ELFa( 40I4 (   h h !AAب(ب(بIبiبiCۣe؄I؄i؄i$$ / /;0&00Qd;0 2 @00Q8$/ // @ P`D  B00 R FР -Lw 5بioذimain() returned p-0LSP P ,  4 ` ,  0P,00,0pp 0 $Pp@0D PT0T0S , , -0P@Lp8`  R   0@ 0 d -0P@Lp8`  R   0 @ 0 d -L_Œ @x`0 P  'H0!@ 0',0 0` 0 0' M-LM0'XX @X0 , %X 0  ( "('$' ,  pPP( 0"(X )%( 0 0 , 0'(h@(K 0-_02@P L0@ 0'0@-0@  0S  4000$ 4 @4@ -4L0S @440S - L0 -LM40S  3 lH0 ,Pk K 0 KhaY> Y> p-LM@`P3PUOx3e H0 PC00 h0 \893 @289.3  : (%,Y>PY>-?dY>tY> Q-L@0 Y>Y> -PLM4p`V$ 4! ,0 w0 ,0 000,  ,  0h|PV@0D PT,0 0,0>A?Y>Y>Y>Y>Y> 0-0L @P ,00,0 R 0$ 0 00  0 0,00,0 R$ 0 0 00  0   0;00h760hcKDm3LDm -@L̃0  0;0hh tm -L` @ ;0  tm -4LSPp `00  08#8<8#8000 08#8@08#803 08#8 08#80  0  6u4S0=0Sh9Kb4S 08#8 00L$H@0@@000 ׺31C0 1-L?rcWP`S eV @ 0DPT0`T0d  D0PT0C4Q -LàL0L0Ϡ@blpP30 0S PVd)0P0,0 00P 03Q - @p`R0 0L PP 00 0 0008#808#80\4SX 03g4   -L@pX00S20W6 ) 㫃00` 㛃00P00Zpd3 00X3  #|0W  -0pS0L00@`% 000PU00S`U \    8U ,ArY>-?Z> Z> -8@QL0z2>0 p-8P@L@`4 00 00S > S 0 p R  B  hz 000 PrXp 0 00 b,Z>Z>dZ> 0-L@LPX ڂ0( ҂0( 0hɂ' p-L@`> PUP00SdXP ?lp  000PS p 0U 0 0 㓂0P 0UPp@p -0LSP 0S" 00 @ = p`Z8:Xo`Z6 @ 3S `V O0@ D0TTPPQ @Om@ &00000@TP303n8P060 0 308#83 R 00  ^ @㦀00h,A p-L@Y ہP`dU  0΁00PY YR`pp 0-LP@P 0,d㮁H@ @0cP' 0H@ 0V 0' -LM0` Pp @2㈁0S3  09P.0  0*0,0K0,0 Kh ` KhST0S O08#808#80KhP @ 0P00 0S  0P3g4 Kh, -0`10#LP8p@P@ 00 0000  0 0, |0| 004 P`0  @ 0@  0P0    $ Z> -L M0PSp 0S` K@K PS 03K 3[8#808#83K0` P`h3[8#808#83K 3[8#8<8#83K0@0 4 @K?0K 50T;@T*6 @0S4 000S$ 00~ v 60Ts@T*v0OK000 Γ,P000Bl0  ᚓPH0@ ᑓP0 0 0   A p-L@P}04`K@M}p -2L M PRl2   ``0KST2`0 0 S<2004 plPRd0S| 3>1 :`@ 000S3033 T] ~3dp0p|14 GP=303@To3 `3`V㏏H0"S3R1  K~0 ,pK y3 00,0K,0K3 f @4  0+@K*K( 2_#t003 P3,00,0PNiA \ ,ArX  㐑 0-L M|P@T  ‘ P00 K0H 0@`@,$0 SG00HAZ>tm Dm p-0QLM@`  `\xR P 0P ,Vx p-0QLM@`  `nxR P P0\Vx p-0QLM@`  `;xR P P0XVx p-0QLM@`  `xR P 0P (Vx0@- @@  P @   0 0< 4("4!̃,<,$,W0U VT0-  00  00 0 <4("4!  < $ W0U VT0@- @@P  N      0 00@ 0 0 0< 4("4!̃,<,$,W0U VT0A-P0p K Q,@ 0@0ll 0$ (, <4!4"<0cT$0 0!$` 0@0ll 0$ (<0cT$0 0 0 $@ 10ll 0$ (, <4!4"(00c0c$010ll $0 ( p- L0@P0  Z>Z>Z>[>h[>L[>P[>[>[> [>([>0[>8[>@[>D[> -LM0@p  R 0 QP@ TG 0UD0$UP P 9 0S0U00T@,@ @ P"0!B203 0U>00!010!,0?@0p?<0,0 A00 P!0p20A 0?A0S 0' 0! <4("4! < $ +0) *(@! 0 T!0#40 TW(K0!0R0>0U;0U8! P 0 0S0S00@ P"0!B20T1 0U>0G0D!010?0p?<0!0 400000p00Ġ0U0V0, 0TW0020!0100?<0!0 000Sf0Ib0 ! (0 ! 1< - L0p @05 $P iV0$ , P0 * 0, 0 (0 $ @ 00 10P@ T`$00  0(0 00 $0` 00c0 " $;#;c 0 $ @ 0p[> -LM`0 R @p  t0 ! 0W0U V T0PS  0 (0 0 0^W0UT0UQ< 0RP \ S 0S]0A@0!0?30P0200 >0!0?<0040!000P000L! 0 T!0#4 0T!0 T 0|P\0S  P 0HN0 (00h Bz\>[>2<[>\>\\> -P0 RLpẀ` @H 0S0800 0300#0! < $ +0) *(0! 0 T@00 @@ ""  0! <4("4! 0 000 # 0S/000 0300P 0! <4("4! < $ +0) *(0! 0 T0800 S0 0 00 0 s 00! 0W 0U V T0 000 # 0!000S0 x\> 0-0@L $0P0 Tdx0 T0 p-L@P4x0B $C $`P U=p0R $0N $ PR R @R "pt0N TpD 00N Tp꠆]>]>D]> ]>h]> p-0L@ $00 TPoxx0U 0 $PpD0@P T`$0 p]> -LMp @0T?x 0T@ 0T 0T@ 0T 0T@9 0T@ 0T@A 0TN 0T@O 0TH 0TP0@00 T%020J T0 0!0; T0;V 0O $0PM T0 ;dw@ 00O TM 0T@0O T0 3 DT0R $   0 S0C1 00w0R $  M T0  0P@" T`$ 00" 0  0@PG T`$0G 0  0T0 T0g -LM0p 0 ,0 G QE 0㊁8 0 0,0 : 0lppl 0P`$@(,(0 c 0..p .̠p, 0((< 4("4! l0.̠..l l j!lo芁 0p llp0@P0 ,< $4.4,$  0   :4PP  K PB?P0`  0 PP! `:PP 1, : !0` , 1<2<^>^>]>P^>^> -LM04 (@T ,0  c = -LM0) (@T :  -0L   1 <4("4! 10!, -0L @  <,$!$.!0\ 0- 80"(,#@L(P 80,#(0h -LMQ0p @Rb8` 0 0S[:01!$C0A0bA !!\Lt!`!!A' A10C0  101 - 0$N)` ,0  !< 4("4!,Q 0$\!! 1! c 100 Q0 0 m $0!00|8< p-1@L`$  8Q 01 ph -04p@0aA@ L00 P0U Sd 480@P8 1080 08Ć1Q0C1 -LMP@ pP`( @0 0  B0 P` (0K0 0 *,P 1 ㉆`$K0 0 ( 04P 0 P 1 81 0 -LM1! 0SP@# *AT R0001 0  うpP 0  a .0 < 4("4!, ! 0A \!0  ! 1/< 4A!4",/0!1 0 101@ ! 0!080|00 1 !?\t8<4A -0Lp`Q@4P @T   48 1 40! T 1@01P R 0S 000Q0  PU@0i^> -LMp4`0A张TP 1@ R  ʅP 0 < 㼅P,   ,P@@0<80 P8  \ `  0Q0 , 0!\@_>^>_> -LM0 @p`10! P0UQ@,PP G/Z$ 0 p_> -L M` QP @ 0ͅP GP0  P?P@ 0  00s0 00  0 P@ T0@ # , 0 , 0 0`  40 0P y  4,3Cp p0 0$ 0"0 0 0! U0V0WT0<80 (44 <0 (  4Z [XY00@! 0?<=0>00 <4("4!  (  4B C@A00! 0GDE0F00 <4("4!   ( 4HJ KI00 <4("4!  (  4R SPQ00! 0ge0f0d0000 < 4("4!̃, ,,4kj_ \ ] ^ i0h0, <4("4! , < $ a bc0`4 <4("4!@0.̠.$.T  0$0 436("$ 4$#  4  (0 080 8 38("$$# ( 4 0 04 "4 4 "438("$$# ( 4 1!0< "8 < "838("$$#  4 ( ! 10# < 4("4 ! 10...̠ 0" ! 1.< 4!4" 10...̠ 0h" ! 1/< 4!4" 10...̠ 0 "< 4("4! 10 ...̠0p! 0Q1R1SPn ]p0d0 d 0, 0 , d1>n,0 S@Qnp\10\!\(Ko/n, <48 ("44 $" < s   (Ko (Konk tfPT@@GR J0!0 PU@@DZ(R49_>_>`>$`> 0-PL@n $ d10d!@dA0hm 0-PLun`AT R000d1 0  $ m0 -LM` TA(P0T1000 hQ,0 U  0 10! p0S PU,0SpQ0,0 0 $0S (00 1S X 1SX $0,S 'Z ʊ0(@'Z@sP(Z X 00 0 -LM`0 1 0! TwB@Tm )T 0(0H$0S* 0  (@T    $0  $$pWN W 000(Ko0T T4 0(0$0S(@T  $0  B $0 $00S0(0(T0 00$ >00l! l1`la(K$0S0$0,(@0(0P,@0 <\_0] ^ ,p0 0" 0( @ (    P(\ $0@ Bh1S0h1la`haf0(0m`>`> -LM`0)C >00< 4("4!< 0Z\S0@ 1Y>0 1Y>0 ,$!$#< \10 I L S @ < 4("4!, !10\h @ 0Z? 02|R@ 1 Y>!0@\ T0  @Dh L2@|P".,2@|!.@ 2|0 S0Z/C1!PZ/B1! R0001 0 _Pg?P1pPA TP 8K0P80 NpP0) (\ 00: 1>, \  @0  !< 4("4!,10\ " @LXP @0  !< 4("4!,10\" @2<(A9<9<_> -L M4 lV440%00KR,0 0 :4Q1 10pW# 0`00P0 @T ,00@,@ 0/ (0 `PR00SZ0S40% R4 hAT$00 0P0,  @,@ 0n/ @PU04 l10 0P,00@,@ 0Y/40pAT$00 0P0,  @,@ 0D/h@PU04 t10 0P,00@,@ 0//0@T, (0  0(0P( 0B0 /$ $00CS00$0$00$(  R000,0  0@ `U(K004000!  L40%e a>4a>\a>a>a>a> p-@LT`Ȯ0. <0ejP(00(0phia> -L(M0` $PD D0SM 0 ,X\ 0 ,Q::Q\:\ , 8 4 0 p @l3 Z0B (0P $<  Wm 4x. (K0 T0S 0CTTZ >ΟW@ 0 @@@@ad.`#43p KW  4 0 80 , , 08 10 0@ 0 $<0@  @A , , 1@c , L W5 0) !0 "$#(, <4!4",  s@Lgnd Ha jB0t033 W  0 $ 0\04 $<0@ R R , ?@10t03%5 W 0$040 ( 0  0!"4# 8<#L4TB@ 1p0, \, A , 8p 4p 0 W 4t-< 00 ,P@WF $0SS,:T 0CTj 0 T 0CT  40S 40(0, , 1@c , d 0 0@P; T`$00;  @_ W 0 <#0! " l$ ,01fs 1p0, \ 0!"4# 8<@Y 04 T@ 1?, \e 1=>, \W[! 0"4#8,N@  ` P> T< Z =0@P, \`,0@, *7T( 0CT  0T>04 $P5 $06 p$10!Rh 10P AT 0G?, \xRM H`0 ,@, , 1 c<0W 0$04 ( \bYJl 4P V>@6T 0T05 $0<0& 1p0, \5T |0T0, , !b4Q0(0U~|b R\z 0B< 4("4!̃B,<,$,O0M NL 1=, \U05 $<P@)0 $P` #P 4P +0h; 00 .b> ?f>f>@b>|b>b>b>b>@c>f>b>Pc>c>tb>hb>Pb>c> d>hd>f>e>b>e>|d>,e>xc>f>4f>c>Tf>d>f>d>d>xf>pe>Le>e>b>800 04 R q*P\/hx:p#8 @0 (00@ 1?, \800 0  -LM0tp庐4 !0 0@,0 0` T$0!0(0 ,`, 0 <4("4!  < $ _0] ^\0  ,,B @P  0@PC(@T     $0  F0<00% e00t!@ t1ptqE0 PU fPU: 0 0 R U. (Kod0S00 B0(0(Ko )(Q 00`S  0S,0S0 0 0   00 ,  p  g> p-LMP`P+gυ^O>.ZVd1t!l \|0`apahaXaai/`0@`003Ta_n@K00  xa a A[5 -P0 L  80C R8 2 d #8XH$ -P0 L  80C R8 4 h #8XH$ -< <0L:\0  (@ H$9;90@-9 0 0@0@0 0@0@ -L MA0P` ` ,0K "[L1RC R $K2[mCX#X`+p@1 R0C8 p (K"[p0 R2K"[0X00@ 0   00   &0Kp p0 00@0@, [D0   s=P'H$### 0-MLM@P90000% 1 R* ?  p!0S`1 KT!0KH1AKA AP$1K R000K003X000 K  0C,K 0AKA AP K00C S񟗼ꘌ 0 0 0 x 0 0 0 0 h 0000000000004*P'D -80)0L 0 :P'0 0  : p-0LM @+P-` x0 00> `P0 R0C  (P01Ł'B'D'F'H' 0-LM R꼐  4 @ \ x ȑ d 8P@0!80! 081P @1 P @@P1P @x1 P @`1P @H1  8!0 @P!0@0 P0 000 0 0 0 0P @ = P @l 0`@0 PD D0 @P|P'.'0'2'4'6'8'<'>'B'D'H'F' R-L 2 p-LMQ@;01  P `# 0!0  0PPV0(B(R`0 01> 0PP9 x+r 00a=C4`#hl 0dx0S 40< `*  `0:0P'8,'g> p-0L P@p0`   000h{2  R` ^P00 S 0 PV@p|##,o# -@PL 1 `p = R 0 0< SY  SK  SI  SMS00-00S $ l l l l   ` 1 9 0 R 0 )0| 0 R0 R S x0 h0 X0 H0 @0  0 0 00*64P' -/0HpL` S ꐘ ܗ ܗ ܗ ܗ ܗ ܗ 0GS h  0 0NP@/宜P ᠝h0h pᲀX0 R    *46 -L\M4@KP 03K/P3#K 8#c[Qr Qn 0S=Q  2 3K2#K 2["[`0 2[d h0  2 ㌂#K3K0[[3 1C 0!0}"[208P"KKK 7 Py Ps r2">?DFcà.L !2c N"10,Ϡl`P!PdP0PhPc 0` P@(K  = =`   P!P1QQZ@K&#05K,15K P-V0[@S*T0[.S'Q0[-S$N0[S!U0[S[#!BR[ O[3 A 1C "P[05A1!1 00 \p["[2[@P'9< D$dd>hQ h>g>v'N$h>g> 0-LMPl0  (ޣH0@@0!0@ 9I=98,P' -9L@@, 000 000 0-d3 LR@P H3R $<3R Q03R 20RB R3 00CR "2Rg -2Rv 0R- # 0h.V0CRt 72RD >0R@2@ 0C 0h:0CRI l2Ry 0R X2@@00CR0 0R( 0? R2 0h,0CR> 0R1@@00CR 0R@A=@01@@0 = 01@@01@@0t1@@0@0  0,1@@01 0h 1@@0 0 0 0h0@@0 D 0 # :0h 0 0R t~00 0 # C648F<.2:>*B|#0#Th> -MLM1 0 p 000CSp(KBKII  D 0T `0S` @ T apP@VP9 -LEMpA0SO X!000HH1 R<10 S<08PKV1q "880K"17K6 K @ 5KNoKD`FT  |80[7 [6[ 00P30 @  0} 0$$$$̠ @  0|(K10 00$' '## -LPM5 0 6 -1S" 'pP% l`KD4K 0CR@- a KP&6 #1S 0q BW 0S*(KK ( 1 0R`!d!  10C1 RH 3RE RC 3S@ 14K3 R3 RZM@ 0S+D 0 D B0000 . LP  ǁ6;#60 0P /ZK n20Sp0 { pQ2 R 0 RPTK Y0t0 >K S8K O0H"0C4K#KK t0 B("(S04"43K@BK0 5[Z90K 5K3Z*K .ZM @ 0 B$[4[Q04KD 0 D B0000 < { ZM@ Q0 BDt 0 0 0C0D 0 ^5[|#P' i>h> p-LMP (<N9k x[H 0@`,`ZV  xhQP'0i> -M LM0@cS00ʑ= R 0   9 <0  K0 +||0 Kt ̠0Kh0AK APA>K R<0# 40Baၟ"Li>P'Agfff 6S-LP` 8SB  p 0:Q8  X@#8  0Q:`8X@   #8`|@@DQ\t `X0 R0C  (9Tp<li>H$ -LMt!0 0 @P  @ 4QPE\uD q 0Rj0 ` ( U3 0R" D ( R4 h 0X 60bP?`VP\\0 R0C6 l P:CXU<P'i>H$ -= LR xPx`x@0 $<< p0T[ 0Ti[  0-@LP@40 00 @0@0i>P' p-L M= @RP+ 0`0 P PEm[uKpUp 000X01KL01K01K0K 00PP'i> -0LHMp$Kh`KD0 ZK P H(@"(D0#K0K"K0 0H00< 0 04P  ~|P' i> -LTMl p D_l p@hY,?` S  ~ .0 G>P  &XG>n*T  E>TL E0CT >T >T.p 0l吕X `>T [0CT 0TJ  p0l0XX 4X0 X0S  x mx\  m- 0:0`X(K=T !=T S=T =Th}rP/ 4XX l 6@ x x$=T K 0CTp 0Th[rP< R l 62 = R  m |9R  R 0CR 9 Xp0X)~$9T 9T 9Tl 6 8 R  l8X 0X <0$9 XPX 0 St8T 0Tyl 6 = S/ @St 8 l0&48 ~,8T $8T 8T\h qPpX X70SLp  X LpX EhpPo 0.lp X X'P+X0 \d7Q 47Q  Q%  Q PG0XPXP l 6hpP8 Tkp X X<&KPXppX hpPp 1S k?X 0p 1X 0XPl 6 6 l 606p0 0S 5 $5 Rp 010   k,X X0/ l5 XPX0 =R p 101p?X  d{k4X 0X0, 4 X@PX p0 ۻs akL4X 0X0, p4 XPX0 p0![hpP3 R |@k0T0 p X 0T 00bY"p 0SX 0 P\ d0 t U t0 `  @h s hv rt0 0$30 R0S   `05 %<0 S  S  7S  nS  0t B02 R B000 C B0 2 R00 h%P000p0\  P:p0 T0 p0 X 0T 00b S,p 0d  Sd %:0B\0 1 p0@/ .,p7X p0# :! ZX U  :j rjP_,oi>ii i5i i i iiii *"A gfffj>:#816i(i8i A i iii88?71B##-%C(P'>   0 R \0 4K04K@0$K NK0RV 0RD 0CRl nPR XDヺi@X0  s ~2 0T X 0 !jX0 x 6xp  ! x>   0 R x1 4K04K1>,0X ^= R&X A s E0X 0!1X 0000 XD 1X 00-0X 0S00 X 008200X0 T X +00#@; x xP Z2Q !0Q~2Q< 2Q4 2Q, 2Q$ 2QC 3Ql\i3Q' D0CQ >0Q_@3Q4 0QX= RX l3  q|3  H3  3 @ 3  0WX0 M4   &= R $4 X;1>,02 -L:#[#8#,: F-B,j>j> |####*D$! -` L@LtPi@DSte q0 ( TXA 8R  #8X PR 8  #8X PR8  #8X 8#8 XJnSz/ pP 0RJ0 ` (  0R  ( R4 h 0X Z9 P帽<9  0,宽<<$H$Pj>xj> -LMP,0 60  Paz,0> R6 l 6 R6 l 0X @R6 l 0X 60 h@P R6 l (P0P R6 l ($0P(KH$4xV -L0M`P? QC =P 43QX Fd0CQd  80-P/ @Rz8 p 0X R8 p 0X\ RL8 p 0x2  0dP (K0S<2.`K0K2K02K 2Q: 0Q0SX2K?2K.`K02K00C SK  0!02K0"K.`K2K A=0S: l10S. S08#[.`KK}h<@0 fP厺=  A$[P& >K 8K 㽳 *K 㹳 0  0D P 0 0@0@Y갤[>0P 6[TM lK⊳0 <0< P 9 3<00 0lK @AM@ 0p GP 9 m00 @0@A= G 0  KP'(4'*|##j>j>k>k>hk>k> -03L  9sc @RZ2 d 0X R4 h 2X謢r Rj2 d 0X 0R0 ` ( RP4 h @2Xsc 0R" D ( R4 h @0X1 Rh &4  1 R0C4 h :Xdd1 R0C2 d P1XU 1S?1 R0C4 h >=CX0 R0C4 h 0X R4 h 0X R4 h 0X~0`H$p -7gLP M}/ @7 #K3K 4KpP $K賯 0KAy ṃph 6\70P9$ # ! 0D|1( ! # ( :    7 'p0C &006 & <06 pp0d &00A= &6pp ?"K2K*K0P6|6"[   =Q Q Q +>2K 5"K P2[S&000 , (ⶏ Tű5B@K4K 04K5 P5  [^5ࠃk5  P N@\%\5[ 0<, 060 e0nT0@<S  ~ᲄ2$000z0$0f10Tl4 d4@ Q 3T$3}.  842Q$000(4Q#0;04  b3^ʙ03\`0@  03\000Ǵ3K 0ˈhc 0ň0  0Ṉ 0᳈c 04孈0 z20{ 0ឈb 0嘈0bY Q20d 0ቈ 0bㄈ0:1 (0O  0vE 0"p0< 0i0312 P0À 01 P 00 01 0O0! 0H0 0A0 0: 0l40 0T-0 @0&~ 0( 0u 00l 0R 0 0I 00@$P'k>l> l>dd>4l>+ 0,24.6BF#8D -?D$'j)('_eNa;@20*S)20S S S:9 - :*0: P0L4884#8 X -9L 84 0X -0"LR@ #8p 1?0c4X \804H \9<984T ;\tgfff -h0"LR@ 840X \9<9840T \9<9t Q- L Q Q T

p-PL`@U 8 ,04< XV V Vphd804< XVYphd Ҷph:n> -LÐp0 6H804P@T`$00P dnK804@PP T`$00P \K804@PP T`$0P dKKȀ P 804@PP T`$0P  -LMp,  804@PP T`$00P dK804P $ 08#804@PP T`$0P dJXʠ,0尐 -LM8pK@4P0 P T`$<<0P dJZ*804@PP T`$00P  * K804@PP T`$0P 0"[0 X 804@PP T`$0P (K 0-L84@7 0TPPU J8047 $U 9  84 0T0 n> 0-8L#88P814` \@@^JT 804` ,PT 0hNJŴ Qp-L@ plR 884` \PP4JU 804` ,`PU %J p804$p哴Tn> -0p69L!<@96+=6804@PD \`,0D 9_;?847 TI84< 0X8@4> 1X P 099@[t3S <0x$t0t3@T@\7S <0$07@T8047 T9 OI@T 804@ , d TxOI@T 804)$@T 847 0T n>ln> -LMtP b0tPe 0 0@0@0/"-0?0b b0t#RO <0(|C\E 0| 00 <7(r\ 0| 00 W2@7#<07(`V x $0  B< x$t0t3 0 0@0@0 0@0@7rW;';Q;0t;š 8)4@0T -PL@p`G"0R  0jiFVT  d 884#8XiF 07f h j {b tn> -`LP@gG"@1pR  U@FH$TUU* f U XU  FUFU Ud 804(@Fj 804 $804h (@804b (@@tn> 0-@L+P20" 0+ -L,MH P0L ,0 00  9 0 ""0 0001,0 00 , L <0 2P0  x#X4D H P P 7@(KHyP -LM6P=@S` 9  1S x7p 0 1S* P. 020t#Rn KP007PPbS( 1S3 00 @0@1S0  BPr0CW 08x7)@04T061S LpP  j 00S: BP  10R`!d!  10C1 00S: BQ  10R`!d!  10C16;6 0-@L+EP+ 9  }D0h載 0-LM'P"i0  @@RtC0<(\ |; B$0   7G7xGtG8 -LMP ;k@P7 0!0 0 y<凁0g 1 P 7(K<(\' $0 <天( \,  0 00 < (\ 0 00 Z e90,0 0G,0@,0, ?WA0 @<(\ 0 0 0 ,10<(\ 0 0 0 0/"-0?00b9n> 0-@LPzn@P@T h7P90d90 -LMɐ`4K@ )3< @0\ w d3 0)R1y01)ypy<0/"-0?00bQ<0 ] << (IR\pP 0 00 <(p\8p  0 00 X><1@wܙ9<0C9(PU  $0  < $ "2 @R#  T 7 S 0 0@P0@ 099pX8p < )^T4K y (K9S0D0 0 T!0Ca% BbQ(1 ,! 0 Q A:1 01)py0 D99 9@P   8   20280 : S 9 S2024KF  2022: S 9 S) 00C0 0;<t  0-@PL _@ YYYYm0 -L M80 "Kp@ `4,T- R" @=R %4=R >3RB R@  Q <8 26 R. R  R R+9< 2$R R R R | 0yn@ 0 `@,0,P; D 1(K03*K0C"[:6@KR030 0PK \00[S/0[S.0[S-0[S,0[S+0[SZ  B+0[ 0+0K<7'2 4P , <0'09@ 9)nQ0R 3#Q0C 3#Z0 3$#+ 0  0 P) |幭<0'"8804#$0!0@3 SL ៭!03909""唭A<7|'2 P@ 僭<0|@T 2<? 0 0 P@ Lh@[x@Q <0T<0|$B03 R R? R9t6 2R R R T6RA F:3R96 2l6R, ORy Q L68 2q?4&Q     5G?22 ^95 2W   49D5 2H9A ,5 2B5R1 &R=.R R8R R3 A G4 2+45R R&9 4 2R R  <$'>?@D0 0@ ,,P 屬G <>0) 0h4 4P P圬<0 )0,< >  0 P 公<0#8<)3 P@ o<0@T7 1z><0 0  0 P@ 8S@\@Q <0T<0$804 ,pB 804,00, Tp'9"2+1"2!1"2T@10RA01 R R001< <9 ,  0 01!21+^@"2!1̢{ 0̠BT-  | u ^x804@Po T`$<<0o 2 S804@P T`$0 9嶫 "0|"||DP#xT0t?;<\o>lo>o>)hmlmo>o>o>Do>o> p>xpx;@6x8xT|@xT *Dp>pp>p>p>p>"!!`"! !( 0 D q> p-LM8P4D ,;!8#8  +2S><8#8; 0` 0 `0 9" 8 <(4"4!<4 \ 8 <(4"4!<4 \840D \Kp84 0 \8@4 0\ K``P @@v P 00 @  01 0 0 T -LM8 8 D?4 8j8 80) )0i0@0088#8#84 X0K '84P 0T8@4 ,0\84 00\8@4P 0T98P,  04 \8),04 \|'8P,0@04$ \|'8,04 \9j847 0T8@4@ 1\84 0T8@<4D \*>:8@8#84> X8 0L 4\"1R 9) 84 0X804P`C Tp$ 0 08 46@0;6=9+:9M(K84 T0X804@P \`,7 t? -L`PZ>pD00 @0@h=q> -PL@`p;>l1T4 \1T T1T  0Tv@4T =0CT% 0T6/ @6 Xp=@0+.%z@4T6@@_=+>uh@608#8@6 0 RT@@ @@i 5i 6i( -;L@@`84< 0X804> (p1PP P`TpQ, 8 ,04< X804> X%7P`  00 00  >`9  #JG``  804H \_  -@QLPppU@pW?`0OOP$ 2>AB?PP``0O?0@@ cAQaQ p- @L`0T 0TP$ U  $8P pp -0L040 T -,0L8l02 0 A/i -,0L8l02 0 A/i0 8 A0 -1LMpQKP 0K 00`P 0@  T 0@`\ ڔ 0S 00 S R0Ġ T 0$ 04 000Ġ(AmlimXihJ!tm -04Pp008@L `T0 T0  00G  0Td= $)d=0 T0@@P*P 0T 0T 0T0 T $P 0T0 T -0L`4P 0T 0T 0T 0T 0T 0T0S0'0 Tp0 T}N@T = $  T 0pWd<}~@ $ pW <0@W}~ $0P0P@0T J@s> 0-@L ;04 00P T0h: -0㈠4p0  LT64 Qi  $  0PT  0T  0T  0Td<@T T! 0  T0Sq S@3!t1!L3!2!2! 3!3!X3!3!  $ P7 P%00<<0  T  $@P90  T  $P000  TP00@0S<< 0 T !0 T  $P  0T0  T  $P00  $0`  T  $Z0P  T  $0@  TZTU000c U0} 0 S0 00  0T  $q0@  T@0  T0@ 42P ("(Ÿ0 S[00 SY QT C}< ?} ^%Plf 1 R0  01ŦQ000pdQ 000D<ߥ4ܥ0@000~m  $0 r0$ 0440 0S0 3;0 @0 0 00\g넄mLs>liXihJ!8t>@!'!ts>s>s>s>`s>t>s>o(A|m'Ht> -PL `p@9 0TW@DD0 @T0 T 0T 0T 0T0 T $i8 -LMP@pP 0`P  0<<0< 80@` ,0 $ $0pxm0Aom(A,Am$A 0-LMhPd0d@ @0P @0S000,0 0K0ho彥넄m(Axmm $Alt> -8pLW`4@P t0  0@#00C S`9!`9!D9!7!7!7!7!7!7!7!7!7!7!0@2Ÿ 0i9 @0TP 00 T0 TH40 T0 T0) 0KSpږ SpGpӌ0SY p0 Td : $ 0Td: $0S2 0 T0 T 0T 0T 0T 0T 0T 0T0 T $<<0 pT$Am -LM@`p`8}^PU 9 $  0 T00 0 }^PU 9 $  i70 ꄄmxm -LP `%8p $  $@ $k7 0 ꄄmxm -@L8t0  0t0U7 -PPLL 0RH 8p7@堀`T Q):W0  t0 o170 0040 T!7T*tt ` x p0 0Rp0x <TQ| l0  2@ 0X/i<< -L M80`S4P删  $8 , 8  $@P 0  0, r@q0  , 0  , t0 0t0| R,0Ho, ,l0"20  $J  $p l@ 000 90SV 09x t0 0Rt0x )  $p  $0T *p@0T@, 0 0 00 T@T<{(K0, l0 20,P 0 00  Tt000 00d6l0 20,f/i -L M@60pPtpx0p0t0&6<<0W ``U 0p`K訔>dd>t> -LM!p00AP4`p6t0 0(5(K|0Sʤ0 0 mH0S t00t00 0H0S H@TP0 00 T00 T 娐KR #H PP @ 0@ TT M A -LM#p0`0Q(@0P4,0 $0S T @(K0, R@pp  Rp  R*    p0p pYp# 0S $0R 0Y0! t@H"2d |@|@尺|0@P0C|0 DWApp0,00 T, 0T0 0Si $0KS00, T0000N 0N 00$0(  0 9S0&6R l0d!20P  0 00, T@n,0 T0  ,TI4,0 T,0 T0,00 T 00, T,0 T$0KS0!0, T0, T At>/i -LMŸa48@, l ሠpPP(K0 gP`2Wh T2W4 @0CW6 42W I1CWd ;1CWhNP 00#3000000?000 , , T0 00 0 0 0H1WG 0W0 @00, , T1W 0W000 000 000000|0  @@0@@@,  @ LD ,0@$P@@a0 0 A/i]t@yt ktzt lt - LA8P4pt0`  0  l0 20 ~4t0  t0 0t0 3000 T<y A/i - (LM(" P4 80 0qW I48P@U 3tp5p% 0 px   8~MPI24 , R; t0  ,3@(K$ $ 0  0 0 0T 00 T $0  0tt4  0S ,E3@\$4 ťt僸@P t  t0S  ,"3t@́t6p3 0 0@>K -T0L R ϐ: 0\ϐ: 0\> -(0L8ϐ8* \F p-0 @8L4ϐ Pj0< \ ϕ04 \p p-0 @8L4ϐ Pj0< \ ϕ04 \p p-?j@PL ,  4 ( 0? , 40p 0-Lϐ@Z ,9 ϔ0 \0PPc!Xc!`c!hc!pc!xc!Hc!Hc!Hc!Hc!Hc!Hc!Hc!Hc!Hc!Hc!c!840,($ t>t>t>t>t>t>t>t> -LPp@@F/dT ?j ,PdT ϕ 4%#61 \10E=i螙t> -A= LR@ < )0 @ hD -L@PP/dU& ?z ,idU ϔ49 \P.dU ϔ: ,0 PSNu> -L@pPP.dU ?j , dU ϔ94 \i&8u> p-LP@@.dT P dT8p,`@0 @@TpTu>=< 0-@LPpT TA-00C0S 0h p-@L`XTP TPPA= A QRP ?JW/,0ϖ80W/\p -_JL`T 0 \3.ϖT 0\*.ϖT 0\!.ϖT 0\.ϖT 0\.ϖT 0\.ϖT 0\-ϖT 0\-ϖT 0\-ϖT 0\-?T , PPXEϖ@AzT 0\-ϖ0T \-PUZϖT 0\-Pϖz0T \-?T ,, ňO ȠT 0,PE\-uϖT 0\-ϖT 0\-ϖT 0\z-ϖT 0\q- -Lp%  à  AU Ƞ!A=H,Ƞ.P$H P= @Em 0 @`@@ 4#T0`E]P@ 4*T0P -L@0#`P00V0SS3PFA-0Pp1p#S,(n!dn!n!l!n!m!4#03!3yDp V ""2! "D8S H8S FV  F,ϔ: ,@2!v\ $"p"l2!g#)D a!![1!V#@ Q!L1!G#)D AVL! -;P!6L1!1#@  * 1!%#)D 0V    0! #)D  g -4 80!  -TP><?<\><>< -LM0S, + `P @0S ,?(pW $0, ?$=001 0 !    ` Q,0(\  $0  B 0,0 0(0$000(K -逡|1 ` `6L=6pf 0OZ` 0\Ϙ 0\O 0\Ϙ0 \O 0\Ϙ 0\ArB,nA8jC fAW /R 0 00 048 -\3pL ?S P  H #000|ϗJh 2\_"0l \ϗ"0t \_"0p \o"0x \ϗ \2\_P"0 \8B`ϗZ @\TO0 <ϗ1 \% lϗ 0\O 0\P  x|(p x8pD8S0C 6 n0~0ϗZ \? ,ϗ ,O 0\ϗ 0\60;@06D(R   B4u>00T0 $=90 -PL@`p(1T* 1T2 1T  ᇙ4P@2 'X10SL1T; 0_@4T'@606 0S. 6@ @@ '@ W4P@D8S 6A0AS@@ .'0_@0ǹ6A0AS|04@Di i i ϖ1i 9@0 -LOM`00@H! @  ā @OP 0p H!\Q 4! 4 D8S 0<1 W6 P4X 4Q QT8S% S 6&Ɵ 2PT1 AC @0,A  0 PP00U@@TS 6PU @P0@41&|05 0G͆0540C (KpP947P4X 44@@ |@@ t@H$H@H$(@ 081 Y#D崒 7P4@4(X ftu>u> p-LM6`=@SP2 xH8S1SS 3P p2 .R{ʬ1SR '@LP  ?K K|@P tP  3K Pe1  060 Q Br0C  BQ 1 R[0G@T/0S*,00 tP  K P x 1ASq Bx 00S:A BT  10R`!d!  10C1 10R''  70C7,00 tP6x;6   xxQ00 0@0@x6 ;6   xd84 -00LM`,0 K @0qJ4 8< ""0"(0 ϖP(@T 1!0#0"B,0 ϖ(@T  $0  Bϖ $@B@,弝P@ 0L0/".000bA 010Cp(3Pj1\@ 0C  00  04 8  0S #00S0 R40 \0 R`0C  R L 0009;9,(Ko(Ku>xd4 -0 LM`, VP P8@080   048< ""0"(0 ϖ(@T X2X"0#0"B,0 ϖ(@T  $0  Bϖ $@喾@,Q@1!/!b32Cc@1p0C(3@jt1\P 0C  00   048,+ )' 1JpP(8 0(80 0@0@0 0@0@s(8 08(h0Q40 R`0CP 0009;9,(Ko.Q(KlD*d\v>4 -LGMϐ:p( ,x4 t4b l$`00V8 <1   ?PP ; W1 ϗ(`V  $0  Bϗ $ϗ0` 0`;PP, 0 - 4. 8< #8/ :#: 0 0<3 R9 ?jD ,?@@ ,PP0F͇ $ C2|" 0 "0 n0m0C 0CF͇ -?`zL ,pP Pϖ 0\O0 \9@   @ ϖ H0\L -@#L{[@Q \00HS X00 0R B0HSQ -PpJ@LhmfkfZ #x!X!D!D!!H8pZ8HHS 9j' }(R( R P8s(   H8p5H8p0fVϕ:8 :C\ R(}f#-0{ 0-@L!D8PS N! }0hsfx 0-PL!H8@S 0h8!0⩛ -L@y4P 6A0AS 4@( S6 -LM0S ϐ(@T  $0  BϚ $0Ϛ#"B 8? 0@T/ 0S' p@P0S  Ϛ(` V $0Ϛ $卻 pQ ?0 S@ o5 -LM0S ϐ(@T  $0  BϚ $0Ϛ#"B 8? 0PP0 0S) pP@0S  Ϛ(` V $0Ϛ $00Q0 ?0 p S o[5 -0$MLp$0 0(0 ϐ# RB0`  0 @P 妌$4@ 4(Kϖ",0K0 0 *,@P 匌ϖ0 ,  04@Pϖ 0 P4  $r4@m0 ,  0 5Pn YR48 0 0P ;S ;!R ϖ0 @ 0 @P1< H<@@@0 080, 0  S-00.  /00 1O00 080P 080 P 0 <  @P   e(\e  $0  B ]d @TT @O@K8 @FPv>tv>v>v>,(w> w>@w>hw>v> -0ML@ 0(0$000,0 ϐ#bB0p  0 PP (Kϗh!,0K0 0 *,PP 0婋ϗ0 ,  04PP ϗ 0  PP 吋匋0,  0 4P X`ʼV ϗ 00 0 PP` ,e$a PPv>tv>v>v>w>v> 0-@ Lc 0Pcx8TA"B,A8C 0 -0` L? 菆Tb  Obϖ: ,ROU#A=pAM0 @0 P ` B],P P ,A8  P ۊC   P ̊  0PSH81/88| @D ` P@sD1P/UN>0@$1$!9!1!|10@!0` hރTdw080 20"2 AuF  X0@ 0 D0C @<0D BD0t|j D!w>w>w>w>x>`<`<&y!H!x!Ĕ!`!ԑ!P!|!q+@x> -LM0@S  # 0 30 S(\  $0  B 0 0$0 -(LR0000 000CS!!!!!(!! ! P P@7P,@nPX@l`0 $H0AhSw! ! ! ! ! ! !!! ! ! ! ! !! ! ! !! !! ! ! ! ! ! ! ! ! ! ! !! ! ! ! ! ! ! ! ! ! ! !! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! !! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! !! ! ! ! ! ! ! ! ! ! ! !!0 0 R Q Q0-L@P    0@T  08#0`08#0@jPjꄧ!|!!|!|!|!|!|!|!!!|!|!|!|!|!!|!|!|!!|!!|!|!|!|!|!|!|!|!|!|!|!!|!|!|!|!|!|!|!|!|!|!|!ħ!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!̧!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!|!ԧ!|!|!|!|!|!|!|!|!|!|!|!ܧ!      -L@8Ơ#Ȍ0 Ƞ,<.L p(8H#8""l$H"X,Ƞ.0@P`p@ M0Y Y 06 04Ƞ8,Ƞ< * 0"*#"#? ## 0Q @1 0 0 @ ("<8 #8"(T-0, I Y Ƞ ,4Y 0 48000P0Ba21C0aX  Q  R ,{0 0 颋.@Pl!d!\!T! t>dx>x>x>xx>-A= 02 X0\  \J@\Z@00\  \V@\d@@@  -LIM4! p t2p 0CP  B  ADo, <Ÿ  00 `P}2P "z?C`,!1I͇ 0!00140C  -L M0pS0 0, ,  , P @0S 0?(`V $00 ?$j00 0     ,0 Q80(\  $0  B 0$0 0,0(0(K -@LQ Rt[@Q \00HS X00 0R B0HSQ(R>t 0-PLH8@S 0h[0̔ 0-PL@ KR08 R  040 0   0   B > 0h// -`eVLpP X0QP 0@S 0SPTP p-PL<0`Q 0@S Tph p-@K]0LcS`$ $/PP K͠ 0T0 0 `0  0Pp0cSK]E 0-LP (.@P 00 p-PL^00`Q @XTph -LM0S ϐ(@T  $0  Bϙ $? #8ϙ  0@T. 0S&@Q`0S  ϙ(p W $0ϙ $Q ?0 S@ oG. -LM0S ϐ(@T  $0  BϚ $0Ϛ#!B 8? 0PP0 0S) pP@0S  Ϛ(` V $0Ϛ $徳0Q0 ?0 p S o- -0$ML<  $0 0ϐS0p`  0 @P 6(0@ 0(Kϖ",0K0 0 *,@P pϖ0 ,  04@Pϖ 0 P0  0@0<,  0 K.Pi < R0040 /IꌳP ;N ;!M ϖ 4 @P38 4  4 B8 @@@40< S,00-  .00/   04 炡0POP 0 8  @P  墄j(\j  $0  B bd⒄ @YT⍄ @T@刄P8℄ @KPv>tv>v>v>w> w>@w>hw>v> -0ML@ 0,0(0$0 ϐ#aB0p  0 PP W(Kϗl!,0K0 0 *,PP 4?ϗ0 ,  04PP ϗ 0  PP &"0,  0 p-P X`ʼV ϗ0 0  0 PP` ,$ PPv>tv>v>v>w>v> 0-P LA\ 0@=\pL@AA@"TEE00P  Y,0D -2"LQ`B 2QB 0@2"9!2"|10@!0` h|MBp1!181(2!1"2!n ( X081  D0C!@<0D BD0XAAA- P 40h8. {|p@$P0l0P/DU=0@@ P"l0P U=0@@l0@ T=0pm4x>x>L`<`<&!!!!@!!!!h!q+trx>x>`<vx -LJMϐ0 H! /0 0@0@ 048<0#,## 0Ϙ(@T 884 00 #<0Ϙ4  ! ?  a 3(@ 0C` S0Tp 0C  @0 0 48< @L*0PD1 ; AD1 Ϙ务( 0R8! <1  $0 8  Ϙ $D1Ϙ 0  0@;P@ <D!  ,00-  .00/ \ 04 8<#8:#:0 0 RF Ϙj*,?",?@*,Ϙ!,PP@Ä 04 @10A=!1 .0*0C̈@1, , K01 2L( 0v> 0-LP?J*,ϕ ,@0 00P 00 00000 0@0@S  Tv0 0@0@P 0 00 00v> -"p``6L=6 f0.?J*,ϗ80"\?*,ϗ-,?P*,ϗ8-\?*,ϗ0!\?*,ϗ0d!\?*,ϗ04!\?*,ϗ0 \?*,ϗ0 \?*,ϗ 0\AA`VEE0|X /R <@00 00<040l4h48 -9L@@ 0D 0008 p-Lϐj@*,?