!slSڴ$slSڴ$tlS KtaslSڴ$slSڴ$tlS 5PO!slSڴ$slSڴ$tlS ֍|aslSڴ$slSڴ$tlS _5!slSڴ$slSڴ$tlS<v :B"aslSڴ$slSڴ$tlS<v Z{/!slSڴ$slSڴ$tlS<v nF>aslSڴ$slSڴ$tlS<v !slSڴ$slSڴ$tlS<v (VaslS M%slS M%tlS<v d'!slS M%slS M%tlS<v iaslS M%slS M%tlS<v X\!slS M%slS M%tlS<v yaslS M%slS M%tlS<v =!slS M%slS M%tlS<v C>aslS M%slS M%tlS<v oY!slS M%slS M%tlS<v ECaslS M%slS M%tlS<v OZ!slS M%slS M%tlS<v ۜaslS M%slS M%tlS<v !slSd%slSd%tlS<v p9aslSd%slSd%tlS<v 5!slSd%slSd%tlS<v #[aslSd%slSd%tlS<v ?C!slSd%slSd%tlS<v z2aslSd%slSd%tlS<v 9&!slSd%slSd%tlS<v nҎaslSd%slSd%tlS<v Ș!slSd%slSd%tlS<v $TaslS~&slS~&tlS<v P=;!slS~&slS~&tlS<v 7 .aslS~&slS~&tlS<v }i!slS~&slS~&tlS<v N+aslS~&slS~&tlS<v !slS~&slS~&tlS<v 3?TwaslS~&slS~&tlS<v !slS~&slS~&tlS<v 5aslS~&slS~&tlS<v SI!slS~&slS~&tlS<v LaslS'slS'tlS<v q T!slS'slS'tlS<v Oh@aslS'slS'tlS<v ?mm!slS'slS'tlS<v f34aslS'slS'tlS<v  !slS'slS'tlS<v xaslS'slS'tlS<v ] q!slS'slS'tlS<v ߋC;aslS'slS'tlS<v uW!slS'slS'tlS<v M_aslS;'slS;'tlS<v !slS;'slS;'tlS<v f8aslS;'slS;'tlS<v h!slS;'slS;'tlS<v @\ZaslS;'slS;'tlS<v fp!slS;'slS;'tlS<v C aslS;'slS;'tlS<v -!slS;'slS;'tlS<v &aslS;'slS;'tlS<v (!slS;'slS;'tlS<v vG+aslSVH(slSVH(tlS<v !slSVH(slSVH(tlS<v Yl aslSVH(slSVH(tlS<v W)Z!slSVH(slSVH(tlS<v IaslSVH(slSVH(tlS<v b!slSVH(slSVH(tlS<v A'aslSVH(slSVH(tlS<v Tœ!slSVH(slSVH(tlS<v waslSVH(slSVH(tlS<v h)!slS(slS(tlS<v |aslS(slS(tlS<v fVG!slS(slS(tlS<v 1.aslS(slS(tlS<v }01!slS(slS(tlS<v >~aslS(slS(tlS<v @A7f!slS(slS(tlS<v  !slS(slS(tlSN sBu!slS(slS(tlSh *[BuaslS(slS(tlS<v -!slSXy)slSXy)tlS<v ǡմaslSXy)slSXy)tlS<v ɉr;!slSXy)slSXy)tlS<v 5!slSXy)slSXy)slSXy)?r-$!slSXy)slSXy)slSXy)?oaslSXy)slSXy)tlS<v 0/!slSXy)slSXy)tlS<v 5QaslSXy)slSXy)tlS<v l!slSXy)slSXy)tlS<v BkaslS6*slS6*tlS<v cxN!slS6*slS6*tlS<v W*laslS6*slS6*tlS<v .!slS6*slS6*tlS<v ".!slS6*slS6*slS6*<^i!slS6*slS6*slS6*=䅦!slSC+slSC+slSC+" !slSft,slSft,slSft,"H!slSft,slSft,slSft,4!slSft,slSft,tlS<v fE!slSft,slSft,slSft,( GB!slSft,slSft,slSft,(|~!slS -slS -slS -(u!slS -slS -slS -(JrGulSlSl/lSl/ <8 &׾or\+op1 tqk"kk?-zw b-~ zv0@ . ..GMAKEDEVHconsoleI ttyJ memKkmemLnullMzeroNstdinOstdoutPstderrQksymsRklogSbpf0Twd0aUrwd0aVwd0bWrwd0bXwd0cYrwd0cZwd0d[rwd0d\wd0e]rwd0e^wd0f_rwd0f`wd0garwd0gbwd0hcrwd0hdwd0ierwd0iA ...B ...C ...D . ..ztsscale=zE . ..termcapF ...( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O @@ !1Aa  0@` #+3;CScs$M4ML@MLM\MhM|MMLVusage: %s [-123456789cdf%sh%slNnOqrt%sv] [-b bits] [-o filename] [-S suffix] %*s [file ...] usage: %s [-cfh%slNnqrt%sv] [-o filename] [file ...] usage: %s [-f%shqr] [file ...] OK %4.1f%% -- replaced with %s %lld bytes in, %lld bytes out method crc date time compressed uncompressed ratio uncompressed_name%-7.7s %08x %s %10lld %10lld %4.1f%% %s %10lld %10lld %4.1f%% (totals) .-_tgztazfchown: %sfchmod: %sfchflags: %sfutimes: %scompression not supported%s: won't read compressed data from terminal%s: unrecognized file formatcrc errorzcatzipunknown program nameGZIPoption -a is ignored on this systemillegal bit count -- %s-o argument is too long-o option may only be used with a single input filemay not mix -o, -c, or -t options%s is a directory: ignored: unchanged%s not a regular file%s%s already has %s suffix -- unchanged%s: unknown suffix: ignored%s%s: name too long%s: input: %sdeflate.gz123456789ab:cdfhLlNnOo:qrS:tVvcfhLlNno:qrtVvfhqrZgzz1.2.3need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionusage: %s [-R [-H | -L | -P]] %s file ... owner[:group]usage: %s [-h] [-R [-H | -L | -P]] %s file ... %s [-h] [-R [-H | -L | -P]] :group file ... group is %s: %suser is %s: %sHLPRXfghorstuwxthe -R and -h options may not be specified together.invalid flags: %sinvalid flag: %smakeentrylinkupfileerrordirscaniblockckinodecheckfilesyspass2pass2checkpass5setup88@`   @ catchinfocatchquit?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@%lld %s I=%llubad size: blk %lld, offset %lld, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock.fs_fpg %d cannot allocate memory for inode cache cannot increase directory listbad inode number %llu to nextinode %llu cannot alloc %lu bytes to extend inoinfo CG %d: BAD MAGIC NUMBER %lld files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %lld files missing %lld blocks missing %lld,conversion levelcannot do level %d conversion usage: %s [-fnpy] [-b block#] [-c level] [-m mode] filesystem ... dfpnNyYb:c:m:EXCESSIVE DUP BLKS I=%llucannot alloc %u bytes for inoinfobad direct addr: %ld bad indirect addr: %ld INCORRECT BLOCK COUNT I=%llu (%ld should be %d)too many inodes %llu cannot realloc %zu bytes to %zu for inoinfo phase 1, inode %llu/%lluphase 1b, inode %llu/%llu%s %s: LENGTH %ld NOT MULTIPLE of %d%s %s: LENGTH %ld NOT MULTIPLE OF %dphase 2, directory %d/%dphase 2, parent directory %d/%d (REMOVED)phase 3, directory %d/%ldphase 4, inode %llu/%lluDELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS UNKNOWN ROTATIONAL TABLE FORMAT %d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %ld MARKED FREE ALLOCATED FRAG %ld MARKED FREE BLK(S) MISSING IN BIT MAPSphase 5, cg %d/%d%s: NOT LABELED AS A BSD FILE SYSTEM (%s) NCG OUT OF RANGECPG OUT OF RANGENCYL LESS THAN NCG*CPGSBSIZE PREPOSTEROUSLY LARGEILLEGAL BLOCK SIZE IN SUPERBLOCKILLEGAL FRAGMENT SIZE IN SUPERBLOCKoffset %d, original %ld, alternate %ld VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN LAST ALTERNATEINFORMATION; SEE fsck_ffs(8).clean = %d UNDEFINED OPTIMIZATION IN SUPERBLOCKIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE NPSECT=%d IN SUPERBLOCK (FIXED)INCORRECT BMASK=%x IN SUPERBLOCKINCORRECT FMASK=%x IN SUPERBLOCKINCORRECT BSHIFT=%d IN SUPERBLOCKINCORRECT FSHIFT=%d IN SUPERBLOCKFormat of filesystem is too old. Must update to modern format using a version of fsck from before release 5.0 with the command ``fsck -c 2'' INCORRECT MAXFILESIZE=%llu IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%lx IN SUPERBLOCKINCORRECT QFMASK=%lx IN SUPERBLOCKINCONSISTENT CGSIZE=%d INCONSISTENT INOPB=%d INCONSISTENT NINDIR=%d cannot alloc %u bytes for cylinder group summary area cannot alloc %u bytes for inostathead cannot alloc %zu bytes for inpsort cannot alloc %zu bytes for inphead inoinfo: inumber %llu out of rangeCANNOT %s: BLK %lldWRITING %sZERO'ED BLOCK %lld TO DISK UPDATE STANDARD SUPERBLOCK %lld (%lld),   delete %d: %sinsert %d: %ssession database close: %ssession database open: %scannot get kernel security level: %scannot change kernel security level from %d to %d: %sfatal signal: %scan't parse getty for port %scan't allocate windowcan't parse window for port %sport %s changed utmp index from %d to %dcan't fork for window system on port %s: %msetsid failed (window) %mcan't exec window system '%s' for port %s: %mcan't fork for getty on port %s: %mgetty repeating too quickly on port %s, sleepingcan't exec getty '%s' for port %s: %msome processes would not die; ps axl advisedcan't open %s: %mcan't get %s for controlling terminal: %mcannot disable lid suspendcan't exec %s for %s %s: %mautobootcan't exec %s for %s: %mcan't fork for %s on %s: %mwait for %s on %s failed: %m; going to single user modeinit: %s on %s stopped, restarting %s on %s terminated abnormally, going to single user mode/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bincan't exec %s for single user: %mcan't fork single-user shell, trying againwait for single-user shell failed: %m; restartinginit: shell stopped, restarting single user shell terminated.single user shell terminated, restartinginit: %s init: already running initial setsid() failed: %mrootsetlogin() failed: %munrecognized flag '-%c'sfignoring excess argumentsusage: %s [-b block-size] [-c fragments-per-cylinder-group] [-e maxbpg] [-f frag-size] [-i bytes] [-m free-space] [-o options] [-P file] [-s size] special node usage: %s [-Nq] [-b block-size] [-c fragments-per-cylinder-group] [-e maxbpg] [-f frag-size] [-g avgfilesize] [-h avgfpdir] [-i bytes] [-m free-space] [-O filesystem-format] [-o optimization] [-S sector-size] [-s size] [-T disktype] [-t fstype] special ioctl (WDINFO)%s: can't rewrite disk labelinsane maxpartitions value %dP:T:b:c:e:f:i:m:o:s:NO:S:T:b:c:e:f:g:h:i:m:o:qs:t:%s: invalid ffs versionsector size invalid: %sblock size is %s: %sfragments per cylinder group is %s: %sblocks per file in a cylinder group is %s: %sfragment size is %s: %saverage file size is %s: %saverage files per dir is %s: %sbytes per inode is %s: %sfree space %% is %s: %s%s: unknown optimization preference: use `space' or `time'.file system size invalid: %snewfs_%s%s/newfs_%s%s not found%s: getmntinfo: %s%s: not a character-special device%s: can't figure out file system partition%s: `%c' partition is unavailable%s: `%c' partition overlaps boot program%s: no default sector size%s: maximum file system size on the `%c' partition is %llu sectorswarning: changing optimization to space because minfree is less than %d%% setblock bad fs_frag %dclrblock bad fs_frag %disblock bad fs_frag %dwtfs: write error on block %lldrdfs: read error on block %lldcg 0: bad magic numberfirst cylinder group ran out of spaceinternal error: can't find block in cyl 0ilog2: %d is not a power of 2 fsinit: inode value %llu out of rangeinode table does not fit in cylinder grouppanic: cylinder group too big: %d > %dpreposterous size %lld, max is %dpreposterous size %lld, max is %lldblock size must be a power of 2, not %dfragment size must be a power of 2, not %dfragment size %d is too small, minimum is %lldblock size %d is too small, minimum is %dblock size %d is too large, maximum is %dblock size (%d) cannot be smaller than fragment size (%d)fragment size %d is too small, minimum with block size %d is %ddensity reduced from %d to %d bytes per inodecan't honour -c: minimum is %dfile system size %jd < minimum size of %d fragmentsreduced number of fragments per cylinder group from %d to %d to enlarge last cylinder groupcalloc failed%s: %.1fMB in %jd sectors of %lld bytes %d cylinder groups of %.2fMB, %d blocks, %d inodes each can't get physmemwarning: fsck_ffs will need %lluMB; min(MAXDSIZ,physmem) is %lluMBsuper-block backups (for fsck -b #) at:cannot allocate I/O bufferfsinit1 failedfsinit2 failed%s: initializing cg %ld/%d checkrm_overwriteusage: %s [-dfiPRr] file ... "." and ".." may not be removedremove %s? override %s%s%s/%s for %s? %s (inode %llu): not overwritten due to multiple links%s: malloc%s: is a directorydfiPRrusage: %s [-t] device usage: %s [-f device] command [count] %d: unknown tape drive type %s tape drive, residual=%d erblocksize: %d (%d) density: %d (%d) ioctl MTIOCGETf:no remote support%s: unknown command%s: illegal countbsfbsrdensityeomfsffsrofflinerewindrewofflretensionweofWriteProtectMounted76543210usage: %s [-p] [-m mode] directory ... m:p\ can not be used as a string delimiternewline can not be used as a string delimiterwhitespace after %sundefined label '%s'RE error: %sunterminated regular expressionexpected context addressunexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandfilename expectedw commandread commandbranchempty labelduplicate label '%s'substitute pattern can not be delimited by newline or backslashunterminated substitute pattern123456789\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expressionmore than one number or 'g' in substitute flagsnumber in substitute flags out of rangeno wfile specifiedbad flag in substitute command: '%c'transform pattern can not be delimited by newline or backslashunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthextra text at the end of a transform commandunused label '%s' ..."usage: sed [-aEnru] command [file ...] sed [-aEnru] [-e command] [-f command_file] [file ...] Eae:f:nrustdout: %ssed: %lu: %s: first RE may not be empty\ %03o\%d not defined in the RE\abfrtv! h< 4 Ĺ4 ' (? , 8 @ H d4 L: P' \' hh tD0 |  7 c_umaskd] h A l\m pN x$A N V \C O  A O L ĉ^ ̉$K ԉ\U ܉\ 4W \m  A q P K A ,A -a-b-c-d -e-f-G-g-h -H -k-L -n-O-o-p -r-s-S -t-u-w-x-z===!=<>-eq-ne-gt-ge-lt -le!-ef"-nt#-ot$؊TXttfcds̋lmnLpx_modex_search_histkb_addx_bindx_emacs  ̲ 4L H X d0 |P    ȍ ЍP Ll ة x >= &= ^= |= <<>><=>=<>&& || */%+-&^|? , ~!():hist_initj_print| $doppromptyylexIFS= ${PS2=> } ${PS3=#? } ${PS4=+ }țԒěgmatchgetoptions a,8c@L\edlxiklXdomC4nfܖbĞu̞؞prs8shv0$4xdo_phys_pathshf_vfprintf8    k   (0@`$4{ }T8<@DHL ]]<>!let||&&()str_valxp "   | ȥХإ|@(#)PD KSH v5.2.14 99/07/13.2 AAA  Q AA A QBafree: %p not present in area %punable to allocate memorylmmissing options argumentmissing name argument%s: is not an identifierc_getopts: no argvarguments changed since last callOPTARGbad signal `%s'ls:usage: kill [-s signame | -signum | -signame] { job | pid | pgrp } ... kill -l [exit_status ...] %s: arguments must be jobs or process IDs%*d %*s %s%*d %*d %sjob control not enabled%%lpnzno argumentsadtdprtUxalias: -r flag can only be used with -t and without arguments alias %s alias not found L#R#UZ#fi#lprtuxonly -t, -u and -x options may be used with -ffunction %s %T %s() %T %s: not identifiertypeset -i -x -r -t -L%d -R%d -Z -l -u -U exportreadonly%s[%d]pvpvV is a reserved wordexported is an %salias for alias %s= is an exported traced undefined (autoload from %s) function special is a%s shell builtin is a tracked %salias for not found%s is *GOK*Rnprsu,-n-p: %s-u: %s: %sLPcan't get current directory - %srestricted shell - can't cdPWDOLDPWDno home directory (HOME not set)no OLDPWDdon't know current directoryCDPATH%s: bad directory+alias+cd+command*=export+fc+getopts+jobs+killletpwd*=readonly=typeset+unaliaswhence+bg+fgunalias-tacan't suspend a login shellinvalid file modeusage: mknod [-m mode] name b|c major minorusage: mknod [-m mode] name ptime: -%s unknown optiontime: -%s requires an argument:p%s%*lld.%02ld%s%s%*lldm%lld.%02lds%sreal real user sys user system fv%s is read only%s: cannot %s%s: can only %s %d level(s)%s: bad numberugorwx%#3.3o augo=+-rwxugoXsbad masktrap -- bad signal %sprsu,nothing to shift*=.*=:[*=break=builtin*=continue*=eval*=exec*=exit+false*=return*=set*=shift=times*=trap+=wait+readtest+trueulimit+umask*=unsetsuspendmissing closing parenmissing argumentexpression expectedmissing second argumentmissing expression operatorunexpected operator/operandinternal error: unknown opmissing ]-t-aunlimited unlimitedinvalid limit: %s-%c exceeds allowable limitbad -%c limit: %susage: ulimit [-acdfHlmnpSst] [value]ulimit: %c%-20s time(cpu-seconds)file(blocks)coredump(blocks)data(kbytes)stack(kbytes)lockedmem(kbytes)memory(kbytes)nofiles(descriptors)IFS"#$&'()*:;<=>?[\]`{|};|&()`+@!fileglob: substitute errorFPATH nothing to yank yank something first I-search: duplicate binding for %sPOSIX%s = %s %s = '%s' cannot bind, not a ttyauto-insert%s: no such functioninvalid return codebeginning-of-historycomplete-commandcomplete-filecompletedelete-char-backwarddelete-word-backwarddelete-char-forwarddelete-word-forwardkill-lineredrawend-of-historyeot-or-deletegoto-historymacro-stringkill-to-eolkill-regionlist-commandlist-filequoteyank-popbackward-charbeginning-of-linebackward-wordend-of-lineforward-charforward-wordnewlinedown-historynewline-and-nextno-opup-historyprev-hist-wordsearch-character-forwardsearch-character-backwardsearch-historyset-mark-commandstuffstuff-resettranspose-charsexchange-point-and-markcomplete-listexpand-filecapitalize-worddowncase-wordupcase-wordset-argcomment*+?@! substituteexpand(NULL)%Rfunny $() command: %s%s: cannot open $(<) input%s: parameter not set%S%s: bad substitutionparameter null or not set%*d) %sdbteste_error: %s (offset %d)shcomexec: %shere document missingcan't %s temporary file %s: %sherein: yylexerror writing %s: %sPS4%s%s %s: restricteddupcannot %s %s: %scould not finish (dup) redirection %s: %scoprocess already existsPS3EXECSHELL%s: %s: %sbuiltin: %s: not a builtincommand -p: restricted%s: can't find function definition file - %s%s: can't find function definition file%s: can't open function definition file %s - %s%s: function not defined by %sCFUNC %d%s: cannot execute - %s-rend of expression%s: unexpected `%s'%s: bad number `%s'%s: expression recurses on parameter `%s'%s: %s requires lvalue%s: %s applied to read only variablemissing )zero divisormissing :HISTFILE%s.%dno history (yet)%s: not in history%s: invalid rangehistory functions not available-%c%se:glnrs0,1,2,3,4,5,6,7,8,9,can't use -e, -l, -n, -r with -s (-e -)substitution failedcan't use -l, -n with -e-16%.*s cannot create temp file %s - %serror writing temporary file - %s${FCEDIT:-/bin/ed} $_cannot open temp file %serror reading temp file %s - %sno coprocess%s/shXXXXXXXXbad file descriptorfd not open for readingfd not open for writingillegal file descriptor name%s[%d]: internal error: shl_stdout not validtoo many files open in shellcan't create pipe - try again RunningDoneDone (%d)[%d] %c %5d (core dumped)%s%s %-20s %s%s%s%s%5d %-20s %s%s %s%sremove_job: job not found (%s)notifyj_async: job not startedj_async: bad nzombie (%d)zombiejobsstopped and runningYou have %s%s%s jobs j_waitj: tcsetpgrp(%d, %d) failed: %sjob not job-controlled[%d] | 1st tcsetpgrp(%d, %d) failed: %sfg: 2nd tcsetpgrp(%d, %d) failed: %scannot continue job %s: %sjw:resumejw:waitforwaitlast: no last jobwaitlast: not startedjw:waitlastexchild: XPIPEI and no last_job - pid %dfork failedcannot fork - try againchildexchild: execute() returned[%d]jw:last procj_init: getpgrp() failed: %sj_init: tcgetpgrp() failed: %sj_init: setpgid() failed: %sj_init: tcsetpgrp() failed: %swarning: won't have full job controlj_suspend: tcsetpgrp() failed: %sj_suspend: setpgid() failed: %scheck_job: job started (flags 0x%x)checkjobno such jobambiguousargument must be %job or process id%a %b %d%l:%M:%S%r~/%sPS1\$PS2missing ] no closing quote here document `%s' unclosed MAILyou have mail in $_shell: %dUse `exit' to leave ksh include: %drshrkshrpdkshpdrkshSH_VERSIONPPIDUSER$ -c requires an argumentCannot determine current working directory/etc/profile$HOME/.profile/etc/suid_profileENVtypesetKSH_VERSION-xOPTIND=1evaltypeset -i RANDOM MAILCHECK="${MAILCHECK-600}" SECONDS="${SECONDS-0}" TMOUT="${TMOUT-0}"hash=alias -ttype=whence -vstop=kill -STOPautoload=typeset -fufunctions=typeset -fhistory=fc -linteger=typeset -inohup=nohup local=typesetr=fc -e -login=exec login-tUccmailmakeprviwho |&;<>()*@#!$-? =-+?#% "#$&'()*;<>?[\`|0123456789ABCDEF%-*s%*s'\'%s%s-%c: unknown option%s%s-`%c' requires argument%-*s %sA:o;sCurrent option settings -o %s%s: bad optionparse_args: `%c'allexportbraceexpandbgnicecsh-historyemacs-usemetaerrexitgmacsignoreeofinteractivekeywordloginmarkdirsnoclobbernoglobnohupnolognounsetphysicalposixprivilegedtrackallverbosevirawvi-show8vi-tabcompletevi-esccompletextracealnumalphablankcntrldigitgraphlowerpunctupperxdigitshf_flush: no fdshf_emptybuf: no fdshf_write: flags %xshf_write: nbytes %dshf_putchar: flags %xshf_putchar: no fd0123456789abcdef(null %s)shf_ungetc: flags %xshf_fillbuf: no fdshf_getchar: flags %xshf_getse: flags %xshf_read: flags %xshf_read: bsize %dshf_sopen: flags 0x%xshf_snprintf: buf %lx, bsize %dshf_reopen: missing read/writeshf_reopen: bad shf/buf/bsizeshf_fdopen: missing read/writeunmatchedsyntax error: unexpected EOF ?%dsyntax error: `%s' %s unexpectedtoo many <<'s too many redirections for%s: bad identifier %s: invalid function name thenelseelifficaseesacwhileuntildo{[[&&||;;((|&too many varssetexecsig: unset signal %d(%s)ERRError handlerEXITtimed out waiting for inputSIGwdscan: unknown char 0x%x (carrying on)%S #no-vars# #no-args# ( %T) %T| %T%;%T%s %T %S ]] select %s for %s in %;do%N%T%;done case %S in%N(%S%c%;%T%N;;%Nesac if %Tthen%N%Telif %Telse%;%T%;fi %s %T%;do{%;%T%;} %T|& %T& function %s %T%s() %Ttime %T< <<- << >> >| <> <&>&No controlling tty (open /dev/tty: %s)Can't find tty file descriptorj_ttyinit: dup of tty fd failed: %sj_ttyinit: can't set close-on-exec flag: %s%0*s%.*s%*s%.*s%s: subscript %ld out of range%s: is read onlysetstr: %s=%s: assigning to self0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789abcdefghijklmnopqrstuvwxyzOPTINDPOSIXLY_CORRECTHISTSIZEMAILCHECKMAILPATHRANDOMSECONDSTMOUTLINENOM-grabhist: bad history arrayy$%s %dfc -e ${VISUAL:-${EDITOR:-vi}} --derive_key_pkcsbio_diskinqbio_createflagsbio_parse_devlistbio_changepassbio_deleteraidbio_createraidbio_blinkbio_getvolbynamebio_alarmbio_inqstr2locatorbio_setblinkbio_setstatemainInvalid keyInvalid saltToo few rounds: %dcan't specify passphrase file during initial creation of crypto volumeinvalid passphrase filecan't stat passphrase filepassphrase file must be owned by rootpassphrase file has the wrong permissionscan't read passphrase fileinvalid passphrase lengthunable to read passphraseRe-type passphrase: Passphrases did not matchpbkdf2 failedinvalid KDF infoinvalid KDF hintKDF hint has invalid sizeunknown KDF type %dnumber of KDF rounds too low: %dDIOCINQ%s: <%s, %s, %s>, serial %s invalid flags listinvalid flag %sinvalid device listcould not open %scould not stat %stoo many devices on device listduplicate device in listNew passphrase: unknown errorBIOCDISCIPLINEOld passphrase: BIOCDELETERAIDno devices specifiednot enough memory for dev_t listunsupported raid levelnot enough disksnot exactly one partitionioctlPassphrase: BIOCCREATERAID/dev/bioCan't locate %s device via %sBIOCBLINKBIOCINQBIOCVOLinvalid alarm function: %sBIOCALARMalarm is currently %s %-11s %-10s %14s %-8s VolumeStatusSizeDevice %d%% done %u secondsScrubbingInvalidOnlineOfflineDegradedBuildingRebuildWTWB%s %u%14llu%11s %-10s %14s %-7s CRYPTO%s%s %11s %-10s %14s %-7s CONCAT%s%s %11s %-10s %14s %-7s RAID%u%s%s %s BIOCDISKFailedHot spareUnused %3u%14skey disk%u:%u.%unoenclunknown serial%11s %-10s %14s %-7s %-6s <%s> %11s %-10s %14s %-7s %-6s '%s' target not specifiedTarget %s: %sDisk %s is not in an enclosureDisk %s does not existinvalid device %sBIOCSETSTATEusage: %s [-hiqv] [-a alarm-function] [-b channel:target[.lun]] [-H channel:target[.lun]] [-R device | channel:target[.lun]] [-u channel:target[.lun]] device %s [-dhiPqsv] [-C flag[,flag,...]] [-c raidlevel] [-k keydisk] [-l special[,special,...]] [-O device | channel:target[.lun]] [-p passfile] [-R device | channel:target[.lun]] [-r rounds] device Invalid RAID levelNumber of rounds is %s: %sa:b:C:c:dH:hik:l:O:Pp:qr:R:svu:need deviceneed -c parameterneed -l parametermust use bio deviceusage: %s seconds do_movemainusage: %s [-fi] source target %s [-fi] source ... directory /bin/cp-PRp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status/bin/rm-rf%s: remove%s: set owner/group; not setting setuid/setgid%s: set owner/group%s: set mode%s: set flags%s: set timesrename %s to %scannot resolve %scannot rename a mount pointcan't remove %s%s: destination pathname too longeval5syntax error|&=<>+-*/%:()non-numeric argumentdivision by zerousage: %s [-M core] [-N system] M:N:sysctl: KERN_MSGBUFSIZEcouldn't allocate space for buffer datasysctl: KERN_MSGBUFmainusage: %s [-s] [name-of-host] sethostnamegethostname/etc/networks"(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDlɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~[/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxqg jgrn<:ORQhك[0.0.0.0127.0.0.1::::1/etc/group/etc/spwd.db/etc/pwd.db/etc/ethers%02x:%02x:%02x:%02x:%02x:%02x  0123456789ABCDEF0123456789abcdefnanNANinfINF(null)bug in vfprintf: bad base HOSTALIASES/etc/hosts;#nameserverlookupypsearchinet4ndots:RES_OPTIONSoptions LOCALDOMAINsearch lookup bind filenameserver 127.0.0.1ASR_CONFIGlookup file %d.%d.%d.%d.in-addr.arpa.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.ip6.arpa.no spacebad domain namedomain name too longbad dlen@BKMGTPE0B%lld%c%lld.%1lld%cimsg_readmsgbuf_write/dev/diskmap%s%s%s%c%s%s%shmac_sha1pkcs5_pbkdf2logout/var/run/utmplogin_protect%s: %s: %m/etc/fbtab/*%s: chmod(%s): %m%s: chown(%s): %m%s: opendir(%s): %m%o%s: bad entry: %s\\#readlabelfsLLLLLLLȞLLLLLLL %sr%s%s: not a device node%s: couldn't read disklabel%s: bad filesystem type in labellogwtmp/var/log/wtmp5MS7) OOPStgetentTERMCAP/usr/share/misc/termcapTERMPATH.termcap /usr/share/misc/termcapinet_net_ptoninet_net_pton_ipv401234567890123456789abcdef/usr/src/lib/libc/net/inet_net_pton.cn >= 0 && n <= 15n >= 0 && n <= 9assertion "%s" failed: file "%s", line %d, function "%s" assertion "%s" failed: file "%s", line %d inet_pton01234567890123456789ABCDEF0123456789abcdefinet_ntop4inet_ntop%u.%u.%u.%u|b0b1ncdtscsbpxbxfxoxtxdxgetentcgetnext%s.dbtc|:InfinityNaNlongjmp botch. s$SHA256EndSHA256DataSHA256FileChunk0123456789abcdefPOSIX_V6_ILP32_OFFBIGPOSIX_V7_ILP32_OFFBIG-lpthreadasprintfܾ^[Yy]^[Nn]yes646NONEUTF8 P`|0Pl (D\xRPC: (unknown error code)RPC: Port mapper failure%s: %s - %s RPC: Remote system error; errno = %s; low version = %u, high version = %u; why = (unknown authentication error - %d); s1 = %u, s2 = %uRPC: SuccessRPC: Can't encode argumentsRPC: Can't decode resultRPC: Unable to sendRPC: Unable to receiveRPC: Timed outRPC: Incompatible versions of RPCRPC: Authentication errorRPC: Program unavailableRPC: Program/version mismatchRPC: Procedure unavailableRPC: Server can't decode argumentsRPC: Unknown hostRPC: Program not registeredRPC: Failed (unspecified error)RPC: Unknown protocolAuthentication OKInvalid client credentialServer rejected credentialInvalid client verifierServer rejected verifierClient credential too weakInvalid server verifierFailed (unspecified error)[:<:]][:>:]]ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ !"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789ABCDEFabcdefNULSOHSTXETXEOTENQBELalertBSbackspaceHTtabLFVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBIS4IS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoponetwothreefourfivesixseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDELregerrorREG_0x%xREG_NOMATCHregexec() failed to matchREG_BADPATinvalid regular expressionREG_ECOLLATEinvalid collating elementREG_ECTYPEinvalid character classREG_EESCAPEREG_ESUBREGinvalid backreference numberREG_EBRACKbrackets ([ ]) not balancedREG_EPARENparentheses not balancedREG_EBRACEbraces not balancedREG_BADBRinvalid repetition count(s)REG_ERANGEinvalid character rangeREG_ESPACEREG_BADRPTrepetition-operator operand invalidREG_EMPTYempty (sub)expressionREG_ASSERT"can't happen" -- you found a bugREG_INVARGinvalid argument to regex routine*** unknown regexp error code ***SHA512EndSHA512DataSHA512FileChunk0123456789abcdefclnttcp_create: out of memory xdrrec_create: out of memory BLOCKSIZE%s: unknown blocksizemaximum blocksize is %dG%s: minimum blocksize is 512%ld%s-blocksttyname_r/var/run/dev.db/etc/ttyssecurertsctssoftcarwindow%h %e %T MD5PadؗҜ<3#I9=D2[%Cod(hinityan0123456789abcdefglob2ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/readpassphrase  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~tcsetattrt,8DPh|(@Tht,8DPh|(@ThSignal 0HangupInterruptQuitIllegal instructionTrace/BPT trapAbort trapEMT trapFloating point exceptionKilledBus errorSegmentation faultBad system callBroken pipeAlarm clockTerminatedUrgent I/O conditionSuspended (signal)SuspendedContinuedChild exitedStopped (tty input)Stopped (tty output)I/O possibleCputime limit exceededFilesize limit exceededVirtual timer expiredProfiling timer expiredWindow size changesInformation requestUser defined signal 1User defined signal 2Thread AST/etc/protocolst8<@DLTX\dhpt|,HHUPINTILLTRAPABRTEMTFPEKILLBUSSEGVSYSPIPEALRMURGTSTPCONTCHLDTTINTTOUIOXCPUXFSZVTALRMPROFWINCHUSR1USR2THRexecvpeexeclpexecleexeclexecvp: : path too long unknown option -- %coption requires an argument -- %cambiguous option -- %.*soption doesn't take an argument -- %.*soption requires an argument -- %sunknown option -- %sfstabscanxxsw "`"too small (4@HTdl ,nosappndnosappendnoarchnoarchivednoschgnoschangenosimmutablenouappndnouappendnouchgnouchangenouimmutablenodumpnoopaque<@DHxLPTXx%m/%d/%y%Y-%m-%d%H:%M%I:%M:%S %p%H:%M:%SESTCSTMSTPSTEDTCDTMDTPDT  $(08@LX`lptx|| 0$SunMonTueWedThuFriSatSundayMondayTuesdayWednesdayThursdayFridaySaturdayJanFebMarAprMayJunJulAugSepOctNovDecJanuaryFebruaryMarchAprilJuneJulyAugustSeptemberOctoberNovemberDecemberAMPM%a %b %e %H:%M:%S %Y  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~authunix_createauthunix_create_defaultauth_none.c - Fatal marshalling problemauthunix_create: out of memory perrorxdr_array: out of memory argument buffer overflowunknown/invalid errorno errorinvalid value for ai_flagsname or service is not knowntemporary failure in name resolutionnon-recoverable failure in name resolutionno address associated with nameai_family not supportedai_socktype not supportedservice not supported for ai_socktypeaddress family for name not supportedmemory allocation failureinvalid value for hintsresolved protocol is unknownrealpath%u.%u.%u.%uinet6_rth_reverseSHA1TransformSHA1Pad/etc/services,/ ((((( AAAAAABBBBBB __stack_smash_handlerstack overflow in function %sconnectlog_r__vsyslog_r/dev/log_rsyslog%s: unknown facility/priority: %x<%d>[%ld]Error %dlibcUnknown signal: Unknown error: _catopenNLSPATH/usr/share/nls/%L/%N.cat:/usr/share/nls/%l.%c/%N.cat:/usr/share/nls/%l/%N.catLC_ALLLC_MESSAGESLANG$<Phd(<`p 0H,X|0Dd|0P`x,Pt  0D\ D\p0LUndefined error: 0Operation not permittedNo such file or directoryNo such processInterrupted system callInput/output errorDevice not configuredArgument list too longExec format errorBad file descriptorNo child processesResource deadlock avoidedPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkOperation not supported by deviceNot a directoryIs a directoryInvalid argumentToo many open files in systemToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksNumerical argument out of domainResult too largeResource temporarily unavailableOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not availableProtocol not supportedSocket type not supportedOperation not supportedProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceOperation timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downNo route to hostDirectory not emptyToo many processesToo many usersDisk quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticatorIPsec processing failureAttribute not foundIllegal byte sequenceNo medium foundWrong medium typeValue too large to be stored in data typeOperation canceledIdentifier removedNo message of desired typeNot supportedt,8DPh|(@Thvsnprintf<clntudp_callclntudp_create: out of memory bindresvport_saxdr_string: out of memory xdr_bytes: out of memory isatty !