` ,x(3D2 8P?Q*X,ϔ0 \pd0 -?J`L*,ϖ0 \?*,ϖ0!,\?*,ϖ0!\?*,ϖ0 \?*,ϖ 0\H1H!X p?Z* @,ϖ)0pTW?J*,ϖ0 \?*,ϖ 0\PP}U ?J*,ϖ ,d }U!HDx> -?j@L*,Lp? ,ϔ*,_ 0\! -_J`L0*,ϖ0$\)?*,ϖ0$\?*,ϖ0$\ ?*,ϖ0H$\?*,ϖ 0 $\?*,ϖ0#\?*,ϖ 0#\?*,ϖ0X#\?*,ϖ0#\?*,ϖ0"\?*,ϖ", PPXE?z*,@ϖA0X"\?*,ϖ0"\qPUZ?*,ϖ!0\`p?Z*,ϖ0!\N?*,ϖX!,0#27O8*#,ϖ!0\pG-w?*,ϖ0 \?*,ϖ0 \ ?*,ϖ0P \?*,ϖ 0\p4 p-L` 42 42 42    E1 Ƞ@!!,Ƞ @j?.0 x 2 8HQ #80L0Mi0S!<C<0N`0S <C<00S /0#@0C00F]S (P00C0H 48#(R0  0S0:@ 46T0PGM@P-0@8sP 40ĕĕ#U@pL MN ,2-P 0 ?L/ T  TJ=!80`0`<V ?J*,ϕ*,@P Vt}4YHT}P1`h 08}@AA P'@TE} P u}@DAA@TZE0@ P 0@T  hV}\R}0D@ K@4 !!y>po>LDy>y>Жm`y>@x>$*iл! -L48ϐj@*p p,?H ,?P*,ϔP0 \$0 p-?j@L*,ϔ-,9V ?*V,ϔ0-\p -@0 HzD0PL`@*L,ϕ0L \?@*H D,ϕ0 \0 0 -@0 HzD0PL`@*L,ϕ0L \?@*H D,ϕ0 \00 0-0L0PS S ?J*,ϕ 0\0?J*,ϕL >\0?J*,ϕ 0\0>T0 p-?j@L*,ϔL ,48W?*W,ϔ0 \pP0 p-Lϐj@*,?T ,xUp0 ? *U,ϔ7 \pP0 -Oj0LPȠ*,x,?!,,D ?*,ϕ78!,\?*,ϕ0 \ 0-?Z@L*,ϔ8 \?*,ϔ0 \?*,ϔ0P \?*,ϔ 0\1 0h,04 -L@pPPdU' ϔj*,? ,PdU ?*,ϔ 4$61, \1 0i^{0t> -LP@@dT8 ϕj*,? ,xdT& ?*,ϕ49 \`dV ?J*,ϕL ,0` { {0u> -L@pPPdU! ϔj*,?l ,dU ?*,ϔ(04 \ iz08u> -A=L P p(p* = R& pϕ81J*`,?!,Jv I00f0B S  Q@T  0@Q 0 RpBv0 :vp0 8# PcP0AW0!@0R01@#v00էշ`@@0$ 0-@LD8PS 0X HP 000   }0hSx꘯! p-LP@@dT 0@0SddTt5zph`@0 @2TGMGm@.`@T Q  pTu>@< -0pQHXP,`8` (P`L @ ] < RY 0 @`1  `h O < RK K V X  # a b?J*,ϕ-,0?Jhh*,ϕ0-\0 `0   Q H0 R 0 @`  0 R $ -L@+Mp'ϔZ*,?-,?`*,ϔ8-\ W MS?*,ϔ0-\ -L`0pd82P  \^22PPP \ 0P0\0!AM0 Q p x t LA n0 %h b ^   X0 %Rm L H  C0 %=ul 0SS Z  ^0 m@MC<A<NL -L MpD7 ?S P x(K&000F 10P x $000oJ6*P,ϗ0l&\o`6*P,ϗ0 +\oC=*P,ϗ0%\o5*P,ϗ0%\o5*P,ϗ0%\oF=*P,ϗ0\%\?*,ϗ850%\?*,ϗ 5%\?*,ϗ4$\?*,ϗ0$\?*,ϗ0x$\?*,ϗL$0\@d蠆?*0,ϗ 0`\ VO0 q?*,ϗ0#\?*,ϗp#0\@@! T ϗZ*,?(#, Tw  1P |8x(AMp00X?*,ϗ-,D8 SX 6W V?J*,ϗ0-\M4`K?Z*,ϗ ,1 @-BT?*,ϗ0|!\?*,ϗ0X!\?*,ϗ41,!\?*,ϗ0 \?*,ϗ 0\60;@06D(R  C =8u>y>4`4 4P4P4 4 4@T4,444X4?<000?0h4l4 0-0p 60LSP0CS006 0h_0v00 @0@0<i> -L@b4P 6A0AS 4@90 -PL@`p 1T* 1T2 1T  {4P@2  X10SL1T; 0A@4T @606 0S. 6@ @@ 3 @ {4P@D8S 6A0AS{@@ q 0A@06A0AS|4@Di i i ϖ1i -`J@zLpXWNUNZ '!!!!!H8p8HHS R' (R= R 0  ^0}N.  H8psH8pnNUϖJ*,?X ,?P*,ϖ4 \(d0 -LWMxpQ@0H \1 L  c LfPB 0\@ Q8 8 D8SK 0\D1 O8` V04X@1 p0  @>ftdh(yzPp04tu> p-LM6P=@S`3 xH8S1ST P D2 R|ʬ1SS @LP  , K@P tP  , 0Pa1  060 Q Br0C  BQ p1 RE0G@T/0S*,00 tP  w, P x 1ASq Bx 00S:A BT  10R`!d!  10C1 10R''  70C7,00 tP6;6xxQ00 0@0@xp<` -LM(@p08 ;]  ϙ, (P4U@  (#!Bϙ0 (P U ,04 $0ϙ $̠8E  (@ @ 0T(@0C@ 0(@(3aCZ 80, P     A 4 ""80"(0 h0Q0C R40CH0 R <)0+000)8(KoQ(K`p8 -Lϐj@*,?",?P*,ϔ ,u  p00p0?*,ϔ0!\?*,ϔ0 \?*,ϔ0!\?*,ϔ0 \9@ +IB<5.)$ ?*,ϔ0 \?*,ϔ0 \EC B0BAh4l4 0-LMP0@S /(\ 0 $0  B /0$?+8ϔ'  0\0Q ?@0Q ?  0Q8$'' 0-LM@P 0498#,("(#8 \ 0(\  $0   P8 0-LPϕ: , 4 " 1!0@ \00S 80 \0  S 00 0 0@0 00  0D(H( p-_@jL( (0\ϔ !<\p\` 0-Lϐ@Z4 ,48ϔ0 \0 -0L0S S ϐ:\ X0\ϐ:8 >C\ϐ: 0\>_ p-?ZL@` ,ϔ0 \V ?h ,ϔ8#8:@ \?( ,ϔ0 \p,( p-0 @8L4ϐ Pj0<, \ ϕ04 \p p-0 @8L4ϐ Pj0<0 \0 ϕ84 \p  p-@LϔjP< ,8ϔ0 00 \p p-0P@||0PLϕ``*0/\8 $Ph Phϕ:0 \ph 0-,P48 L0#@ 04800  -NpLP@l0T T6T8ϗ04 \1`V@b>j.R4ϗ6Z.02/\`>h.P4ϗ6X.02/\a>i.Q4ϗ6Y.02/\X0X ϗ08".\404 ϗ081-B\\Tld p-0LP` ϖJ*,0 1#ϖ 0*\pH?AKZ ,ϖ0 \p@ P """""""""""""XTPLHD@<840,t>y>y>y>y>y>y>z> z>z>z>y> -9I9)QL 5tI   42  42  42 M@xP8 P 4U0D@8(QH  48#(P8R 0  h8 T8  @8 8 (8P 8 ( 0G  48S7'000S 7' 0 B07 'l;`pO@@)W 0@ 4@0  4X706p 0 S00ƅ60S060ƅR`m `pO@@<tV S@ 4@0  4(X706p000S00ƅ6000S060ƅ(Q`5 0S  p 48# R m<`oU  @ Ȅ 00 -LMϐ`J!0\_0 0; PPhU ?z/,@ Uh<2Rϖ%0/\DQ0 P QL00ϖZ+\O 0\$z>O 0-?Z@L/,ϔE0/\0h -L@pP?j,,  P U4i{h U ϔ48,\t> -LP@@dT ?z,,hdT|Uhϕ48,\@@dT ϕ:,,0dT Hz> 0- 2 "LQPD  0    ,, wl1 !R kL1 R 0C !R0?J !,ϕ4 4 \0u Km,, Bd@ :\,, 1S ).K .!C 2'54'' Q-L !0S0Q@@̓'<800 `p@            0 0S  S 00SP  S@ 0  x@?   ?  iI Q-`Lq 1p0S01 1R0S S0-'<Q800  -1LPx8p <181?@@0P3(:ࠃ2 A 1 | /:`\p0 0 p-LP@@T  @PTe<p`@0 @T@0P# 0P0P pK?C  RE BI pO P Q3 pK?C0 Q T Btz>G<2'`(p0 p-QL0`!S)ϖJ0 \0!S) ϖ0S0,0 \M]@3P@T 0A0S @yTp g7 0ϖ 0\4'4'8 -L Pz? p Np F @@dT> R7H`P dT1  @@ 'd00T 87.0`0S  T0D@@  ) < -L`,, @ ϖ:#,3 R 0C !R 4ϖJt#\?h#,ϖ 0L#\@3@#Q8S@ 0 @&T r@ R0S) "@=10@ ;  V l"/=20 A! >02 !R[?JE/,ϖ0E/\1 Rj u0SS 1 R 01 R s 1 Ik BdD1 !R0 R 01P00 ,N %G 4A PJD0 @ >TTx00S`0 S@0X00S SK'2'r5H<5''4'6'8'9''H< -pM,@ L7 b` >P 7 b ? @7 b V Vl3 RkR KP ϕ:0#,03#Q} R l3 Rp KF dϕ:",0ϕ*0/\2"2"P\M V@|2@ h2R @\v D2\v ϕ:0@"\2$"Q@ V2Q""0Շ0՗00.0  BhrRb KF 1Q= =,0! 20 x1@ d1R@\RDPKP R ϕ:/,1 . V:ϕ*00/\0=,0! "0 RD ϕ:0T \  V',2'r5'9'58'(p0'VUUU 0-LP0M @P00T0Sh0h Q`T@TT0h02'p0 -LMϐ'|2 p Pp  0 `Pcϕ!'L,0K@0 0 *,`P bRϕ'$,  ;4`PJϕ @;`PDϕ(@T 0 0 ;ϕ0,p 0 p 0Z 00p  ϕBAD 0 0 0 ~  L@`P H Ha[(K,a atv>$w>z>{> -LM6A0ASr 0BSpD"F"F"F"F"F"F"F"F"F"F"F"F"F"(F"040 00228 {8 yRt :ϙ 0 00t00S) 0SS  | S .4 tv>z>{> -LMp`@T  ?(PU $0? $ 0400  @0@X`01 11 -LM6P@p^!@@6F=6 0ϗj0/\?$!,_ 0!\ϗ 0\_0 0; ϗ0 \0@3@}T[4"X /R D@0000('0' -LM`: ?S P L _p4*000,: RoϖZ0 *\?/,O>/\ϖ+9\O0 0; ϖ+<\pP7O0 X/\O/ 8\ϖ+7\OP ;P ϖ+<\O'0\ϖ'0\O ;P ϖ0T'\LGpϖZ @\T 7 'Q/? , @@dT ?,,PdTs`&ϖ000/,O0}0/\ϖu-B;\ϖ,&0\O&0\ r0LxWpPCϖ\0P+O;)00ϖ0P*O\E0P+ϖ0P+O0*00z p^ϖ $1\O @0\ϖ P0\)UO0 \ϖ/0\O/0\ϖ<$<4\@@dT ?Z/,0 pdT ϖ>/\O0!.\]M@P0A0S @Tt3 A  QRP3R 0<3S 0(3B 0TR0S0"001 }0S2 0S  S B2\ <2t"Q_ 12"Qx(|8p0| 0rI?",!ϖ0 4+-\4(10P pP'ϖ,0\O/1\0  `1 06;@064( D8S   \00 \00 @21C! c. @Tu>'($z>y>{>?F<2'p0H{>(pp6''''9'8'5D :'900 -PL@`p1T* x1T4 p1T  a4P@4 <10S01T4 0'@4T@606 0S' 6@ @@@ z ia4P@D8S 6A0ASh@0'@06A0AS|4@Di i i ϖ1i 0-0| LQP@AT@06 0hE<[300 @0@0('i>9@0 -LMϐp` 00 P`  0 @Pdϕ"(0K 0 0`  ,@P [Sϕp`(  ;4@PNϕ P;@PH0, ` !<P;A ϕ D @  2@P. Z, ` -00.  /00@) !ϕ  00 0  @P; D[o$Kh;[\7[T3[7@(\ 0 0; tv>w>z>{>h{> -LKMD @T9H! `W@ 0SZ P 000S< zj, 8 00U0Sq 8 R0001 8pZ 0U0H08P0Dl(08#,(^"(#80 0@ 0 X^ 00 $ (" $3"0001 U30, 8 ,1 81 < r28   48P<`0 S? $PD嬇7@ 0498#,("(#80 AH80801 MD1 R:; 11D冇ᄇ7@ %YD|}"1|  0 081!0|!0 0= K,0L 1 D1JK L(1 $ _D 0DņD00 0Kϖ   0@P ,,! #,L 0P! 0( 1|/0  ?P4! ? $%7@%D X DX>G<$<<4$''$,'0'tu>t<u<z<< -LM6P=@S`0p0 H8S.0@ BTX0S*1Sc @Pw LP   KIl@P tP   ZP*|1  06l1 RR > RN G0T B0S:G BT  1R0' '  770C0C77,0 0  e00 @0@ 1R0' '  880C0C88 00S:A BT  10R`!d!  10C16;6(' -LMP, ,:",0ϕ140 ,0/380 ,480 ,1!000 Y0 E p01|0 @T * ?(`V $0? $-0d !00@ 0@010 0  00/"-0 ?00bAY 048 0,l 01T 0?Q, 02<0   90;9(Ko84<('0' -LIM?*`/,l6 < @ *00T@0T> M00 @0@w0Sr"r"r"Dr"<1   ,!0000S񟗅 -L MR0 P x1@TL@2 8'C0 [0(S5#(q, , P\0 2S P UZ$0X0#- 0@ \@DJ0NS` 2"0 P`0, [0 S, (K20  @Hϕ:0!0+0!0tdG< -HLT`pP[ Wu"v"v"v"u"T ?JX!,ϕ88!\ H8p8S 3f{H'(R% R }H8p  H8pH8pT H(((2! +8  `BD8SxH8S S0b p-?PjL,,p@ Ppϕ,0\   @" %(+ . p      @ }  x s n   0-LP@@4P 0p 0 |" 20 2S Q <0 6A0AS 0!0>G<  0-0@LP@.@3@T[4[0P  0 *-L` 囵Pu1 1RRDH88@. MMQA=A@P2N-U /| 9M h 4M@P<L1P/UN>0@> ! 1)1!10@1|!0` hM@0 80"2 0"2 0"2 r> $ X0A  0 D0C @<0D BD0 0lhS{>6'`<I<`<`<&PY"h"["y"s" "8 "D" " -0L M P`@?/@dT ? ,0@s dT^S2'`(Ypo>6'4'8'{>@x>,'Жm`y>{>Lz"$*i -1Lp <,$!$(S@>@OH$D@ H$( ,0S t h ~\ zL v@ r4 n,0hiP gfff  8( c31 0P @PP p-0L` 0   XU@0@8#Xt t0UPPhN* (P"(ph+(@[%X XX%X  0- 0LSP X@ @00\T@ @ 0tT0 -Lp@0P`  0S 84#(#  #("(X 0S3 X " 0S& ("(, ("(0Sw |, ("(\0SH XP T  L$H=08#8T w" =08#8" kb/=08#8b/_ 0S@ AQ4,\0SC/4\封0DS;#HMx- ("(V8X#P`0@ K_  ?a :0 P@^ X`(08#8^ $=*("( K~a'+ (-L`"X@p o,R00C4 0@(T"X 0 S R10lAC 0CS? 0 Cm@S@P @ -(0L("(0*( -pLtP@`T@ @P P,@ TT 0-H0L0P@0 ,$0 0 $#20 00!  r 3R0000088##0  P -rL@808P00/$0R?@S000kN -Lp`!HPw04 4 0P(U"H -H0L0@pPK/\`,0K/ -L0L0P`@K/\p,@0K/ -pL P`@!1 $O\H@0 \0@1 0C\ p-8|#8L 0@h 8P#8B.X`8 04 8#8` XVp",P+@P P -@31CLp`PP PP@0A.T  008#`08#L0Ba,0 R 08#Mb -0LϠ̠ 0( 0@0l 1 \ -@0L 0( ,  P 0-LP808 @p B,H@@T06@  0\ -0L \ -0L MP@ (pK`0 ^@"K Z@@ 0! Q @C TK\ p-L@cP2U  80(0PP  @ppTT -LpA`@ 0#0PW@ @p P@D  7 @00@ #TT p-`L@Ph }T w @ q(,P U hp蠯 -@!XL<p#X`'S ("( M ("(E ("(=,7-M`Vp 0\0,8#( L  ("(--("( -LM0@  *KD0 R? *KP D` 0< 40 Y`@ @I@I``T@V`F*K,K 6?080 T0 T@@ D,0[  + [(KQ< -RL Pq *,@p8 R#hc @WpT p-`LP@,$("(j* *("(`x*("(W-m0Pp -L$MΩP@LK[@T-T@DL6-.0D@T,G)")'?)("(6 ("(-%  % ("(%x t ("(\T @%D 0 ("($  ("( ("(0 ("(|t0  ("(XZ-YH$ X *("(  ("(# ` @ ("(,0S R[Ct ("(CQ p 0SDD#i e+}?  ("(+[+s?,+("(+Qi,("(H`" @2   0Sz.z Wp`,8#H` CPX`VX10 ("(@FTp pT0G8#xP@ @0 @Tm?%@D01.0D @TD[ ("( w $[$[$[10C1C 0C /?(KVpڨ SC pCP+("(4,)("(k2S0 0T -PR000L@`p T0 R 2pPU00p $0 @ (B\4|> -h1LM @P) L!00C0S#? A  KPU% a q0 ,U 3*0 0.B\  U 0 \h0h .B,  0S : \`g -L@h 0-PL@0h -3LM ARp(0C"Q# , K@MP "04$2x2h"Q& 0?, /LBLR0H",, K!P0@P"\`,? 0!̑! 0@P,B\`, 0B/t10S S 0h!P@,B\`, 0B/ 0 !@P` B\`,!20 0 A  P| 0P \ 0 P , @x0T 0\ X T ,P 0  PThoTTl` 0-LM@h0 AA ( KPP <0< 0l \ tP8` -LMp圁!0P@.\`,9.0X!@PH!X`(08#8$!1!1Qo$0 AA (, K0P0 @Pl \`, 0 0l  ,0 P@@ X`(<8#8 C` -LMp`hb Qn H2 \1S_tS \ ,R00CP1Tc1@S1ų!QT \^@j@P&K60P8U#H2[08SL2[08SG2[08SBp ^R0<08#ႏ0S>0@``1@T  `P@ ? KQ0@11Sʸ?J01,R00C41"0R 40`1p@ 8` RP?`<0R4 `!4 8`C|>P|>P PRR< -2p"LQ? Rb0|"X0/(HH"0X08"(@8.#8ʠ",ʠ"$N 0R10$ R- R [?!1P\D Q?OT@ T0@@Rxh10d1P \1PE P4?81P* 4,?00 110!S1 !1 1 !111!11010,@0T@000 10!10 S000! 10t0110p 1T0!1| 01!C`}>` |>P S |>0}>"]#""X<|}> 0-1@L!P>.(,R00#$R *\F P>0R 8>0\( 0 S 0 S9 0 S8  >0\ >010 ^0$ 0 *>R00#600|0 $0t0 1G.0!2X0 $0r01s01t0 2}>~>X<}>}>8p#rD" p-X1LP`@% P 414!Q pQà 0e010   0S  R (>p ">p>pR 0e01P0  A 8X0@` 00 0 RP 000p8 000pp$CtX<\~><~>(~>|0 -LMp`P =,K ) K42[ S 2B 0S 0S=*P =`|B|R0 ,d2)[X"0`2[ B0 8 #X,2[ SX 2U  0 S R =`!1 B PU 0X 1   @! t0CXP/0"0)[0D!D1 @@T W`P ) K![1!PP 0P) [E=)0[S4 #0  7=`U 1=Pp0 t)=`GA4 `@~>P<~>`fCP<~>loh~>t>4|> > -`@p0PL.,1 010P, 00<,8\0,,0000X 00 R $<@>d> -@P0Lp.,`43.\.,0S@@'dT @ P dT<<> -p@圀0P`L.\,0. 0J/\0.,J/, o -P@L`>.(0pP.\@,7.0S1 01s1 01 -LhP p0@P.\`,0.0., @`0@T H0H .B, $0T;< '> -0LStpt0P@.\`,7.0., X1 01 -LM8K`P@m  p5#[3[,K0K@P ,@ 0P C[6" 1R 8#H2[3K3[CK3K >(K,P0QTQ,0S0 A0C A@,0 0 ,0 0 @  8#HT,0 0@,0 0 00  , 1 B !H, 0 P  -LM1p@0M/p1RI )PKX 6PP 0SA p ,P;)0[( ['[&[ 0  ?0? ??)0K( K'K&KP "[2[[00[00S 0C1UA% K(P[! a00B1Zc?0 b c!B0 F$KZ P`0@0 0H p-PL>H8`S phD80 S $@00 $\L -@0L <4,4!Z BpPaRg` 048#8#$0$("!888 S L23,:X^^1!04!48#8PNX0Z`E1 U70 $("(04"48#!888 S-*Q ^PN304 8<̠Č@ Č#<\0Z`EU  tb:d]: 0HU:8P:(K:4>>>>> p-L!@`VPP Q !NPPp):p $:pX>l> -X"p1L0C #a.4A\VP"<4!4 <Y/\P V@Qa@L.1,С\Y/9\@.d1\X @P8!<4!4 <Y/\P KX@P`J/0\@.0\@@4T `吀0J/,PU Th9<0J/,  JP(9>> p-LMRP`@"iT 0 $(, <4!4"<NS  ]9x0S  `@S9x H0L9x0S @ @A9xx>L>>> -LM1/pRL (!1!@P!X`(10! 0S6 1@1 0S< mO(K 0PKO2 K2 03K02K 02KU@T101)1cP`P*Tv v  K0  (K,0Sڸ"l0Rv ("(v881@01{zP ́> -L P`9A 0p .P 8@ 0 P 8蠀0 @0.,1 S 0`` q80J/,P 0,$ b8UU>UU>>Y<8> -L;A S 8""""0""""""""""""""("""""""""""""" " 8`>@?d@\> -鴁Q0pL!,@ `h!8\@TB <1> -LaPL@y8A80$!\0!,0 ,-0., 8.\8 \0x ,8P \08 ,h 0\ p-AMLM(@ KP`P xP L0L 0t B\ `x } -X!`PQ LHn}0q0(!,H7!\0 , 8 \0 ,v 0X0.,U 1.\0001.\000 -p@L[X\0PW`#!*`X ]0@PWz: `YX0GjSr"$""$"$"$"$"$"$""0"$"$"$"$"$"0"$"$"$""$"<"$"$"$"$"$"$"$"$"$"$"$"<"$"$"$"$"$"$"$""$"$"$"H"$"$"$"$"$"$"$"$"$"$"$"$"$"$"$"$"$"$"$"$"$"$"$"H"$"$"$"$"$"$"$"$"$"$"$"$"$"$"$"$"$"$"$"$"$"$"$"H"$"$"$"$"$"$"$"$"$"$"$"H"pZ p $6 pp0p輂> -L@ ^tQ0B S0$/x 0r!Sr!0"\'l""''HP p`@6Ђ> -L M@00 @K -L M$  0@  K|T - 0 L48#H P @ @0!`"100100cS 03DC 0S ?P ? ;0c! 0bS03CC 0S 0  $("()=?0R0CQ""""$E6 > p-0@L!X`- ,0/S>0&088#8#8ESF0C8#Ƞ  0b8#Ƞ\ 08 #(^"(0S)48U#( U 6p9S:0C8#Ƞ -S.0C0C88#Ƞ #Ƞ U 0U08#pp08#p0   P98#48U#( U`008#p U 80U=08#p(p=08#p> - 0LSP a 0@R`p R0Sp0"R 0@`p i0S 0`00@ p@0@`p5P  > p-`0L`1JS\@P0S : $b00 @TplT -L!Ȱ`o4* =R?006$ᘠp9 910 B 0*PS=`@ X$b Q 0@A Q 09;9 >T -LP`p0.,@P]/ 0, 008#80$!00 @0@9 0| -LM:p0(`\P $ $0  B 4@T , 20 !k0/"-0?0@bV4`T -x0x` tP00pL ,J$JA1 \9 0|T -L`0p@Q00 1 , &00R0S R @= T t3 T X!PP00 0\@  00 1 ,  @ T 3 T  00 0 0\ 3 $0 01S=@P0PS : $a000S 4@00U@S0>\> -QL`0p%3$001S=0@P0PS : $aQ@: U@ XY: p0JS\@P0S : $da:  @TS -LMp, , ,3$00PPU/ "10 0S=0@`0`@  0 P , 02U R=<0@: `V@, m (K,  R, S<00@ 0 P P 2,P@U 21C*:00 `0` 0 P h 2U J@: ` V: 0ꀃ>>ԃ>S -0L M`,+:(\ $ $0  B 0(@40P0Pp@ p-@U@:(\  $0    00P" KT p-0LM @P@h+@@T  0`P  p2x:(\ P0 $0   404 0@xS|TT>tTlTxT -$300"1 L0M{ 0  +:(\ 0 $0   ;@dpd0P \`1 1\$O00H 0\TSS -p@L*00S* S0 .B,P` 80UaP@10\0\  , a00PPP `@`gPC\(K:$000" c`P@#9 \$l 20a #9 \40, .B>C\`!Cg?BC -0@00L p)|)H0 88 0  @R00<<O)81|1 -L0M0`@VD@T@D7k,D@T((e}))("([s ("(Rj  ("(dH\`T&L @0Sz3p ("(zz* ("(zP; zz 5 ("(,%  d$ ("(LD ("(,0 ("( 0 ("(Z-Y.X 0S *("(  ("(ld`$T ` @ ("(z ("(z2@K(03K0K2KC  ("(Cr+D p  {e0SPP@0VC @| T @D0 ß,C @DNt ("(f~)("(]0SU@ᤢPBKp 0 @ITPڶ%[B%[8>(%[:(K0"4b @BK @+TP@DBK<@T. /    %,("(xp@ ("(X`@ ("(` ,("(qP {x  HPW$HPEpUW  BpP {^w p HpW$HPpUW  (jQ<~Q<)ZQ<"x -8L#8MP@0  *K< '080 40 00 0"p0"烀<9@`J4 R Z  !D*K 'XaX080 X0080 C)(H@2R C 2@8@008#(z410  !*K 0ApW4000S40 0 8(K)h @P *K ' C41Z 080 @BR L @ C)(0R  : @0 @80 *KP'Z)(C l08 0088@#()H *K <' C08` 8 R -LGM8 8  4< @ P0 41 {, p 0! &Y qD 4 "  2,07X1 d4d$`V P$x@P0@p0U̅p 60 40C  TH-Uh>@>TTT>>Ȅ> -0LSPp`0@rP  H  (0"(0`SP $,m  H> p-LM `K@PG%02K01K01K01KB0t -^P 0S00  0Kp -L -4LJM0 Z0pL H! D1  D (  0 48#80$S("HPP  TYx+00 @0@ Z0/"-0?0bL1 S :(\ Q B Q B#0e0 $0  B 2 R 0eŸ0  B P 0 0@0@"0e0 50+]7P0 0@0@,K $0@  00 NW0[ ,f< 1`V2  048!#80@P10<1xȗ 0p1 p.0@,0C@10P1^00 (K0NK C,A 8 4   W@H:0P00  80KČ Ƞ ,Ƞ` H4 .H7 PU0PPTTTTTTDtT -h0hL`p P ,J$JA ` 1\lT 0-PLH8@S 0h908 -L@RMP-Y`P70,0 D TE ;AY; 00 H0t03  P, 6TqB9 !0g0`   A,0g`@ #:(\ 0 $0  B   0 0C| ,(K ;XXTqB qB 0 g $SPPPT -@RLMPpX`P7@. T/; X;㇥ 000i@1`, 0 <#:(\  $0  B 0 0C @(K ;X;T i0 0H @  @⇥ @P XPPPT -LMpX$X4Th1L$0P 3$00APPU$ "100*S=0 `0` 0 P )U R=<0@: `V@XY, '  #X RM @PP0#$3mU (Kd)U @: @T`,  R, # ,P3$001R=<0@`PU 2 *0% 0 ;P@ Y$2 "Eh 2P&!), @1 @!1lT )  B@1 @!t1lT PP@U7 21C*:00 `0` 0 P (U J@: ` V ~@0 @ 0^lT0 x0VlU @@TQ  P@ `( [@00 @ 0;lT Ap<<T>x>(>> -L MP@` 0gP( p(K  00 0 pP q(t t0l  pp0pP0@, ,V( 0< A<ȅ>>> p-0L`PV J0 $ 00$$  0 phpT p-SL[L`@tP0S : $0 k00@T@0S *0 $0 0k000 R pRM @PP\ L D0 yk00U@<@P 0 lk00p A<|TtTpT -@LP  X01 -LM`@0 8CN@ $F\2V  p   0 @P  ",K0   ,@P ' 0$,   @ 0 @P) w'(K 0,  04@P  0@@ @P ,[' 0, 0Q' 0P 00   ,@P ?' ,0,   04@P 0' $, @@ 0@P$0, 00( 00<' 0, 0T\>4>>>Ԇ>>> -\2PLP H"00+  h1eQ2Q Q '!1 !0S1 0!0 01!01 0!0C X0, @p2S2<* `P6@Tl*<`P0"X0 R0 `V(> 0C 0 0 & `P &`# }&VP`p08>D"#T#l"T#"x #T"T"#Ь"|>#"">X> -L & -@A #L[@Q \00HS X00 0R B0HSQA #- -D8LS@  <}hx -pQLP2 9@$1$!!(RM@` Q Q  T0W0  Q+ * R i`V@0 0 XQ =Q 4:\0pQ W W Q Q  0 R  P> 0-@ L P $U0P0L 0-6 @LP& ` 0S 0CS006 0h0(%00 @0@Tq> -L M6P=@S`0 (KL3 0 p140 4  0,#0Q} 00CQbs BH8Sp1Sd NPh 1S 㹃@ 0 S X@P) 4P, LP  , K9@P tP  0@GXP ,0P ,Q 10 0@0@  0  S p`\ 10 40 0G@T?0S*,0,0  1ASq B00S1p 1   &f,   u@P] X ,10,0  00S|:A BT  10R`!d!  10C1l 10R''  70C7,0,0 x S6 ;6p((T -lplP0h`@L (L0 0 X 0Q 4hX -PL0@p` ( 0d X0 0 0 ?/à€0Q , 0 0mXP -0QL0@ 0 0@0  `R0 0R^ ^ ^X 10 h4$,0$0XxmTTPHM<>DH p-1LM @R a 0S] ad!<S  B$fK!K<S  B$R̈́K!K PK R00L 0\00L00L  \ 0A0QS 0\Q00L00L Q00L 0S PQ  Q 4 Kph0R=000 \ L 00?00 10C 0`8M@8#8?.\0 0P@X`c >@8#8?. iR#P ԇ> S< -L,Mp "JKT IRK#3"胟R0P0  *"3Rd +#@ ("(R@T`tS@ ("(RwP#@18#8S!h1P1 T ("(R`@T<8P#X/ U0"8#h@18#8 S11T<8"#X, ("(/"H2R $[7(K+,"* "$[ $[*#[5$[$[$[0"[Cm"[ziR"[ ("(R^T h1T0`!P0/X *K5KKK}0KyCKSzKO@TK0P/(RP A00 2KBT/h0X3[X  542[  z P ?? -L0M,0pS .((&'W G0'(X 0`Pd'X@(98#8<'@07.0D@T@D 7<0D@TFV0&(T 0/(P 0SCzp ("(z4K  03K0 3K03Kzz 0S$0 ("( 0  ("(z ("(zf8z8#yz Y0S ` @ ("(o454%@P/X`(:8#8/zR ("(z0$O0Sd0 ("(BZ0 ("(x8 03K03K 03KW,0S R ` ("(RC ("(CZ-Y. X  㟶 X H8C8DQ80 cp0tZǡǡSӜSLH#< ((# @2.0D @TRbX0"X@T0"XP0/X@x2<0D @T00 ("()("(0SZ @PLK` 0 @TP1(K褑@LK@T. s o0SS) S' SS9 `~@ ("(`]u,("(T쐟@LK @KT0UC +Y,("(8P@ ("(/DL  $)TQK@TCS0#(H 0#(/(D 0Szz LS0 @8#8?.Z 0aP@/X`(00/} |?S! i@0P` 0 P@/X`(;8#8/ >G@0P`  -0L \ -`Pz\LT -@L)03+,0   % h -L(Mp0"JKP0 d0EdEdU0\%(98#88%X0/( *K 5K`KCKzKRK0K 0 C0/X. (x 3[$ 52[$z +#*#09@ #[0@ L$H, ("(| ("(\@H$(8x9@m.#o0c /#hRb 0/X$[[*$[W5#[S`#[OC"[("[z$B[R@BK:008#8 R2K 0"X0 #[*#[&#["#[#[#[P (K! ("( /!e|1^#[ ("(D3[T! 0pzX ("(zi, 0BSUR HFP  !??`aˆh@+ -0LS`p 4$Q 0$Q DP PLU@5,,("(5TD2S 00S?ڸ2S $4$$0$X ,("(*("(# ,("(5 d ("(5{] ("(]q0S &3+j0 f3# 3/X0Sh  "V0SW  PB12S u #y P P# 2Sd [{  \ z% ("(z  2 *!|2S8 1!P@/X`(?008#8/X1X!/:X L!&,!,!" !#!$!l] P Zp 8 zP ("(zz ("(zQ ("(Q !P +j"?0>c7~g p-0LS@`  R` RX L { R8 B RRvPPPPPo R0Rx Z,0S 0S0,0S%3#Q "3R,0S R7T3  ("(R0S03 M .#*0SM/##00Smz"2 A 00S:sy ,0S; ?|"8S? p00SXX"LL"U @ ,("(  z. "0S/!0k G,0S!?|!8S! TL((ph60*&("(6iNG+  c ("(~ ("(u> "("(RI5~P uxC02)> 0-|0@Lp .,  0S 000PU"  -2pL"`2/X "& 0 >,XBP PLDU@DR/:X0S A2S u y P P# 2S;  2 2SK 5h!&3+2SB </X*!2S 0  i|* P xZp t[{ p\ lz h8` 2 &,{"?0=<P ˆw -LMH 00 H`P@D ,K , <(4"4!<S  X R,0 4 PpL@,0S  X RH@' H H   PPp@@< (4"40 !<0D <(4"4 !<0 ¼(K@ p-LHMQ@U`p 1S 1S= 1SY 1S Kp RR R0B0St0\PKS0#@T"!Ks?pP 0!u0eP  0 0\PKS00@!!Ku?IP0!p0>P  RR 0B0S08,q/-uP 1Q0\PK@ Z!Kw?P0!i0Pn p\PK@ 0=!Ky?P0!i0PT S갈> >,>X>d>>x>>> -Lp( P PP4 R0C R h0C#P@` B\`,20#PP (c吣 .3\PPPPZPPPP00 0,# X$0S 0"X@ a.9X0 "X@ "<Xx2h".B9\@1$PwD4 0 \8"@T?C P7 Tg 0 @P!\`,6! !0 !X 0i@x1PP>@TX1PP:1 81@P50 !P0X!P0=}? 8101; b/1\@ c/4\x 00000C xJ lF`BPo؈>VUUUTTT>>8> 0-0LS@3TPP 0}PP 0S- [PPPPPP000l 00d0\ 0X ,0, l B, -$4LMP$100!0#0#?A3c03@ 0C @@<     $`P `Pd3  h`Pt`P*`PB`P~3 Rp(K31C01A=40@ 0`PL`P (&`P2p RY`Ph2h"1|!`2`"1)  0PhR <1\xBM P00 AC4R?Q` / 0S㠀@h 0 @8 w N@p,p1/Wᰀ@OH 2:TP1  0`<`<&po>Tح"T[#1#l1##q+(U&U\> p-1L`P+0@@0T0000000` 000T0L 0X b101p0TTT -QLMPC 0 9@?D1 R(L0@ ` 1` R0zO 31C01A=40p( KP (0` RZ" 9@=< BQ@9Ib9@ L0@<0< K/,OpT\ -LP@P10SAm4`@ P m{pP.O0 ' L 60!00 B= R3 =P9Z@0;90@) D8S,  m)@0@,T p匀0.,]/T\H  Tذi0g0> -Lp -L@4P 6A0AS 4@ -PL@`p奣1T* 1T4 1T  4P@4 L10S@1T1 0@4Tۢ@606 0S$ 6@ @@@  r4P@D8S 6A0AS@0@046A0ASx|80p0x(4@Dpp8i i i ϖ1i -LM9`@(KSs0J/,p@ 0K/, 2P0@KD0 PU 2唂%A@r@!U 7KwK,07 1  PPUJ/ 0\@2 0 0@\Tk @V P@(c@0PY408@OI=1 R9 x1 R5 0T0U  ' P1P!0QE|AQ0-,-0XD 1 O?_SRU V>Du@l0@X0PD'\VUUU>g0XTDHԉ>>TT> 0-L0@Pt0 R @@A 4=@0@ R;@ᑡ 0p0S0S<0S<<   <0CS,<00-,000-,000@-,00@0@<0000 -0@4L0 0 0S 040 R000 - 2! 0020208 $Q . -80L0="R   -L@P 0h@-4@PTp 4`  !00\;0 #;^0 <00d<00 0@\# 5 )\  0;-R#;  '\v Q  Q0 00000v 09000 0-80P@L >0 < "@0hw 0-PL@<0L0hk Qp-L`P @Vp p-LMlR@`pt2 ` l” 0pXdlRpt2 ` l” p0Xx -0LP@ ra00B@0U0 0 0"2R0CB200 -0PL4`嫠0pSS  4@0T0 1* **P\^ˡh p-PL`b0 L@0U0 0 㱡<SLp00㩡 p- 80RLP` 0@S  0@4 ph=p p-0LP` L@0U0 0 z<SLp00r p-0LP` L@0U0 0 ]<SLp00U p- 80RL@`P 0S  080 Q 4H0Sp0 ph4 p-LMPL`T 0< 15Kp 0KP   ,0 0  ,  ^ @< p-LMP㷟L`T 0< Kp 0KQP   ,0 0  ,  ^ @< -L,MPD L P T0 @a 0%  <  4 0 8 8 - (K00 40 < P0 C ZPpQ08#h H V0(0(00 pG0|! x1Q,p  ,0@ "@ SG,,p i `0 D <Q8 8 444i0 079 @ < @0pW, 0 0 00 #J(`L^@P" D, 0`0@0W0 D P AZPH R 0@P 5ZPpT0L  > -L MP804@`Tp <0 0P0  0$Q  R 0S  0K  0K$K0$ T040 $0 0 <0 0P  00 -RLMp, X R@@Yg 0PᢳP> T`; U  0"100"P V `^U$`00 `V$ vP  V1@`F4hV g 㢲,0<4PF`ឝ, <4P< @`, <0@iTዝ,> -0Lp@40 0 Q50P`•40\ PP 0S0 0 ` VPV4g iG iL P> -04PLp`U@<0@T3@<0@T&<g i -0@Lg ` P pD11$$00WW@44(40@T PPT1Q@CRJ40wPU@DZ4g ޱ㉝@P4 0  ^ 0@ќ 080< i 0-  LP0 0@S P P 0X1,00L1,0000S####0( 1r,0 0h0,0NP400,00ho0,0AP4 kP@450aPD4+@0 80P 4@D0dA|AAAAA -LM8 @ ^,+0P4 < @ Dp4@`8  0000K  ,0KHPc00, p00 80H <% @ <04 6Ǡ-0 0b 80< 40f,0 0 0 D00%0 000S 1 100  0 0`p8 `08 0叜80` R 8 r<S0,00\ >0R0 <2S 00Λ(K8 dl@ ,N00幛iĬ# -0LSS@ P 0 P0! 0:0::Q:\   lF0Ph -8 L`P=2pS5X2S00h!R, p@l'8Pν R 050 R^0@<>d 0M@shE0jp@lP8埽,o>x> 0-L@ϛP0h#-80=\  0 `\0d hPWꐬ# 0-=2LSPX20QX2 @JT<SX20CX200<40ꌄm0 ꌄmC -QLM` Q l–Ppt2 P l2p (l–@pt2 P \2l–0<8#8 pXdCl–pt2 P l2p (l–@pt2 P !l– (1"(0p Xdtl–pt2 P l2p (l–pt2@ P 41l–008#8p X 2l–ppt2 p l2 p(P (  lBpt2p l–00p XX l–pt2p I=l–08#8p X0> -L@MP 0h> -L M80`P=2S00 50SJ 8@t1 <0  @ 4`,@V, p0 F4000 0@T4@ P B6t:P0p8@4 <0,0<0(Ko"(Kl– pt2 0  l2p (?<@cg> -LMPpQpl• pt2  B l2p (W0`lB8 #h`pt2  B l•0p X@l• pt2  B l2p (20#0W@ L TḖ00W,  $ ᭖>>> 0-LMlBP pt2  B l•p 0X@dT l• pt2  B l2p (@88h > -L Ml`pt2 ` l2p $lB pt2 ` l˜p 0XS@T lBPpt2 P l˜p <T ?pP|"0lB0x2pt2 P l˜p 0XlBpt2 P |2l˜ ,0p0 \PP ppp p@P Pp00LPP 0@00 p\\@P 0P00 pLL`Pv 000@ pllP@P00TQ_0$00  0 Z000 HBB  x"0 Q0 ZP@ L(1lR`L 004 lppt2 p l˜ 0p XlRpt2 p l˜p 0X$Kmk ᠪPP p$Kp4 0@ ꌄmd#LA,>T> p-LMlP pt2  B l2p ( 1@P% ?! <S x``` ` `}  =2S! 0=2Vx0=2xlB pt2  B l•8#8p X\20\2xS`>>>ȋ> -LMl@ pt2  B l2p (?h -LM`0Vp0P`VJR=2 SlBpt2 l2p (? \0S 00hϼ p-8 L`P=2S04  R40 BA6@@<S0,00>0\0儔<2Spp p 0-LPUP@0T0 -L M8 P`@=2S p0D 0%00080 $K 0K_pP K$ 040 $  40S <0 0  40Sʴ<@S0,00>0\0@<2Sp Ap -L@P 0h 0-80L@P="R 0P<2S00 -L@̻P 0h -L M8 P`=2S  K4@ $K 0KP$ 040 $00  0  bpa<S0,00\ >0R0 <2S @@ᥓ<2S l@T #Ĭ# -L@mP 0h=2S<2S * -LM=bPVM|WJ <0@ `lBpt2  l•p (0 0S 00 0lBt2p l•p (00S 0 00 0S oe 0 0 ړ8 @X20X2X8 X20CX2o% -QLM`P\ QS Q i<2p0<2l•pt2 ` l2p (h3lBpt2 ` l•p 0XlBpt2 ` l2p (l•pt2@ ` @l•H$8p X2[<20Cl<2p<2l0<2ppt2 p l2p (l•pt2 p |2l• ,00 p\lBpt2 p l•!0p XlBpt2 p l•p< TlBpt2 p l•08#8 pXlBpt2 p l•00p XlBpt2 p l•p 0XlBpt2 p l• 0pX,2<20C<2iz 0-LMQP 4lB@04 pt2  B l•p @0\84lB@04 pt2  l•p @0\80 0 0-#204S0$0 0A>0 0!2010P0S0SP(0-#206S,0&,000a>000, R000000 !2010P(0S(0S,P800="R$ 0 000 - 0p`L80@ -00@pLP8`<{ 0R [10PS 0S 0 0 ṐVږ0/-000b10# BQ#4@0mN -80`L@<0SS000p090LP4 R P40S ႐"@᥸0( 90 irqi> 0-80 0$(L0@Pቸ0h[ -L@8P 0h Q-L \ \ 0S 0 0 0  0 Z0> -0L0p@P͐`㱿0 0000i 0-0LP@40h 0-0LP@ 40h 0-0LP@40h -@QpLP` p`@`T`  P.P @$pTp,8S.   0S`(8S $$0SpL> -LM80 `=2pS0KXRU;T1h!R7 Ip@l[P8ᛏ0908 #60@8 v0 ᄏ', 0LpU$0S 0P#>S@ lX00090号,oap@lP8影ၷoS,o>t> 0-L@P0h= p-LM H`T ؏ X@ 0 8%040 0a#Kp 0KoPPP㼏@   ,0 0 ( (@ ^ 8 -LM800<0 08 =P}80s<0"0080<04 @0 ,04@\^j4 PL@&j, ;, p0 0, 4R0><ʅ0 S00,0 ,4 0PLCJ 3( 25 < ( 480, ^0, P80@ B00p*0 W!`<apP- ,#(0L",A P p4,80< 00 80< `&(08 04p090(Kow(K<0$(Ko<  (Koꤌ> p-LMPH`T 08 Q0$00jOKp 0K⚻P   ,0 0  (0 ^ @8 -`80$ @RL0p4PP 00$1l00< @0, 00 00C 00$@202LP0040004 -LMD < @ b 0%  0 <0,  @,00 `,0R ' @"0F08 @ 80R64 80 p2 @@<^:#:zc>0PP4*3 S R I`` `0F 08 XP"$> @ 00C 0 市8 0pDP2$00S (K0 0000 ,@ 10R0S 4VI@P<P 80 00 0B$@Bp -L M80+p` ,P4@0Ppt ,0 Pp $ 0000 ,P  0,K D,0pP , j044080< % 108< 0, 0 00 P22$`D0L@0%0 P0,!,Q 100,0P,0, ,0 P, 02,0R, $`复00 p04lB pt2   lš0p \0S <2S p(Kl@< e  l ,i(0# p-LMPfH`T 08 00᳌Kp 0KP   ,0 0  (  ^ @8 -LM P=b@Vp7 0SP32,0Pn Y0P P, F 4,0p 0P  4# 800 0pS0000Y \##,## P  1,01,0 @ R? 80,  ㉹PP& ,0S  P 4(p,` "k j( l0r,0 oP0,0oⰌ@ AAAAA A 0- 0LS@P YP 0᪻P 0 PIP0-80=\  0 `\0d hP(# -LM=BT (KX20X2_(8,X,H40 (H崋U'Y P$ $`V 0SS l_P80S 0C0b20000#s2(Y P40S`  4P$0U00 W 0SSQ 3N 4 <00b<0 L, 0 倐3. 0 p#> 00Y R00`V,0@ 1@*C6"*0S8# 00V,00,0 3 YE 0L0ҋ@U(0 R8SCX20CX2\$p0W80 @$0S 800 00lB pt2  B l˜0p \Z00 Z0 000㖋@90S㉋@ ߊN080ꐄm0 ꐄm 0-L@'PPKS0 -L0M80p="R =,+ )0*T d<0@ %0& $('$Ru *:R eR R R 0lB pt2  B l—p <\00#@ᦲy$K Rk  R zD9R 0RU80 R S 9R RV8VUlB t2p  B l—!pP ,0 L#Ġ# (K 'K&K%@K(0KR 2\8R 0R 0V8V!0NPPS񟗊`################p#,###7R RqU000~|7Ry 0Rv 0wRr 0sl7R[VY8VV!0NP`SP#8######D######################@#^ǕA 0AlB pt2  B l—p <\-lB pt2  B l—p 0\Pd-=2P SlBpt2 l2p , UlB pt2  B l—p 0\lB pt2  B l—p 0\lB pt2  B l—p 6\l— pt2  B l2 p, HlB pt2  B l—p 0\lB pt2  B l—p 0\lB pt2  B l—p 7\lB pt2  B l—p 7\lB pt2  B l—p 8\lB pt2  B l—p 8\U=  JN4S Sr S0.Ÿ@(U@1@# @8 C4  0`2^/ 00l— pt2   l2pH ,O`K@' C8 M0K$40#  $<@L KJ0KK@Kl— pt2   l2L p,P 0  @P !0 0R@1@!  O0KU00U0 0 U 0R0* R# R  ů U`1 `#@f TP1 P#p@e T@# xl P P 夯 .⟯# #$AOA>6A?AHA> -L@P 0hB -LMplBP t2  B l2pP ,Z8 <0 @1pCWp!W"@T`l• pt2  B l2 p,/.00 b` T!0,!@W 0 0 mޯ 0-=2LSP 0M$@0h螇 -LMPP "R pWO 0``c00v[ VlB pt2  B l•A0p \4` X2\"0 X2\"{rlV@IX2V0CX2 lB pt2  B l•p 0\4 04 l• pt2   l2p ,` "p0=2l• pt2  B l2 p,"`$Q@`ilB pt2  B l•p 0\lU٨`P80P8ƮP`z $P(@`0P8r,>>>Ќ> 0-LMlBP pt2  B l•p ,488h -LM`0Vp0P`VJ<=2 SlBt2p l•p ,4 0S 00h踮 -80L="R<2S 0-LPWP@0jT0 -LM80P=b0V@  , 4@pP7 $`D00%0  0 0R & 170<0@ ,, 00C 00 2p$PL@ӆ004p090'<2S a ( -L@P 0h -LM8 P`p=2S  $K0 0 0 4@ 0(K(P060( 060(202( 0(0 $L@〆(0T   $P(0 S00( 4090lBpt2 l–0p \0S <2S ᱅<2S l@` /# -L@yP 0h 0-80L@P="R 0P<2S00 -L@UP 0h P =2S<2S  -LMp0  R0 0Q6  090QP4 1 0@9P02>U 0 <P@<0E?01P E 0R904 0 @RJ1?P5@TZ 4  8哱~A PP/ 4 @3 2 \!l—Ppt2 P l2p ,l—@pt2 P l2p4 ,l—pt2 `P l2pH ,, l—pt2 P l2pL , L0@ Hd lBpt2 P l— 00p\dlBpt2 P l—p 0\@ >l—pt2  l2p ,@ T$@P@T 4 OlBpt2 P l—p 00\l—pt2  x2l— |,00 p\lBpt2  l—$0p \lBpt2  l— $0p( \lBpt2  l—p 3\lBpt2  l2p ,lRp t2O  0l—@00p \lBpt2  l2p8 ,l—Y %Ypt2@a  FN.B Bl— c0#1A80p4 \lBpt2  X"`l—1p@ \lBpt2  ,l—:pH \lBpt2  l—P 8p\lBpt2  l—pH ,0\lBpt2  l— 0pL \,@ βPDzl—`pt2 ` l2pH ,@ T0@@ 004  HHDHlRpt2 ` l—4p1 \H 0@^Pꐄm,>\AT>@%I$|A#H> -LMl`ppt2 p l2p , H H81S[ l–pt2 p l2p ,lBpt2P p l–0p \@Fl–ppt2 p l2p ,@dTP ,lBpt2p l–p 1\lBpt2 p l–p 1\  DlBpt2 p l–p 1\h> p-LMPl• pt2  B l2p ,d B`0 @`0P T <0`2xV0`2x萍>dd>>>> -QLMp`G Q1 Q i<2l–0<2pt2 p l2p ,DHPT8 lBpt2 p l–0p \2㏱<20C<2lB pt2  B l–p 0\<2l0<2pt2  x2l– |,00 p\lBpt2  l–$0p \lBpt2  $l–0p( \H8SDHT lRpt2  l–@@ 0p\&lRpt2  l–@0p \lBpt2  l2p8 ,l–LH pt2P  10CN>C 0Cl–0b "!HQ0p4 \lBpt2  L8l! l–p1@ \lBpt2  l2pH ,lBPpt2  l–p:H \lBpt2  l–P 8p\㧰lBpt2  l–0pH \2㕰<2 0CD(<2L(H(il–pt2  l2p ,@@lBpt2  H(l–00p \+l–DXpt2 p l2p ,l–Hpt2 p l2p4 , L%I$0U0U 1303 22a0S100 010 0-Ql2x"@P@L p,l”x"*0 p:\0800="R  0-@LP6S\0&\0`0V`@0hc 0-PL@640F0hW -`LQPp 4@T0000 L008 S 0-PL@ـ6D0F0h/ -L@ P 0h -@LTp`; 0S8 `PU# 0 0l0t圬\0\0\0S `Pd@TQ d@T Qd@TQ000x&\01x2 x0q\0S> -80@PLpx80`0C80 R h -@T`Lp\D 0I\@0P0 ;0C@ 80 0 , $(\LpC 0/\Q 0Ph& p-T`@PL\ 0D0 D0T\0HPD@D0 SH@P0\000ph 0-80 0&L0@Pᒧ0hd -0LSS`3 0 00S8 @T1 Pp4 <D 0׫ 0S P%40S %%88 8pc4@T@p +%20# 0 000iQ"888S@P @000S$$$$@T% pPtl 0㓫40U01#.#8*"*8 #Ƞ00PpP40Sd@T00> p-0L`PCT0S@%T0D000C! `0)p 0-=2LSP 0[@ᝠ0h~ p-0LP`U p0S# @ tl 0+ 1SR lR0006 0 E0PphQphL> -0LSA p 0D<  0$ PW@S4PW D<@ 0D`0 ު&888 D  0oҪ lR0006 0 0P嚠oop>0 00S t -8 L`P=2@SL0 00 @0X!]0 0R00006 0l 8P]~\  1R11d\}~0@6ʟ  0*}@00 hq~ @R0006 0p lzP8!h}ꔎ>> -LMPQ~l2x"p ,!BP x0S QE\P*(0KPk~p`4(0$, 3  h (0Kl0p@t6S\06\ ` ^``pV\ R`0`0`0 \ [lt 00x0\0`0d0U} KP -LM`}FT 4064 9040;} K?*(0K↪PpP(0$ P,@ 8(0K<0@@Dp6*W40@&P -LMpD < 00 % @< 0, @@1`1 F00  .X08 80T2-6-0P4 80   8p30, Q4 <!4 PP^ T<00 Xp>800c S@1p301 :J$JJd 8@`pW00, RP <7 8:#: \ &0^ 0004S804E I o8TP4 !4 W,0S ,p D<4 0` P(K0<90D4 0,P -L M80P+p ,@P@| `P@t ,` 0pe408 % 4 0ͨ1<048 0, 0 ,0D40, 05804 000㶨D00%0 x!0Ph1000  4D4 <⛨`匀|`>0S@@& 6P00{(K<2Sl@ w0K  ,0K@P  v s@0804 90004`00D<QvPAYAbA4A#>> -L@P 0hV 0-Ll@px"0\PdU$ 㬦l2x" p, P l”px"0\PdU 㔦l2px",P0W S 0 >T> p-P0UL`0@PUJo=2Sl”x"p ,6?0 e0S p00ph -LM08 Sp@ !=2S @ 40"! B0AR0q03Q0SQ0  Q000  Q 0 0 @2P8 < Ջ0<0 P,0 40 @ Uh0d0< 40P<0@ , ʠ0:#:0d0>0.S 0!C60,ʠ 40004 40 40QM0 PU< 0P*@0, R00@`>  0^$0ʌ@ 0$ 0 0 4 0$0 ,00(,0 08 ,Q $::5 0%(0 ,0   , P @(K1910d0v@80S4l2x" p,2P0C" 0 00C3 R PS0Q8 R&<0S<@E\C 2 @ 0S00h01&0\0&\0xS`0`028Pc Td@ 804080<0嘠060&@p$@u<2S(  >t> -L@ePh -L M8 P`=2S @  K 0p(K $0KO@P @ጝ(0$ 0 u$0S <2S 00& 6@P@Du<2S Nl@ ĸ]> 0-L@ᴽPPm !Kݡ0 0-=2LSPX20QX2 @ T|2 6S mq6SX20CX20 06e 0- 0LS@P P 0ΡP 0 PpP0 -L Ml2p $l™xp ,l2p ,g0`2 P^D0S l2px", PS$S$ R$S$<2奯 * 0P@0"0R2 2 !Q l™,0x"0 p\e 0WP  #j>060 <07 ` @40&@T P? :(Kl™p 0\8 ;2<2@:!0=C 0Lp@Dp @@@\TD ;0C`@0P1T*pD 0 P@PD PPLp\TǝT"P@Ue:@TP!0 ᷝ h@P P :0@00 ?0C 000LT\H@D@D 0⟝Fl™P0x"0p \m |吴mtՆl2pb@xR \p, 08 10l™x"0@ p\dZl ol2x" p, l™x"6 p\K "P001"P PH 0< 0ꔄmA>P$ >,>> -08 S@L 00t*R90  q0@-P( HT L) 0!"4# 8̓ t\0S \0S  RJTPP \0SX00 P Pp0: p0C*:p0: _0C*:0p30 P  0 0 0-LP@@T0.?  0-@LP p 0 0 9@)0hXo -@4LP R00080 0 4P0,0 0$0(0 0-PLoIT R0009 0  )o0 -Ltɐ`p0P$ 0 0`0=,0,0,09,0,0tpx8@ 04@D00@<:8 |0h1,(0\  @ ` \ H00H0,o( 0-9L@| 娂 -0.@L 0᳂P h3]$0> -L M0 4 L, 04 8 P , 0S ,0 S S] SA p0, (Kp0 08< 044 @0 0@, 04``p4 `00p`pL998< =>@ $?:P(; W ,0 04804@V0 :0*:1 0C*:,0 0@ p,H`P0@pDP0` p0@ L#D <P`0@(!(Dp#L440@G딑>p>\> 0-L ML@! 0Y"4#8 0 K00SPtɔ0X R1X R0K! 00P000SU\p 0( ɄK0p 0ԑ>> 0-PL@z00P0@T0> p-@LP`bnP0S @ 0 0 0 8 80P8 phm > 0-PL@EnP0S m@ 00@0@0  0D> 0-LMP~@# ,0  0   l (00(0 ,00,0$00$0K0d> 0 -L4 8<Sn븒> 0-0LHPT JT LL  P00 -*LR@ TQX0X0X0:TX0*R*R TQX0X0X0 :TX0*R*R TQX0X0X0:TX0*R P \ R`0`0`09\ `0 PP Q00090)R P ˁ -L@h -@L R 0S0S PP 0S00 㤁 R0  00̄m p-dPL `R@ 0S0S  R  㿁P00pp̄m -LXM@ %㯁,  0D P`p0 %4 8 < @ @0 4P `p$8, (<4@,@0D8m,(Kؒ> 0-LP,0U@  % 0h,dd>-? > -L@z@0 ?0 <@ <0  -LXMt@KpP`nY [6\K -LM@p`lt91XPU UV kt)1L)p 08`X`p 0di+ Kik(>[<$ 0R1H < p-L@Pxl`Dphk 0-0PSL S 0T0 *TX :P P0S 4@0TP0 ^@T0P00T RX0X0X0:T X0   `> -`Lp6l Q9 Q7 Q3 Q@ : Q, @00S"  0R& 0000S 00S0`T0:X0*T`L:PJ 0@L:PJ 0SX0 QiPk 0RX0 Qkx> p- 0"# "L@Pk0``9H:UH D0 20lz#PP0`9#kdpP갓>A -*ML 0 0SR ! -0LMPU. $@K P$ xW! \iV`V P0 48<S@T (< iP@  wKzWꘄm o  "P0 48Q Q| Q>  0 $ (,   048 < 8  P[0 48<@(0) *4+8<S(KO0 0 PP0   e0 $ (, B 048<#,##Ƞ 00 $(,0"̠""N 800PPPW00PPP>> -LM Ly@W ßX9 "10 0 0 P $̠$$$H  @ 0 P$ (< L  "\!4!!̠""HP 0@0 0K !" 4#`8>,> 0-L@iPP F0d90hhꀔ> -L`P VX ",0( 4;2( +>$0"` 405 6478`:p ?;P L<$+4"2L)540674 8<2L)! 0"#4 8̃ˆL405 6478;P8p 4 ? 4 8\,Q0P , 8K00K0S@P`P`D0 @@ DKB2MP`0 K $?c`LW? L -L^P`p@ P@L) 0!"4# 8<^P@+ " "202 0-LILPL @08 H_ 0 48 >> -L M4 LYUp, m00a 0 0 /0C 0 B0C` 0 B<0C 0 ` ` `4 !LT9' 040'U)(Ƞ 4 V90 0'4W)!000(0C "#567@0`1`2`03` p4``````````040pYU0@ :  p`D PU# 0 (0,@X h  08d,H 0$ (0W TPU4 p9S  0`4p0S0 @49Ix|)(KV`p(`0@S 0 @T1T! p-\:`*D1D!|:*<1A> -40L@v8 P蘄m -pILT p@T `hP P  0< @pTW m6Ȕ>(0 S-$0@LQ)`9S H:S hY p- L0410T`Ut@H h9S L)p a:S0(0phK00`00%SI 5S@ +(S *SPp*M0(00 uS S SP PS S SS S SPPPP >> -@L,`9S H:S hƜ -@`LP eVp (0S0(0(0:S P% :S$T0S! TT RX0X0X0 :T X0 0P (0S 00 0:S hBd Lda0 0 r8>+- p-@PLn`rYg0T0*TX PH:ʄ0CH:ph8g p-n`PLCgJT TQX0X0X0:TX H:0H:gp -yPLHzg> ,0 W9 * Ʌʅʅʅ ` y@\9\`0)40@ 480<$P}`WD$ 0-@PL YU 09 Ac 0 Xy)> 0 9Y @9l@ 9 P R040S840+z --LM K00,8 0g. K -dL@{P , P  X>x> -HLTp` +^JT L p Pd:S +^ 萕> -HLTp oJT L p PPL9 h P PPfo 萕> - LgM`0hpP`m/K0\@)TP 0 K]K 1 S h h00 0K 0RS.K 0T`p` @p@`pW0`pV,oedA> -@L`p  PwPL w X)R䁟`  0exp)t R t9 RX9"100PVp P Q0p9  0S00Qp p V#t9PP 0 S0 S RQ  PU p t9PPUpp P t9 P2T!   }wPP (A>ȕ> --LM K00,8 0- K --LM K00,8 0 - K<0 0-PL @P ͬP04m -LMS8# 0 l,K =@P`XI 0ĐK:0 . 0h0 0, 0h!0 P` Lp 00 H D P P P H0 0H00 T n0 + 0 S ?04X@ `p XP1X#\ X  S?04X@@,P<(K 00P@K00@@,oH> > -L(MhV. +^jV* L p P0K 4@T@T  pPP (0 @  P  L@+^  4@(K @ L)04 8>>>>Ԗ> 0-RL0 0h( 0> 0-L M@P90K0 p-X9PSL p  >upI`TL )tp\@T \ 0P<> 0-L Mɠ@P 00K0 -L$ML L00 H0 u`P 8KqLpyW D @ < \q L 0P048 L2 $(T\= pWD0SZ  <Q| Lp9Sx \pq $0( 4L8T\^ L Wt9 X [ \q0p pL 0P H71U% $0&'48<@ 0D0R0D0  8K 0@$4(8 @ 8K P; $0( 4L8T\ <  U < ~}T{ UW@)t(K UkHP@HD@H4@(-H @marc>CRAM\>>>> p-LM`R@P !ʭ P $88#Č@ a@0,  @Kp> -LzM0 ! ' 9SH S G(KL)! 0"4# 8  t@X RpX0S pW` D) 4$p`X R 7AX0S3  RL K 0 ,K<P  ß@, h10OP||h.K,0O@P T h1,/O,90  1 S L K (K021 1RS L KSKL) 0 "48 < P @Q  ! K 0!R  ie !1R[zKNK0@TPT[D0 L KP *PP 0P0Q0S`L)000000000K !LK\ ,0 `0L 1002@3 48K(0,@zK04L 8}H0   l @P L K@SA T1SDT[0 L KxP+>L) p L0K\nXI Eq L K<-P>d>>>4>,oedA>>>>ܘ>X>]$@> -LMLɐ 0!"4# 8  tpX0SP  qX0S  Rp (KoPW ?00 sbVF 0S`V> 0S> L)0,0 p h0]Q@ @4 R 0 S@RTQQ 4 R 0 S@RTQ&]T 0 mxY,h w0(Kos0S*]0P@s 8!(\ %P2"0CR202 0S00 qs\t>>Aؙ>>U -LzM\pK 0 PP P  DJ@(K  (B@,K ;@P 8@d, h1iMP ,7P@ h1, mM,7h,.K0@MP 1 S  h02(PK (RQ 0 4 h1,CM,7W/KP " #B00@2 B 2  ~KR <K ! ' q \,0`01 h~OK0@P!(@,P1 0@4PA 8<KH0 Q@X@ ]qm0a 0 0 0 /0C B0 0C B0 = B <KP%Ƞ P>!4!( !? 7P90: ;=0P!"#1P2P3P4P5P6P[@8![<  :!1H0!X qL2PX99X "\Ʌ pt 2!0p)P&O0r"R, 0S02027r@U t P  p pZ  pl  Q "wp@ ‰@>8>T>,oedA>>>>x>>> 0-@1L PR "RE HT P0S J0T0R R R 0 0hfp)R \0S \0S R`0 l1P L)p 00h7>Ě>> -L4MpPK@`P 0Xɔ\048 L1 $(T\ p K"1   P X^L1U0@K `0` dP 0 4 8,R* R R 0:504 80 0 @00 @ @ @X\ 04 8,P00 marc>Aܚ>CRAM0>>> -LvM`! &((0"4#2 40  $,K8@P h    .Uo)Qo(K$P, h1KpP ,5A A A h,.K0 pK@Pc ,h1KPP,j51 SQ Q Q   aoP t  ZoP x A~KXYQ Kp<W 0S&40$ $,K! T8PX, h1JPC0! P >A0 48Lx1 $(T\ X,h1 J,5 h1,J,5q q q m1U L K 0!1P @,h1 J,4 4 0!! ! J )F %11 @ (n@ n ? 0! $0@x>,oedAmarcCRAM>\>Л>> -LM0  80 npX "10!PP4 piV0` * 0㨀00 ,0 40 \ P0\X0048 L1 $(T\ `V X0S\`V)3n4 /n0(K0U \ 40P,0S \ ;00\000  Pn. 8NL  㺾0,0 000 AmarcCRAM -RL,MT `N Mp0@P0  *nT0p900p APt0\@X0, LK 0,K*7P/ ,h1 IP- h.,0 `0 0S @00$@S p P0sP T0pW@P(KP0P 0P0 ((0P0 ,30P0 ,oA@> -L,MOp QL P0 E mL0S7 0 m0\9H 4PH m ?Pb/0p #18#hV%@ PVP  P@ H@K 0 ^  `  P `(K  7pX 7 " sPP2 P PPp@ P L)540647/8 <S ` ` ` t`? I2Tʘ0\T9 x9|I @ P0 x |&- P R0 0:(>*08\`P@( L 0 4 80P 0#,##8  0L" 048 <  " "4"Ƞ 0 @} p9S 3#n" 0@@ T T0U T * $1A p o*`P P`TQ&)PaL0ST9V L) p )L)0^\IT x:S P @TXʘ\l  P0 Pd `#V#`F X` H`L `@  lL p hpxhP9`SO 09L `@  kp xQL) p Xo` /%, 4S PL @p0SP$<$$$301 20@L  p+L9 p0 rL) p >_jPp 5PL  L9 p0\ uL h>>>>p>̜>p>$($|>>>4>>ܝ>>d>О>8>]$> -P0L8p@` m!81TH ,1T6  1T. 1T' 0H0/ m0T, 0T3P00T 0T00S0  0 B&B"B!B%B'B(B)BݽG=!40BS (0Q 1Q -4ud@ -LMH{P@UL ,@ 4S 0S ,S  ,C ,P$ ,#$0S{0Sx  Rqs  .k`P $0, pP  jPP,c L0@clL8 $, KLVqlP,c U,0S 4S `0S $S,   $0S$% $0&'48<04 506$7(,r{ 4QP'XPU$  ;PP\f 0S `0S$ RQ$ $`U 80X080X ,0`P\ jpP   5406@ 427P<01002@ 423<0! 0"@ 42#<0 0 @ 42<043S0P0 40S  0SX RQX Xp4X4s P\$P`0X$0c   0jP<    0jP@  43S $3 $XP$ $|P $0S AjPH  $# 0P L(# L K(H0LK\0 hW(0:98T =<ČT>Ȍ?; ,H  P (#LK09=8< >:; $? (H3 L \(@,P( 09=@8<>Č?:;P|H Ȍl0`4p(H3 8YHLH H0LHO0X0%kL"RG 0SH0L202*k$XP$ s48 2K*0s0S   P 00h0  CR <#00@3  @0 QPZ.S8A8dL 0X@0<X 1 @ 0rD3 ! 0` @ $P(V|: $Z% <L@K|L 0D D30@PpČ@嚀Ȍ`,@ $Z 80R L g<K0p 16K   ` 0CSu PL#0@tjL38 2K0 LKj88 XYV4cP@XpT P $Ph hU@ h`W0#R @P $Ph hU@,@T P $Ph hU@,3S ,@ ,C hT<*h@*h8(K0Q @  P0h0 $@T  PP X@0S<*JL#ѿ@s >m>ȟ>m>>@>h> p- LM0PS0ii0`+`(hbP ~|0/3<00, @K u#S㮸υ0T  vH H0 8 "x蘄m>>̄m$$>-?A[5X$4mm -LLM pL9`98:< =;P> $?(<L  %PX T < P (KP@K hT0T #<`0 "(T0h X \ d #4l Tp0 "|"X"4<tX..h.D`[J0KPKh[X0[OKp[I0K 0 HKGKEKt NKMKLpKKPKF0Kt 0@K0T R0-0K00K/0K.0K0@ *0K,@K+@K)@KoX0#,##0 K/K.K-0K -LrM L ` A= 0<向姠>?@ Č:Ȍ089 ̌ᜡ @ ɯᬑ 娡 $ᐡ! A 娑;/ᐑ夡 壐嘡̑ 圑\ ᠡ ȡ!0O1  OcK| P  aKᨑ `p@d ?$(\p l ZK~KpWP`P`B2MP`.K c@`$!\xQ0T0R _  0 P[\A 唡9S@ M?K0@41 0A KKP`0PU`@p,q ( IK$ t VAڔL9L) 0!"4# 8̓ t 0X R\ 1X RV  QRP 1|AL)p X垼Xs(K atqVꔁ|L)p 卼yx U$xPv !t1Rrqp !""4",D1 <  8 @! hXT@g| x 0T|!h_|XZY l!R 0 H>|>>>>>>@-L)@ 0!"#48 <29 -LLM` 00K\0 @#X@ P\ L)! 0"#4 8<4  L H  ?< 80 ,00 H@4;T$P0 T a\0P@t 0 dkVTn 0D @0 TKpP0S[W \D0t L 0X$(^ ,K8> M-RL0 R(KL9R ? 8 9 : ; < = > &L ty908 :=<;`$>0(?P ČȌ<L "l!4!Ƞ!"D"X Z?`90:;=@>P8< (KoX> 0- @0L,(0 :0 9 0X*T:x>$$$-0 4 8<S 0-(04PS 0L(0 O@8`N0 -LM L ?P@ D0HL`P0 0@ P 0   p (K00 0@D0L)p 儺T 0(08> 0-(0LS4P 0 ( N@ N0h p-`LP # b)HLp" !]Pb0@pPqIT P R 080'a\@Tphq$ -2L@P 2S P P b"`ApP PҲ"b0S0 (  R(@00P2 3 -LMP0h0p 0d0 ` Pd 00000 ,@ $ bR00S40V80 ,"?110AOHL( 0d4p 0 0$0 008PU `(40,0  0 0$ 0K  00K0 @00 ,@ 4P`U(K d0 d ɲ 0-L0P  (Q M@0h M0 <00h6b$ -LMKd @*P 0 g40 @<0bP0(Kꀡ>$ -LqMP@P K 0`0@ ,@ PPpp0K+PDs@0 h1w=Ph0y/K0=P1 S02( K01SSt  a 0@P* p`,@T P Pa aU@ )|a0@V@P00S "h1 A=0'(K 0XpPp`405 6478<sb a\`0 0@0@` \ p , K,@TQS @T, 0 48<S ߱P Kp`  ѱP Kp`P K`~`|0H'p`vP K|p`nh1 0<05' p`dP K8y`^ )`|,oedA>̡>@>>>> 0-L \P@  S  ⃱L) 0!"#4 8<90q P02 Q " RP0#2  P  00-P0 L0 0) 0@ QH8LH@0@ \:*808 X:T*000 `:d*(0( x:*0>$$$L$4$$P$@$ -LqM`LK 0@prPP|,K)PP4Hş, h1<P? ,&Q p@ F`01  @`Z t P  8` .4` 0`T ğ,h1 ;,c&(K p `.` ` (,h.K,0><P1 S  02( K01SS  {Pp@  h1,;,"& Pp@Q  td ` \@,0 `01 h5@P@PL) 5406748 <0@4P(@,P1 L 8bH0 X _@m0a 0 0 0 /0C B0 0C B0 @ 嘀噀嚀囀圀址垀埀 L= BP0 0 407 001 2 3 5 6  !"#89:;<=>?@ʱ!1H≶0|!Xℶ _(80LYXԉD ಱ \_t !  嘀p) x_@p 8r_0008   Bկ\9 0L)\y)(0*+48 <0##Ġ#+)*(0"P@  0@,o>edA>̡>@>>>>>> -LM<`KN_Kp@K▯㓯\ᐯCB GH l  l`l\(K -LzM@`TpP@K z K肏K,g5PU @ @s5U@ -LMPh9i)j 4k8|WN@ P4K 㺮㷮 K!0 " #ČNȌ@(`̌h ;p 4K  ;r PP 㐮P -L$M P P04 8<S S D$K<$0 0@ QH8LHhARP  <$0P  PYU800\PU 0d0㓰}\P LHK$  $L)H D 98:p<= ;P>`?< L#?1SDOpPU! 3! (00  <0 \`PP0 HLp !]P]0@pPqx(%sqo>X>4>L>$ -LzM@`TpP@K zҭ K肏K,G4PU @ @5U@ -LM@Ph9ij`4k 8Xp @P<K㦭 㣭 㠭(K  ]P 0! "#ČȌ̌h  ;p7 -L^M2@S S! ,PK`KeK@30-K2S " RP@,PK`KeK P 2S,PK wP,P (0S`KeK`K hP$P 0SeKeK ZP -P@ -LM@ (p0`0@@@0#@ !@"@^!0 " #ČPȌ̌ h;0 hkIiIjIΌ; 㮬0  @@@ M-RLp0P`  K \@ \pO0 0 \90\IL))(0*+4 8<0###Ƞ+)*(02s- qP2P000) 22s# @$ ,$̠$@L9$`$H:? 9;=>@8P h> -LXMd 00K\0 @h#X@ (P\P`LI`` ! 0"#48] \<P`^Č8> p-L9`] \L^_  pd pL9!] @\^P" D_# H LBD#9p蔢> M-L0Rp a(KL)0_^0\]LǏ] \0^_4 8<4@Ps`   7,#@$,#Ƞ#\$d$x? 9:;P=`>p80<@(KoX> 0- @0L,(0 :0 9 0X*T:訢>8$%%@-L)@ 0!"#48 <9 -,0LS@P` 0(00  L |pױP0S ppPL8p ñ 0 (0 ′밢>>Ԣ> -L$M0K$"`zP=L)0K0P 48<@0 ,  .  8   0LY@ty40 !0 "# 00@1X R#Xz ty 1X R02I *(KLY 0! "#48Q8 c02A 0O0 K  P  80Y! 0"4#4 8<S 4 L)p (>(>8> 0-L MLI! 0Y"4#8 0 K00SPtɞ0X RO1X RK0K! 00P000S/ S 0S$0S,0S= UX%%%%%X%\0<' \Ɏ$ K0\0<&p 0危\0<\0< p 0(w$0K0ho nԑ>>[ -LMP@`Dt)q0X@T& T %0 %%@ %X %%%V V #Dt)0L)p 0P@V0X`p` 0d9+2 KiD0FSV ViV V(>[< M-L0R TiKL9',&&Ƞ&'D'X? 9:;=@>P8` 0- @0LD(@0  8 p:09X*(0( T:* 0 :l*`>D%%t %%%D% @@-BA 0 0#^0 -LM `, 0 V@Pp 0 0 `aP 00,(K  `P  - 0L!@P`,0S (0  L pd巯ppP L(p 褯 0 (0谢>h> -P@LpC`0S 0 D4 30D0?h CP D4 j -L4MD p`t< !X PR8 = R@4@ 9 1R  0 X0S. S, * L)S! 0"4# 8@ @ 0RR 1X0S S S@ R0, 0p4=(K, 040  S P@ Q  g <Lɗ 0! "4#8@ Q 0! "4#8@<TG*TT  @ˠ< P#Lɗ 08@0D P p @K< @P  p @< @P @08@0 D Py { -L M`0 ,0   9Lɖ 0! "4#8) @ TP 0 K  tɖX\ \ (K ˠ PPxPLɖ 0! "4#8<S@ -LxML 0! "4#8pWt P`(KV 1 X@P Q 0P@`U 1 X@P Q@p 98 =<0:$>;p?P4 (8N  0]@^`\\ X0 Č_@ȌlP05 eLQXpEP \ E0LRQr5BPPTp tᄋ4UL H0 jt p | x Pp `t08P 4` +@0 , <0 D@ 048<`p ` p Y8 K `pP ` p O<`  K tpK@@@Prʠ K @@ Pd 00 0 0 0 0P\ K |KLpKHL  2. @   0@ 0@AT*TX :P+A 00#qz 0   LɚX 048<@KQ \8 #@$,##$T$h P`0@L0 p$89`妀( | =@:P<0dp  >;4` ? 8 ́,Pl @h vdKlpKpWP`P`B2MP`l K cP`DU 0T`K@0@|pSZ PIDP 9SW0|K@| x 00K8K T@8 4 P LxPP`ULL) 0!"4# 8<P`Utɚ0X R;  0X R3 0@P1QiL)p 庬WPxT9S VPR L)Xp (Ko衬0 8 yT\ l9>>> -LM00K0 @(&@ OPLP`L9`]!\ Pp"@^ $#_` p( Lp Z 0`KP  0@Q0@5 0H@Pt@ pP 夀pP0H t 0c9C  0 Q 8@Qᄛ4T P0 0K0 @ PH0 D@ T0KtK0S@80 4@ @_\@ XP @ < 凔ᦛᆄ8Lt K PNY\Y@  L9HK`p ` p KQ l h h0X`( ̂S c_ t K @ K | x Kt K x@ R0Sd `0 ʮ 0|`K@`p|` xp pP `0K Fp`7NV>F DKT. P T`p0##8 K 0`t)|01C X R ➫pWh (K\pQ\Kl h P T0`##02, l`KLp| 0 pP\`KlK`Vp\` Xp `D LL B0l@K0@ PLP| d0 PP A  0l@K00LP| P@P P  0 0 0|PRULL)p %f? PR 0S 00@0 0 0T @T0`*X :嘠> eꔣ>ģ>> 0-L ML@! 0Y"4#8 0 K00SPtɔ0X RM1X RI0K! 00P00 R- @R 0S$0SR4U @ %$ % %l % %@ %\0<& p 0k\0<' ɄK0\0< \0<p 0 LJ>>H> -LMP@`>t9q0X@T% T 8!%!%H!%x!%H!%H!%x!%V V >t)0L)p 0PPVX`p0 0d9+ Ki=V>[< -L9@] \L^_  DpL蔢> M-L0Rp` 8 KL)0_^0\]LɐpG] \0^_48<4@s ǏP`7"#@$#$#\$d$x?9 :;P=`>p80<@ KiH> 0- @0Ldݤ`0 p: 0 B9)D0D X:T*<0< t:|*404 :*,0, :l*l>%,"%0"% %(%%` % % % @-BA 0 0#^0E-Bl pA `P (  0 8 , 40<`. VPЋm-\0\   0"  P1 0<0ЈmЄm 1 0cЄmЈm-1 0 ЄmЈm -p`@QLU   !RP 8p8 10!  \@ЋmЈmЄm -LM `, 0 V@Pp+  00 `@P&  0  S  QP"   00 ,(K P  )`P    - 0L @P`,0S (0  L pdӨppP L(p  0 (0谢>h> -`@LP<p0S  U R P D4 P D4 0 )Q000 D4 60D0Bi#< - 0L0 0T0 *TX : 4@T @T -LM00K0 @D.@ *PbP`L9P]!\ "@ $#`( ^_` T Z 0`KP 6 0@R0@@ 0H@P@ P ĀP0H ㄐ 0c9C  0 Q 8@Q㣔4ˉX0 0K0 @P0 L@ 0K0 @ \ P儀KH0 D@ \0K0S@@0 <@ @_8 4 d@ `P 凔ˉd ` `>@ VB K QFQP봐`L9pPKK   圀K KQ l h h(` ̂Y ʁ K H K | x 8KX 80Kt0 p@ pPx Uʳ 0|K@ | x x Yʣ 0|K@| x P 0K EP6NU>E ;0  ? X \@0##@ K D0SDڴ`@t   1X R02 X t R |PU  @D  RN P Q ! `Mp)90 |K0Tl ơD^&`@P|\ K ` X l@K00TPˠ PPD@_\ dKl0KQ d `   PK`P`P ` T``T` H0SP  lP lpP} |L8@~P uTl 0Tl ! K PPlPK```K|` @pPWt K lPK`` @prPG` K ` @`cP8lKT | K  PP%l0K K @pt@  @=PlPK`` K `` @*PY \f  f(KY@ t Rp0S@ |PUx`V@x\5 X%Y#0dQzdKl h uX \P0##@@P Pt@ pP zH^ P`@P ` lK| K T H@TP`@P ` wP )  0 0 0|0X`Wt|^OF|K|p@0qpl TwlPK` K `T`ˠ  @@@`pPiD\`0@X ( tP* |\- ; 0l0KT@S   @F K  oPD`D0O\ʗH^X Y tPpPU |\x^@|K0@傥Ÿ|P 0@$p  l T l@K0 K ```T`0 [ P`p'P Pl@K00 K P t`PPD`VL`0@X- t^/ |Q2 PU5 lK+T0 !0000 K P`DP0OUH\XY t^pP |Qx R PU\HPH\H^*69븀X 0 0@ 00T 0崐T*X :帠x8 y(Ϥrt>>>>Јm>>> -L MLɐP! 0i"4#8L8 K00STt 0X RM1X RI0K! 00T08 R- 0DR࠳ 0S,pWT4V 9%8%8%09%L9%9%^0>& p 0:^0>' K^0> ^0>p 0H@QT `t9`X GT >> >4>@> -LMP@`z8t9q0X@T% T @:%:%P:%:%P:%P:%:%V V 7t)0L)p 0PPۤVX`p0 0d9+} Ki7V>[< -L9@] \L^_  pH L) 0!"#4 8<0S039蔢> M-L0Rp`  KL)0_^0\]LɐpG] \0^_48<4@s ǏP`7"#@$#$#\$d$x?9 :;P=`>p80<@ KiT> -L@00 T匞P0  H p:09X*808 T:t*000 :*(0( :l*t>7%l;%p;%#%0)%'%$'%9% -LM  0Ms&@% -LM) 0Ms&@% -eL`Pp㇜< (00p04S80,0d0804p f00 `, 0@07< wᙄ&((0"4#220&$ 04 @ 0iOA|>>WEV@% -P L d&@ ህpP` 1TJ x1T) *`PX1T* P1Te/)`010S ` 0 b`P 冋`P0T% Q0 00" 0`0 eK@ 0be/ AK 0T %40$ ( q`,irdAhdsd edAk~gd@% -@L!88#!P1 Op" @0020p(P00`t4Q!40,@aT@!0   D壛400d806@ 5 o, 4+0<0, 86@ o5D ᄛ,iAA 8 8-#TLL%pẄ`P 0@᳈ ႄ᫈,i 8 8-#L@(ᜄPPp 0`ᖈpP h0S  01p၈0 pP,i -L@03dB%0L00≉ - ؀L`p0p%KP$  J@P P00 `(pPp 0{P,p0X@P00 @~ iki,iii>$m>> -L]ԥ> -LWԥ> -LQ>800S SP 0S@i -0L -L@\p``h\# 10 0 P 0W hF$>H> 0-PL@~0 00h3 -- LM K00, 0 K -- LM K00, 0 K -- LM K00, 0 K 0-@0L@PT@T P0@i 0-d0LP\T 0@ST0 00 @tIT0@i 0-PL@ IP 0 @ P00S0 0 0@i p-1LMQ@P, 0Q( !0Q$ 0Q! @0Q&0CQ*0Q(`K 0t@PP@Kpd0Q \0QP  @,0Q @'B&B"B!B$BB B(B%B -T0LPD00S 4 40àLDioXi -X0LPp@0P 40à$ L  DioXi -h0LPp 40#D"B ,0S 0P DiXio -$0L0S o 0-LPL0@S P0 T0  0o 0-`0L @R PHD0P $40à0 L 0oЏmXi -tLpP` Pu P0S %40CBD 0$ oЏmXi -p2LLMPQ@(P p $K  pG`0+P p G+0坁P0+P @, I( KpP ( R 00CS 0 I(+0h0 0c @0 (0l p`  pK'pP(0\ $@000C0S, (0 (0 @ (0P$(0 @ P(0 ,@0P(4@8P(0<@@P(D@HP(0L@PP$(  00CS 0 H %G{ 1%(00(!"U (n+wd \4i -82LM,2\@haJ LPF   :GPP @ !0 qP?@ F(K l 0h BKp 0 P h`  P CK(!0"@P!0S @ 08!P0l0  h0CKp 0 P h` @P@ F 0K T'S$ FpP @ 0@H0 D@ 00K@ < , L P0 0p 8 4` (1PK "@P0p0 @ Жm,oT>P>G-@0 084 0<0   0 0 84 0M<0   R0 P ` p@  l0 P ` p08 40< 00 (0$ ,$  084 0<(00 ( 0$0 ,, 08 40<0 (0$ , 0 8 40<0  (0$ , Ѝ Y<Y< 4 0 0-8 40<80 (0 $ ,< G-SkM0@   0 0@0@P@P`P`p`p堀p 堠Ԁ$ؠ(,@0 408 <0@0P?UU[ [`00p R0@10XHA0崀0㸠P @h1X100 (H1@,00 0#00 c80`1*dH`n`1lȠppp0P,& #'a0 ` P0eZ@1P1 (@#@0b*,0c̠0 c<00*0$10n010dLp$1'P#1  #P1\0T1@1,0D100(0T1`#D1&@#0nc80`$1dH0(1101(1 &#1` P#T1eZ0X1D1 0H1b*0 *lȠ0(0pX1'a#H1 @# *0l̠c<p`q0(q1andL`p1& #1P'#h1,0Sh1 \U0000 d`X张0 HȠ 0\LĀ8! P `p蠝0@?@ Q$Pa(` q,p048<p@@pGp?PP@4P`0`kߍP h 000QhP@4P`0`G-QM= 0`p0Fjj hq,f>0-: 3:*fA*Q 0, ::,!,,,\V0 !0!"Y!0` 0ЍmLm؈i0Y<1s s0<0 0<0Xihi@-;@ 0$@@-:@ 0$@Pკ$0 -Lth+s[<iԏm -LM 102Ԁp(0 0@P(0,@!  @`2  ,K0 0 `,0 ( @0 O@0 P@PAQ 00$KbrLimHmmȑm -0#L0M0@`ß 40, :BU{ 00 0""00S X 2@8P 8< 0(K p0@S 0<0 l2<080 T2 L"10 P L 4,H0 : 2  0@ D @ H @ X T ]`P`P0K0@P0 L@ 1< 8@R H0XK@D PK!8PAD K @QDa $0!00Sq 0 0c b"GS0c aR bW00S0!((R08 C4C2 C10Xt\&0 0L q[D0@0P 04 0`4Kj9mȕmLiHmmȑm -`LMKOKp*th1\PK*.51( Z( ϑ@̑Ki؈i p-@PL` ;U (V1(#Q 0 0#0P0,PHDD( ,w00+ p 0 p؄iiiDijHi p-L4ML`KP$@Kmj 00#0 QU /(p0@P P u/(iKp($0@P  xim -LP`p  WAPP  P@1J# `\pP  00 RAPPpX  *@wt -L 00 0  T spx0t0 R h0 P LVo@@ hOo !Tȕm|1< A4ma0ia%ԏmma% -xQL@p.0SI \!0Z0j005@*ZD `.44 ;0, ( ㄒ?V0 0pS PV@1@!c "` o0`d0dS0 V0  @0X  o.,<44,z 10ixiHiDi؄iii؈im p-LM@` Q@KpF_K@@PT@ -LhM@pTK  R@ T`P10KS "  S@1J#U0 H R[@P U'*?G ?