#&(*-/14LLLLLLLLLABCDEF7yACnF?O8M20HwZ~???>ccpp `8 ǃx8 089 pp<cc8` a`p ǃ0 009 0`<cg8` q`` FLJ0 009 8|cf0`8  p089 `f?0?  ?8 `f0   8 `f 1   8 `f 1`İ   08 8 `8 q`8  088 0` `qxp ap8p  008 pp ~??>?~?> 0 4f xǎv|w0xxD\1``bˌ  .&Ș|`` 00( r @ t `"b`11F0 ~sLJ;??~~c   @@? `mF8|x`a1C  mv<88J|LJϜm~|8Z cc `Ș F@F R#cHX $|B b#c0`Ș ,FF gό9>|a`G8p 9>Xa@@@x"" e j    ky ( JKYdu f    bv z!w" (F2R r u'g <<p%[)]*())* * ){{}}{}(())()[[]][]#$G>> P30123456789.=:f/?/*?*n+n,N-N.&7m'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !+ Hh VqQ:q:QZZ    l h b  w  i x X      0  $  k  j  is not a regular file (use -f to see it) is a directory@@apܖbp@̊$DBp܊dcpԊdpA (ep@\pfpFpĘgp4`hpipԙ jp4DJp!ĊTtKp LpԚmp ,np"Њ8PdppH0Pp0qprp"@sp!Sp!Ȝup" ؜ Vphwp"8\xp(ȝԝXpAyp؊(@zpd|"p~p!Ȋ̞?p#ppA p4Xp|... (interrupt to abort) (press RETURN)ċh444 Ȏмظ11"t €u6Uu|agPtPS[X!Using drive X, partition YMBR on floppy or old BIOS Read error No O/S No active partition OxUkԍ$P,T\dHk8@d\D̍Xč00l8@ L9@X8 A0B-CD@EPF`GpHU eVabLoceLfhiLlnqqrsvw$x0uptdit     uL`Xkhwdodti !li"# $%& ^'j()$*,+4,@-H.L/T0X1d2l30485x6LHp$Tt priorityrttvarrttssthreshsendpiperecvpipeexpirehopcountmtuUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CLONING XRESOLVE LLINFO STATIC BLACKHOLEPROTO3PROTO2PROTO1CLONEDSOURCEMPATHMPLSUPBROADCASTDEBUGLOOPBACKPTPNOTRAILERSRUNNINGNOARP PPROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD SRC SRCMASK LABEL<NOOP ",4<7DL( 0(EHC P E(  0(EHDHC`;HL; ... ...(P(P(P(Qy <HTX`ljt|@ȟ@@@%s: can't read disk label; disk type must be specified......ToXo\o@do   holopoxooLooToo{}abcdDgGhHilnNpPqrs tw xy !:#=))d PțԒЛțܛ;țМ0țМTiP`pԜTiБ,d$H,s040<EDELETF\(FdPFlxFdFtFhF|G@GU _ xx:xx:xx:xx:xx:xx0000000000000000 8@DLTD\dlt|88@`  kh̾RuneCT10NONEBBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~<DLT\dldt h@|(  0ydyzxzly{zx}z$<LDLLLTPL\ LdtLlLdLtPLhtL||LLL`!          (,048<@DHLPTX \`dhlpth x!"#$%&'()*+,$-,-<.D.//Ա0P1T2X3`4h5p6t7|89:;<=>?@[\\]0^<^P_\_h`x{{|}}~ <Lht;   4@ \h ' L@48@d\455<EDELETF\(FdPFlxFdFtFhF|G@G\^?LGMT\ 0\DhTUpTT+hTUpTT, hTUpTT.\D\-`))4),d) 32$3,343659t9$98d8t88778$98d8t887t $cP$T$.shstrtab.init.text.fini.rodata.openbsd.randomdata.data.eh_frame.jcr.gotpad0.got.ctors.dtors.gotpad1.bss.stack.arm.atpcs.note.openbsd.ident pp $$g%(w(w9,w,wS?<<I@@NDJWDJD$\hJhcpJpjxJs`xTT . ..chownzdhclient=z disklabelzdmesgzfdiskzfsck>z fsck_ext2fsfsck_ffs=zifconfig=zinit>zmknodzmountz mount_cd96602< mount_ext2fs2< mount_ffsz mount_msdos mount_nfsznewfsz newfs_msdosping>zping6zreboothalt>zroutezrtsolzumountsysctlbioctl#ttyU*} o=$(alph2d $U) M ttyU$U c 68 $o 660 dialer uucp M cuaU$U c 68 $(($o+128)) 660 dialer uucp ;; wsmux|wsmouse|wskbd) M wsmouse c 63 0 600 M wskbd c 63 1 600 ;; wsmouse[0-9]*) M wsmouse$U c 62 $U 600 ;; wskbd[0-9]*) M wskbd$U c 61 $U 600 ;; wscons) R wsmouse0 wsmouse1 wsmouse2 wsmouse3 wskbd0 wskbd1 wskbd2 R wskbd3 wsmux ttyCcfg ttyC0 ttyC1 ttyC2 ttyC3 ttyC4 ttyC5 R ttyC6 ttyC7 ttyC8 ttyC9 ttyCa ttyCb ;; tty[C-J]*) U=${i##tty[C-J]} case $i in ttyC*) n=C m=0;; ttyD*) n=D m=256;; ttyE*) n=E m=512;; ttyF*) n=F m=768;; ttyG*) n=G m=1024;; ttyH*) n=H m=1280;; ttyI*) n=I m=1536;; ttyJ*) n=J m=1792;; esac case $U in [0-9a-f]) M tty$n$U c 60 $((16#$U+$m)) 600;; cfg) M tty${n}cfg c 60 $((255+$m)) 600;; *) echo bad unit $U for $i; exit 1;; esac ;; pty*) if [ $U -gt 15 ]; then echo bad unit for pty in: $i continue fi set -A letters p q r s t u v w x y z P Q R S T set -A suffixes 0 1 2 3 4 5 6 7 8 9 a b c d e f g h i j k l m n o p q \ r s t u v w x y z A B C D E F G H I J K L M N O P Q R S T U V W X \ Y Z name=${letters[$U]} n=0 while [ $n -lt 62 ] do nam=$name${suffixes[$n]} off=$(($U*62)) M tty$nam c 4 $(($off+$n)) M pty$nam c 5 $(($off+$n)) n=$(($n+1)) done ;; ptm) M ptm c 98 0 666 ;; tty[0-7][0-9a-f]) U=${i#tty*} o=$(h2d $U) M tty$U c 12 $o 660 dialer uucp M cua$U c 12 $(($o+128)) 660 dialer uucp ;; st*) n=$(($U*16)) for pre in " " n e en do M ${pre}st$U b 25 $n 660 operator M ${pre}rst$U c 25 $n 660 operator n=$(($n+1)) done ;; vnd*) dodisk vnd $U 19 19 $U 0 ;; rd*) dodisk2 rd $U 18 18 $U 0 ;; ch*) M ch$U c 27 $U 660 operator ;; cd*) dodisk2 cd $U 26 26 $U 0 ;; local) test -s $T.local && sh $T.local ;; all) R bthub0 bthub1 bthub2 vnd0 vnd1 vnd2 vnd3 sd0 sd1 sd2 sd3 R sd4 sd5 sd6 sd7 sd8 sd9 cd0 cd1 rd0 tun0 tun1 tun2 tun3 bpf0 R bpf1 bpf2 bpf3 bpf4 bpf5 bpf6 bpf7 bpf8 bpf9 pty0 bio R diskmap vscsi0 ch0 audio0 audio1 audio2 fuse pppx hotplug R ptm local wscons uall rmidi0 rmidi1 rmidi2 rmidi3 rmidi4 R rmidi5 rmidi6 rmidi7 tuner0 radio0 video0 video1 uk0 random R lkm tty00 tty01 tty02 tty03 tty04 tty05 tty06 tty07 tty08 R tty09 tty0a tty0b apm crypto pf systrace wd0 wd1 wd2 wd3 std R st0 st1 fd ;; wd*|sd*) case $i in wd*) dodisk wd $U 16 16 $U 0;; sd*) dodisk sd $U 24 24 $U 0;; esac ;; *) echo $i: unknown device ;; esac done } R "$@" { echo -n ${RMlist[*]} echo -n ${mklist[*]} echo -n ${MKlist[*]} echo -n ${whlist[*]} echo ${oplist[*]} } | if [ "$eo" = "echo" ]; then cat else sh fi #!/bin/sh - PATH=/sbin:/usr/sbin:/bin:/usr/bin T=$0 [ "$eo" ] || eo= hex() { case $1 in [0-9]) echo -n $1;; 10) echo -n a;; 11) echo -n b;; 12) echo -n c;; 13) echo -n d;; 14) echo -n e;; 15) echo -n f;; esac } alph2d() { local t="$1" local p="0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ" local sub=${p%${t}*} echo ${#sub} } h2d() { local s="$1" local f=${s%*[0-9a-f]} n=${s#[0-9a-f]*} echo $(($(_h2d $f)*16+ $(_h2d $n) )) } _h2d() { case $1 in [0-9]) echo -n $1;; a) echo -n 10;; b) echo -n 11;; c) echo -n 12;; d) echo -n 13;; e) echo -n 14;; f) echo -n 15;; esac } unt() { arg="$1" tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" while [ "$tmp" != "$arg" ] do arg=$tmp tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" done echo $arg } dodisk() { [ "$DEBUG" ] && set -x n=$(($((${5}*${7:-16}))+${6})) count=0 [ 0$7 -ne 8 ] && l="i j k l m n o p" for d in a b c d e f g h $l do M $1$2$d b $3 $(($n+$count)) 640 operator M r$1$2$d c $4 $(($n+$count)) 640 operator let count=count+1 done } dodisk2() { n=$(($(($5*${7:-16}))+$6)) M $1$2a b $3 $n 640 operator M r$1$2a c $4 $n 640 operator n=$(($n+2)) M $1$2c b $3 $n 640 operator M r$1$2c c $4 $n 640 operator } RMlist[0]="rm -f" mkl() { mklist[${#mklist[*]}]=";mknod -m $1 $2 $3 $4 $5" } M() { RMlist[${#RMlist[*]}]=$1 mkl ${5-666} $1 $2 $3 $4 G=${6:-wheel} [ "$7" ] && { MKlist[${#MKlist[*]}]="&& chown $7:$G $1" } || { case $G in wheel) [ ${#whlist[*]} = 0 ] && whlist[0]="&& chgrp wheel" whlist[${#whlist[*]}]="$1" ;; operator) [ ${#oplist[*]} = 0 ] && oplist[0]="&& chgrp operator" oplist[${#oplist[*]}]="$1" ;; *) MKlist[${#MKlist[*]}]="&& chgrp $G $1"; esac } return 0 } R() { [ "$DEBUG" ] && set -x for i in "$@" do U=`unt $i` [ "$U" ] || U=0 case $i in ramdisk) R std bpf0 wd0 wd1 sd0 tty00 rd0 wsmouse R st0 ttyC0 wskbd0 apm bio diskmap random ;; std) M console c 0 0 600 M tty c 1 0 M mem c 2 0 640 kmem M kmem c 2 1 640 kmem M null c 2 2 M zero c 2 12 M stdin c 7 0 M stdout c 7 1 M stderr c 7 2 M ksyms c 8 0 640 kmem M klog c 6 0 600 ;; vscsi*) M vscsi$U c 100 $U 600 ;; video*) M video$U c 38 $U MKlist[${#MKlist[*]}]=";[ -e video ] || ln -s video$U video" ;; uk*) M uk$U c 28 $U 640 operator ;; tuner*) M tuner$U c 75 $(($(($U*2))+16)) 644 ;; tun*) M tun$U c 33 $U 600 ;; systrace) M systrace c 50 0 644 ;; rmidi*) M rmidi$U c 57 $U 666 ;; *random) n=0 for pre in " " s u a do M ${pre}random c 40 $n 644 n=$(($n+1)) done ;; radio*) M radio$U c 97 $U MKlist[${#MKlist[*]}]=";[ -e radio ] || ln -s radio$U radio" ;; pppx*) M pppx$U c 103 $U 600 ;; pf*) M pf c 46 0 600 ;; lkm) M lkm c 35 0 640 _lkm ;; hotplug) M hotplug c 37 $U 400 ;; fuse) M fuse$U c 77 $U 600 ;; fd) RMlist[${#RMlist[*]}]=";mkdir -p fd;rm -f" n=0 while [ $n -lt 64 ];do M fd/$n c 7 $n;n=$(($n+1));done MKlist[${#MKlist[*]}]=";chmod 555 fd" ;; diskmap) M diskmap c 102 0 640 operator ;; crypto) M crypto c 47 0 ;; bthub*) M bthub$U c 101 $U ;; bpf*) M bpf$U c 22 $U 600 ;; bktr*) M bktr$U c 75 $U 644 ;; bio) M bio c 52 0 600 ;; audio*) M sound$U c 36 $U M mixer$U c 36 $(($U+16)) M audio$U c 36 $(($U+128)) M audioctl$U c 36 $(($U+192)) MKlist[${#MKlist[*]}]=";[ -e audio ] || ln -s audio$U audio" MKlist[${#MKlist[*]}]=";[ -e mixer ] || ln -s mixer$U mixer" MKlist[${#MKlist[*]}]=";[ -e sound ] || ln -s sound$U sound" MKlist[${#MKlist[*]}]=";[ -e audioctl ] || ln -s audioctl$U audioctl" ;; apm*) M apm c 34 0 644 M apmctl c 34 8 644 ;; usb*) [ "$i" = "usb" ] && u= || u=$U M usb$u c 64 $U 660 ;; urio*) M urio$U c 67 $U 660 ;; ulpt*) M ulpt$U c 66 $U 660 ;; uhid*) M uhid$U c 65 $U 660 ;; ugen*) n=$(($U*16)) for j in 0{0,1,2,3,4,5,6,7,8,9} 1{0,1,2,3,4,5} do M ugen$U.$j c 70 $(($n+10#$j)) 660 done ;; uall) R ttyU0 ttyU1 ttyU2 ttyU3 ugen0 ugen1 ugen2 ugen3 ugen4 ugen5 R ugen6 ugen7 ulpt0 ulpt1 uhid0 uhid1 uhid2 uhid3 urio0 usb0 R usb1 usb2 usb3 usb4 usb5 usb6 usb7 ;; ttyU[0-9a-zA-Z]) U=${i@ . ..GMAKEDEVHconsoleI ttyJ memKkmemLnullMzeroNstdinOstdoutPstderrQksymsRklogSbpf0Twd0aUrwd0aVwd0bWrwd0bXwd0cYrwd0cZwd0d[rwd0d\wd0e]rwd0e^wd0f_rwd0f`wd0garwd0gbwd0hcrwd0hdwd0ierwd0ifwd0jgrwd0jhwd0kirwd0kjwd0lkrwd0llwd0mmrwd0mnwd0norwd0npwd0oqrwd0orwd0psrwd0ptwd1aurwd1avwd1bwrwd1bxwd1cyrwd1czwd1d{rwd1d|wd1e}rwd1e~wd1frwd1fǀwd1gǁrwd1gǂwd1hǃrwd1hDŽwd1iDžrwd1idžwd1jLJrwd1jLjwd1kljrwd1kNJwd1lNjrwd1lnjwd1mǍrwd1mǎwd1nǏrwd1nǐwd1oǑrwd1oǒwd1pǓrwd1pǔsd0aǕrsd0aǖsd0bǗrsd0bǘsd0cǙrsd0cǚsd0dǛrsd0dǜsd0eǝrsd0eǞsd0fǟrsd0fǠsd0gǡrsd0gǢsd0hǣrsd0hǤsd0iǥrsd0iǦsd0jǧrsd0jǨsd0kǩrsd0kǪsd0lǫrsd0lǬsd0mǭrsd0mǮsd0nǯrsd0nǰsd0oDZrsd0oDzsd0pdzrsd0pǴtty00ǵcua00Ƕrd0aǷrrd0aǸrd0cǹrrd0cǺwsmousewskbdǼ st0rst0Ǿnst0ǿnrst0est0erst0enst0enrst0ttyC0wskbd0 apmapmctl biodiskmaprandomsrandomurandomarandom dumb|80-column dumb tty:\ :am:\ :co#80:\ :bl=^G:cr=^M:do=^J:sf=^J: vt100|vt100-am|dec vt100 (w/advanced video):\ :5i:am:bs:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :@8=\EOM:DO=\E[%dB:K1=\EOq:K2=\EOr:K3=\EOs:K4=\EOp:K5=\EOn:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:as=^N:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:do=^J:\ :eA=\E(B\E)0:ho=\E[H:k0=\EOy:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\EOt:k6=\EOu:k7=\EOv:k8=\EOl:k9=\EOw:k;=\EOx:\ :kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:l1=pf1:l2=pf2:l3=pf3:l4=pf4:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[0m:mr=\E[7m:nd=\E[C:pf=\E[4i:po=\E[5i:\ :ps=\E[0i:rc=\E8:rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :..sa=\E[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t\016%e\017%;$<2>:\ :sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: vt220|vt200|dec vt220:\ :5i:am:bs:mi:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :%0=\E[29~:%1=\E[28~:*6=\E[4~:@0=\E[1~:AL=\E[%dL:\ :DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:F1=\E[23~:F2=\E[24~:\ :F3=\E[25~:F4=\E[26~:F7=\E[31~:F8=\E[32~:F9=\E[33~:\ :FA=\E[34~:IC=\E[%d@:LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:\ :SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:eA=\E)0:ec=\E[%dX:ei=\E[4l:\ :ho=\E[H:if=/usr/share/tabset/vt100:im=\E[4h:\ :is=\E[?7h\E[>\E[?1h\E F\E[?4l:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k6=\E[17~:k7=\E[18~:k8=\E[19~:k9=\E[20~:\ :k;=\E[21~:kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=^H:kd=\E[B:\ :kl=\E[D:kr=\E[C:ku=\E[A:l1=pf1:l2=pf2:l3=pf3:l4=pf4:le=^H:\ :mb=\E[5m:md=\E[1m:me=\E[0m:mr=\E[7m:nd=\E[C:nw=\EE:\ :pf=\E[4i:po=\E[5i:ps=\E[i:r1=\E[?3l:rc=\E8:sc=\E7:\ :se=\E[27m:sf=\ED:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[24m:\ :up=\E[A:us=\E[4m:vb=\E[?5h\E[?5l: / right/Indian/Antananarivo right/Indian/Chagos right/Indian/Christmas right/Indian/Cocos right/Indian/Comoro right/Indian/Kerguelen right/Indian/Mahe right/Indian/Maldives right/Indian/Mauritius right/Indian/Mayotte right/Indian/Reunion right/Iran right/Israel right/Jamaica right/Japan right/Kwajalein right/Libya right/MET right/MST right/MST7MDT right/Mexico/ right/Mexico/BajaNorte right/Mexico/BajaSur right/Mexico/General right/Mideast/ right/Mideast/Riyadh87 right/Mideast/Riyadh88 right/Mideast/Riyadh89 right/NZ right/NZ-CHAT right/Navajo right/PRC right/PST8PDT right/Pacific/ right/Pacific/Apia right/Pacific/Auckland right/Pacific/Chatham right/Pacific/Chuuk right/Pacific/Easter right/Pacific/Efate right/Pacific/Enderbury right/Pacific/Fakaofo right/Pacific/Fiji right/Pacific/Funafuti right/Pacific/Galapagos right/Pacific/Gambier right/Pacific/Guadalcanal right/Pacific/Guam right/Pacific/Honolulu right/Pacific/Johnston right/Pacific/Kiritimati right/Pacific/Kosrae right/Pacific/Kwajalein right/Pacific/Majuro right/Pacific/Marquesas right/Pacific/Midway right/Pacific/Nauru right/Pacific/Niue right/Pacific/Norfolk right/Pacific/Noumea right/Pacific/Pago_Pago right/Pacific/Palau right/Pacific/Pitcairn right/Pacific/Pohnpei right/Pacific/Ponape right/Pacific/Port_Moresby right/Pacific/Rarotonga right/Pacific/Saipan right/Pacific/Samoa right/Pacific/Tahiti right/Pacific/Tarawa right/Pacific/Tongatapu right/Pacific/Truk right/Pacific/Wake right/Pacific/Wallis right/Pacific/Yap right/Poland right/Portugal right/ROC right/ROK right/Singapore right/Turkey right/UCT right/US/ right/US/Alaska right/US/Aleutian right/US/Arizona right/US/Central right/US/East-Indiana right/US/Eastern right/US/Hawaii right/US/Indiana-Starke right/US/Michigan right/US/Mountain right/US/Pacific right/US/Pacific-New right/US/Samoa right/UTC right/Universal right/W-SU right/WET right/Zulu Africa/ Africa/Abidjan Africa/Accra Africa/Addis_Ababa Africa/Algiers Africa/Asmara Africa/Asmera Africa/Bamako Africa/Bangui Africa/Banjul Africa/Bissau Africa/Blantyre Africa/Brazzaville Africa/Bujumbura Africa/Cairo Africa/Casablanca Africa/Ceuta Africa/Conakry Africa/Dakar Africa/Dar_es_Salaam Africa/Djibouti Africa/Douala Africa/El_Aaiun Africa/Freetown Africa/Gaborone Africa/Harare Africa/Johannesburg Africa/Juba Africa/Kampala Africa/Khartoum Africa/Kigali Africa/Kinshasa Africa/Lagos Africa/Libreville Africa/Lome Africa/Luanda Africa/Lubumbashi Africa/Lusaka Africa/Malabo Africa/Maputo Africa/Maseru Africa/Mbabane Africa/Mogadishu Africa/Monrovia Africa/Nairobi Africa/Ndjamena Africa/Niamey Africa/Nouakchott Africa/Ouagadougou Africa/Porto-Novo Africa/Sao_Tome Africa/Timbuktu Africa/Tripoli Africa/Tunis Africa/Windhoek America/ America/Adak America/Anchorage America/Anguilla America/Antigua America/Araguaina America/Argentina/ America/Argentina/Buenos_Aires America/Argentina/Catamarca America/Argentina/ComodRivadavia America/Argentina/Cordoba America/Argentina/Jujuy America/Argentina/La_Rioja America/Argentina/Mendoza America/Argentina/Rio_Gallegos America/Argentina/Salta America/Argentina/San_Juan America/Argentina/San_Luis America/Argentina/Tucuman America/Argentina/Ushuaia America/Aruba America/Asuncion America/Atikokan America/Atka America/Bahia America/Bahia_Banderas America/Barbados America/Belem America/Belize America/Blanc-Sablon America/Boa_Vista America/Bogota America/Boise America/Buenos_Aires America/Cambridge_Bay America/Campo_Grande America/Cancun America/Caracas America/Catamarca America/Cayenne America/Cayman America/Chicago America/Chihuahua America/Coral_Harbour America/Cordoba America/Costa_Rica America/Creston America/Cuiaba America/Curacao America/Danmarkshavn America/Dawson America/Dawson_Creek America/Denver America/Detroit America/Dominica America/Edmonton America/Eirunepe America/El_Salvador America/Ensenada America/Fort_Wayne America/Fortaleza America/Glace_Bay America/Godthab America/Goose_Bay America/Grand_Turk America/Grenada America/Guadeloupe America/Guatemala America/Guayaquil America/Guyana America/Halifax America/Havana America/Hermosillo America/Indiana/ America/Indiana/Indianapolis America/Indiana/Knox America/Indiana/Marengo America/Indiana/Petersburg America/Indiana/Tell_City America/Indiana/Vevay America/Indiana/Vincennes America/Indiana/Winamac America/Indianapolis America/Inuvik America/Iqaluit America/Jamaica America/Jujuy America/Juneau America/Kentucky/ America/Kentucky/Louisville America/Kentucky/Monticello America/Knox_IN America/Kralendijk America/La_Paz America/Lima America/Los_Angeles America/Louisville America/Lower_Princes America/Maceio America/Managua America/Manaus America/Marigot America/Martinique America/Matamoros America/Mazatlan America/Mendoza America/Menominee America/Merida America/Metlakatla America/Mexico_City America/Miquelon America/Moncton America/Monterrey America/Montevideo America/Montreal America/Montserrat America/Nassau America/New_York America/Nipigon America/Nome America/Noronha America/North_Dakota/ America/North_Dakota/Beulah America/North_Dakota/Center America/North_Dakota/New_Salem America/Ojinaga America/Panama America/Pangnirtung America/Paramaribo America/Phoenix America/Port-au-Prince America/Port_of_Spain America/Porto_Acre America/Porto_Velho America/Puerto_Rico America/Rainy_River America/Rankin_Inlet America/Recife America/Regina America/Resolute America/Rio_Branco America/Rosario America/Santa_Isabel America/Santarem America/Santiago America/Santo_Domingo America/Sao_Paulo America/Scoresbysund America/Shiprock America/Sitka America/St_Barthelemy America/St_Johns America/St_Kitts America/St_Lucia America/St_Thomas America/St_Vincent America/Swift_Current America/Tegucigalpa America/Thule America/Thunder_Bay America/Tijuana America/Toronto America/Tortola America/Vancouver America/Virgin America/Whitehorse America/Winnipeg America/Yakutat America/Yellowknife Antarctica/ Antarctica/Casey Antarctica/Davis Antarctica/DumontDUrville Antarctica/Macquarie Antarctica/Mawson Antarctica/McMurdo Antarctica/Palmer Antarctica/Rothera Antarctica/South_Pole Antarctica/Syowa Antarctica/Vostok Arctic/ Arctic/Longyearbyen Asia/ Asia/Aden Asia/Almaty Asia/Amman Asia/Anadyr Asia/Aqtau Asia/Aqtobe Asia/Ashgabat Asia/Ashkhabad Asia/Baghdad Asia/Bahrain Asia/Baku Asia/Bangkok Asia/Beirut Asia/Bishkek Asia/Brunei Asia/Calcutta Asia/Choibalsan Asia/Chongqing Asia/Chungking Asia/Colombo Asia/Dacca Asia/Damascus Asia/Dhaka Asia/Dili Asia/Dubai Asia/Dushanbe Asia/Gaza Asia/Harbin Asia/Hebron Asia/Ho_Chi_Minh Asia/Hong_Kong Asia/Hovd Asia/Irkutsk Asia/Istanbul Asia/Jakarta Asia/Jayapura Asia/Jerusalem Asia/Kabul Asia/Kamchatka Asia/Karachi Asia/Kashgar Asia/Kathmandu Asia/Katmandu Asia/Khandyga Asia/Kolkata Asia/Krasnoyarsk Asia/Kuala_Lumpur Asia/Kuching Asia/Kuwait Asia/Macao Asia/Macau Asia/Magadan Asia/Makassar Asia/Manila Asia/Muscat Asia/Nicosia Asia/Novokuznetsk Asia/Novosibirsk Asia/Omsk Asia/Oral Asia/Phnom_Penh Asia/Pontianak Asia/Pyongyang Asia/Qatar Asia/Qyzylorda Asia/Rangoon Asia/Riyadh Asia/Riyadh87 Asia/Riyadh88 Asia/Riyadh89 Asia/Saigon Asia/Sakhalin Asia/Samarkand Asia/Seoul Asia/Shanghai Asia/Singapore Asia/Taipei Asia/Tashkent Asia/Tbilisi Asia/Tehran Asia/Tel_Aviv Asia/Thimbu Asia/Thimphu Asia/Tokyo Asia/Ujung_Pandang Asia/Ulaanbaatar Asia/Ulan_Bator Asia/Urumqi Asia/Ust-Nera Asia/Vientiane Asia/Vladivostok Asia/Yakutsk Asia/Yekaterinburg Asia/Yerevan Atlantic/ Atlantic/Azores Atlantic/Bermuda Atlantic/Canary Atlantic/Cape_Verde Atlantic/Faeroe Atlantic/Faroe Atlantic/Jan_Mayen Atlantic/Madeira Atlantic/Reykjavik Atlantic/South_Georgia Atlantic/St_Helena Atlantic/Stanley Australia/ Australia/ACT Australia/Adelaide Australia/Brisbane Australia/Broken_Hill Australia/Canberra Australia/Currie Australia/Darwin Australia/Eucla Australia/Hobart Australia/LHI Australia/Lindeman Australia/Lord_Howe Australia/Melbourne Australia/NSW Australia/North Australia/Perth Australia/Queensland Australia/South Australia/Sydney Australia/Tasmania Australia/Victoria Australia/West Australia/Yancowinna Brazil/ Brazil/Acre Brazil/DeNoronha Brazil/East Brazil/West CET CST6CDT Canada/ Canada/Atlantic Canada/Central Canada/East-Saskatchewan Canada/Eastern Canada/Mountain Canada/Newfoundland Canada/Pacific Canada/Saskatchewan Canada/Yukon Chile/ Chile/Continental Chile/EasterIsland Cuba EET EST EST5EDT Egypt Eire Etc/ Etc/GMT Etc/GMT+0 Etc/GMT+1 Etc/GMT+10 Etc/GMT+11 Etc/GMT+12 Etc/GMT+2 Etc/GMT+3 Etc/GMT+4 Etc/GMT+5 Etc/GMT+6 Etc/GMT+7 Etc/GMT+8 Etc/GMT+9 Etc/GMT-0 Etc/GMT-1 Etc/GMT-10 Etc/GMT-11 Etc/GMT-12 Etc/GMT-13 Etc/GMT-14 Etc/GMT-2 Etc/GMT-3 Etc/GMT-4 Etc/GMT-5 Etc/GMT-6 Etc/GMT-7 Etc/GMT-8 Etc/GMT-9 Etc/GMT0 Etc/Greenwich Etc/UCT Etc/UTC Etc/Universal Etc/Zulu Europe/ Europe/Amsterdam Europe/Andorra Europe/Athens Europe/Belfast Europe/Belgrade Europe/Berlin Europe/Bratislava Europe/Brussels Europe/Bucharest Europe/Budapest Europe/Busingen Europe/Chisinau Europe/Copenhagen Europe/Dublin Europe/Gibraltar Europe/Guernsey Europe/Helsinki Europe/Isle_of_Man Europe/Istanbul Europe/Jersey Europe/Kaliningrad Europe/Kiev Europe/Lisbon Europe/Ljubljana Europe/London Europe/Luxembourg Europe/Madrid Europe/Malta Europe/Mariehamn Europe/Minsk Europe/Monaco Europe/Moscow Europe/Nicosia Europe/Oslo Europe/Paris Europe/Podgorica Europe/Prague Europe/Riga Europe/Rome Europe/Samara Europe/San_Marino Europe/Sarajevo Europe/Simferopol Europe/Skopje Europe/Sofia Europe/Stockholm Europe/Tallinn Europe/Tirane Europe/Tiraspol Europe/Uzhgorod Europe/Vaduz Europe/Vatican Europe/Vienna Europe/Vilnius Europe/Volgograd Europe/Warsaw Europe/Zagreb Europe/Zaporozhye Europe/Zurich Factory GB GB-Eire GMT GMT+0 GMT-0 GMT0 Greenwich HST Hongkong Iceland Indian/ Indian/Antananarivo Indian/Chagos Indian/Christmas Indian/Cocos Indian/Comoro Indian/Kerguelen Indian/Mahe Indian/Maldives Indian/Mauritius Indian/Mayotte Indian/Reunion Iran Israel Jamaica Japan Kwajalein Libya MET MST MST7MDT Mexico/ Mexico/BajaNorte Mexico/BajaSur Mexico/General Mideast/ Mideast/Riyadh87 Mideast/Riyadh88 Mideast/Riyadh89 NZ NZ-CHAT Navajo PRC PST8PDT Pacific/ Pacific/Apia Pacific/Auckland Pacific/Chatham Pacific/Chuuk Pacific/Easter Pacific/Efate Pacific/Enderbury Pacific/Fakaofo Pacific/Fiji Pacific/Funafuti Pacific/Galapagos Pacific/Gambier Pacific/Guadalcanal Pacific/Guam Pacific/Honolulu Pacific/Johnston Pacific/Kiritimati Pacific/Kosrae Pacific/Kwajalein Pacific/Majuro Pacific/Marquesas Pacific/Midway Pacific/Nauru Pacific/Niue Pacific/Norfolk Pacific/Noumea Pacific/Pago_Pago Pacific/Palau Pacific/Pitcairn Pacific/Pohnpei Pacific/Ponape Pacific/Port_Moresby Pacific/Rarotonga Pacific/Saipan Pacific/Samoa Pacific/Tahiti Pacific/Tarawa Pacific/Tongatapu Pacific/Truk Pacific/Wake Pacific/Wallis Pacific/Yap Poland Portugal ROC ROK Singapore Turkey UCT US/ US/Alaska US/Aleutian US/Arizona US/Central US/East-Indiana US/Eastern US/Hawaii US/Indiana-Starke US/Michigan US/Mountain US/Pacific US/Pacific-New US/Samoa UTC Universal W-SU WET Zulu posix/ posix/Africa/ posix/Africa/Abidjan posix/Africa/Accra posix/Africa/Addis_Ababa posix/Africa/Algiers posix/Africa/Asmara posix/Africa/Asmera posix/Africa/Bamako posix/Africa/Bangui posix/Africa/Banjul posix/Africa/Bissau posix/Africa/Blantyre posix/Africa/Brazzaville posix/Africa/Bujumbura posix/Africa/Cairo posix/Africa/Casablanca posix/Africa/Ceuta posix/Africa/Conakry posix/Africa/Dakar posix/Africa/Dar_es_Salaam posix/Africa/Djibouti posix/Africa/Douala posix/Africa/El_Aaiun posix/Africa/Freetown posix/Africa/Gaborone posix/Africa/Harare posix/Africa/Johannesburg posix/Africa/Juba posix/Africa/Kampala posix/Africa/Khartoum posix/Africa/Kigali posix/Africa/Kinshasa posix/Africa/Lagos posix/Africa/Libreville posix/Africa/Lome posix/Africa/Luanda posix/Africa/Lubumbashi posix/Africa/Lusaka posix/Africa/Malabo posix/Africa/Maputo posix/Africa/Maseru posix/Africa/Mbabane posix/Africa/Mogadishu posix/Africa/Monrovia posix/Africa/Nairobi posix/Africa/Ndjamena posix/Africa/Niamey posix/Africa/Nouakchott posix/Africa/Ouagadougou posix/Africa/Porto-Novo posix/Africa/Sao_Tome posix/Africa/Timbuktu posix/Africa/Tripoli posix/Africa/Tunis posix/Africa/Windhoek posix/America/ posix/America/Adak posix/America/Anchorage posix/America/Anguilla posix/America/Antigua posix/America/Araguaina posix/America/Argentina/ posix/America/Argentina/Buenos_Aires posix/America/Argentina/Catamarca posix/America/Argentina/ComodRivadavia posix/America/Argentina/Cordoba posix/America/Argentina/Jujuy posix/America/Argentina/La_Rioja posix/America/Argentina/Mendoza posix/America/Argentina/Rio_Gallegos posix/America/Argentina/Salta posix/America/Argentina/San_Juan posix/America/Argentina/San_Luis posix/America/Argentina/Tucuman posix/America/Argentina/Ushuaia posix/America/Aruba posix/America/Asuncion posix/America/Atikokan posix/America/Atka posix/America/Bahia posix/America/Bahia_Banderas posix/America/Barbados posix/America/Belem posix/America/Belize posix/America/Blanc-Sablon posix/America/Boa_Vista posix/America/Bogota posix/America/Boise posix/America/Buenos_Aires posix/America/Cambridge_Bay posix/America/Campo_Grande posix/America/Cancun posix/America/Caracas posix/America/Catamarca posix/America/Cayenne posix/America/Cayman posix/America/Chicago posix/America/Chihuahua posix/America/Coral_Harbour posix/America/Cordoba posix/America/Costa_Rica posix/America/Creston posix/America/Cuiaba posix/America/Curacao posix/America/Danmarkshavn posix/America/Dawson posix/America/Dawson_Creek posix/America/Denver posix/America/Detroit posix/America/Dominica posix/America/Edmonton posix/America/Eirunepe posix/America/El_Salvador posix/America/Ensenada posix/America/Fort_Wayne posix/America/Fortaleza posix/America/Glace_Bay posix/America/Godthab posix/America/Goose_Bay posix/America/Grand_Turk posix/America/Grenada posix/America/Guadeloupe posix/America/Guatemala posix/America/Guayaquil posix/America/Guyana posix/America/Halifax posix/America/Havana posix/America/Hermosillo posix/America/Indiana/ posix/America/Indiana/Indianapolis posix/America/Indiana/Knox posix/America/Indiana/Marengo posix/America/Indiana/Petersburg posix/America/Indiana/Tell_City posix/America/Indiana/Vevay posix/America/Indiana/Vincennes posix/America/Indiana/Winamac posix/America/Indianapolis posix/America/Inuvik posix/America/Iqaluit posix/America/Jamaica posix/America/Jujuy posix/America/Juneau posix/America/Kentucky/ posix/America/Kentucky/Louisville posix/America/Kentucky/Monticello posix/America/Knox_IN posix/America/Kralendijk posix/America/La_Paz posix/America/Lima posix/America/Los_Angeles posix/America/Louisville posix/America/Lower_Princes posix/America/Maceio posix/America/Managua posix/America/Manaus posix/America/Marigot posix/America/Martinique posix/America/Matamoros posix/America/Mazatlan posix/America/Mendoza posix/America/Menominee posix/America/Merida posix/America/Metlakatla posix/America/Mexico_City posix/America/Miquelon posix/America/Moncton posix/America/Monterrey posix/America/Montevideo posix/America/Montreal posix/America/Montserrat posix/America/Nassau posix/America/New_York posix/America/Nipigon posix/America/Nome posix/America/Noronha posix/America/North_Dakota/ posix/America/North_Dakota/Beulah posix/America/North_Dakota/Center posix/America/North_Dakota/New_Salem posix/America/Ojinaga posix/America/Panama posix/America/Pangnirtung posix/America/Paramaribo posix/America/Phoenix posix/America/Port-au-Prince posix/America/Port_of_Spain posix/America/Porto_Acre posix/America/Porto_Velho posix/America/Puerto_Rico posix/America/Rainy_River posix/America/Rankin_Inlet posix/America/Recife posix/America/Regina posix/America/Resolute posix/America/Rio_Branco posix/America/Rosario posix/America/Santa_Isabel posix/America/Santarem posix/America/Santiago posix/America/Santo_Domingo posix/America/Sao_Paulo posix/America/Scoresbysund posix/America/Shiprock posix/America/Sitka posix/America/St_Barthelemy posix/America/St_Johns posix/America/St_Kitts posix/America/St_Lucia posix/America/St_Thomas posix/America/St_Vincent posix/America/Swift_Current posix/America/Tegucigalpa posix/America/Thule posix/America/Thunder_Bay posix/America/Tijuana posix/America/Toronto posix/America/Tortola posix/America/Vancouver posix/America/Virgin posix/America/Whitehorse posix/America/Winnipeg posix/America/Yakutat posix/America/Yellowknife posix/Antarctica/ posix/Antarctica/Casey posix/Antarctica/Davis posix/Antarctica/DumontDUrville posix/Antarctica/Macquarie posix/Antarctica/Mawson posix/Antarctica/McMurdo posix/Antarctica/Palmer posix/Antarctica/Rothera posix/Antarctica/South_Pole posix/Antarctica/Syowa posix/Antarctica/Vostok posix/Arctic/ posix/Arctic/Longyearbyen posix/Asia/ posix/Asia/Aden posix/Asia/Almaty posix/Asia/Amman posix/Asia/Anadyr posix/Asia/Aqtau posix/Asia/Aqtobe posix/Asia/Ashgabat posix/Asia/Ashkhabad posix/Asia/Baghdad posix/Asia/Bahrain posix/Asia/Baku posix/Asia/Bangkok posix/Asia/Beirut posix/Asia/Bishkek posix/Asia/Brunei posix/Asia/Calcutta posix/Asia/Choibalsan posix/Asia/Chongqing posix/Asia/Chungking posix/Asia/Colombo posix/Asia/Dacca posix/Asia/Damascus posix/Asia/Dhaka posix/Asia/Dili posix/Asia/Dubai posix/Asia/Dushanbe posix/Asia/Gaza posix/Asia/Harbin posix/Asia/Hebron posix/Asia/Ho_Chi_Minh posix/Asia/Hong_Kong posix/Asia/Hovd posix/Asia/Irkutsk posix/Asia/Istanbul posix/Asia/Jakarta posix/Asia/Jayapura posix/Asia/Jerusalem posix/Asia/Kabul posix/Asia/Kamchatka posix/Asia/Karachi