[@P0SU@ K@lsD@KPK(0,0Y$K(P -L MKJe+(0   KHi؈i -PQL MK.e 0 KHi p-LM0A0-0S: !0S0C01 a0S ;0,( {?0@ aK!P` m0@L X -x,<44,~ 10ixiHiDi؄iii؈im P0-LP `@T00C-0 dpR 00P`U%  \00 N @ l3)^Q<0PU TX 0> n1 ^2p* K<0PlD"[0R  =X X R h@X0O|0 x@ 4`S< ph P26B 0bC  R7AQT7Rx 0PL0K |K0Ph `@800 j D0l0 |K48d R 0@@PSPT00S40,00@8V` w0<S t0X@l(4 K0T0@0TV ^< tD06040H0D 0  H0t0PD@0 :@^^ `P`p4P8`2@8P 8< d UL 0.S"$@DP@ L T pX 9Lṍ PG=8jHt TN8jt0< tVD060<t X@(0T04 K1@P>V UF40H0`1@0P 04 O0tt H y\@ ;pl0PL! !Pl0*0 t04PXP 4h 0K 0Pw T0Sl*7t< PD0\@ 60 < t@PD060pYX 4\@ pQ<Pm R0S  0G- M0 v~ L1 pW0@  Ѝ1 PN1a@E1 0LOBd g@  e g  0P n0R @ABA21C 0#!B0 031CdQ ;0S9@0U5:0S\ \ 0S 0S 0S0P R @ R 0@4 R(K0S  R P`0OTS/0 0OR 0 C, l5.)0S#Q 00KP0 D00@PQ -L4M  $0 0<0 @K;   1KB Ki -L4M0@ $ @K <0 3 Ki 0-L M(0@ P b$p!0S(0 K0S   00 $ (0!Z(0 T!? J p-0L@`P5 P p0p0d0p0|000pp0P d0P |000pP p0p0d0 |pPd P 0-@LP} 0h(h> p-0L4M"`@0Ph 㝉P 01`0D 㔉P <LK( 0P H0 t  Kpꀦ>i 0-L8M @( ,0 xP!0K H 0@ $ K0[S< L@KLK0L@KH0 0H0 (i8i p-0LS@P p R R`d BP0 <0p`87P0 S -P ꔦ>>>0 <#<0@0  p-0L@ S H%d%l%Ћ%%Ћ%Ћ%Ћ%Ћ%Ћ%Ћ%Ћ%Ћ%Ћ%Ћ%Ћ%Ћ%Ћ%Ћ%Ћ%Ћ%Ћ%Ћ%Ћ%Ћ%Ћ%Ћ%Ћ%Ћ%Ћ%Ћ%Ћ%% 徏"P8#`(0  ("( Q&*0(00 $0 e0b$000p` PB8#`Pp`P\`P0PP`8#$ Ɉ$0V0$0000p謦>T!?Ȯmخm -LM0 0P0,0 , (0U@$p0`>*V2S/00@0 S\긎%l%%؎%%؎%؎%؎%@%؎%؎%؎%؎%؎%؎%؎%%؎%؎%؎%؎%؎%؎%؎%؎%؎%؎%؎%؎%؎%؎%؎%%h@`T  s 0P,0pS(0$p@0`0 0S000 (K`@T (000 $00a$0 `ᐐ@`p@`d0\@`0pd `㰐 @` pd@T!?̦>Ȯmخm0@- 0P840 D3iix4i>>T><> 0-RLM@P 08萧> p-``P ,  0 QOL 0@,0   $( Z BZ  ep p -LM`BP`p0S00 `| -L  p`P`B 0 TP` ;0 ` _9 4$0`R:$0 -L8MT`$, PD p(KpPIPڠ5 Up @(!0@@tp :W@D 0pPh0 l0S00  H < L @ 8 0,K/;pP,,0D@ [P#0S S S ,P S0,0 dY,P J0,0 < R 0 DD Q0DT0 X  p,P5HQ 0  0W Yw 9 {30`2p 93@<P 0P84<  0< 4 P 0P" 4 44 08 40<040  ( 0$ , X00 T00@L`D    $0 X:($0D` Ph q 0000# Q00000@SQ 8 P@" 㿃08 40<0  ( 0$ ,@0 0H\ T0`LQ=, <@ L ,p >H0S5h0,8@ H ,p 4X@@ |@ P @ $ t@0P0  @0 l8@0P@ 0 K0@0p P 0p  *4 0 0C,K0/Pp,0 DPh0h0  ãh h ,9h 0,0 kЖm>>>>c -LM`$@p(KK p pP$0 `RP K Z 0㰮pP@0,0 0C(p 0000pP@0S  pP  KpT h 0 #40Sp37P $0; 0SP p <0(! P / ^p@ZB_ÂPZ zZ㻂YO Z rZ㳂 Z k p 㮂 ,~y 0PP B|li p- 1LtM1ha8PP0@1PP BKp KPP 0K$P PP 0   B  10h@P0 00, .li,o,miЖmħ>>>|m -LM@ pP@@`,0@<,0,   ;tx 40,  +P D@P 0S S 0P@`UVP,0 ;,00 $B Q0BP( 8  0^07<@`0@p P:0p0`007\0 (Piᾋp 0 @, i, P갧>WEV T0s 0s0s,0s 00s80s<0s0s 0s P0"$0sE00CS8%`%`%h%`%`%8%8%`%`%`%`%`%`%`%`%`%`%`%`%L% 00 H000d 0S  0%000ʚ;0d@/ - L> -LMPp0d0CS<l0tS q T ` 0@0  Kp0S@t0@ `Pt0s4Dt8`@od`,0<`;,0@bW{>0d@ D/0d @>/ -L@K p -L@@ e -L MHd@P0S p K0 C1 0(K pP (( D 00S@ 0S0 S%*}0" KP 0S0  R*(}p(y0S0 S*[ Kp<"[00b0"[000"[00b0m -L@ h! `p0PS` :` p`#JPdchsl -L 00 , 0^nP`U TE*Ap1 @f0P  00,08 0 (KT-*. A.0P@ @0 0Y 4 00< 0S0c>0a00 , Kw@s@o@d>00n 0, 00 6b@r%%$% -L M(p`@P K00` p P 0SK -LM@,0  0K+2` 僢 0PP'22 Vp!@!P#*@ @T!*0S P 0P: *p 0PP  W* S*(Kp PJ* 0R P0 S, zPP -L8M 0 , 3SPp_P10C8S{1 R` (K  0*T 2 2@0 @ T0W`Pc T@ *^P` D` 1S H  85 41, 0 S!   5@@SP 4\/ @,KD 0  `P  \00SR2S(@T`L < 4@ 8@ R JRk 2 S@ `4@ 8@ R`DQ yT@ )V`01 1"RT@P` D` 0 S*wD   D0`P"R @0DS\` S SPQP@ RJ 03R<0S: 0R`*21C   0 @<Hh <  @@@H0SC P V P 0@ c0  4K8K00KP@0 H 0 80 1s_ Q40000b0a1!1i L fP0SY`m PH !Z 1sF Q40000b0a 1! 1LH@ 0  L 1s0 11s2 D0@10DH\0$1%  -)L H 00" 000, 8D!@ T( `40!140! 1 1S !10>0>0 1!H0 4K 8K00K0 H q `\i4>Ximۣet% -LsMD  LP 1 P 倀 KpP@`V p@ (,00(K(!0kpP@(0$ (!0NpP @0(!5h@K 40pPP5[S p0  [ )3[@RL 0PpPc[Vq q ^  0S0!(K. ! 0>00b>01 ! z 0Ll 0 DQ `a S(K1 0   0 !.  . a0 S1Q>2=12>30300 5V* 0! 1 1 0KP PDȡ `! 00\ . 0C0b!00`D  ! `\ʼ#[Rc`   1Q5 1 `0R1 S000 40 Q\T  0 c, 0K4K ,0KP\2:00\,%* , b 00b$1#[0,0 ! Q!0Q+*"!B00  000 #[a 0,G p , a ! , ۣet% -LHM8QD1U@$0 p @aV $K 0}P3P  'V w K0d0  0\0 ` 0T0 X  0P L0 *0D0 H  0@ 4 8 <0 0<dK7 ( , 00  & v>m -L@P 81S<@ -L M (18 @ `@ 0SD JyP 0PSU *0 S   0 S  R: (K00@ T T@ T T TpH@ Dp  0T0S  Tp p T p@T TT D H 08#8;00 0 40  8 (! 0Q  ,',K.,(Z0<0 w(1, 0(1,0, $,0 , (00(0, 00CS 0  c00P (1 0(1? 0& @< ? k& 14:0@ 8 (10(13 0(!08u<0S P @? %P<? % 0(! 0@  T4 8 j 4 8 ?0(1,/'0R,@'+ߡP@ 0 00 S S0 S S S H H00H0 0SHD 0, 6 0(! up<>\4i@>m -LP P   %P`pPU X U@1J# `Pp *C% p-LM R 0.>0 0` Ȍ. qΌ@P 00 `Kp -LM pR`$K0.>0 0`. 0 @P`0 `P@(  0P``0 S`P  . . 0`` -LM @R`@" 0:#:S%0:#:S z'zW aP @  @ Ȍ PqΌ00p g@P K0@ 0-LQ@ P21C 0 P G QP P \  ?$00P0 -0LS`@ p2PC@0 0 000 p@P00R00S p-@PL? 0 %2AC `t 0P  ?>$`p p-T1!!1@@Q(!L00>0>0 1 R70P/*"`!B ` 10a 0`0PP PPP0P:"!B00` 1 0 10a0P PPpR00C>!00 cc!()i$%0hH,o0h,o -0LHM,0 0@ L0 T0$ ( TK BP T0 P P $){ K%{@lL>>\> -L8MB 0R<0 0 !G0S 0`0  a 0, (K01 :0 0*@P0 `>PUh1PU,Ku0@c 00 卞0`Cp0K 8@ 0p 儞X/@F 8K}80 PKD KP0 L@ Hp P& P zPU 0- ,04 Kj 4K1@K@``ds0 30K2K0@ U<` `F<K M(K,z(a{$_{뼘m> iب>̖m>>> -6娖LMh|0QW'z\믒ϣ,ūJ5'] 봍(TP( Q |<6 R0 0$6 00  !!D 0(D  !!` R0@a 0 ,0E00S 00400 4 0S000 0 `0  0  !!$ 0,$  !!0)05 D01u L?Q:4 00;38( 0A R4@4@@ P  kp@P0@0`p @0FP`pP`pX@\Ph@lPp`tp(T@`d*1@@@4 @!

dqF#0S @P0Sl $ @JN:@ @lO8V@ß,K 0 @@6P,0 c3 C  0S 0 "nF0SE<Z20S P 1zŸR$09$0 0 @Pk dr 0!:0 @ 80 80 80 @J1`V P>U |@ K 0 0@PU`V 1 P>!1 P5 tt1 P, ``1 P# LL1 P 881y P,;$!00D!0HEyyyyyyyy,oDmY<?mHmLm@mmīmԖmi>&mԛm$A1o0moo AX%m`mm>*i>Ԅi$>|mmm1P>m%l>%>%>1>1ȩ>$*im>8>>ԩ>>>>t>\>0T00T   PT0S0 0ST0T00P0@-@PT! x0tS T R x0S\ RT0T 0T0t0St0ST@0T0T@0 0-L@PT0PS00 0U 0S0e00 -0LS@ ^ x x0Rڭ00C0 0T0 T0 0t t0S - LR@ T0S0@ R0ST0T0 00S0S  -L P 0 0  -L  P00 0-dL\0PU @0$0$CPU 00C0h(i(ihm p-P@L`0$ 0CR0 S 0S  0R:z0\0p Cs0\0pC 0-PL@y,0@_0 p-`@LPh,0phM 0-PL@Y,0 @?0 - L M, F(@,0 T4 Qb0epP , ,6(0 S@0P 4`  "100 0c4 0 @X 0eP00e0,0p(,40 0b0(KtZ< p-LM 00t t0@T P 0 S$ `D0 D0S @Tx(ihm(i> -LM`@p $0S $PP0 D$0S\@000,0h  > p-LM0@SxPⲂ  0R: `  40D 0 BQ *xh (> p-L` ,0 ;< ,0 @K@ PPp 0-LM@,0P00xl 0S h0XX eD0SD R00 0S008h< hm(i0>(i -QLME hp0OO$ Bb!R^V )ڀP@p 21C Pp, (P! P 0S 0xx D0Sd X00  RPpPpU vvmtZ(iT>8> p-ZL" 000X00SZ0PZ 0O Y,@`uPPppYp `0ST0 P0Bc&0@0@?Pp0YAA@Bc p-L M t0Ϡ`$P ` Al31C0R D0 R 0P@`$ $P `   $KKpMb?B p-\0LM`PP0PHH0@^ ,0K(P $@ ,` x:KpApmA Alm -LbLP0 LS@hQ RP L N 2 00S. U 0D  EL00CSL01SGUx00x040 0@408@0UL0 D0!0D00S000iPpD0 7L0,0CSL0p00p0D!R/$0 0@$0(@0} @!0H'vL00CSL0ʴU T0S t00t0,00 @L,00@H v0 0@0 @<0 0@<0@@,oLilmmpm 0-D0L # 0  !D D !X00CS0DP0S  000 @ 0hW0|mpmLiPi p-L M@$KB $0PQ@c=YB@DB ]BT00U00S Kp0Tڀ0`&Td0@A P8 41Cc0A0cAA -L x0P l l0@@@ \0\QT00S<<0 R@hB$u''tmLiPipmlmA Aml> -qLhQU $0"  1 R/ H00CSH01-DKP30`0SD G?0$1S p1CFP0  !$ $ !(11 RH00CSH0PCKP 0@P ` 0S i 000 0@@0A?0 1S \0EP0  !$ $ !0,opmA{mtm -D0L 0  !D D !`00S0 H0 R 404 @,0( h+|mpmmlmLiPi-A" J1S 1 0<S RZ020CQ^1S100S^0Q:0P(0 p-0 !L$ Q$b1@sP 0<!0 ! 0U 00C0p0 #  1 0 10 0C0p8 2028 (("800 0-0LS@P P R000 H! 00C0k0(mXm p-LM0`P@P P \-P Kp 00 0 0$( $ 1K0 , $01KP K(00(00 00K P 00CS 0 00KP01K(00 (0 -LM`Pp Q B  Q D00BS 0 K0S@$@P K40K,@ (P 4@ 0P K ` -pL2`0C8#8S2F P@U R 00 0 PU@Z@@0S#0202S' ' P P8P  @P  <hj' 00202S舜m - Ldh`@,H00000C400 20  2$舜m> -LM8,0,0 HhPH 1kPp Pm,0 2S 0SOH0 `Pp@0 0 0  `k  k  k k,  0@S`S  0 `S@ R 0s 08C8SK 0`S@40s 040< 8 @ `cVڃ ?`cVV0' 02@r 0W ' 0@' 0q A0 qAꈜm> -LM` 1R/2P 0 p!, 0' @A j dk@ |j dk0ST02, 0R0(K000 02Q0p, ' 0,hP0' a@p@B@BA  Gj,0! dk@@B@@A Q6j dk00202S' u' qp' j0 -`LpkPP ` 0 S  S0S<0 ``0BS 0-`$@ M  ` -LlMPp4@P ` 0匀K0 0  0`0CS 0 V  KhVP0` l ` -L `qP@1 00qW 00 000   Q$  0R0W0S 0WP( 40U  1 2 1 1s 0U0 P00 1 21 0-@ MLLPHT 0 @j00, @j0@K0褪>Xm>m,m -P ph` LD0@03P9 00R2 0s% 0` 0 0  00 0101 1s 0U0 P001 21 + R 80R  ,o -LM0 0(00p0$\ 1! Y 01 0!,0 X0 R4 8 \C:0BF  c03P? i2@`v`  V1@K0 SSBC  c03P< i2@pI00(!0$ P1! Y 01 0!,0 X0 R4 U Y(K@020Tp 10 pR@ @Tp 10 pR@ ڷ2,^  1 @2 1 1s1 21 0$ ^ 40R00$8 0 0$A -L -LM@ ^ 0(  @c -LM  0Y -LM@p$`KU' uPPxx1 Q+@$$0^$  1s 01 !0  ! 0^ 00C0lP0  #1 01h 00 b0(0 R 0S00 0$ 0( 00W00X$00 00 0 0S0(m$AH>Xm,m -@pLaPV3 0 0 0!$0Q$1s 00!0 ! 0U 04 0CU0h@0 #1 01 -PL,`p@ 0T  0@S* -PL,p`v Q@@Q 0   @Qhw p-P@L`P P ,@QtPbp 00 0 -8 L018 s0$<0  (i80$ R00 0S008$0 ? S $0  R,08@ R0@0 0S00$ 00@-0@ 0$@10S 0<0Z<P,0 0 ,0!P 0-@L P R 0 0 00  0 ,  , 00C00h9 0-<0P@QL 08 1 Q000S00,0<0 R 8 00CS 0 D0hc0< #4#0@1 8Sm p-@LT`P <0 @Tp0!8 00CS 0b0m p-P$`Ll d0*O  D0H@T p -< L0`SP<\5 0@ #4#0 1000`,04@0TLS*0 \4 8!pHc4 `!d8P  4@8p08 1000`,0@ <0-<@ - 0L@  h$0 05 0 0 0hw 0-@L P00  0@,00,0   P0h 0-@LTP@T <0 P ,00,0@T0 0-0L@@P 0h#,00,0 -LM, 4$pQ8 1@0T `0PS`, U@4Q<Q q @ 1@0T `0PS`" U@<0S,0@$@ 00 0[<08 00CS 0 <aP<0aP 8 m -L$P @pWA@ `V v 00 0@ -QL|M`   h S3 @5 ?L3c 4 0 ,0 ST00 O㜠  0PI @pTOQM 0F0 00,%5 e0S74 00 ,0S @K)9@pK40KW T R40KLK80D LK cPRL H D H0Sl$43C" cb 4@K:P  0(K0吀K0 P Z0K0K $P  , 00C0Z@ @ R 0 0 00  0X l , 1= 1H 0> ,0 $ 0,000C0YJP  ~00Qp0 ZP唐 R00 000 Y40j<0 P,00,0  B 00 0 @,00,0  B <0 ` =p0Z. 8  <"!B$┋0 j[00SHڈ!43C" cb @KF84pK@0K,8 p@!Q4p 0 , 0p=)A@ -B4p 0 , 0@40 0@ , S X8 ,0R  L 0R 0@=9 =L H D0 4 d0R~ 00 g[s a 0#SP ]!@ ZMbĪ>A?BQ -LM0`A8@|ZszJ $3Zu 0S} pP - 00 040PP#(*80QU#PU 0S!0S 0,0 , <0  ,W 00CS 09 p0 U^ 000 4 0(0 c<0@ P'  ,0 Q,00,0  ,0 E,0@ R0,0-    ,00,0 <PpP @ .4.0QUPU 0^0S1ASpc]P  8p@<0@00 04 0@  PP p   o )im -LM0p2`S" S PK 0@(P(0 $@ ʌ14K 4 K,p P 3KP, h0 08, 1.0@ 0$@@ R 0S000@0 -L0MH L PD  0S < <(K 00 0P 8@K ^P< D 00CS 0DH@D Q$L0$@0 P Q"!BP, >P< ,\) p2BAD:$@@2H  P Po 0@S@ 7 0P4`92 喉 0 0 B 0 ,p\2 l1C0R 0@\L  D 00CS 0 H0  ,K< v,0L 0z< DH -LM`p,@$K( KrPU  K$0 $0 $0t  l.\@P$0$`(004 R4P$ `(00(0$ 00CS 0$g(i0m -@@L=  00C0)i p-0L M `Q %0040O$KBCd31C0A#!B !_$@ P  01P 01  @(e<=@@Kp)i)iMb 6& p-L M,0@ 0P ` $ ,0 14\0O$KBCd31C0A#!B !_$@ P  @u=Kp7Mb p-LP-`P( D@%0h V  (0P pP18` 08#8 1 40!O 0$@*00!@00@Ppp p ,o 0-@ MLDP 08 @^( $D0 @^K0̪>0mت>m -LM40@`8 Vc>0p `0`0`,K@0 @P0` 帼P 4,]0, +(Gi -LMp4 8 @P 8K` P*840 @10@0!0P,0 P@8 ,K ,'P8 0,0 B0R,0 P8  чP'00K@ (K4K  ÇP`@Z`J,K ,P0 ,0@T0P,0 ` J ᫇P'00K  㡇P -L$M"0(0, 0 p`P Xr X `l8i\ (K00 (!W`P(0$0! 0@;00@(!05`P1 I (!00`P0  P(@ 00P,K  `P@P;, 0h0b 0 R@0P`0P41<  V V (1#20@0 S00S 0S V ` P ` 0S* @N00(! 8d[`~V@$1 !S@#@3R0 0!( $0S ThDmTi<i -L Md" (1`2 0 X2 JpP (K0  !X DD !0MI?C? 0 P lp hp p d ̟H" 0K L @2 <" #>KB/K %K(q Dr q q 8r 42 L!  pPE<, (1\ Tr @PPU \"P , Ru 0 嶇T2pP0T2 00@,K`d 0` pP00KP K(1PQ S[P  Q `" 0P\ E[\+;DL? @ 0  !X DD ! gm$Q0STr \B \BTr  0S 00S  ? 0TST $Q?  (10(1 0,(1 , TPp PU  , R 0 4P00@`d,K 0` }P00KP p}?W{pypw9 R[! 0T"00 00100\00`00!0S00 pZ 01 > !㜶XH!<`. | H1D!0>0>00a#6l0@! . @10>00a#6 p0t 01%K>0#6x08104! PX"08Xe A4! HP= <(Q$aZP  _ \XZ`" 0P\'7RL? N  0  !X DD !z?P\ p  P]T@ H 00 L@Kb%K \2$P X"4 0PPXN @ {" $Q\T0S0# X00 ZX2V/6X004@PP1XT40@0!!X0D  D !!XD @ 0!!X0D @ D  !X" 0 !D 0 D  !X2 -` R 0  !X D D !1 0  !X DD !` 0R 0R `t` (0 0 X"`2P 0`00:X"D0 s0@ 0@\d$0@0@0@H4oD\hY`"P 0X@,0S %KP d2%K (X@PX"D0  f L ?B X01S/ L R,  S (1 +  1S+0D 0R %K 1X010  !X DD ! HpM X2@[8X21C0 \  q 0R/ 0R+0R(0!!X0D D !!( P' 0  !X D0D !`1`  (001 0`0,A 040 P4  X,J < K4K X@@PX/8KP%`" 0!8UP'X8 00040@4 00408 40$ 4(00(04  00CS 04 <4 5, <4 +8Ȗmip  0S hP W   @ > p-L\M0@ S`  K\0lK`+PP0SQ K P 0S Q lKP PKpP 0-@L84P,0S00 0040@4P0h*,)i8)i 0-LMP@T  0+@T 0 R404040 q$0  @`D0 bO0  !D D !    )8)i,)il> -0Lp@P , !$ $, !`0S T  T   R0000 0 $ s hX $0 s!} 000!L0S0 0R)0404040  R 0 0 0 $ : R 0 0 0 D  P0S0 0 0` ,@T% $h)W@ $pD0? S=C  !D D !H R   W@$0 3h = \10CS\1N P#000f<^\1S@02#1*\1SD0 | Vy[5, @0S  00 p 0  !D D !b l ED0 ^$0 \10CS\1(0S.,0Su 0!!D 0 D !!("(> D@ 0!!D 0@ D  ! 0 !D 0 D  ! ( @,r6  VSh0Sh BUh0 @( R 0Tp 00,h|0S  I uPp pP '$ E]Pmm1o>>m> -L  -LM@Q K00  P u   l@-88 @2 1 0!0 c@TiQПm -L@ R 0 SLPwPP0Q  ,1S 0S Q 0, RПmPm -`0L RP 0@@<S@P L@P`mXi-00  0 0\1(000,[3T' 0h!$T,o -0LD @ zhG -L`@tpVRP @MV4 JJT(! `0004P4-D,10D Q0 D' s 8' 0' D0< ' D0D<DD@ɌD Ȍ8DD0l R0 0 Ps 830ñD0<  ̦mHm -L$M@ D0 ` #>!S  = S (!<8ğ, R0 0 t ,p  P100S!00400 0Q,0 010Y400S0 00, 0R0$0(0D0$  , @( ,@ 0  , Q\  K8^ 0dd0d 0 d ,00d ,00D R ,0(K=9 =0 D }PY | 0Q  *vY@ ,+"<0S000000000^P<Q  D0 a R ,0X"Y  0  ,"0&D000  0PH R L0L  !$ $ !    p0x 000) * P0 +  4!000K  @  p0x 000 i 0@)00|0&``'V/000  !D D !I A@)ihiD)i(>A<)i\i0>pm&h4dmLmDm@m1o@B8> -LM  0  K -LM@`0,(  0@ @K[& p-LMP0L S`@Kp0 $K0 $0 0 |@P($  0 @P`@[& p-X`X0@ TL  04PSP0 X@TpP)im p-d0L@`TP p  P $ `P@0pfY넡mP)i@> @P- p-@MLK`P 0D/@ @P kSV00KpDm -L 000@0@0h` -LP  P P  0-PL @R0h  0\ aR0\X0SLL 0HS900S 0C1S0!S0%5\)id)imi`)i  P-L>00 -QL@M'0S S -$K0`@KA< ,Q zR<  0@T   0P P pp0 0ZR`P@05f@ xWRPU`V0 0 Cmh)im> -LM`x@0, K !6P$ K @ 0$@|0 @定```0pCADh0@P@$U<`K(Gi\)itimX)imm m -PPL3 0  bB&!0`xG01 SG#0!B  %0#,i@F Tڲ (0&Iim mmX)i -1L$MP`(!31Cp_ Y>00, Ã0ʃQ #0@S00'0,0T0a(K Q W!>0 C6 00 6P@40  04 0P @@@團PP" ,s  Z0 0cC61᱀00@4 0jj00S00#00!P0wWm>,GiX)im m̫> QP3-L@P`p:P !U hf  QW>000 0 h10S 0S,o 0- PL@Q0h0 Q0B0R;"00 h R 00CS0 ,o -0L,!,M10 `h  P@p0 T  0S (K"@ D 0@0 8pK 0! < 0T@ D00"<0S  f"#."P ,oZ< -H0L h  R@0 00P00,o0 Sh1 000,o  0R00  ]0R  T0R0B040S840 -LMbp<0 P @2Pp8 hp (K)0  @0L2`00@p,0P Q 0, RH0 @0 P,0 S,0 S0PDm@mT0 L0 P 0P ,0 S$0Dm@mH0 @0 P0 S0 SPĦmīm -@LT )0S0) R Q  @T - 0L,1@SPp ` 0S ,@T$@T ,P 0SD0W00000CS0$@TR00000CS0 - 0L @R |0S0|0 R000 00CS0 L hLꜧmTm - @R0L00 ,0S 0,10,1 -LPp`P@P' ,1T\ V LL u ,q R000 ,0SL ,A0S0 00P@VA 00 @P@,1  M0  !D D ! `00!@ R00!p  q0 0100V 8+L0(LS,1 000ꜧmTmĦmīm p-0L 0 !@PT`@T 0Sp) @@T P0@0S0`p@T 0S) plmȦm -L@ 0@T @ T> p-1L M`P ```) l1@QdAdQ0S 0C) D1E0pmL>̦mX>md>$ml>Tmt>m0>0,,0=9 =0 0,0,(00(00D0 0000(00(000S 1 1 0\ 0S0S  \(1 PV/0 00P0D  0"R0$1$10 0-0L,!P @P0 w?P00,! \  u -0LS(a0p  upT  u@U  uW@T@ -0LS(a0p  upT  u@U  uW@T@ 0-LP\( A\*0! uP@01 00 -0LS00  0 001 !K\ J00CS0=J$m (R(!000 - L 9H00$m 0-L@` PJ000 0-0LSP ` @J00P0 0-@QLP ,1 P ,00000, Q P 0,!, 0P 0 0-@QLP 0, Q yP 0,,!  0Q 0,0000 -PVLP@+GTp,1@ 0S V0,` 0h0, R C@P P ,1, P @\I0, R DP ,1  Q@D0 @Tm -@L0|,PxGphtG,1` R P 8\I,YI 0P蜧mTm -LDM@?pP`Vp(KhPK spP0@\ l0 I I8#81@0 , !D D, !l -` L0pS($ 0S 0S PP@\ I`@0 , !D D, ! -P L0pS(2 0S 0S 0S P#`@\ vI0S PPPP@0 , !D D, !^0U0U -` L0pS($ 0S 0S PPP@\ 4I`@0 , !D D, !& -P L0pS(> 0S 0S 0S LP/`@\ H0S =PP PP@0 , !D D, !Z P A>0U 0U -@tL`(Q [ 0SX 0S 0S 0S PIv 0S 0S 0S P9pP\ Ht@v`t 0S2 @P0 , !D D, !t P xt 0Sv 00Qv 0S tv 0`S -PuL`(A Q 0SN 0S 0S 0S P?v 0S 0S 0S rP/@p@\ $HuPv`u 0S( P@0 , !D D, ! u 0Sv00Qv 0S uv0`S -PuLp(A` W 0ST 0S 0S 0S PEv 0S 0S 0S P5w 0S 0S 0S P%@\ GuPv`wp@0 , !D D, ! w 0Sv 0S u -PuLp(A` a 0S^ 0S 0S 0S POv 0S 0S 0S P?w 0S 0S 0S P/X@\ ȫm R0"( p p-L@ `Pph p-0QL@P`h0S- P E@T i@Tl 0!pS s pP gE 0pP \EpP F 0-LPMdPK@ PP oK0 -QLMP0S ` (q 0S * qP`(A0S \ @0S@J(>0(!@0JS؜&̜&Л&Л&Л&&& 1QE 0S= Z  1 ?Q 00SZP/ Q '$ 0f `. .  x0 ?l0 d0 0S:0SPP 0` fQ$AAt)il)i p-LM@(`KP nP SKp p-(1PLQ \0R00S0D!@TPDA x@`T <&@Tp00Q \ p p -0LSPp S# S P7Q  hP/ PP @T ` @`TV0S(1 h0 @T `@T 0 R ` 0,Hm0 S-L@- S SP6P D(^)^ 0N00S(1 0 \ )\ 0 RD1^ࠡP P P )D1^ࠡP0,Hm,o,o0 , !  ! -@L 0@im0 , !  !-|!X0"0CX0 R 0 00d  0  ` R0>X!00X1X!R|꠬m -|LX00,X0!00 @dd0$@d@X1  0-@MLlTP `0 P@P T8@0( H000K0I&Dmi>> 0- LP1`00@ Qd0`@ T@dAK 0h9 &m -,`L hq@+0)0|`P0  !$ $ !#0*`1SvxX1SsxX1S xp`1S 0@)0# \!R 0Q404040\!R,omX0 R 0S P 0S  R |)i p-LM@KP`P0p R R 80S@0S xx 0-8P@L?000hQ p-8P@L3`V  0Aph ;@ ph0$!جm -@L0pSP` @ P@ @``  $P >!8DQ ,+"P 0  جmԪ&h&>>[< 0-PL @l0p 0CRl00p0 0S008 @!00CQ 0hE -L@ D D00CQ0000S00h,ܬm|)i p-PL @l0`S 0 R0@p00p@810@ S00l00l0php8 8R P8  R P@ @0@0 @80S@@00nS 0-PL@ ^x 00@000hT0 R 00aS0 @ 0@0ܬm|)ip@-(`@V0P S ^ R D0 T $00Sp0 Sp S V Vp,!, 0S D0 0S Vpf0 $10$1 0 -@0!0Q0""!A0 !!Q0 1)i- 10 P P P0  !     ! 0  "!   !  "!10 !@-L!0 .!$ $@.! ,0h4!,10!0cS#3,o, h1 018 @00@,o8@ R0@0 0S00@-  3R $0   0 0@ 0$@ -`0H0Lp0 , !D D, !@T@T T $0 0  !$ $ ! F)0PS @T$0H0S0)0" -pP0 GbL 0@$01 1    (,0W K 01100110@1100110 1 100 1 10110011Q 1! 101 R101 m:Q0  !  !W1011010%0  !    !0 0Q 0 0S 0  !    !0  !    !0  !    !n)im 0-L0LS@LP02 L0S0Ȭ> -0L0@J 0 P Ь> -PLH0`Sp! PD0  K0)0@g H0S WL00CSL0LD0   D0    -Lp`PPLWi W0  !D D !.!D *D  !@0TL0H`%WS @T T $0  0 !$ '$  !)  BRԸ&Ը&&&&&&WM $0 W0)0ĕe!L00L0W L0 0L0t0 0  !D D ! )0S;!L00L0{m p-0L`P , !$ $@.!V0l 08#801  Pa0S  IP` ph<0S)i -1LMhA @0P80 0r8 00` !! ! !P!RX140 \!, , 4 TYO 7$0 !0  0  !$ $ !L100 ! 0 , !    ! 1U0 1 0!10101[P!0R000T1P1X1\18  01 ,00 40 (K(KoN,o)i -@`Lp P->T`@00 V06p0 0 -L M@1P @8p^@ K?(KP 0 0 0 gPT (`K fPW  0 41$0 SK?"(( 3 K -L MP0 ER@0`@V U U; T* !1, 0 $ ( 1$  1$00$0 1$00$0 1$0@0$0 U $0,K0$0 0 0 (0 f@PV@ ,pK /f@P @ K 1$00$0  1$0 0$0  -0L)0p0 .!D D@.!PP%!D )D @.! , !$ $ !|0 Wh)X0@P `0S x000 0@@0e갭mtm -$0`3P0# DLp!0@3PN < @@0  "! !  "!0 1D D + = SN !(2R.,0S>? D ,1 R8#8.W0m @a D  D  !0@3P@R 0  !  !%B D D8#8.0.B3W) V@!D  >P  @0@ h0  "! !  "!0 | DM)iج> -LMpPD`R0 Am Z @ D5 Ay 0  !  !,  0  ! 3 !0  0  !  !.!$ %$  !$00Z00S @T T @T,0Ss )0@S Sd S`n V (KoB Q005; H0QP  !  !(K0 1 10,0 1,   D1S0D1Dž ,1 R 0,0 0  !  !j$3h!R 0S  RGP RC $  1 P92 (KoY )0S$0 D  `h,p3Y00Sk0P00S`U @0  "! ! !("(0 D0 V* YT 0!!$ 0%$ !! , !$0 3$0!!,0SD ,P` H0S` 0)0;60  !$ $ !`12S201Ņl$0 j 1gP0  "! !  "!k00SH0Se $0b  _ 00#!001 00#!)i,o{m - L mN i Pp-L`P @T U  D0 V@Tp P-L@xP  h S-pL ,1@T< P,0SD0 h 0S  P X*@TZ# R& HP& @T @T P,0SD0h P X   0,Hm -LPp`P P U 0 R Q 0S U U U  hlP @T0P \ 0S U U U @T U  -@L T` "R"0R = B @PP  0S  PP $0s HP  T r R 0h.p 0h$ b0h@B0$10CS$10007m 0-LP 50J/@q80$10m 0-00L$!PR @0@0 -L M88 <0@ $J 09K谭m&>m -`L00@P" p[9 0@#P1 ^1010  !!!0 ! !!0P1K 1P 0R 10P0)i -$0L@S ?0D   10 P Q$0 0  !$ $ !L1Q 1$0 y1|1!D lQ 0D   10 P0  !$ $ !!0 , !$ $, !$0 -LMp 00 0K 0 8PP 4K oa`PE,1PPO0HL 1`Q5 0D   10. P +  @0 & W01 B0 !   ! 0 Q` K a`(K00 U#V#J 0 ` 0Ay004P/1,ȟ@Y P`v0S`PxPBɚ;i>AA -0L@T D0  0!!D 0)D !! 0 1   @T Hm -LM@PDA ~`01X\TPaD0  1! 11  (Ko !0 000 @ 0! 0 , !    ! !00V1 0!10101(K)i p-L`P0S @ T0p @T R0000 0  R0000 0  -pL@` PP W` P 00  00S00@ P0-LPP@@@T: 0P T 01 R0D00=> 0-LM0PS Q@ R  R 0A@S0@ 80SK` >`P  0 B0 00 0@@ 0 @8S0 -pQLPT \Q 0 0CW . \, @ R W`1`!P$0 70S( _^ 0 f0 0 0pf0@ fW0 @P0S  P` Q_ D`,oQ -L@M0P@00 ,@ PL #0S c@T0H0 P LP0S 7P@PTPHP \ßP  zD#P  s(ß@$3@ß`0 @)"  2@`Vl pAKA ŸR20H g"w;26|ŸP Pp6, X 000@8 @0$0(@H,0 P0408@<d0Hp0TPR``V! @ 6T0K @ 4P A @0 BC  Dh! E FG@@ ;W$!00`C 00L(KU 0pW L P P`?6!, X 000@8 @0$0(@H,0 P0408@<d0Hp0TPp`WM4*i8mDm<*i@*iTmdd>4>>-P  0S 34\^ ^Q0S :P00 (0,o -@LPp`5T  0R U T  hu^  M-PL0 0S R K P Z^ -PLM0  0S R  P  KD^  -PL`p @ 0S:PVPR00S P0 @ &^P00  h] -LMP p, u5U`&,0 SR00 SU0 0S @V  ]P00`,  g]000V R S  D]P`@A ]P00dd> -L MP K -L MP K p-PLP`  0S@U@R00S P 0 ]P00pp p ph] p-PLP`  0S@U@R00S P 0 k]P00pp p ph\@-R @ Q\ 0@- 0-LMPR@@ KP0T30%K00 p-LMP PQ`'0@S)&&&&&&|&@&&&&X&&&&&&t&H&&&&20S KP 0Kp20S6- 2_2 RxŸ 0`Ÿ 0H2H"@ 0@cFP0 P]2@FP0 PR10S  +10S-10S-10S- 0H P`1`!à0L  P$10S 1 :"~ 0 0b 6s 0 6k 0 e 0^ h0X$ QmԮmNi̮mD*iimi1oدmܯmЮmmTm@*i<*idd>io -LMQ`@p E 0B@S񟗗&0&0&0&0&0&0&0&0&0&0&0&0&0&0&0&0&0&0&0&0&0&0&&0&0&0&0&&0&0&0&0&&0&&0&0&0&&0&0&0&0&0&&&&&&&0&&&0&&0&&0&0&0&0&&&&0BRS&`&D&d&$&&&&D&&&&|&|&|&|&&x&\&\&&&x&(&d&D&(&&&&&|&\&@&@&@&&&`&&&&D&&4&&&&&&|&|&|&t&|&T&&&&|&|&|&|&|&|&|&&|&p&P&$&h&|&|&(&$&D&|&|&|&|&&& K 01 0* 0# YP 0R`9`9^ L9R@ #K Q2(  000QY@@@T0 @A  0&Rx8x8\ d8R 0 Q~V #NKa [P0070S0000 00  00KOrG@ PyPi00CUSPc0S^ @_`pd 0!밊P7P'ODǟ 0G(ǟ 0{? ǟ 0s7Ɵ 0k/Ɵ 7'F,K , ,P,0 CRS0A 0 - HƟ  6Ɵ 0/ş ş L@ P00R00S 550Bn  #>K0B ,R ( Lş 00ş 0 5  4` 4w 7ğ ğ hğ {LD@ PPr0So /m-k 4d ^C0(K ( b(00Pß L@ P00R00S? l3;`C K, @P0 R- 0S$ŝS 0 ,Q A 0|N͠ 2  2 A 0`Ÿ A 0Ÿ PfϠ 1 0 0 0 t1 \1P 4   0h$~^4m8ma0,oio4AMi8AHm<)i<A-i(mH.i()iX2i,1<@)i AȭmmmMbm@m|1 -L M0@SpP (`K TUP K`G -LM0@K`Po Mp0 @ t3WP K 0i0@-,P@@40T @0S0d*i0@-,P@@(0T @0S0d*i0 d*i -X0X@0LSL }?’D0?< A3c 0 0 AL*iMbip@-RRP` ڔP`0Q @0p$0@p rP`<0Q*0P`Q 0QmL*ix@-P 00$\  $0(@L*i -L(M@Pp Pp 00@PT x0H`K  d 0 , @D0T  0 D @(K`*idd>`>/? -L(MĐHKP@`p  ,  0PP (K+P X0@T @T +P@PL*i`*i-Q00CS''''- L0 800 0 ^ii -"LMp`D@ @0<0 @`)@匒P0l^@`  @   1 P` A$ 0@ V 0$@ 8K0K00@R00 ,@  8PK`U0 0@0@Q08PK`@P`8P 4` P`8P 4` (0@cT@PTP@DT8PK`(P,`,P5쀟0@8PK`4P8`,P`5q<@0^@  0OO$[P`% H FX%`v(`< @P0H 0 @P@04 00(Kd*iL*ii@Bʚ;P*iX*i$$ 00S0008ii 0-0@SL  0A21C 0`0Q U! 0 0@ RP0R @0 0R 0R000 $//A`*iL*i0l>>@-HpDP@0$ 5^0`@0 @0Sd*iʚ;@-HpDP@0$ 5^0`@0 @0Sd*i@B -LM @0,0 @ P`p0 c5F$0@X0 @  , R @0SW0@ d*i -L -L M  (Kox4 帔0 , 0POᓕ"4 P `pPU` V00pK@p0p , L 0pKpWp P$`(Ko Ui Kd*i 0-LP \ 0Q 0 P0@  0i -LMp,K,0K  P5 0`@0K@B -LMp,K,0K  P5 0`@0Kʚ; -LMp,K,0K  P5 0`@0K@B -LMp,K,0K  P5 0`@0Kʚ;0S P(0P 0Rɚ;-R \D0\\ ,00\00Q?BA   R 00R0A@-\ 0 l  0 0@=Ɍ 0@ ͌ 0 ` \  0 l\ 0S0 0=Ɍ0 ͌@ 0@ -L M4Kp I4PK`,0PU`0`S!X0  V 00(K X0࠳0X\P 0@P`U -L M0Kp `0K(0Q SJS T 0$KSP\ 0T0SP 0= @ -LM 8 0  RXP`P` (K 4KP`0`1P`PP`0P@`=9@P` =C0 ]P`4pKU V  R U V ,0R  R 0@K,08 @K cPR@ < 8  ᬶD0@Q[+4KP`0@=9 =@ < 80 ?B -L$M@PT` KDK 0' 0p@ 0T<0 0 0D0 @@ 8 4   'P,K8K000S ,@K0P% U T R 0@0 80 4@  0 $0P cR8 4 0 0@=9 =8 4 00 Q0 $0R  -L,M`PVpT@T PK [O0PHW  ,K(p ,` {0P>T0; DPKPPpK8P4V4[Oj8K}D @0 <0S uD0K8PK`< 0P `QDP @` < 0P@`=9ADP @` =C<0 0$K0  L @Pl0?B -L MZ  4KV& 00| `p04` 0p | P, #4K  QOPX *P (K4K NPXP400,0%"O04@`00@=)@ -40 0@ , m@B -LM@pTP $`K0P K O0PU0 0P$@K N0P0 p-L M`U $@K % NPV   NKpA -Lʚ; p-L M$`KP@ B%P00=:#:S  = @ @P  0R Kp<0<@0$0 @ z Q  +NAʚ; -LMpQ`!'!'x!'`"'p"'L#':#:S!= @ @P  0S $K*`3 `PU`\` l0P``0t \0P@`1ÌeȌ`6̌ 0P`\`j1Ì0PeȌ@`6̌``2 `PU`\`^ 0P`\`0P@`1ÌeȌ`6̌ 0P`\`.p!0P@`  `Lq4Ke0,K 0 P0S, (0 : 4 K < 80 (0P<0K` 0S@40 0@ b`04K@ < 8 4 0 0P0ŌP@kɌ` ̌`0ŌP@kɌ` ̌`NR40K<0 8@ ,oɚ;6emʚ; p-L M$PK@` $ P !MKp p- L M0@R`e)Kp" $K 0 R0$KT Q  R  Q hI)P 80QU 0R  m>̮m(> p-L M00`P%T ,K KLP U  K CLPT $08K#!B !,0K0 80 4@ PU  0KKp`A 0-L M@}P K0 PK LP0Sk$0$ 00:   Rmm00  p-4L⨿,b\I  000cSoSb SA400!!Ń1у10000 0bSG SA400¤!դ!Ń1у100000cS- SA400h!h!Ń1у1000 0 bR RC400$!$!Ń1у100\phDRC80#< Ń1у100SA80!< ո Ń1у100SA80!< Ռ Ń1у100SA80!<` ` Ń1у1000 P000@td-imxmmmmm 0-LŸ  01 0S Q Q0!01 0 P01   0]C401 0S  0C40!0C401 0 P0C401   B4:B801 0S  0C80!0C8010 P0C801   B8"<1 0S  0!010 P01   @{@T@0d-ixmmmm 0-@LH0 P 0$0P0000\0d-i 0-PL@e0 0@  @  c0cS@  t0  @0PP@4080  0 PP'@0d-ixmm -00@ ALvhA - 0@LvhA p-P0LϠ\ @?x RphpA@-,0 2TsA -p 0tLQl0v\0`P/ 1./@ Ribq@BAA -0@ LAprvX0`P/ 1./@ Rh;qAA -p0@LpPvX0`P/ 1./@ RhqAA00  p-0P@L@p`m0@ 0R0000$0 0@ Hp -LM`PpO @T  0 @T0S ( R000$0 0 00 @T X> -0Lp@P ` 0 00 $  $0@$@ p-`PL@T00Ӽ 0y@޼T Q:phüT  X&Ỽ( ph~4% CRQ5'`>|> p-LMP@᰼ R00xh蕼R d&0 S ` @0 0S|( xh?꤮>> -Lp( `pPP @Pp ` @@Y 0 @$0 x2' -@Lhx2'p-i-i -LMx`hQ@pp'!$ $p p'!`F0!!$ 0 $ !!,o -LM 0P A0pK 0h , !$ $, !@0pK `P $(0  M `P@0@C@ 0 X0h , !$ $, !T id',o4' -L]{ -L@P @0D! 0 |0S0# Q!|D0S 000,o{m4o p-0l @1P0Q0@L@00APl0 0CSl0 kl00CSl0 >tP@pho 0-@L @0P0$S$0#@011S1ԅ1ą0h: -L MPrhax0,Kf,@K0T_ Q0X00S $ 0T cR, ( $ m0!,0K\0@! l(QTI 0T30  D0 , ! @, !V0)0 000 0-D0L hA1 P1) 000/0hg,o -d1d!`0VムT1L`L1@T: \ 0C  !L !!O0)0u|l0S|0 S|(l D0!R 55030505>,o{m4o0 0,m$m 000m 0S0,Mi0 , !, , ! Q-L@0Q0P (0@ @-0@ , !, A,, !Q  0 @ -@LTP`p" p@T $0SV V$pW V V V $0S 0 @TUWpO"I"8>> p- 0L@P`~0S @p@p p-L@[PaT`p04L P PU ph0 U PV php 0-(@L0P00(0P(@000C0 Rm -pL@`TU@ 0P$ RU00000  XU@,m 0-$0LS@P  P 80@ P0  00h g"e",mD>x> -LM0bP,s0S 2 l0S0C0O 0P 0S P bO00S0|K x4 -h!0S@ @ @0S W0Q4 Q0(0BS0A0 R 000  0  01 Q0S  1S R 00000 R008!Q ! m-i> A$m>> p-d`@ L0P0 P $0SRP0 Pp$m -LM0p@/P`a PP` 0 0( @0S* 000l! PJ$p @RTR 0pP> T*p 0!R30,00Q0S Q0!R 0S S0 R 0Sʵ! 8>H>>>x>p>> -PQL 0 Qp0S" `0S 0C8S 08J@08 J 5RZ 08Z `0SD A -0LS@`p50S&0S  0PS)0U 0S P  Pp0S00S0| 0p0S Xp0 4 io-iܰ>İ>>>ذ> -QLM0P0 4 ,0 (  0 Qp0 $ R 0  `0S 0C8S  08J@ 5R 08Z `0S`0 R , R $0DS 000,K4Kb A-i$>8> -LMr@X0S 1 Q0S004X] 0 QP @V ` 0,0 Q0S00P t@@00 PXJ D AY   !0S  0S V 8CR0S00 S00 0S u,0 /p00CS0T P׵(KP 8CR00 m-i>$m\> AP> -@PL` pP  0hZV 0-i? -LM08`, J|pP4 ( 0 $ 08JE00C8S0rP4K08Z,K A A p-`@L PP  0ph ph>820P#! 00"8Q#(p@-(0 S<3(057<@ @00@09780<S3 ; @@0@008<<7P`@ +7P`@ :00;@0$TP7p"p -LM80PS@`= tpX94Y (@Ġ 00 ,0 :o ,0 ;< ,08(K mP020P`00 @$"X W Y 4POT 4SD4K40XW0  0 TmDm8mQ S 8Q20 R  \  \ | 0 00|  | 0!|  R  R | 00010|  0001| 0  0| 0< P0S 0 SPmi -LP @0 R 0P 0P RDm -LMp/`P@2P (K]P=; c0K   00B0 S=?( K Q02\0A0@T (0 0 S @ CP) @TX \ 00 P0.Sa0I0Sa0B0SW0BXDm @dd>> -L MPp`( ((0"4#220 $04 D,K⸎P 0 @(K, h1Ph ,0股P 0t m` ,h1 ,w0< ^ h1,,h p긱>,oedA>ܱ> p-LM(PK PKp(0[S  00C0 S00•0S@`Q @@Q ,P10mi 0-0L~M@Kx Kd0kPP0^K0 @@0@0  K0XS QD0 Q<0 Q4;00K0뼄it%B0L>i/?0> -PQL`. 00S`S%p0@T@T 0S .P00SxP020$ 0440apCWPE@$m -L@P TP0@T @T 0S$@T|>$m>-? -LMx`0  P@T $0s (0q @TU 8@K I\ P RR< ,9D((00((0000QV ǟ0#4PP0 7@PK$88@#D0a'$B8 ,0KE@P VPPpT00S 0S V 0Sc 0SJ X(K R 0S(0 @ &P0&10T0U0SxƟ0s0Sh @pPP000  " 40 $46 020$ 040 0 6 %ş00a5 0W 0S" |$ %0#(("#4@!| ,40T,((0 "4#Q r  <0R05 p J5 "88 #$0a0""p 84 "88 #$0a0""UpKV 0Sx tp @zPz24SP 0u03V0STU(0K@E0^*S@ ,K0 PP 0S$ q3\#  ig 㪮@rzlzTP X,0S] S7 ,0@"00䂟2TPPp,K 0NEPP +APa' 00K0P 0,S0 0\ ,@0 L@T@T $0s (0@TDP , ((0"4#220 $ 04ă\0 l `@P 0dP@ P` a P pW (0 P @ P @VPP|,@ 0 \l`@P 0P@ P`^DmLm(>A>iĄi>LY'>>-?>Ȳ>>D/?>ز>dd>@> >>`>>X>>>% 0-P@LI,00S,0 0h.d -0LMp80 < 3,00Cs,0a 4K 4PK`d0,l PU`QMJx0pL1 Ppt x0@ =9@pt =Cx0d0Y*<0S /PP`P`80 0@80<@PPT`8߯ * (K /HP`P`00 0@004@HPL`@0 0@@0D@0=@P` ?B> -鰀L0`S Pp@0@S 0PSp0S P`p@00@S 0PS  0o  0i|li`NiliXi -0L0@Se/9 PR 0D00  0 (0 BR T4mTmDm8m > -L~M@ (0 0 (0ZKd0K$t KP(00 Kf~(00(0 -,@L#(00(0(> p-(0LP`F e PB X00  0@P 0 V P@$ ` P 020$ 044$0$0s  @V\P qP0D00S pDmTm8mh'[<4m0> -LMP@ 8|8#@T"p 4 `0 ,  44"}02,0 ,0(" $24  @0 a0, t4  R lV 0O  , t4 ?0 R0Q4O0@ @,|  RD VD0(2 0P`0p0 @8!@P0hh04KP  (`80d0hp,0P 0Nh 0h 0@l , (K40(S  ,04'?dd>'d>?l>>>>>> -LM< 80@ S8 0 (0S- [[U) r 42R#<0SP<84 @ 40!+ )Y00p@` pP`W (KXYyᔐ`0@ Pp ` V, 4  4 0S0S004 R(pK0@'<0@` BP <<H< <e/80 U|~PUPU 0S @ P P e/WEV8mDm -LdM\@ <0 s  <( 4"4&, Pg< ,$ !$*,R^04!48#8S U20Y *00!8P#QF 8 040 (@LP@ ,(T 00, <\0 4 l0d 80\<4 l0 < 8,t X <0, L̠H  X0|,P0dT0T\0Dd0l0Čt00$80p40t0D0 (080 ,08X0 008`0 408h0 808p0 <08x0 H08|0 X080 0#dX0#T`0#Dh0#p0#Čx0#|0#0#$80 D #t40$H #$L ( ,0"l0 #\"L408 #"̌<0H # "0X " -0L@  0  00 R 0  0Xh 0 0S0 0  0 00h7 Xm -L@P`ppP? DQ 10T' T\2 3:Q$ T \:T\ R000 W 0 00\*00X 0PL@ 0R 00 p p[<ش>> p-LS`P@/ 0 0S0 0Q  0S P0N0Q 00@@pP 0R 0000 6ph20Q  0S 0N0 00S00@@Ppph -L MAjl@ pP `@ Y4 @ Q  V0@<0 0S* RQ< 0S%0 0j 0 @ {:R  W3 #0 58 5, 50 %8 %, %*o0Sj < Ph>*\< 0S!  0@  i0 0D cD0I  Y4  0LS@0!*P: 0E40R\!: d0 R00S,0R0#03P0S<08  , 8 0 00j0 @R , q 3P R] v @000@0!Pb (K@4< E>* W?: R e 00 R0S8,0R0#03P0S<08  , 8 0 0@ 0  i0 0D cD0I 0Y40\@ * W %0 :4 S R!*0 80@< @ <0@4@< 8 0 , @#40 8 , д>A-(p@p,@ P$`(p,A -LMpP`@P    0  K -LM` QPpA:0A @T<P6 \B  T?: U 0  T: 0U Q -  2 U: 0S+P0pe000 0P T T0S*@B0ep0 R000 d ]#д> 0- LRP00 @M @T0@B0  00hT -LMAPU^, p`C ZQ  B ,0FS@0$P(` 0@ F,@ ,0 0 BS0 0R 0 0 ,0p0  0000 0 (KPP- p 0S00P0P00 _ Q 0Z0 0    'P ,0@p @Z  ׷@ i >Xm0 -S0  R 0 Q R0S0 S0000 00Sa0 P00(m@-@ 00bO 0$@P p-0L0M@`T9P 00 08 4   0K @0 ( < 0  , $` $ 0 @ KK 0P0CS 0 KpΊ0m -L@L R 00CS 0 $0$ 姛0m(m - L XP 00  0 08ma0? Qp-L@`0 PAR  x0 0 PR0 R H0 p 0S0SU RU4ma0,m0@-P@ R( 0S%\ ) \ ^ \@ 0 0\0 S 0  0S R 0 000@ 0 0  R P,  R/ 0\ 00 S 0  0S0S 0P@ 0S@@0  @0@ 0 0 0S00S0@ 0\@@  @0@- R 0S^ 0Sk0 0R 0SI0SD \  R0 0 \0S0  0S R( ^ 0Sm R 0S 0R 00 S00 S0 0S    R 0 000 0 \0S0  0SR 0S@0T 00 S @0  0 S 0R 00 S00 S0 0S    R R 0SP0U 00 S P0@  0 S@ y -LXp5 PU?P0S`X`V  0S@ W`RP 0WPP 0RPPV 00SZ  `X `V 0S` -@LP ((0S 5:\ R0P 0 \:0 0/P((0S005:SPP( (0Q 0#03SP P 0S0SP0SP0S  P 0S0SP0SP0S PQ00SQ00S00  -(0@S0(0 L 0x R t[<4> -L M 0 R,0 Pp  K,0K(0 0Q0 ( R0000 0  Q( ,0S: ጞ᝞,@T L0P S$ $`K2 :@T LP 0Q$0 * >Pm, RQ000(0 0 , R 0Sg00CS0,Q R000 00 ,Q 0-L8MP@GxP\00M 000$0  R00# 00$0$@ QA$J Q L0 80C PL0 @T d14 \1 `RE@AK00001Q 004 0$00  03lLK$@ P# (0X 0T:d Q00000$00$ $$ẝ d  xmA>`[<> 0-L M 0@02P 00#^ 0#^002(Ax0S K0,K0hKd (0Px`m>T[< p-LMP0 K 0  兝@T < 40`R00 V @@ @ <04 S`H0@ 00bS*O P R0000  0 PKp -4L⓰,0@T  @Th蛰 .i.i p-`PL@200  0@@Yph 0-PL^ 00CQ0! QU  0Spb@T M>@T0 0S 0 00 0S0 .iXm.i 0-@hLPϜ0h˜ -L MR0  04 0  80 0 00BQ0tU800S@ 8 0Sʠ0l,0 < cU< 0f8S8pLpZpj < f0< 0 0 $80,, @\ 40@d08 0` 000 P00WX 0@@ @(@<@0@4@xpH@L@|@@@l@ 00fp0!U th @@@@@@@\QTQ,0^@0# 4140坯,000T0 R> !0S 0 00000(Ko蝯8pL < T< 80R D Zʠ Z \l 0l8 ,0 d\ \0 8 l, \8 :Cʠ8 ,0 V,,`m< .i\m.iXm>.i$.i0.i>[<- \ 0Q|  @ 00m -L MtptP`@F ` 0 04l`V pPK$i0m >< 0P \|  @ 0t0m -1pPP0 ` U00SL@ 00S@P`0U00PWP$A WW V 0 RU h0\0 R P0` PV  0U00mDiL.i,m4m -RL\M !|  x pL L p h PP p%PP00mPu `0  @p d0 \ X0 l pp l 0AZS_'''@'''''''X''''''D'\'\'\'\'\'\'\'\'\'''''''''''L'''''''''''''''''8''''''''''''''x'X'''''X'''''4'(''@''X'L'D'''|''ؿ'p0Z0p0  L@W00 S} | z(K>| rd  d d0  `0X0  \@T \00dQ00(Kd h  R^ (0K2h0 5:Ra x pM\`Ph@ X0U  ST  T d@TT dt `T @bTZ L W00 S 00 |  @DTXQ Z  L W00 SX@@ |0  tP @eTZ LW00 S000 |   @Ddd d  ] 00` X d00d0 d  `Vz-@Pu`X@ u` @ b` p0dd dYd  Vd0@S 0@8CXo@1A h>0 ` l@Ph d(Kl 0Rh@h0000d( K(Kch@  d\`P\d1d .d @+ 0@8#X`@+dd d@ 0@8#X`@lP P?Kh TP ?K`@X` 9X Rp0p X p d00d0 {0\` p@rd) P `d 00d 0 d   X X0 pdd Up0+X Pp0lPdd p0 d d D@@0p d0 0d0 ;0\h0 h8\Q@h  \ P h \0PbU\PT T őd0 m H D  `  0S S S`D@H0?K0(@+@?D Ru Zg L W00 S  | i @0P? K@h TP ?0K\pd @ d 0d ǟ@xX P` P d @l ]d\ǟ P bd d0 d@ 0@8#X`@Up d00d0 l00Lp!0000L Qp l `0 p*P 0@ \l \ p00P!0l 00A 0 \?\0 p 0@P`@0@Po@0@P`@ | @DAL@W00 S |  hh PU):h0Z| `T @bT:Z L W00 S000 |  @D0| @D%0| @Dd ` T0@cTZ L W00 S 00 |  @DTP | @Dd Z[ LW00 SF |  X| V U) Kh %(0Kh0 P  %2h >&BbP`h (0Kb1(@K 0T0 0dTQP` @Dh@ h (K00b0 P0@P`@]000L0S  Rl |@ . | 0Bl| =d d  d@ 0 8#8@H0 D@ 0 H D }|  @xQ pH0D@0w `Pj  P@ l@2A \@QHK<@00` !0@0^S!0@0^S^<,Z9 LW00 S |   !0@0^SL@W00 S |  !0@0^SZ| hPT \P?T0 D@H0?K @I| DH0?K =^ Z LW00 S>00 | {p 0?@\0 p h>(>L>D>T><>> -L@MQ  K" 0( K 0 K(0 --0 L M0CQ0  0( K  K0 K( 0 0-LM@TP 0P40@ R ֖8і8<.im --LMPٖ 0 e,0@ R 巖K<.im -@L > -L? --LM 0 7 K --\0LMh!D0 ,1 Q @@ ,1  0@K,o 0-LM@< +PK0@ U+[P @ P> K0,/? -p-LM ` 0@PP P00 R0PP QKp(m -p-LM@ `坓P 0@@ @,0 R0@@ ,Kp(m ꄶ> --xpLM0PSd0 P `AO L&P 8 ,@ 0@LmH.i>-?i -@0 L( 00CS 蠶>H.i> -LM  0ܶ>@-0R0S  c1 #880S$H*!?>,/?0S400S S gd aP.i(>,/?$> -1@XUL aU_!00UCUڨhFaUʐ!2p<x8@0sJ `10|8s0ST'T'T' ' '0!0 Pq0 `@Aqh`@@! 0S0c!00c10 Rڄh|hph0s LT.iX.i A|> A>> >>AA>> A AL>h>0>\>0> 0-LMP@tMhd(X0 S S SS8KP008ķ>̷>mԷ> 0-L0SE P P@@ T 0L0C*S*'h'h'h'h'h'h'h'h'h'h'h'h'h'h'h'h'h'h'h'h'''''''h''h'h'h''h'h'h'h''h'''h''XV0S0OLIFC@|=t:l7d4\1T.L+>t.i?/?(>-?>Թ>>p>H>$>>ܸ>>>h>>D> -LM0 S S, C SA S?  R R  08 R R#Ā0S*8@㰐pChP08#X(0BHTPp0  e8P#08#X(0BHT 8C8s , 0\.iA 0-xPLq h0 Q 0000D[0@40@0QTqT000`.id.iH>X> p-XP 0P`SL @800@SP 00p\.i`.iA? -d`dP 0\pr0L0 J@0 0S8P@C 00 AX.i`.i 0-0d L(\TkPPP0@ P *0b4 [00D>ml.ip.im 0-t1L @R ` 0S3''' '0'4QT(1 T0`!10 0 0c0C1 0S* 0h 0h0h@c@Xe0 0 0c0e}T.i AX.i A A> A>>|>>>h> 0-t1L @R ` 0S>'''''4QT"(1 T0`!10 0 0c0C1 0S/0cd0Z:h0h0h0h0 @dB"Pp0 Lw@@r8oT.i AX.i A A> A>|>Ⱥ>>h>>> -LM40p,S0 @h, 0' 00 @(r 0 P (r @BVW 0Rp,eQ sQ dQ ,*Y h00T 0 SW@@AT.i`.i AA> p-LM0P S S` S S S S 0 S S S S S SPx@KP @ |x0 S S x >Է> -LM R R00P R R P R R  08 R R# R R R R  P R 0S?8@!Cx`0 08#h(0BHTP0  8P#800 08#h(0BHT0 8CHt Qs (K,`KNPs da\.iAԷ>,> -43LM `R#SP3 P8CxnTNT ?(Y@;yTYTYTyTw (K(Ko.8C nTNT t$ Y@h yTYTYTyTc@"2Q @P' Q 0S$ PZ` P0 s 08s 0pEP] q@,p  )0@ |!0 8s hqPC v08s@mZ0$ - (Koc(KocxX@aA00c10J0 0c10 B(KokP 0, P00 00, %L(KoT.iX.i A@>-?t> AAA`>>h>|> A> A>P> -L8cY(Cx02B  $"0`S/ @P 0PS( 0qP0  PW WV W0S (B(00R0S {Pc0ISF<'0'$''PQ0SD@0@S PWc0IS''''cY0   0@00/|00SS P@~`.i A A A>X.i> -LM`p(@0 S SPP S@S(K,KP0, R ڜ?P QPqP |2p 0 $P,00aZ<f 0Ȼ>mT.i|>Է> Aл> -L0MȠLK8 LȠ`CxT #3 Q W ß0SأP @$0 @S sP0  $0PPS @U ,PKpa 0Pl,@t H# T0(i PKtKX,0sq aT,",p RP 2"PP@ PE _U @D2 |B@T`Ÿ 8C8s S<2 P(2\ 8C8s S1 PP!001 R$ @p 0S# 0P0  SP0S S0WpT(KH@,@U0S @P 0S 0P0  %P0S S0UP p0@S 0S 0P0  P0S S1pTAT.iX.i AT>x>AA A A4>>> -LM0 S SPpp0 S S P S S S S  ` S S `0 S SP`0S @@0S HP P@0S@ T T`` TPz1 0 L B*R񟗾P''''''''''''''''''''''' '<'t''''''''''''''' ''H'0 S0` 0$KT ,KP, 40 T ,K& K(0K@P,"[2[A0@ T ,KPr,  RR@@ Ry840 Ti ,`K@P,K0@ Ta ,`K@P,d 0@ TS ,`Ky@P,e 0@ TA ,`Kd@P,@0@ 000 T*0@ q-=000 T?C e000 ~Ÿ"00s03S0W000 pR000 kT0@ fH000 aC0@ ]?0@ Y`|90@ Sp50@ Od10@ KZ000 F,`KP0S ,0A0 0B0 RS 0B0 RS Rt R R R P,00& K(0K@Pf"[2[,s0@ @P,0@ @P#, 0@ & K(0K@Pc"[2[,Q0@ & K(0K@Pve"[2[,A0@ & K(0K@Pfd"[2[,10@ t.i>d.iP.iA0>-iL>@P>l>Է>>>>Լ>> -LHT<(4P(P Thꀽ>>m>N- 21C`Ni 32CXid0 $\H0 \<0 | (0("404 limili-0 $ Rl0\`0S  Q 1S0Ġ 8 8#$ $ |limiliE -LP@p`V `P@ P -LMR,0 pP ' `0S` VP 0 S00ű@P 0 0 00 0 00CS 0Ề,0 -LXM`<ğ(@0P!Pt x0 :R`Kl  0P `Kl  !tlp Ph Z 0l 10 R0x Rd p 4Kx0, H#40KpQd 1e0@p6d P $| "0P  !$ @$ !0l W0SLxQ$ 4K4KQk X0d 00S;,0d Wc\@ < 8 h<0S\"43C" cb l$0@@ 0S 0  !| @ !F|! 0xh ᧆhQ 0  !| @ !h#Q q1 Qt lh 0lS p xh(KW0R,0dP00ӑ@ 0R@K}0x @ @ < 8 h tlPh 0l h S$Aɚ;@mA >HmL < L0 0-PLP 8@ ^4 0 n0C00 0000iDm@<< -Ll $:0 `T @?PD@HP@Pp6=LP 0( 0$@( ,04 ,00@4 80@ 80<@@ 0  0  -$@`AL0LHPp  0SL0 p0u03R0SL0 pWQL0@0L0L0 p p 0 0b Sp!L0@0L0 -L0L@@  CL0 D,0P h趫@0L0L0 0-@PL% L0P 0RL0 ᴷL0 0L00X 幸P0SHPU L00L0執0H0'0hF0,>Hm -$0@$@@L -$@L`P?P0P0P0p\" Q6  0 0`SP1P! U P! m`Pe0 0S00`%0eSp0``P\U`A P00CSP0, 41RL0= 00b S-*L0W004L  L  7`P`PP0L0L0  00L0 00b S:0 BP00CSP00L0 k#`T4> p-PL@TP P0)*`P v08`0 P00  p p<@Dm p-@PL@ P@L@H@`P 8@, 00D0p -LMP@ pw`@Po@P (K, < ,K8 K}@PO0 , S,0 ,0\!$`,0 0K4 Kx}@P400㸐0 0000$0 10 8 0004 000HH`, (00(0, 00CS 0' 0 (00(00 00CS 0 8K@ $ @P <嫓8v,v`<塓8}4}0Ov,KvHm/i 80S j g -@$LPD%0$0 -LM$`Ppl 90  P0S T00 0@0000   0K$ -L$@PT}A`p L0SI 0SF ` `  H0S& `V$|000| 0 `0aR R3S `@`xt000  0 `P h0R ! *  3S3S`  0-LM\@P$L 1\, 1\ 1\0 ,40iSR rSJ   0" K0<1\* 41\0#300 < (1 @ (1 D P00<<00P 0,< ,0T00<000,< ,0  K0h#  0K0h' s@~fs}ff@s@ -LM$  0E% K -L M$  0 K -0LS0s0s S-p0`0B!`R ?R? 8#L0S8#8dSd08#8>gfff-\  )0h SS\0  1>1>1t00  |0S0 0 0l0$0(Q mL@  0PT;:h0h0h a(h ]Hh YD00 8 P0$0 0PA0 0-@L{t0P0t00hUz p-LM@zP`H0St0t0$ 0  0S H0St t  0  0S 0t0H 0tPP zx/i p-`@Lp 40l#"B PzH L00bO 0$@H >RPPyp1P91pXi 0-@@Lp 40#T"B Pz R00 0S000hy0Xi 0-@@Lp 40#T"B Pdz R00 0S000hy0Xi 4 0p-#Lp"B @`!r r p<0P<0@`:z00@yp0P<0Xi/i/i -LDMP(K|3 "  1ˌ\3ŠT"10A0 0c0S |P @T ,K`P@T 0KU P 0 ,0R:, `@PTD0l<0<K 0H K,P4x2x0S40 <0K 0@P<0 8@ 4 @020S@0 mQv )0h SSp, Q )0h SS\0 L P ,0R:h0p,0 Q)0S㔡 S㌡ d1Z31C0!02d4@8!;5@><Ϡ.,0@lEnb <@K00H@K0 @P` ]JP0 z0 ,0Rvg:D0dqP,0R:$0 hH0K 0@H0 D@ @ P5D18-oQP>@KLɚ;@ļ>ľ>о>k_kؾ>>`>|> -@Lt0 | 㙤h -.H0LS@ t0h0t0H⯰⫰ -t0L@@ 0  P HZPt0@0t00 0S Pt0@0t0 - L X_ X X X - X00"# 0@d 0 d HPT#0?0S ;(09(,;($9(;(09(:(0r8#(.a0HS H0 `0HSs;(D;(D;(D;(D;(D;(D;(D;(D;(D;(D;(D;(D;(D;(D;(D;(D;(D;(D;(D;(D;(D;(D;(D;(D;(D;(D;(;(;(;(;( 0 .0Pc0>nxpH z P``0O0@d  d w>V0 H>{  0@d 0 d  H P 0>eHb 08#(08,!#8 Q0A8#(}zA0H\XSNP 0@d \ d Hr Pj ;^P!P(P'P)X)P0 l 0@d 0 d  LHP PH>SB >$m[0> p-`QL@ Pd aP]Up -LM2@0 SP 50 ^ B?@0CS+1 ? R  t0 ! W0N>N2n @ :t0\ 8CRvt0 :t0>%`(pKⰎ >~ PP ( N PP0t 5*0t )v.8C8Ac Q.PPQJPUZ[< > -LM0pP,2 8" `4r 0r vt @0  82 $ 4C0 u02S  u#0h, R  VR 0H0S8V` V(ڠ#?0@ @V; 0>H u .` D. 0O0@d P d `l pgʨ0H0X VRӋ 0}H0XSV0B@Q Q QkVtH0CD ` |0P] 0Z @X00!T 1FQ0S:  B  1@vP0  4  42S K=0(K   u 42 S ,2R#  0" u002 t #002 4K  002 h/i,o[<$m/i8momp/i L/i p-L@P{u` (Q+Q%t0 >;.t0.\4phtp0t#40#"Bp0t HQHP 2 (/ Q HP( Xi Q-L@ t00t0t0 0t0 0) P P  -Lt@  0R'0 t0! 0)P P ۞xQ  p0̌#40#"BH0t 0t0 hʈ m0 Q>|  00CS0 ttDim -`pLpF0 㨀At@s  0@D  D 9@P ✠% !,t 00S t PWP|@$ k 20P=d t {RyW  b @h0(PTh ?R](0Sڜ0  P HD Pt0@t0 0S Pt@tt  p [ t|  0S- 0S  0S 0SI 0SW~ X*| t p 0@$  $ h0 t@0  th0@t t    0R40,50t o pG0 #Y!   A0GS p0S P 0S 0SM @T T   t@(0 h0S&  .H0SOtp  0S 0SWt W W@ p p(0 S|PPrPY T 0S 0S 0S >08#8S>>>t  ^50SpSn l >(B8CS@1@#Td@DT]0p  x t  (Wt{pp !W|pl 'W`pi &W X?0|S W 050;,(0 0S050,| tWtW   ^tɌt z Tx 0>(ExW 0S &+tWW9 tl 0W+tW   >Rs kQe0>t>tW  |@ P0 P p p P P 0 @Pp0 P P W 0@0S mtt/! W   st}\Wˌtx6op0̌#40#"B0t )W}p ^W~p  R @0S?&| =z,m4mm[0S8\,  8 u8Ḵ80S, ~8寴0po#ppop,oAgfffh/ix/imp/i7( -0L@  (0 P0S0 p-P@Lp# 40#"B `Ap@ $o0 t0191p$0Sp191p 0SXi 40 -LàLP@ pAp&0`  VW Wot0`.H0S` PFo I wPʤ0  `t0`Xi -LTMP x0 U`' J:U# :U J0U :Un F:U s:U :U 0Uu :U. p(Kx:0S, 0 S D |0^ @00 1F0S )9@+pP 9U'0CU*0CU9U[ I0CU 9U_ 0Uaot @  5,0t npH9U 9UHoA? np 9Ur 8U :80S2o8t 0S$0Stnp|8UG n8U 8U 8UnH0p0kot @p0,#40àL<8t  P} X0S Z t0(0(SpJ  @0h 'D0 @0CpKl0 p H@ @ V@pP; \@a0(!\ _p \x`\JW(l7Up 87U!(1 R x0A ,1 RuD0r l0'20 p 6U 6Ul0p0Q0CUU 0Unt0p;t0m6U? 0U囅,1 Q-D0* Pp 0Qp| p &0Zp pp  sp,1 RV 㮇P|pPp , Zp %p TpKnt0p;t0m@  .P  =| 㩙p5@ p`Tp#*l0S (nl0T20x   pP   l0 jmgpP _,1 @T0S Rz\ 00CS0 ,! 000,! 00,!| ,1 0 !D 0 D  !p1,1 QuD0r 0p ,#mx08x0 @8x0  x07x00@x08x00 x07x0]m0St0t000t0t0Rm@ 7lp(0Sq0S  pPyt  0    0t,@/if@t@et0it,m p-@LPlt0p@ @` 0t0 ,t0N<t0,lpR0@-P-  ^ϠR0Π0A 0 0 Ql` 0< 0C T   0T00>0C 0 00003!0 !00l # B,0 000-0S 0x 0 QR BP0R 0P R00c!0R#<0i-H0P R 00c!0R#<0i p-@LDl`Q@# 0 R00B0C 0 0 0A00P0Q  00b0<^,00\00S0 0@tkp 0-@LPl0S US 0S\ a aR QPb0bU00S0 00hHk000 0 -@L`kp^P V  0 PbU0Pb-k 0 b PP 0eS0 1S00PS0eS0 0PSk p-@Lk0`SP!  0P0Q  00b0<^,00\00 0S00000CS00 0jp -PL`kkV@.Q@*pQ% 0S a0 aR@@ U  P 0ax0 0S00`dd0Vp@hQ  j -@LP > tP 0SB0 S B! >c000 p-@`LP >V`0 0 0P  pUB>  -pQLP@p1j Q( Q* `0Q! 0P ` `0RPP `P  0a 0 0S 00pe 0Wj R 0   p-LP@j `R4 R0S) 0 0 0P \  a 0 10 0 P000  0ip0 #0 00  V0ip -LMpXj0S" 0S 0R ip$K@@KP@K $Kmi00h! D0 ,1 P Z,oD0 ,1 0S Z p-LM`PD , @T Q Q0 S 0  !D D !Kp`kZat -Pp LD0` ,1 @T  /\ 0@Z `g[` -Pp LD0` ,1 @T   \ 0 Z `E[` p- PD0L` ,1 @T  [0 Y `$[p`p80 P0S0SPDm -L@PP*0S( BT 4P: P0-LP@0P QT 4Q08C(R0S T0SR\ 0 -h0LPpU` @T * \4@0  ^PUDm p-`0LP`U @ T*$04@S  RPUphsDm p-`0LP`U @ T*(04@S  RPU}phVDm -LMQP@#P P CP U Q4Q0S0\ E 0 $K*A$Kmx 0-0 L 0P0S@ T* 04@S  RPUt t0pS00d0 \0 PLL L(召00h苬Dm:iDd>L>4> 0-@Lh100!p B!h1P  %@t0U1U1:110iLmhm 0-L@P@0SU 0  00 0PP 1  T0S2 0S P00 P-L P p-@LPxh 0R* ?\h`p`000ShVpBPp 0-@LPUh 0R* 9h00002h0P 0-LPD@P 80h4 1 01hQ0h0hm0iLm -@LP,T`p UPP 1P 01DP,0P P0H L`X@T@W@ s@pP @P( p-@LP`. PP>  R'000 0P1  *1! D D31! 0D !X@T@1 0 1 p0 17pD 7p P 0-LP\T P@ L@gD 1001vg0 Q 1000hm0iLm -LM`P PQ@ @ R*@PbTp1e#Zp pP  0j0  - DD0  0 P0 pP  P'00h00,0 Z  0j0   0   P@/,0p0p -LϠMϜp0 {Q10 K0 c`Pp W0,0 ,@KaDD0@000`00W  pl 000 S0`00 WEVA @(PP> Z& 00 0bW1! & 0S  ; RW1! 0  00b\! 0   EPd0Wp00 W,(K,ge cʚ;Կ>>> -LMk -LQӻRQ`pP PP 0 \@ @ 0S*@cTS5X V 0!0 00P0000f0PP" 1 `000 0X0j 0    0S 0S00P 0PX  -LM Q-Lp@`8W 0 0g 0 1000GP% 1 Q PQA @@AQPQ100D00 0g0 `` p7`> -L@P  k -L@LPLpL[n <0"@ T0hhm<,A>m -PLMp, [ ,  0Q`&,` P`U0@TpcP @P0V U1R   P P@U`0X#@gT@!  h0X PU X`p0S P P0gX@cTPP P, 1 0Y7pP XPp 0 1777 -L`RPp/Q+U" 0Q*U 0ScPPV`dVP U 0@`T@! P $s qm jT>p>@>,> -RLMp`@0,0 0PP V@`;,K⼠,0S PP3 젠 jR",0S W gpZ @1@! @`d VPx0Z0 c; 1,, 1:1,m -1L`Qu 0,0Sp* 0Xcp`!Q@@T P 0D P0 S`:X4p`X  `V00S 0 X@1@! G d 00dS 0000 X  V00SR``  pP T)1 Q PQA @@AQPQAD00X@@X 0Xpc`0 o100 2022RP0S0SP00 -LQ@ 00Q02m - LR0@0 0S008 R0 0 R8#82m 0-@QLP 4T R(P P@00m> 0-@ LPP v0 -@Lp`@T PU00002 P02@T P7 -LMPp, 00 , KK@P P P T0PTP0 ,RX \ 0`h 0%`hW00S Z,00 0(KW#VgXg 0PUSUY  0 `Q ,0 0P@, R  0 R0W8\fEW3PP00W00SU& `0,  0 0f 0 00 M 00 0{00P0@,0 0 .1k @PP  P0 XU( ,0S 00S VU 0S:0f 00,  00f 0@,P V0 1e 00 00 0? s@> -40MLh @   0K,o0S R$  0S$ 0-80$P @P @$P0  191# 0#R 00 40Q h0 ?SRP@-8 $3O 0$@P 0-80@L$P^ R00 0S000S<0<0hA^ 0-80@L$P^| R0|0 0S00|0S8080h&^ 0-!80r@L$ r 0P0P<0^,  3,@03 ^00PP00<0<0H2i(2i82i 0-LM@^0P9@ %@ 80 h 0@]K0,o p-LMP@}^@0`h 0 @]Kp,o -LM0@P`-@ K[^0p 0  8@]P,0Ph!  0@,o -LM0@P`-P K.^0 hP0p PP 0S000VH 0V`< 0V003h]e] `,oX2i\2i -LM`P@] p0 @H]K -@L<@ D0ωxhY -,LM^P` 0S \  0 (K*0 V 0f Vc ?V` V] l*x2V"0CVA `4pK⶜ `@2 P0O 40 0@ 2 ,0 1V\ U0V= 0V 0 R] 5- V @V V 0 0000CV 0V 0Vh 0  V  V0 00 0 0 X 0 0Sy  Rv  Rs \p 0 f3 003 0 V Vm 00 09M $AA -LMXp`40 P" 0S \ 40K0 0 @$Kd3RO R} R  R  R *@U  R8  R R_ U@R R RUT 0S%0 R00 0000 0S \ 40K0 0 @S5 0S00S S0@82hu@P Rk2R 0S  R  R \ 40K 00 @R R R@S 0S0 R-@U 0S0*B BQ@@R񟗛((((X0Th@h00T@00 \MP 7@c0CPP@u 7@SPP\@m 7@KU 0 S0@K "QP!@<00V X VU@1,o!j -P@Ld 0S   -L -LQ@ 0 0S P )Oh蓼m p-LMP>X0`BP- 0K @S 0 0("8B?BS 0( ,1 6F!Ɛ@P 0S 1h  0T@0,00ZWKp@T @T  @TH0 h 05@P XA$>,o,> -LMSX1hq0 @ r`VK 0SH 8CT)@ (KK`W , P0 0$ 尀 p P00(1   ( 0 ((,@p@ `@P 000,V,V00P+@,om -@ ML  0@K@>m@-80$ 0 `0aR  $  1@91# 3S@ 0 00  40@ ?S @0@ ?SR -L$M ,0 SR0 D @ 00`p`W0S   ,P R (KD0S  R000 R 0 0 R XQ7<0< 0#\P0:0V4  B3S; 0   00X0 V9<8 #8*  0< N@0S 0Pb0c UP00 [S<  W0@4U( 0 Q P:0O0@/Tʣ 4UhD R, K8  ,@T p젠PW0Z0 X00S\ ; 1T 00S ,0S  V@KdD D0P @8 P, 000`pVM0AV0@:02 h<0 S@0  ,  U0Z,0  00 X00SR A00VjV X00S0 X@@ T @Rd ,0 s 3Z R 0d000X00S ,@8P TtH뼠P@@qU@SY0 R U00R0SN  J0G<$!8#8 ,:`0:40UZ 0`pr , `1p01k 0 R 0H0 , 101^0+aR@@>VT'#TT 0<%4T#,o8m0 000R33    00330(0 (, 0 Q 0\  0\30C3(Q,0,0,00(, 000 30C3Q P0 \540 R 0 Q000`2i0@-0PPL@ 1NT: PL31CPhP%: 2T0TD P0L20P000P00 p-@LP`P`UP? QA0Pa0a0!RR 00b00,C 1P00c0-UP` R$ p1SS 00b00,C 1P00c0P 0S ` R 0S$ pV ` 0e  000e0!RR00e0p> -0LS@ 0S -L@000 -PL@`pP 7PP 7h0 S0h00pS;0S\` p-`RL@PR 0RU  0 R 0 `0aR R4P0S2  0 1SS 0001P00S 0 00!RR 0001P000$0S`` $`ppx> -@QLPpc 1 `0VXR 0SZ !1RK WR 1 V&@ @ 0p00!RR 0000!P000!0 !@TX+ W0 101V!1R0 D 00 0 0  1SS0 00$0S0$0@@W 0iھ>Q-Q  1S. S' 000!RR 0000, 1P00000 0R$0Q ! !101 TQ RQ 000!RR 0000, 1P000$0S$0Q0 ! !101 # -L @0$0Q$ R 10S $ p-LP@R`(4 040 Q0 p< phr~ 040 -L@8! Ƞ8 0,Ƞ @FP 03>400@40 3F>0 00J000D -0@0>L068h7 -0@080L06Չ)h( -L MP L32C0bC^ (K#0 0Rx lP 0@0 @10 -LM @S 1 !@ xPK r 0-0@@1LSP S TpP 0@A0007jP -L@DIP  0S 0& 0  0S -`;0SpLPp3*U@ ; <1y7p P pPV@0Pg -LMp`$ K@P $ $P0  00CS 0$;I9@ K(K q@P $  00CS 0 X  @p0@P(0H@$ I -LMp`$ KjPP  K(K 7PP $  00CS 0 X U$0$@  Pp0PP(0 P$H p-L M0`@ K 0 *PP* 0S* $K PP0$ 0K'PP Q $ R 0S R $ \PP   00CS 0 PKp$P H$K DP -LMp@ KPP%0 SP 0S` 0`SV  PP!0 0 0 $0P  00CS 0  OH7P; 1V 7P  00CS 0 p-LM`@ KPP x0$ P 00CS 0Hx -L@M\ `, K4 0 uPp 0@ P0 L@ \0\X T D @ <0 H  0SH0 ~Q{H00SH0 v\  ,0R@$ @4K00KX KHPP@pPH0r 0c0Qp 0Pp8  08 R !pPJ80X0 8K upP@Q& X" 4PU  0X05! 0305  ]P0U @@X00P0Sp U0 cW,,0 0@,00@0,D0/0@D0H@p,  00CS 0 0P4P(K\,dGH0S wW #W -L(M0`Sp @K P02(K `D < D K8 (@ $P 4 ,`  K@0 -L`MDKPp f@P8 P(@P`K0P,0  0KU0S3> -RL MD p@ 0K PP, KPP (K,K,0< $@ 1  : 3S PY  00G ,`80 a,K4 K,KPPU0 >a@ 3SOma4C,D|a0P<J 00CS 0 'D3SP0 0F6!PP <J 00CS 0 904 0005 5#03P<J 00CS 0;a6㵂 PPN |IM, 0080, 00,0! ,0@$PD PP00R00S(U `4C,2D a@* #P5P,08 K0, (00(0, 00CS 0 40 000@P,C p>0/i~f> -LM 9@0 @K -LMP0  ʠ K p-LM`@ KPP x0$z P 00CS 0YCx p-LM`@ KPP Kp K0PP   00CS 08C0 $ P  -@PL' Q 1S 0 Sl0 R0S0 0C#qW P`Z0 ` 0WP@TP (P( 0S0 0  (0(mP 0  0C0 00C0ECm - L RhrR@0T0  (0 ( @T@T ( f  ( 00C0( 0 S( J @T@T1& 0 _ `R3 P  Q 0Q(0  00 0P pLW@P@T J P0S$P @TZ@WPB@TPZ& ^00$Q d0 R0 l D(@ Q 0Q@m,mm(m1i(P 0S  0咮 卮d2i -L M`4 0PS |2R P(K Q 00\D2D @2 A0!/@!b0SP0p1`l ] @V; 1_ ` I ]  @l~@T 0X0 Q 0 0@Cp0PK 0sE 0sB 0SSC %, p 0X0 0,@D000  1  04iA\,K , ` PW,pK†@ , `F 0V0C 0,00C0  B rPp 7]7Pj` PPe`P$Amgfff -LM8 040 2 P Ah 0@!q#W< t 0]0 40 0S Wt4@PW P0@S$0S S  :Pz W ,v^WY40@P`0 <0 `P!  000W@M DP, @VJ0 1P5@@TZ,0S(PK ,[^,A^U @0@0"W,K^0 R  \(K40, %^W (P0 0(P00 ,^A 0=4  @@80P @X, 0 W B A ,]P BP,om00S SPP -@LT 000S S S 00h0S00 S  R  R 0S00  000 Z> 0-@LP0S 00iD 0h\0 -@ 0LR )  0S S S4-00> -LLMp0PS/@ (K iQ0@0̗jQ@h VP 0D H0 D 0 BpKp@ h0 l @P @P\`0S&@ !