posix/Asia/Kashgar posix/Asia/Kathmandu posix/Asia/Katmandu posix/Asia/Khandyga posix/Asia/Kolkata posix/Asia/Krasnoyarsk posix/Asia/Kuala_Lumpur posix/Asia/Kuching posix/Asia/Kuwait posix/Asia/Macao posix/Asia/Macau posix/Asia/Magadan posix/Asia/Makassar posix/Asia/Manila posix/Asia/Muscat posix/Asia/Nicosia posix/Asia/Novokuznetsk posix/Asia/Novosibirsk posix/Asia/Omsk posix/Asia/Oral posix/Asia/Phnom_Penh posix/Asia/Pontianak posix/Asia/Pyongyang posix/Asia/Qatar posix/Asia/Qyzylorda posix/Asia/Rangoon posix/Asia/Riyadh posix/Asia/Riyadh87 posix/Asia/Riyadh88 posix/Asia/Riyadh89 posix/Asia/Saigon posix/Asia/Sakhalin posix/Asia/Samarkand posix/Asia/Seoul posix/Asia/Shanghai posix/Asia/Singapore posix/Asia/Taipei posix/Asia/Tashkent posix/Asia/Tbilisi posix/Asia/Tehran posix/Asia/Tel_Aviv posix/Asia/Thimbu posix/Asia/Thimphu posix/Asia/Tokyo posix/Asia/Ujung_Pandang posix/Asia/Ulaanbaatar posix/Asia/Ulan_Bator posix/Asia/Urumqi posix/Asia/Ust-Nera posix/Asia/Vientiane posix/Asia/Vladivostok posix/Asia/Yakutsk posix/Asia/Yekaterinburg posix/Asia/Yerevan posix/Atlantic/ posix/Atlantic/Azores posix/Atlantic/Bermuda posix/Atlantic/Canary posix/Atlantic/Cape_Verde posix/Atlantic/Faeroe posix/Atlantic/Faroe posix/Atlantic/Jan_Mayen posix/Atlantic/Madeira posix/Atlantic/Reykjavik posix/Atlantic/South_Georgia posix/Atlantic/St_Helena posix/Atlantic/Stanley posix/Australia/ posix/Australia/ACT posix/Australia/Adelaide posix/Australia/Brisbane posix/Australia/Broken_Hill posix/Australia/Canberra posix/Australia/Currie posix/Australia/Darwin posix/Australia/Eucla posix/Australia/Hobart posix/Australia/LHI posix/Australia/Lindeman posix/Australia/Lord_Howe posix/Australia/Melbourne posix/Australia/NSW posix/Australia/North posix/Australia/Perth posix/Australia/Queensland posix/Australia/South posix/Australia/Sydney posix/Australia/Tasmania posix/Australia/Victoria posix/Australia/West posix/Australia/Yancowinna posix/Brazil/ posix/Brazil/Acre posix/Brazil/DeNoronha posix/Brazil/East posix/Brazil/West posix/CET posix/CST6CDT posix/Canada/ posix/Canada/Atlantic posix/Canada/Central posix/Canada/East-Saskatchewan posix/Canada/Eastern posix/Canada/Mountain posix/Canada/Newfoundland posix/Canada/Pacific posix/Canada/Saskatchewan posix/Canada/Yukon posix/Chile/ posix/Chile/Continental posix/Chile/EasterIsland posix/Cuba posix/EET posix/EST posix/EST5EDT posix/Egypt posix/Eire posix/Etc/ posix/Etc/GMT posix/Etc/GMT+0 posix/Etc/GMT+1 posix/Etc/GMT+10 posix/Etc/GMT+11 posix/Etc/GMT+12 posix/Etc/GMT+2 posix/Etc/GMT+3 posix/Etc/GMT+4 posix/Etc/GMT+5 posix/Etc/GMT+6 posix/Etc/GMT+7 posix/Etc/GMT+8 posix/Etc/GMT+9 posix/Etc/GMT-0 posix/Etc/GMT-1 posix/Etc/GMT-10 posix/Etc/GMT-11 posix/Etc/GMT-12 posix/Etc/GMT-13 posix/Etc/GMT-14 posix/Etc/GMT-2 posix/Etc/GMT-3 posix/Etc/GMT-4 posix/Etc/GMT-5 posix/Etc/GMT-6 posix/Etc/GMT-7 posix/Etc/GMT-8 posix/Etc/GMT-9 posix/Etc/GMT0 posix/Etc/Greenwich posix/Etc/UCT posix/Etc/UTC posix/Etc/Universal posix/Etc/Zulu posix/Europe/ posix/Europe/Amsterdam posix/Europe/Andorra posix/Europe/Athens posix/Europe/Belfast posix/Europe/Belgrade posix/Europe/Berlin posix/Europe/Bratislava posix/Europe/Brussels posix/Europe/Bucharest posix/Europe/Budapest posix/Europe/Busingen posix/Europe/Chisinau posix/Europe/Copenhagen posix/Europe/Dublin posix/Europe/Gibraltar posix/Europe/Guernsey posix/Europe/Helsinki posix/Europe/Isle_of_Man posix/Europe/Istanbul posix/Europe/Jersey posix/Europe/Kaliningrad posix/Europe/Kiev posix/Europe/Lisbon posix/Europe/Ljubljana posix/Europe/London posix/Europe/Luxembourg posix/Europe/Madrid posix/Europe/Malta posix/Europe/Mariehamn posix/Europe/Minsk posix/Europe/Monaco posix/Europe/Moscow posix/Europe/Nicosia posix/Europe/Oslo posix/Europe/Paris posix/Europe/Podgorica posix/Europe/Prague posix/Europe/Riga posix/Europe/Rome posix/Europe/Samara posix/Europe/San_Marino posix/Europe/Sarajevo posix/Europe/Simferopol posix/Europe/Skopje posix/Europe/Sofia posix/Europe/Stockholm posix/Europe/Tallinn posix/Europe/Tirane posix/Europe/Tiraspol posix/Europe/Uzhgorod posix/Europe/Vaduz posix/Europe/Vatican posix/Europe/Vienna posix/Europe/Vilnius posix/Europe/Volgograd posix/Europe/Warsaw posix/Europe/Zagreb posix/Europe/Zaporozhye posix/Europe/Zurich posix/Factory posix/GB posix/GB-Eire posix/GMT posix/GMT+0 posix/GMT-0 posix/GMT0 posix/Greenwich posix/HST posix/Hongkong posix/Iceland posix/Indian/ posix/Indian/Antananarivo posix/Indian/Chagos posix/Indian/Christmas posix/Indian/Cocos posix/Indian/Comoro posix/Indian/Kerguelen posix/Indian/Mahe posix/Indian/Maldives posix/Indian/Mauritius posix/Indian/Mayotte posix/Indian/Reunion posix/Iran posix/Israel posix/Jamaica posix/Japan posix/Kwajalein posix/Libya posix/MET posix/MST posix/MST7MDT posix/Mexico/ posix/Mexico/BajaNorte posix/Mexico/BajaSur posix/Mexico/General posix/Mideast/ posix/Mideast/Riyadh87 posix/Mideast/Riyadh88 posix/Mideast/Riyadh89 posix/NZ posix/NZ-CHAT posix/Navajo posix/PRC posix/PST8PDT posix/Pacific/ posix/Pacific/Apia posix/Pacific/Auckland posix/Pacific/Chatham posix/Pacific/Chuuk posix/Pacific/Easter posix/Pacific/Efate posix/Pacific/Enderbury posix/Pacific/Fakaofo posix/Pacific/Fiji posix/Pacific/Funafuti posix/Pacific/Galapagos posix/Pacific/Gambier posix/Pacific/Guadalcanal posix/Pacific/Guam posix/Pacific/Honolulu posix/Pacific/Johnston posix/Pacific/Kiritimati posix/Pacific/Kosrae posix/Pacific/Kwajalein posix/Pacific/Majuro posix/Pacific/Marquesas posix/Pacific/Midway posix/Pacific/Nauru posix/Pacific/Niue posix/Pacific/Norfolk posix/Pacific/Noumea posix/Pacific/Pago_Pago posix/Pacific/Palau posix/Pacific/Pitcairn posix/Pacific/Pohnpei posix/Pacific/Ponape posix/Pacific/Port_Moresby posix/Pacific/Rarotonga posix/Pacific/Saipan posix/Pacific/Samoa posix/Pacific/Tahiti posix/Pacific/Tarawa posix/Pacific/Tongatapu posix/Pacific/Truk posix/Pacific/Wake posix/Pacific/Wallis posix/Pacific/Yap posix/Poland posix/Portugal posix/ROC posix/ROK posix/Singapore posix/Turkey posix/UCT posix/US/ posix/US/Alaska posix/US/Aleutian posix/US/Arizona posix/US/Central posix/US/East-Indiana posix/US/Eastern posix/US/Hawaii posix/US/Indiana-Starke posix/US/Michigan posix/US/Mountain posix/US/Pacific posix/US/Pacific-New posix/US/Samoa posix/UTC posix/Universal posix/W-SU posix/WET posix/Zulu posixrules right/ right/Africa/ right/Africa/Abidjan right/Africa/Accra right/Africa/Addis_Ababa right/Africa/Algiers right/Africa/Asmara right/Africa/Asmera right/Africa/Bamako right/Africa/Bangui right/Africa/Banjul right/Africa/Bissau right/Africa/Blantyre right/Africa/Brazzaville right/Africa/Bujumbura right/Africa/Cairo right/Africa/Casablanca right/Africa/Ceuta right/Africa/Conakry right/Africa/Dakar right/Africa/Dar_es_Salaam right/Africa/Djibouti right/Africa/Douala right/Africa/El_Aaiun right/Africa/Freetown right/Africa/Gaborone right/Africa/Harare right/Africa/Johannesburg right/Africa/Juba right/Africa/Kampala right/Africa/Khartoum right/Africa/Kigali right/Africa/Kinshasa right/Africa/Lagos right/Africa/Libreville right/Africa/Lome right/Africa/Luanda right/Africa/Lubumbashi right/Africa/Lusaka right/Africa/Malabo right/Africa/Maputo right/Africa/Maseru right/Africa/Mbabane right/Africa/Mogadishu right/Africa/Monrovia right/Africa/Nairobi right/Africa/Ndjamena right/Africa/Niamey right/Africa/Nouakchott right/Africa/Ouagadougou right/Africa/Porto-Novo right/Africa/Sao_Tome right/Africa/Timbuktu right/Africa/Tripoli right/Africa/Tunis right/Africa/Windhoek right/America/ right/America/Adak right/America/Anchorage right/America/Anguilla right/America/Antigua right/America/Araguaina right/America/Argentina/ right/America/Argentina/Buenos_Aires right/America/Argentina/Catamarca right/America/Argentina/ComodRivadavia right/America/Argentina/Cordoba right/America/Argentina/Jujuy right/America/Argentina/La_Rioja right/America/Argentina/Mendoza right/America/Argentina/Rio_Gallegos right/America/Argentina/Salta right/America/Argentina/San_Juan right/America/Argentina/San_Luis right/America/Argentina/Tucuman right/America/Argentina/Ushuaia right/America/Aruba right/America/Asuncion right/America/Atikokan right/America/Atka right/America/Bahia right/America/Bahia_Banderas right/America/Barbados right/America/Belem right/America/Belize right/America/Blanc-Sablon right/America/Boa_Vista right/America/Bogota right/America/Boise right/America/Buenos_Aires right/America/Cambridge_Bay right/America/Campo_Grande right/America/Cancun right/America/Caracas right/America/Catamarca right/America/Cayenne right/America/Cayman right/America/Chicago right/America/Chihuahua right/America/Coral_Harbour right/America/Cordoba right/America/Costa_Rica right/America/Creston right/America/Cuiaba right/America/Curacao right/America/Danmarkshavn right/America/Dawson right/America/Dawson_Creek right/America/Denver right/America/Detroit right/America/Dominica right/America/Edmonton right/America/Eirunepe right/America/El_Salvador right/America/Ensenada right/America/Fort_Wayne right/America/Fortaleza right/America/Glace_Bay right/America/Godthab right/America/Goose_Bay right/America/Grand_Turk right/America/Grenada right/America/Guadeloupe right/America/Guatemala right/America/Guayaquil right/America/Guyana right/America/Halifax right/America/Havana right/America/Hermosillo right/America/Indiana/ right/America/Indiana/Indianapolis right/America/Indiana/Knox right/America/Indiana/Marengo right/America/Indiana/Petersburg right/America/Indiana/Tell_City right/America/Indiana/Vevay right/America/Indiana/Vincennes right/America/Indiana/Winamac right/America/Indianapolis right/America/Inuvik right/America/Iqaluit right/America/Jamaica right/America/Jujuy right/America/Juneau right/America/Kentucky/ right/America/Kentucky/Louisville right/America/Kentucky/Monticello right/America/Knox_IN right/America/Kralendijk right/America/La_Paz right/America/Lima right/America/Los_Angeles right/America/Louisville right/America/Lower_Princes right/America/Maceio right/America/Managua right/America/Manaus right/America/Marigot right/America/Martinique right/America/Matamoros right/America/Mazatlan right/America/Mendoza right/America/Menominee right/America/Merida right/America/Metlakatla right/America/Mexico_City right/America/Miquelon right/America/Moncton right/America/Monterrey right/America/Montevideo right/America/Montreal right/America/Montserrat right/America/Nassau right/America/New_York right/America/Nipigon right/America/Nome right/America/Noronha right/America/North_Dakota/ right/America/North_Dakota/Beulah right/America/North_Dakota/Center right/America/North_Dakota/New_Salem right/America/Ojinaga right/America/Panama right/America/Pangnirtung right/America/Paramaribo right/America/Phoenix right/America/Port-au-Prince right/America/Port_of_Spain right/America/Porto_Acre right/America/Porto_Velho right/America/Puerto_Rico right/America/Rainy_River right/America/Rankin_Inlet right/America/Recife right/America/Regina right/America/Resolute right/America/Rio_Branco right/America/Rosario right/America/Santa_Isabel right/America/Santarem right/America/Santiago right/America/Santo_Domingo right/America/Sao_Paulo right/America/Scoresbysund right/America/Shiprock right/America/Sitka right/America/St_Barthelemy right/America/St_Johns right/America/St_Kitts right/America/St_Lucia right/America/St_Thomas right/America/St_Vincent right/America/Swift_Current right/America/Tegucigalpa right/America/Thule right/America/Thunder_Bay right/America/Tijuana right/America/Toronto right/America/Tortola right/America/Vancouver right/America/Virgin right/America/Whitehorse right/America/Winnipeg right/America/Yakutat right/America/Yellowknife right/Antarctica/ right/Antarctica/Casey right/Antarctica/Davis right/Antarctica/DumontDUrville right/Antarctica/Macquarie right/Antarctica/Mawson right/Antarctica/McMurdo right/Antarctica/Palmer right/Antarctica/Rothera right/Antarctica/South_Pole right/Antarctica/Syowa right/Antarctica/Vostok right/Arctic/ right/Arctic/Longyearbyen right/Asia/ right/Asia/Aden right/Asia/Almaty right/Asia/Amman right/Asia/Anadyr right/Asia/Aqtau right/Asia/Aqtobe right/Asia/Ashgabat right/Asia/Ashkhabad right/Asia/Baghdad right/Asia/Bahrain right/Asia/Baku right/Asia/Bangkok right/Asia/Beirut right/Asia/Bishkek right/Asia/Brunei right/Asia/Calcutta right/Asia/Choibalsan right/Asia/Chongqing right/Asia/Chungking right/Asia/Colombo right/Asia/Dacca right/Asia/Damascus right/Asia/Dhaka right/Asia/Dili right/Asia/Dubai right/Asia/Dushanbe right/Asia/Gaza right/Asia/Harbin right/Asia/Hebron right/Asia/Ho_Chi_Minh right/Asia/Hong_Kong right/Asia/Hovd right/Asia/Irkutsk right/Asia/Istanbul right/Asia/Jakarta right/Asia/Jayapura right/Asia/Jerusalem right/Asia/Kabul right/Asia/Kamchatka right/Asia/Karachi right/Asia/Kashgar right/Asia/Kathmandu right/Asia/Katmandu right/Asia/Khandyga right/Asia/Kolkata right/Asia/Krasnoyarsk right/Asia/Kuala_Lumpur right/Asia/Kuching right/Asia/Kuwait right/Asia/Macao right/Asia/Macau right/Asia/Magadan right/Asia/Makassar right/Asia/Manila right/Asia/Muscat right/Asia/Nicosia right/Asia/Novokuznetsk right/Asia/Novosibirsk right/Asia/Omsk right/Asia/Oral right/Asia/Phnom_Penh right/Asia/Pontianak right/Asia/Pyongyang right/Asia/Qatar right/Asia/Qyzylorda right/Asia/Rangoon right/Asia/Riyadh right/Asia/Riyadh87 right/Asia/Riyadh88 right/Asia/Riyadh89 right/Asia/Saigon right/Asia/Sakhalin right/Asia/Samarkand right/Asia/Seoul right/Asia/Shanghai right/Asia/Singapore right/Asia/Taipei right/Asia/Tashkent right/Asia/Tbilisi right/Asia/Tehran right/Asia/Tel_Aviv right/Asia/Thimbu right/Asia/Thimphu right/Asia/Tokyo right/Asia/Ujung_Pandang right/Asia/Ulaanbaatar right/Asia/Ulan_Bator right/Asia/Urumqi right/Asia/Ust-Nera right/Asia/Vientiane right/Asia/Vladivostok right/Asia/Yakutsk right/Asia/Yekaterinburg right/Asia/Yerevan right/Atlantic/ right/Atlantic/Azores right/Atlantic/Bermuda right/Atlantic/Canary right/Atlantic/Cape_Verde right/Atlantic/Faeroe right/Atlantic/Faroe right/Atlantic/Jan_Mayen right/Atlantic/Madeira right/Atlantic/Reykjavik right/Atlantic/South_Georgia right/Atlantic/St_Helena right/Atlantic/Stanley right/Australia/ right/Australia/ACT right/Australia/Adelaide right/Australia/Brisbane right/Australia/Broken_Hill right/Australia/Canberra right/Australia/Currie right/Australia/Darwin right/Australia/Eucla right/Australia/Hobart right/Australia/LHI right/Australia/Lindeman right/Australia/Lord_Howe right/Australia/Melbourne right/Australia/NSW right/Australia/North right/Australia/Perth right/Australia/Queensland right/Australia/South right/Australia/Sydney right/Australia/Tasmania right/Australia/Victoria right/Australia/West right/Australia/Yancowinna right/Brazil/ right/Brazil/Acre right/Brazil/DeNoronha right/Brazil/East right/Brazil/West right/CET right/CST6CDT right/Canada/ right/Canada/Atlantic right/Canada/Central right/Canada/East-Saskatchewan right/Canada/Eastern right/Canada/Mountain right/Canada/Newfoundland right/Canada/Pacific right/Canada/Saskatchewan right/Canada/Yukon right/Chile/ right/Chile/Continental right/Chile/EasterIsland right/Cuba right/EET right/EST right/EST5EDT right/Egypt right/Eire right/Etc/ right/Etc/GMT right/Etc/GMT+0 right/Etc/GMT+1 right/Etc/GMT+10 right/Etc/GMT+11 right/Etc/GMT+12 right/Etc/GMT+2 right/Etc/GMT+3 right/Etc/GMT+4 right/Etc/GMT+5 right/Etc/GMT+6 right/Etc/GMT+7 right/Etc/GMT+8 right/Etc/GMT+9 right/Etc/GMT-0 right/Etc/GMT-1 right/Etc/GMT-10 right/Etc/GMT-11 right/Etc/GMT-12 right/Etc/GMT-13 right/Etc/GMT-14 right/Etc/GMT-2 right/Etc/GMT-3 right/Etc/GMT-4 right/Etc/GMT-5 right/Etc/GMT-6 right/Etc/GMT-7 right/Etc/GMT-8 right/Etc/GMT-9 right/Etc/GMT0 right/Etc/Greenwich right/Etc/UCT right/Etc/UTC right/Etc/Universal right/Etc/Zulu right/Europe/ right/Europe/Amsterdam right/Europe/Andorra right/Europe/Athens right/Europe/Belfast right/Europe/Belgrade right/Europe/Berlin right/Europe/Bratislava right/Europe/Brussels right/Europe/Bucharest right/Europe/Budapest right/Europe/Busingen right/Europe/Chisinau right/Europe/Copenhagen right/Europe/Dublin right/Europe/Gibraltar right/Europe/Guernsey right/Europe/Helsinki right/Europe/Isle_of_Man right/Europe/Istanbul right/Europe/Jersey right/Europe/Kaliningrad right/Europe/Kiev right/Europe/Lisbon right/Europe/Ljubljana right/Europe/London right/Europe/Luxembourg right/Europe/Madrid right/Europe/Malta right/Europe/Mariehamn right/Europe/Minsk right/Europe/Monaco right/Europe/Moscow right/Europe/Nicosia right/Europe/Oslo right/Europe/Paris right/Europe/Podgorica right/Europe/Prague right/Europe/Riga right/Europe/Rome right/Europe/Samara right/Europe/San_Marino right/Europe/Sarajevo right/Europe/Simferopol right/Europe/Skopje right/Europe/Sofia right/Europe/Stockholm right/Europe/Tallinn right/Europe/Tirane right/Europe/Tiraspol right/Europe/Uzhgorod right/Europe/Vaduz right/Europe/Vatican right/Europe/Vienna right/Europe/Vilnius right/Europe/Volgograd right/Europe/Warsaw right/Europe/Zagreb right/Europe/Zaporozhye right/Europe/Zurich right/Factory right/GB right/GB-Eire right/GMT right/GMT+0 right/GMT-0 right/GMT0 right/Greenwich right/HST right/Hongkong right/Iceland right/Indian 08`jlS<  jlSE`[~ [~jlS`@@<@TU lSvblSvvAmlS&6ulSGulSG`"AmlSǡmlSǡmlS_aeEAmlSatlS$44tlS$44byAmlSvX"mlSt,mlS؇>.c'!QXAmlSM%rlS&rlS&dPHGAmlS`*mlS؇>.mlS؇>.e^AmlSb7mlSb7mlSb7f%ztlSBQtlS1:tlS1:h5htlS$44tlSi4tlSi4gBtlSGM%tlS*tlSs,pxP)AtlS%tlS$B+tlS}+PPtlS~&tlS$B+tlS10jf-)tlSl.7tlS\_8tlS\_8k %mtlSh*:tlSZ;tlSZ;lulSulSulS/tmp/fstab.shadow!ulSSulSulS/tmp/resolv.conf.shadow(0 ulSGulSGulSG/tmp/hostsVo}icp )r!` 'I&ou>2/.[A*@߭P3:a{jubmB>aCAs\z~㠻K!&< .`(6L})2Q:F(N'4+ZfUuCQn[F<?]Z\N$'Nj8jDG޸*,o M۲RVH Zwc A@y ҭt6]hIL2;/'IZ3j@Qޭ׎ ] ]k7)/F*ǡB<JOj"'  xdqp╚'EHt|@50m"uBgնV/ē0 O¨Ypͱ/ skvsa/hm!)YO$ Z*&V.XTaNof;ue ݕ/v䭻/:IIRB`5_ &B/7;12S/8--p T˶D.s . .. pppfirmwarexsignifygroupx protocols-d<passwdtmpspwd.db services-asswd.origpwd.db fstabz resolv.conf hostsz ... . ..openbsd-55-base.pub . .. binCmdec]Dsbin]share . .. ftpgrep>zfgrepzegrepzgzip>zgunzipgzcatzless>zmore>z sedPsignify . ..Emisc]ƣkeymaps ...untrusted comment: openbsd 5.5 base public key RWRGy8gxk9N9314J0gh9U02lA7s8i6ITajJiNgxQOndvXvM5ZPX+nQ9h wheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root bin:*:7: news:*:8: wsrc:*:9: users:*:10: auth:*:11: games:*:13: staff:*:20:root smmsp:*:25: sshd:*:27: _portmap:*:28: _identd:*:29: _rstatd:*:30: guest:*:31:root _rusersd:*:32: _fingerd:*:33: _sshagnt:*:34: _x11:*:35: utmp:*:45: _lkm:*:61: _spamd:*:62: _radius:*:63: _token:*:64: _shadow:*:65: crontab:*:66: www:*:67: _isakmpd:*:68: network:*:69: named:*:70: proxy:*:71: authpf:*:72: _syslogd:*:73: _pflogd:*:74: _bgpd:*:75: _tcpdump:*:76: _dhcp:*:77: _mopd:*:78: _tftpd:*:79: _rbootd:*:80: _ppp:*:82: _ntp:*:83: _ftp:*:84: _ospfd:*:85: _hostapd:*:86: _dvmrpd:*:87: _ripd:*:88: _relayd:*:89: _ospf6d:*:90: _snmpd:*:91: _rtadvd:*:92: _ypldap:*:93: _smtpd:*:95: _rwalld:*:96: _nsd:*:97: _ldpd:*:98: _sndio:*:99: _ldapd:*:100: _iked:*:101: _iscsid:*:102: dialer:*:117: nogroup:*:32766: nobody:*:32767: root:*:0:0:Charlie &:/root:/bin/ksh daemon:*:1:1:The devil himself:/root:/sbin/nologin operator:*:2:5:System &:/operator:/sbin/nologin bin:*:3:7:Binaries Commands and Source:/:/sbin/nologin uucp:*:66:1:UNIX-to-UNIX Copy:/var/spool/uucppublic:/usr/libexec/uucp/uucico _dhcp:*:77:77:DHCP programs:/var/empty:/sbin/nologin nobody:*:32767:32767:Unprivileged user for NFS:/nonexistent:/sbin/nologin ip 0 IP icmp 1 ICMP tcp 6 TCP udp 17 UDP ftp-data 20/tcp ftp 21/tcp domain 53/tcp nameserver domain 53/udp nameserver www 80/tcp http nfsd 2049/udp nfs nfsd 2049/tcp nfs ed_keys fi if [[ -n "$_rootpass" ]]; then _encr=$(encr_pwd "$_rootpass") echo "1,s@^root::@root:${_encr}:@ w q" | ed /mnt/etc/master.passwd 2>/dev/null fi /mnt/usr/sbin/pwd_mkdb -p -d /mnt/etc /etc/master.passwd [[ -n "$rootkey" ]] && ( umask 077 mkdir /mnt/root/.ssh print -r -- "$rootkey" >> /mnt/root/.ssh/authorized_keys ) if grep -qs '^rtsol' /mnt/etc/hostname.*; then sed -e "/^#\(net\.inet6\.ip6\.accept_rtadv\)/s//\1/" \ -e "/^#\(net\.inet6\.icmp6\.rediraccept\)/s//\1/" \ /mnt/etc/sysctl.conf >/tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf fi finish_up bin*Binaries Commands and Source//sbin/nologin1binrdrrootdaemonCharlie &/root/bin/ksh2rootdaemonCharlie &/root/bin/ksh3MHdaemon*The devil himself/root/sbin/nologin2daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user for NFS/nonexistent/sbin/nologin1nobody f]\W operator*System &/operator/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Boperator*System &/operator/sbin/nologin3operator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/ksh1rootA<bin*Binaries Commands and Source//sbin/nologin2bin*Binaries Commands and Source//sbin/nologin3uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucpD6Duucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2_dhcp*MMDHCP programs/var/empty/sbin/nologin1_dhcp^P^_dhcp*MMDHCP programs/var/empty/sbin/nologin2_dhcp*MMDHCP programs/var/empty/sbin/nologin3M@2@nobody*Unprivileged user for NFS/nonexistent/sbin/nologin2nobody*Unprivileged user for NFS/nonexistent/sbin/nologin3a  n}bin*Binaries Commands and Source//sbin/nologin1binpbprootdaemonCharlie &/root/bin/kshs2rootdaemonCharlie &/root/bin/kshs3MHdaemon*The devil himself/root/sbin/nologin2daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user for NFS/nonexistent/sbin/nologin1nobody e\[V  operator*System &/operator/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Boperator*System &/operator/sbin/nologin3operator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/ksh1rootA<bin*Binaries Commands and Source//sbin/nologin2bin*Binaries Commands and Source//sbin/nologin3uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucpD6Duucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2_dhcp*MMDHCP programs/var/empty/sbin/nologin1_dhcp^P^_dhcp*MMDHCP programs/var/empty/sbin/nologin2_dhcp*MMDHCP programs/var/empty/sbin/nologin3M@2@nobody*Unprivileged user for NFS/nonexistent/sbin/nologin2nobody*Unprivileged user for NFS/nonexistent/sbin/nologin3a  n}#!/bin/ksh MODE=install . install.sub DISK= DISKS_DONE= _DKDEVS=$(get_dkdevs) _fsent= rm -f /tmp/fstab* ask_yn "Use DUIDs rather than device names in fstab?" yes [[ $resp == y ]] && FSTABFLAG=-F while :; do DISKS_DONE=$(addel "$DISK" $DISKS_DONE) _DKDEVS=$(rmel "$DISK" $_DKDEVS) if isin $ROOTDISK $_DKDEVS; then resp=$ROOTDISK rm -f /tmp/fstab else ask_which "disk" "do you wish to initialize" \ '$(l=$(get_dkdevs); for a in $DISKS_DONE; do l=$(rmel $a $l); done; bsort $l)' \ done [[ $resp == done ]] && break fi DISK=$resp makedev $DISK || continue rm -f /tmp/*.$DISK md_prep_disklabel $DISK || { DISK= ; continue ; } grep -qs " / ffs " /tmp/fstab.$ROOTDISK || { DISK= ; echo "'/' must be configured!" ; continue ; } if [[ -f /tmp/fstab.$DISK ]]; then while read _pp _mp _rest; do if [[ $_mp == none ]]; then echo "$_pp $_mp $_rest" >>/tmp/fstab continue fi [[ /tmp/fstab.$DISK == $(grep -l " $_mp " /tmp/fstab.*) ]] || { _rest=$DISK ; DISK= ; break ; } done /etc/fstab rm /tmp/fstab.$_rest set -- $(grep -h " $_mp " /tmp/fstab.*[0-9]) echo "$_pp and $1 can't both be mounted at $_mp." continue fi while read _pp _mp _fstype _rest; do [[ $_fstype == ffs ]] || continue _OPT= [[ $_mp == / ]] && _OPT=$MDROOTFSOPT newfs -q $_OPT ${_pp##/dev/} _fsent="$_fsent $_mp!$_pp" done >/tmp/fstab munge_fstab mount_fs "-o async" feed_random install_sets if [[ -z $TZ ]]; then (cd /mnt/usr/share/zoneinfo ls -1dF $(tar cvf /dev/null [A-Za-y]*) >/mnt/tmp/tzlist ) echo set_timezone /mnt/tmp/tzlist rm -f /mnt/tmp/tzlist fi if _time=$(ftp_time) && _now=$(date +%s) && (( _now - _time > 120 || _time - _now > 120 )); then _tz=/mnt/usr/share/zoneinfo/$TZ ask_yn "Time appears wrong. Set to '$(TZ=$_tz date -r "$(ftp_time)")'?" yes if [[ $resp == y ]]; then date $(date -r "$(ftp_time)" "+%Y%m%d%H%M.%S") >/dev/null fi fi if [[ -s $SERVERLISTALL ]]; then _i= [[ -n $installedfrom ]] && _i="install=$installedfrom" [[ -n $TZ ]] && _i="$_i&TZ=$TZ" [[ -n $method ]] && _i="$_i&method=$method" [[ -n $_i ]] && ftp -Vao - \ "http://129.128.5.191/cgi-bin/ftpinstall.cgi?$_i" >/dev/null 2>&1 & fi sed "/^console.*on.*secure.*$/s/std\.[0-9]*/std.$(stty speed /tmp/ttys mv /tmp/ttys /mnt/etc/ttys echo -n "Saving configuration files..." (cd /var/db; [[ -f dhclient.leases ]] && mv dhclient.leases /mnt/var/db/. ) hostname >/tmp/myname if [[ -f /tmp/hosts ]]; then _dn=$(get_fqdn) while read _addr _hn _aliases; do if [[ -n $_aliases || $_hn != ${_hn%%.*} || -z $_dn ]]; then echo "$_addr\t$_hn $_aliases" else echo "$_addr\t$_hn.$_dn $_hn" fi done >/mnt/etc/hosts rm /tmp/hosts fi _f=dhclient.conf [[ -f /tmp/$_f ]] && { cat /tmp/$_f >>/mnt/etc/$_f ; rm /tmp/$_f ; } (cd /tmp; for _f in fstab hostname* kbdtype my* ttys *.conf *.tail; do [[ -f $_f && -s $_f ]] && mv $_f /mnt/etc/. done) apply if [[ -n $user ]]; then _encr=$(encr_pwd "$userpass") _home=/home/$user uline="${user}:${_encr}:1000:1000:staff:0:0:${username}:$_home:/bin/ksh" echo "$uline" >> /mnt/etc/master.passwd echo "${user}:*:1000:" >> /mnt/etc/group echo ${user} > /mnt/root/.forward _home=/mnt$_home mkdir -p $_home (cd /mnt/etc/skel; cp -pR . $_home) (umask 077 && sed "s,^To: root\$,To: ${username} <${user}>," \ /mnt/var/mail/root > /mnt/var/mail/$user ) chown -R 1000:1000 $_home /mnt/var/mail/$user echo "1,s@wheel:.:0:root\$@wheel:\*:0:root,${user}@ w q" | ed /mnt/etc/group 2>/dev/null [[ -n "$userkey" ]] && print -r -- "$userkey" >> $_home/.ssh/authoriz usage() { echo "usage: ${0##*/} [-a] [-f filename]" >&2 exit 1 } auto=false respfile= while getopts "af:" opt; do case $opt in a) auto=true;; f) respfile=$OPTARG;; *) usage;; esac done shift $((OPTIND-1)) [ $# = 0 ] || usage . install.md set_term() { local _layouts export TERM=${TERM:-${MDTERM:-vt220}} if [[ -n $CONSOLE ]]; then ask "Terminal type?" $TERM export TERM=$resp else [[ -x /sbin/kbd ]] || return _layouts=$(bsort $(kbd -l | egrep -v "^(user|tables|encoding)")) while :; do ask "Choose your keyboard layout ('?' or 'L' for list)" "default" case $resp in "?"|L|l) echo "Available layouts: $_layouts";; default) return;; *) kbd $resp && { echo $resp >/tmp/kbdtype; return; };; esac done fi } stripcom () { local _l [[ -f $1 ]] || return set -o noglob while read _l; do [[ -n ${_l%%#*} ]] && echo $_l done <$1 set +o noglob } quote() ( for a; do alias Q=$a; a=$(alias Q); print -rn -- " ${a#Q=}" done | sed '1s/ //' echo ) tmpdir() { local _i=1 _dir until _dir="${1?}.$_i.$RANDOM" && mkdir -- "$_dir" 2>/dev/null; do ((++_i < 10000)) || return 1 done echo "$_dir" } scan_dmesg() { bsort $(sed -n "$1" /var/run/dmesg.boot) } scan_disknames() { local IFS=, bsort $(for _n in $(sysctl -n hw.disknames); do echo "${_n%%:*} "; done | sed -n "$1") } get_dkdevs () { echo $(scan_disknames "${MDDKDEVS:-/^[sw]d[0-9][0-9]* /s/ .*//p}") } get_cddevs () { echo $(scan_disknames "${MDCDDEVS:-/^cd[0-9][0-9]* /s/ .*//p}") } get_ifdevs() { ifconfig "$@" 2>/dev/null | egrep -v '^[[:space:]]|(bridge|enc|gif|gre|lo|pflog|pfsync|ppp|sl|tun)[[:digit:]]+:' | sed -n 's/^\(.*\):.*/\1/p' } get_drive() { ask_which "$1" "contains the $MODE media" "$2" "$3" [[ $resp == done ]] && return 1 makedev $resp || return 1 return 0 } mount_mnt2() { local _dev=$1 _opts _file=/tmp/parts.$1 _parts disklabel $_dev 2>/dev/null | sed -En '/swap|unused/d;/^ [a-p]: /p' >$_file _parts=$(sed 's/^ \(.\): .*/\1/' $_file) set -- $_parts (($# == 0)) && { echo "No filesystems found on $_dev."; return 1; } if isin "c" $_parts; then resp=c elif (($# == 1)); then resp=$1 else cat $_file ask_which "$_dev partition" "has the $MODE sets" \ '$(disklabel '$_dev' 2>/dev/null | sed -En '\''/swap|unused/d;/^ ([a-p]): .*/s//\1/p'\'')' [[ $resp == done ]] && return 1 fi grep -q "^ $resp: .*MSDOS" $_file && _opts="-s" mount -o ro,$_opts /dev/$_dev$resp /mnt2 } askpass() { stty -echo IFS= read -r resp?"$1 " stty echo echo } rm -df /tmp/lock lock() { while ! mkdir /tmp/lock 2>/dev/null && sleep .1; do done } unlock() { rm -d /tmp/lock 2>/dev/null } retrap() { trap 'kill -KILL $cppid 2>/dev/null; echo; stty echo; exit 0' \ INT EXIT TERM } rm -f /tmp/update if ! $auto; then ( while :; do lock if test -e /tmp/update && [[ "`dmesg`" != "`cat /tmp/update`" ]]; then dmesg >/tmp/update kill -TERM 2>/dev/null $$ || exit 1 fi unlock sleep .5 done ) |& cppid=$! retrap fi _ask() { local _q=$1 _def=$2 _int _redo=0 _pid lock; dmesg >/tmp/update; unlock echo -n "${_q:+$_q }${_def:+[$_def] }" _autorespond "$_q" "$_def" && echo "$resp" && return trap "_int=1" INT trap "_redo=1" TERM read resp lock; rm /tmp/update; unlock if ((_redo)); then stty raw stty -raw else case $resp in !) echo "Type 'exit' to return to install." sh _redo=1 ;; !*) eval "${resp#?}" _redo=1 ;; esac fi retrap ((_int)) && kill -INT $$ : ${resp:=$_def} return $_redo } _autorespond() { typeset -l _q=$1 _key local _def=$2 _l _val [[ -f $respfile ]] || return mv /ai.conf /ai.conf.tmp while IFS=' ' read -r _l; do [[ $_l == [!#=]*=?* ]] || continue _key=${_l%%*([[:blank:]])=*} _val=${_l##*([!=])=*([[:blank:]])} [[ $_q == @(|*[[:blank:]])"$_key"@([[:blank:]?]*|) ]] && resp=$_val && cat && return print -r " $_l" done /ai.conf [[ -n $_def ]] && resp=$_def && return echo "\nQuestion has no answer in response file." exit 1 } ask() { while ! _ask "$1" "$2"; do done } askpassword() { local _q=$1 if $auto; then echo -n "$_q " _autorespond "$_q" echo '' _password=$resp return fi while :; do askpass "$_q (will not echo)" _password=$resp askpass "$_q (again)" [[ $resp == "$_password" ]] && break echo "Passwords do not match, try again." done } encr_pwd() { local _p=$1 if [[ -z $_p ]]; then echo '*' elif [[ $_p == \$2?