@(!07@PTX 0R)@ 0 / 0=@P  t P  0(1  $ (1 ( 0 ,  0, t $0$ t0 `@ʚ; 0- LR@ 0T00#0S 63P0PP80 R  H[0h0hB[m -LM0S@80C hR3PU/P,߭hP`* j0p 0 ѫ 0 lK00@0 l0CdP DP h0 l < 3PPX@T TDK 8TP C!"0P$KP"@K 00 0 ˠˠTXKD K 6PPX0pT0(1  $ (1 (0,@ ,@"8 -0LS@ X0S0S S Slh0h LP D ZP @8/$0$ 97>t2ix2i|2i2i - QL@p`5 PXP Q00S0v03Q0SQ<\)L)4))))))d),)))x))|)))))) 0S -X )Z & r- 0Sr et P V8_TPE PC 00 0 3@P  80@ 0$@80<@,00@( @ 4 00 @5U80(B8Sf S7 S5 l"0S( S S Lxv R P00T0P 4 `0 a00400P 0l 0jZPU0p 0"PI UPIRN P`40 0c c 040 P0 b0b0 PXP0=0Y0( %W 0S80 P@QP 0P7WPXP0Y0P90 PP P, >m> >>d2i,,,,0  LmPm8mm 0P0P 0Pm8mLm0m-00, C6pǏ,0( 0S@ 00S@0@`0P` PU`0@`0d@P`` R$0$0$00 $0 ,0,( (0S@@m8mmmPm\mLm -0`VpL, 0!V#\- 00C6OPU`` P$0$0$00 $ ,0 5,0, 0$ 0, 0$0 0 0`U0U0װmPm(> -00, C6LpPo,0 ,05,0蠀0@0P`P`0 0 $ 0p<LP``0 0@`0d@P`m\m@mLm8mm -L$$rPmP@m8m\mLm 0-@LC,0P 0P |,0  FC,0  ,0<,00,0  <P0D> -LM`@PCKp<H@ DP N@P ,0 @ CK,0,00,0|,0,00,0u,00,05 -L M*!0 C6B6cO`p`VpࠁQ 000S @d _,00AS00L1P&O0d P(qP03! 00a&0S0@00R 5 .0@W R00C10/0 @L Kd 00?2c, dS0d00Mi1omi4A8AHmLm0mmL>fffdmm4mmQ 0-LQ0D0 P 0@:P 0 0h[mdm p-@LC,0` ,0;,0,0 A 0S `10S,0,00,0P <,0   0S10S 0 @_Q t0S'0 0gzph!B0S*,08,0Zzf,0:0,0@,0 ,08,0Iz00Dzp0S8m4mXmmm 0-,0L PL,0\<P,060S 10S,0 *   ,0  ,0  ,0 # 0 0@ 0$@,0@ ,0 0hV,08,00hy,0@0,0|0,08,0(0 0@(0,@Ǯ8mmT> -P2Lh!H2 9Bp8WD Y 2 0PoPVif ?pP2 1 0PoPV30 2QiA,0 :0S ,0 x!0S  P2D4!0*A pP !0S: !0zUt0SY00S0p RA꧉,07,0AmKUt0Sʒ40p R4 0S 00Iy,oXmmm4m8mXmTm> 0-,0LP @0#4 R21C 0Q ,  , ,0<,00hv,00,0~A@<@$ h0000h|li`Ni,o - LRpd 0ST0(, P00S $0@OQ XB x0 0@x0|@(P `00 0@004@ $ ,@,0<0,04AP0h  0H  H @,08,0L3\P6X@ @h0 0@h0l@b@,0m,o -HpL0PS` 0@4@ R @,0 ,0;,0H` R -U,0 h,08,0hnx -1L P@@@0@ Dp@ `P 0 @_R 0 P0OT Cx m?p0 R0S< [kSt0S0p RLmm8AmmTm -SLM<0 0 8 4 @u@ , ʢ`P C0P@0 @P< p4 00S 8KP8 K t x0l p0000<P@ PR00 3`< P,?(K4@2帢 , Po0PVAt0Sڀ2|2 RA<@l>0#6pǏ P`P?`VU@P3 'P < P`0P`OV t0S\ڼ0 ?V6ڬA!0"A wx1t1 R U@P\1\!h0Q L1 Q @A,ew4!0jx,?p,0@;,00@@f =lil|,>pgUxU &P0p Rq80p R,>pP0 @dm!Ce2immHm8Am4mp>Tm,o|> -L@ 0P  -LMp< ,0 & > 0PPQ?K` Tp P PP ,0 ,0 8,00l w@>T P(KD@0 0@@0D@, , Hg>>m -LMp,0  Z0ST0(P Z p0 0@p0t@$K0 0@0@,0\9 0,0P(` 800@(, 80<@ 1 h000m,o -LMP @Pp, Z `@P` P U (Ko, 1 -LM@h -L(M@PH `v>0~pW (K4K 0H ,@K@40 PE,04 @r,@ TP<  0}SPD < PR/JD 1`PU'J0O U 00HP`F<@T D1P @,0;,05< TD R0 <D0\ 1@ > D8 1P(`80 p0@(, 80<@ /,0dP`90,040K tx 0`0p4p8  08 D0 0O`0@8<d0h@@\, 40K)D t0x@, 0D |00H P(` 80X0@(, 80<@ /< h000600sK/m),o p-`0`` @X0TLP0 Q00cR0bc00cUppLm8A0mp-,0D 0R,0 L RP P0X0P0 L P0H pP` P`H0 0@H0L@pPt`p|mm -LM00PC6/`0`,0 R0dp`0dPh`ڈ6@ , 000v00 @0 @0 0PB&@`?S RQm -LM||@P0@P0 0<(6@0@ 0 @d`hp0` \mmm 0-0 LRP@D0arN0@0o 0-LPQP0P x0P0 LP hp0 0@p0t@D@0D0L0P(,,0 -0|mmodm p-D`0VLPD0 ,0D03L`0SLVJ ,0D` ,00,0 R  6,05,0 RL L0L0P00PPp0 0@p0t@pL RP0P0P00L P0| 0p@ pt LH0 0@H0L@00tpohmm|m -D0LSP 0H@ pHL Lp p`P 0@P0p L0^0pt ,00,0ps,00,0m|mhm -D0LS L @RP P01P0 L P0 1p0 pt l!H0\0 @H0L@DD1 Y$*(!p00 @p0t@00#6 vP`d0 `o  8 800CX:6D`@圐XthQtp Uh 0 `U 0t\p^|mmmdmo,oXm,00,0z -0ML 0 0,`p@P0ʠ @ @PT0T` P'HH0P h@lP`p@tPKhh (Gi|mmdmlmmm>0@-P@ R( 0S%\ ) \ ^ \@ 00\0 S 0  0S R 0000@00 R P,  R/ 0\00 S 0  0S0S 0P@ 0S@@0  @0@000S00S0@ 0\@@  @0@- R 0S^ 0Sk0 0R 0SI0SD \   R00 \0S0  0S R( ^ 0Sm R 0S 0R00S00 S0 0S    R 00000 \0S0  0SR 0S@0T00 S @0  0 S 0R00S00 S0 0S    R R 0SP0U00 S P0@  0 S@ y -LXp5 PU?P0S`X`V 0S@ W`RP 0WPP 0RPPV 00SZ  `X `V 0S` P 0S0SP0SP0S  P 0S0SP0SP0S PQ00SQ00S p-` ML<@m -Lp\ \\ (`VV , $0R \0@HP HL 00h0@@P P@D 08 @bP:0"09F@`2i`m 0-00LS@E HR 0<10  0  B (P X(PX0S P0Q 4 $0R _U 0hzQ 0S8 R R:0.SR 90.S R$0$0$0`0 $0 0 <R  000 0   0  B mmm\mm 0-0PLP (0@S (0S TH0P (0@S (0S T0|zmm -@\LP o\PXP hXP 00S0$000$0m8 80R c99o p-@LTP `P`@@T@p 0-@LPT P@@T0 -4LXM@h3@Q` 0S0 GKH0KQKXP   0pWb 4 $0R |3@P  @(KPP  0 0@00 0p$PW 0JW  )060 6P0"0 RP e*@P060G  )060P2@P   I*@P0@600SX 1@P  ^@ 0 0 p @ 0 P0t!0 R$$0U: ?D1@P W 0!0 Rj(0 0@(0,@ @) ] 1)0600@D90P  0@P  A`0@P @p: ,0@ P @ $ ,,o2i`mmm p-@LT`P@P  R0T 0@ PPP@p0@0@@P -1`LPpP* 0S'ʼ弡 0R1P mW0p$0@40$0 9,0(`8 X0S; XP 8mG(1PuW,  W @0@00 0S 0Rڼ0P m8 RR:0.S `0  $0@` TX p @0 0 0R 90.S2imAmmm>\m -L M0@0a1, 0  +'K0 Z0 0P` ,0  p 040 0Pp@`Z !00,0 0(K M-LM p0, 0 `U0@P`pG } P 00 Y W ,  ZW,0S (KoW(K, 00, (Ko(Koq -L\MP lp\ X0 T PL T 0@0@0 @0@ T0 \ P@d@ `P P`P`U P040h0 P 4 h LP(04l 3l@\, 1h\ 0OS"U`U P ,KtL 0'PPP@t0sI ,T\ :PT0p PPTt00@(KhT 0O4 0 T SD @ "40\@D`U`H P H@@h D0Lp @PP4PhP TpPXVx0sPTP Pt0p 0@V P@4@h@ tPP 4Th h0t$ɯ0 QdPx0 S`T  0O 0 @UE PXV@4 K P 0R< 80 SHP\TP L 0` B1LPH'P< @UU+ pITP0t p H@4 @<@K0@ PpP0LPP4h V 0Lh PP `d0K0@d0 `@ T@0 0T dK(@U:FU*+ 3I<KT  PPt00@@- R00 RP00 10S 0<02i 00@Q@- 0@ 0$@!001 - L0; S m! -@(1 LRhq5 0 $  \kP$V T 0P P T 0S T00Q0SPkV<0f<0P 0lTP PU  0P ,",o> p-P MLhh 0PPD0D `VPP@P U$@Kp>m2i2i -@ LP ( R,0,0,0,0$0 00tk P -LMP,  @0=   0R 00P0 ^,0  0R q0 Y t/ W> X. WFʁ qp tq U<9 Xt0   0 0Su0000rtuXYTU0SVt0 TY t6 q: R Q W t0 00R XY V qrruuXuVzrQ > p-L M0PK0%@ `K0S 0S  0`%PKp  -LpP01 0101 P`u 0P@`PU`P `400v0@0 @ -@L0'K00C0h:m 0-L@PKUT00460P0T$0 0   R0m83i -0SL 0R& 08 pὗ P` 0S@ 0@ 0p $0( 0S 0 0@ 0R0 @  -L M0P@T$pK `K$0   0`x@P ]0DS R)R)R)\R)0R) 0 0 @K 0 @ 0@ 0$0 @ 0$  0@R  0S v 0 0$  @ 0R 0 0@ -L M0SPIJ@PN d @ 0@ 3 cHQ d0S\  0@  0S @ K  `V $ (0@(, P$0#0j0@S (Q,0, ,0, $ 00T 00F` pK'`@(K 0P ( `P U)m -LM 80@ `"0 R\ 0 [  _ P|0P0C,P SP%0 ,0S 0 "xP  00W(0$  PX W(0$  0  R F 0  ,0S (0$ u ! 婜姜,>@> -LM,( 0 080 R0 0`(40 S P< 00  , f"<@0/S D 0S/S 0S/S0dS@0 c0/S ,,0SɌ,80SɌ,,Ɍ,@0S , ! 0U D0U 0,P (0PN  "0Sy 0Sv 0 ,  00,P @PD R,Z, 0 jb, D@0,SɌ,P0 ST@T$  "- P,  !,K0 p W^u ,P,P0 S SJT30 S ( @<@` <@ D 0S/SY0c@ 0/S^0/S ,`jnj ,WPP~,  (00CSP  z40S,r @Q p!0.SM0.Sʌ,HIS,hR 8 @0! RN  T+ 00(K0/S 0 db<0@S@ p0S4 0p03R0S@,PɌ,p@ ?@p u pt,@0 R1(0$ ,  0p \  , 00S (0$ 4 Rs (0$ o p@0 0 jȌp,0 @pm@  -L(M0,0(! 4 p(P 0S 8+0 `V/ R+ ,0 80CQ 0S/S0/S{L Q0$0 R3  0/S dq &P8啒 ``8叒00(K@ P}8(0S < P `Pu,0n 0`"\ RU $0S0$0o0S8$r0`0K4 PP 0PK@4` H0 D@ 8 `8l 600d R8 `?`0PS8Zmm0@-P@ R( 0S%\ ) \ ^ \@ 0 0\0 S 0  0S R 0 000@ 0 0  R P,  R/ 0\ 00 S 0  0S0S 0P@ 0S@@0  @0@ 0 0 0S00S0@ 0\@@  @0@- R 0S^ 0Sk0 0R 0SI0SD \  R0 0 \0S0  0S R( ^ 0Sm R 0S 0R 00 S00 S0 0S    R 0 000 0 \0S0  0SR 0S@0T 00 S @0  0 S 0R 00 S00 S0 0S    R R 0SP0U 00 S P0@  0 S@ y -`LV@3 ^=0S`PVPU p` 0S`` TPR 0T 0RU 00SW `PV p PU` 0S``P p P 0S0SP0SP0S  P 0S0SP0SP0S PQ00SQ00S0-l@0l S0 UTR p-@LTP `P`@@T@p 0-@LPT P@@T0 p-@LT`P@P  R0T 0 PPP@p0@ 0@@P0 L0PP 0S 0RP|m -LM 0 `0p00Ġ R 00@4l 04 0Q$0 $PK @$00$0 08P#8@$00K|li i|m@-0@ 0@ 0$@\0`@D0H@80<@,00@0l0 0P T L @ 4 X (    (0S 4 R808080 Q(0S40 408080000  R0S,PP000 D000 ,0 0,0 ,0 0 0 0Tm,m 0 0C 0S0S,DP000 8000 ,0 0,0 ,0 0,mTm -L@p`\ (0S 4PPU (0S \ -L M0   K0 P K0)-2L?0\ \ T 0S0SDmT0S 0  0 R  R T 0\ 0R0S R 0-L$@ P R 0S   00S P 0$0$0@- P@P -0A0@r@P - pLt 㰐,0S+ 0 ,\`0h h0dx<0@@pP`0LP T0X@DPH`Z ⧎BZ ⢎YZ N➎eh i虎 -pL@T P` 0 `@S PQ 00 R 0 QR02i2i p-0L@`T  P @T ׏P pH0@Q @`0(0S pp2i2i 0- @RL R000 ,0 @P D0S& 0S0 00@P00DP0S S t0d 0?T0 R <0< CL0Q0P0P0P0!Ce3iVUUU -LP  p R R000   D0S 00hDL0\0P0P0P0N!Ce\> 0-0LSP@ @00CST00 @0@ @0S0@ 00@P@0/l> -@L(  tt0P \ 0,0 ,0 0@h'0S,0 ,0,0000@0,mTm -L@p`PHH\ 0 aP  -L`pc(D@PT! ,0  R ,0@,0$ m'0WSA(D@PTW 08 D0S 'h'媔>> -LPp` (0@!D0S j' 0 @Pd(H0@SD0S V'`'@ R% V@ p0S'PD @VP p0S,0&,0 X,9,0;,0@U@ RDP) V P @PP p0S,08,0` 0]`@P '  ' &@VR >>> P-L H00CsH0   S 00Hh!_> p-`LV@P,0   R000   pH00H0!Ce@-Q @P -\ 00 R 0@)Y̮m3i -1h!RL PpU. `PU , 00S,0` #'@@_w&eW`pGZ`V Z L('P0@X PU`(帒 嵒,o2iDm'5 >> p-LP`\@0^0$C! I p\  @P @0  0S p@0@  0S pp$3 0S p 0-@LTP (  :000h) - L@0 1 : -LM@X `RR RN`0SKRISG01 ;딀PTX XpPX 0S ` R,p  X`0,0 \HpP  1:(K` 0S 49@pP0Sp\" p0,  P00U0Sp0p00p$0 p4@pP$0 P<$0 dP7p p-0L@P`    }P$0<$0pQ$0<$00 -L MQp@@ @+ R t1\ \ 0R@@@A 0,` K0S S S -`0 KiV`0x  KimVQ0PU 0S0S PU-` $7:$ @᧊0 00 $P0PHV `92i2im -QLMp`0T@$KW00 9P@ $1W -0T 0CShL@0  h0S0 h,o -LMP@U000`pI<0`9U2 V$P7U 00CS0 u0l0@3'0,  0  K 0Sk 05<0 Ki\  0~| z5i>>4> p-0L\@ !0ph] (0S  00CS'0 S 0p$ 0SYt0S ,`Q00000000 ,0S,0 ,0,0000@0ph $TQ 0S00 S2 T 0S00 $ T0Q( P`Q T 0S 0RV`V 0;0;0$ 80T0TQH>,mt>`>P>0hp,o -0L @ T 0P Q T0  R 0R 0r03P0S 0  -0LS : - 0RL@h!  0 0S 0S 0S 000 00CS00-,ox4i 0-0p 0CShQL@0 0 LP 0Y0S0.0,o -0L @P`  P<00!q\P0#1pQ  RP  PP 00CS  R0 # 0S , R 000000 000", R0 0 , 0 0 , >,mTm -00CS1!h2?01L`P@p  0S 0S2o@T @T T 0S @T $7T PT0PpT 00T PT0PT▉T`  + 0;0@ WP Y0S    0 0 H,oDm -LM 2 `h10U0 4 8 ,0 NK ؁A0 ?0S0 " 0`"1 `RC!0S8 P@UO,PUL P, R0000000, 00    *"0S ,0T0000@ 08040P0d@(KT`p 0S 0S " | Pp \0P\ `0< X 000!4 008m,om4mi,mTm\mm> -p0LM@Pp0 $0KT [P00 $`p P$  $``x4i  7 0- 0LSP@  @7P0@o7> -L0p @T( `@U 0 PPt0h!0 P  PՍ@U`V 8΍W ,ʍ0p @T|m,o>>> -Lv!P巍L0Q P 0孍h$婍 b>m>>Dm -0LP@U3 PU0 `PpP Z6@rp P 0$0 p0 00$0$(0$0 ⟈/0B0Z 0/YZ 0*@2i p-0 ML@P|@@` 0ht@@PGX 0P0@P?@ @@0 P0PPKphNA8m$>\m,>mTm,m|m - L'8> -0 P0@L`p\!  L RP0P0P0    0EL X000 RL L0P0 @Pi 3i3i@m0i 0-@L0Q 0(0PP'!LQP0P0P 000x P0 -pPWL(` `0P$@@0$0 0 @$0@0$03i p-LM0K@ `P000  0P` Q/0 ?0S 0 00^00x80 Q$0  3i$i(i,i3i - L h0@P H T0R D D0 ?R4 0 004im3i 0-0@0P 0LO0 000@m3i0i-0<2 -L@gP 0S $0 R 0 0 0  -LMpP`H P' 0$ 0$S0S 00T(0 $@ 00 0@(KP H K0S -L M`@PpP. 0+ 0$S%0S" 00R$0 , (  00 0 ,K$0K p K0S -LMpP` P' 0$ 0$S0S 00T(0 $@ 00 0@(KP  K0S -L M`@PpP. 0+ 0$S%0S" 00R$0 , (  00 0 ,K$0K pߚK0S p-@0LM 40 0CX \0 8 0@`K`0 0@ mPP KpL`K(!05PP(1 Q .8PP0S0  p-LLM@0P `40 `K0CX \0 ` 8 0` 7P L0(@`Kp -L0MP@Up`( K`P( 0 ` 0S$0S ` 00CS 0 $K(940K 4 @` T0 P <` 0P 8p DP (TK0L0 H@  ,0KL0K( `0 @ V( D0( 0c0 -LxM@ (PP  0S;$0S7  0S`0 S S 0 0LS 0 (K K0tP | K  0Y S 0 <0 0 @<0@@  0 p-LMP8 `KL4 X \ ` `0P m@P L@T H8KZHP }@Kp@K 00 0 ˠˠ HLK8 K @PL_0 0 c -LMP@ hKL< ` d h @8P &PHTp1!Q 00 0KP @ 0 娀 PP'@`T 0SA 0SP WPWA U( KV7 T@KPPxƁ@KPPxv\Ps0币u KT /`@KPT0@ KVP0SPUP,,m -LM @z -LMc0p p-LMP K`P x0$@ 0 0  `  00CS 0x -LxM@( KPP$(`0W00# 0 0P$  O0SP VPP  ( 00CS 0 $K(@K|` xp (0 0 P -LxM0@( KpPP $K(0 $`(0$ P  00  5P0 R K (!0 PP  4(  00CS 0(2꜠KP (! 0P 吀 p P0[S3i -LM Pc0d h0 l D @ -$0@@0$0Lp`-P 00$0(!0PP5 0PUU  $00#X00S% R0 00  0 P 0T0 00C0PU n/& :~|md> -LHMD0 p<0 hK0C` d0 h @ 8p @PTP(1(` R *@P$0  @ K0  ,P@ 0e@ -5LOM@pQ`*PPڠK Z 0PP (KD0T0  0CKXP x |0 倠 Pp PPl 0<PK(!0PP.(1D!R *PP$|*P  -( `$0`(!0PP0S P0 T@ /c%( T! $0X1 -PP(1 Q >*PP9*P  X!`` PP$8$$$"2 00$ p0K  PPT"0@$0H M$$U$X$10SY VJTUT!000P  0@ ;$0 :, 0   0PP! P00 8K0  PP]00ST1 cT! RT! ^ T1 PvPT0S\1  P aP $T1 0 T!0$ 48$ 'w(1$ \1X1 SX4i^P*i|m2i -LM0 0S K- -L M0   <0S-K K -LM   0 $0S-K K -LM   0 @0S-K K -LM   0 D0S-K K -LM   0 0S-K K -LM   0 0S-K K -LM   0 ,0S-K K -LM   0 |0S-K K -LM   0 T0S-K K -LM   0 0S-K K -LM 0  0$  0  40S-$K K -L M0   L0S-K K -LM0  0S-K K -LM0  p0S-K K -LM   0 (0S-K K -L M0   h0S-K K -L M0   80S-K K -LM 0  0$  0  l0S-$K K -LM   0 t0S-K K -L M0   x0S-K K -LM0 0   0 0S- K K -LM   0 X0S-K K -L M0   \0S-K K -LM0  0S-K K -LM0  00S-K K -LM0  d0S-K K -L M0   0S-K K -L M0   0S-K K -LM    0 0$ 0  0S-$K K -LM0 P0S K- -L M0AS))))))))))))))))0   H0S- K00 K<0;0 -LM0 0   0 0S- K K -LM0  `0S-K K -LM  00S K- -LM  00S K-000 -@ ML̠ 0 @PK$K p-@PL@` P< ;F   0Pp|>$ -L|M$P@`\(  (0 pP00V00S 0,! @PT Y  X Q P00S pp$K(!KpP x00b0at f@ -LtM0(!KPrPC l |s0K0 @  00CS6)\)d)l)t)|))@0K4;DL0P@|0KpPK`D0H@dKX0K P$`80<@,0 0Dh\P@tPH`Lp 0(4@@TPX`\p (K  $ -$pP LR3 ``(0S $0 0 @ 0 @( 0 J `00c@  ;  0S` ` -L M$p 40 R0 0,0 !P`Q VP! , 0 @ RP 40  P000c@ , (KUP -L(M`0 p0K@0 ,0 P L H0 D@ < P8p 4 @( W0 PKX@ Y@00 (K0 PKX@ Y@00@0 S T R@ f -@0L0C0P`p W0 @{ -LM(0`$p @PK 80K0@ ,P 8@ 4P K 0 K -@0L0Q00\0S  (1 S ppW P`V  7RU0 ` b 0a0 -(0L$   R02& 0GP -LtM0p`@(a 20 S] ,< D00( ,0PP10S-PK S>PH K ` 0SP< PP8 0tPP1  0Sc  0FPP%0 H000(K  0,0@0,0(PP0S (0P#  00l PPSPPK 00 000 @ 0( PPk  0PPd@;0  0 d0 '@KP 0@|@ xP PP -LMPhp, 6@P t ?000(K`$0 00 H @P00$00\ $00 @P 00, @ ,o -SLM 1 P  0K(!`P~ <(p0 \2@`0 0h t K\ t@ l0 d@ X@ >`Pp!PRP u 0 S  ` @K0p`(!@ P 4`KTK,0KL H T` , 4p 0 D < 8 zLK `RP  1 P!D0 c\)ڰPH0S6  `\ ڰP<0S0S 0@b1S"`#(:00 M(K ,0S `~000w@@0S0`n@`T!? -LM `PQ4 0 , p0m 44 @P#X04 00 R@080 p 0Sj0 '4 00 UR (0 4 /40SM 4 @P 4 ,4 W000Q4P(K8(!0@P*4 =80 04K,K 0 K0p@ T0Q0A/ 00  A0,0CUS4 0,@  PUh0P,,@ 0 K0`@,@0Q 0A/ 00  A,m -LM0 Sz`@S"`p?à@ @( K0D0"D0P0`>`P  ](K, ` k` - L0S 0ET0(  40àLXi -0LT 4 40#"B ,0S -Xi 0-@L0@PS <00S%40"!B 08m`Ni00CS#)p)p))))))p))))))))))))) 00 00 $00 00 0-@LT 0 .$ àlL*PPT  !88#!$  T@ E0 00e0Xi - L -LM`pT 0#((0"4S@)@\& Q  R1@\00 T(K "88# "$ 40@P T00   @ T ( 0T #40CBD * 0| @`T (( 090d00(  (0T `0d;0Xi -Lat> 0-LM0T  PQ%4@ Q XPt HL 8à L8>`NiXi -L M @TP P@K - LT0$ "88" #$Rs> 0  T 0 p-P@0L  ` @ T0 T00 @p 0  T 0 -LM@P T0R p  R s0 P  00`@ V. (KP@ *40bt f (0P0  0f 0`P 06  0`(KoP0  *40"!B `  YW 0,1S 0 R0,!0 0  0 `8>Xi`Ni -PL0pS( D@`T ,0  R ,0@,0  D@`T0S  0s>> -LMP`( T0R  $01 (4Rp R@% 1 W#*1 R 0s 0 2!1C0QX =@PBAD 0*T @D1 W:@0s 0 1P3!2C0$Q1 P}p , KP ,0S$bP3ᘐBC $0S000(0 @ * 0 @q@@P |li̮m`NiliXi -LDMX @`P 0S S sr 0SP:X@00 T2  $ R21C"0 @T `@ K0P|li`NihdXi -L0M @P 0L0 0LSP SW qL0\ f 0SbP@"T0 4 R\0@H0 D@ *0@ <0 8 ,QZJL \UE L0HKP`4;D P 0,@KT @-,pP8Tj@ K T 8T@Ph U P! 0dDUP!L g4@ T, P\P LT0`! 40àL   P (K21C!0 @T P4 K0P*0P P) 00C C  ؿ 0S  T R P L4O0s@H0 D@ ?@ <0 8 ]L0eL@bL _L\>|liXi`Nihd  -0@ L <00 <0 > 0-0L@P 0P 00 -L@P  04 -Lp$> -LPp8> -L@P0 {pL> - Lo\> 0-LMPP @ 0@K0 0- PLP ,0;,0@0%0tP  0h -LM` C AD_X`@Bp @P PU, `pyu Ÿ0Sz < 0 3< 0{.R0 * 0r 0O?0@ @Š c0 PeP!0P p!0PQ ` cP!P10 S<1P8! 00\: Q c02  1(^{>N 0C"(40 0ȁV000W 0@P` < B2MϠNl尀,0尀h0T,\0S0 S0AZ1DmTmQPmnm\<\<Lmk_k0@-@PP0  U0   R 0U 0  P0` R.00  \@ R (0U 0  Q000^<\1C0 0C 0S0 00n 0C0p 0S p/SN 0S~0S0 00n0C000Bp/SN V:0S~0S0 00b0C0/S 0S0S0  /S 0S 00L 03 0A0qQ P@ R .RQ4 0?AcQ 0?AcON -`PL@p`@0!0Sအ0 <P`lPh1 X!X10QP4!<1>A Q  0PP 00C0$#Bb2 0a 0>'R2 !0@~`l"`  Bp@31C#0 ` 00 @# (k\mXm\ R0S  0 0-PLd@f P 0 0= cd0 -LM@p( $0P PK0`K9   4 00     S0  00S K$ K PPH$ d$P dS $0 $0 T $0 $ 5$ #40$ 5$ #40$ 5$ #40$ 5$ #40$ 5$ #40`$ `0$ #40S$0d   S0$ d00#400S0$ d00#800S0$ g0004 $x0s`00#8004 $x0scW Pm z V XT0 s0^\ S0 0S0e 帽U Z -LM@0 pSP4` x0s $ h jP(K d0WlW;`0 00 , `pdX01Y0dp$00W 0, r 00K@PPX0 G2#,p t0Q= x0000s7 3PdX0A1A ,0KPPdX0A1y\0080 Y `X ,0H `0Cd04K PP 4帻 JPPX0` 70bd040dD80cc 494> -LMd@H0S` 00S` 1H0S L( $00  %0`H0 -LM0P@4 x0s` S0p`d R#*d0X  B2!0C03r T0Q` 0_`P0$0dP0i/d 0pj> 0-L> -80 LP; 0+0UAtmpm`m -@LplP`0p8< U##00V 0` S 0!40X lἷ@-P`@p h\00|0S 1Ph 0\ RP00  h0Q0h0p0Q0p0x0S0#x0% -L MßD D@ `0 <` 04P p `\0 o ^d0( K0`"00K,nQ4 |P#000W{x00 00 s@0d8K4 K@0Kr4Q <P 4p c @SPQ0t `P2t0s D4M\Z080P᧵x0sc,t 40u@Pp0, Pg p@ X,0K@P4 Op W0@t0x@4 , 4@ B(>mX>xm -LMP p 02@$p  0 !P  0P:0RT0S$pD0 X1$^D   !T00T01 01$pP0S5:0lP `P00W0S W( K,0K($K ,0PP$px~D 04 0 0, $pᘳP K$咳 -LM4p`P4K(K 07@P$,K(04KַP,(0D R:S 0S Q0Sc$K_P\,V -LMQ@`PdX 032`DnP6"\050@0 0 P喷pPX 0\ D `X H0N a 0PpP 00 -LM$@ 40   -LM04`<0  <01PD p,K8 K0PP40K,08KGPP.0, D0P*0@SD0 @0S0S 0 ZP 0, D0 @0S²pᾲ(KUP0嶲<\PP0宲<00<0 -LM4p8K,K 0Q@P80K,08KP30P,D0P *@,0PD0 @0S\ 0` \ pZP d jZP 0kgpc(KT0Zl>x> -LM00( 0C4Pp00 @4K,KX @D4 0`P1(K,04K営`P-(\0D0 R (0S  @000 A @D\0 0S (庳`P 0\ 00T00S$K ( -L M, ( S0 S0 p`(0S$K``0\p \H 4`x0sA ,K`X H `0Ld0 4pP@,D0 @ 3  YP,0x 4qP0 40X`0S( U$ q@0S (0K,宱 (0K,p pP(S0 `@0\p,p\ W,,p>x> -L(M(PdL ^p4:dX0  a<à  0, `PX0d ,(#d X4K>< K,0K`P( ,0H S\00K H 40<K寵`P00(\ D @H QYP MYS0 0 T0 0% 5#40% 5#40% 5#40% 5#40% 5#40`  `0#40S dS0d00#400S0d00#800S0g00040x r`00#80040x rc000,0SK-D  @  D 0 @ P: ,0 @D0CS,03(0\ C(0s`P< K0 (4K A(X>}`P0K40<K`P00\ (D @d 0g(K0婰0E`PL R S0 `, x0s P0H0  H L0,`@0P,` H -LdM 8 t @0|0 P x d ` 00 4x \ `S0p p(K|@ 0Pp |x Pp | @0l@ ( KK0P Pb P0p0 X T  \X0 0R   S RX q P `m 0Y 0 S0C R .RY0h0 40 d0 p0K`d@ K,0KP@\8K00@Kd@P20P88PD 0@ s 3S00S9 X0S`hp R PP pdd ( X T ٯVX `hp V0fh2h Q 0\0"'p [ x | ᜻0p0 SX`X 0\`S  P~ T0S08\ 0 0  80KK WP`(p`0,0\0x 4r` ,0SPZ V,` PR8{ v 3\x0s00 @`Ru P 00R00SQ  O u | 0Pp ``0S  Z Rp \ ,40KPp l 40R x0 0;0|t p|X T `\(pX 0B,00.S  R R0.Sp`R ,` P ``0S  Z R= |W| x 0  x | ׺P0  u | 00Pp ``0S  Z Rr |3| x t0 40@hQ`M0p0 h8Ϯp@ dP p `\ ,40KPjl0S P t |i06040x P   `00S | 0Pp 8X` 0A,0h0(0l0\;0p *t p|@0 6p 0 t |60\60 ,40K@P!lQ P  &40 x0 m\ ,40KPp l0xS40 |t p060|t P0p@ 6p@ 0t |P060 40p d 00  $00 0-L`P @2P004  0 0 -LM0K@`RP00 0  -LM"0K@`AP0   -LM`B`0$0 ,` (  h0PSp 0S\, KU  W 0P$  $Kg]XX*> p-0LSP@d0 0< 0S  `P  0P hpD0S 0S p-``Pd0,0d Q L0L@ 0@T  T0@0 @0@ ,00@$( Z UBZ U ex U t qWp -L  p'`P `R T0`@0Q `<  ;$0 :$0`" -L8MT0Pp #@P (KPڈ7 U@ `(!0`` @ T$0040  03@P(K@ H H :f@P# T0``,P j4 0R # Z P < E ; A`b,0; KD@w `0 4 !0 4 !0 4 "0 4 "0 4080 0$02 0$08  24 \ 8#8R$402@SQP  0 400 0,0 0 @400 0002SL0 $PP80S 0 40S0 x0 0 40,0080 0$ 00020^v 8 0Br \p:0L m0Qj 8^g 40@<0 Ta,0<!<0@<@0 x rD 0,80<0@ L 2@?!04 H @D000H0`T k80D 4t0LP QT 2R"0D  0 D0x02tQ0 08l0l0K0P  S0CP0l04p0"U0@4 C`\ d0Ud @0RX O@@0 40,0P 0 P,ӫ0,0 |QKP0 0B P< 0P P @P$00104P0010h0 0`刐 T0f"0#4X0 @0!@.X$ 0,00@0H&0%< 40| h0  x0|40+H#13 ׯ@Pq,0D@ lSP 0|0,0, +, ,g0,0 yT [SP@ USP( OSP Жm>>_< -LMMVKp\  x P4}`P$0 ` RC-` R3XP K Z 0~`P (KKX Z 0~`P KZ 0<p @0,0 0CK(` 0000兿`PP0S`(   LPy010 0$00(!$00  $0`P ! $0T h 0 #40S`P $0 LM/(! 0` fV$0F 0S`V`R0 0  00 0 0@>x0s009 ,Kz@P)  `_U/Ks`Y KZ Rg@ 0(! ` Vt B 0`,0@dP,@B_Z[RP\Z TZSRYOKZ  TZKR Z T x FR|liE0 d B40R+hg*g*g*|g*g*g*hg*g*g*g*g*g*g*g*g*g*g*g*g*g*g* 000    00 005w-|`| @!0@`$dP#r"XX 0' @(?0# O $ Y `@&0#@8^nCCX좙N 1s s s 40<0@l00l 0<0 0<06ih6ix6i@l R0l0 0S000-@0@Qd0 d08@P@TP0 @$P @000 000! 001@Q@- 0@ 0$@!00100000@Q 0 S 1 91 0-L M Pdd @0 805K0 p-0Ld@`` $0D XP4%(P%(P 0 0"$Wp>>dd> > -LM0 dpR 040`V  PR00` X0@0b4` c SPQ 0P -LMp 0d0CSDl0tP`S u*  T 0@0  p0S40@` X0b5 ` PVQt @P 0@t0x@D4PtP`080v@1& t0sx0sBX4>0d<!0d< 0d < -L@3- -L@(- -0 LR@d`dPp %pl0lV  { -LMPdPdpWkpP 0@ BpTl`lYpPᏲ 0 pჲ p-L M0d@SPP Kp$`K$0 00 4 0 00 000^\ KS0 0S0T0XV B00Z<0 -0@,LAOl0 zm -LM Pd@p`0S ( d0R`#:#Ob$K贠K Ol K`P 0 !0 044Ka0K00  T` P` $0 00 ,0 "0.00 ( K0`P0  l0 ( 0\K^ K`0K0DN0VKX Ka0[ 0a0K0 ZK0m -LM0d`` 4pR ( d0R#:N(K@0K 0@PK<@KCO00 p $0 00 0  000 `X 00H `0Cd0 PPP弪d@DOD@ O0 D 00#40&[ 6[#40&[ 6[#40h [ [6[#40%[ 5[#40&[ 6[#40x `r= !4 0 0 &[ 6[#40&[ 6[#40h [ [6[#40%[ 5[#40&[ 6[#40x r eP t KP) 0 g00#80- [ `0#80c  @0S 000y dKf Kh0Kr0^K` Ki0[ 0i0Ke@ P0K, K 0X iK\ @ P P0  l0 , 0'0 bK0Mm5i -L`M@ PP', 0 `((0h!(^x `p ,0U ,PR0P (KP (0^\ x P0dd t S0\ P  0S t0Q 0 0 t0@t @0\ 0P l%d0,l0 Pdlp (0 ` l,0 ;x 0d d``0P PQ  | X  Zp0S,{ltPf0 L ,K IP],dPdl Pp p  | X lp R S0mP\_pl_PZ,l0 ,Gp d? KPH00 0 0 XQX  0K 0PV dt T d\h (0d0 X P\Q@0l 0x  *t 0@000.}! x 0 .R?x  pQ ,f00 X0 |0 PB \0S ᛯ x P RWK0S8Ft HpB JK8M?K 4Ml0 ,0` 0( tl @P JK #M0S0th00d 0( 00ht@P 0S x 0x  0M\\X` t2l 0@P Q0edpTt  0S\0` 0$0TQP x | R@I T0`pW9 `X H `0Gd04K @P'4 '4D0px0ls` 40  0x0s ','8  04=@P 0@0S 04呤0TTT,o >>p>L> 0-P@QLdQ0ho -LM@p0d`SP40s0s0s (K0s(0sX0s\0s`0sP0sTq (0$  0R PT!88S(-S0 0S00 00 z (0$ z0  ,0 s 0,0 0S vP0 S 0, S p 0S~ S  0P,0s (0$  0R MP l0  0 P0S 0  ,0sp 0,00Z080sb 0800^\ 0 S0 0 S0 0s (0$ X 0S PQ0S 0 S0S000S0S0S0 0S0 0l(KoS0 0S0dZx 0, S Psn(0$  !qvPTA0sMg00sz80sw<0st<0s00s -L M0,@KdP4p`5 0 004 0 0~ 0000S `K Pl S0hd240 S0 0L004 p 08@04 0Xp 0d0 $w40 S,0DTS0P 8T04 d0(04d \0 00@\0`@ 00 Kd0S 0S`X H a0C$0"@(2"(@1<@00 !!   x0s@00!{ T0XV 0t ,0T D0\ 0^S04 0S00 0\0Z0m -LM@ d0S4p00 0 <@00 !!  0 @@呾Km -LXML T 0d SP 4 @0UP PS00X0 Pd0 0S P(KRX0L4c cb SUaQUs8` 4p L0P h d0 \@X`@ dPQ\P H dD u` X0@P0b# c8! S Q3P< @0   0V: X`d0 ` `6, P0K.QTmPP80K0@0Ud 80jh@HD0cS0! d`PS0!\ lDS@1@!L P0UCL0ST> @0Wd0X@Pp@ lP L l8B \AQU<&`d0 ` `6, P@K.QdT0@K @P,KP8 K0lPP`0K,08K PpPUX^OT(0$  JP 000E꘡C -L]M 0t d0x1 S 4  UKFIt1tA d! `1 @`VA a | Y?K0@ttq`1x2` 8#8R1 `AT@ 0\! X1 @| t1\ xqd|!d0baY_K`W?KPU`X@X\0d A ՞50pa `2 PV1Q 0p! l1 0 W p!h1 x< K00K,@K@P 4K,0<K傥P 4, 80X! cQ!D! 0S> PR `Y?Kp`p Q { da `q p l! h! D!A0 P0S 0@ `pR Rd ` p l da `q h D!A0 P0S Рta\v x!|adAd0faY_K`W/K PU`XX\0d 50pa `2 PV1Q W p!zl!rt1W_K`PX`t1YK Aq 0t0g0xd PQڌ1 00(Kx0s | \ X &0x p40 40Ȍ< \ p@0T P 0B1KhPR OK XAKA[ 0,$0(@K0La Hq t(K0Sm:UKt!P y0 4p! l1 0da `q h1 G01 da `q A04 00,0S00SX `H a0C"0n2O@ # 0@ T1 PA B!KNhPA[(0K 01Bh!UKh 0@4 4YKp l @A h Y_K`WKt1PU`FPV0 0U@0RX{4ߟpq, tAWK^K`PU`Kd `! (4͟W_K`tAPX`V dqRU']0OK,A1KI YoKA1[  L H! 0!0(pK0t(K\%:UKt!TP (PUSKd `! 6x0s 0@T1 PA 0UB1K U0OK,A1KKI@0@T1 PA ?PYK`P` ! t1?PYK`P`da?VtaWKY_K`PU`4_|a 0OY_K`PU`Y_K`WKPU`?T!? -LPMd dP dX d 0L dT 4SH P Sv NX  LTd0@0 @T0ReTPa 0@0@TZPTX ,0KTPSLTdD Z 0MJ TpǏ p X4 RHPd`0@X0@031@ a< QT>QD @PTA 0CL0PP\ ] PXPV X8 UA D8 0LT40l@Q  ,0T0\0(KY  LJP\ *L T0d D 01 HDd0X0C03>\ 0C` @ < X8 9^ 0nSZn< ^ZRQVp l0 T 0\0 4 ^d0l ` RLDd0S*d0l\ R X0P H` \0b@ 0l5 \ Qh0 |tTl0pP` P `5>VNP1V0hR3Q ʧ Ld0 0SXU H d0Pppp֡0 4D8F008p0l0tP`Sm t0s] HT\ dP`0iZ! /L d0Rp:LdP P00 DT 8\ Q,H0d 0S* 0aL\0P00T \d H0XPRH 0Kd0 P:P\ 0םT0MQ0m0#@U];x0s\0STT\ 2p0SH `0Xt c51 a0 QV00 0 m0S 0000400000@-@ 0 $:0S 0O0@ 0$@$0S 0S80 Pl0Sl0SpPm0  00- LP1@s 0P0@<0\0d 0\0 0dPs $0S0 $ f06ixm -0 @LTpP ` @T 0S0S`   0V*LoP `` mp\t0x t0t0" 0-\0L@CTP\@ 0     ( , 0h p-@@PLd `R0d0 0S00ph -L@QP x P $l@0Sp0 p0t0tm0  0- LP \0$ 0\00L06i -@L   000 -LMP P- K@K00, PQT0 Q8@K00, P0S06i6i -QLMP`p@  K0HS}@P 0@R6i -1L@T7 W@2 0pS0pQ+ڸ 0SP$00S PU R `0S p0S Sl 04 R W@0L0PmliXi*m -pL@` P6P <@p ` 0 0 0e0Km> -pRL PP` U @W@1 }CpWP`J>8 rC0  0- L@p'PP@ A`@^0S @:0S 0S 0s $0S0 $ `Wxm -0R,(SL`@ P U 0?