\$[0-9][0-9]\$* && ${#_p} > 40 || $_p == '*************' ]]; then echo "$_p" else /mnt/usr/bin/encrypt -b 8 -- "$_p" fi } user_setup() { local _q="Setup a user? (enter a lower-case loginname, or 'no')" while :; do ask "$_q" no case $resp in n|no) return;; y|yes) _q="No really, what is the lower-case loginname, or 'no'?" continue;; root|daemon|operator|bin|smmsp|popa3d) ;; sshd|uucp|www|named|proxy|nobody|ftp) ;; [a-z]*([a-z0-9_])) ((${#resp} <= 31)) && break;; esac echo "$resp is not a useable loginname." done user=$resp while :; do ask "Full name for user $user?" $user case $resp in *[:\&,]*) echo "':', '&' or ',' are not allowed.";; *) ((${#resp} <= 100)) && break echo "Too long.";; esac done username=$resp askpassword "Password for user $user?" userpass=$_password userkey= $auto && ask "Public ssh key for user $user" none && [[ $resp != none ]] && userkey=$resp if [[ $sshd == y ]]; then ask_yn "Since you set up a user, disable sshd(8) logins to root?" yes sshd_disableroot=$resp fi } function ask_until { resp= while true; do ask "$1" "$2" [[ -n $resp ]] && break echo "A response is required." $auto && exit 1 done } ask_yn() { local _q=$1 _a=${2:-no} typeset -l _resp while :; do ask "$_q" "$_a" _resp=$resp case $_resp in y|yes) resp=y; return 0;; n|no) resp=n; return 1;; esac echo "'$resp' is not a valid choice." $auto && exit 1 done } ask_which() { local _name=$1 _query=$2 _list=$3 _def=$4 _dynlist _dyndef _key _q _key=$(echo "$_name" | sed 's/[^[:alnum:]]/_/g') while :; do eval "_dynlist=\"$_list\"" eval "_dyndef=\"$_def\"" set -o noglob set -- $_dyndef; _dyndef="$1" set -- $_dynlist; _dynlist="$*" set +o noglob (($# < 1)) && resp=done && return : ${_dyndef:=$1} echo "Available ${_name}s are: $_dynlist." _q="Which $_name $_query?" echo -n "$_q (or 'done') ${_dyndef:+[$_dyndef] }" _autorespond "$_q" "${_dyndef-done}" && echo "$resp" \ || _ask || continue [[ -z $resp ]] && resp="$_dyndef" isin "$resp" $_dynlist done && break echo "'$resp' is not a valid choice." $auto && [[ -n $respfile ]] && exit 1 done } isin() { local _a=$1 _b shift for _b; do [[ $_a == $_b ]] && return 0 done return 1 } addel() { local _a=$1 shift echo -n "$*" isin "$_a" $* || echo -n " $_a" } rmel() { local _a=$1 _b shift for _b; do [[ $_a != $_b ]] && echo -n "$_b " done } bsort() { local _l _a=$1 _b (($# > 0)) || return shift for _b; do if [[ $_a != $_b ]]; then if [[ $_a > $_b ]]; then _l="$_a $_l"; _a=$_b else _l="$_b $_l" fi fi done echo -n "$_a " bsort $_l } showcols() { local _l _cdir=/tmp/cdir set -A _clist mkdir -p $_cdir rm -rf -- $_cdir/* while read _l; do [ "$_l" ] || continue mkdir -p /tmp/cdir/"$_l" _clist[${#_clist[*]}]="$_l" done (cd $_cdir; ls -Cdf "${_clist[@]}") rm -rf -- $_cdir } makedev() { [[ -z $(cd /dev && sh MAKEDEV "$@" 2>&1) ]] } addhostent() { local _addr=$1 _name=$2 _delim="." [[ -z $_addr || -z $_name ]] && return [[ $_addr == *:* ]] && _delim=":" sed "/^[0-9a-fA-F]*[$_delim].*[ ]$_name\$/d" /tmp/hosts \ >/tmp/hosts.new 2>/dev/null mv /tmp/hosts.new /tmp/hosts echo "$_addr $_name" >>/tmp/hosts } select_sets() { local _avail=$1 _selected=$2 _f _action _col=$COLUMNS local _comp=comp${VERSION}.tgz _xbase=xbase${VERSION}.tgz let COLUMNS=_col-8 cat <<__EOT Select sets by entering a set name, a file name pattern or 'all'. De-select sets by prepending a '-' to the set name, file name pattern or 'all'. Selected sets are labelled '[X]'. __EOT while :; do for _f in $_avail; do isin $_f $_selected && echo "[X] $_f" || echo "[ ] $_f" done | showcols | sed 's/^/ /' ask "Set name(s)? (or 'abort' or 'done')" done set -o noglob for resp in $resp; do case $resp in abort) _selected=; break 2;; done) break 2;; -*) _action=rmel;; *) _action=addel;; esac resp=${resp#[+-]} [[ $resp = all ]] && resp=* for _f in $_avail; do [[ $_f = $resp ]] && _selected=$($_action $_f $_selected) done done if isin $_xbase $_selected && ! isin $_comp $_selected && isin $_comp $_avail; then _selected=$(addel $_comp $_selected) echo "The xbase set requires the comp set, so adding it back in." fi done set +o noglob COLUMNS=$_col resp=$_selected } configure_ifs() { local _first _ifdevs _ifs _name _hn _vl=0 _vd _vi _p _tags while :; do _vd=$(ifconfig vlan$_vl 2>&1) [[ $_vd == @(*no such interface*) ]] && break [[ $_vd == @(vlan$_vl: flags=0<>*) ]] && break ((_vl++)) done _vd= ifconfig lo0 inet 127.0.0.1/8 while :; do ifconfig vlan$_vl create >/dev/null 2>&1 ask_which "network interface" "do you wish to configure" \ '$(get_ifdevs)' \ ${_p:-'$( (get_ifdevs netboot; get_ifdevs) | sed q )'} [[ $resp == done ]] && break _ifs=$resp _hn=/tmp/hostname.$_ifs rm -f $_hn if [[ $_ifs == vlan[0-9]* ]]; then _vi=$(ifconfig $_ifs 2>/dev/null | sed -n 's/vlan: \([0-9]*\).*/\1/p') _tags=$(ifconfig vlan 2>/dev/null | sed -n 's/vlan: \([0-9]*\).*/\1/p') [[ -n $_tags ]] && _tags=$(rmel "$_vi" $_tags) if [[ -z $_vi ]]; then _vi=0 while ((++_vi < 4096)); do ! isin "$_vi" $_tags && break done fi _ifdevs=$(get_ifdevs) set -- $_ifdevs while [[ $1 == vlan[0-9]* ]]; do shift done ask "Which interface:tag should $_ifs be on?" "${_vd:=$1}:$_vi" _vd=${resp%%:*} _vi=${resp##*:} if ! (isin "$_vd" $_ifdevs && [[ $_vd != vlan[0-9]* ]]); then echo "Invalid interface choice '$_vd'" _vd= continue fi if ((_vi < 1 || _vi > 4095)) || isin "$_vi" $_tags; then echo "Invalid or in-use vlan tag '$_vi'" continue fi grep -qs "^up" /tmp/hostname.$_vd || echo "up" >>/tmp/hostname.$_vd chmod 640 /tmp/hostname.$_vd ifconfig $_vd up ifconfig $_ifs destroy >/dev/null 2>&1 ifconfig $_ifs vlan $_vi vlandev $_vd echo "vlan $_vi vlandev $_vd" >>$_hn [[ ${_ifs##vlan} == $_vl ]] && ((_vl++)) fi ifconfig $_ifs 2>/dev/null | grep -q "^[[:space:]]*ieee80211:" && ieee80211_config $_ifs $_hn resp=$(hostname -s) [[ -n $_first && $_first != $_ifs ]] && ask "Symbolic (host) name for $_ifs?" $resp _name=$resp v4_config $_ifs $_name $_hn v6_config $_ifs $_name $_hn if [[ -f $_hn ]]; then chmod 640 $_hn ((nifs++)) : ${_first:=$_ifs} _p=done fi done } v4_info() { ifconfig $1 inet | sed -n ' 1s/.*/dev/null /sbin/dhclient "$@" } dhcp_request() { local _ifs=$1 _hn=$2 echo "lookup file bind" >/etc/resolv.conf.tail if [[ -n $_hn ]]; then _hn="send host-name \"$_hn\";" echo "Issuing hostname-associated DHCP request for $_ifs." else echo "Issuing free-roaming DHCP request for $_ifs." fi cat >/etc/dhclient.conf <<__EOT initial-interval 1; $_hn request subnet-mask, broadcast-address, routers, domain-name, domain-name-servers, host-name; __EOT ifconfig $_ifs group dhcp >/dev/null 2>&1 dhclient $_ifs set -- $(v4_info $_ifs) if [[ $1 == UP && -n $2 ]]; then mv /etc/dhclient.conf /tmp/dhclient.conf mv /etc/resolv.conf.tail /tmp/resolv.conf.tail return 0 fi ifconfig $_ifs delete down -group dhcp 2>/dev/null rm /etc/dhclient.conf /etc/resolv.conf.tail return 1 } hextodec() { local _d _b for _b in $(echo ${1#0x} | sed 's/\(..\)/\1 /g'); do _d=$_d.$((0x$_b)) done echo ${_d#.} } ieee80211_scan() { [[ -f $WLANLIST ]] || ifconfig $1 scan | sed -n 's/^ nwid \([^"]\)/\1/p' >$WLANLIST cat $WLANLIST } ieee80211_config() { local _ifs=$1 _hn=$2 _prompt _nwid _haswpa=0 _err ifconfig $_ifs -nwid -nwkey ifconfig $_ifs -wpa 2>/dev/null && _haswpa=1 rm -f $WLANLIST while [[ -z $_nwid ]]; do ask_until "Access point? (ESSID, 'any', list# or '?')" "any" case "$resp" in +([0-9])) _nwid=$(ieee80211_scan $_ifs | sed -n "${resp}s/ .*//p") [[ -z $_nwid ]] && echo "There is no line $resp." ;; \?) ieee80211_scan $_ifs | sed -n 's/^\([^ ]*\) chan .* bssid \([^ ]*\) .*$/ \1 (\2)/p' | less -XEN ;; *) _nwid=$resp;; esac done if [[ $_nwid != any ]]; then ifconfig $_ifs nwid "$_nwid" quote nwid "$_nwid" >>$_hn _prompt="Security protocol? (O)pen, (W)EP" ((_haswpa == 1)) && _prompt="$_prompt, WPA-(P)SK" while :; do ask_until "$_prompt" "O" case "$_haswpa-$resp" in ?-[Oo]) break ;; ?-[Ww]) ask_until "WEP key? (will echo)" if _err=$(ifconfig $_ifs nwkey "$resp" 2>&1) && [[ -z $_err ]]; then quote nwkey "$resp" >>$_hn break fi echo "$_err" ;; 1-[Pp]) ask_until "WPA passphrase? (will echo)" if ifconfig $_ifs wpakey "$resp"; then quote wpakey "$resp" >>$_hn break fi ;; *) echo "'$resp' is not a valid choice." ;; esac done fi } v4_config() { local _ifs=$1 _name=$2 _hn=$3 _prompt _addr _mask if ifconfig $_ifs | grep -q 'groups:.* dhcp'; then _addr=dhcp else set -- $(v4_info $_ifs) if [[ -n $2 ]]; then _addr=$2; _mask=$(hextodec $3) ifconfig $_ifs inet $_addr delete fi fi if [[ -x /sbin/dhclient ]]; then _prompt="or 'dhcp' " ifconfig dhcp >/dev/null 2>&1 || _addr=dhcp fi _prompt="IPv4 address for $_ifs? (${_prompt}or 'none')" ask_until "$_prompt" "$_addr" case $resp in none) ;; dhcp) if [[ ! -x /sbin/dhclient ]]; then echo "DHCP not possible - no /sbin/dhclient." elif dhcp_request $_ifs "$_name" || dhcp_request $_ifs; then echo "dhcp" >>$_hn fi ;; *) _addr=$resp ask_until "Netmask?" "${_mask:=255.255.255.0}" ifconfig $_ifs -group dhcp >/dev/null 2>&1 if ifconfig $_ifs inet $_addr netmask $resp up; then addhostent "$_addr" "$_name" echo "inet $_addr $resp" >>$_hn fi ;; esac } v6_config() { local _ifs=$1 _name=$2 _hn=$3 _addr _prefixlen _prompt ifconfig lo0 inet6 >/dev/null 2>&1 || return set -- $(v6_info $_ifs) [[ -n $2 ]] && { _addr=$2; _prefixlen=$3; } [[ -x /sbin/rtsol ]] && _prompt="or 'rtsol' " _prompt="IPv6 address for $_ifs? (${_prompt}or 'none')" ask_until "$_prompt" "${_addr:-none}" case $resp in none) return ;; rtsol) [[ ! -x /sbin/rtsol ]] && { echo "No /sbin/rtsol."; return; } ifconfig $_ifs up if rtsol -F $_ifs; then echo "up\nrtsol" >>$_hn fi return ;; esac _addr=$resp ask_until "IPv6 prefix length for $_ifs?" "${_prefixlen:=64}" ifconfig $_ifs inet6 $_addr prefixlen $resp up || return echo "inet6 $_addr $resp" >>$_hn addhostent "$_addr" "$_name" v6_defroute $_ifs } v4_defroute() { local _dr _prompt=" or 'none'" [[ -n $(ifconfig | sed -n '/[ ]inet .* broadcast /p') ]] || return [[ -f /tmp/dhclient.conf && $nifs == 1 ]] && return [[ -x /sbin/dhclient ]] && _prompt=", 'dhcp'$_prompt" _prompt="Default IPv4 route? (IPv4 address$_prompt)" _dr=$(route -n show -inet | sed -n '/^default */{s///; s/ .*//; p;}') [[ -f /tmp/dhclient.conf ]] && _dr=dhcp while :; do ask_until "$_prompt" "$_dr" [[ $resp == @(none|dhcp) ]] && break route delete -inet default >/dev/null 2>&1 route -n add -inet -host default "$resp" && { echo "$resp" >/tmp/mygate; break; } route -n add -inet -host default $_dr >/dev/null 2>&1 done } v6_defroute() { local _if=$1 _resp _routers route -n show -inet6 | egrep -q '^default[[:space:]]' && return _routers=$(bsort $(ping6 -n -c 2 ff02::2%$_if 2>/dev/null | sed -n '/bytes from/{s/^.*from //;s/,.*$//;p;}' | sed -n 'G;s/\n/&&/;/^\(.*\n\).*\n\1/d;h;P')) local PS3="IPv6 default router? (${_routers:+list #, }IPv6 address or 'none'): " select _resp in $_routers; do [[ ${_resp:=$REPLY} == *:* ]] && break [[ $_resp == none ]] && return done route -n add -inet6 -host default "$_resp" && echo "$_resp" >>/tmp/mygate } enable_network() { local _f _gw for _f in dhclient.conf resolv.conf resolv.conf.tail; do if [ -f /mnt/etc/$_f ]; then cp /mnt/etc/$_f /etc/$_f fi done ifconfig lo0 inet 127.0.0.1/8 for hn in /mnt/etc/hostname.*; do ((nifs++)) if=${hn#/mnt/etc/hostname.} (ifconfig $if||ifconfig $if create) >/dev/null 2>&1 || continue while :; do if [ "$cmd2" ]; then set -- $cmd2 af=$1 name=$2 mask=$3 bcaddr=$4 ext1=$5 cmd2= i=1 while [ i -lt 6 -a -n "$1" ]; do shift; let i=i+1; done ext2="$@" else read af name mask bcaddr ext1 ext2 || break fi case "$af" in "#"*|"!"*|"bridge"|"") continue ;; "dhcp") [ "$name" = "NONE" ] && name= [ "$mask" = "NONE" ] && mask= [ "$bcaddr" = "NONE" ] && bcaddr= dhcpif="$dhcpif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 down" if [[ -x /sbin/dhclient ]]; then cmd="$cmd; dhclient $if" else cmd="$cmd; echo /sbin/dhclient missing - skipping dhcp request." fi ;; "rtsol") rtsolif="$rtsolif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" ;; *) read dt dtaddr if [ "$name" = "alias" ]; then alias=$name name=$mask mask=$bcaddr bcaddr=$ext1 ext1=$ext2 ext2= else alias= fi cmd="ifconfig $if $af $alias $name" case "$dt" in dest) cmd="$cmd $dtaddr" ;; *) cmd2="$dt $dtaddr" ;; esac case $af in inet) if [ ! -n "$name" ]; then echo "/etc/hostname.$if: inet alone is invalid" return fi [ "$mask" ] && cmd="$cmd netmask $mask" if [ "$bcaddr" -a X"$bcaddr" != "XNONE" ]; then cmd="$cmd broadcast $bcaddr" fi [ "$alias" ] && rtcmd=";route -qn add -host $name 127.0.0.1" ;; inet6) if [ ! -n "$name" ]; then echo "/etc/hostname.$if: inet6 alone is invalid" return fi [ "$mask" ] && cmd="$cmd prefixlen $mask" cmd="$cmd $bcaddr" ;; *) cmd="$cmd $mask $bcaddr" ;; esac cmd="$cmd $ext1 $ext2$rtcmd" rtcmd= ;; esac eval "$cmd" done /dev/null 2>&1 route -qn add -host default $_gw && break done [[ -z $rtsolif ]] && stripcom /mnt/etc/mygate | while read _gw; do [[ $_gw == !(*:*) ]] && continue route -qn delete -inet6 default >/dev/null 2>&1 route -qn add -host -inet6 default $_gw && break done route -qn add -net 127 127.0.0.1 -reject >/dev/null } install_files() { local _src=$1 _files=$2 _f _sets _get_sets _n _col=$COLUMNS \ _tmpfs _tmpsrc _cfile _fsrc _unver _t _issue _srclocal _size for _f in $THESETS; do isin $_f $_files || continue; _sets=$(addel $_f $_sets) if [[ -z $DISPLAY && ! -d /mnt/etc/X11 ]]; then isin ${_f%${VERSION}.tgz} xbase xetc xshare xfont xserv && continue fi isin $_f $DEFAULTSETS "site$VERSION-$(hostname -s).tgz" && _get_sets=$(addel $_f $_get_sets) done if [[ -z $_sets ]]; then echo -n "Looked at " echo $_src | sed 's/\(^ftp:\/\/[^/]*\)\(:[^/]*\)\(@.*\)/\1\3/' echo "and found no $OBSD sets. The set names looked for were:" let COLUMNS=_col-8 for _n in $THESETS; do echo $_n; done | showcols | sed 's/^/ /' COLUMNS=$_col $auto && exit 1 echo return fi isin INSTALL.$ARCH $_files || ask_yn "INSTALL.$ARCH not found. Use sets found here anyway?" || return select_sets "$_sets" "$_get_sets" [[ -n $resp ]] || return _get_sets=$resp _get_sets=$(for s in $THESETS; do isin $s $_get_sets && echo $s; done) _size=$( ( [[ $_src == file://* ]] && ls -lT "${_src#file://}" || ftp -V -o - "$_src/index.txt" 2>/dev/null ) | ( sum=0 while read x x x x s x x x f2 f && : ${f:=$f2}; do isin $f $_get_sets && let sum+=s done; echo $sum ) ) _size=$((${_size:-536870912} / 1024)) _unver=$_get_sets for _issue in ''; do ! isin SHA256.sig $_files && _issue="Directory does not contain SHA256.sig" && break _tmpfs=$( ( for fs in /mnt/{{,var/}tmp,home,usr{/local,}}; do df -k $fs 2>/dev/null | grep " $fs\$" done df -k ) | ( while read a a a a m m; do [[ $m == /mnt/@(@(|var/)tmp|home|usr/@(src,obj,xobj))@(|/*) ]] && ((a > _size + 10240)) && echo $m && exit [[ $m == /mnt@(|/*) ]] && ((a > _size * 4)) && echo $m && exit done ) ) if [[ -d $_tmpfs ]]; then ! _tmpsrc=$(tmpdir "$_tmpfs/sets") && _issue="Cannot create prefetch area" && break else _issue="Cannot determine prefetch area" && break fi _cfile=$_tmpsrc/SHA256 _srclocal=false _t=Get/Verify [[ $_src == file://* ]] && _srclocal=true _t='Verifying ' ! ftp -D "$_t" -Vmo "$_cfile.sig" "$_src/SHA256.sig" && _issue="Cannot fetch SHA256.sig" && break ! signify -Vep /etc/signify/openbsd-${VERSION}-base.pub \ -x "$_cfile.sig" -m "$_cfile" && _issue="Signature check of SHA256.sig failed" && break for _f in $_get_sets; do rm -f "$_tmpsrc/h" "$_tmpsrc/fail" ( ftp -D "$_t" -Vmo - "$_src/$_f" || >"$_tmpsrc/fail" ) | ( $_srclocal && sha256 >$_tmpsrc/h || sha256 -ph "$_tmpsrc/h" >"$_tmpsrc/$_f" ) if [[ -f $_tmpsrc/fail ]]; then rm -f "$_tmpsrc/$_f" if ! ask_yn "Fetching of $_f failed. Continue anyway?"; then [[ -d $_tmpsrc ]] && rm -rf "$_tmpsrc" $auto && exit 1 return fi continue fi if fgrep -qx "SHA256 ($_f) = $(<$_tmpsrc/h)" "$_cfile"; then _unver=$(rmel $_f $_unver) else if ! ask_yn "Checksum test for $_f failed. Continue anyway?"; then [[ -d $_tmpsrc ]] && rm -rf "$_tmpsrc" $auto && exit 1 return fi fi done done [[ -n $_unver ]] && : ${_issue:="Unverified sets:" ${_unver% }} if [[ -n $_issue ]] && ! ask_yn "$_issue. Continue without verification?"; then [[ -d $_tmpsrc ]] && rm -rf "$_tmpsrc" $auto && exit 1 return fi for _f in $_get_sets; do _fsrc="$_src/$_f" [[ -f $_tmpsrc/$_f ]] && _fsrc="file://$_tmpsrc/$_f" case $_fsrc in *.tgz) ftp -D Installing -Vmo - "$_fsrc" | tar -zxphf - -C /mnt;; *) ftp -D Installing -Vmo "/mnt/$_f" "$_fsrc";; esac if (($?)); then if ! ask_yn "Installation of $_f failed. Continue anyway?"; then [[ -d $_tmpsrc ]] && rm -rf "$_tmpsrc" $auto && exit 1 return fi else DEFAULTSETS=$(rmel $_f $DEFAULTSETS) GOTSETS="$GOTSETS $_f" fi [[ -d $_tmpsrc ]] && rm -f "$_tmpsrc/$_f" done [[ -d $_tmpsrc ]] && rm -rf "$_tmpsrc" } encode_for_url() { echo "$1" | sed " s/%/%25/g s/ /%20/g s/!/%21/g s/\"/%22/g s/#/%23/g s/\\\$/%24/g s/&/%26/g s/'/%27/g s/(/%28/g s/)/%29/g s/\*/%2a/g s/+/%2b/g s/,/%2c/g s/-/%2d/g s/\./%2e/g s/\//%2f/g s/:/%3a/g s/;/%3b/g s//%3e/g s/?/%3f/g s/@/%40/g s/\[/%5b/g s/\\\\/%5c/g s/]/%5d/g s/\^/%5e/g s/_/%5f/g s/\`/%60/g s/{/%7b/g s/|/%7c/g s/}/%7d/g s/~/%7e/g " } ftp_error() { if [[ -n $(echo "$2" | grep "$1") ]]; then echo $1 return 0 fi return 1 } startftplist() { ((nifs < 1)) && return set -m ( ftp -Vao - "http://129.128.5.191/cgi-bin/ftplist.cgi?path=$FTPSETDIR" \ 2>/tmp/ftplisterr >$SERVERLISTALL echo -n $SECONDS >$SERVERLISTSEC feed_random ) & ftppid=$! set +m (sleep 12; kill -INT -$ftppid >/dev/null 2>&1) & } waitftplist() { wait "$ftppid" 2>/dev/null } ftp_time() { local _ftplist_sec=$(cat $SERVERLISTSEC 2>/dev/null) local _time=$(sed '/^TIME=\([0-9]*\)$/!d;s//\1/;q' $SERVERLISTALL 2>/dev/null) [[ -n $_ftplist_sec && -n $_time ]] && echo $((_time + SECONDS - _ftplist_sec)) } install_url() { local _url_type=$1 _file_list _url_base _prompt _passwd _mirror eval local _server_ip=\$_${_url_type}_server_ip \ _server_dir=\$_${_url_type}_server_dir waitftplist ask "HTTP/FTP proxy URL? (e.g. 'http://proxy:8080', or 'none')" \ "${ftp_proxy:-none}" unset ftp_proxy http_proxy [[ $resp == none ]] || export ftp_proxy=$resp http_proxy=$resp if [[ -s $SERVERLISTALL ]]; then _prompt="Server? (hostname, list#, 'done' or '?')" sed -n "s,^${_url_type}://"'\([[A-Za-z0-9\:_][]A-Za-z0-9:._-]*\),\1,p' \ $SERVERLISTALL >$SERVERLIST set -- $(sed q $SERVERLIST) _server_ip=${1%%/*} else echo "(Was not able to get ftplist from ftp.openbsd.org, but that is OK)" _prompt="Server? (hostname or 'done')" fi while :; do ask_until "$_prompt" "$_server_ip" case $resp in done) return;; "?") [[ -s $SERVERLIST ]] || continue less -XEN < $SERVERLIST ;; +([0-9])) [[ -s $SERVERLIST ]] || continue set -- $(sed -n "${resp}p" $SERVERLIST) (($# < 1)) && { echo "There is no line $resp."; continue; } _server_ip=${1%%/*} ;; +([A-Za-z0-9\:.\[\]_-])) _server_ip=$resp break ;; *) echo "'$resp' is not a valid hostname." ;; esac done eval _${_url_type}_server_ip=$_server_ip set -- $(sed "/^$_server_ip/x;\$!d;x" $SERVERLIST 2>/dev/null) resp=${1#*/} [[ $resp == "$1" ]] && resp= if (($# > 1)); then resp=$resp/$FTPSETDIR _mirror=yes fi ask_until "Server directory?" "${resp:-pub/OpenBSD/$FTPSETDIR}" _server_dir=$resp eval _${_url_type}_server_dir=$_server_dir if [[ $_url_type == ftp ]]; then IFS= ask_until "Login?" "${_ftp_server_login:=anonymous}" _ftp_server_login=$resp if [[ $_ftp_server_login == @(anonymous|ftp) ]]; then _passwd=root@`hostname` else resp= while [[ -z $resp ]]; do askpass "Password? (will not echo)" done _passwd=$resp fi fi _url_base=$_url_type:// if [[ $_url_type == ftp && $_ftp_server_login != anonymous ]]; then _url_base=$_url_base$(encode_for_url "$_ftp_server_login"):$(encode_for_url "$_passwd")@ fi _url_base=$_url_base$_server_ip/$_server_dir if [[ $_url_type == ftp && -z $ftp_proxy ]]; then _file_list=$(ftp -V "$_url_base/") ftp_error "Login failed." "$_file_list" && return ftp_error "No such file or directory." "$_file_list" && return else _file_list=$(ftp -Vo - "$_url_base/index.txt" | sed 's/^.* //' | sed 's/ //') fi install_files "$_url_base" "$_file_list" installedfrom=$_url_type://$_server_ip/$_server_dir if [[ -n $_mirror ]]; then PACKAGE_PATH=$(print -r -- "$installedfrom" | sed -E "/\/(snapshots|[0-9]\.[0-9])\/($ARCH)\/*$/!d s!!/\1/packages/$(arch -s)/!;q") else PACKAGE_PATH= fi } install_mounted_fs() { local _dir while :; do ask_until "Pathname to the sets? (or 'done')" "$SETDIR" [[ $resp == done ]] && return [[ -d /mnt2/$resp ]] && { _dir=/mnt2/$resp; break; } [[ -d /mnt/$resp ]] && { _dir=/mnt/$resp; break; } [[ -d /$resp ]] && { _dir=/$resp; break; } echo "The directory '$resp' does not exist." done install_files "file://$_dir" "$(ls $_dir/)" } install_cdrom() { get_drive "CD-ROM" '$(get_cddevs)' || return mount_mnt2 $resp || return install_mounted_fs } install_disk() { ask_yn "Is the disk partition already mounted?" if [[ $resp == n ]]; then get_drive "disk" '$(bsort $(get_dkdevs))' \ '$(bsort $(rmel $ROOTDISK $(get_dkdevs)))' || return mount_mnt2 $resp || return fi install_mounted_fs } install_nfs() { local _tcp ask_until "Server IP address or hostname?" "$NFS_ADDR" NFS_ADDR=$resp ask_until "Filesystem on server to mount?" "$NFS_PATH" NFS_PATH=$resp ask_yn "Use TCP transport? (requires TCP-capable NFS server)" [[ $resp == y ]] && _tcp=-T mount_nfs $_tcp -o ro -R 5 $NFS_ADDR:$NFS_PATH /mnt2 || return install_mounted_fs } install_tape() { local _z _bs get_drive "tape drive" '$MTDEVS' || return export TAPE=/dev/nr$resp if [[ ! -c $TAPE ]]; then echo "$TAPE is not a character special file." return fi echo -n "Rewinding $TAPE (mt rewind)..." mt rewind || return echo "done." while :; do ask_until "Skip how many files? (or 'done')" 0 [[ $resp == done ]] && return [[ $resp == +([0-9]) ]] || continue if (($resp > 0)); then echo -n "Skipping $resp file(s)..." mt fsf $resp || return echo "done." elif [[ -n $_bs ]]; then mt bsf; mt fsf fi unset _z ask_yn "Is the file gzipped?" yes [[ $resp == y ]] && _z=z [[ $_z == z ]] || _bs=10240 ask_until "Blocksize for this file?" "${_bs:-8k}" [[ $resp == done ]] && return _bs=$resp dd if=$TAPE bs=$_bs | tar ${_z}xvphf - -C /mnt || return done } set_timezone() { local _zonefile=$1 _zonepath _zsed _tz _zoneroot=/usr/share/zoneinfo [[ ! -f $_zonefile ]] && return [[ -n $TZ ]] && return if [[ -h /mnt/etc/localtime ]]; then TZ=$(ls -l /mnt/etc/localtime 2>/dev/null) TZ=${TZ#*${_zoneroot#/mnt}/} fi waitftplist if [[ -s $SERVERLISTALL ]]; then _tz=$(sed -n '/^TZ=/s/TZ=//p' <$SERVERLISTALL) [[ -n $_tz ]] && isin "$_tz" `cat $_zonefile` && TZ=$_tz fi [[ $_zonefile = /var/tzlist && -z $TZ ]] && return while :; do ask "What timezone are you in? ('?' for list)" "$TZ" _zonepath=${resp%%*(/)} case $_zonepath in "") continue;; "?") grep -v /. $_zonefile | showcols continue;; esac while isin "$_zonepath/" $(cat $_zonefile); do ask "What sub-timezone of '$_zonepath' are you in? ('?' for list)" _zsed=$(echo $_zonepath/ | sed 's,/,\\/,g') resp=${resp%%*(/)} case $resp in "") ;; "?") sed -n "/^$_zsed/{s/$_zsed//;/\/./!p;}" $_zonefile | showcols;; *) _zonepath=$_zonepath/$resp;; esac done if isin "$_zonepath" $(cat $_zonefile); then TZ=${_zonepath#$_zoneroot} return fi echo -n "'${_zonepath}'" echo " is not a valid timezone on this system." done } sane_install() { local _q=$1 _s for _s in $SANESETS; do isin $_s $DEFAULTSETS || continue [[ -z $_q ]] && ask_yn "Are you *SURE* your $MODE is complete without '$_s'?" || return done } install_sets() { local _d _locs="disk ftp http" echo [[ -s $SERVERLISTALL ]] && _d=$(sed -n '/^method=/s/method=//p' $SERVERLISTALL) ifconfig netboot >/dev/null 2>&1 && : ${_d:=http} [[ -n $(get_cddevs) ]] && { _locs="cd $_locs"; : ${_d:=cd}; } [[ -x /sbin/mount_nfs ]] && _locs="$_locs nfs" [[ -n $MTDEVS && -x /bin/mt ]] && _locs="$_locs tape" : ${_d:=http} if ! isin "$_d" $_locs; then for a in http ftp cd nfs tape disk; do isin $a $_locs && _d=$a && break done fi echo "Let's $MODE the sets!" while :; do umount -f /mnt2 >/dev/null 2>&1 [[ -n $method ]] && _d=$method sane_install quiet && _d=done ask "Location of sets? ($_locs or 'done')" "$_d" case $resp in done) sane_install && return;; c*|C*) isin cd $_locs && install_cdrom && method=cd;; d*|D*) install_disk && method=disk;; f*|F*) isin ftp $_locs && install_url ftp && method=ftp;; h*|H*) isin http $_locs && install_url http && method=http;; n*|N*) isin nfs $_locs && install_nfs && method=nfs;; t*|T*) isin tape $_locs && install_tape && method=tape;; esac $auto && break done } update_firmware() { echo "/usr/sbin/fw_update -v" >>/mnt/etc/rc.firsttime } munge_fstab() { local _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do [[ $_dev == @(/dev/vnd*|\#*) || $_fstype == nfs || ! -f /sbin/mount_$_fstype || $_opt == *noauto* || $_opt == *xx* ]] && continue _opt=$(echo $_opt | sed 's/softdep//') [[ $_fstype == ffs ]] && _opt=$(echo $_opt | sed 's/ro/rw/') [[ $_fstype == ffs ]] || _opt=$(echo $_opt | sed 's/rw/ro/') echo $_dev /mnt${_mp%/} $_fstype $_opt $_rest done /etc/fstab if [ ! -s /etc/fstab ]; then echo "Unable to create valid /etc/fstab." exit fi } mount_fs() { local _async=$1 _dev _mp _fstype _opt _rest _msg _fail while read _dev _mp _fstype _opt _rest; do [ "$_mp" = "/mnt" ] || mkdir -p $_mp _msg=$(mount -v -t $_fstype $_async -o $_opt $_dev $_mp) || _fail="$_fail\n$_mp ($_dev)" echo $_msg | sed 's/, ctime=[^,)]*//' done 0)) || continue echo -n "fsck -${_f}p $_dev..." if ! fsck -${_f}p $_dev >/dev/null 2>&1; then echo "FAILED. You must fsck $_dev manually." _fail=y else echo "OK." fi done /tmp/resolv.conf for _ns in $resp; do echo "nameserver $_ns" >>/tmp/resolv.conf done cp /tmp/resolv.conf /tmp/resolv.conf.shadow fi } populateusrlocal() { if [ -f /mnt/etc/mtree/BSD.local.dist ]; then /mnt/usr/sbin/chroot /mnt /usr/sbin/mtree -Uedqn -p /usr/local -f /etc/mtree/BSD.local.dist >/dev/null fi } apply() { if [[ $sshd == n ]]; then echo "sshd_flags=NO # disabled during install" \ >>/mnt/etc/rc.conf.local fi if [[ $sshd_disableroot == y ]]; then sed "/^#\(PermitRootLogin\) yes/s//\1 no/" \ < /mnt/etc/ssh/sshd_config >/tmp/sshd_config cp /tmp/sshd_config /mnt/etc/ssh/sshd_config fi if [[ $ntpd == y ]]; then echo "ntpd_flags= # enabled during install" \ >>/mnt/etc/rc.conf.local if [[ $ntpd_server != default ]]; then set -- $ntpd_server sed "s/^servers /#&/;/#server /a\\ servers $1 " /mnt/etc/ntpd.conf >/tmp/ntpd.conf cp /tmp/ntpd.conf /mnt/etc/ntpd.conf fi fi if [[ $x11 == y ]]; then sed "/^#\(machdep\.allowaperture=${MDXAPERTURE}\)/s//\1 /" \ /mnt/etc/sysctl.conf >/tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf fi if [[ $xdm == y && -x /mnt/usr/X11R6/bin/xdm ]]; then echo "xdm_flags= # enabled during install" \ >>/mnt/etc/rc.conf.local fi if [[ $defcons == y ]]; then cp /mnt/etc/ttys /tmp/ttys sed -e "/^$CTTY/s/std.9600/std.${CSPEED}/" \ -e "/^$CTTY/s/unknown/vt220 /" \ -e "/$CTTY/s/off.*/on secure/" /tmp/ttys >/mnt/etc/ttys [[ -n $CPROM ]] && echo "stty $CPROM $CSPEED\nset tty $CPROM" >>/mnt/etc/boot.conf fi ln -sf /usr/share/zoneinfo/$TZ /mnt/etc/localtime } questions() { local _d _xdmask=y _def ask_yn "Start sshd(8) by default?" yes sshd=$resp ask_yn "Start ntpd(8) by default?" ntpd=$resp if [[ $resp == y ]]; then ask "NTP server? (hostname or 'default')" default ntpd_server=$resp fi def=no [[ -n $DISPLAY ]] && def=yes if [[ -n $MDXAPERTURE ]]; then ask_yn "Do you expect to run the X Window System?" $def x11=$resp _xdmask=$resp fi if [[ -n $MDXDM && $_xdmask == y ]]; then ask_yn "Do you want the X Window System to be started by xdm(1)?" xdm=$resp fi if [[ -n $CDEV ]]; then _d=${CPROM:-$CDEV} ask_yn "Change the default console to $_d?" defcons=$resp if [[ $resp == y ]]; then ask_which "speed" "should $_d use" \ "9600 19200 38400 57600 115200" $CSPEED case $resp in done) defcons=n;; *) CSPEED=$resp;; esac fi fi } upgrade_to64time_t() { /mnt/usr/sbin/pwd_mkdb -d /mnt/etc master.passwd >/mnt/var/log/lastlog >/mnt/var/run/utmp } feed_random() { { (dmesg; cat $SERVERLISTALL /*.conf; sysctl; route -n show; df; ifconfig -A; hostname) >/dev/random 2>&1 dd if=/mnt/var/db/host.random of=/dev/random bs=65536 count=1 } >/dev/null 2>&1 } store_random() { { dd if=/dev/random of=/mnt/var/db/host.random bs=65536 count=1 dd if=/dev/random of=/mnt/etc/random.seed bs=512 count=1 chmod 600 /mnt/var/db/host.random /mnt/etc/random.seed } >/dev/null 2>&1 } finish_up() { local _dev _mp _fstype _rest if [[ -x /mnt/sbin/swapctl ]]; then /mnt/sbin/swapctl -a /dev/$SWAPDEV >/dev/null 2>&1 while read _dev _mp _fstype _rest; do [[ $_fstype == swap ]] && /mnt/sbin/swapctl -a $_dev >/dev/null 2>&1 done $/\1/p') md_installboot $ROOTDISK if [[ -f /mnt/bsd.mp ]] && ((NCPU > 1)); then echo "Multiprocessor machine; using bsd.mp instead of bsd." mv /mnt/bsd /mnt/bsd.sp 2>/dev/null mv /mnt/bsd.mp /mnt/bsd fi update_firmware upgrade_to64time_t store_random cat <<__EOT CONGRATULATIONS! Your OpenBSD $MODE has been successfully completed! To boot the new system, enter 'reboot' at the command prompt. __EOT [[ $MODE == install ]] && cat <<__EOT When you login to your new system the first time, please read your mail using the 'mail' command. __EOT md_congrats [[ "$MODE" == upgrade ]] && \ echo "After rebooting, run sysmerge(8) to update your system configuration." $auto && >/ai.done } ROOTDISK= ROOTDEV= PACKAGE_PATH= SM_ARGS= SM_ARGSX= SETDIR="$VNAME/$ARCH" FTPDIR="pub/OpenBSD/$VNAME" SERVERLISTALL=/tmp/serverlistall SERVERLISTSEC=/tmp/serverlistsec SERVERLIST=/tmp/serverlist WLANLIST=/tmp/wlanlist FSTABFLAG=-f for _opt in d f l m n p s; do ulimit -$_opt unlimited done dmesg | sed -n '/^OpenBSD /h;/^OpenBSD /!H;${g;p;}' >/var/run/dmesg.boot FTPSETDIR=$SETDIR set -- $(scan_dmesg "/^OpenBSD $VNAME\([^ ]*\).