녁p mP  r@TZP,@(m  _]P Z@,p(p 0-80LS@P0S  R00Q0 0008P PP YJWJ>> p- L 0`S t0 PUPU 0S 0S@?I ppm -0L@pTP) `0S8 DPV 0R`@TV 0S 0@S S m0  0- L@`%;0pS*\6Tz P6T :D6T 86T Z,6T P6T+ < 6T g6T 5T  5TP0P0|P 5T :0CT (5T 5T 5T P5T `|5T 0T 0CT0S i70CT 705T0P00 0T 0CTP 0P04T 4T 4T 4T PP gPl4T 0T 0CT<0P0T4TZ 0T0P;0w 0CTs@UPk0CT] 0TT 0CTa0P:0^3T 3T 3TTQ0PP 0 M#0OS$,|3`P 0S0P 06P40PH00iL0P0(0P0S0<0"0S l80@SP  i0P0S0D0  QPL@0P0=0P0I0@S0P@@0P00P@00P0=01 @Pp ]1 0 P 400D0P0 i PP (1 T (1 X X1T ,0T P1T :(10SP1T 1T0S i0S0 0R 0R 00 P H0Ts 0Tp P0PP080akB @}fwBlB mB tB@f@oB@nB @wt@|B@vB fB@hB yB}BqB@iB vtgB~fAApBfB{B6i -@LFH0S LQ`U0`0P `U0`0 -LMS00 Sp p@`0\P, 00  R400404 0@0 @ @`0 h0 封 ,00:0`S$P d 00S* P 0 0 $  (Ko(Kxm -LM`Qp9 0Z P 0 PR@T, 8 8\ @T$ 00= 0 00@0\ (P 800S80 4K 0 k<0S101@T(K4K Fꠡ* 0-LMRP  (@K  K(P U 1[!0 !K0 -LL̠Č.Č M!̌K!00 K0 -LM@TPp8@ ' 080 @T 00= 000  0(k`P X4K T0  <0S80080 @T8(K4K 30  00- L9@w0PSt00  0- L@0PS`  0R` R\0 0rp\0: $0S71 $ PQE :0S QH p P!$00S":`V. 0  0`  ~  `0 @ 0  Bm0$00 pP` #P0S*UP "M`0 0 0 0 xm8> - QLM`p Q -iQ Q pQ0 )*00@Tt 0iTP0 @P S pP s0!t17p Q00Q0000 0VT 0YY V  > 0 0i 0   x`xp ,Km>, <4("4!<0 -0 LBM0 P @RP `62P PPK,~K  K0_PP p 0SIs(P0(0D R 1[S01K( @ 0DPy0@-00 \ PllP \@0 SP 000< 80P 000nS0 n00Q Q 00 84 004 <0-00 \ PllP \0 S P 00 000 048#0A S@-2*Qf 1@ 0S'*****,*Թ*Թ*0@S 2S K S 0S0S Q0A0@S. )ڀS S) `S 0S0 S 0S @S00Q00Q`S pS SS SS S0S:00:PSS 10 S R6i -LDM@dK`@P&=T@Dp @0S񟗽L*D*,******\*\*\*\**\*\*\*\*\*\*\***`*\*\*\*\*\***\*\*d*\*\*\*X*@*\*\* *\*\*\***\*\**\*\*\**t*\*\*\*\*\*\*`*L*\*\*,*\*\*\*@*$*\*\**\*\*\**̿*\*\*h*\*\*\*\*\*\*\*\*\*\*\*T*\*\*\*<*$*\*\**\*\*\*\*\*\*\**\*\*\*\*\*\*\**\*\*\*\*\*\*\**\*\*\***\*\**\*\*ܾ*\*\*\*\*\*\*\*\*\*\*\*\*\*\*\*\*\*\*\*\*\*\*\*\*\*\*\*\*\*\*\*\*\*\*\*\*\*\*\*\*\*h*0U*U$ KG$0S< K U0܇0q3U 0\ :0S b0 bS \* 00q`p000 0 0 K10Dp0 K10D00UU 0P :0S b0lS P*0 01@0UF*U$ K$0S 001@0P:01W|  0P:01UkUk 0P:0Sd b0lS^ \P01U:0aS0 $("0P010zQ20aS/ 0< 8kP 01gd0S 010c[YpW01@Q0N0 K10DpH0 K10DBp@><,, 00S00006im R000  B m0 R0 6i6i -QL M &2 H00SH0<6 KH00CSH0ʴ64 8#8 & 6 1K, KPi 00  0 R0000 0 0 0cPxmm p- 0PL0cS@`$P  0P@ R*bP!00p 0 \%*0Q25 RP:p xm p-`PL @<0 P ` `pxm -LM$pK@P `dP $0$@ T1!Q dK2!  dP -L(MH`KPp( @;U  ,<4K0 08 K-4 40, 0cS$ 000xmmmm -L MPLp8#(`@K>08#83K6  P@T@T 0S 0Sf@T0@T V 6 8#8 #K&x Po KP ,00@K03K6 Pi Ji 0-@LXPQ &8S0B8#8S6 $080h7A 0-L`@PQ \0000  h00h0LQ0h6i -0 LRh9,AD>-Q 0P P P-@0 H0 D j p-0L@`T$@T :P 0 RP U 8P1 SPUppp6ii$ 0-H0L@PT $@T :P00006i 0-<0L@PT@T 8:P06i -0LM@PT$@T :P0S P 00PK@`T SP,pK9 8: ccPPE`@T U6i -LM0S $Q 00QK$@`T SP,pK8 : 2cPPE`@T U -L$ML RP1P Q P 0 R BPQ PPL P (KL0D1YL RI8HK 8pW5PU bP( 0Zp PEW  UHK`@0Sc8Ks8HK bZ Y UL0 0eL 0` b8KO8HK bP PE 6i -LM0` V ! P0@T PPPU,pK@T PU !8 9 bP` Km6i -L`pn8H0PU ,0S @A@PUhQDm 0-L,0P@T @T0h>6i p-$@LT`PC@T@ R9P R000(0 0 PP 0S R000 0 0 00CS00$ R( (0@0(0 0 ($ pp6iP 0P0 - @L 01 0- LP, P@ @ )9 40$    0$ (0@ 06i -0LSPp!$@T @T 8P  `P%  P" 9@E0/S809S@P r n 0@T$@T 8P000@p 00  (00( `(6i -0L,M@T$@T g8PP @T @K60 0KKtP 4PLi<@K @6 eP 4PZK6i|>X< 0-0P @L0 PP 5,P,00 -0P000 %4P400 8 @Q<0 -1LSP8L8m 00S0C p0 ` p0@0p e6`m0060l00A - L@ R`! d!  110C0C11]k 10`P RZ -LP`p@QT 0@SpW@0@Sp@0 0C@0 3kH0T0H0P U 0-L@P6#00ha -6@06LO%#0 T hm0<o[< 0-6P0L66@T g@T1S 0h" 10`P  R`! d!  110C0C11j RZ 0-L M0P@T@T 6 6P!8H#8 R84 K KP@TK06ii 0-PPL4 0d0 @T@T  X5Px0P 0 Rd08;P4d0  00 08@0 R P0m -pL#W`P,PU) PU7 0SXQ 60@^)*0 0# 0 0#^ 5P Q  4P PUP^ Pp-L`P p8Q Q P @P 00 088@ R 0R p* -L`E0pPUPU 0W6 @T@T 0 R0S 4P@6i -LP0p`V%`V" 0W@T@T  0S ~4P 6 P R q4P@6i -L1`V9 `V4 0Z@T@T  0SPU 0 pR*0 0# 0 0# WY  P  6i -P0LS@  PP  $  0P0ahF*AQ -@L hmH* -0LSp 00C0 SP@ 00BR0 SQP@T`U 0S U0S; 0`V`V 5P 5P0gS"\ 00L0 S0gP ^0P@@00L\0 SL0!l/@!b00RPXP0S 6igfff p-L@`P KPP  R 6p@ p-ppp p-LMK`e@PP !PP xPPP  -PxLpMUp`P \KU T;Ul [H;Ud 0U `C$;UC*;0S^P ;崖U m:U6 P0CU0CU*0CU 0U 0CU \$ `0 0`0 6 0#l0S @ V6`(K8`PUD M`9U*`PT````PP5 P$ P/`\9@UV D9U =N0CUX 0CU 0U 0CU`` 少0`8U@e `8U3 O0CU 0UJ 0CUn`PP` 6ʕr`H8U *0CU 0U 0CUU61`` 0^Yg7UC 0U 70CUD`P`P1Sd  0`0 A7UR w7U,0`` 05l7U4 d0CU }`P< `P7 P` 7U. Z70Sp@b`P!P1S%  p0`T 00 L`P  P `P00 p0`` 05`PLPK ,0Kz]`PMO1` t0`` 0M?P` P ` L@K 3 ,0Ko]0`0 l !\0`0 0`` 0`` 61`PPK@ ,0K6]`P@@ 2@ N3` `P0` t0`P6  |$qDm**> -L@p(00  0 @ h|6i -L@^00S0 0000@hh6i p-1!S0#RL@:6 h0 Q0 00   h00h0Lph0  p0h0 0 0 @0  !  !\@P `^0S phE000 0@@036i mm -0LS@ S 0SQ 0S 0Sh< s.PT 0S  h.P #!^ """!1# `@\#T#@DY@ 0hcP  0p{`7@>ʚ; -0QLP`(0p 68#(_ 0!  0 +PQ  +P11<<88#8#8110 0@0@00@0@0@04 !48#H+ 1$ 6 x 3T / Tg 3T00S 0S x`  <+P l` 0  !  !1 3T0 2T0  !  !P@ p0S B@ D0Rk@ 1 00Sa@`10`@  @ 6 W0  !  !P@ p0SI yA60  !  !|@P pt0SF \\A0Sg H1Rc0T4] Wb`PY  * Apq]H00H0_P0SFvC000 0PP0000 0PP0kcL]000 0@@06i m5݆moBnmQ`0S9`00 Q-L@0CQ:T0Q %0CQ6@06QT 000p02i i + -Lp`P LP 6AUp d 420S00 0@0@0O0@0@ R R 80-_/Q@@ D0RH00H0_ b7xQ@_d0 3A0 @ 1 00S၁@10@ 0 @ , ! $  ! P` @i0S QP`0@  0 O0@0@000 PP,*1>oBn mm> -40L @P B/m p- L`@PP(  08/ 9p0&0 P1D!0 Tl0n m @L 0p0@PE p> ++m -$LP h07i>- 0  \  \ 00SP \`0S S S 0S 21C 07i p-` LPP0#U T u@R0000 0  =Tpp -P`QppW@L jTh 1R' 1RP  0S\0PS000000P 0S 0S \@ P @P lP6   R03 Pp`PP`p  0 ^P1 P!p PU00@  01 PU@PP  @P0PP!$RP5i 6i( -L@`p  PP 0` pP0  0/> 0-L @PP 0  T.0P P 0 P/><> -pRL` @PPU@ -L  0P /+mP> -`L@T( pP@T 0  "!    "!P S s @T h m-0S  0 00Sp@- 0@PcUe\5*0   0`Q  ^ T 0SQ 0S p?R00S eQ 0SP 0S pr3p 0\à@-0@    @ @0 -P` Lp 0  0S0@Q :* 0 RQ /  \0R 000Q ^f 2 @ 0  @PP0S:  0   @ 0PP00R  0S 0 S 000S  -pL0S`0S 0@T  0 0S@0SP U 0Pl P 0 -p L@`(0 6pP0@@ 0 0 @P<0 40\ 0, ,0 0$ $0p 0PiTi'++ +#+<+ 0-0LS@P 0p 0P 00h0 -L M  0P'0 R (0P0 RQ Kh- 0 W0P h0 l0d P*00PDP K,-(-p>mDmmx>PiTiLim>> p-@ LTRP 0` 0S 0SY 0CS 0 p0R hX-pXS- Q R 0S: ,G-p 00CS 008C8S08C8J\0 S  P RP 0S T T  0Sd- 0 p0A 0 p4-p0$0$p@>>>d>>m -L@ T@P0S R 0U0U R0 0T p Q 0 S R 0U0S 0 S @R 0S 00 0 \ "`P 00 00 0@000``p ,`m> -LMⴒ`0P@@PRPU%Uㄢ||2 E'% e"%Qk*0PSh 0RS BQ:`aU"0S`1 @q RL!``0@ 0  @@0S  $P@TXppW0 lP @ 0 $,1, K 0o,0@S2\P P Q0h 100 0  d& 0 00d0 R 0h1000@+  0LSmLiTi9im`<> -LM0 P`@ 0  @@0S  eM$PVP  $P P 0S PU8P Pp^# UL 000Sp` 0 @ 0V@@0 @@ 00 0  @ T0@S@@Q 0S!0S   0S`V  0Vpp0 pp0pST@ Q T00S 0S ` 00CS 0000R 0  @-+#0>>m -L M` @ 0  @@0SPU00  Q *0 R  0R  Q 0P(K0S@0"0S  0S Bf100U40 PPU  0U 04 RPU10,0 @PUl04QlPUe 0 pP 0\ P  S 0 0 0R !\0, 0S0!Xp1Z0 0  "00 0p 0 0# ^P 0 R !P0  0R01p Wx0  "0  0 0#\c TP_P]Ti Q0-L@P0h&0 0P  @P00T00S00T P0 -PLUPp+  R/ U@`#0`S(  @R" R 0Z P  0R:"PW  `  w 3 -`LV0V 8CxW0 08C8J\F0 S  P RP: @T#@T 0W0P Y( 0.0PU% P  0R:""Pڐ P@P 0 0 0000P@ 0 R 00 0@$oy)v) m>> -LMQPp0`%( K0( @RV 0 0`  `( RR(`0 00@0 `P@ 0 P @ 0-@PPLld R000  0h0  p-@LTP` X0X hP P 0< a!0S00@@p7p9i9im0 m - QLp@`0P& S 0S-` XVU` wT.*+*+*+*+*+*+*+++`*+++\++*+|++`*+*+++p*+*+-` PG @ U!` @ ᭻0 ` `q`(-` 0S* yi`i`W @T8`0 0 0` @^ci`t`P`9` 0S  0`4> --`1LM@0 T, ` 00 A p@T3  0 P!0R!R 0SP 0 P P  PW  0YXP 0P .jP Up@TW 0P jP U(K__pmʚ;00 R310 P0 9imm0 R0%3 %'9imP (0 P0 Q9im 0-L@PP P0 A0m - LtJ+- 0-@LP0P  00<0 R  R 2S9i -鄀L`p0pS:0PP}@P 4 #P P%U0pS*9i0J+ Ȱ-P2 S R 2 S,00CS,0 R0000 0 :9ip@-@` 0 PU1! \ *0 00\: Up lp@ 0-L@0qPP ""0  0 f!0 -0LSP' @T=@T !P,00,0@Tp, "0R8@#xT0W0 `P /!,0T0r,0  @ 0``@00 ``p9iP 0-H@LTP#H@T  R 0 0 0 R 000 0 0  0S0C0 %H@T0m@> -LM`HPP!00@ ,P 0`pXT`XpP`X 0S R 0 0 0 R 000 0 0  0S0C0& E NP7 0 0O0 @`$PH R0 0H 00  000(K%P*iX*iml> P-L R 0B 0 h?&> 0-l0LCQ@l0d0Q 0 P" Q00C0C8P0P   40h 0 0hB% &mm>> 0-L MdP@TX0T( @*@0@@ 8T,00K0%9i>mmXiC+> -p0L @R  P 0@ 00@ R 009im -LlMpK@P`@  00 >K|0 x t ^4T \18l0   0h d `g K -LPM0P,0 plKp @ @hP W0P @P 0 @T ` 00` 0 0S @  0hP , p2,(K,@ d0 l00l0 8 ,0KpF`P ,@ l00l0,P d0   xm p-@dPL`  @P l04 0CRl0 Apd @\ 0{P@ d0 T0 P0`RQ TA@p0pd0P @PP*i -0@S0C00ppPL`, PP4 0 0P P@P 0@0d0 +P@ \00` R `R`0S0C000S* PP7 -L`p`PU@ 0 R P@P@PPU@0S r@T P l0d 0Cl0 0 R 8@T 0SP v@P -@LTP`p tpP% 40S P. P4P& PW00 SQ  R 00x440S3Ip\ 00 g4-4P -L4M@X P`P/P  000 0X RB R R P P(KX P| d0 y 80JK R4 8040  d0 <8000 0 00|,4pW V  610`P7P  0 @ PT W Ls70P0   PG d 00V00S70  @P6 d0 / 0P@P D@PD Rl0DP0Cl0d08 0Rd0 0S Xd#X0000P0 @l0S~0l0 P zP w j0P0 p00r`d00H0hT     UPP 1 R T,P  0X0 08p 0 Q40 r0 T0 0 P, 0S X Xl00l0d0  + '@8 0S@ LLl0r 0l0r D@  T[`P$d0 DP@P0P    P "PP 4pd0 !80S 8f08p 040 0 S  @r0  0T 0 @YTtmm>> -\1LHMl @1X PU 0/ ` W X Gl(KV R 0 0 0 R000 0 0 `V h0S0C0P!h@K@0 0d $r 7X*imm<> -LDMpPU"  R 0 0 0 R000 0 0 `V 0S0C0C!PU R000  K\@K@q0 0X $r md> -LlM0 ,0 P`pT0SQ NPP7P @ d`8#H 2Pl00Cl0 80S PZ NY3PAP(KpK@  M?\P ` ` NK^Yd 00   ,0K@PP ,`V  l0SZ N0l0B,  -LlM 0㈀KP`$0 @@ p?0 0 @ M?TP X` FK\ 0|0 8#x  $0KpTP*$@T' l08 0CRl0 0 } 80S 88P 040 0 0R 0  $k K$ >`< -LLM\PKp@` `@ `0KX P 0 T d, r 4`p@, 0T` l0SK0l0` -40LS d@P  # -d0L D0S  -LTM p t `@Pp@ 3@& 0 p0 #&30#P00S, 5 00 R' @PP 0t03 R00SH TU000|!000lK@ tlK p0h dp ` P V(K P,,80T CP,A@,P 0S 0Sd0 0A@P   0d0, lP, `@lK@(0K#t`lK8 8@ h dp ` <` @@,PP d`P0t03mmm -`pL 0PP# 0@T \ x0$ @TP0S 0Pl 0S mDmm P-LPP>@ 0~`P4  0wpP! ԀPȐ@  @ !L  !F  `pP0P  80P($0 0orm9im -L M@ 0t% l0l Q  0S0 QPKv>mmDmm> p-PL0S S |@6 p0@` V@p0S@p P   < p-PL0S# S 6 0 @@`P d0@p 5@4 wP 0S@p  <0@-000 @ p-@PL,`rT*^1 @0 CS  @ Q00T0#Sp p-P`8LP00  00 @p -L Mp 4  , 4  R>` 0 Z0 PD 0`@PD 0 10 0BR0U ` P@ TXU00  S@7 ,0S4 00S 0/0S, 0T0 S, " 4  R R000 վR000 Z0 P P, ; uP 0 S@, 00PUP U 000004 @ (K 0 -LDMdKpP @1X[6R XU  R0 P P]0`S @T 0SC0P0 @T3 0S @T, W L 0X0 0 D P80`S P 0S  00$d0 0@P 000@T0L0 D0 X0 X$K6l0? 060Rd0 0 @P0006i -L(MP@P`0AS`(KHK `& 0`T<0 H D 4 @ T pP H0L 0CPS PX+PX+X+$X+W+D@~PAL```L[ 0M<0@ X < : 400hS `300  `LA@`U @%T 40P U`P  ``0h!@qBK- K ,0K21C0b ?A1c0m,Y+,ogfff -LhM0`S@, PK@4 00 P0 | x  18p0 l 60d0 BK0X  `:0pS PU 0S K d0d L r0(0 0 l0@04 0帀 0?P00000 -L M 0@0 S \+ \+[+,\+`P,P J@P00SAX/ , @@  /,Pp @Z `Q 0 70 0BR0`0 rMPP+p W@00P0, 0 0(KP,P aJU@@P00S ; sJ1@IP,P P,P I 0-40L@0PP XP 0?^P I8000a0h400400hS9iAgfff -L`R@pP TU kI@@TS S *@J0 0 80@0T@S# S U *@FIJ0 0 000U 0S @0`v P@ @8`U 0S @000 -LM`@pXTPQ T< T  0p ៮$K <lQ@d h1S p@ rpP;h1 Q@180@ Q0001 0  d]0@004 0XPd ` a `R \0p40 pU P Phd00C0 00C 0 > F(00C0000,oH\+m9i --LM0 pR,0 \d2@TX P@T3 0 !0R1S R SP  P P  P` R5 0Q 02 0BSM,b+,b+,b+,b+8b+8b+U d `X0P `0aR  R  40040H(K 0P \P hRH8p240`U  0JP0  d `X0P `0aR  R0P 0 \P ARP8 r 0Rz 40040T0NHPo0Pkmʚ; -p0L PRp`P @8V P $$ $0 ph4m9i9i9i -0L@M 8PRp `K\@K@ P0D0 !H 0P0  < P 60$00  \00 0o`0S00 0m9i9i9i p-0L PRpq`P @6l0? 060h,P$ $0 phm9i9i9i -LP ^@FP @00 `p0Z 0尦,嶠T 0 @0 0mm9i9i9i --LtMP@ 0U00 ,@ @  0SKPP 1 0S`V p oG(KQ+p_V V(p P7p  0F4ǟh1P嘀 0`, `00V ^PWp 0P 0CP>@t 0C!` @#2 40P 0CP$0PN=@ 0C! ̇ P P10"104 P PP10N  0\ڣ20S*>000S \ -8LS@ 0CS8 06 l8S06p@-@P`0"U@T$b0"PU0t0" ^" 0S0R  ^P0,0,P"p`bS  -Rxq+q+q+xq+q+D\ 1 Ra< p-0 0 8LS@P+ 8`S S:0 00CSpr+`r+Pr+@r+0:0p080p080p080pH8\ 0\8S 0008 H8"R -41 \ Q`< Q-L QQ20@Ss+s+s+s+s+s+s+s+7P"  P P nP P,$`0 lH q> Q-L QQZ$P> 6P? P? PG 0@*Slu+tt+u+tt+tt+tt+tt+tt+tt+u+tt+tt+tt+tt+tt+tt+tt+tt+tt+tt+u+tt+tt+tt+tt+tt+tt+tt+tt+tt+tt+tt+tt+tt+tt+tt+tt+tt+tt+tt+tt+tt+u+HP 0P   `P lP`@ 7n > -LDM₮@P`)" 0 2 8K pl d d RPd0p0d0 H"0S7 82 1 h0 08 |W *>0"QP0PS0@ P h0倀  08 M8[PT70[S O0S  8KR0(K 0C8 Kl0Pl 80[S@80[S8K0 fP@ P 0 8  0B 80[S`Kn DlP p0@| (Kh  08[PPh B0t{ b<@B/. R-L@`0T T 80H y84tn>0Q0bC><> -!L0pS1`o Qo1/^AP 00S   R` V0 00Sq  00S 7 17 ^ V 00S  ^LQ L1GT@# P 1'R! 1/>0LLQ wL1GrT@Lk8,0`H2 Lb> 0-08L P& 08#QQ B0S108# Q t 0S1 0P0Q@@O0W00 @ C0  -0X@LQ@ Q; Q` Q`  V`!0S6  pP V%  z 0  PPR P4P8 S8P4S X14``D 0S8X op `  -@L1f1"\"R`2`2`2 jh7 -LMp l 2! i D10o  !P0`00` VP O0S /rP> 0 `8`  V P\AL1 R!  0S 000, l>|@:i0 0000  0@-1 @T^* T(0T^  T00S 0 000008S  0S00 000S8 0C8 @0 R 00 0S0 :[0(0CR 0 8080 0̫8, 0?/ 0 ? 0 /? 0/? 0 2"Ў++@P&Ԃ++܂++++Ă++++++++̂++++++++++++++++Ă+  8 01S^X="!B10b#=0 0 \=X= p-OLTP`@@T 0R!  P V Pp -L\MP @p` P*tK   nK  P"hK  HK |0|XX L00 0C 0 L )0C (KtK  @hK `T++> -LM 04a8b #8$0(Sp"hc S KVOK 0F898#8 @@PK1  OK 0K  0 0L -LMPU@ p$ 0`K)0KDPUp)0[ 0)0K  c ^[)K WU=@K( G (K -L"M`04 8 $#8(0"(SpP S S KOK  QZOK LQOK 0PK  Q   -LMQ@,`KPp   B  r PK -LMMPPP`pNK  S O -LM_pU@`@PU 0S n P@ 00 ?H P P@ s 0@0/@D ?PP -LOM`d V p* 1@^K2K08 `V p#H d *K BK  ,K VL@K 0 (K p-8L`P@8 0J 0 8  0R=:0 "#A10a#= 00CS/،++++++Ȍ++++++++،+++++++++++++++++0 0  0)S0 SCLR0S =p1S^/phphphph}  048# @(R"!B10b#= 0 0C-LS+č++č+č+č+܍+č+č+č+č+č+č+č++č+č+č+č+č+č+č+č+č+č+č+č+č+č+č+ԍ+=h+h!h h+ -0L0C@S Ď++++++++++++++Ď+++++++++++++++++zh 00CSx+d+t+d+d+d+p+d+d+d+d+d+d+d+x+d+d+d+d+d+d+d+d+d+d+d+d+d+d+d+l+R -OLT` @ RD0D0D0?@ D0H  TOT#]PpyW 21C! c#-QpP@  dW h] -LDM 0\ 0C0@  p$@`P 0d `0 dPK`0@\l0 h@ ,l@#$0@`P H#H$8p0!,X Sp` : X  8>08>0<>k< -L$M@p0 @00L K080 PJKK0KD  DK@ >K< LK m  B h l:P  =PC 0 0 L0P 0 0 B0  `!4 08@K040 "880 "4<0   O 0   0 0  00 0@0@ (K= 0=; -LP@  00 0-LP Q@P ?@0 0 -LLMPd `0 \0SK\ S0K0 SR K QK @ KK EK0 0S 0? K>0K=pKz 0S 0 0S00000p 05K 4K50Kv0h0 p0 d0`SKl#|t 0 t*d` *XdX"$#h*4`l 00>9 $ 0S0 10PP ;;:1P0 0@00S000010PP 0S: =0=9900 4>04>99 9@@ 9@ =0=9 -LP@  ij00 0-zLP @P  _@0 0 -LpM    L:0P|0   8P|0 0 R |@ 0S p|0 4P`0P`P`|@P "4 <00 `3 00 "8 80 040PP "40  jHK8KXK C8Kh K*K)@K塋00j St0 |pڈ l@ |@p `x xp 0Q 0x p0  Z < x@a 0p 0aT@!0TP$pT (0K  0R@R0# 0B`!VpڀHKH Kbl08#̠8K#8h Kl0 *K)0KVT`tdQt p  @p 9PU t0\ 0/ tRt  t    V HKH K) 6P/ 0XA 0HA 0#0Q| 0 0 0 y8|(K; 81P0 0 ;|8|1| P0 0 B9P 0 0=0=O8|M8| =0=D8G-p#00`400$M400 !0 0 0  Q0 @  "$""40  0 4,4 ! 0 0$ ""40  0 4,4!  0$ ""40  04 4! Ƞ,Ƞ0 0$ ""40  04 4! .0 $ ""40  0 4,4! X$Ѝb<8G-#p0 Q0 B ("( 0!0##4 "0 "  0 4,4 !0 $ ""40  0 4,4! 0 $ ""40  04 4! Ƞ,Ƞ0 $ ""40  0 4,4!  0 $ ""40  04 4! Ƞ,Ƞ 0 $ ""40  04 4!. 040# 0'  040# 0'!h0 08#X 87 ("H0('08# )Ġ87_   `P@0 4#0#00b< -LM8`p 8  P0 0 31C ` cR 00~>XU 0~>NH>,@%H0,$H 0h l>xmA -L(M@p`Qp+H+ ++8K00S0,0K00S00,0KPPK0+0K)0K*0Kּ  ᇼ0  g@ }@T ᣼(K8K  92K 58K  /2K +8K  %2K  !8K -LXMp l d t h p0P  0RfdP0 @e d00S   P`| x x0|@$$,0@H p#H80@ L#D<P`t0x@ 0@xD p4R` \ *p06@PT@ * p 5P 0 BjR 0 T 0S T dP T00@00h@!!R t@`0 \,X!8X8U.h"H h0t@Eh0⠐!1 0 W`L@K8#8  h,T P@0pdXGpPP@X  0@a0g T@! h07X dXX p.P@ 0W 0pU` B6P`q jX RPP B;51P  pX 0(>5x $T d 00Sd@000`\,XX.hJ ;TU51TP0 0lp=0=4T4T V0htE⠐7ll,>p0,>4T4 T 0S:p4T4l@$>0$>`KT p4@T@ p4T@ l@p=0=4 -LP@  ׮00 - @LI P0 1!  -L,MP T p L `50PH0  T 3PH0 0 gR H 0S TH < < J00 @0@H#4<<_  0 03 00 "880 040 @ 40L !R^ \ P`0@0LPCoS 8@K9 w L巹T< 0bY[H@0`pD @0 D@b 00gT@! @D @   dL0ṹY@`p @D 0WpD  0VP4Pg PgY P P U`` P   P L0CoP"88 L0 1; $41PP P0H@0 1 P4P3 0 0 0PLP!0<T @ @0LV 0@P 0$$$$ P @  L0DH 0 0 0 Tz3H(KP T=0=q3Ho30H0  ;H3H1HH P0 0PT=0=W3 -L(MP pL P H P0` 0R<@K - 9K)  HҸP 40P@0 P ^2P@0 0 BjR q@  0S @0 @0 @  fZPPIP@@ PD  0@a0h T@! H0ẸD q dZD +P@ 0X 0Up `3Pp: jZ RPP`` B;/31P  D0P,@K 0 020H w,0SP2@(K ;@3@ 1@P0 0L P=0=2@20@0 LP=0=2@2 @ P2@ LP=0=2 -LP@  㱬00 - @LBP  -L$MH L ` D >30P@0 L 1P@0 0 iR @ 0S L@@ P (D0\ 2\D01@0, ,4008@K30  5K   D崷L0eZH@@`P <  0@a0fT@! <~<   dD0ṷZ/P`@ 0V 0`Up 2PpH iZ RPP  B;521P   @p< /P2P# 0 0p<@ 0 ##Ƞ#\0PD0j@ 0 0 0 L1@(K00 ŠeHL=0=1@1@ ,lT ;@1@1@ P0 04H L=0=v1 0 S00RSS   -0p.0RL p>@0#200   N000N "" N04\0N8 |2S0S = 0=0S = 0= - 0LS=(0R=  l - 0LS=(0R=  l -LM8@S P0  0S00 ?$   0h 0S00\0S 0-LM@KP  P P P K0@K \ rP00CSh+p+\+\+++dq @Pl"000 2 R 3 878 8781Q3#51 R\ 868 !000 lo6 `1\XA@^08 #8<8H8 S808=0=UH` 2SD` | SyR=0=s+@K  PhPf0Sc0< S < ]< R P D 000t08680D < H @ Ld@dd>>d< p-LM PQ ` đ=0@= Kp ĆD ȠH,Ƞ$H@x -@L h讨? p-`LQP@ ݨP   Hp 0@S  ㋨ p -LhM #R0 (KH8 p !0&`0 " $PT #0P0 LX :% 0X\ %p:\0x0 t0 ` |0 p0 l0 h0 d0 X0 0 S pP  S xP  5|P 5:S P`X: p0X*=0=xQ 0S| R 0` S`1'R!=0= 8S `\ Q=0=`0/. @ |0v P  PP TP(48R#x 3  p0S  HTy 0S :Q ;@ :0|   '0 0  -/>0$0#sp0X t x t0 AR ` r0S hP n *SjR 0X0 e2S tP a S^R=0=X+@K (O (PM0S dP I RFSD0lSl >8 h` x t ` | p l h d X 8hQ ?Nd R ?/00v8Sf8Sct0XS (1 R? 868H8X t 30' Q 0 Q'5IlPP  L P PP5 L KCP00d]PH00@  <008 A?![0 L K8Ph@ 868d<-\" ڰ\ \ \0\ P\ \ =0=\h0 ]0 -LMpW( F`(K(0S(  Q 0 , 0@`W1(PU f-@P,  PfjU; ,1P (0S 000C `b 0,@P  +P S,(O,(M,I,+C, -L MP`p 2S 0 0@V0@  0R 0(@Kf*CK L0R >0 >,LP  ,ꈎd< -LM` 0PSp :@00S H+p+|++L0PP=0=#2K 01R0S= 0F0f8#8 $#$"Kv)  00 PP  {$K2K  ,K  2K2K  ,K 2K  ,K 0SFK;)ꪪ 0-@LvP+000hɐ -LM`p!28#8N8 ,0 @P0M(K2> 0Q 0, S PU @0 0@0@Q+`00 S0 00#   P00  P4 U 8(+ 000 @4`$`@|P| R|@4P+4o, 0 : `8 -LM` @PU$  rpP! 0 %aXH8Pp@d 80X  `P@H< 40$KmC8S $K(e<|e<>@+[< -L M`pP00  PUh=0h= W DP  ݵ(Ko*@d=0d=q Z,  -Uh=5P!02h=5d:0S  R ,0S000Z 8S 1R#28#0"=00 ,0.  0Sp=0p= 8S 00 0 08 ,0Z g Z7 Z)Rt=0t=$8 S@d 2 Y TTd Tb 6mDP  n1@ 00d(Ko6*0 0@W0@r(K8SkRt=0t=f8S ' Pl=0l=Z6  0Y8 6 t1 00@0 0< =0=@=0=<8 0@6TPT=0=/00@(  pP 00000@=0=  pP=0= DP   0(Ko ~Px=0x=  0-P@L ! '0:0; B0 [0C\}%#53c0t0d D0u & 64 0&,0 l (p08t (780dfh -@PL`! pX' T:0 0;Jpwp0 0\4[BC=hRl8-S0T 23535t0c0u 0d 0 6 0&06(l 8p0(t 87 |x 0 0|00|00|00|00|00|00|0P000H8S000dfh ->LMQp %x>Q @l>QJ `>Q X>Q P>Q85P0 00,.h@Pd 00 Pu=Q /=Q ^=Qf =QW =Q^=hPP^80 V=Qr s=QH 0Q 0CQC. 0PAD=QR @8=Q 0=Q (=Q.<hçPP.=P P|1'R!v 1/>00L888S8S H8Lp R 4P<Q <Q |<Q  0>P(KP<QP H<QD @<Q;h傧PP!<  R 89 8 ;4P8;Q ;Q ;Q8P900;Q ;Qh ;QI@K! a8S8 HKI0K! ePH; @RPpP:h7PP8@ 208S:4P*P  xP8#m<000X=@00 `p0S :h PPx0SS0P021Cc PPgpW@`P`8 :0 0?00? 000 ?00 ?000 ?000 ?000?S S S S00 0?00?000?0P0! P8P#500(008S.H' VPPP1@P 0S`АK000@P 0S:   `PP℠F 8@2 8P㳀ᴁ/+Pd7h`PP6A0AS2P'8 ' S' w l`7 20CH'P6h8PPIK! PPI0[ SN@ 4I [(HK4PT6hPP8 0S8 <4P8{ 6h PPu184P208k5hPPe0S 858 4PX5hPPR8 n 0S864P8F8P2#>1@ 5hϥPP:@x `P8;8v8S8 * H' OP4P!4h尥PPȘ 7 0S774P4P888S78SLP,4h咥PP@ P PA 0 3hzPPfPP8K  $PH8pHHK:0; I0K eP858 [4P8;8 P00CS#M@` R0 0S- Rʉ" Q 0e! c#-Q /0S0000f0 e`00 PPy PPrY`@ 8 B<4P8X-e_00?0 _??0?S0?0  /0 / /  /0  /0  /R0 ? 0S S S S ?0?0?0?00?0?0?00??S 0?84P68 aP0Q H8p Q4P n8 ;4P8ii 6i(i8ii4,oi i8iiid<0p8T T0Π\(`8H H0d(h8 80QX( ,0x(0 0Q0,+++<:iP8H(s0\ 8S80\  0@-P@ R( 0S%\ ) \ ^ \@ 0 0\0 S 0  0S R 0 000@ 0 0  R P,  R/ 0\ 00 S 0  0S0S 0P@ 0S@@0  @0@ 0 0 0S00S0@ 0\@@  @0@- R 0S^ 0Sk0 0R 0SI0SD \  R0 0 \0S0  0S R( ^ 0Sm R 0S 0R 00 S00 S0 0S    R 0 000 0 \0S0  0SR 0S@0T 00 S @0  0 S 0R 00 S00 S0 0S    R R 0SP0U 00 S P0@  0 S@ y -`LV@3 ^=0S`PVPU p` 0S`` TPR 0T 0RU 00SW `PV p PU` 0S``P p P 0S0SP0SP0S  P 0S0SP0SP0S PQ00SQ00S!!  p-@LTP `P`@@T@p 0-@LPT P@@T0 p-@LT`P@P  R0T 0 PPP@p0@ 0@@P 0-pHLPT ! P@@T0 -@qsL HȔ\ 0p Rn>0p0 -PL@ p[` \[ |V @[0S  q[00[0 m= a0=[@ -@L`PWp8@P @Ph衇 -LPp`@P ;p0S  0S 3 #0S R@ӈ:0S  p-@PL! !08P`6t80t8phj 0-H8LS@P gt80Ct8`0}L> -XhP0LX8@PW@ Xpt(x8R0V 0`S>W0>@ m% -t(x8LR@\t(x8R p-L@`PP=0=  H ''H8p p p p-L@`PP=0=  fp -L`ㆇpg@PU@ )8PScU@hȆ -LpPf`c@@D@庆T8S h貆D 0-LP@P 40p0H000埆0d HH 0~`> -tLP@  せ0t1 p-@L'^`PvHQ php 0-@PL#- 0t1tP ]0h0 -L@ hH#  ゛ 0-HH/0L000000 /0P  8 00000S /000000001(  A? ` 00000000 P  S 0<0 p-L`pPp1GT@(1@$R@ p0R@(l10@S: :  (@R :0R@ @ 2$ /0 /0@@ @@$@@0SS S S@@/0A? @@ 1 S@@8   P@@p @@@@ 0' P @;P@ -H8n^p`LpP`V/n`Q12GLT@ 8 0  H8p Rh8Q2G3H82 p`l -6LP 8! 88S808@PpDS(=V@ 8`S #PW 0RVp@W&  HdHHp08& 0108 l7  <07lP'0S 808hU0C7 >>> 0-LP@ =&0= T0T  L810(0(,0 $0X0h 0>>> -HLQ@ `0H8hR -`8 LSR R R 0SHX  p$@kPxU 000p\ 00S4,`,X,X,0S00FPPHX X\ 'H[[ 08p2S   d< -8LSHHՄ000,00@Qʐ0P 0V.RP P PP 0V.R 0V.R 0V.Rd< R% 0S 0 $(, <4!4"<#Q#:Q@Q`Q Q0 0@S QQQ p0   ;8#("40 .0 0.0C 0 -(L"HP  0 0 K -(L"HP  0 0 K -LhHwPP&$x 0 $L&  p@帀 p-8L`#XZ@P   ;0 B 0P p -(Lp"h@PP @  K0 B  0`   0-20P0 @P@D@L 0 0-0P0@PT@#@L 0 0-0@0@ LP0 -LMSPp" +@Kp 0 0  00CS<,(,,,(,(,(, ,(,(,(,(,(,(,(,0,.@K t00P@ `6?J&40`P0`T]Z&40`|&40`A  04"#400<00Pa8 R(K00P @`  -00@`  "00 (@"h  08#h&4  0`@0P`  00`P  08  #hP00P00P{ ? S0C0P \0 0S  P 08  #hPw 00 (P"hid> -"0L@M+pK0`P 8 00  0d0C0d< 0-00@0PL00C0d0C00 p-@ TL`PP T000p; 1ph(> p-0L` P@P 00P  0#40 b p R  R -L[ R8p p\L@`:U 0<Q 1 PP^H 0 D ;0\ 1 #      pP0 8P I8d;8# 40 Z 0 #40B : ;[PB0[0S480 !8 00c0 00  0  3d0  pp0  08#H ' | p-L@pP*>0`(0\ࠓL ;0\    @P (0 S00c0 0p  -LMpQ`j PX P = @,pPP`0!P21   W S' O8  VV80; 0@006@0!0 X7ST@10X'0 6'L$K PR 0"A癷p`IpPXX0 80H V 6 $0 @ f(e<|e< >> -`LAAP@Pp Q2P PS 0iSSOpW0 8  0S 㲁πQ JPP 1 018yP!1R1@10d!PR`A@@10dA! !/00@ 0@ 0 0@0@6   0mL7PL> -LM@` P 0iSS3 0 S@P=0=" 6K  b }PP=0= 8" 2S2"[R>0> T ZU 00@(K00Sy0,,0,,08(F @ p0U  [ B@P=0= @ p0R0岀41 "!8S0' 0K     X1  0@00P41  "[1R ;p< @ <0 0!(<S1 08#(<0!w00021  TPoppPP 08PnpHX000~U8 W=0=Mꈎftp> -LMpQP@`z 000~T_ T: T" TI =@0= T @T T &P `0 @PVhF( 0P `P= @0=("( P 6 !⳵0 8`F((8"(#8P 8S `("(P 6 !⑵0 8`>>> -L,M P` 0@lHP 0@p PD0p ` P` 0@`LD #D<P`0@ HD#H$8p!,`1 S@ *D  L PL @>0> @>0>(K\1S:D L P< D CL,  04Sa b04S 0<4.J@21C! c@0# .H 0 4 H@ HD0 0@808L08F E0@$@<A`D0@P#D pC < <P`B0@<@!(#Lp4 H0(, (@0c, L W@D4 P8 L<0 T  0@,8H`P 0@ pDP0  ` p 0@#D <8 P`0@8@!(#Lp4D0 \`!@6@D4 (Ko<D@ 0h@ l?D!x@0@8 00D "@L /L,>> -LHMp P` 0@Tp P lHPpT0KP` 0@D0p P`0`@\0 X@ \PK` 0@L L#D<P`0@ H#HL@8$p!,`1SpH K*L` PL 048#8 D0 B L P<a b0cP4epX4:d d0X4 %8 % *,0PpX1: 0X-:0SR+@K s LP0S8P  S4L4 4 HP>0>(KHp>0>\1S:8Q L 800  0R8PH`@@21C! c# ` < `pHL08008F E0@$@`D0@ApPLC #Dp<P`B0@(!(D#Lp4 `0(0@HHP8`0 HL< P@ 4pWd 0S 00L H0hH l0 $("H0D8S21Cqpc#  HL184~  P` 0@$hP d` @@`Ph0K 0@@@#D<P`  @  0@@@!( #L4P` P T(H`4pHL PD 8  0@,@pH`P 0@pDP0  ` p 0@#D <@ P`0@@@!(#Lp4L0 \`!H@6 HL@ 1LHLP!⼲$ 80e<,>> -LMd1S /  0@,Hp` 0@PD0P`p  0@ L#D <P`0@(!(D#L`!p4Rp%*(9  (K@C P0΃! PKK? P p@P  @>0> >0>\1S:@ 48#8Z0 P a b0cP4epX:d d`0X: S 0PpX): `0X$:00S0S^ PP R+@K  hP0SP  S@7 P Q R 0S{ P  1S `@o tQ  0R  00 0 h lX  ,P^ P KP L0S  @0S4[SD ? !  0@p,H`P 0@pDP0  `p 0@ L#D <P`0@(!(D#Lp4 0\`!d1& q ş8 0 .PPI w  04S  |0Sp F E0@$@Ap`D0@ P #D<P`C B0@!