*$/s//\1/p") [[ $1 == -!(stable) ]] && FTPSETDIR=snapshots/$ARCH MTDEVS=$(scan_dmesg "${MDMTDEVS:-/^[cms]t[0-9][0-9]* /s/ .*//p}") nifs=0 DISPLAY=$(scan_dmesg '/^wsdisplay[0-9]* /s/ .*//p') CONSOLE=$(scan_dmesg '/^\([^ ]*\).*: console$/s//\1/p') CONSOLE=${CONSOLE% } [[ -n $CONSOLE ]] && CSPEED=$(stty speed /dev/null 2>&1 for _ifs in $(get_ifdevs dhcp); do set -- $(v4_info $_ifs) [[ $1 == UP && -n $2 ]] && continue ifconfig $_ifs delete down -group dhcp 2>/dev/null done get_responsefile() { local _f _ifdev _mac _mode _server _lf [[ -x /sbin/dhclient ]] || return _ifdev=$(get_ifdevs netboot) if [[ -z $_ifdev ]]; then set -- $(get_ifdevs) (($#)) || return if (($# == 1)); then _ifdev=$1 else while :; do ask_which "network interface" \ "should be used for the initial DHCP request" \ "$*" isin "$resp" $* && _ifdev=$resp && break done fi fi [[ -n $_ifdev ]] || return dhclient $_ifdev _lf=/var/db/dhclient.leases.$_ifdev _server=$(sed "/^ *next-server /!d;s///;s/;$//;q" $_lf) _mode=$(sed -E '/^ *filename "auto_(install|upgrade)";$/!d;s//\1/;q' \ $_lf) _mac=$(ifconfig $_ifdev | sed 's/.*lladdr \(.*\)/\1/p;d') hostname "$(sed -E '/^ *option host-name "(.*)";$/!d;s//\1/;q' $_lf)" if [[ -z $_server ]]; then echo "Could not determine next-server." elif [[ -z $_mode ]]; then echo "Could not determine auto mode." else for _f in {$_mac-,}$_mode; do ftp -o "/$_mode.conf" "http://$_server/$_f.conf" && action=$_mode && return 0 done fi return 1 } if ! $auto; then cat <<__EOT At any prompt except password prompts you can escape to a shell by typing '!'. Default answers are shown in []'s and are selected by pressing RETURN. You can exit this program at any time by pressing Control-C, but this can leave your system in an inconsistent state. __EOT elif [[ -z $respfile ]]; then if ! get_responsefile; then echo "No response file found; non-interactive mode aborted." exit 1 fi rm -f /ai.done echo "Performing non-interactive $action..." /$action -af /$action.conf 2>&1 >$_lf chmod 600 $_lf _lf=${_lf#/mnt} cat <<__EOT >>/mnt/etc/rc.firsttime ( /usr/bin/mail -s '$(hostname) $action log' root < $_lf && rm $_lf ) >/dev/null 2>&1 & __EOT exec reboot else echo "failed; check /ai.log" exit 1 fi else cp $respfile /ai.conf || exit fi set_term if [[ $MODE == install ]]; then ask_until "System hostname? (short form, e.g. 'foo')" "$(hostname -s)" [[ ${resp%%.*} != $(hostname -s) ]] && hostname $resp THESETS="$THESETS site$VERSION-$(hostname -s).tgz" echo donetconfig ((nifs != 0)) && startftplist echo while :; do askpassword "Password for root account?" _rootpass="$_password" [[ -n "$_password" ]] && break echo "The root password must be set." done rootkey= $auto && ask "Public ssh key for root account?" none && [[ $resp != none ]] && rootkey=$resp questions user_setup set_timezone /var/tzlist echo fi diskinfo() { local _d for _d; do makedev $_d echo -n "$_d: " disklabel -dpg $_d 2>/dev/null | sed -e '/^label: /{s,,,;s/ *$//;s/^$//;H;d;}' \ -e '/.*# total bytes: \(.*\)/{s//(\1)/;H;}' \ -e '$!d;x;s/\n/ /' rm -f /dev/{r,}$_d? done } while :; do echo "Available disks are: $(get_dkdevs | sed 's/^$/none/')." _ask "Which disk is the root disk? ('?' for details)" \ $(get_dkdevs | sed 's/ .*//') || continue case $resp in "?") diskinfo $(get_dkdevs);; '') ;; *) isin "$resp" $(get_dkdevs) && break echo "no such disk";; esac done makedev $resp || exit ROOTDISK=$resp ROOTDEV=${ROOTDISK}a SWAPDEV=${ROOTDISK}b @*"x0"H0"`;bi:#$:į$,:8%4:,@"<:?"D:?"L:dP:?"X:H9"Xq;@"`:`?"h:@"(%;@":@":@"p:?"x:?":;":P?":0?":@p":$?":d?":"D<<":<"ĺ:<"̺:<"Ժ:<"ܺ:t<"::(M":(S";(S":K"HX;ԅ";":" :7"4];7":8":X"$:p",:q":q"4:r":r"@:r"H:lr"P:lr"X:d;"`:="h:#$:į$l:Tdt:d|:A":@Y":;"t:H"G"D"dG"E"E"xF"xxliliPؓdk@:dԄ"H:dԄ"P:dԄ"\:dԄ"h:dԄ"p:pdԄ"\d|i ii"""" ER"CE"STx"SL0"RR<"CE"STx"NMh""CL "0PL "0RE`"@RR<"CE"STx"PX|""TFp"d"PN<"RR<"CE"STx" # #D #&x#%<"&D #%%t#"L # #"%< #p #T #T ###0 #@"%%&%%p #t # #% # #D #'x#H'&&''ԟ't#"''8&'Ƞ'@''T #'''@"''&''p #ԗ'''x't:#ܙd4D-#ܙdnative2K'$-$-$2 &Ht&x&-$-$h%%$$-$-$-$-$-$-$(s&-$ % Щ%-$ xF'J'-$|#`#D'-$-$Lf#9'}&u&@&lB'\'-$-$ $-$-$-$-$-$-$8#0>'-$-$-$-$-$-$-$-$-$-$-$-$f'-$-$-$0O3-$-$-$-$-$-$-$T<':'-$-$-$-$-$-$##`#-$-$-$-$-$-$-$PX'n# /\#\#-$ U/-$@'O'dE'{$DP/O/-$-$#-$ %-$-$-$-$-$-$-$-$-$-$-$-$-$-$-$-$-$-$-$-$-$-$-$-$-$-$-$-$-$-$-$-$-$-$-$-$-$-$-$-$ XS/-$ %D# G'# R/-$-$-$-$-$-$ܸ%c'-$-$x;'9't#-$dQ/@Q/-$-$-$-$-$-$-$-$ # # # #-$ ]/h#H$-$-$-$-$-$b'-$-$-$<$#-$$# t$D'L$-$-$-$-$ho&o&-$$['L'J'-$_' XB' 8'`'@m'W'pD' ]' \'-$-$-$p##4#<#D#Ԍ##\#L##P#H##Ė###l#ԅ# d d dd>?? ' ` ~ ^ "' ,AAA AA'CEEEEIIIINOOOOOUUUUYaaaa aa'ceeeeiiiinooooouuuuyy"A"E"I"O"U"a"e"i"o"u"yA^A`A*A~ACE^E`EI^I`I~NO^O`O~OU^U`UYa^a`a*a~ace^e`ei^i`i~no^o`o~ou^u`uyL;$555,5555505555N:6 66T666666X6666????@`px|~ 08<>????????????????????????? @`px|~ 08<>????????????????? @`px|~ 08<>????????? @`px|~ 08<>? Boldface.iso1 eGallant #e\Je& e\ewfllllllll||| 0 `F8ll8vv0 000000 0 0f<0p000x6 0>p00p>p|`08l 8llF`0| 0|``f`?8`DDE9  2 2 a>wc`aaa?`  0  0f`vvf`    ` 00`000000006??a@ 0  @````@``@? !? ?1```@```0 00`gop``````p@??`@@000  000 ``````p?```<     `xx``88`9  ?0```g ollg`0? ? @@`@`````a``````````` `````` 0 @a``````````````````@a0@0@000?00000 0 0@0@000?000000x` ````a`` `0````````````````````````80acflxx|ngca`px00000000000 0 p`pppY`Y`Y`M`N`N`D`D`p` p x X L F G C A@@@`0 ````````````` @0@00`0`0`07000000x `````````````0@8@#a````|ngca`p0`` ` p<@`@``F p` ` ` ` ` ` ` ` ` ` p@?`@000 f f f v w@3@7@;;p` 0@8   @`p` 0@ ?   ?``00 || ||1`0009 ```gop````````p`xO1 ````p@0`````1 ````````p9`p0``````0`   1```1?`? `@ @ ?0p00790000000y 08````acf|x|ngcnf`f`f`f`f`f`f`p'y0000000y ````````p@8q``````````@p````  ````````p`8````s48000000x00@8 0?  @y00000009`p` 0@0@ pf f f 7@;@;@p@8  ` 0@0@  xp`A8 p`8    8 >`6gC0000~|V`s@ o`?0000?o`@ ``00`0?a00`0`00/@)@(@(@)@/@0``0`0`?` 6ll6 `??0/@)@/@*@*@+@0 33 ???<f0`~<ff< y00000009>`0000x?```?````````` 8<0`0`0`?l6 `` 6l08@@@@08 8D8D8@@@@ 000@9  ? @@` ? @@` ? @@`  ? @@` ? @@` ? @@`   # ##CCC` `````` 0 @  0@0@00?000 0 0@0@00?000 0 0@0@00?000 0 0@0@00?000 0  100`0`0``0`0`0`0`0@1 p` p X L F C A@@`0  ``````` @0@ ``````` @0@ ``````` @0@  ``````` @0@ ``````` @0@ 0`  0` `!!c`c`f`f`l`l`8@8@8o p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` 0@ ``````````8```acc````````ac 000900090009 0009000900096@&``?fff v@;1 ````p@0  0``````0`0``````0`0``````0`0``````0` Dl88lF ````p@8 'y0000000y  ````````p@8 ````````p@8 ````````p@8  ````````p@8 ````````p@8``#c`f`f`l`|@8?`` y00000009`y00000009`y00000009`y00000009`` 0@0@  xp````aaaaa`` 0@0@  xpJeKeKe$Ke4KeDKeTKedKedLe2eLe)LeaLe!Me3Me  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ͳɿپ̴ްe;|;;;;;<Dd66D66`<  % 3u Du u <u 8u 2u 0&'u 1&u 0&u     )%uu 0 1 8%u   3 D D%uu < 8 2u 0&'u 1&u 0&u  <t66t6#p\:<<*p07\0717 < <$<# # d<<x<<{{<8<<|=888588'8*8+8!8l&80$8&8|#8#8<x<T}8|8<P8P8<x8888ܥ88 8x8T<8D8x8p<8D8x8<P8x8x8<x88x8,<\88x8H< 8h8x8X!<088x8!<(8P8x8!<p88x8"<88x80"<88x8t"<88x8"<88x88#<L8t8x8@#<48\8x8#<88`8x8h$<8@8x8$<88x8D%<@ 9p 9<9 9l;4$.symtab.strtab.shstrtab.text.start.data.openbsd.randomdata.sbss.bss.arm.atpcs .) ! 8E(<@( .TeE$Bxe8EHxe8E$oM8E8EX;E@  @FǙ  <Texexe  / $G 0t &t!$T,H'4B"MQ78VX9n v38#4!P25'p$t04*"85d /.XS/;|)XS`%([8S8Lo.P2 ,:(,  7(/d\dd2K7+T*8Ed#Pg)c%0p9#8Xd;)\%Ht&8h%<\%)\@$ 1d'd.!8(=dIȹ7\T+ ](k9w{'Dd6$0p$`pd:4TkkQe-7(\8P *|#8/$>4dJldX2,e)!s(5L#\t6Tv5<(<|.-h,8#$*l Pk ]3L* '2&=^1Jjda6oTkz@*1\D7h-a#H3hd$_*|`"L!, t 41x"0@A*pTd@Z140hx7w(5<"80"@)T,dm!02h(Y'(Q150P4AL!X 8Pgm0s 1$8{(TeػdD8h\. l|~:td$C(|&di,Q54l3`@i '!xI6:iK@dQ$XW<b&Dj5vOe~3L\m.l#  hc%z7tČ'h(*2 / "P( T<7 ,F 3[ (de $y #` [!T /l Xc. W*\ e )9 8 &L 18 2* )@ D:"pS 1a io m" a,P 6)t 2h )D   l 44 Pd d $ ,0 3"8 5$- : : d$H tc.\ 8dl A6z xk k $+X P2 T{*X 6D 8  4( ȝ4 5 - }.XD h,T ,+_ im 5z & (%4 Tk  ) &8 h8 d1 ' i % d  # i@ $' < {"@L D8Z /j 1r i} ܥ/< #0 5x ԰d : z1` 9(| B&< 2t @%_!1"t'D'7;\iS/TbH#rD-#D$]3xT5dT$di8  -4P Ȁ >jSe& ,4L:`EP)/U6@j06hv45(.DX`%t(4\<:N" 4|1 9d 7  k+x&8(,@I%<Q5(`1gg((nغ50Kkx S5 dpx/dw,i԰8$h4(A7@$k0 ixd8`d%9l $2 |"x k7 Ԉ$A #M `#Y $4i .y 8 t5@ `. i $7  h,T S8 l2, l55 *$!D:)3!@9D!37V!4!o!X"<~!8<!Me!p$!Re!#D!#t!̟#!"8!LB!!C5!$X!p" "V6 "L@$/"q!D>",$E"m$Q"Td["@*f"L'(s"8(~"2"&&p"i"d#"hX4"*l"2<",i("2 $"7 #L"<##d!:#(M#L74X#4a#h6y#k##(#&#+D#2$ #du5#l.#(M"#6t#5 $k$2-$dk5$J4@$0dO$bi` ^$-kl$L0$ 5$+$7$6$2$7$9'$$4v2$l/0%K+8%t)`,%#(<%*|8,J*ܲ18Z*"j*$0u*)'* *7 *8%*Pd*9*k*/$*(k+̫7+P((+&P0+&8\=+`2TH+ Y+8`g+dq+L8+Y2 +M6T+ 054+ 4$+&(+xB5+ &t+$l+#,ԅ" ,.9(K."^.tA!hm.x5t.@.x.(6d.4,.k .d.,.Ld.j;)!l;<(;<;P7;tb.;p,4;#<L2X#< 7<(<@< #,O<d`<0dp<8&<@Q/$<ȼ.x<|5<"<Di<D&P <L]4@<tB%x<Ā<<@9 =D: =3L2=|*E=@7DT=DI*n= $=h*-=\1 =2p=d=X04=&=N4\=x5(=o4d=L}),>(\ >'d*>J(`5>#<C>f"$Q>@7@`>D5m>Pd}>i>X$>$['(>l"0>2>/& >x*t>(P>!>:>ho&x?5?&#?!$4?.Q?&W?2j?/,?@.?(1X ?ĩ'?k?: ? ?F9?(2X?/p?, @i@,#x@w),7@R7lH@o5lS@P)Di@4l/(v@ 0d@h*@ @<2@Di@Ti(@>'T@ T@| \@(7A}'<A<$`!Ada,-A&5A|&=AP8`RA$-_AK6HsAHdzA`/ADu"AhF9AASeAw5xA dA3 A54 A(2A< 7B#B\"!Bi#(Bi2B"l=Bt: IB#kZB7TcBdjBp5yBT 7pB0 Bp*B^dB$BtdBz*X C8.(C0*$C%*CD'7CИdGCMeNCd]CH{5|wCdC-3 C4: C`dC,C|#pC .,XC6 C$18C7 D;/D5D(Dd`5DD,@D$ LDd[DԄ"$iD\ PvDJ4DL44D|.D9'D7DH# Dd;)D6D+Dt HE1:x Ex"4 E`9D.E\38E(HHE 0\EddE$rEd7}E6<EdHEU'tE#EReETd E$7"E &|E HE,dELJ.(Fx: Fk`!F;2H6F-?Fl GFL['(RF88_Fd/kF4g%yFX1$F$ 8lF5F؁*F'F5(FK5@FxC.F$)hFR9FH8G 2 G$Gx=%$G|46G/GG8 ,SG7]GG: kG81}GdG7 G/4G+#xG\F9 G6Gh8G28Gu48 H1d'HX13HZ#4:HN*|RH-%bH$lHlk4yH*,HH'LH7H47TH0-H)lH$H)H('H I\&$IiI8Pe (Ih6;I*FI8 *_Ix: kIexI41}Il/0I8.%lI &5$Ile$I<%IC#I7dI4HI)LJ&|JiJ6+J%(3JLg"0@J\8\NJdTJ, hJh3sJ|#~J;"Jtg!XJ%J{iJd$J{(TJD25JxdJ%K&Klq* K(".Kv48>Kl(UKkibKXP8xsKd5KHk KXF!<K2KiK!/`K<&Kx&xKdt'KM(K0$\L%`L2LD6)L }8 :LHZ),TL"l^L-XhL5wL@t6pLd Ld4L6L3L@X3L $L$#XLU7 L3pL07 M$@ML.'$Mw504M9+?M.4QM'0\M0djM>9xM*Md#4MD!M7MkMH4McQiML14M#XM,}8MC7M7 N1N,.*N<\*HCNԷ+WNH*"^N(8<xNiNl)kNȫ-\ NX-dNdNXdN87N2N0$Nx%$N'tOl#%tO|#O\88)OH"9O, lVO % _O3sOE)@O2O@4TO2@Olr1DOh$!HOt7OP-HO!P!|P,7#Phk4P 'EP$`]PijPL!|P3P .PP,j&PiP 1HP dPd"PԽ&P(PD$Q(9\Q@d%Qp^3L/Q1>Q1XIQ3lXQAjaQ44tQTe.QT 3 Q&Q8 Q$ QkQ9Q&<R87R@.1R T.R\\:6R7AR5RRdddRt-xqRf*dRdRp'R`dRh6R.5,R!R9RQeR,37S 6\S($04SP;0t @SR4pRS/eS4R9nS4$HS$$dSh"S6S@,S&XS/$S`4|THd T 2T(,Tq"`?TpD5MT4kZT q,LbTԃ#xnTl.T$%pT#Th&,TL T5dT3hT,1/T+T8d U4<U(&U`d6U!CUXq.HTU2)hU`%$mUR7l~Uk8Uk4UkUd"<UdU 9 UO'U2UD8UkU$U5dV2!V7/V!=VX)lTV$$ iV0 uVdViV7VP&VԌ#tV3V|iV,f4TVs.<VTa%0VH6pV0/0V-XW_1W8P1Wh #)WZ1=Wn!LW|!9bW8kgW 'wW'#W?",W(DWD&<W$WkW"tX/& X&!X0(&X88X7BX\2TXt:#iX45uX`*X%X"TXiXT"X8X=5X48X$YК%` YTd-hY <Yp^7T0Ye-AYd7+LYP#<UYdiYHa.dwYxB1lYd.YxdY8Y1Y$5Y8 Yk%DY /dY\{!|Y2Zi Z #"Z,\1Z+8BZ8(MZd[Z)fZ,ktZ(Z$ZL Z4ZkZdZp1 Z`%|Z0'Z5, [M1 [4'[\L+l5[i'H>[,'F[((xV[P#h[! y[7h[_,[ .[ī2[#t[4.[4d([ *([#`\j!\|=8\T3(\d 5\\#LA\ܿ7L\"8`\ Hr\ 8x}\&D\4"t\9\x;'\{ix\p.$@\y&\%\,\' \pU! ]d8 ]H7$.]~'@7],ddW]*b]Oek],&'r]Pd] *t].]<]'0],i]td$])p]d]84^H$^X3"8#^j54^d5xC^kO^64a^#,n^t<4^lf(l^d^|d^0'^dG"D^82^#X^TT#@^ȍ<_+x_6)_`5x6_Ld$E_P*@P_"8b_-Tm_#P|_.'_h5h_pD'(_!d_,N9_4_$l_ L_(+p`l6$`5&4` 6/`Z+>`lkI`0?" [`#@i`#({`O3`$E: `/`) `*L`,#P`(#`H74<`d aX#9|%aD^67a875@BadVadca*xat (La%a0datT/,a\9a9a4q4Pa6&0a^%tad4bkb5$,bĀ*6b&/Gb'Rb/_b$:3ubv!b(lb6|b(-5lbLj/,bD&bh%Dbg)Sg(K)kg3wg,d~gdg|m/tgĘ*g,gigdg5\gd(g0ih4H!h-+h\Q#X=h3Fhi%Vh*pchH$shDdh 9\hj&<h$d(hm,$h<$h<; h,hkh0iik iĘ"`.iRe7i(tBi /LRid"8ciPTemi44D{iTa*i di,l"i/i%i{iiei140iD:iȏij2' j'#j$`7j6Ej,,`UjH~$(fjI9~jl2,jT0j`'<j#xj8!j"9Tjh/4j)k'#kd%t2kkCk% Lk0d7|Vkkmk. yk4$(k(kh%$khdk@Wikt2k\/Xk`),k|#k`s"l 8D&lLi/L:l\/QlQ6gld-7 {lo0lw.lop;$8NoD!dho(. voț8xo"*o$7|o3o(o3ods'o`w!Ho{5pd pv4`p|d#p&0d6p#',=p$%kJpQ&hQp1_pw.qpx8}p5$pX$`pDWip"xpV"p\8(p 3pM(tp48<pl7q̛0q/+qK.9q14Bq(SqP ^q@8jqp4{q4@#lq.4q@( q|iq/qpiqkq>.q2qn,rt7dr.l'rؓd 8r Er2Ur 2\`r"4qrY2r*rH<7drj(r9\r)rLdr8 rO68sx3sK"dsn44s28s6Is+tXsd8/fs$?8lts5sDc4sU/|sy3$sX1slq,s 6sisis{* t$tt5L$td7 /t-;t/kTBtPd$PtS#Zt0!kt $dytp-\t'0tdp#Lt|$t.(t8 t84t7`t, tA%t"% uXdu 4/u 7=uxdNu)fu\duu()Dui$ uT6`u% uHiuX6u 9Hu.Tudv& vd$vTU&D+v.$Avz'DKvp0klOv|&4,hvN1uvkvHdvd4DvTdvivp.(v30v3v/v8dw>"Dw $w2;w.DIw0Y!xUw3HdwD1iwX&Xxwn#w 50wl5@wdw<w9w8&lw|iw("w3`xO8x(<x$K8)xd3x4K%T5m{+|{d{\",{#L{ld{+${>&{@9{X+{8({po({&t{7  |?(l|t *|ldd@|č<L|d(c|4d||dv.|<#|,d|(',|Ў78|Ȫ'0|H-|'T|h%|xi|,2$|-@ }+}c#%}XWi/}4&48=} M'(G} 1hV}h/Xk}<.|}hk-}W7x}i}\Wi}T1}h3,}ix}k}.}@d},~i~ 4$~L7/~3TA~ u/S~h 6i~H.ts~$x"4~<~tO+p~496~ 5~l*T~Ld~1"~Hk300p  Z,(74H/4Md)U4#a3mT 4|d-$"\i @93p, D~*0 d"#\,,d7o hBTeJ05,W #ct6q^9@[id&D/t'xӀ#4$4" Z `6(k51AdO^/[8,!rA+~, tBjdkO1'ȁhiЁ-ف &8D-%tM4\4,|+89*Qx!4`!y3Xi3%XD<x*$/&Ĥ%xۂT #  8Td2$1 |17)(2>\/K-$U1Tf#n@ 9(z|/<dp 83ă,(0уt(L܃̏dA5g3 /<9X4t'44<B`, M6`lD)0t$i~|.T!x4&H k/X܄9V(6'<.t$1e#D'&TKu!@T8kXcX6s y0e,:b*H@.Dž@'@Ѕ& ,p540i \S7X"(?":< \Bx#I\('XNx0"X9b@4vp)@5`'4T#@'8D1lʆ0k҆x3D$0<4 Z,D$< 1$18@$pO67Xl68h I6lu1<-.C!D7Ƈ(H.0ԇLt*@H= T6/\% A%L*Qe3t8@45%Nd6@Y//tjl+Tv%T,.T$|*4H2Ɉ /L؈&$|( @H!xt6Tg08.*2<.'93<L-4Y(hj|*y9$| !88'd&x2͉|iۉ- h8(,t1ܒ" `6@̻d),"5<A 2<R̟/[v44hxdolix85hz*L3& Ȋ<9@֊خ(ފ0#8|2pA)@k'36\2Is,Y]/dkz#pddP06884D/8؋Xi83,3(/D'"u&): 6 ~8tJ5XU&e.|q"xyD_'4 5D. ï!D"Ō/4֌o.<9d 2"))64i@)Id\$i|Bjp'H}t['d 864#$4"`6ȍ<0lԍI9P!4NeX+Ld/%D)88<\6UI5gx$Tq470NdV00`Peg 8 v9`.|P#8x7|2'0͏,ڏ\!(D5 *T`7t%29SeC8+,N9`P$`j` y1D$/dĈ".lԐ>(ސ878h}($ *P(t)3DEc.TLd(b,8o@ 2<8(D &hL9Ddh784Б0kۑ$#T\*"4)i }),.%9#JW8Xt5\e2hy#<8 <(HI3`(DĒ$iђ H4 l3 y"p-7<#\d,7 9L~7 E50W$^. g̊$<s4K4pM40d͓hd ۓ8X(4@"  . X% #L((88 kJpd$W?" lijdt8{'D}4 ki6d03p֔tSeߔ6.pܗ,|N*HWi+P88(48I-`V/"](1g't'{t2\H1D4V#$-xeƕL1ݕ`i`"h(i#y%-@*A57ė1A4,Q(2`U4p42ub-Td*<*86$H"$v*ӖddޖX7 h( 84K0V#<\ 8os5x_83'46H2͞]40ݞi4d9D'" %z!@-Z!<:)PVTe^/&j4|3< 3@,6t1 K30dПh(1P4F.H̴dD'!8܁%\.4!X>|6Nt(0U(da.n%`z,$ ̌+  825Ġ#9٠5p.*U&a^'jiq|:P}D*hB(a+PG%L'Ƭ$i̬%P֬P/t(l6,8i4L3(@R6Ndjإ*ht|!0Ly64 L*@´`'(δ,d޴X9N8'<L6,$4!0I'h,8r!h@ &XKؽ88[}4Pmlkp/0Ht)x(S ,*kϵdT)d)l$74#L,8v(F`$PT'\3kC${J о54.d P*ɶ'Lն&0ݶ$65l3 14,/',8<%8H8-Uį$`ePel(%pvO0 !(d{,÷,"`ηSe׷8$4*)k/p.<F\*<[ 8Hgo)hU#`&<ml8 z &2Ld0|diѽx:޽d|+,($:  - ").5 ^/AS3Lh-`Y+d@m'8o (&̞2(9 d68Ҿd8"p6 dpx: '`4|86A`7`LI4Z$kf,ds<$i|3T%5$ /Ŀd׿<.(*H 5x.)<"(P0107 M8Z8fkzd)?$TTe$4{3$d%X,"6274L%Xi/L;78+$CP%M6"ZS8LnD:``2d6 30,X!Pky5)1 p"8%@!D'k*``*<Ft~# O|i]k"Djp5$|TE5`&X'4-D\]3P2Y2.!,5\ج21  Ldx3)&2(D:'@GD$<W<Z5k2~d #t86|k̭2؃.+tq( H38*p07\95ND34U@w6c'$q"}Pe05}&hdd#7h0dL9Di '807\$J!X/d 5P:0xI4iQX"]@F5d*rA#$D75$"4LWi\64.dPP3Oe8ild3'{"48в4HhdUx"/h&-w#kHDj'|p&D`8ؗ,*$e50J4 3İd!?/<)$-5|3C(@Q@$bT3Dk{"(w3ht3x#k48)$ k|3 L8,3 L)8U# 47p(lk : -A!6$6(Lp % T4*k("yx338&TA+43#kA*0h3p0c/8 $'P*p# h(-|"A<`6Q 1``ȼ#0l0r&|" !8`,8$6LD 2dli/kx-<<9\+H|'D{7)26T5$@Bx9Wx_'Ta6qk9#@t)8&PWiĹ.tddT85D!d .D+g305X'B$7pNdY'@jC1xdh7`2 iD@7`62/,&X#44 2,2X6@Q5$f44z"Td&R#3H*14$$\(5$,+ p% 7DS6/Л0B)8\ 5\n2d7d 752l./Dki&7i2 90 h<$?( /<7do8Bv70KT.'dTd`t5x-8(Y#`& "8 :&5l'4kD0x(d5+ ds()43Pd>,r%LD#Ydg#qxd.)( '8 7 5  A4)dh7&l 4#h.$"k9{* X$lܓ6|.`d( s*,/T0.p0-XSe6$6`b(8#Q#4dDP(4Y5$lP2$ *B)p6\2`)?(0/d$,;!H@8 " $8Oe@X5DM$U#6cT \k6&w3@@)TkBj$-4]4X/(+xX<0T^38(/,l&4Td`: o8P|D/h!0{5,(0iLi ,-4TV(-78 kt#(%0%H9d@"(L75XX&d3q-l}pc,#)T'lpd!.hi<<t7`< -$dY4+!'.x%5>_*dU`i`}#h0<q8`{)8(iLiH,{ir6P2\*6lE: p!`' d%-2?Xq8J74T@2` (m%ukT(3(* d-|1$&4o) Y 4R'$/,,.=2M8#lh"rT24P54(i|#d Qe+>94L$kdM 5X ha@,pO"${<<tm"0 <B%,0.@kx})^&d 2<&',#,% 0`)DE@r,U#L\|ii`t8xwM5k@L='8@]8T7Lq/\Hi4q?+X,!La08L878h64H$<DdH3H|S"\3x2*6x#PDt!lNTq-Y5o$d+X |\RedJ4.e#xL! "pM+d\#00H l8(,0<Ԯ)UtE:`L$ m-{D34d*H(%d&<Y!E/P(, *, h&Dh(&!@d+̥34</IdX,g%ur"Hd$P: 3449("4,ks4@di`,7Q8/$d7@t"H|iW8!tc(r0 2d~ x9@76$h8 dL1D4\-pd5X ș"H'tH'@,$Se6@15Hd$Pd^%e88x9`, @<p~$T&@LC5`$3Xx"4: ,D$ !,*+1T$\?A9Q7 _4,8ldtj8x6J.<"D|5d0r5XH4 '"r1!&(Te29t=pN+Mt]"Z6fdps2l+h'8 2$H F8"p-H,B$`|3П*X[8+ 24H9X3MhiZ,v!n'x|'Dp$8<i p(`Ħ1H~(X|#"Li g(< 5.n'8<!L\<(`T3_dik12TxdTk.ppd$d 0$#$L2 D5pi%#/~'T:d(Q3Ym'0d!LsC9h38p(iht4XQ*ii d8Ȏ8%$9.Ti8<6pB|2$V'^d<fLd4n$d@}dd$?" r4 Z/ {4P$)4p6d0iTi<5<,2 ;dG8$L7$VV:PfdQeo48(z5l4,#kl7p'` 58-8#LJ4.@it?%h-$9P3X&,B!S344j@{3w028.8dN7`9)d%d8<.\d(Pkip 9))t;(|9dKH4d`|2j0Lu}622.D%L/%d6D54 4*HQ( 6<PF9C4kOu/a_7ix2u/  p`*1pCjT#8 !48NeX44+&P*" -x+A0M(YxeeT4/P\7[x4m8$y,-$$C*4&2(c,H+ !p8  0 4<6|7((6%|6ix<7Fl- Q:XL'kfЪ!s7 .LS!`p6)\%8 ( 5. -T g' \28. X&4 L.49 (4M 4(T 80a t&u p9 +8 \07 /  d24l d `L7@ lr"\ #t  W8 ," &D) $\; DdL 8,TT C%a t$ n 2 n0 X'x /X /D $ *"4 g3, 5P 1 % 2 t<"5 83|> 3H M.U !l_ 4kq . ]' 8T Re J5 #X 49  4r#8 `,0 (D i ؚ8 1 b4x 2, 0F/46 8d? p7<H 08X ,g"g !w XB' I9 9t X' F#0 6 ) (d $  r7D p3# ̿d/ /|= 02HP p8T` ,2r ta7{ d J!  6 l* tU94 [# 57` 3 % 0l"<40.F(:Mk_ioT!|B30)Ld]5t,Y0 x"k|/8t7|*4i`%l /"t':(1Ti:D0Ldh'X\ 8(b:k2~x#& da-#$8.\`# 8(o,t2p*'l,288Hخ0Xԟ'c @sd4/*@Ѓ)45P3HE.d|K-0#l!8)_'4# Ne+0$882Hp1 Z fp-p${Ȏ<kشd@8lH807T-x9kL4(,\`M6,8'46$9/G,-_in$8}te9H ~'DHg-dXi 6hF4ll.l'4D #-/"ld,p.PCu&xP"8Wd_$Ljiuu.T&$\DPe& _9&|?$PDT3HNe\5|!4 d( $18@c&Pt7l^y58tJ4ر '6 |)XZ!&w.:+lOP9al1 g0vx8tS[+ahihx9"\}R40h%,)<&XK4*k6@5`1&4<)xD:9|30C-M,]08h)|8k 2`1 |!40d\$x(i<77\9(kn! 3{4C.Zm,\o6Xy$dd%#/8d-l6T9/)&T(@Li 4i,7<<5J|'l^\-g0$ w9'j.<Y2:"$\8(4$/0,'008(d`Se 3$1pN'(%Q018#$8A4>4F0d _x0XqkLz+)l%e4<{3PU! 6H L<2 ,'D <6T( /<4 (4,B  &\M @<W T-] TI ,i p0u Dg(< "$  (  TV: P8 T5/t ( (#d d 0d X8X!d H!d#!/8F!d-4V!l *8h!+\y!' X!\d!!0p!Q/!78!3(!$@!5!P1!ԙd!li"*"}*`&"L&t0"h ;"Z)R"V7p["(O8l"h2~"<' "8P"D8 ":x"l!"V5("a%<"hi"p2"D"#+#62#$S*|6#"\K# R#` `#p&l# e$0{#!#`d#h6T#2#p%#x.d#Td#0O3$i$xh,"$1"D/$* 9$8K$,(Da$k$&$|,H$(%k$2\$94$H#$X $ *$ 5$q0%/"%/D/%(k<%ddX%;4to%H)%(%#%6H%p6P%1%P#%4t%3 %r*p&03(&Y12&P =&1"E&t8U&8 c&+0v&4"4@&0:d&]30&!&h3&3&/L&(H&h3('2,'PQ8!'L24'$iB'лdO'h6dj'3Hy'*'q#'8`'7''''|2 P'5'X!'g4D(3(d(F#((4`9(H.DC("0lS(z5|d(.5q(Ne(Ȝ1p(D$(l4'('D(T8X( .4 (((P.(&H) D) 15 #))P5))E)$8T) #g) R. u)dCj)6\)d$4)%0)0")x 8@)@e ) d)g#) *,7x*3d$*4d-:*܅(J*$\Y*8Db*d@u*0$*Hd*/h*L&*`h4*81* $0*,5d*L0% +0! +h4@2+N4@+؏dS+4c+83p+h5l|+2+*+$r1H+5\+.+L]8+ 5+ܿ/,+T # +c!,%!P,d(x ,i',D #7,x!0$D,7N,E7Y,ȫ,g,)t{,%l,#h,E.4,02h,\28,ȝ6`,V7X,h6t,Oe-!p-H_#!-R#4-TX"<-0%F-Xo.DX-,lf-4K6`u-3dN36`f3K-xu3$Pe}3*@3`!t3\r6343h+83D%@3$8/@3P'k3&k402 4$d.0'4@894\5R42b4/`r4'<|4e#44&H49p47l4dT484M64}5`4358=9P5"5P&@25v%C5L'H5*4W56b5xCjo5xF"}5!0548565D#6\5,t5$")><2p1>7;>,0,I>:&dP>@#|_>f"Hl>`5v>24l> &>:>l">|i>Կd>d> >8>%0>9>`i>(i?<8%?8'8"?6 3?$/@C?(Z?l!f?(q?q.?,.(?d8?#$?("?#?1?d?%? 0)@l[:@,5!@*<-@)0B@(kU@l)h@4(Lp@S/}@W9@d@,"@X.@@:@@d@С5@`dAE# AM:AXv#0)A'\;A\#LIAl$XAH(jAԒ"wA4/A/AdA$hA%A`S5dAT05A\g4A8Ad BdBd)B$5Bd3D*(D,lDL+E8% E<"EH0 &Eؕ*6E3DEh2`EPb*wE8E@4ETWiED EM6E,E 2EkE(d$FQ&FU!PF3.Fd20LF$UF|&aF&LlFP1@qFdB9dF5Ft40F{iFL)LF S#0F8$!0FddF=1 G2G8<Gk$Gi32G@&<AG"pHGq'|RG0/aGitG5HGkGdGE"GHQeGkG^!(G%8G4#G )Hh#$Hd4H7=H̯/`Hld mH(8(yHV!xH<H8(HE: HkH4+H5HkH0 I8Ia1hIxU",+I#k8I(PFIH%LIH9"]IS 4mI/|Ih3@IK4(Id(I~)Ix:Ip2I,&8Ib'I%I< HJ  JHk(|1J#?J8) XJdfJX$nJM TwJd}J5|J85pJN4JT;"J_9JT<'J4 K|3\Kp4'K2`8KdAK"HUK 78dK$$xKD8KtY70K)0K]&`KdK7K,Kd+ KdKH'kK(PL4H L06,L<-&LLf#<0LO%IO0&VO"$fO\ $trO(+~Oԅ#O6OLi'OH,(O$iO`$xO $lOkO*3PM% P$P,'Pp3x2P/8OP}2XPidPTioPȧ.PiPk(P}8Pm/PHkP8iP.PL#<P. Q1%Qk#QHd1Q)?Q;&HHQ$6XQh8 qQh9/x{Q@*"QX"QL6XQ!Q6(Qt%Q &$Q'QdRk$R5)R/6R!SR6iR`&yRDP/R4Rh)R4"dR<3@R|!'R1R$RiR<#Rp'S)TS !SL*|9S|%@S!dYSt-eS4+vS0iSX&6S@iS%S9Sk Sd1HS iS&SP2S-:SȀ'<T9LTdT5@)TDk8T.\HTHk VT$:6XmT2$rTpRe{T ReT DTW9TtL%tTkT#Tr"PT`,XT|$T58U,@"T"U71Uy6tCU4HdU&dtUďi}U<,Uܡ6HU$5U\K4`UiU&0Ug!Ud8UeU9Vh $V/ V`4(,V29V@5xGVpiNV44aV p6nV2V 1V|*V d VLR3V-5V$1,VT$dVh0V`5V:( V&WH*!PWd2WD'(=WX"KWkXWldeWP8TrW8PW(PW2W3lWď2( W-<WiW. W2WkXb&8 X3lX@d,Xd4X d:Xl5`GX7 PX!bXH;$(qXf7tXԈ'XiXث&X0#TX ReX2XkX\2XXd Xy/X Y5'Y]!$=Y xMYP,[Y9 iY2lvY&Y6YXk9YCjY !4Yk(LY*8YXx*Z(!4$Zx8D8Z.IZTiVZ1fZz*Z "(ZP Z444ZV& Z$Z#`Z4HZĶ/l [(@[)d#[g/l7[A!hE[8(,P[8"P`[D8l[)~[ p[Me[h,,["[3@['[D2L[ 6 \\'\T8\+\%P6\8(@\~$xP\LK!hc\pio\u7~\5\y%\x# \&9\ls#\v5\#d\x|3$\ԩ'P\lh$]P$4]/%< ]T"L+]0K48]dF]d 3$[]do]iy]@50],]L D]P/8]-]T,L ]5]@5]@P#]dx ^@0^T4%x*^P*9^$)Q^#X^TM*n^` $$w^P#@^#`^TK4^%4^l$4^.^(` ^DV'^d^60 _4g1L_\8 0_<+9_S&B_ 6R_Hkc_8$ j_77@t_<-t_,_d_4b%_$l_Lk_4d_825 _X,_#$_D9_]*`p*& `d0`,=` ,K`d7@V`tg7c`p9y`8'`0 `d`d `d`K4`ld`t `3`,`d$a9a,l7$aP+L5aĐ: Ba,Oa4, \a%jax<paXd~a !aH8a4$aPkab1tapdahdax/dad bL9",$b,i1b2ep PNe&)|ceh"'jel8 xeu6e3e|de#ec'e!eG: e`'e3`eif+Xl8l+!l"@4l9>l_3GlJ64Wldiblڎ< mltB3<l'l3lI!l7\l"llp%Ll0 DlL8(lX00mim8T'lml$*mRe3m|':m$0Jm{3H\m8Timu.p|m+`mW9mTem3m2mԥ+m^&mx/m-ma'nt7 n03#%nq&,5n4Dn:)lXndfn}"Xpn3x|n+dnS(0ndn#Dnl4n8\6 n d(n0B7@n.< o,ohX#&o65oPd?o̍<LoL&RoQ-0 _o6<ko̩8voTeo%0o4%hot Pol-0oP9o0 Do6$o@$|o'`o7 p6p8d'p802p\6Bph6 Rp<5\fp-ppw)4pd&p6&lpc1pvd*LvH)^v0ihv\ 3~v=.LvT#vW v$+vP7* v42vM4v\'v8"< w|M94w$&wQe4w̜'4@w|xr/M|Ȇ6TU| h|('.t|%}|5\|L7|,.T|i|L$|14|\$p|O9|60|Tk|}8,} /0}8,)},/F}@\"P}d(g}dv}hd@}h$\}d4}pi}Q'}w*|}d}d$}]&~X"~z5t&~S! 1~d$<~`6M~G:b~X/i~82~~, ~D1~L2~8^/~xp*l~i~t!~O+\~l+t'4<x4(.|>)J#[P(s$:zd$`/t788( k t" 0'5@2 2t8P! 5l!p*$3f%>@B#PP7Y*dkdxA('@2L\$K+€)؀x.4Oh,hX'Ddil8~{$| 3@,2~2%|хHn"܅8)ptil5|p6&W0X3H *K8 Xk l8Sev̞5@,2e( $dɆ<64 "@X,7<Ld%T,2i;dPF6(U!c'L r@'`d7$dQ'p,%& Ho&V<bl78m6, 2p #d *D̋1% ֋Pd<*t0dd-tb0P!(/Li6'DA$H1"U9d<6lr`'0~+`L2tS/cOeji%u&$ /Qeswap_onwi_set_nwkeypfslowtimonanouptimebuf_rb_bufs_RB_REMOVErandomreadaxe_tickuaddr_bestfit_functionslongjmpwi_usb_rx_list_initproc_freesr_crypto_discipline_initkdb_trapvfs_allocate_syncvnodetc_setclockpcmcia_printarpresolvedp8390_readchange_displayparamchrtoblktblsw_reg_strategysys_minheritieee80211_tree_RB_NFINDputcharural_update_promiscuvmfault_unlockmapschild_returnsmsc_cartlabel_unrefHMAC_SHA1_Updatene2000_write_mbufsmsc_startuvm_map_initne_pcmcia_caipsec_soft_first_usenkmempagescopyinstraue_miibus_readregieee80211_send_group_msg1sys_getgidieee80211_tkip_micdofilewritevsdmmc_intr_establishwi_inquire_usbdumpmagieee80211_derive_ptkttyflushsys_setsockoptsys_ppollcomdefaultrateieee80211_watchdogclock_gettimewihap_sta_disassocdefrouter_lookupinetswwi_get_fid_usbwdog_periodcdce_rxeofip_reassrt_maskedcopyin6addr_anyVOP_ACCESSusbd_get_quirksip6_get_prevhdrscheduler_startdb_logpxa2x0_gpio_intr_stringpmap_alias_bitsuvm_maxkaddrnsphy_cdumass_io_puticsphy_resetieee80211_getmgmtrlphyattachpxa2x0_gpio_intr_establishipmforwardingmainbusprintohci_waitintrzssp_read_max1111sys_closeusbd_do_request_flagswsemuldisplaydevsubmatchrtflushclone1ffs_inode_allocdes_encrypt2sys_setsidieee80211_encapax88190_init_cardzaurusmod__ashldi3vn_statunp_detachnd6_nud_hintether_ip6multicast_minusbd_submatchtcp_secretrti_find__mainaue_stopufs_quota_deletehardclocksd_vpd_thinenc_xform_aes_ctrieee80211_eapol_timeoutsr_raid5_discipline_initsr_rebuild_threadwi_read_data_iowdc_reset_channelin6_domifdetachieee80211_get_authvtagsmtx_enter_trysmsc_sethwcsumwskbd_cndetachdb_get_variablecd9660_vgetieee80211_inputcrypto_dispatchsr_discipline_shutdowngeneric_armv4_bs_wm_2if_group_routechangesys_fstatatnd6_timer_workwsdisplay_burnerpxa2x0_apm_sleepohci_device_intr_closeurl_csr_read_2dest6_inputgsignalacphy_caipport_firstautomii_mediachgwi_txeofaue_devsipsendredirectsbpf_setifunp_internalizetk_rawcc__wdstartscsi_xs_sync_donefc_lfcemptyvfs_export_lookuprasops_eraserows_rotatedif_cloners_countifnetyieldohci_endpdm_freemwsmuxattachuhid_seltrue_filtopssc_print_addruaddr_free_rbtree_RB_NEXTfilt_seltruecomspeedlogsmsc_tick_taskvn_writechkin_ifscrubarmv4_tlb_flushIuvm_pmr_freepageqdp8390_media_initpdevnames_sizemichael_updatescsi_mode_select_bigroute_dstsingle_thread_clearinit_execsr_schedule_wuuvm_pmr_size_RB_NEXTuvm_addr_alignieee80211_send_4way_msg4wskbd_cdsdmmc_mem_enablezaurus_udc_attachnamecache_rb_cache_RB_FINDbcmpgeneric_bs_r_1ieee80211_node_detachdb_set_breakpointsnd6_dad_startexec_maxhdrszdb_force_whitespaceSHA512Initieee80211_ifattachmmmmapieee80211_clean_nodessetjmpsd_read_cap_16prefetch_abort_handler_addresswdc_disable_intraes_ctr_reinitbio_infowsdisplay_switchurlphy_funcsuvm_deviceopsuvm_addr_align_backlogread_filtopsrasops_cursorvndxfer_poolcpu_info_primarytcp6_mtudisc_callbackcopyoutstrieee80211_countrycode2regdomainusb_transfer_completelxtphy_servicepxammc_matchapm_suspendscoop0_set_card_poweruaddr_stack_brk_selectswcr_newsessiontcp_attachla_hold_totalwskbd_cngetcbuf_dirtysoo_writesystempageieee80211_align_mbufm_zeroural_alloc_tx_listnd6_llinfo_timervn_fsizechkunp_gcingreaddoslabelbdevswcalctsrubaddynamicportsworkq_initohci_root_ctrl_closeX_db_line_at_pcural_ack_rateuvm_mk_pclusterbswap16domainnameuvm_pmr_addr_RB_REMOVElockinitwsmouse_detachttywrite_filtopswi_usb_devsnd6_ns_outputbpfkqfiltersorwakeupinflateCopyttyunblocksr_meta_opt_loadbiocloseremovedeudav_miibus_statchgigmp_timers_are_runninguvm_deallocatefilt_procattachufs_quota_free_inode2filt_procdetachsys___thrwakeup__divdi3wsemul_getnameallowpowerdownsys_clock_settimeural_txeofwdc_floating_buspxa2x0_spllowerlocnameshidkbd_bell_fndisk_busydb_breakpoint_allochidkbd_belltcp_pulloutofbandevcount_sysctlsqphy_statussddetachmouse_copy_extend_linezapm_power_infoarprequesttfork_child_returnsiginitsr_wu_enqueue_ccbpool_set_constraintsusb_task_thread_procip_sysctluhidev_closemsdosfs_vptofhscsi_mode_sense_bigusbd_clear_endpoint_stalldb_vnode_print_cmdsetdisklabelbio_registerdeflateknote_removescoop_pcic_writepmap_bootstrap_pv_page_allocbufq_nscan_createsr_hotspare_rebuilduvm_mapent_addr_insertroutedomainusbf_interface_numberhid_locateicmp6_errorVOP_MKDIRpool_large_freertl80x9_media_initip_protoxsys_settimeofdaypcmcia_read_cissdstrategyaddloguvm_page_physgetusbf_add_taskmsdosfs_synccheckdisklabelscoop_pcic_attachscsi_mode_senseip_savecontrolstackgap_randomvm_map_unlock_lnffs_clrblockusbd_set_hub_featureuvm_addr_linsearchbpf_filterchgproccntip_drainieee80211_tree_RB_PREVdb_map_print_cmdumass_init_shuttlesoqremque__adddi3uvm_map_inheritusbf_rem_taskapmopensys_getthridcd9660_syncin6_ifawithscopebuf_page_offsetuvm_pmemrange_addr_cmpkm_freeusbd_is_dyingzts_pollsync_printvnopsieee80211_rssadapt_inputsys_lchownmsdosfs_removecd9660_readdb_read_tokenieee80211_regdomain_compare_rnfilt_timerdetachwi_get_idzeroin_addrbmtphy_cdwdc_set_drivecyrillic_to_koi8uvm_map_protectusbd_get_xfer_statuswsfont_enumpxammc_clock_stopuvm_map_setup_mdprintfpxa2x0_splraisecdce_devsrandomwritepxa2x0_cpu_suspendprelist_updatehmac_ipad_buffercrypto_drivers_numsmsc_miibus_readregip6_protoxsys_recvfromswcr_freesessionttrstrtwskbd_mux_openrandomif_getsysctl_doprockcopysdmmc_mem_mmc_initzts_sync_sendwsdisplayopenext2fs_initrtfreesingle_thread_checkpxaudc_freemcuio_getptrcd9660_linkwsdisplay_emul_detachhostnamelenupl_cdusb_needs_reattachdeflateTunezkbd_cnpollcuaddr_hint_selectxscale_cache_purgeID_rngttyopenraw_ctlinputwi_usb_ctl_unlockzkbd_devpxa2x0_gpio_iohnd6_ioctlsched_chooseproczssp_ic_stoplcd_set_brightness_internalphyslockspec_setattraxe_miibus_statchgpte_l1_s_protousbd_get_stringfill_prlistipsec_exp_allocationsHMAC_SHA256_Finalbpfcloseusbd_probe_and_attachsys_writevsys_setprioritym_tag_prependaxe_cmdurl_unlock_miiumass_detachusbd_free_iface_dataip_defttlwi_usb_attachurl_rx_list_initusb_schedsoftintrarpintrsdmmc_activatewsemul_vt100_output_scs94_percentkqueue_registercred0in_delmultisdmmc_io_rw_directsdmmc_io_write_2pxa2x0_init_interrupt_masksuvm_forkdisk_lookupuid_findumass_activatend6_rtrequestuvm_km_suballocusb_delay_msrasops_eraserowsif_getgroupattribsbpfdetachsys_closefromttydefcharssigexitscsi_link_openhidirtypagesin6mask128bus_space_read_raw_multi_4uvm_amap_poolin_pcballocVOP_LOOKUPsr_raid5_regeneratesr_meta_readdb_shift_exprapm_pxaip_caphysical_startbs_notimpl_bs_c_8ifa_delpcred_poolenqueue_randomnessexphyattachusbd_set_idleieee80211_find_node_for_beaconemul_nativeaxe_txeofwskbd_inputacphy_cdcrypto_getfeatsdmmc_printwsmux_attach_sccpu_do_powersaveaue_rx_list_initwsdisplay_kbdholdscreenuvm_km_pagesufs_quota_alloc_inode2ieee80211_name2countrycodemicrouptimesr_validate_ioaes_xts_decryptsocket_poolsr_raid_recreate_wupgrphashsys_setpgidprofhzAES_GMAC_Updatesr_meta_init_completentp_update_secondcache_enterdb_watch_tableexec_elf32_makecmdsusb_rem_wait_taskext2fs_bufatoffsys_setlogininitarmamap_listpxa2x0_lcd_suspenddb_trapip6_maxifprefixesieee80211_node_cache_timeouttcp_do_rfc3390ieee80211_req2nodesys_setresuidpxa2x0_lcd_load_fontcrypto_kinvokern_deletesd_get_parmsiskmemdevstat_rush_requestswi_watchdogipsec_def_compfc_lmdistancepxa2x0_intr_stringnch_poolphtree_RB_REMOVEsomaxconnsdmmc_card_intrural_readugl_initpxapcic_socket_enablescsi_xs_get_donepxaudc_ctrl_methodsipsec_exp_timeoutip_directedbcast_bus_dmamap_loaduvm_pmr_pg_to_memtypeuihashtblieee80211_node_getrssitaskq_syssd_buf_doneieee80211_get_rtsamap_initffs_flushfilesicmp_sysctlsys_lseekdes3_decryptllinfo_arpmsdosfs_pollmsdosfs_accessaddupc_intrdvd_read_bcaamphy_servicevm_map_lock_read_lnwsevent_finiip6statwsmux_set_layoutuvm_pageboot_allocconfig_pendingmii_phy_updatesys___thrsleepether_crc32_leaue_csr_write_1ipipstatsecureleveldb_consoleurl_matcharpt_keepsdmmc_mem_mmc_switchsavectxdb_printsympte_l2_l_cache_mode_ptbinuptimedogetrusagesys_seteuidpxa2x0_bs_allocuao_shrink_hashugl_rx_list_initwskbdpolluvm_map_checkprotmax_protohdrcdce_activatedes_is_weak_keyural_rf_writedb_access_irq_spzapm_poweroffieee80211_add_qos_capabilityieee80211_cipher_keylensdmmc_alloc_ccbsumass_scsi_attachsr_raid1_discipline_initrandomkqfilterbufpagesusbrev_strsleep_setup_signalrlphy_cdprocess_newsys_keventcopyargsarc4_reinitsr_chunk_in_usewd_standbymi_switchcd9660_statfsrasops_rotate_fontsysctl_sensorssr_scsi_wu_puttsleepkern_sysctlnd6_delayin_pcbinitsys_fchmodatsqphymatchbs_notimpl_bs_rm_4nmbclust_updatehw_prodfdremovepxaudc_softintrigmp_fasttimoatomic_setbits_intuserconf_cmdbufwi_get_pmumass_bbb_statedb_print_loc_and_instohci_device_ctrl_abortrt_mpath_matchgatecdce_startapmioctlusbd_port_disown_to_1_1uvm_map_entry_poolcrgetunp_bindtcp_delackcsignalreaddisklabelvm_map_unbusy_lndb_print_cmdusbd_clear_endpoint_stall_asyncwskbd_set_displayvirtual_availbs_notimpl_bs_rr_2tcpstata4x_bs_r_2dma_constraintdb_break_tableuvm_anon_poolicmp6_mtudisc_timeoutfillmapentrytcp_timer_persistugl_intrwsemul_vt100_output_esc_hashcpufunc_ifarudav_newbufsys_umask_tr_flush_blockpow2dividesyn_cache_reaperieee80211_find_rxnodefilt_fileattachsysentcpuset_addpmap_alloc_specialsbs_notimpl_bs_r_8tcp_setpersistufs_ihashlookupscsi_inquire_vpdicmp_rediracceptmemmoveapmcloseusbd_get_hub_statuswsemul_vt100_detachworkq_create_threaddb_boot_halt_cmdural_attachip_outputbpf_mtapnkmempages_maxfindblknamekue_rx_list_initpool_inituvn_referencelcd_ioctlpcmcia_card_attachuvm_pmr_addr_RB_PREVbpfreadbio_errorpxaudc_ep0_intrpool_putm_copym2sr_raid5_addiobuf_alloc_pagessysctl_structbufqs_stopaxe_ifmedia_stssysctl_rdstringuvn_attachsdmmc_send_if_condlasttimesr_wu_putcryptoclosesysctl_disklockcnkqfilterdesiredvnodesbs_notimpl_bs_r_2ufs_pollsr_raid5_writepmap_map_sectionmsdosfs_readlinkpmap_devmap_bootstrapdes1_encryptieee80211_decryptusbd_get_device_statussdmmc_verbosenchinitexec_mapdb_qualifysnprintfcomcngetcext2fs_readlinkether_ioctlumass_bbb_transfertqphy_servicescoop_pcic_functionsip6_forwardingsr_shutdownural_cdkue_resetarp_allocatedrasops_isgray_bus_dmamap_load_mbufwdc_print_capssdmmc_io_write_1wi_watchdog_usbifindex2ifnetcd9660_ioctlrt_mpath_conflictin_pcbnotifyallmouse_copy_worduvm_pglistallocsyn_cache_addpool_large_free_niohci_device_ctrl_transferwsdisplay_addscreenbuf_kva_enduvm_map_splitentryvm_map_lock_lnincoreurlphy_cdhzusbf_attachdefrouter_resetcd9660_ihashinssched_exitcheckaliasdl10019_mediachangecue_activatettyretypestartuphook_listsdmmc_card_detachpte_l1_s_cache_modeuvm_pmr_remove_addruaddr_pivot_poolkue_detachrt_timer_queue_changelf_initwi_ioctl_usbcpu_attachwdc_preata_drivemii_phy_matchpxaudc_cdural_amrr_timeoutzlibVersionrasops_list_font_cbzapm_enable_chargingsdclosevop_generic_kqfilterzts_attachpffasttimoinitsiginfosys_getuiddb_set_cmdcomconsunitcpuidsexec_setup_stackuao_createdb_free_watchpointssensor_detachifaddr_items_RB_INSERT_COLORbuf_mapaue_lock_miiidentify_arm_cpuffs_realloccgcdcef_newbufwskbd_load_keymapxscale_cache_cleanD_rngm_clpoolpxaudc_zaurus_cacd9660_bufatoffgroupmemberuvmspace_initscsi_plug_detachether_sprintfmsdosfs_unlockselwaitpmap_init_l1icmp6_mtudisc_callbacksnd6_slowtimosys_forklistbufq_implsip_setmoptions__qdivrempmap_deadproc_cache_stateifaddr_items_RB_PREVpxagpio_reg_readspec_openpmap_vac_me_kpmapmld6_checktimerswcr_sessionsfilt_bpfreaddb_watchpoint_freesr_disk_attachwsdisplay_emulinputuvm_fault_wireusbd_abort_pipepcmcia_ccr_readkernelstackicmp6_mtudisc_timeout_qcrypto_initvm_nphyssegifaddr_items_RB_NFINDip6_randomiduvm_pseg_initproc_filtopself32_os_pt_notewdc_print_current_modesSHA512Transformfiledescopensys_vforkpmap_vac_me_usercomcnspeeduvm_pager_initcpufuncswinChkNamepxaip_matchdvd_read_copyrightieee80211_recv_4way_msg1bio_delegate_ioctluvm_pmr_addr_RB_MINMAXdb_history_prevpxapcic_scoop_casys_mkdirdl10019_media_finiuao_reference_lockedcom_resumepmap_devmap_tableufs_fhtovpcrypto_donewskbd_translatedumppcbusbf_string_descriptorrttrashtargetpagesohci_root_ctrl_abortmblowatrasops_rmaskgetnewvnodeufs_inactivekue_load_fwnd6_mmaxtriessingle_thread_waitsys_socketffs_cgreadwi_init_usbwsemul_utf8_translatevm_map_lock_try_lnzssp_read_ads7846spec_close_clonevop_generic_bwritenanotimeufsspec_writelxtphy_casd_read_cap_10iso_disklabelspoofpcmcia_cafdfreeuvn_detachieee80211_ccmp_set_keyuvm_km_valloc_trytty_countugl_cdhidkbd_detachdeflate_globalpxaudc_intrraw_disconnectpxaudc_ctrl_closesensor_task_registerip6_neighborgcthreshbufkvmKERNEL_BASE_virtpxaohci_activateremove_coproc_handleratomic_clearbits_intumass_polled_transferdeflateSetHeaderuvm_pmr_extract_rangebrelvpsensor_attachgpio_strobe_pins_c3000msdosfs_mountfsvfs_relookupuvm_map_addr_augment_getsys_utracencpusfoundwi_stopzts_ioctlsync_fsyncsetstatclockratecd9660_strategyuserconf_parserrw_initural_tx_bcnpxaudc_intr1ext2fs_alloczapm_ac_onpmap_cachevivtusercryptowskbd_deliver_eventdb_eregscom_fifo_probeieee80211_delba_requestbread_cluster_callbackfdcopypxapcic_event_processin6_proto_cksum_outbuf_acquire_nomapemul_findAES_GMAC_Finalb_to_quvm_pmr_size_RB_INSERTin_len2maskbus_space_read_raw_multi_2ugl_startpxa2x0_lcd_setup_rasopsscoop_set_irledusb_blk_freelistudp_sendspacerasops_alloc_screenscoop_gpio_pin_readuvm_objtree_RB_PREVifg_headvfs_rootmountallocSHA1Updatecue_tx_list_initbs_notimpl_bs_sr_2netintrcd9660_openrw_initwsemul_vt100_output_dcsglass_consoleAES_GMAC_Reinitsr_uuid_generateohci_root_ctrl_startvm_map_busy_lnbuf_rb_bufs_RB_FINDcmask_bss_end__ext2fs_blkprefdb_pool_print_cmdwi_alloc_nicmem_ioicsphyattachdb_delete_linescsi_activateuhidkqfilterVOP_ISLOCKEDsys_kqueueAES_GMAC_Initieee80211_tree_RB_REMOVE_COLORuao_referencein6_addrscopebuf_getsys___threxitieee80211_ifdetachdb_searchapm_get_eventbs_notimpl_bs_wm_4vfs_getcwd_scandirmaxlockdepthwi_usb_tx_unlockieee80211_free_nodeieee80211_node_leave_11graw_usrreqnblkdevinitiduhidev_detachbs_notimpl_bs_wm_2sr_crypto_hotplugttyinputscanc__stack_smash_handlerukbd_consopsbiodoneural_activatedb_set_breakpointzssp_activateicmp6_rip6_inputwi_usb_txfrmsmsc_encapmaxslpext2fs_makeinodecue_startaue_csr_read_2ufsread_filtopsufs_symlinkm_dup_pkthdrsr_crypto_assembleufs_mkdirvfs_getcwd_getcacheusbd_get_no_altssdmmc_initural_newassoc_length_codenamecache_rb_cache_RB_PREVin_iawithaddr__anddi3phtree_RB_REMOVE_COLORrt_missmsgVOP_BMAPip_dooptionsvn_lockcue_tick_tasktimeout_add_tsrip6_ctlinputscsi_link_shutdowncdce_caSHA384Initwsemul_vt100_handle_csiumass_cbi_adscsbdropsr_meta_native_attachmsgbufphysuaddr_free_rbtree_RB_INSERT_COLORusbd_desc_iter_nextscoop_discharge_batterytcp_debugusbd_transferinpcb_poolohci_pollohci_hubdnextralocsmsc_miibus_writereguvm_addr_fitspaceblf_keysys_setegidbus_space_write_raw_multi_4wdc_wait_for_statusrn_matchcd9660_symlinkautoconf_verbosein6_setpeeraddrunp_externalizesys_munlockalluvm_faultscoop_led_setrandomioctlsoftraid_disk_attachsoreceivepxaudc_connect_intrpool_getuextralocsdmmc_discover_tasksharp_zaurus_C3000scsibus_printlinkdb_show_radix_nodeudav_csr_read1ieee80211_eapol_key_inputohci_root_intr_startffs_dirprefrip6_outputinflatescsibus_cdin6_get_rand_ifidndflushpxaudc_allocxcompose_tab_cmppxa2x0_lcd_start_dmaieee80211_parse_wmm_paramsrn_insertspec_pollbpf_wakeupfilt_kqdetachdb_flush_lineaue_unlock_miiwsmux_getmuxipsec_exp_bytesbufqueuesconfig_defersys_faccessatgf_mul_bus_dmamem_allocm_tag_initbsearchif_attachsr_crypto_free_resourcesugl_casys_setrtablelcd_get_brightnessm_reclaimsr_raid_read_capuvm_map_addr_RB_REMOVE_COLORnameibs_notimpl_bs_sr_4uvm_map_setup_entriesext2fs_readdirip6_ctloutputdead_pollpte_l2_l_coherenttqphy_funcswihap_initversion_bus_dmamap_syncuvm_pmr_remove_sizelzs_dummybuf_needvakqueue_initieee80211_wep_delete_keyaxe_rx_list_initata_dmaerrieee80211_bip_set_keyuvm_pagezeroin6_setsockaddrigmp_leavegroupcom_common_getcbs_notimpl_bs_rr_8mountlistuserconf_histbufsys_getdentscomsoftwihap_mgmt_inputudav_initVOP_REVOKEconfig_deactivateSHA256Finalclallocbiowaitusbf_insert_transferfilt_ufsreadrasops_vcons_cursorunixswuvm_objtree_RB_INSERT_COLORdb_stop_at_pcsccstqphy_cawsdisplaymmapccpupmap_updatepxa2x0_gpio_intr_maskgeneric_bs_sr_1hidkbd_inputprocess_zapsr_raid6_wu_donefdinitboothowtoarc4randomnsphy_funcstcp_delack_ticksupl_stopttopenata_get_paramsukbd_apple_iso_mungeip6_randomid_initieee80211_tx_ba_timeoutether_ipmulticast_minconfig_rootsearchrip6_sendspaceieee80211_countrycode2nameuao_dropswapin_addprefixenxiosys___getcwdcd9660_specvopsusb_cdrnd_event_headwsdisplay_switchtoconsolein6_maxmtupmap_enteramphy_funcsundefined_handler_addressRMD160Transformsys_setreuidSHA1Initusbd_ratecheckwi_usb_open_pipesudav_tick_taskuvm_map_findspacewsevent_initl1_sec_tablecryptoopencomcnattachuserasymcryptodb_var_rw_intwdc_xfer_puta4x_bs_w_2sdsizeuao_dropswap_rangesys_pwritevudav_lock_miikqueue_scanieee80211_pmksa_findusbd_iface_claimedtcp_closeohci_free_stdsd_patternsX_db_search_symbolsdmmc_disablescsi_initmsdosfs_advlockdl10019_mediastatusswcr_idwdog_registerkue_attachusbd_free_xferdb_varssys_utimensatfalloclxtphy_cddeadproc_mutexdb_breakpoint_freepfctlinputcomcnprobephys_mapext2fs_pathconfumass_bbb_methodssoft_intrqdeflateSetDictionaryufs_lockcomintrsys_accessnsphy_statusuvm_swap_iouserconf_initkillpg1url_tx_list_initwsmouse_mux_openarpproxyvputonfreelistmouse_removewdioctlext2fs_mountrootieee80211_findrateregyearurl_ioctlpage0setrunnablepool_do_putpxa2x0_pi2c_closeuvm_pmr_getpageswi_set_ssidcue_ioctlzts_accessopsnd6_prefix_onlinkffs_specvopscue_attachpxa2x0_stray_interruptelf32_read_fromosversionhid_is_collectionnsgphy_statuswi_usb_tx_list_initapm_power_infofind_pfxlist_reachable_routerip6_pcboptstvtohzieee80211_get_eapol_keyphtree_RB_NFINDratecheckpxa2x0_imaskin_rtchangevfs_syncwaitudav_ifmedia_statusaue_crcffs1_reallocblksieee80211_node_lateattachcansignalieee80211_up_to_acmsdosfs_check_exportlf_setlocknbigpipecue_devswsfont_map_unicharin_controlieee80211_get_addba_resprlphy_funcswsmux_srcopslmaxuvm_pagecopyphtree_RB_NEXTzssp_ic_startsysctl_quadsys_readexec_process_vmcmdskue_tx_list_initpxa2x0_pi2c_setvoltageieee80211_tree_RB_FINDm_cldropmbstatuhidev_intrttyinfodb_flush_lexusbf_transferttyinohci_root_ctrl_donegetnulldevispidtakendb_dmesg_cmdsr_meta_save_callbackextent_destroydb_lpenc_xform_rijndael128if_group_egress_buildzapm_pollloop_clonerttsetwatergetcieee80211_addba_requestsr_raid6_intrfilt_apmrdetachifaddr_items_RB_INSERTdb_last_addrural_update_slotmouse_copy_startuvm_pseg_lcksr_ioctl_volpmap_enter_pvmsgbufenableduvm_mapent_mkfreeunp_disconnectsys_listensys_mountbpf_mtap_etherpgsignalfirstcdb_read_bytesuhub_detachusbf_set_addressieee80211_ccmp_delete_keysr_failioffs_fsyncwsmux_mux_openrasops8_putchar12wsdisplay_consinetdomainwsfont_findscsi_devid_wwnmemcpywdc_enable_intrkthread_exitaxe_activatescsi_req_detachcue_newbufdisk_constructvfs_unbusywsdisplay_paramrip_usrreqvm_map_upgrade_lnspec_writekq_timeoutmaxsdmmc_inquiryin_broadcastfd_getfilesr_sensors_deletehidkbd_set_ledsmsgbufaddrsdioctlutsnameip6_setmoptionsexit2usbf_set_configaue_resetkue_open_pipesip6_mloopbackext2fs_cgupdateieee80211_send_4way_msg2tcp_update_rcvspacerddumpusbf_set_endpoint_featurecpu_setperfuaddr_rnd_poolufs_lookupufs_bmapdoasyncfreepxagpio_cdudav_miibus_readregcpufunc_dfarip6_randomflowlabelttpolldegetlogpollkthread_createsdmmc_mmc_commanddb_elf_sym_initwdc_default_read_raw_multi_2logclosesd_vpd_block_limitsieee80211_kdfgeneric_bs_wr_4pcmcia_submatchinstall_coproc_handlernd6_dad_findohci_rhscudav_detachufs_strategysr_crypto_create_key_diskohci_device_requestkue_watchdogphysical_freeendcopy_statfs_infobounds_check_with_labelarc4_timeoutsr_raid1_assemblesd_ioctl_cacheext2fs_checkpathsocantrcvmoreprocess_poolip6_setpktoptfile_filtopssr_raid6_rwbuf_unmapmsdosfs_renamesysctl_proc_argssdmmc_mem_initpipe_wfiltops__lshldi3purge_detachedpfxrtr_addcd_load_unloadipq_poolpxa2x0_rtc_getsecsuaddr_kbootstrap_destroypmap_activatebuf_dealloc_membmtphy_resetconfig_make_softcpte_l2_s_prot_kruaddr_stack_brk_functionsunp_discardcue_csr_write_1ip6_outputwi_read_record_iouhid_caudav_rxeofwsmux_get_layoutswap_syscall_lockufs_kqfilterieee80211_newstatescsi_autoconfcheckdirsexecswwsfont_addzapm_batt_minutessr_raid0_createsdmmc_set_relative_addrnsphyter_cdumass_atapi_attachwsemul_vt100_output_csiin6_are_prefix_equalin6_controlpxaudc_bulk_startuvm_pmr_rootupdateleapyearsleep_finish_timeoutsys_sigsuspendcd9660_unmountwsemul_vt100_output_scs96swcr_authcomputenamecache_rb_cache_RB_NFINDtrapsignalpxaohci_enablerushjobpmap_devmap_registerrn_inithead0db_single_step_cmdwd_flushcachend_defrouterblf_decfdcloseexecuvm_map_sel_limitsevcount_attachlimcopybio_doreadwi_do_hostencryptscoop_activatescsi_req_probeuvm_mapent_forkcopytcp_timer_rexmturl_ifmedia_changepcmcia_io_maprt_timer_initnd6_useloopbacksr_crypto_rwuaddr_rnd_createieee80211_next_modeputsaxe_tx_list_initrip6statip6_id_ctxtcp_debxcnpollcd_casdmmc_task_threadsys_truncateesigcodeacphy_servicescsi_xfer_poolsysctl_wdogscoop_pcic_clear_intrarmv4_tlb_flushIDudav_csr_readohci_add_doneieee80211_tree_RB_NEXTsched_choosecpu_forkohci_add_edwdc_xfer_poolcdce_newbufsoacceptkqueue_pollcdgetdisklabeldb_call_depthlcdintruaddr_pivot_randomdb_printfuhidreadin6_ifaddloopufs_creatend6_freend6_optionscd9660_seeknd6_llinfo_settimersr_roam_chunkssdmmc_mem_write_blockfreqmsdosfs_unmountelf32_load_psectiondb_show_all_bufsrn_mpath_nextnamecache_rb_cache_RB_MINMAXtaskq_create_threadarm_pcache_unifieddb_add_symbol_tablem_tag_nextohci_intr1msdosfs_writezaurus_udc_detachcue_resetbs_notimpl_bs_w_1exec_script_makecmdszapm_resumeieee80211_reset_erpfilt_pipedetachcd9660_rootentropy_add_ptrdb_unaryiophyattachzts_readposne_pcmcia_get_enaddrdisk_attach_callbackselrecordffs_validatecomstopaxe_ax88772_initffs1_compat_readrip_outputrrw_exitpxaudc_bulk_methodsext2fs_accessmld6_fasttimeouaddr_rnd_insertkthread_qcdcef_txeofimaxwsmouse_matchohci_free_seduserconf_pdevuvm_object_printitsr_detachinflate_fastmbpoolclock_secs_to_ymdhmsaes_xts_setkeytcp_canceltimerstqphymatchrip_recvspaceroute_initswap_prioritylink_rtrequesttc_setrealtimeclockwdc_get_xferpxaip_measure_cpuclockuvm_vmspace_poolpxapcic_cdstackgap_initpipe_createsysctl_vnodewsemul_getcharnd6_sysctlpxa2x0_setperfsyn_cache_putdoopenatvn_openif_clone_createbufq_fifo_requeuesr_boot_assemblycdce_tx_list_initSHA384Finaluao_detachcpufunc_controlmallocamap_pp_adjrefauth_hash_hmac_sha2_384_192in_pcbrtentryknote_dequeuesr_discipline_initwi_cmd_usb__udivsi3tcp_outflagskqueue_statcdce_ioctlcd9660_rrip_analyzeohci_hash_find_tdexphymatchbuf_fix_mappingbio_unregisterip6_v6onlysys_preadvdb_tok_stringuserretsys_recvmsgpipe_statHMAC_MD5_Finalvn_writesr_hotplug_unregistermtdphy_servicehidkbd_hookup_bellVOP_LINKpcmcia_megahertz_xjem1144_func0icmp_inputumass_cdvcountvm_page_zero_enableieee80211_get_sa_queryuvm_vsunlock_devicerd_root_sizein6_delmultistathzenc_xform_cast5route_ctloutputwdog_ctl_cbpxagpio_dispatchsched_idlebio_warnwdc_ata_bio_intrwskbd_cnattachvirtual_enduhidev_get_reportsys_getloginpxa2x0_gpio_intr_disestablishifaddr_items_RB_NEXTbuckstring_initicmp6_rediracceptdetruncdb_elf_symbol_valuescopyoutpfindbufq_peekcomconsaddrip_ctloutputuhidev_set_report_asyncwsevent_readenc_xform_arc4arp_ifinitdb_write_variableufs_dirbadcd9660_readdirvfs_unmountallwsdisplaypollsys_renameatohci_allocxcopyrightsdattachsched_peg_curprocwdc_default_lba48_write_regtcp_timer_keepusbd_devinfo_vpsbsyncwsemul_vt100_cnattachtcp_mss_updatefree_pagesdb_proc_print_cmdrw_enter_readdb_show_all_procsvunmapbufgpio_sense_pins_c3000uvm_map_pageable_wireroute_outputrti_deletefreepidsys_geteuidpxa2x0_gpio_set_functiondb_output_positionsdmmc_mem_single_read_blockrasops_masks_initapm_attachzaurus_main_batteryicmpmaskreplin6_pcblookup_listenmsdosfs_mknodttkqfluship6_defmcasthlimsys_munmapsdmmc_io_write_multi_1kp_nonepxa2x0_lcd_initializefilt_solistenvsnprintfpxammc_intrpte_l2_s_prot_urwsemuldisplaydevprintarplookupuvm_map_pageablechainallocsw_reg_startpmap_copy_page_xscalesr_ioctl_deleteraidifmedia_baudrateusbd_setup_default_xferzssp_attachuvm_pagelookupsoshutdownuserconf_hist_cmduserconf_listproc_cansugidcd9660_rrip_getsymnamedb_command_tablewsemul_vt100_scrolldownwsdisplay_getc_dummyip_mloopbackbpf_iflistKQREFwdc_downgrade_modeieee80211_node_leaveip6intrqaxe_newbufnd6_rs_inputscsi_activate_bussoabortm_free_unlockedusbf_clear_endpoint_haltcast_encryptunp_inotaskq_threadhidkbd_attach_wskbdlogkqfilterbpf_mtap_pflogni6_dnsmatchdb_extent_print_cmdip6_init2uprintfdb_clear_single_stepsensordev_installrandomiduvm_page_printitmainbus_cacoredump_elf32softdep_flushworklistsys_issetugidinitclockssdmmc_decode_cidcd9660_mmapif_detachaue_watchdogwsmuxopenwdc_ata_bio_startnd6_cache_lladdrcatqsession_poolugl_txeofunp_connectuvm_pagermapinif_detached_startpool_serialugl_ioctlxscale_cache_flushD_SEscsi_probe_lunaue_ioctlirq_entryni6_inputvfs_mountedondb_expressioncputypert_lookupfc_lookup__bss_start__usbf_alloc_xferif_downndqbVOP_GETATTRieee80211_fix_ratea4x_bs_wm_1ip6_mtudisc_timeoutwihap_deauth_reqieee80211_node2reqwi_usb_matchelf32_check_headerdb_historygf_logeephy_cdinphy_cdttytstampural_set_txantennaieee80211_node_allocieee80211_crypto_detachpmap_unwireipaddrip6_auto_linklocaluvm_pageunwirerti_fillHMAC_SHA256_Inithw_seriallcd_pxaip_cawsdisplay_resume_deviceauth_hash_hmac_md5_96autoconf_attdetapm_thread_createufs_chmodbufq_nscan_resortcdattachuserconf_devicein_localaddrsys_sigaltstackDES_versionsdmmc_cisptrsoisdisconnectingauth_hash_key_sha1Blowfish_initstatesched_steal_procwi_media_changenull_decryptsyn_hash2rttimer_queue_headarm_pdcache_sizedp8390_enableexphy_cartredirectuvm_map_printitdb_read_variablensgphy_casoftintr_initieee80211_setkeysdonedb_regsdb_stack_dumpuvm_pmr_pnaddrttymodemdb_lbuf_endwsdisplay_defaultscreensmtx_enteraxe_devskqueue_poolvntblinitbuf_rb_bufs_RB_INSERTcpuset_intersectionuhub_activateAES_GMAC_Setkeysleep_queue_initax88190_mii_bitbang_opspmap_preferin6_ifattach_linklocalVOP_REALLOCBLKSsys_setresgidsr_crypto_encryptsdmmc_mem_read_block_subruvm_pmr_freepagesieee80211_input_bamsdosfs_sync_vnodesplassert_failarm_picache_waystty_initaxe_ioctlwsdisplay_clearoncloseuvm_km_freesys_killrn_mpath_repriouserconf_numberperflevelcomconsiohpmap_set_pcb_pagediruvm_pmr_addr_RB_NFINDrt_setmetricssys_getegiddb_set_single_stepusbf_config_descriptoruvm_objtree_RB_FINDsw_reg_iodone_internalrasops_vcons_copycolsumass_init_insystemfrag6_deletefraghdruaddr_destroydirchkifaddr_items_RB_FINDexphy_resetipip_outputpipecloseVOP_REMOVEwi_usb_activateconsinituvm_pmr_isfreesdmmc_scsi_minphysurlphy_statusext2fs_dirremoveuvm_vnp_uncachesysctl__stringffs_clusteracctconfig_detachmtdphyattachifaof_ifpforaddrcryptop_poolsensordev_listsr_checksum_printminidatacleanrt_timer_queue_destroysr_meta_probezkbd_syncwi_cdsd_cduvm_pseg_geticmp_mtudiscipport_hifirstautoieee80211_tkip_delete_keysys_fstatlcd_show_screenufs_itimesenc_xform_3desuserconf_enablepte_l2_s_prot_uwext2fs_vinitdb_endlpumass_bbb_resetffs_alloccgbuf_object_storecryptodevallowsoftsmsc_wait_for_bitsgeneric_bs_w_1sa6_anysys_getprioritysysctl_diskinitsr_concat_discipline_inituvm_km_valloccdcef_watchdogieee80211_send_mgmtcue_getmacscsi_xsh_delrt_mpath_nextscsi_plug_probesys_unmountsr_meta_native_probewsdisplay_activatebootdvapmkqfilterelf32_probesin6ifa_ifpwithaddrvgonelcrypto_taskqsofreend6_dad_timeruaddr_rnd_destroyinphyattachctrl_eventcpuset_unioncomsiraddrdb_del_symbol_tabledb_add_expreephy_matchpmap_removebpf_mtap_afusbf_free_xferhidkbd_parse_descicmp6_fasttimouvm_pmr_addr_RB_INSERText2fs_removemtx_initif_clone_destroywdccommandcdcef_ioctlwi_pcmcia_wakeupvmcmd_randomizepxaintc_attachbpf_setfuserconf_historyuvm_page_unbusytk_noutusbpalockext2fs_mountpmap_collectBlowfish_expand0stateukbd_enableuvm_map_addr_RB_PREVdb_symformat_elfwdc_xfer_getgeneric_bs_rr_4cpu_sysctlcd9660_deftstampzlibCompileFlagsip_randomidaue_tx_list_initnettxintrsdmmc_io_function_disableieee80211_recv_disassocnosuidcoredumpukphyattachrasops_load_fontcddumpdb_search_cmdpxa2x0_lcd_alloc_screenastusbd_claim_ifacetcp_disconnectuvmspace_execwi_usb_detachwsmux_createpxaohci_attachsys_mmapbootnd6_is_addr_neighborblf_ecb_encryptwsemul_vt100_output_normalunp_rightshostnamedb_print_llinfodisk_closepartwsdisplay_emulbellupl_outputext2fs_bmapuvmexpenc_xform_blfbufq_donesr_crypto_dev_rwsensordev_getufs_diremptyreinsertfinishdupsleep_setup_timeoutuao_grow_hashukphy_serviceqsphy_resetsmsc_stopdeflate_decompresspool_destroylogwakeupshutdownhook_listdl10019_mii_readreghidkbd_attachip_dosourcerouteieee80211_node_join_rsnsoread_filtopsieee80211_media2ratedmapoolsrasops_show_screenbdevsw_lookupdisk_changewsemul_vt100_resetopsdmmc_create_threadamap_lookupsdoreallocblkscache_revlookupbpfread_filtopssoinituvm_mapent_isjoinableVOP_MKNODuvmpxa2x0_update_intr_masksnd6_ifdetachin6_ifaddrroute_protopxa2x0_lcd_geometrysync_vopshw_uuidext2fs_truncatecd_play_tracksscsi_do_mode_senseuvm_pmr_allocpmrip6_maxfragpacketsdb_errorax88190_media_finiprefetch_abort_handleruvm_km_threadsr_checksumscsi_probe_buslminm_leadingspacesys_fpathconfscoop_battery_temp_adcwsmuxpollarpt_pruneohci_device_bulk_methodskp_zerosoconnect2knote_poolcnopenscsi_test_unit_readyural_set_bssidnmbclustural_get_rfsominconndma_freesoftraid_cdpcmcia_matchuvm_vnp_syncusbf_end_configpool_allocator_large_niusbf_add_configwsmux_set_displayieee80211_get_disassocwihap_assoc_reqarpt_downwsmoused_wakeuprdgetdisklabelarm_pdcache_line_sizebpf_tapnthreadsdb_lookupuvm_pmr_addr_RB_NEXTnumnegmii_phy_autorasops15_putchar12wsmouseduvm_pmr_addr_RB_FINDuvm_mapent_free_removewsfont_rotatemsdosfs_initohci_device_ctrl_startwi_write_record_ioext2fs_writelf_clearlockpxaudc_writegeneric_armv4_bs_wr_2uvmpd_scan_inactivedb_lastsymurl_memip_srcrouteuhidioctlip6_accept_rtadvieee80211_recv_4way_msg4pte_l1_s_cache_masksys_setregidpcmcia_cdusbd_device2interface_handleurl_csr_read_1cpuset_infosusbd_dopollvinvalbufmii_bitbang_writeregsys_ftruncateaes_ctr_cryptm_splitsoftintr_disestablishentropylockurl_stopzts_irqtcp_timer_initdb_tab_stop_widthdb_putncharstuagg_unlockednd6_maxnudhinttcp6_inputsosetoptkp_dirtytcp_mssrt_sendmsgifa_addcache_purgeudav_stop_taskbpf_mcopyax88190_mediachangepcmcia_3cxem556_func0comconsrateauth_hash_hmac_sha1_96pcmcia_intr_disestablishuaddr_pivot_insertfork1db_activevfs_hang_addrlistcue_tickdead_writeufs_dirrewriteinsmntquettreadtk_canccdb_write_bytesext2fs_blkfreeudp_outputfind_last_setsoftraid0pxaintc_matchsys_chmodprelist_removeuvm_objtree_RB_NFINDuao_shrink_arrayffs_vgetaxe_encapinitprocsr_bootuuidip6_getpmtu__umoddi3bcstatsarm_dcache_alignvm_map_downgrade_lnip6_log_intervalnull_encryptsched_idle_cpuswihap_auth_requgl_newbufscsi_activate_lunuvm_page_physdumpwsemul_vt100_nextlineuvm_atopgX_db_sym_initmaxprocesssyn_cache_timervt100_initchartableslcd_paramieee80211_auth_opensolisten_filtopshfsc_dequeueprocess_kernel_argsin6_update_ifa__wdcerrorSHA384Updatecdce_detachpxa2x0_intr_disestablishrt_msg2suser_ucredsd_shutdowncom_is_consolemem_noext2fs_buf_allocdp8390_startbufbackpageswihap_sta_deleteuaddr_kernel_functionspmap_free_l2_bucketRMD160Update_intrevarprequestmsdosfsreadwrite_filtopsrrw_enterkernel_mapwi_init_iodumpdevwsmouseioctlcd9660_lockusbd_ref_incrieee80211_mgt_subtype_namegf_powdb_not_taken_bkptm_printuvm_pmr_splitvfs_mount_foreach_vnodekqueue_kqfiltertimeout_add_usecsr_raid5_set_chunk_statewi_mgmt_xmituhid_do_ioctlzeroin6_addrstrncasecmptimer_filtopsuvm_objwireohci_device_bulk_starttcp_mss_advSHA512Update_intin_ifaddrzts_cdcurrent_spl_levelnd6_optionwin2unixfnmax_hdrffs_readm_freephtree_RB_FINDpxaudc_ctrl_startne_pcmcia_dl10019_get_enaddraes_key_wrapurlphy_attachieee80211_get_assoc_reqsr_meta_attachsr_meta_native_bootprobescsi_inqmatchfdesc_poolpool_page_allocsr_switchin_pcblookupm_tag_delete_chainfilt_pipewritecd9660_pollugl_detachbadaddr_read_4bzeromii_bitbang_syncumass_scsi_probearmv4_drain_writebufswapdrum_addufs_closedefrouter_delreqfixjobcsdmmc_matchuvm_pmr_size_RB_REMOVEdb_show_all_cmdsusbf_set_endpoint_haltscsi_devidin6_addmultirn_newpairbioszts_enable__udivdi3sys_obreaksdmmc_intr_enablepxapcic_attach_cardpxa2x0_gpio_set_intr_levelblf_setkeyusbd_set_config_noieee80211_pmksa_addlastddateuvmfault_unlockallsr_meta_getdevnamem_inithdrpmap_curmaxkvaddruvm_pmemrange_addr_RB_NFINDin6mask0bpf_validateusbd_get_string_descvaccessuao_set_swslotsys___thrsigdivertsys_getdtablecountmbinitsr_errortcp_secret_ctxusbd_get_reportabortwskbd_default_bell_datascsi_readsafe_cmdieee80211_set_link_stateamap_allocVOP_LOCKbuf_rb_bufs_RB_INSERT_COLORMD5Finalwskbd_matchcp_timeaxe_rxeofcd9660_vget_internaldb_page_print_cmdwi_intrrw_casvgetrd_attachkd_nowaitpxa27x_cpu_speed_91ieee80211_create_ibsswsmouseopenwinChksumbufq_requeuefreeclusterchainmld6_initswapmapscsi_get_linkdisk_initpxapcic_intr_establishSHA256Updateohci_bus_methodsohci_hash_rem_itdrip6_ctloutputdisk_readlabelaue_sendusbd_getnewaddrrasops_erasecols_rotatednd6_na_outputext2fs_fhtovpsr_validate_stripsizeumass_cbi_transferext2fs_createieee80211_gtk_rekey_timeoutwi_sync_mediauvm_map_teardownpipe_pollpool_reclaim_allnsphy_cabmtphyattachsysctl_dopooluhub_matchuvm_mapent_clonetcp_respondsys_readvcrypto_getreqamap_cow_nowroundrobinsa11x0_intr_establishbadaddr_readuvm_map_createissignalwdprintsr_attachfilt_uhidrdetachin6_selectrouteieee80211_recv_rsn_group_msg1cdevvpscsi_pending_start_setsoftintrmsdosfs_kqfilterigmp_joingroupuiomoveohci_device_isoc_donewi_usb_wridrespmsdosfs_startlf_alloccpu_idle_leavedb_loop_countwi_intr_ackbpf_reset_dnd6_dad_stopdiskmapioctlhid_start_parseuseloopbackscoop_pcic_socket_setupinflateSyncPointuvm_waitfilt_apmreadnexecsmclpoolszts_avgposieee80211_regdomain2namepmap_referencesys_bindax88190_mii_statchgsdmmc_done_xsloioctlrw_exit_writebs_notimpl_bs_wr_8ieee80211_eapol_key_micusb_abort_taskspmap_bootstrapbs_notimpl_bs_wr_2blf_cbc_encryptsys_mqueryarm_picache_line_sizekmeminit_nkmempagesspeedtablesusbd_new_devicewi_pcmcia_detachuvm_pmr_size_RB_REMOVE_COLORmcllivelocksscsi_iopool_initscsi_io_putuvm_pmemrange_findfillinusemaprecvitbmtphy_funcsusbf_get_descriptorscoop_suspendfilt_sowriteuvm_kernacccnpollcsys_linklcd_blankuvm_addr_initlog_opensr_rebuild_initfilt_randomdetachuvm_pmr_size_cmpuaddr_free_rbtree_RB_MINMAXfragtbl124userconf_totdevxscale_cache_flushIDieee80211_plcp2ratert_tablesrt_ifmsgrandomread_filtopsrealitexpireipstatunix2dostimedounlinkatscsibus_caurl_newbufusbd_delay_mscrfreecnputcuhid_do_writeip6_lasthdrdl10022_mii_bitbang_opsohci_device_isoc_abortuhub_uhub_catcp_reaperpool_sethiwatwi_read_record_usbwsemul_vt100_output_c0c1wdgetdefaultlabelmicrotimeuvm_pmr_addr_cmppipeunlockuvm_pmemrange_addr_RB_MINMAXuvm_swap_getrasops_free_screenext2fs_reloadurlphy_matchcsefindelf32_copyargsisochariophymatchuvm_km_alloc1cdopentcp_usrclosednsphyter_caaue_ifmedia_stsphysmemuvn_flushurl_cdnsgphy_servicesdmmc_del_taskuvmfault_relockinferiorukbd_attachxscale_cache_purgeD_Eclusteralloccryptof_readsr_raid_syncrt_if_remove_rtdeletewskbd_attachin_pcbbindumass_cbi_statexscale_cache_flushImtdphy_caudp_notifysdmmc_app_commandendtsleepwihap_check_txstrnlensigactsshareuvm_map_freelist_update_refilldb_set_watchpointuvm_map_addr_RB_NEXTbpfattachugl_openpipesif_detach_queuesitimerdecrieee80211_get_delbaether_outputpmap_bootstrap_pv_page_freeuvm_addr_printauth_hash_md5crypto_kdoneinflateGetHeaderbpfilter_lookupm_copym0sdmmc_io_detachaxe_miibus_readregpxapcic_detach_cardvm_physmemiso_shipdirrdwriteieee80211_node_join_htrnd_timeoutieee80211_parse_edca_paramspipe_ioctlfilt_timerexpireural_set_chanwskbd_enablepmap_devmap_find_vacd9660_mountrootusbf_devinfo_allocbpf_allocbufsset_stackptrrt_gettablemsgbufmappedohci_device_setintrpxapcic_attachcomprobe1cdsizedb_symbol_valuesumass_lookupdb_evarsupl_activatesmsc_attachwsmouse_mux_closewakeupuao_growgetnanotimewdc_pcmcia_disk_device_interface_callbacka4x_bs_wm_2pxaudc_ctrl_transfertcprexmtthreshkprintf_mutexusbf_alloc_bufferrt_getifadb_malloc_print_cmdwi_get_fid_ioenosyslockmgrrtlabel_name2idhidkbd_is_consoleuvm_vnodeopsdb_bcstats_print_cmdvfsconfVOP_OPENcompwroffwsdisplay_console_inittedbuckstringusbd_fill_deviceinfoscsi_interpret_sensesqphy_cdext2fs_flushfilesdes_ecb3_encryptieee80211_send_eapol_keycomconsattachedlxtphyattachwi_usb_txeof_frmufs_readlinkrdopenin6_ifadddoscheckpathpcbmap_tr_stored_blocknd6_option_initbufq_quiesceext2fs_setsize__guard_localin6_init_prefix_ltimesnchstatscd9660_fhtovpmsgbufpsys_setgiduserconf_common_attrfilt_ufswritezts_activatert6_flushpxapcic_io_freegeneric_bs_r_4pxaudc_epN_intrmmrwffs_bufatoffieee80211_add_ds_paramswi_usb_rridrespdohooksgf_invieee80211_rssadapt_choosenprocessesukbd_activateif_detached_ioctllocnamppsegswi_usb_causerconf_showip_mtudisc_timeout_qsr_raid5_assemblesr_scsi_cmdaddress_exception_entryffs_fhtovpgetvnodefilt_ufsvnodecrypto_get_driveridspeed_to_freqpool_setlowatkmembaseswi_entryrip6_inituvm_aiobuf_poolisofncmppcmcia_card_detachsysctl_emulseltrue_filtopssys_sigprocmaskdb_commandin6_if_upfilt_pipereadskip_spc_rightpxa2x0_intr_establishenc_xform_aes_gmacsoreservedb_formatconsoleuvm_mmapusb_activatepxaost_attachscsi_report_lunsufs_quotactldosymlinkatuvm_map_uaddraroundin6_pcbnotifyifaddr_items_RB_REMOVEusbd_clear_endpoint_toggleexplore_pendingstrrchrgetdevvpm_clgetdefrouter_selectamap_unrefext2fs_statfsbpf_mtap_hdrcrdupamap_wiperangecuio_copybackisodirinodb_strlcpycfrootswsmousepollchrtoblkscsiprintuserconf_pdevnamminphysukbd_matchurl_ticksys_fchownatztsavgloadedrtalloc_nocloneether_addmultitimeout_mutexieee80211_recv_actioncdce_cdffs_vptofhvfs_isbusyifunitirqstackbawritetputcharwskbd_detachpmap_postinitcsedeletepool_print_pagelistffs_fragacctpxa2x0_lcd_resumeffs1_ballocsys_fchowninflateInit_SHA384Update_intdb_breakpoint_cmdvwaitforiopxagpio_camii_phy_ticksdmmc_io_function_enablecd_read_subchanneluao_shrink_flushflsextendfilelortrequestwsdisplay_resumeicmp6_inputwsemul_vt100_outputbuf_valistuserconf_addsdmmc_io_write_4ohci_device_intr_methodswi_func_iocreatedefilt_randomreadieee80211_michael_mic_failuresbreleasedb_history_sizein6_selectifmsdosfs_islockedmax_linkhdrumass_attachwsdisplayioctlcryptof_statwdc_xfer_iopooludav_resetget_stackptrsysctl_rtablemsdosfs_reclaimwdc_free_queuesqphy_serviceuserconf_hist_eocsys_readlinkatuvm_objtree_RB_REMOVEext2fs_getattrrtlabel_id2nameusbf_setup_default_xfersbdroprecorduvm_coredumppxaip_searchwdsizenamecache_rb_cache_RB_REMOVEsdmmc_io_scanacphy_statusip6_sysctlsuserusbf_devinfo_setupdiskconfural_tx_datavn_syncer_add_to_worklistusbd_get_interface_descriptorgeneric_bs_rm_1pxaudc_activatetk_ninsysfilt_opssdmmc_io_function_readyclusterfreefilt_randomwritesr_warnsr_raid_intrieee80211_alloc_node_helperrootdevm_tag_firstpxa2x0_cpu_resumecdmatchpmap_map_entryusbd_get_config_descriptorpfxrtr_deldumpsysicmptstampreplif_detached_watchdogrip6_sysctlext2fs_fsyncdoforcesys_fsyncwi_usb_stopuserconf_add_readsr_crypto_writeusbd_reset_portifconfcpu_apmwarnamap_wipeoutuser_configcast_setkeytcp_outputnsphyattach_bus_dmamem_mmapwsdisplay_emul_attachsdmmc_mem_read_blockupdate_ledsext2fs_updatepxa2x0_memcfgtcp_timer_2mslne2000_writememaue_openpipesffs_reload_vnodebuf_putmsdosfs_setattrVOP_RMDIRwdog_tickledb_delete_breakpointsr_ioctl_installbootif_addgroupieee80211_setmodeuhid_matchieee80211_add_ibss_paramspool_allocator_freefilt_proceopnotsuppsdmmc_enableffs_reallocblksphtree_RB_INSERT_COLORrandomcloserootvpaxe_miibus_writereguvm_pmemrange_addr_RB_NEXTpxagpio_intrlowieee80211_eapol_key_decryptpcmcia_intr_establishuserconf_maxlocnamespool_reclaiminitdisklabelusb_quirksbpf_sysctlvflushieee80211_bip_encapcddetachpmap_clear_modifytcpctl_varsarptimerbufq_dequeuetcp_reass_limitruaddsys___set_tcbrdstrategym_copymmouse_copy_extend_charbcopy_pageip6_freepcboptsdb_free_breakpointsif_upcoredump_notes_elf32timeout_add_nsecuvmfault_lookupm_extfreene2000_ring_copysdmmc_set_bus_powerupl_intrural_matchdeflateBoundVOP_BWRITEbufq_fifo_peekrt_timer_queue_createm_cluncountwddonemsdosfs_ioctlupl_matchno_constraintsys_opensr_crypto_change_maskkeywdc_alloc_queueusbd_match_devicerasops_pmaskinet6domainural_enable_tsf_sync_bus_dmamem_alloc_rangeether_crc32_be_updatepgdeletepxapcic_intr_stringuvm_pageidlezerosdmmc_io_initusbf_do_requestwskbd_do_ioctl_scdead_vopsdb_symtabsieee80211_media_changeuaddr_hint_createraw_attachural_set_rxantennahidkbd_cngetcscsi_ioc_cmddb_boot_sync_cmdmax1111_adc_value_avgastpendingifnewlladdrether_ip6multicast_maxpipe_pooluao_initudav_iffsdmmc_needs_discoverifa_ifwithroutem_clinitifpscoopattachspec_kqfiltertcp_notifyieee80211_match_bsscd9660_tstamp_conv7ural_free_tx_listffs_dinode1_poolieee80211_set_keyieee80211_bip_delete_keydb_print_positionrtflushclonedb_radixgetblksr_raid_turmouse_pastedl10019_stop_cardmouse_copy_endxscale_cache_flushD_rngmaxsmapwdc_ata_bioip6_mcast_pmtusoconnectural_initrasops_use_fontwskbd_repeatvtypesuvm_map_fix_spacenobuffers__lshrdi3data_abort_handler_addressin6_delayed_cksumrtrequest1usbd_errstrSHA256Update_intsr_scsi_ioctltcp_identtcp_rst_ppslimifinitsd_cmd_rw10cd_load_tocunpst_recvspaceuvm_map_mqueryget_ifidsr_infoscsi_io_getne_pcmcia_attachkue_initxscale_cache_purgeIDuvm_map_kmem_growraw_inputcd9660_reclaimkue_ioctlfilt_logrdetachtimeout_add_btnd6_ifattachunpdg_recvspacedofaccessatpipe_closecd9660_inactivesoftdep_mountmsdosfs_rmdirdb_is_activemsdosfs_fsynccfdatadeflateInit_ffswi_usb_tx_lockusbd_do_request_async_cbufs_checkpathcdcef_rxeofpmap_pte_init_xscalepfxlist_onlink_checkdiskmapreaddb_elf_lookupm_tag_findinittodradler32blf_encvputaue_iffpte_l1_s_cache_mode_ptvector_page_setprottcbhashsizeworkq_syswqcd9660_setattrusbd_get_configieee80211_node_leave_rsnuaddr_kbootstrapufs_quota_initallocpidkqread_filtopscoredump_writeusbd_setup_pipexscale_setttbaue_csr_read_1pcmcia_check_cis_quirksxscale_cache_cleanIDieee80211_beacon_allocbuf_acquiredolinkatbioopscpu_classesieee80211_add_htopbpf_setdlttcp_flush_queuepool_setiplmsdosfs_statfslboltpipe_inituvm_wait_plarn_mpath_priousbd_open_pipe_intraes_gcm_reinitsyncerprocpcmcia_card_gettypeifa_print_rbpxa2x0_clkman_iohufs_ihashinszcfreein_setpeeraddrinphymatchpxa2x0_a4x_bs_tagwindow_inflatedb_readlinewsdisplay_delscreenether_ifdetachsr_meta_native_readieee80211_recv_probe_requhidev_get_report_descuserconf_histcurrndstatssdmmc_mem_write_block_subrmsdosfs_inactivepanicstrwsdisplay_kbdinputupl_newbufumass_scsi_cbscsi_delayext2fs_sync_vnodeif_startunpdg_sendspacesession0viscpywsmouse_do_ioctlhw_ver__umodsi3copyincomparamural_stopudav_sendcd9660_defattrohci_device_bulk_closertalloc1bs_notimpl_bs_sm_8uao_swhash_elt_poolufs_ihashgetdes_set_odd_parityne2000_read_hdruaddr_pivot_selectsigacts0scoop_mmc_attachuaddr_free_rbtree_RB_REMOVE_COLORfindblkmajormsdosfsvnode_filtopsrasops_vcons_mapcharntohlsorflushiophy_funcsusbf_create_threadlcd_matchuvm_mapent_tryjointtioctlarpintrqvprintfslpquesr_raid1_wu_doneohci_root_ctrl_methodsttycharssyncdelayuvm_vslock_devicewi_usb_infofrmuvm_pagealloc_multisdmmc_io_read_2hidkbd_enableffs_mountwsmux_mux_closeicmp6errppslimbadaddr_read_2msdosfs_vopsdp8390_mediachangeconfig_process_deferred_childrenbufq_waitohci_ifcdwsdisplaywriteieee80211_add_htcapssdmmc_decode_csdxscale_cache_purgeID_Ebs_notimpl_bs_sm_2in6_setmaxmtumsdosfs_rootmii_bitbang_sendbitstqphyattachbpf_getdltlistm_tag_getuvm_map_freelist_updateuaddr_bestfit_insertsb_lockohci_root_intr_abortuaddr_bestfit_removert_labelscrypto_unregisterHMAC_SHA1_Finalupl_watchdogsuid_clearttwritedma_alloc_initbuf_rb_bufs_RB_NFINDbuflowpagesswapdev_vpdp8390_resetpxa2x0_bs_mapaes_xts_cryptieee80211_deliver_datadead_readusbf_reallocpxapcic_socket_disableufs_pathconffile_pooldb_boot_reboot_cmdohci_timeoutunputcendpcmcia_verboseVOP_CREATEcpuset_firstSHA512Updatecdce_stopifai_cmprasops_copycharnd6_recalc_reachtm_intervalin_ifinitohci_device_ctrl_closerasops15_makestampwi_pcmcia_activatein_pcbhashlookupsys_mknodatapmread_filtopskp_dmaural_writeVOP_ABORTOPrasops_vcons_eraserowscoredump_traddofchownatsr_wu_done_callbacksys_acceptnsphyter_statuspxa2x0_pi2c_writeuvm_map_entry_kmem_pooluvm_pagerealloc_multiieee80211_wep_decryptwi_inquireuaddr_bestfit_pooltcp_rst_ppslim_countieee80211_recv_assoc_respieee80211_parse_rsn_bodyukbd_detachaes_key_wrap_set_keyif_clone_listtc_windupsys_futimessdgetdisklabelsysctl_proc_cwdwi_do_hostdecryptinternal_commanduvm_map_boundarymalloc_errintvlin_losingVOP_SYMLINKgeteblkusbd_set_interfacewsscreen_detachscsibusmatchinflateBackInit_crypto_kregistervn_ioctlwi_usb_ctl_lockufsspec_readdb_show_calloutaxe_cdpipespacefiqvectorget_last_resort_ifidohci_alloc_stdip6_sendredirectscast_decryptddb_sysctlukphy_caitimerfixpxa2x0_apm_attach_subip_stripoptionsieee80211_node_join_11gsyn_cache_countuaddr_stack_brk_createieee80211_add_xratesusbf_errstrnd6_timer_chugl_rxeofne_pcmcia_ax88190_set_iobaseuvm_pseg_releasecpu_resetudav_ticktcp_ctlinputether_multiaddrstart_cleanerffs_blkfreeexit1ohci_detachwsmouse_add_muxbdevvpifa_ifwithdstaddruaddr_bestfit_selectuvmspace_duseddb_watchpoint_allocudav_ifmedia_changeselectroutein6_nigroupscsi_mode_sense_big_pageauth_hash_sha1sys_mkfifoatuihashpxaudc_read_epNrijndaelEncryptscsi_ioh_deltcp_keepintvlcdwriteufswrite_filtopsttybgconfig_searchzts_samplesphtree_RB_PREVwihap_sta_findusbd_printscoop_set_backlightuvm_km_valloc_prefer_waitsyn_cache_poolffs_allocaue_tick_taskdb_preveephy_funcsinphy_funcsbswap32ipsec_exp_first_usecdcef_cdrlphy_serviceplimit_poolip6_defhlimumass_setup_ctrl_transferunp_connect2usbd_set_pollingpxa27x_frequency_changern_walktreepool_prime_pagesys_chownuvm_pagewirerasops_putchar_rotatedin6_joingroupsys_munlockinflateBackuvm_anfreedofilereadvipip_sysctlbs_notimpl_bs_sr_1vn_statfileieee80211_iterate_nodesrw_exit_readwi_intr_enabletablefulluhub_exploreupl_txeoftcp_maxidlescoopmatchvfs_getcwd_commonset_cpufuncscttyioctlsys_lstatscoop_gpio_pin_ctlieee80211_recv_wpa_group_msg1ieee80211_recv_addba_respohci_timeout_taskohci_hash_add_tdieee80211_tkip_set_keyiso_uiodircttykqfilterurl_activatecttyopenpmap_link_l2ptinet6ctlerrmapicmp6_redirect_diagdisknamessched_queued_cpusumass_quirksdumploRMD160Updatemsdosfs_mountacphy_funcsffs_clusterallocnullcnpollcuvm_km_inituvm_objinitbzero_pageffs_sbupdateudp_sysctlsys_openatax88190_mii_bitbang_readm_clcountbs_notimpl_bs_wm_1vmmapbsyusb_add_taskurl_int_miibus_readreguserconf_histlendb_list_breakpointsusbd_set_protocolnkmempages_minukbd_accessopspxapcic_io_allocusbcloseudav_matchpxauart_matchvector_pagekq_ntimeoutssys_sched_yieldvmspace0scsi_decode_sensettywaitwsmousedevprintuvm_map_setuptcp_syn_cache_sizewdc_default_vtbluao_grow_arrayieee80211_add_tielcd_set_brightnessetextifa_ifwithnetmemchrohci_device_ctrl_doneqsphy_statussqphyattachpte_l2_s_cache_maskcomp_algo_lzsieee80211_recv_barsysctl_cptime2sdmmc_capxa2x0_bs_unmapscsi_mode_sense_pageboot_argspipelockvt100_selectattributeumass_scsi_setuppxammc_clock_startproc_poolaue_intrudp6_inputsys_writedb_get_valueural_set_txpreamblesharp_zaurus_C3000_blgeneric_armv4_bs_rr_2sb_maxusbd_fill_iface_datacd_set_pa_immedsr_uuid_print__bss_end__wsdisplay_maxscreenidxip6_insertfraghdrcnstopextent_print_allihashtblieee80211_set_shortslottimesys_dup2db_inst_countdb_read_linewsdisplay_switch1wd_get_paramsbread_clustersys_readlinkext2fs_size__ashrdi3bs_notimpl_bs_mmapzErrorohci_intrwsdisplay_burnxscale_cache_flushI_SEcrc32ip6_auto_flowlabeldevid_copylf_splitifafreeVOP_STRATEGYtimeout_add_sectzpxammc_card_intrxscale_cache_syncIrip_sendspacecoredump_writenote_elf32uhidev_writeusb_generic_tasksxscale_cache_cleanID_rngamap_addtcp_freeqif_setgroupattribscom_attach_subrdvd_authexphy_serviceumass_scsi_cmdscoop_gpio_pin_writecdreadrasops15_initspec_inactivedp8390_stopwi_func_usbwsmux_do_ioctlsys_sendtoicmperrppslimgeneric_filtopsknote_dropcue_watchdogin6_selectsrcrd_casdmmc_read_cissoftclock_siwi_usb_threadugl_watchdogsr_ccb_putzkbd_ioctlin6_pcbsetportalldevsdp8390_rintwddumpicmp_do_errorvmcmd_map_readvnsmsc_initpxammc_exec_commandrandom_startcomconsfrequsbd_get_interface_altindexamap_extendsigpropvmapbufumass_scsi_switchdehashtblsocketopsscsibus_bioctlX_db_sym_numargspcmcia_activatend6_maxndoptuvm_map_clip_startffs_fragextendtcp_always_keepaliverawcbtablespec_readunp_markacphyattachdes_key_schedicmp_mtudisc_timeoutnwsmuxskip_char_righta4x_bs_r_1pmap_zero_page_xscalettyread_filtopsuvm_mapgetinoquotascsi_do_ioctlrtable_existsdisk_lock_nointrcd_resetX_db_forallscsi_ioh_addscsi_detach_busudpstatroute_inputsetrootcsr2cd_read_tocural_amrr_updatecdioctlieee80211_defrag_timeoutbufq_switchcue_stopifmedia_addfrag6_queuelxtphy_funcssr_matchusbd_set_config_indexlogopenieee80211_add_rsn_bodysr_raid6_initcd_buf_donescsi_devid_pg80breadntcp_hdrszscsi_devid_pg83tcbtableieee80211_recv_4way_msg2__xordi3frag6_drainuvm_objtree_RB_REMOVE_COLORdosdiremptyigmp_slowtimoifpromiscrtl80x9_mediachangerasops4_putcharip6_setpktoptsfork_returnsys_getsocknamecd9660_lookupsr_concat_initwi_usb_intrusbd_alloc_bufferinflatePrimemask_rnheadsw_reg_iodonepte_l2_s_protoufs_rootsdmmc_detachtcp_sysctlVOP_SETATTRsmsc_chip_initpmap_kremovesigactsinitsdmmc_io_rw_extendeddomknodatusbd_set_reportcpu_kcore_hdrexec_elf32_fixuprt_newaddrmsgvop_generic_lockcomconsiotuvmfault_anongetconsttywdc_pcmcia_caural_bbp_readpxammc_host_resetsr_ioctl_diskusermountext2fs_dirrewrite__ucmpdi2vn_closefileumass_discoip_mtudiscvfs_free_netcredmld6_start_listeningcpu_mainbus_cakue_matchpmap_kenter_papidhashtblaue_matchusbd_get_protocoluvm_mapent_forksharedm_pullupenterpgrpwdc_pcmcia_lookupxscale_tlb_flushID_SEcrypto_freesessionwsemul_vt100_output_string_escwsdisplay_kbdholdscrpxa2x0_rtc_getalarmcnbellm_copydatabufq_nscan_requeuecd_setchanieee80211_get_probe_reqmtx_leavefilt_signalsigactsfreewdc_default_write_raw_multi_4ttymallocupl_attachrasops_copyrows_rotatedicmp6_notify_errorieee80211_recv_probe_respwsdisplaykqfilterbs_notimpl_bs_sm_4kue_setmultizapm_acintrmmioctluaddr_free_rbtree_RB_NFINDuvm_coredump_walkmapdb_nextumass_matchsched_choosesendsigsdmmc_print_cisohci_device_ctrl_methodsbpf_ifnameohci_cdural_ioctlsmsc_iffvfs_busytimecountermouse_copy_extend_afterfilt_ufsdetachbufq_initlf_getlocksr_raid6_xorpsolistenwskbd_compose_valuespec_getattrl1_lru_lockip_ecn_ingressmsdosfs_bmaprip_ctloutputffs_vtblif_getgroupieee80211_parse_rsnpool_debuguserconf_morekqueue_ioctlmax_processessys_wait4rip6_recvspaceamap_share_protectieee80211_bar_tidfs_sysctlukbd_cnattachpxammc_card_detectpxaost_matchieee80211_ibss_mergeboot_filefilt_sordetachknote_activatepsignalwsdisplay_console_confieee80211_regdomain_compare_cnconfig_pending_incrusb_task_threadamap_pp_establishauth_hash_gmac_aes_192ieee80211_setkeysuvm_pmr_nextszuvm_anon_initffs_reclaimbmtphy_causb_free_deviceusb_exploreifaddr_items_RB_REMOVE_COLORbufq_nscan_queuexscale_cpufuncsif_link_state_changelcd_max_brightnesspmap_virtual_spaceieee80211_add_wpaieee80211_eapol_key_check_micusb_disconnect_portpage0_endieee80211_add_capinfobpfpolluvm_pmr_nfindszupdatepriohci_activatebmtphy_servicesched_kthreads_createuhid_cdwskbd_cnbellbintimevt100_decmodewi_seekfilt_soreadpmap_remove_allrtable_addzeropageipsec_def_encffs_nodealloccgsoftintr_establishpxaudc_detachuvm_pmr_removeip4_input6pdevinit__iordi3nsphytermatchuvm_pmr_findnextsegmentinetctlerrmapresetpriorityusbf_device_descriptorrasops4_putchar16enoioctlwi_usb_start_threadrasops_vcons_copyrowsflslsigacts_poolexecsigsconfig_initicmp6_redirect_inputbuf_rb_bufs_RB_REMOVE_COLORrw_enteraue_read_macuvm_addr_destroysr_raid0_inituvm_pmr_size_RB_MINMAXdb_access_abt_spnd6_ra_inputffs1_blkprefin6addr_loopbackuvm_objtree_RB_MINMAXttypenduvm_swap_freepagesqsphymatchnd6_dad_starttimerin_revarpinputstrlcpyuaddr_bestfit_destroyX_db_symbol_valuesusbd_reload_device_descsmsc_read_regext2fs_advlockknote_fdcloseusbd_get_devcntif_clone_detachpipe_rfiltopsin6_cksumcomcninitstrncmpcsrc_ptedes1_decryptvfs_shutdowngetsockieee80211_get_deauthbs_notimpl_bs_c_4upl_startmouse_hidezssp_matchsyn_cache_respondif_creategrouppxa2x0_gpio_set_dirllinfo_nd6sbcheckreservepreemptuvm_iobioattachieee80211_begin_scanunixdomaindb_next_free_breakpointsmdscsibusattachugl_devsnsgphy_cdsyn_hash1ulminwihap_data_inputpxa2x0_lcd_free_screendb_last_symtabproc0paddrrn_addmaskifaddr_itemsusb_attachbpf_bufsizeselscanpxa2x0_do_pendingsoo_polluvm_map_uaddr_ertafidx_maxsig_filtopsknote_processexitohci_device_bulk_transferukbd_cdzkbd_accessopspxaip_scwskbdopenpxa27x_fastbus_run_modettclosurl_rxeofipsec_soft_allocationssleep_setup_bus_dmamem_mapip6_fragmentnet_sysctlcom_cdusbf_devinfo_freetimeout_adjust_tickswskbd_do_ioctlxscale_cache_cleanD_Euvm_pmr_size_RB_FINDudv_listdead_ioctlaue_initusb_match__wdccommand_startsdmmc_complete_xssysctl_iflistrasops_alloc_mattrvwakeupif_clonerswdcbit_bucketvgonewdc_probe_capspmap_initializedtcp6_ctlinputsched_init_runqueuesdb_stack_trace_cmdusb_allocmemsd_sizeufsspec_closene2000devsnd6_prefix_offlinkuvm_anon_dropswapdl10019_mii_bitbang_readwi_detachigmp_inputkmemusagezapm_suspendswcr_sesnumlf_getblockautoconf_attdet_mtxtcp_rttdfltcleanerprocieee80211_parse_edca_params_bodysbappendstreamm_tag_copy_chainohci_handoversowrite_filtopssr_chunks_unwindstrncpycseadddb_disasmsdreadsys_pselectupdatefatscue_memata_perrorvfs_getvfssr_alloc_resourcesaue_txeofffs_sync_vnodedeflateInit2_sr_raid6_discipline_initproc_stopvfs_vnode_printdb_history_lastrrticks_initbio_status_initusbd_set_port_featurebpfilter_createsysctl_lockax88190_mii_writereglockfpoolwihap_disassoc_reqrasops_copycols_rotatedieee80211_find_nodecpu_switchtohtonlsched_all_cpusin6_mask2lentcp_dooptionsdos2unixtimesys_sigactionsr_scsi_donewsdisplay_suspend_devicedeupdatusb_fill_di_taskzapm_get_eventSHA256Transformrndlock__negdi2in6_purgeaddrcpu_modelarm_dcache_align_maskcttyreadcd9660_unlockuserconf_cmdsural_taskwsdisplaycloseiophy_statusschedclockbpfioctlconfig_attachsr_sensors_createohci_alloc_sitdcue_rx_list_initzaurus_battery_life_c3000pxa2x0_bs_tagdl10019_init_cardbmtphy_statususb_syncmemdisk_unbusysysctl_filesoisconnectedurlphydebugsdmmc_ccb_allocamap_clean_worksusb_block_freememVOP_PATHCONFumass_fixup_sonydk_mountrootassertwaitokdb_run_modescsi_minphysauth_hash_key_md5sdmmc_delayxscale_cpwaitvattr_nullsys_getsockoptuhidev_attachdb_vprintffrag6_nfragpacketspxapcic_pcmcia_functionsdb_linesr_raid0_assemblepool_allocator_largeuvm_anon_lockloanpgvfs_sysctlcpu_get_controlVOP_READLINKbuf_mem_initumass_cbi_methodspxa2x0_intr_bootstrapdb_ed_stylensphyter_funcsmii_submatchuvmexp_printohci_root_intr_transferwsdisplay_unset_cons_kbdmsdosfs_pathconfoldpidstimeout_wheelpxa2x0_setsoftintrbpf_m_xhalfumass_io_getaverunnablecd9660_getattrttyfreettysleeplcd_cddp8390_initzapm_bcintrunp_disposescsi_inquireufs_getattrBlowfish_encipherieee80211_mhz2ieeevfs_exportpxammc_scoop_casr_hotspareuvm_km_pgremoveex_region_plfscalesmsc_matchffs_alloccgblkpxaudc_disableip_optcopyvfs_registerscoop_mmc_matchieee80211_proto_attachm_livelocksys_dupmcllowatmii_printieee80211_setup_ratesbpfilterattachproc_stop_totimeout_todoswcr_initdb_lcrasops8_putchar8cpu_read_cache_configwsemul_vt100_scrollupzkbdsleeptvsr_ioctl_createraidpanicget_pc_str_offsetural_rxeofcue_rxeofL_cksumdatamsdosfs_lockseltruewsdisplay_console_devicebpf_m_xwordscsi_xs_syncieee80211_recv_group_msg2softdep_initializestackgap_allocunp_shutdownieee80211_tkip_encryptwi_resetdovutimensdummy_get_timecountext2fs_sysctlgeneric_bs_wm_4kthread_run_deferred_queuearc4_initpxa2x0_gpio_bootstrapwdreadlastdaycheck_execdb_max_linewi_usb_cdtcp_initsdmmc_start_xspcmcia_attachpte_l2_s_cache_mode_ptdeferred_config_queuedp8390_getmcafbuf_rb_bufs_RB_MINMAXnetisr_initipport_lastautowsmux_detach_sccom_raisedtrdb_last_commandpxaudc_bus_methodsicsphy_statusip6_pcboptwinSlotCntvn_kqfilterext2fs_syncsched_stolenpte_l2_s_prot_maskudav_ioctlcrypto_registercache_purgevfszaurus_udc_activatepostsigsys_pathconfcue_open_pipespxapcic_mem_allocin_addmultigetmicrotimebs_notimpl_bs_rm_8zssp_cdrasops_reconfigmaxthrsleepumass_clear_endpoint_stallohci_setup_isocaue_newbufscsi_probedevaxe_ax88178_inittcp_templateieee80211_notify_dtimmsdosfs_readdb_object_print_cmdohci_initcomopenusbd_setup_xferauth_hash_hmac_sha2_512_256ieee80211_tree_RB_MINMAXmtagpoolbcopywsmouseclosewdog_autourl_tick_taskcue_detachusbioctl_bus_dma_inrangekqueue_wakeupip6_unknown_optuaddr_rnd_removetcp_reasssys_getfhext2fs_vgetrt_timer_timerrtbl_id_maxcomcnputcKERNEL_BASE_physSHA1Update_intwsemul_vt100_output_scs94cuio_applyscoop_cageneric_bs_rr_1ni6_addrsaxe_resetlcd_get_backlightdefrouter_addreqin6_clearscopend6_dad_ns_inputuvmpd_tuneusbd_set_addressne2000_readmemscoop_cdudav_openpipesffs_setblockipsec_expire_acquirekue_stopwsscreen_switchwaiticmp6_mtudisc_cloneinflateResetmemcmpwskbd_init_keymapnamecache_rb_cache_RB_REMOVE_COLORip6_dad_pendingieee80211_rate2plcpmsdosfs_createcd9660_startdb_output_linezkbd_hingecomstartaes_xts_reinitdb_examinecfroots_sizedb_end_linetickadjpool_alloc_item_headerip6_splithdruvm_map_addr_augmenttcp_secret_initieee80211_recv_sa_query_reqsbreserveundefined_initvrecycleextent_printieee80211_alloc_nodeblf_ecb_decryptcrcopydb_symformatural_newstatewdcloseundefined_handlerssys_revokeusbf_get_xfer_statusural_free_rx_listsysctl_stringsys_rebootpxammc_host_maxblklenuvm_unmap_kill_entryext2fs_specvopsbufpooldl10019_mii_bitbang_writeproc_finish_waitwdccommandext_dist_code_bus_dmamap_load_buffercpu_forksigonstackuaddr_kbootstrap_selectwi_write_data_ioscoop_checkdiskdb_print_ifattylistwdopenuvm_vslockdeflateResetuvmfault_update_statscast5_setkeyttyoutputsr_raid5_wu_donekue_caexplicit_bzerousbf_cacd9660_tstamp_conv17wskbd_calxtphy_statustqphy_cdpxa2x0_wakeup_configcopyaddroutcryptodev_cbpcmcia_scan_cispxa2x0_memctl_iohclockintrcpuset_add_allVOP_READufs_ioctlffs_freefilein6ifa_ifpforlinklocallastdtimegetdisksys_setuid_wdc_ata_bio_startstart_updateudav_cdusbd_clear_port_featureusb_abort_task_threadufs_quota_free_blocks2senditsr_crypto_decryptudp_detachbufq_fifo_destroylcd_bpp16_screencluster_writernd_event_tailsr_raid5_createusbf_add_endpointhidkbd_decodeuvm_setpagesizepxa2x0_lcd_list_fonttcp_xmit_timersr_raid1_rwin6_recoverscopensphy_serviceaue_tickpxa2x0_gpio_get_bittimeout_add_tvtickmclpool_warnmsgscsi_pending_finishdb_termscsi_preventmmcloseieee80211_get_assoc_respcd9660_accesssr_wu_getffs_statfsscoop_set_sdmmc_powercpuset_complementrijndael_set_keywdcprobeiophy_cdudp_recvspacea4x_bs_w_1km_allocfdropsr_block_putgf_initsyn_cache_unreachuserconf_histszsys_getrlimiticmp6_errcountbpf_attachdicmp6_ctloutputieee80211_ba_move_windowstuck_keyscpuset_issetufs_dirremovepxagpio_reg_writeieee80211_add_timif_attachsetuppipe_writem_clsetwmssr_set_chunk_stateuvm_map_addr_RB_FINDcryptof_pollin_pcblookup_listensbappendm_copybackpxammc_cdscsi_remove_linkuvm_swap_puticmpbmcastechoHMAC_SHA1_Initextent_print1db_continue_cmdbufheadconfig_scanwi_get_nwkeypxa2x0_gpio_clear_bitkp_pageablesr_raid6_addiopmap_copy_page_funcpxa2x0_lcd_attach_subripsrciso_nchstatskue_txeofural_amrr_startnlineswdb_restart_at_pcdb_sstep_printohci_rem_edether_ifattachinflateSync__wdccommand_donesdmmc_function_freeumass_adjust_transfersignal_initnsphyter_servicefill_drlistffs_updatedb_print_formatwsmuxclosedp8390_getunix2dosfnspec_advlockmtdphy_cdmax1111_adc_valuefragtblraw_sendspacenullopzaurus_udc_is_hostsdmmc_intr_disableAES_CMAC_SetKeycomdiagextralocunsleepvop_generic_bmapwdprobescsi_xs_getX_db_lookupmtdphy_funcsblf_encryptsched_proc_to_cpu_costohci_alloc_std_chainipintrgetnanouptimesdmmc_scsi_detachudav_activatedes3_encryptmaxdmapural_alloc_rx_listusb_block_allocmemext2fs_symlinkdb_skip_to_eolinverse_charip6_savecontroldevice_registerpxauart_activatesr_raid6_set_chunk_statend6_dad_stoptimerq_to_bmountrootsdmmc_scansyn_cache_resetdb_inputcharuhidev_opendb_boot_cmdsundefined_entryip_initreaddeprocess_read_fpregsohci_freexural_txtimecd9660_rrip_getnameufs_check_exportdes_encryptsysctl_rdintcd_interpret_sensein_mask2lenural_eeprom_readpxagpio_matchscsi_iopool_destroylodirtypagessr_ioctl_disciplinefindwin95VOP_WRITEsys_nanosleepusbf_free_bufferstart_init_execifa_update_broadaddrnd6_addr_addifa_ifwithaddrclock_ymdhms_to_secsdb_write_cmdrootduidif_clone_attachwsmoused_releasesys_getfsstatohci_abort_xferbpfopencdstrategynetisr_intrdeflatePrimerandomwrite_filtopsnd6_slowtimo_chuvm_km_valloc_alignenc_xform_nulldb_max_widthip6_pullexthdrmalloc_printitcpu_idle_entercomwritemouse_copy_selectionbuf_kva_starttuagg_subVOP_RENAMEauth_hash_gmac_aes_128cdclosesys_fchdirsr_crypto_readsdmmc_scsi_cmdgreen_onsysctl_ifqprocess0pxapcic_mem_freeieee80211_send_eapol_key_reqm_cltick_tmorandompidwd_cdurl_initusbf_open_pipe_ivalfilt_ttyrdetachsdmmc_mem_send_op_condarp_inuseuhidwrite_bus_dmamap_destroyvn_pollinet6swrouteswdosdirtemplatemainbus_cddb_uvmexp_print_cmdpxa2x0_lcd_cnattachsys_mincorene2000_test_memapm_power_printieee80211_tree_RB_REMOVErasops8_putcharlastsecondswdog_timeoutwsmousedoopenwi_get_txpowerural_plcp_signaludav_stopusbd_error_strscdcef_caamphymatchscoop_set_headphonepxapcic_intrtcp_maxpersistidleudav_tx_list_initspec_ioctlzkbd_set_ledsufs_initproc_reparenta4x_bs_r_4uvm_exitfc_bmapcallspr_rmpageffs_initsdmmc_submatchcluster_wbuildsr_crypto_createpxa2x0_gpio_clear_intrscsi_ioh_setbootsyncuvm_initcdcef_matchaue_attachieee80211_crypto_attachsys_ioctlusbf_clear_endpoint_featureuvm_map_addr_RB_NFINDif_free_sadldb_dotsdmmc_attachieee80211_node_joinfilt_bpfrdetachwsdisplay_emul_capxa2x0_clkman_configcompress2icmp6_initrasops15_putchar16bs_notimpl_bs_rm_1disassembleuvm_mapent_free_insertfilt_ttywritepool_update_curpagehid_end_parsepxa2x0_gpio_intr_unmaskin_setsockaddrbpf_moveinwsemul_vt100_output_esc_spcostypevndbuf_pooluvm_page_physloadaxe_iffreset_entryuvm_pmr_remove_1strangewdcresetwdc_exec_xferip6_insert_jumbooptipintrqtuaggohci_noopsr_raid5_intrusbf_add_stringusb_frag_freelistpxapcic_intr_disestabliship_slowtimordsizerijndaelKeySetupEncip6_nexthdrrtdeletemsg__bss_startrt_tab2domkue_rxeofrasops4_putchar12rijndael128_encryptVOP_KQFILTERukphy_funcssys_msyncdeflate_compresswskbdreadsbappendrecordevcount_detachsd_capcmcia_function_disablesoftdep_fsync_mountdevinitmsgbufwsmouse_attachmemsetcuio_copydatapipe_free_kmempxa2x0_splxufs_getlbnsieee80211_get_actionieee80211_sa_query_requestphysiosr_ccb_doneohci_strpcmcia_3cxem556_func0_cfe0in6_selecthlimdb_show_all_vnodesupl_sendwdattachdb_symbol_is_ambiguousmii_phy_delete_mediausbd_set_report_asyncpxauart_attachin6_unlink_ifacrypto_kdispatchicmp_mtudisc_cloneclass_cmpuvm_pmr_insert_sizesodisconnect_spllowersys_setgroupsmainaue_csr_write_2lxtphy971_funcsrasops_add_fontohci_device_bulk_doneether_crc32_le_updatemtdphymatchtimespecfixrasops_init_devcmapsr_raid1_set_chunk_stateuaddr_bestfit_createural_set_basicratesip_flushieee80211_delete_keykue_startdp8390_configrasops_mapcharuvm_unmap_removepmap_alloc_l1icmp_errordb_hangmanwsmuxdevsusbf_transfer_completepxagpio_attachbs_notimpl_bs_sm_1upl_rx_list_inituvm_swap_markbaddes_set_keykqueueopssmsc_miibus_statchgvholdbufq_fifo_dequeueidgen32db_help_cmdrt_if_removesr_minphysscsi_default_getghash_gfmulusbd_no_quirkm_adjsr_wu_donemld6_stop_listeninguao_shrinkpmap_map_chunkextent_alloc_subregion_with_descrppsratecheckkmemlimitbuf_rb_bufs_RB_PREVwsemul_local_translateamap_copybufq_drainphysical_endbio_statusuhidpollieee80211_ieee2mhzsched_wasidlesr_raid5_initieee80211_dup_bssuaddr_hint_destroylf_findoverlapsr_raid_start_stopfilt_msdosfsvnodelf_wakelockkv_anydb_sym_numargskue_attachhookdumpconfAES_CMAC_Initwi_rxeofuaddr_lin_selectwsdisplay_cons_kbd_pollcdead_badoppool_large_alloc_niblf_cbc_decryptcalcrusys_unlinkdb_cmd_listmainbusmatchrt_setgatetcp_ack_on_pushpmap_growkernelext2fs_rmdirufs_chowndofchmodatsysctl_intupl_tx_list_inituvm_shutdownkqueue_closewsdisplaystoppte_l2_s_cache_modeuvn_initstrlcatsysctl_int_arrbs_notimpl_bs_wm_8uvm_map_set_uaddrcdce_matchsoftintr_dispatchdisk_unlockufs_ihashremtaskq_destroyieee80211_recv_4way_msg2or4cttywrite_bus_dmamap_createSHA256Inittcp_update_sndspacesr_crypto_doneurl_stop_tasksdmatchusb_freememudav_txeofpool_chk_pageproc0cdce_initufs_renameaxe_caext2gennumbersr_bio_ioctludav_attachuvm_map_entrybyaddrsr_already_assembledusbd_get_hid_descriptorrt_ifannouncemsgsoo_readwdc_scrub_xferscoop_resumeuvm_km_doputpageufs_opencopyout_statfspmap_modify_pvm_catsplxpxa2x0_rtc_setalarmrtinittqphy_statuscluster_collectbufskp_dma_contigwi_write_data_usbumass_scsi_minphysuvm_swap_initpxagpio_intr0tcp_nowaue_miibus_statchgdb_trace_until_matching_cmdproc_printitural_bbp_initdes1_setkeyunp_gcsys_clock_gettimeip6_hdrnestlimitcsefreepool_catchupcpuset_clearxscale_cache_syncI_rngfrag6_initbuf_replacevnodeuvm_pmr_size_RB_NFINDuvm_mapent_addr_removetimeout_setrdread__subdi3wsdisplay_resetntohsmsgbuf_putchar_bus_dmamem_freedb_boot_poweroff_cmdsd_flushcd_setvolext2fs_mkdirohci_openpte_l2_s_coherentext2fs_direntersys_symlinkatmii_pollstatrlphy_cawdgetdisklabelrw_exitkv_pagedupfdopenidgen32_initifmedia_list_addpidhashcdcef_encaprtprefpxaohci_detachxscale_context_switchuvm_totalencdebugugl_sendicmp6_ratelimitdb_unread_charsr_raid1_createsys_mkdiratdl10019_mii_bitbang_opssdmmc_io_attachdofstatatstart_inituhub_attachieee80211_recv_assoc_reqether_fakeaddrsysctl_tc_hardwaresmsc_rxeofscsi_ioc_ata_cmdtcp_mssdfltuvm_swap_freedata_abort_handlerusbf_setup_xferbs_notimpl_bs_r_1axe_initdb_look_charsr_block_getuhidev_set_reportin_pcbdetachmsdosfs_vfsopststohzaue_ifmedia_updcd_sizettycheckoutqicmp6_mtudisc_callback_registerdb_set_variablene_pcmcia_detachvm_map_unlock_read_lnaue_causb_explore_tasksrnd_event_spacesr_concat_rwpmap_clear_referencert_getmetricswdc_ata_bio_kill_xferin6_ifdetachdb_search_symbolcn_tabswaplist_insertsmsc_lock_miiip_forwardsensors_taskqextent_createrdclosebpf_freeddisklistin6_lifaddr_ioctlsys_fstatfsurl_txeofkue_devsbs_notimpl_bs_sr_8m_injectip6_mforwardingffs_isfreeblockseltrue_kqfilteruvm_map_lookup_entryhztoicsphymatchBlowfish_expandstatebs_notimpl_bs_w_4ieee80211_get_probe_respdead_strategyswi_handlerusbf_new_deviceni6_store_addrsspec_fsync__wdcwait_resetcom_pxaip_cauvm_map_deallocateicmp_reflectieee80211_parse_wpazkbd_attachscsi_xsh_iohext2fs_reclaimffs_ballocsys_getgroupssr_raid5_xorieee80211_node_attachsys_linkatuhub_cdwi_start_usbgeneric_bs_wm_1ip6_raw_ctloutputkernel_textufs_startsigstkinitohci_devd__end__kinfo_vdebugnsphy_reseturl_sendcdce_encapufs_bmaparrayfragtbl8uvn_sync_lockpcmcia_function_enableaes_ctr_setkeyrasops_vcons_alloc_attrurl_resetusb_needs_exploreswaplist_findufs_quota_alloc_blocks2fc_fileextendsfilt_sigattachwsmouse_cdsdmmc_go_idle_stateVOP_FSYNCffs_sysctlipport_hilastautoarpinit_doneusb_wait_taskdoclockintruvm_anon_pageinspec_closecd9660_closeuvm_map_mkentrypxaost_cauvm_map_addr_RB_REMOVEsys_shutdowncngetczkbd_cdtc_adjfreqrnd_statesuaddr_pivot_createm_gethdrconfig_rootfoundcue_cdputcieee80211_phymode_namebufbackoffsysctl_rdstruct__divsi3uhidev_cdwsmousereadsr_raid1_initxscale_minidata_clean_sizeschedcpuurlphy_servicesbappendcontrolukbd_set_ledswsdisplay_screenstatea4x_bs_rm_1wihap_sta_timeoutsoftdep_flushfilesdb_access_und_spipv4_inputm_getclrpool_headax88190_mediastatuswsmuxioctlsr_crypto_read_key_diskapm_matchipforwardingieee80211_get_cts_to_selfdb_lexohci_device_isoc_transferusbd_open_pipe_ivalicmp6_redirect_timeoutpxa2x0_wakeup_statussyn_cache_lookupprtactiveksym_upcaseufs_makeinoderasops_copyrowsscsi_xs_ioip6_process_hopoptsusbd_find_edescif_link_state_change_taskwsdisplay_set_cons_kbdfilt_ttyreadsys_getpgidcom_common_putcswaplist_trimcache_lookuprdioctlrijndaelKeySetupDecdb_boot_crash_cmduvm_objtree_RB_INSERTsysctl_tcurl_detachbs_notimpl_bs_rr_1sdmmc_intr_disestablishumass_scsi_sense_cbdp8390_intrrijndael_encryptrasops_do_cursorwsemul_vt100_handle_dcsieee80211_recv_mgmtaxe_detachwskbd_set_console_displaydumpsizesowwakeupsdmmc_io_read_multi_1ukbd_keydesctabirda_onsr_raid_inquirysmsc_setmacaddressextent_freeuvm_aiodone_daemonaddupc_tasksched_syncusbd_clear_hub_featureext2fs_vopsieee80211_send_4way_msg3db_mount_print_cmdcomclosepcmcia_print_ciseephy_attachsetsigvecurl_iffsys_sendmsguhidopenvn_marktextstrcmpsys_quotactluhidev_matchieee80211_get_hdrlensr_raid_startwuuaddr_pivot_destroytcp_mtudisc_increasesdmmc_card_attachulmaxin6_pcbconnectdehashkue_cduvm_pmemrange_addr_RB_INSERThook_disestablishexphy_funcsbpf_catchpacketffs_isblocksr_concat_createdb_stack_trace_printpxaip_cdzaurus_startusbd_find_quirkuvm_swap_allocpagesuvm_aobj_pooldb_show_frame_cmdsys_adjfreqmouse_copy_extenddb_examine_cmdqsphy_funcsicmp6_reflectsetrunqueueudv_attachsettimecdce_rx_list_inituhub_intrarm_pcache_typertable_inituaddr_lin_functionsuvm_addr_entrybyspacedp8390_detachata_set_modemii_phy_auto_timeoutsyn_cache_getnetisrdb_clear_breakpointspxaudc_bulk_transferttyrubieee80211_get_ratevop_generic_islockedpxaudc_bulk_closeuaddr_hint_poolwsemul_vt100_output_stringwsscreen_attachm_pulldownbufcachepercentlcd_screen_listpmap_initufs_rmdircryptodevkey_cbrlphymatchieee80211_next_scanpmap_zero_page_funcarmv4_tlb_flushD_SEminsr_meta_native_writeip6_initconfig_detach_childrenrawcbsmsc_detachukbd_cngetcz_errmsgtcpcb_poolsr_shutdownhookmii_bitbang_readregpxa2x0_cpuspeeduvm_map_addr_RB_INSERTBlowfish_stream2worduhidclosetimeout_add_msecipip_allowsys_polluvm_map_clip_endufs_makedirentryusbd_set_configuvm_mapent_mergeieee80211_recv_addba_reqm_defragrtable_l2setvnode_hold_listlastdosdateudav_unlock_miiscoop_timeoutbuf_rb_bufs_RB_NEXTufs_linksched_choosecpusys_mkfifouaddr_free_rbtree_RB_REMOVEzcallocdb_cmd_searchural_read_eeprompcmcia_parse_cis_tuplein6_ifinitin6_leavegrouprtlabel_id2sasqphy_casddumpiminsys_chflagsget_hw_ifidKQRELEdelaysdstartdb_machine_command_tableip6_hopopts_inputddb_regsieee80211_media_initselfalsevt100_outputscsi_default_putsr_free_resourceswsemul_vt100_output_esc_percentcom_enable_debugportpage0_datavn_isunderusbd_get_port_statusuvm_pageoutpxa2x0_setiplpffindtypepdevnamesqsyncwi_setmultiuvn_clusterifaddr_items_RB_MINMAXcd9660_vptofhwi_attachusb_camii_phy_downuvmspace_forkraw_initknote_enqueueudpcksumtcp_sendspaceurl_csr_write_4dl10019_mii_writeregdb_maxoffuvm_pmemrange_addr_RB_REMOVE_COLORffs_oldfscompatieee80211_add_rsnrijndael_decryptwdcdetachmaxlocksperuidin6_matchlensys_madviseupl_openpipesscsibusdetachdisk_attachwskbd_displayioctlip6_clearpktoptsncpusdb_cmd_loop_donearptfreedb_show_arptabbufadjustcom_detachieee80211_ccmp_encryptaxe_stopural_set_macaddrbs_notimpl_bs_w_2dead_printeephy_serviceinphy_servicemii_media_tablesr_discipline_freewdstrategyttyprintfreaperprocsigcodedb_elf_search_symbolipip_inputdeflateCopyieee80211_send_group_msg2db_delete_watchpointcomttyne2000_detectbuf_undirtysysctl_tstringsr_meta_cleardb_watchpoints_insertedusbd_start_nextxscale_cache_cleanDfilt_ttywdetachamap_swap_offpool_allocator_nointrsys_sysarchallprocessBlowfish_decipherbio_validateigmp_initmii_phy_add_mediafilt_msdosfsreadwritecpu_reset_needs_v4_MMU_disablecache_zapMD5Initcryptodesc_poolbus_space_write_raw_multi_2ffs_vfsopssysctl_mallocwihap_ioctlieee80211_outputlcd_burnerfrag6_slowtimouvm_pmr_insert_addruvm_map_hintwant_reschedpmap_bootstrap_pv_allocatorpxa2x0_gpio_intr_fixupieee80211_ioctlmsdosfs_mkdirkthread_create_deferreduhidevsubmatchrasops8_initcrc32_combinebufq_simple_nscanpxammc_intr_donedevid_freeieee80211_sa_query_timeoutscsibusactivatend6_timercomcnpollcbioopenusbf_stall_pipeqsphy_servicein6_ifloop_requestpxaip_attachcd_patterns__cmpdi2sr_crypto_create_keyssd_ioctl_inquiryscsi_xsh_adduvm_pmemrange_addr_RB_FINDraw_detachscsi_xsh_runqueuepmap_get_pdeural_read_multibs_notimpl_bs_wr_1domainnamelenigmpctl_varsusbd_get_report_descriptorsd_thin_paramsip_rtaddrfiledesc_initurl_ifmedia_statuscue_csr_read_1vrelewi_set_pmwsmux_do_displayioctlohci_alloc_sedpxa2x0_lcd_setup_consolescsi_xs_errorprtrealloccheck_consoleapm_record_eventamap_freein6_domifattachwsdisplay_cnputczapm_restartusb_blk_nfreend6_prefix_lookuptc_getfrequencysync_inactivespec_printusbf_start_nextext2fs_lookupmsdosfs_openext2fs_linkvop_generic_revokeohci_hash_add_itdapm_activateieee80211_add_erpieee80211_decapfilt_sigdetachfilt_seltruedetachext2fs_renameipsec_def_authusbd_setup_isoc_xferpxa2x0_bs_vaddrttywflushcd9660_rrip_offseturl_startwskbd_default_keyrepeat_datacomcnmodeclosefcomioctlumass_cbi_resetscsi_ioh_deqsoftdep_sync_metadataif_clone_lookupgetmicrouptimemii_tickpxa2x0_bus_dma_tagdisk_openpartip6_dad_countuvm_pager_dropclusterfilt_generic_detachpxa2x0_lcd_mmapip6_getmoptionssensor_task_unregisterzssp_ic_sendpool_print1wdc_ioc_ata_cmdpcmcia_card_deactivatepxaudc_allocmdb_breakpoint_listwi_pcmcia_matchcd_get_parmszkbd_cngetcpmap_extractin_purgeaddrnd6_ifptomacwsmousedoioctlamap_unaddural_watchdoglcd_cnattachuvm_pmr_insertcd9660_printsr_meta_saveohci_rhsc_enableif_congestionnfilescd9660_islockedin6if_do_dadcue_txeofaue_detachcryptodev_keyieee80211_iserp_stapipe_kqfilterdowait4ext2fs_openpmap_devmap_find_papmap_kenter_cacheusb_insert_transferaxe_matchrasops4_copycolsukbd_keymapdatasr_meta_validatestopprofclockbufq_nscan_destroydb_hangnullioctluaddr_pivot_printcryptof_closerasops_getcharpte_l2_l_cache_modeisohashmclsizesparsediskwi_set_debugzkbd_onbcstats_printsdmmc_mem_single_write_blockbreadieee80211_node_copyamap_lookupipctl_varswsdisplay_suspendpmap_page_removert_timer_remove_allwskbddevprintzkbd_irquhid_intrwdc_output_bytesieee80211_classifyzkbd_modstatewsdisplay_closescreenieee80211_media_statusproc_stop_sweepiophy_capmap_set_pt_cache_modescsi_xs_exectcp_usrreqmichael_keydb_playsieee80211_setbasicratessd_interpret_senseuvm_map_pageable_pgonuvm_addr_invokeudp_usrreqifmedia_initusbf_open_pipertable_l2ext2fs_vfsopsuvm_mapent_freeext2fs_inactivedead_bmapdb_guessesif_getgroupmembersdb_show_all_poolssoo_kqfiltercpu_startupwsemul_vt100_output_dcs_dollaramap_refdb_command_loopwdc_ioctlamphyattachapm_suspendsfdexpandtickscoredump_countsegs_elf32sr_wu_initwdc_ata_presentmsdosfs_closerd_detachpool_do_getext2fs_setattrapm_resumesysctl_clockratevn_rdwrohci_close_pipend6_need_cacheip6intrsyncer_maskwdc_default_write_raw_multi_2uvm_pagedeactivateearly_clkmanufs_unlocktcp_ctloutputpxa2x0_turbo_modeukphy_statusieee80211_derive_pmkidMD5Updateblktochrifmedia_settask_setpcmcia_function_initbio_lookuppmap_createuvm_map_extractsr_crypto_meta_opt_handlernd6_prelist_addufs_removesysctl_tc_choiceptsignalboottimecd9660_readlinkwsdisplay_set_console_kbdxscale_cpu_sleepVOP_ADVLOCKdb_watchpoint_cmdaxe_watchdogwskbd_mux_closefrag6_inputcompressBoundpmap_alias_distunpst_sendspacewsemul_vt100_output_escffs_indirtruncsmsc_cdieee80211_add_ratessr_raid5_rebuildrasops8_makestamppxapcic_mem_maptcp_rscalettwakeupuvmspace_freeext2fs_inode_poolffs_ino_poolpmap_pageidlezerouaddr_rnd_printmii_phy_statusmsgwsdisplay_internal_ioctlcpufunc_domainsswapdrum_getsdpVOP_PRINTfdshareuipc_setaddrsdmmc_intr_taskugl_tx_list_initicmpv6ctl_varszaurus_udc_matchrasops_vcons_unpack_attrinverse_regioncdstartsdmmc_stimeoutgf_premulfilt_generic_readwriteuserconf_disablevrefin_scrubprefixusb_detachipforward_rtdb_elf_forallohci_device_isoc_closeurl_int_miibus_writereguhidev_activatevt100_ansimodeAES_CMAC_Finalsr_uuid_formatrasops_lmasknd6_dad_na_inputsd_cmd_rw16ghash_updatedb_set_temp_breakpointdb_buf_print_cmdinpcb_pool_initializedsys_nosysat_pollallproccdevswsr_rebuildxscale_cache_flushDne2000_attachsys_mlockallusbf_config_endpointgallant12x22uaddr_free_rbtree_RB_FINDwskbdcloseuvm_sysctlmalloc_lasterrstatintrgetsndiskmapopen_bus_dmamem_unmapsys_fchflagsnamei_poolpxa2x0_pi2c_readrt_timer_countvfs_buf_printcryptodev_opworkq_destroysmsc_ifmedia_stszssp_caukphymatchpxa2x0_gpio_get_functionuvm_pager_putdiskmapcloseohci_device_bulk_abortudav_cain_canforwardrasops_unpack_attrsmsc_unlock_miiremove_selectionpxa2x0_bs_subregionifa_item_removeohci_device_intr_abortieee80211_tree_RB_INSERTrasops_copycolswi_pcmcia_attachpmap_destroyip_oursscsi_mode_selectkernel_pt_listuvm_map_freelist_update_clearetherbroadcastaddrieee80211_rssadapt_updatestatscdcef_do_requestrasops4_makestampvfs_getnewfsidaue_rxeofSHA512Finaludp6_ctlinputitimerroundarm32_vector_inituvm_pmr_size_RB_PREVwdog_shutdownscsi_print_sensewskbd_update_layoutmmopenffs_inode_freeohci_device_intr_transferwdc_cdamphy_statusukbd_intrifa_item_insertrtioctlkue_ctlpxaost_get_timecountscsi_xs_putifaddr_item_pluaddr_hint_functionsieee80211_tree_RB_INSERT_COLORprofprocswdc_free_xferip6_inputbuf_free_pagessleep_finish_signalicsphy_cdwi_usb_cmdrespsr_crypto_alloc_resourcesgeneric_armv4_bs_rm_2route_srcbootduidspeedup_syncerigmp_sendpktloop_clone_destroywdc_ata_bio_doneifmedia_baudrate_descriptionsv_putcsr_scsi_wu_getsdmmc_add_taskm_getptrukbd_caufsvnode_filtopsscoop_pcic_set_poweruvm_fault_unwireuserconf_common_attr_valsched_noidlesys_getitimerhid_get_datadonicewdcstartcpu_configuresr_rwip6_freemoptionssqphy_funcshidkbd_delayed_decodeieee80211_amrr_chooseusb_create_task_threadsieee80211_end_scancdce_txeofwsdisplay_common_attachne_pcmcia_matchbufhighpageswsfont_rotate_internalpmap_fault_fixupuaddr_poolrn_refinesgeneric_bs_rm_4hmac_opad_buffersockargshidkbd_ioctlwsdisplay_getactivescreenvop_generic_abortopsr_raid6_set_vol_statesetregsupl_rxeofni6_nametodnssobindvmcmd_map_zerodb_read_charzkbd_pollpxagpio_intr1vfsinitupl_cacnclosedb_tok_numbertcp_do_rfc1323ip_fragswdc_dmawaitmii_phy_setmediain6_ifpprefixkd_trylocklo0ifphostidpool_chkwi_alloc_nicmem_usbusbd_free_bufferuvm_pagermapoutrt_if_linkstate_changesr_raid0_rwif_downalluaddr_pivot_newpivotext2fs_vptofhnam2blkrw_statussr_raid6_assemblecoredump_writeseghdrs_elf32rt6_deleterouteip_maxqueuesysctl_ttyieee80211_chan2ieeeuhub_cazssp_initin_socktrimieee80211_recv_delbaext2fs_dinode_poolieee80211_node_cmprtallocsys_mprotectieee80211_std_rateset_11gwi_pcmcia_cadequeue_randomnessuvm_km_kmemalloc_placue_casyncer_maxdelaywsdisplay_getscreendeadprocstart_reaperunicode_to_latin2sys_fcntlvfs_free_addrlistsys_setrlimitsys_sigpendingloop_clone_creatediskmapwriteuvm_map_cleanuvm_pmr_get1pageicmp_redirtimeoutworkq_add_taskttyclosewdrestartzapm_charge_completepxa2x0_lcd_ioctlusbf_freememicmp6_nodeinfocomp_algo_deflatemaxvfsconftimeout_addcpu_cdip6_forwarddb_fncallnumcachepxaudc_write_epNsr_bootkeyural_write_multiuvm_pagecountcpu_initclockscue_sendwskbdioctlmii_downcdcef_attachrn_mpath_hashbrelseext2fs_unmountpsratiosdminphysohci_device_isoc_methodswi_usb_tx_lock_tryaxe_unlock_miicpuset_delwsdisplay_switch3ttyoutdevice_lookupDebuggerwdc_pcmcia_prwi_usb_txeofsr_crypto_preparecdcef_start_timeoutcdminphysschedhzurlphy_carip6_inputtcp_totbackoffvdropuserconf_basesdmmc_mem_sd_initsr_raid5_rwlooutputcue_setmultisoisdisconnectedcpu_coredumppxa2x0_bs_barrierxscale_cache_clean_addrrevbitsdvd_read_disckeypmap_clean_pageuvm_aio_aiodonesr_ccb_rwpmap_clearbitieee80211_mgmt_outputcrypto_freereqsyn_cache_rmclrbitsdb_boot_dump_cmduvn_putigmp_checktimerscsi_add_linkxscale_cache_clean_minidataieee80211_proto_detachmii_phy_statuspcmcia_card_intrcommajordl10019_mii_resetrasops_list_fontcrypto_newsessiongeneric_armv4_bs_r_2pxaic_baseenc_xform_aes_xtssoclosesr_ccb_freescsi_detach_targetinstall_coproc_handler_staticwakeup_nsys_connectbuf_daemonskpcsdmmc_scsi_attachpxammc_bus_clockpxammc_bus_powerdb_leieee80211_bip_decapbufq_fifo_createohci_root_ctrl_transferipv6ctl_varsroute6_inputbs_notimpl_bs_w_8cdcef_stopcsr1board_startupsys_socketpaircnreaddounmountuvm_swap_allockthread_create_nowwskbd_pickfreehidkbd_bell_fn_argtcp_ackdrop_ppslim_countdb_elf_line_at_pcusbf_cdarm_picache_sizesr_map_rootttspeedtabkqueue_readieee80211_add_edca_paramscd9660_mountuserconf_maxdevcue_inituvm_pmemrange_addr_RB_INSERT_COLORfork_tfmratelxtphymatchsr_hotplug_registerpv_sizensgphymatchzkbdhalttvuvn_sync_qin_proto_cksum_outwskbd_activatewsdisplay_cons_pollmodewi_media_statusurl_miibus_statchgnd6_purgedb_mult_exprtcp_keepidleif_attachheadnextcdb_listbreak_cmdwi_scan_timeoutuvm_wakeup_plaiszerodevpxaudc_matchauth_hash_hmac_ripemd_160_96ieee80211_recv_pspollumass_cageneric_bs_sr_4lf_freesys_fhstatnullmodemohci_hash_find_itdwihap_sta_deauthif_attachdomain1sys___get_tcbieee80211_amrr_node_initraw_recvspacediskerrwi_startcd_cdwsdisplay_screentype_pickwsdisplay_addscreen_printpxaudc_opendb_machine_commands_installieee80211_state_namesys_preadne_pcmcia_activatescsi_movewdc_pcmcia_detachkernel_pt_lookupkmem_mapcd9660_check_exportukbd_translateconfig_pending_decrqsphyattachaxe_startieee80211_input_print_tasksoqinsquediskstatscdce_attachdes_ecb_encryptudp_inputnchrtoblktblihashrn_search_mresettodrusbd_ref_decrufs_readdirsys_flockpvwi_usb_do_transmit_syncspec_badopmsdosfs_linkbufq_nscan_dequeuebs_notimpl_bs_c_1ohci_root_intr_methodssdmmc_check_cis_quirksicmpctl_varsigmpstatmichael_finalvn_initialize_syncerdpipeselwakeupxscale_controlcd9660_quotactlsr_rebuild_starticmp_sendadjtimedeltacdce_watchdogsmsc_newbufrasops_vcons_erasecolspxagpio_intrNdb_mbuf_print_cmdusbf_abort_pipewdc_ata_errieee80211_choose_rsnparamstime_uptimeuvm_pagealloc_pgfill_filecdce_intrsmsc_rx_list_initfilt_uhidreaduvn_wlistuvm_pmemrange_addr_RB_REMOVEsowakeupinsidetcp_autorcvbuf_incbufq_queuepxapcic_create_event_threadpxa2x0_lcd_stop_dmabs_notimpl_bs_r_4db_putstringprefetch_abort_entrymouse_copy_linesigactsunsharetimeout_hardclock_updaterdattach_edataupl_detachrijndael128_decryptttkqfilterm_tag_deletecd9660_ihashremsensor_findip_fragmentfilt_timerusbd_endpoint_countsys_statfsSHA1Finalsched_nomigrationsinittimecountersensordev_deinstallrawin6pcbtablepmap_protectkprintfdevice_unrefrc4_keysetupscsi_startuvm_pmr_addr_RB_REMOVE_COLORin_cksumzombprocessvnode_pooluao_shrink_convertvnode_free_listtcp_savetiusbf_matchuvm_pagereallocapm_battlowsensordev_countuvm_fault_unwire_lockedklist_invalidateuvm_km_createthreadpool_printit_enddes_check_keyrt_senddesyncsogetopthid_report_sizeusbf_endpoint_attributesuvm_unmaprd_matchdb_deletewatch_cmdusbd_ref_waitsr_crypto_calculate_check_hmac_sha1wsemul_vt100_attachpollscandomaininitvflushbuftime_secondip6_forward_rtwskbd_get_mapentryuvm_pmr_initsr_hotspare_rebuild_callbackusbd_read_report_descsbcreatecontrolsys_mlockpxa2x0_maxspeedieee80211_setup_nodebioioctldvd_read_structvdevgonehtonsdb_show_callout_bucketbucketkqueue_writesys_syncieee80211_reset_scancominitieee80211_add_pmkid_kdeenodevsr_raid0_discipline_initffs_mountfsin_delayed_cksumm_cltickswsemul_vt100_edrtstatttvtimeoutkd_waitokabtstacktimingsafe_bcmpspeclisthbdwritecpu_idle_cycleversion_to_spcVOP_INACTIVEsdmmc_io_read_4zkbd_cawsmux_do_closepte_l1_c_protouvm_mapent_biastcp_syn_cachewsemul_vt100_translatehalteephy_cainphy_cawihap_sta_is_associeee80211_std_rateset_11akputcharbootargssys_getsiddb_trace_until_call_cmdRMD160Initdisk_gonewi_write_record_usbdb_show_all_mountscue_csr_read_2rasops15_putchar8wdc_pcmcia_disk_device_interfacem_trailingspacefileheadrc4_cryptusbd_alloc_xferscoop_mmc_get_ocrpxaudc_ctrl_abortnextvnodeidcttypollsr_meta_initural_startrotatedfontskp_dma_zerosensor_task_ticksys_swapctlpxaohci_matchcpufunc_dfsrpxammc_attachbd_reqpxa2x0_probe_sdramrasops4_initbs_notimpl_bs_rm_2copypktoptsin_selectsrcmsgscpu_exitzapm_batt_lifeip6_initpktoptsworkq_threaduvn_getwsmux_add_muxbpfilter_destroyunp_attachohci_device_isoc_starttcp_syn_bucket_limitsys_renamesr_raid6_xorqfrag6_nfragsip6_log_timeeephy_statusinphy_statusrtalloc_mpathxscale_cache_purgeDscsi_activate_targetdisasmufs_ihashinitunp_deferuvm_km_valloc_waitsys_sigreturnlid_suspendsbflushscsi_link_closeipsec_require_pfsswapdevwd_cawsdisplayttykue_sendsr_raid5_openingssysctl_intrcntaxe_tick_taskvn_readnclrunegheadbwriteleavepgrpqsphy_cdarmv4_tlb_flushDkernel_pt_tablepmap_get_pde_pteuvmpageropsuvm_page_initohci_root_intr_closewsdisplay_common_detachsr_copy_internal_datawihap_sta_alloccast5_decryptsdmmc_io_xchgxscale_setupnamecache_rb_cache_RB_INSERTwsfont_locktcp_timer_funcsipqent_poolpxaip_attach_criticalif_attachdomainicmp_ratelimitieee80211_rssadapt_raise_ratesr_crypto_decrypt_keyusbf_iface_endpointuvm_km_page_initrttimer_pooladler32_combineieee80211_regdomain2flagadd_entropy_wordsax88190_mii_readregpxa2x0_gpio_set_bitsosendtaskq_initdosetrlimitpxa2x0_pi2c_getvoltageuvm_pmemrange_addr_RB_PREVrn_initieee80211_set_timuvm_objtree_RB_NEXTsr_scsi_probeloopattachdp8390_watchdogural_rxrateieee80211_save_iewdc_input_bytesusb_abort_task_thread_procRMD160Finaldb_listwatch_cmdscsi_cmd_rw_decodechainlengthprocess_read_regsusb_fill_udc_tasksys_unlinkatural_disable_rf_tunettwakeupwrrn_lookupthrsleep_unlocksr_wu_release_ccbsrtmask_poolsmsc_write_regallocate_copybufferuserconf_show_attrsys_execvesdmmc_mem_send_cxd_datafdallocwsdisplayreadprfindscsi_donechkvnlockhw_sysctltc_ticktockphtree_RB_MINMAXdb_siftingpxaudc_freexdb_look_tokenpmap_alloc_l2_buckettcp_syn_cache_limitnumvnodeszkbd_activatecryptof_ioctlcomreaduvm_pagefreeext2fs_inode_allocswcr_encdecwsdisplay_switch2scoop_check_mcrbufq_fifo_queuedb_examine_formatin6_pcbbindpool_large_allocicmp_do_exthdrieee80211_inact_timeoutreaperieee80211_add_gtk_kdecoredumpfilt_kqueuemalloc_rounduppxaudc_bulk_donepipe_readpxa2x0_bs_freeuvm_map_addr_RB_INSERT_COLORifioctlsys_utimesdb_symformatsusbd_do_requestnd6_storelladdrusbf_endpoint_addressrip_initsocreateusbd_find_idescpmap_cache_stateureadcaue_startufs_setattrrijndael128_setkeyieee80211com_headlogpriworkq_queue_taskmemhookdoclusterreadzapm_batt_voltcast5_encryptsys_exitsbtryieee80211_send_4way_msg1m_applyxscale_maxspeedswcr_processcryptof_writeudav_startaxe_lock_miiuaddr_pivot_functionsdomkfifoatwdc_exec_commandpxaohci_caudv_lockbufqspxaudc_bulk_abortdb_watchpoint_listwdcintrcd_playHMAC_MD5_Updatesys_clock_getressdmmc_set_bus_widthaxe_attachsyn_cache_insertnsgphy_funcsrc4_getbytesswcr_authencttystats_initne_cdnd6_umaxtriesohci_device_intr_doneusbf_get_stringpcmcia_intr_stringpte_l2_s_prot_kwnd6_setmtu0nd6_debugip6_maxdynroutesuvm_map_piewindow_deflatedb_delete_temp_breakpointcpu_cpuspeedcpufunc_iddefrtrlist_updateurl_csr_write_1_tr_initSHA1Transformesymusbf_schedsoftintrscoop_mmc_set_powerieee80211_defragcrypto_invokeosreleasesdmmc_free_ccbsVOP_RECLAIMscsi_probe_targetsr_raid1_set_vol_stateip6_getpcboptbuf_releasewsmux_evsrc_set_displayHMAC_MD5_Init__modsi3smsc_txeoftcpqe_poolpgrp0mainbussearchurl_watchdogwihap_timeoutuserconf_changewsemul_vt100_jump_scrollpxa2x0_lcd_new_screendb_panicuserconf_helpsr_ioctl_setstateufs_advlockicmp_initpcmcia_cis_read_1mouse_moverelcdst_pteuvm_growcsecreateinet_ntopvfinddevieee80211_node_cleanupugl_attachrt_msg1apm_handle_eventether_delmultisave_rtedb_history_currsr_crypto_get_kdfmainbusattachrn_mpath_initheadarc4_taskexec_sigcode_mapsys_gettimeofdayipsec_soft_timeoutwdccommandshortieee80211_rate2mediavcleaniophy_servicerasops8_putchar16cd_getvolsplassert_ctlsys_getresuidsys_fhopensr_crypto_ioctlzapm_battchkratedos2unixfnscsibussubmatchrtentry_poolbufq_restartzkbd_consopsuvm_km_pgremove_intrsafeext2fs_sbupdatein6_init_address_ltimesdefrtrlist_delsdmmc_mem_set_blocklensys_fchmoduvm_unmap_detachieee80211_recv_authupl_initusb_dev_quirkswskbd_srcopsdopselectuserconf_common_devvfs_mount_printpxa2x0_irq_handlerhfsc_purgestartieee80211_needs_authwdog_cookieusbd_devinfoskip_spc_leftvn_isdisksys_selectscoop_charge_batterydeflateParamsbadaddr_read_1cryptoattachvop_generic_lookupdb_branch_takenpxammc_functionsin6addr_intfacelocal_allnodeslogreadrn_mpath_capabledead_lockworkq_next_taskieee80211_name2regdomaintcp_issphysical_freestartfc_largedistancesys_setitimerisofntransurl_attachnd_prefixsmsc_tx_list_initwsemul_vt100_resetvfs_unregistermii_phy_flowstatussmsc_ifmedia_upddisk_mapvt100_setnrcselwakeupffs_reloaddb_set_watchpointsfill_kproccnwriteumass_bbb_get_max_lunzkbd_keymapdatain_ouraddrpolloutdb_show_panic_cmduipc_usrreqnd6_na_inputrtl80x9_mediastatusdb_next_free_watchpointvflush_vnodewsmouse_activateaes_key_unwraprip6_usrreqin6mask96coldpxaudc_ctrl_donedb_clear_watchpointscdcef_startbutton_eventunp_scansbappendaddrbufqs_mtxbpf_maxbufsizeextract_entropyufs_islockedusb_detach_wakeupffs_unmountne2000_detachffs_vopsdofutimenssys_pwriteisohashtblscoop_pcic_matchwihap_shutdownuvmspace_allocrevarpinputbufq_nscan_peeksdmmc_function_alloccd_pausecompresshashinitttstartumass_setup_transferwdwriteipsec_keep_invaliduao_detach_lockedieee80211_parse_rsn_akmsdopentcp_tracemii_phy_resetip_getmoptionsdp8390_mediastatusin6mask32__moddi3rasops_doswitchdisk_countohci_confdpmap_page_protectdead_openscsi_detach_lunsr_ioctl_inqkue_setworddb_list_watchpointsuserconf_attrwdc_kill_pendingbmtphymatchicmp6_redirect_outputroute_cbsys_futimenstaskq_createexphy_cdreadepcpuset_init_cpuscsi_init_inquirylxtphy_resetuaddr_pivot_removetcp_slowtimoieee80211_std_rateset_11bamphy_cdcd_play_msfpmap_remove_pvtcp_newtcpcbsbchecklowmemswapmountffs_mapsearchsys_fhstatfssmsc_activateelf32_load_filesys_getpeernamepxapcic_io_mapieee80211_get_txkeydb_taken_bkptdb_eqnamescsi_strvistcp_set_iss_tsmbpfwritedoingcachesys_getrusageapm_threadrasops_initauth_hash_hmac_sha2_256_128aue_reset_pegasus_IIuvm_map_addr_RB_MINMAXcryptoioctlbufq_destroyusbd_get_cdescnd6_prunecomconscflagm_getffs_truncateuhidevprintmii_attachsdmmc_cdttylclosepool_allocator_allocwdc_default_read_regin6_ifremloopchar_typeohci_free_sitdusbctlprintworkq_createvn_closeudav_csr_writeuhid_do_readdoclusterwritecdcef_initusbd_close_pipeusbd_deactivatewsdisplay_cfg_ioctlffs_writeieee80211_wep_set_keybremfreefilt_sowdetachnd6_initip6_maxfragslimfreedoutimensatdb_show_regs__wdccommand_intruvm_km_free_wakeuprootvnodeifmedia_ioctlpxammc_host_ocruserconf_modifyusbf_setup_pipewi_usb_rxeof__one_cmpldi2cpufunc_nullopcd9660_ihashgetmii_phy_detachwskbd_add_mux__muldi3db_qualify_ambiguous_namesuhidev_caurl_lock_miiip_mtudisc_timeoutrandomopenin6addr_linklocal_allnodesamphy_capxaudc_attachusbf_allocmembufinitskip_char_leftbootconfigscsi_quirk_patternsuserconf_lineslimit0rt_if_trackuvm_md_constraintsif_attach_commonlcd_set_backlightpxa2x0_pi2c_openuniqdosnamedb_recoversr_raid5_set_vol_stateinflateSetDictionarypfxrtr_lookupext2fs_mknodvttoif_tabdb_delete_cmdwdc_pcmcia_activatebgetvppgrp_poolsr_concat_assemblesmsc_ioctlsd_cmd_rw12uvm_pmr_addr_RB_INSERT_COLORucred_poolxscale_cache_purgeD_rngcpufunc_ifsrip_insertoptionsdes3_setkeyarp_maxtriespmap_uareacd9660_bmapax88190_mii_bitbang_writeaue_eeprom_getwordukbd_cnbellphtree_RB_INSERTnaptimeufs_dirbadentryusbf_close_piperasops4_erasecolslogioctlicsphy_funcs_bus_dmamap_load_uiogeneric_bs_wr_1strlendb_machine_initsensor_task_workrasops15_putcharconfig_suspendzkbd_enablewsfont_initieee80211_parse_rsn_cipherkue_activatewsdisplayparampool_page_freewdactivatewsmouse_inputcopystrsched_nmigrationswdc_do_resetiftxlistwdog_ctl_cb_argsys_pipeural_setup_tx_descusb_detach_waitpxapcic_printpxa27x_run_modearm_pdcache_waysarp_rtrequestieee80211_encrypthw_vendorxscale_setup_minidataext2fs_reload_vnodeelf32_check_brandwi_cor_resetudp_initieee80211_recv_4way_msg3proc_trampolinepxaudc_read_ep0sys_rmdirdp8390_disablecd9660_vfsopscpuset_copycdcef_methodsspec_accesssocantsendmorepxaintc_causb_rem_taskpte_l2_l_cache_maskcdactivateuvm_vsunlockether_inputlockstatus_splraisequotaoffpxa2x0_read_ccntcoredump_note_elf32fs_posix_sysctlif_slowtimosmsc_tickudbtablewi_setdefwdcattachufs_printuaddr_lin_createfatentrywi_update_statsAES_CMAC_Updateusbd_printBCDsys_statukbd_apple_mungein_baddynamicieee80211_keyrunlineswpxaost_cdmsdosfs_symlinksys_symlinkicmp6_sysctlclfreeconfig_found_smuhidread_filtopsusbd_interface2endpoint_descriptorfdreleasedb_line_at_pcuvm_swapout_threadsural_bbp_writetask_addusbf_add_interfaceknote_attachmax_keylenlcd_activateieee80211_tkip_decryptdp8390_ioctl__assertif_congestion_cleardb_put_valuewsdisplay_emul_matchnd6_dad_ns_outputin6_prefixlen2maskscoop_akin_pulluppcmcia_megahertz_xjem1144_func0_cfe0uvm_pmemrange_use_insertudp6_outputieee80211_prfcn_devvpcom_activatewi_get_debugmaxfilesupl_devsuvm_pagecmpuvm_pageactivatein6_addr2scopeidgf_mapdma_alloc_bus_dmamap_load_rawffs_mountrootrd_cdrrw_statuspxaudc_write_ep0uvm_map_pageable_allsleep_finishipqtaskq_next_workdl10019_media_initpxa2x0_lcd_show_screenmsdosfs_strategycd9660_vopstimeout_delural_media_changem_cltickwsemul_vt100_elieee80211_chan2modeif_delgroupspec_strategyuvm_pglistfreeusbopenax88190_media_initext2fs_readsoo_statwskbd_cnpollckue_newbufuvm_map_isavailrusage_pooldisk_detachstrchrtask_delsystqhid_clear_localscsi_plug_poolusbf_host_resetuvm_pmemrange_use_cmpaes_xts_encryptuvm_pmr_size_RB_INSERT_COLORdb_deleteauth_hash_gmac_aes_256crypto_driversiftovt_tabsysctl_int_lowertcp_backoffworkq_task_poolsys_chrootieee80211_rssadapt_lower_rateicmp6_redirtimeoutenc_xform_dessoisconnectingarc4random_bufwsdisplay_pollcsr_wu_freeaobj_pagerrasops4_putchar8zaurus_battery_c3000uvn_iogeneric_armv4_bs_w_2MD5Transformmld6_inputgeneric_armv4_bs_sr_2uvm_objunwireieee80211_rx_ba_timeoutbpf_d_listsr_wu_allocsyn_cache_cleanupip_pcboptsfc_purge__data_startpxapcic_mem_unmapieee80211_eapol_key_encryptfilt_timerattachifmedia_delete_instanceurl_caenc_xform_aes_gcmuvm_mapent_allocudav_miibus_writeregacphymatchicmp6statdb_single_stepzssp_write_lz9jg18generic_bs_w_4inflateEndsr_set_vol_statewsevent_pollieee80211_pwrsavesys_profilvmcmd_map_pagedvnugl_stopin6_pcbhashlookupwsdisplay_cdbpf_detachdVOP_UNLOCKpmap_uncache_pagesingle_thread_setsyn_cache_initieee80211_find_txnodecd9660_wchar2charip_ecn_egressether_ipmulticast_maxsr_raid6_createohci_checkrevmouse_copy_extend_worduvm_init_limitsukphy_cdentropy_input_rotateusbf_softintr_establishin_pcbconnectieee80211_add_igtk_kdeVOP_POLLVOP_IOCTLsafepriunicode_to_latin7pxapcic_io_unmapuhidev_ioctlpxaohci_disablewdc_default_read_raw_multi_4ip6_copyexthdruao_swap_offmachinewi_cmd_ioVOP_CLOSEuvm_anallocin_pcbdisconnectzts_sync_ads784xuvm_vnp_terminatewi_usb_rxfrmsdmmc_io_read_1sys_getpiduaddr_rnd_functionsipmultipathunp_dropugl_matchuvm_map_advicetcp_mtudisctimeout_startupcue_matchrn_addroutesdactivatefilt_msdosfsdetachdb_print_sadb_elf_sym_numargsural_detachwsscrollbackdb_trapperukbd_cnpollcdoreadlinkatdvd_read_manufactundstackconfig_activate_childrenpxaip_printip6_check_rh0hdrieee80211_input_printdomkdiratremrunqueueusb_fill_udf_tasksoo_closetcp_recvspaceuvm_meteruhidev_maxrepidpmap_needs_pte_synctcp_ackdrop_ppslimmaxthreadnd6_lookupieee80211_cache_sizescsi_iopool_runurl_openpipesukbd_countrylayoutzts_matchsys_getppidsr_raid_request_sensescsi_ioh_pendingmii_anaruaddr_rnd_selectrc4_skipVOP_READDIRdomainssdmmc_select_cardsys___sysctlsd_cmd_rw6arm32_dma_range_intersectin4_cksumextent_alloc_subregiondb_putcharieee80211_recv_sa_query_respneedbufferwsemul_pickusbd_do_request_asyncin6_ifattachieee80211_get_addba_requgl_activatetcp_rst_ppslim_lasticsphy_cawsdisplaystartbs_notimpl_bs_rr_4wsmouse_srcopsohci_root_intr_doneip6_multipathusbd_get_device_descriptorpxapcic_submatchcd9660_initumass_fixup_yedataipsec_soft_bytesmichael_initnselcollemul_elf32usbd_open_pipeohci_softintrmsdosfs_lookupspec_pathconfmountroothook_listhook_establishtcptv_keep_initsys_chdirdb_unread_tokenext2fs_diremptymotion_eventuserconf_cntmouse_zaxisext2fs_inode_freepxaip_capcmcia_ccr_writedb_find_variableapm_cdscsi_io_get_donexscale_cache_clean_sizebuf_objectpxaintc_cdip6_rr_pruneuao_grow_convertusbd_desc_iter_initsbcompresspmap_free_l1nd6_outputSHA512Lastcdevsw_lookuplogsoftcsys_adjtimerijndael_set_key_enc_onlyohci_device_clear_togglesr_ccb_allocwdstartwsmuxreadamap_splitrefspec_open_clonewskbd_do_opensd_thin_pagescryptof_kqfilternclruheadscsi_move_doneural_next_scanrasops_alloc_cattruvm_aio_biodonern_initheadusbd_get_descuvm_pmr_printvop_generic_unlockuvmspace_shareieee80211_node_leave_htrt_timer_addentropy_poolieee80211_print_essidroute_usrreqdeextendspec_vopspxapcic_event_threadieee80211_wep_encryptsr_raid6_openingsieee80211_recv_deauthsched_init_cpurasops_erasecolstcp_dropicmpstatudpctl_varsuvmpd_scanm_prependsys_getrtablesoftraid_casmsc_resetwsemul_vt100_output_scs96_percentinflateInit2_cd9660_pathconfax88190_stop_cardin_pcbrehashpool_walksyncer_delaynoin_arpinputpmodzts_scalezts_caufs_accessin6_embedscopeif_alloc_sadlphpoolunix2winfnmsleephfsc_enqueuesdmmc_io_resetwsfont_unlockreassignbufip_freemoptionssr_meta_rwieee80211_release_nodesohasoutofbandddb_initbs_notimpl_bs_c_2nd6_dad_duplicated_bus_dmamap_unloadieee80211_free_allnodesmsdosfs_fhtovppte_l1_s_coherentbs_notimpl_bs_wr_4maxvnodesether_crc32_beinflateBackEndieee80211_add_ssidcpu_reset_addresspgfindsoftint_pendingtcp_ackdrop_ppslim_lastloadfirmwarerasops_cmapswcr_compdecip4_inputtcp_inputsysctl_dumpentrydkcksumwsdisplay_cnattachuaddr_free_rbtree_RB_INSERTnd6_gctimerieee80211_ccmp_decrypturl_csr_write_2iptimerip_inputwi_set_txpowernd6_setmtuaxe_ifmedia_updwdc_ata_ctrl_intrdb_last_non_spaceusbd_get_endpoint_descriptor_tr_tallyudp_ctlinputmii_detachsdmmc_io_send_op_condudav_rx_list_initpool_sethardlimitrasops4_do_cursorip_freefvfs_lookupdb_show_cmdswdc_default_write_regrlphy_statuscpu_info_listudbhashsizeicmp6_mtudisc_updatesun_nonamekmeminitnsphyterattachnd6_ns_inputdeflateEnddevice_refffs_syncrd_root_imageusbf_task_threaduvm_map_submapsr_hotplug_callbackscnioctlufs_vinitsys___tforksr_ccb_getpool_primesdmmc_mem_scannsgphyattachdevid_allocpgrphashtbldoppollifmedia_matchget_crc_tablestatclockaue_activatewi_read_data_usbdvd_read_physicalrw_enter_writeuserconf_argbufpxa2x0_lcd_consoleMD5Update_intm_tag_copyinflate_tabledb_value_of_namepmap_l2ptp_ctorrn_mpath_active_countdata_abort_entryhid_get_itemrt_xaddrsmsdosfs_getattrdb_find_breakpointip6_maxifdefroutersm_devgetwritedisklabelin_ifdetachmsdosfs_printkernel_pmap_storewsemul_vt100_opsin6_ifattach_loopbackstartprofclockohci_device_isoc_enternsphymatchupl_ioctlundefinedinstruction_bouncesys_getresgidprocinitapm_userstandbysuaddr_free_rbtree_RB_PREVmsdosfs_readdirdead_ebadfextent_do_allocusbd_interface_countnd6_timer_taskpxaudc_enablewddetachsoo_ioctlswap_officmp_redirect_timeoutforkstatwi_card_identaue_miibus_writeregieee80211_recv_eapol_key_reqdl10019_mii_statchgicsphy_servicenull_setkeywi_send_packetigmp_sysctlin6mask64db_lbuf_startohci_rhsc_ablesoftclockieee80211_node_freetc_initupdate_modifierffs1_compat_writeieee80211_amsdu_decapdb_breakpoints_insertedblf_decryptswdevtdisk_lockscoop_pcic_readarc4random_uniformsbwaitufs_reclaimkv_intrsafescsi_xsh_set_tr_alignsr_meta_opt_handlersdwriteohci_device_intr_startxscale_minidata_clean_addrlcd_accessopswsmouse_cafilt_logreadsysctl_rdquada4x_bs_w_4uvm_vnp_setsizea4x_bs_rm_2vmcmdset_extendsr_sensors_refreshural_caaes_key_wrap_set_key_wrap_onlyzapm_batt_stateip6_use_deprecateduserconf_hist_intextent_alloc_regionsys_mknodpmap_proc_iflushext2fs_mountfskill_vmcmdsuhid_attachrasops_vcons_putcharzkbd_matchufs_mknodsbinsertoobin_lifaddr_ioctlknotelf_advlockpffinddomainsdmmc_ccb_freeeephy_resetwsmux_do_openfreedorenameatwi_ioctlzts_disablelcd_attachffs_hashallocpxa2x0_ccnt_enableswstrategyuserconf_pnumscsibusprintnamecache_rb_cache_RB_NEXTrtl80x9_init_cardsys_getpgrpukbd_ioctlusbf_add_config_descwsemul_vt100_console_emuldatasonewconndb_fetch_regufs_direnterudav_csr_write1uhid_detachgeneric_armv4_bs_c_2pffindprotoudav_watchdogbold8x16_iso1uvm_pageallocsdmmc_io_enabletcp_saveti6wdctimeoutwsemul_vt100_initHMAC_SHA256_Updatenchrdevfrag6_freefundefinedinstructionuvm_pmr_use_incaue_cdaf2rtafidxnamecache_rb_cache_RB_INSERT_COLORcoredump_unmapuvm_map_vmspace_updateqsphy_ca