(#Lp4p^O 1q匁|1PQ   P3#  `VU *  0R@@21C! c#   H0(8008F E0@$@`D0@ApPL #D<P`C B0@(!(D#Lp4 0(@HP` L  Pe\[ 0S^0 $("H0D8SU21Cqpc#=0 0 {H180`  P` 0@$P ` @P`0KP 0@L#D<P`  0@(!(D #L4P` P T(`~  P@ 000  0   P .@K t P0S0SP @@T@T@ PP A"e<8>>e< -L`Mt d1Sp 0  0@,Hp` 0@PD0P `p  0@ L#D <P`0@(t!(D#L`!p4Rq*a b0cP4epY0:d d`0Y# *)0PpY`: 0Y:0SR+@K M &P0S0PpY`*X 0S (Kt 0SS<X  ptP t0Ko #t!p0N0>\1S:t@pKo ap $80 %e<8>> -P0o0@0@pL0P 0 0@0@WM is0bS 0bSB0S>0>0SA SC  048#80\a0b $("(c Q00\0S 048#H 0B8S0SS#R 0Q' '  0   :cpP=0=0S0S1S 0SRpP   0S  [  ~ /z p-@ TL`PP T0 00p; 1ph@> -`LP pP `K @1 0 ! 0  00S00 00$(SS"(08#(,"4 0 0  C Cq0CB#4Ac Ba0b 2@wQ A`P"/00@ 0@0 w1S 0S08#(08#(!1R 7`101 a@10d!`R`q@p10dq! !Lꈎ M-LM0, 8 #X40 0@ BP( Z c @ ;8#(@#< 0 ,o1 0l!"8 0l!"4 0l lk14 0h!l"880h!l"4<0h! Z? 0@h1lA,@&,( ?$Kk"400$D<@ #\#pT l#4<[@<8@ FEpDPCB040[A0!➭8  $K`> -LM` pPL Pc ]c1 0`!"8 0`!"4 0` `_14 0\!`"880\!`"4<0\!!D 0S0 c 0 6 ?$Km!R \80P 0#40  002<8#(#< $K,>> -LMP wpP> `c c1 0`!"8 0`!"4 0` `_14 0\!`"880\!`"4<0\!!D 0S c0  0 0& ? Ki`! @804, K@408>> -LMP`Q<  pP; @c 0 0  I D0cS  ` d 6 0$Km!⥬P8 0@ i`@40 $K8>>D D0D 0< 0h"n0 0CP($8 0l"d2 T* ,4J,+Q888888x2 S-L 0-8p@6l 800\0 PQ L0S 8  878087808S 28 8o S00Ro0 - L@ RT' X'  770C0C77 10TP RZ 10P  R' '  770C0C77 RZ -L M4  P8s4p4 *> 00 [`p, ZRi Vf P\X00@  X0T @ V 40P( 0, 0T , = \G 0P2  0T, \00+ S+ 0F0Z[0[`٥ Y00[` 0 V0A 0Z\000S , 0r0300 (K\ Q 0S\P0P  P\@  -L0 Ƞ8^@pP,Ƞ#h 8\S8 V 6 H8S808=0==0=? 08Xz  lHȐ0000H(H8dH^/> p- Q` `VLP0 0C0^S@0 0C0^S@TtHT`PP\@UDph;V 87V@@$0Tp@> >>.? -LMX`U@pH TCK,K,K,K,J,U U:([0R6+ (d4R'\D@ 08HH:;8p0\@fT4@0 8$ 308 08L0ESL,L,M,|L,0ESM,`N,`N,M,U U 0h8D08 ! ('p/* [2  U N,N,M,M,M,w 8SA0C0 0h8S0C0 0h0 8 RT' X'  770C0C77  10TP RZ 10P/  R' '  770C0C77 wWF Wr00 0hi6CPH!P808 RZ@0 0hGWE00 0h<89 00@ h1(000 h08"H'⴩8 @88D>P>`>dd>x>|>>>>>6id>$>eEN-E8 BS(00"S: 2 1C00 2 1C00k0 8 K70K1<18 K 0D(K6i -LM0PK`p@ @T@pW0 BK,` /0K0KP d\0l 0B Sl00 R< W K\ X p-PL 0`P p0@T@T 0S00 0 Pppp6i -LP l0S0Q 0S 4Qh   d00d0-4> -LPMp`0 $#$("(("80CSp  (K 0h 0K d0 ,Kd P 0QI 0 R<0@\/0\ `0 <@ X@ LP 0X RG ,PRF X 0@(R@@Ŵ0 *PG YD 0PUA  R40S P@K,K 0 `4P幦8P8 0,Q 0 R<0@\P 0 R@,PP@K,K 0`卦 0fX000 p0CHTo0PX R (l 0Pb @40l Rl0SZP` 0`0 dh 0Kd 0,0 >K \ 8K2 3K0? K@0K @ K0CD/` PWP@K,K 0 0`l0 P d l20Sm40Sz P@K,K 0j`4P8P8 00l0 T l0  `T X0  !0O0@T0X@d00d0 T0R0S&00 @ 0T]  R    B X!L PDPU0P0 P B !00C0^ 40  P` A`\ =RP@K,K 0`嬥80 P@K ,K0`圥 08Ls@ 0T T0X@T>t>6i@> `>H:iP*im>(>0 $!$("( BRQ - ^ 04"48S 0 000^: 04"48#8 S  S p-4aLn 1@T0 R*ph"n\.  @00C@0n 0SP 04"48S 0 000Q: 04"48#8 S  S @P@00C@0m @Pm p-L@np0``0P 0PT0 <0R UphmQD:imP*i -@?L 00f, -LM` P-  0^ 0 0@00  00(KQ! (0,K {@P,d0  0< KL u.@, @$0pP,  Q T0 0u0S 6cPbʰ2 R? BP[ Q 0 SA 00C00S`0 ``000,T X0 a d00d0 R{ ,"T0`SR T0X@1 PW, d00d0,/T00@T0X@ 0P0  00C0 P0#@00b 00C0 P000!TʇS<Ppv< K0E @:X0S#@5 Rk 0g@+,0 8 ?#@!< K08 , >6im(AP*iP:iL:i>> -L MßP^p0<`4 dW\ WP W! (K8ß 402 03D  0@ 婱0S 0s d 20 S V R  ᇴl00060dT2 TX    00  j0S(  "80(Ko,V "00C0Q00 d0<;d0 P Q 00C0 Pt(Ko0Sl0V060{< P<A DH0 0 0d0,!;d00PS0d0  0@T0X@Y`VU`VR 0 R 0< Q0@T0X@  n|08 P4 8 00 08`2P4 (KoPm>TmP*impia, o<>o p-L MQ@P` KpP * 0< @`8^$ 0$PKphFT:i(m -LMp@r`P< 0 0    0; 0T0@0 0@P0C 0@P00P60 0C 0 P0p 0,KrK&K%PKPP$ 00 0 Kmi(m -@LT @T 0 R(0SC \\0 ( $0S,0 Q 0$0 @TA$m -LkP0 R R 0S00S000 Rhji p-TPL0Sp~k80 @`T  @Tphj$m6i p-L@!Pdk$0`0CS04S U 6,0 R  .phjD P  P 0S 0 08i 0-pP@LP 0S0S P8 P 0@0 00i p-`LPQ 6S0&R Q8 @P Ე0  @,@p,0Sp@pi p-PLᛔ@j0 4S`$  T 6@ 0(0ph(jp  @$@2? 0(@$m l0l -@@L@L0P k00 t0@ @@ 0hX$miiL>o< --LMP  0 ,0 @04!48#hdV)ڲ1 0S*PP000 0p0d 0PI 0d0 00SW SD S %(K000f 0c0 0&@T 00S1#0`AqpV `V 0 R4S  p3R Q$00CS$v,0v,0v,\v,0v,000-000& 0SB 000000& 0S0R 0S QQ 0 R(0 0P P 0 R 0RP| ( 000$0Sy s:Sq0$0n0R 0S QQ 0 R(0 0PW PT 0 R 0RPJ ( 000$ RB02&> 0$0; 0 ]P07 0 0R+@T+ @T( 0 R(0S0`4S2 $`>0(`(0S3@$@0 w>`0(@0(0$0%000nk,0 R(mgfff$m0S S  P0 0 BQ0S 0`000 RP0S1 Q 0-L M0@0CS0 K0ĒPP 0  0 $ K#K4 KHPh R000 0 0 Mh60 ?}2i -L M`PQ Q 0 R 0@RQ000P1S@K06 U}pP  0 00000,K< KhPP@h0S 0  0 00 0p`g60 |@1i -@L 'L0S  000@  0-TL @}PPL0S0000 oPP @ 0-0L, 0\P< \#\ 6 0 Q@T@T 0 R0\ <00^R0h06i6H@-0\@<0\!\ 6 0 QQQ 0 R0 \ <00^R@x6i  0- @PL)hP 0h00 00h 0-PLP T @0S,PT00 -LMSPpQ 8@<`KP1SV  PPGᙑᶴ,0S 0,0 0 Sl14,0,0,0\0 0(0XSt0$06("8 ,4$R3 ( 00L06("8 " R.UY(KI0SHt6P(ᦴ^OlP06P(0L06("8 h0S0(K0 Uh i  0-@LP2T00!R00P    a -L@0\\ 0P6 QQ 0 R<0T L0T6i!Q Ƞ Q:8 10: 00* 0Lm -@HLP 0H0 -L\@P` 0S s 00S" P60  00@0 `/ P 40S 8P <001R pP @吨TPP 0 Rd0 0R R0040S 0-@HLP d0P 0?HP$ HL@0 Q Q H00S 0S$0S(0S X0 Q0P  PL H0( R P0QP0 L 峪H p-@P` PL 00P30800p -LHMH@PT `\pKH`@ d0P ,0 X 00T0  P 40d @d0ѩKr 0 p-L@` 0 \ @P P 00P30(00pph@] -@@00L PqHP㝩l0 $ 弓=Qc R 0 0 0 R000  R 0000 0  ,00C,0bhP=n p-@``LP  0P  $0P  ,`bph6>> -<L48M,4pLPK`@!<%K 0 * 0K`哉P0K @卉 @N$001K -(LM"(0 `0p8@ #, 9P @T 08 40 @TL 'U3SE l0  ,0S00S` 0S0S0S 0Sf , {P0S^ 0S[$0SX(0SU0S<0S90S6 0S3Z 0 4ZZS 4 8@ @T8(Kl0,(0S Y Y30S80S , R ,Q80YS, R 40S80S0S0S0S 0S 0S0S0S  Pe30 Sa8@ 0S -L -L MA`^PY  ?@P7E  |1 P@` h0@! ] pQ5 R000 0@#P0S0 0 0@ %8 3 ( 0S00@@]@ 0 Q<l0K, 00#R , 40 ?00l:iP=n,o> -L@Qp `V ۡ@TԡX@0S 0S@U l0P (0V -LM@,pK0P`D P@P00P0#S K> -PL\M| 0 P (KHK u0/ 00a!(K 0c1\ p q@@ R 1S q w Tp Rq w Ypw Ypv KvK` 0S WW `V00P0#S w WV3 @T*:0V0. Pd0!1>PU`V00P0#Sw 0S1 0S* 0aR }:vK |Z|x |Gs@WY Y4 h0R  d6P` W RY*:00 RR*200̐? -LMP` \\! \ (KQ p04"48#8g00S03#!4@K,0    08#8,#0@ 4KK.K-K@P E7, 0 @P( K2+0P ,@ 0 @y ("(04"40 > p-PPL` d00S p[$@[phP[u0> -LM@PP& d00S \00`0K ,`K[$p;P 21C0@ 10\ $ 0  [D >np:i`> -0L ߙp3P ᭡Pᩡ P =i, 0-PL@P9 04$48# `04"48# Q\00AQ\40 p0 0QS\ JQ :40p Q`0Q:S`0hi0\0\0o< -0LP 00>00>0#p 000U0S 0("(04"40 ;t!@s q ?n>> -LM@P  WP h: --LXM` 0,0 @04"48#XdUp$&000(K 0$U$Q  0P %000"`P%0000(S(1 0  @AQ긼,,`,,,,,,d,H,ܹ,,,, ,5 R 5 R1  0004 R U000T@ڴ000T@ʲ1#U0 0U R 00S 0)SCU00U000}4 R1 0010000K 0 00Pd0`p4p 13 RU 3 RQ T#U  10URTK d@K WtPK R N0 PKS0KTKs0Kc0KtKdK `K  pK40K0P(  0卣4P 2 R# ZTh@mTc,,,,,, ,,, ,, ,,,,, @X@V@T@R1 (0{4PIU600 d|aD@K 0 C0KD K0s S@0  0@0 W *P 00\  0S? 063 LP0  05`P000  001DPK ᭽0 D KC0K0|@0  21C0d 10\ 0(  L0 0 ?nnp:i p- LM@T`@PK0`0P@-, 0T PPd@PK*![0(( b!("( 0P0 xiiK?KDpK 0 D0KC K -L MQ` 0SP  K ŸA0`ǁP 0B!S#,,,,,,,,,,,,,,,,,,,,<,d,|,, ,,,,8,,,,,,-P&R 0 P`FPU 1 RP÷ x 0 Ki X 0P Ki 4 0$A 0 @`PV, @0S0嬜p 0 p뼀P0S~ U@唚MUu  0x0   Ki萆Hp0Sb U@(`1UYBn=i̮mP <  000T T3 R ` VX  LK'0K0KLK\ 0(LKH0 P 0WF *\ \ W@i<K 㹸:[Q; [R 0S09 ["200 "S9 K 6` LK0HK K0KLK噸Tb \ H(QX H0<0 ኸX0  000S0T0 a,KA  y90[0S SW S* 90K@i \ 0y!P00P0S:0[; [0SL@K ᪹ L KP `0K0KH P. < I:0[0:0K:0[0 0C0K >:0[0:0KT@\ LK(LP\0LK(嫃\` t@i 0@i :0[; [0SnL@K c\0 (0K0K,0L KH0 RP :0[0:0K\0H(/P @@i @i np:i -b0L00 @R P 0@SX00X0 i@P 00 00qW000 0W^0<SR 0<SN 2000t00t0!P000 04"48#W000 Q000Ž 0S  bWP  bP% 0S$ r R 0 R(00(0  it6p00p0 @PP000i1<1Q Q 0 R 0RQ|  | 04S(00(0_tAnBn>@np:i >nDAn>\Bn@n>=i=i> p-LM@0  Q0e `l PK  0S S S! S Kp !K 0S08# 0S  0K?08# 0S0![ 08# -LM"1P0S; `02K00q 04 @"48g#8!,# $8#$$. ,8#8!8S\ <00<0 00pW7/ <00<0202%tAnm -QL0M` P pL  , K,0pL0 P 001L0 0< 0S_ D K@X RVD0KX0  PT d0 0Q ύ000 0 00(  0SX qV P `0H0 4Sp 8H L0 0@L0P@ d00 Q<0 0g Qe r 0s V 0S d0 61@  @GP\X0Sf (K VD KX D@K ㌭D`KX@ PT d0 0QR k000 0 00(  0S( q& P ` H 4Rp08H0 L0 0@L0P@ d00 0S  <0 0Qr<!E 0\10000Z ! : 6S7%3@T00T0DP DK3@X 0 0@0@ 0 L0L! 4  4 0 8008004DKp0H0 00 T X N!<  6 0S QQ 0 R<0 0TQ Q 0 R 0RQ  R 0S  T %0S 6 @%1<10V0 0S \00@00  H04"48#\: 0 P0SV "Lx00x0 0D@0@0PSf R d0 \0p`0S`,"(@L00L0\ oP p QH Q 0 R P!A@T00T00p $#$("Q(@3:1<12020S oP pQH Q 0 R (0RIT (0RH  @PPP W"0D@pU 0TP  0 D@K D`KX@  嗌P-T[ @D00D0UtAn p-RL@ P` PP K@p@pkS dS5S 0 PphmSnS)`1RP9 j0 0 0PP@ 0S@ 0 Rl0l000l0l0P@@ T+P( ,@ =0 0 l00@0PP 0S0 S Z@ @P @-@" --LM0 0 P@l0 p`-00S,* @P7( q0y0 ` x("(04"408 P  p0(0 0H # PAQ(KQ`0P 0S 04"48#8QS0S , "\00\004 40tAn~\Cn --LML2pP( 82U r PUF @0 l0l@(Ty R 0S8 RR( R 0RX#  !0@P l 10S@0  (K 0h@P< (0PFm(Pj0(0 PUX$ l 00S@0   (K 0E@P (0P J(P F@%$K0R 0S 0 3@004  B4 0 )@\Cn >iʚ;tAn - QL`P0@+ 0t03Q0S pX Qb -t - - - - -` - - - -l - - - - -| - - -0\ Tp op i 0`S0SK 1p-p 0S0S/p0(0pcpTQ0 p V+pC$1@  pPpP5 Bp p0 V8p( iep9p0  0S s sP 0p80rV 0 ,B0y`f>i >i\Cn>>> -L<`@41à PddUp !@0P0@AW 素ᶐp' tf/9|Q Q V# 01V 4 #tf 4< (<oCn@-@1M    QP> (19C8# ("(8S 0 Ӵ (B(R bA9C08#8(R00Ӱ0Ѡ =0 0S01AS0#!8#(B8 CP&8!̱P ü&,0 0 20oBN|1S(  S < t0b? S Q Q c|0@ P1Pp0P 20Sp P(0p S1*(0P!H>i -L,MY0@S5 S Q/ ~/(K(0 40 H <0 <0*0S`` P PPjpP7 PDP D T08 # R; 1 P7 (4 H < 0 0 (0 {Y0S S  @ ` P0 , 8  <(4"4!<0D  <4("4!<,0 0 0 D ("(04"4000 ,:8#40* 00S D# <4!4"<0: 3 #0T0 <(4"4!<0P <4("4!<0Y Rx R4@0a8#8#!<< !8#800beKY 0S|RK R4 @0b8#8 $#$(0"0"(`0!0 Y Rf R/H Q4L@0 H  0Xz `@  p@ |k@ 005(P0<@@0 `= >0?@0 , 80 =^401q  x0 0 Y Y 40 c("(04"40Y `\0P0x 0 05()* 0@ 0 , 8 7+,1 D 0S;0H Sm \>i=i=i -@Q`RLMQp % 02K R RP VPU00U0SRF R R @00`eV00S RU 0BP U 00 ť<( 4"4!<0 㹥 <(4"4!<0 0 6S-t0i -pLPB P`,1(!P@ ! a0PBAD00S@PUPU L0SX 2P t,P ᥄@墄T ? ?P0( (8 0 0# "@oo`>i$o 0-L@@P _0hj?Ho -p0L M\ \"!B 0 Q0 @( $0@婥K`>i$o>Ho 0-PLP P "0 0@ 0ht- -: 0RL: 000 0Q000 H0"!B 00C0Ƀ4 00C0H0"!B  $oDo -LM@`Pp?0$ K@P < 4("4!<S >* :S0:>>(0@P pt!o -LM@`P_?p0$ K@P 0 0bS>z>(0@ZP hl!Vo -`L9?dQpU @^ETP0d1h> -Lp"?:: S 01 Q:1@VP X\!4i^> P>`0@1A }: 08#8:AQ00Q000@ H 0?0 i2>@ ề(>iop>iAD- -LM0`S Y0S{ S0L0X0@"2  ! 1L0圢L0"HAB>xrx2, P Rj`"0Q< L2* ! BR0 0R000@b "0?0ূd1@0Sd!00da0㼀0  0,`1R01 HL!`o=d!> 0H@P`1dA@0 rYX 7P@800# L 00j^/  @0x!|1L3@|  21CU @ 40P!@ TU@Do@oo`>i$oh>id>ip>iAoD- -LM@PD X qK! P0`1 d ` f! ܢX-0S%  0 , KYPP> cb? 0@X1A Pp0P0DPd @0 0@0d (K1|2H |2R(K  P! 0 0$ 0 P $ pP| X 剢 tⅢ0 Z 娀0\0g  Y10 0a aS0SD0Dp0P0P!= SB `0`S% 000  ! @P }d @0 0@0d T0@P !}0q [0 20   0 p0R0P000:0:TP!Xy ToP>iHo`2i -bLP|p@P |4Q- Q(+ WP2ųpH20S S03T@!t@T@@3b/  R8 @D#h.8`#hw1 10S> S A !0S01S 1 g`P \ 67Q1 QL  Q3 0n Cw@ Qp0/ 0nC0@P10%Tt h1l1 S 1% A5g0 R0! S 1 !g0 R p00n C PN.n2 2:20Sp pS:0S0 Q020Sp  p S:0S R00n CH>i2X>i9=i -|0GL`@pDP PU:Eh0R1XP @y00PR1h$@`2i -LMpP< @0, K`P 0 0R e; (K 0aS0BD 0a0bS&S; P @l0l <0 l0w0w000030S S,0S H 000 0PP 0 0 P Po xD@D0t t 0S "2S1 `0 R!t0:t0=t0WPx T0prX1P hRT!00 001006<2 4!0$"?08000v:Sn: S7 100! 00&?0D R1 0cS!`> 0@P1TAcCW7P  0(@0 @ LY H0@P !0 80P00Aw:H Cl0 PM 7 Ao\>i(>i A-L@J 0\:@T 0c 0bS R@TLd0D L1M0L1  l Bҟ 00C 0> -6| 8SLP@p@T  0S 0 0 ( V%  0@S1 `0V 00000 U | R l0  HPP t04t0vt04t0"o -LM`0 ȜP P  00lSں 00lSpWP, $ 0! lPU0U0 P` 0O0@0@R 刞M000e0     0/8 4 0 W  1QS P, R0000 0$ YUp 0 0lQ0@ @,P尀U㲁 ,0S0,   0R (K R 0` 0R(Ko 0 Y  0R; $!0000 0a1 ~0@ @,P尀U㲁,  0@_8@ 4P @P@P@ p 0,@ /8 4 0  s R0000 0  0R "oo --LMx00 4 x0KH 1 0#2S S  x(K 0R :Y 0@`jT,` TPP P  2 @10\1 \( ,0B@T 0,#21S  S R0 000`n^,` P<` ,  H $0$$@X%4P,̂&.,%    R  R > 0P0"!U00s UK 101P=P L wP  ~,`,``,` 0   (0 pd w  80KuP 8 0R:0[000N  R 0S0sA 0S0S 0s7 R   0S0S0S+ @0S' PP <000  0R0% T:Y PPE UP  @@ R 0S PP M p;R  G  CH  <(4"4!< D0  <4("4!<@0 00 + ,0@ 0@\K d@Kc0K@0xK @KK0K6@GK0 ^  ^ h(  @  0 0 RS02 J@TI \ 9@T 0Rb 0#3Rm101 R |0@  @|1S SPx9A ,@@w0 00(, 0PU R 0S:D R \ 0`@ P1#  @ 0 0\41ʴ@T H0K0(  0 PHQ @P PhȟX!0 b0b S0@ @0 \ P@dPX`P a1 n0dPR ?S0 0,1(1\ \ \| HQ 0T!R D00bS0c^/V !R0B" N1Ɂ ,0^0, 0O0@0@00 0, `n,` 1^0n Σ 1ɱɡ0,` ,`6VSʨ@ 00c0a0PU0U000O0@0@ RP 0R P U t0 0t0 P @ 00cS10cSn U = @ 0(zPdKśK›Q Qz 1P0P 1$0 ?008z70S @0dP`XPP0S3HQ D T10bS00dS'ڨ@D 199000 { 0K  V101 00cS10cS0O0@0@e$,``e ,` H0S DT10cS`!0bSNڤPL  `1R 0R 0RL6 S=&02 '14 = #P 00 0 2  80KPl 8@ 0R0% *8圢 @Pt0PP t,0O0@0@t0@ 0@d0Kc K ` 0KKK0|0 K  1AQ T!D00bSJ0 @PR00U0S% ^0S9Q `10cS 0\1D T!,0S0 P 00cS0`S 1S:6S dP`XP (<PUo,>iDo0>i oPP@Ji>#o`2i\o4>iPo8>i$>i#o0oA#oo\>iH?T>i (`PVu U 00lSxy00[W 6S7 1Ũ@t0 @UAt@8 0 0bS3000!0 !? 08ey@t0`0`SS1R!P1Q!]81S \ c 1'0 1,0@S>@0L0  Z@  P 6 Sʠ@$"P00SPQ,` VPPX 8C(RR R ʠt 000t8C80CS@\J-I-LJ-I-I- J-tI- 0bS R 0bSQ0Q,0S 0 0R@P0U000H0^0 Hጅ t0Ńt3P3Cx0 |1S S  @,A $4$@04t 0S @ PVD4P3Cx 06 0 ( 0 C 0 00i4 orPL I0 00cS@,` ,`B68C( RA0@S0S  ,0K  @t0t16S' Sʨ0lSڨ%6S$! 1S !10cS000ű`l/H0 P  @0Sj08\ @ <10cStl 1SG 40&@0?0w A$1T'P1#0Q  !S | R l0  HP 0 x@ V0b @:< 0Vt 0p!0bStŨh1Vha 0 0bS 60CShN-TN-io$>i -L -0-0L@08C8A9Q/h1 !S0 Q xQx<0 / (t&8 S0Һ6 sBp>iA,> -L`Mt |0`U@t tPhUtPf -400`S:70 10 0h0 3t0VtPr 0\ P1P!R,nx Ux0xSP"P3 ! 13^hhX0W0U1!X x0d d X@d` P0\b0c3QX` . X hPt0 \:0 t0|1S Sd S .0t0 t(K1Sh r0SH1X:S0!0bS`Q Q; 0b` R0a0aSTt 00aS  0Q ^ 040@ t Gsx ^hhX|Uy8s40 @ Voj p aX pʃd XXp I r0 S X RU0!0bS`0ODH0@@)H0L@D:pP IX00S; L1 0X0 0X0X0x F 00 0x 0S0 (p  X(t00t0pP 8HX00S 0X0 0X0 00 x0S 剓x0 P @B t0 1R B X40 <(4"4!<0p <4("4!<\0, X0`#P7P` 1Q!0\ a6`2 S 0S0S"("(\0 04"48#800 cQ0ՠ0 ڄ& 0Q 1("(" 0 0202r R 40 1 0cS!0|0 ( |1S S S ("(04"40| @x00| q0%00|S;0H l@ .t tQ(l1lP\l@0\0@0tP 00 0tPP  10cS0P`!tPdQS 0 S   4X0|0 T ,< $8 #$,,p.T0K,A  d4TK 0T| p ,0d00d0ğh00h0t0Vh tP    Ut0 PtP 1 0cS 81!S3 <8!0000@P 0RL `#0?0q40A rqF=0P(0C8#,("(#80 0@l 0|}8|H 0@#ft N0 p TK/p 0#10 " 0t09qTx 0P_7 t 1@0S0KT@K 04 4TK(K 0`@:tP ' T#R1p < 4("4!i<>iom=i AN@>#o0R1\R!0  Q 0-LEM|0@p Q 0S- J_K  mK .|> .|< -|1S# |8 -|( -XK&0X0T :0X!K0\Lh0DH -00|, -| -Poo#oo p-LD@P`P00T00S d0ph p -D@LPpT Pg d0 \0 00h0W0sP 7S -@ML0  0 @ @%Kk-X<#o -L Mp@Q` (K0S PĢPQ 0@SŸ3P8 PŸ. P+ U V' 001@0 @ 0\@ Pi @0S D^ < ,$ !$0,0cS10cS 01 RV @ 0@ P< DZ <,$!$0$L0cS10cS`F0l $#$("Y* h1Y0*t05t0 p10dSupA0^/t10 00j0 Rf 3PAP @P`8@K P8K@7K` 0cK4P hMt05t0<0=i,Lk-#oXr-=iDok- -L(M@PQp` (K0S0SJ UU 0ES៕LU UG 1 R VA 0S a  0R:<K  <0KJ[#[`0pgUF P3 @08S D^ < ,$ !$0,0cS10cS09 0S0S s娐 0pP $0Sl0 R L03PAP @P < K0P@{,4KiXr-X<#oDo -LD@@68C8S S\06aGhB6S,0 R3QAQ @QN 0-@LTP R0000 0 ?u@T00"o 0-L@*Pco) 0000Too p-|P@L@`bt0xPt06t0 @$nD@p0t0n p-6| SL@P@`h 000<U8#L00S8C88#ph06 00 0oN - LPPPpN @p81@P0.@7 la@@ lT  l 0-S00t00| " 0C18#8(BQQ/6ڀQ0ü6p0 $1 1h!l!l  00|1|1 @0@0  w x DPToH>i-iL>iB? Ji=i -L0MP@ PH0 L P ||0@ @ H0D0 Pd`X0`0lQ< PN #0@ R RF TP X  PL0X 0  2@0 2P@ 0 0 0H0H  ,<$4 !$ 4),.

ToT>"ol>i#oHmmll-\>d d0S=0T 0S00D 0S=00S( (0?0c0#o#o#o#oAgfff -Lq'4@440 (0!nj h&#o\>i#o#o 0-@LX't0P6 S `0P T 400aS70h&, ,0 ?0Phk#o\>iA#o p-L M@,'t0`V% 40040&(BP1 R|0@  0 ?08i#o -@L&t0p0 h#&,00,0&= R P0` 0r00r0p04h0a P * 8(C89H C1S01P:000<00oB\>i#o>i 0-@L&t0P0t00h% -L0M`x&t# |^ p!0 RJ70cS608#8(R62 &$  $ 0S8<Cg% Kr(0-0(00 h1C1 S01("(8C8S&ƱS0ü6 "0?0Wj2 R$ |@T! 6Sں6Q@0 R  P d0 \0 |1S (TPP \0Q Bl6Qʰ0 G P!P 8Q2PV$1 AD10D1|.-0100tD [5t0K^?0 4KDK(0LK40 0@Ka㼊|0 00K/ K(0T,0 (0D2 %_0\08oNBp>iA=izk-#o 0-LP@@@iT0 p-|0L@P@X`eP 0X`V GPPDph;T0\ QX`X(!10bQ 0 0`V`!p>i>i`2i 0-|0L@@P3P l0GD 0S 0h 40 \! 0 `\!0>i`2i -LMp`WP P0SR@ Q㕯K"! * @P 0S:QR K /@PS2[S S% @(K %S2[SF S  KPL 8KH0KW X DP @0 5 8K 0n0P  UKHK0f0@P @ /$X! @ 0  0T0 P0 #$/ *@0P0 @ 0T0  KPL P1]x S[0Q00 Qi#ool>i"oLm -6L@S4-4-4-(-(--06T 6S|0@6 SD D0 ?0P h0606@A#o 0-6| SLP@@ڲ0 Q P@P00h0h p-0LSP X0S!@` @P@P p`P@00<H0$H@07@0pP@P@`8`\P Fl0 00|1|1>i>i#o -LM`@pPy#0S "V:0P6 *6@U 0 R R/@ 0W@" 0^@VDP V@0W`1 W? W V *@6@,0W 0@ W8 W *@t0 0@0V7 0S0Pt0t000@@t0t0V& 0S0 Rڰ7R@Ӱ'@V 0S0 R t0@4t0t0 4@0 7@0@t  6$St @@ -LM Q@p` \ 0S ׼TԼP(K 0 Q  0(Ko蒻"0 0y03X0S 3SPP!T X X᯼ 0(Ko$Y4 ,  DPU% 4P , X񟗮ꌔ-|-Ԕ----|--,--H----ؓ-t---l0L GP40S 00!, A4  004rP4 0 P-P0S S 44 Px 0$:04 #00040#0? 04 8Wf44000100Pl0L PQl0<  uPU40P 0 `0aR  rt 7PH0S0@X 0 U4L1Q#Pv 0 04 M10L1P0#L1iXY8Pd PP`0 0Sx  0D040 Ul0 1  'PL00T0!P4P?0X 4P845P4 2 J4 P4 P0 P*P%  P  &P P40 0 0r 44 0Pr0 R 0S0S0S 0S R 0S0s  fPU  PDP p 0S 卼P P 7P`2ioA(>ih> 0-L MQ@P K00S S *0 `@P#S^D 40PK0h1R$ 0PK0h(R?i#oLn 0-LP @Ꮍ0hO  -LMPYp00 *R7 0S` 00S(K(`0S/`0S1` (0S8`@ 8H0,K@Z`P3S l1@h!P` V(0S9` 80,0  ;PP7` @ ᙅ08#8 $#$ ,0Z 0(0003311 (0"(104xq"40p0 R2H 02,00,0(@0 0 P`A`},o#o?i - QLp`@P 0u03Q0S1Qu-X-T--------T--؛---4-------l0   0 m" 0 m PZ 1X.Pl0L P-Pl0   0m+PUt2@p PPTPP Hl0Ln Pl0p ]  DP2P-PQl0 > 0S 0S$0S(0S$ 8Pl0  0S  0S$0S(0S9P l0@<4,800P00z@PUol(0S@9P P᲻PTPO 0mul0 (0(0  w x =?i?i0$ot>< Ji=i -QLM 0S K0S0S P0@ SAP T \  0 0HP־0P @0S   0=i,0$oȢ- -LlM@Qp PU (K`VP0@Sl kPg P 2 R X 0x S 0t0 p z L0KLK0 KPKL`KDK| |x  4 0LK`*P2l0 Yg xt 0R:0@Kh`K0 xtG@`PKⵃ0 g0KhK崃x  P 03*PWI ["[pLK l0@p$l LKL KD0K|0  DKLK0*Px p r DKLK0)P dLKD Kl  | tl pLK l \0TpdM[DK"[0(P3,4KiȢ-0$oX< -@0@L@5@h0 --L✩PM000` 000 , 0@#2S S0 7,P4(K0c0K 0 Sp p *:W 0S000 0V $#$("(8#X 0 dR' U00U0S 0000c0K 0 Sp `p * 40K♽P[ 4 0R0%p *0\bᔵHK0Y0 0S 0S0s 0SV 0Sl0 ; 0Y0 0cP[U` U d@K㭂0d0KcPK0 6K(1  X7PU h l0  b@(bT< PU @0 Yl0 000b2  (0V0(07  0ש0S 000F0S 0s?Y= R00d00dSPU_#0RYW ,0S00S40S80S0S= 0S:$0S7(0S4h0S? %0@P8 Y h0l x50Sh @0   h, K@V h0l 850Sh @0   h,K 0pƴh0dK@ P,0mP,P 00 00,0 @0   hP [Y (@ p0@哻PU 0Y,0 l @40S@0   , Kv@V l 40S@0   ,K 0Y l0  ,0S,@K @0S@ )0V l0  ,0S,@K @0S! 0pU@dKP ,0PK 00 0fh0S Y h0l 20Sh @0   h, K@V h0l 20Sh @0    h,K0kp h0dK@ P,0P h @M5dKO0d0KcPK &K 0`0 , 'P@8 Y  0%> $0"!0Y$00C ( |NPUD0T00! 000Y: l000 ;(@  0@嶻P#000 Pi#0Re8 R 0R^( R 0RX( hPh @׿HK00l  0 hP E#o>0$oʚ; -L㎸0$o-Q@P P*R 000PL 0M`$o4?i -LMP)0Kp @)0[ !#R)K R ᛵ (0/0(0(K%aVT 5,  , 創001S %1S T5,  , y0701S1S1S ,1S Q ( Pk$700001S41S81S 0SN S 0SD S00S S000(1S 1S  ᳷P @ @ 0 000 ("(04"4#0庐(1 0 ! 04 40)[Z Z x#(0/0(0l00S 00S0 0 0``000I(0C8#8 $#$("<8"( #8"000 0O&B 0J&)@[T T` ˴"(0/0(0/ 00S St) +0K-@0+ K*K*0KW 0*[48( <"4!<#,## 0000 1S S0 R0 0(0C@0@0@0 R00C@  00C@0@0@ 1 00K(ܳ00,<$"*)0+ K00(0C@   00Kij00,<$"*)0+ K 0嶐0+ K*K*0K*0[0 +0K⭳ 0 㧳 04"48#89C40`$o=i -LM⠅4 8  +0K`ዳ+ ["2S S (00(0 (K( 0P "2S S k 0P[`P + ["2S0 4* K哱0S000 04 8<,<$"*4* Kz0SY )Y( 0S:Y )Y p 0S 654 R1 ( ^30 PU)PU& 00 R@T@T W 0S 0R Z 0S W~P$00$0儳w040`O0@Y0@ )YuBP8 R LP  0>S@ D0R@ 1 00Sa@`10`@ 0 @ , ! p%  !<"@P `0Sw  }) i 04 8<̠<Č,ʠ*K) K)KP>  048<!$!0!̠ 0)0[p:("#! !4!(0 @p*K 0)0K tP  )0[S 0 0Q(K`P000 00 0۲ t@PZH00H0Ȳ 0 0 0 000 @@p&}`$o>4?i6io mmBn -\0LP1  0 y($ 00 0噲 4?i`$o --\0LM R1   00 0 W K 00 0w4?i`$oG-@0 0P8< 0#40   0 ! 0 8<0# R M` *\\\s\`B0P3P .0.. " A1 "4 " "  " "0,`0 (V 0 Ѝ08 <0#40 (0, "V0```r``F0 0! #0 042P .0.. "1 A "4 " " "0" 0 `# V  08 <0#40 (0, " VHHHqH  41,!(1 !1! !!, ! !0,0 00 0 P 0.(. .A 1 ! 4 (  0 .,0!$0   !80R0!L`@ OL? A10N@b@P, P0@ R?W@pG 0 _?W@P0 W(K (Kou@, u I,0!pc?WP -L$M L 1>?0@0c40 S.,0.D < 80 @0 L0 #\##4pmvmznܼNS @L❀fm 00@0#@D@H0g{  0  Pl PM舂0na0 P0#    P T0` 0fk00#̎00i$ 8Pl1 X0  P$0 PĐlq dK 0'b,p hQdp` P} 0P `p h 00lˠT1P $Z g{0q 隁 0ppfKXa0 $!@ 0 @@Pa018Ba  n @ 0@ a0g{ e[lp @  0@p`dI 00 0 nb)h0Hr `la p `0 01lip 0  la dKa pPcH0gy  `0`h P 0`l 0` P80hh  e[ 0P 0T P 0 g{XT˄  0 aP 0PP0a8@  0  hDL1fk e\ ᜐ@ 0@ 0h@ lˠ K Xp! `0 l! !0p l0e[p  ab*  pL0<` ༐  0` 0L!`dK 0}  Hࠕ00! b+ ! T1` ` 0e0i  0 `, 0``L0lʀg{Pp a  T P\vfl0   0p0p, pP0ig} @,1lA l1@Pn 1 @  Pfk @P@0H` 0Wl1 0P荁Pl1  00lˠP g{ 0 eZX0 pP `  %8Pj0$ 0#Wh0 PdKPHahnਐ0*0#  gT0 !P`Xj`@pì 0. 0#  (xT1 %`pmnpX` a0,0# @ @lL0 &pe[zlˠ dK 0  0# fk '88 h0  (` T j0$ 0#a`0g{dKHP0* 0# h )@Y@0 P i `LP !lɀ` Y0jfj 0. P 0# &PnPP ` 0,a0#@@ d0yflˠ ``dLp 0 0#]jX1 %pp`gz` `L꩎0$  'e[ 0#` H0d g{p dK0pin0* &0# P1h fk (  ሀ hpPj ̀ 0. 0# !0hq 0`[\b,0b;(! 0`Xq n0,lˠ@ a{  0#T@I`!  0P!` ꪎP$0 P% 0: HQ 0 (夀,`L;] 0p0Da % 0dc (K -0Q^q?`p@PfUpLpV@@Z* Q :@ @0Z* Q* aom@ m @@Z`* -L$M01>?0@0c40 04L0 0^#<<0 8 0@ #8D0 L0#\#pT..l<[#4)KD[<*K4/0K@L04 00K40-PK C.KP H +K,pKH0K  U 'DH  0#<0 "( 0#40  Q \l(Kx?i< 0@-@0@ $0$ 0 0 0 #EgÉܺvT2 -LZM@  hK3moOh b4bp   _0!dj i .i ( c `0`  cc,0 " 01 \ \0 (bx  c   q! X a=ii .ଐ cq-T 0 ,' i0i  0̐ 0Pb1 0i(i   , a=! L!aL bq *L c-HL1 . i0i ,0 01 0bq'D  @i i jj! 堐 ጑ 张 吡a=(-༠c <0, cc )b0 8  .0ax  b ,  8 =j|x! 4 pb!Q? `P0`?SpP`0L`@  gog@pb@ g C?0YP@p ;?0Y@P 0 -LM`Pp(K  !62 b1 R<0Q0^ ~?@ Q R 1  !1Pf\f K>t}PZ1Ab_`j?qā^f> AfoQ0@^ q  0@N01 joQ0@bq  0@ߍ踑< -pRLP' D@A1>0` W@;@ RpG`@D  Q*H0 0@WH0L@W耀cW-:P` +c@1@ T@D 8 `ph Pc@1 0S@DRH0 0@H0L@Pb@1 0S@DRH0 0@H0L@SH0 0@H0L@y -pRL`. D@A1>?0 @c W1:PP b@1@ @D  pj?W@<@pG@ ?W@D @W Pb@1@ @D Pb@1@ @D 0-8PL@ bP c@0@0D@H0L@0x< -L\M<, @@H l h p P P 0 t p0 t0 < lp p0 t t K @KP0|0 x@ H`0 4 0 lK@  L#D,<4PK`!$P`t|0K, @^ 0 (KT 0SQ0PM ?iUUUU< < <7 -L MP@`pP DHL.$ . . Ƞ,Ƞ  D,, ,4..D, @.$ @$.`0PK p@$,4  0 ,@  v 3 0,40!0 0##$ 4# ""# !"!!" ! 2!26:0#`p4 P!@!4 ! $ 0 (K3333UUUU -,0L0@,0 << 2 0h3`%o 0-L M 0t3pPp0@l 0D@%SDPS@ 80@SK0h S>$o`%o>d%o> -@PL 40$80Q8QhQd%o$o - Lp`O`P W P80U408@ ( O@PP$od%o -@QL^ ppW`&P0S"  1"000 !   \P0@0 0 000ࠠ  @F@@i<@i -LM00 SPA 1p`^2 @0S& 0#1 V U 010 R010 R Qt "10010 R @ ^t`VX p(KV ^"100(K @ pP ,P0@`@00 000 <@i@@i p-@LPf0` RpQ 0ES"100A1 R U 00  Q 0 S Q pP-QU( 00  P@@i<@i -0Lq0SN R\ڈPPU 0S00S  00U.UARl 0`P: @2!  !P0"P"10010  唠 l B`%l 0 <0P  PP P@@i<@i -pP0LS`P @VP#:"100 A 0S0C0000SP P0  0S O<@i@@i -L MpP_ <0S\ h4 8QW 1PS 1 PY`:4 R 0004 R80K cP00K0@#0(04(K1"0 0 0.0S  0@0/00@0 @|0  P p( 80(0p4` P8<@i@@i 0-LPL0@S ,0 z0 0g00`%on.Q@-@ \0Q  P 0 SQZP00Q0S @10  -LQ`.R.\V&  \* V  R b\`FPXVp`V @@lT@!d OXpWWW W>>>> -LQp`-R-\V% 0\* V 0 S c\`FPWV`V @@lT@!pd KOWVVV V>h>0>L> -L`RAQ=8 Rp.0^p.W& 0Sc^pV$ WQ `dV pRP 0 @nT@!  P 0{V(xVprV oV>>>> 0-LxMPP$@KtN| |0 | x p l h T P \ 4 0 ,  L H @ < 8 ( $ K0:VL@i.v.u.$> -X1L PPH0SL a@ TG P. 00 R 0"QPU0ppW!00S PP Nl P M l l0@ T0P M l P Ml H@iD@i` -pP00PQ0SL. fQx X0S X"00l  0F@P%h 帥P  !'Nl u@ 1S  RU 1`l P@I 0BSI y.@x.h{.`{.x.X{.y.|.x.x.|.x.|.T|.@|.8|.x.0|.(|. |.|.|.|.|.{.{.p{.x.tP l p@P  R0 !P0p@ PU `l SP@ 7ssl >@0S l 50S 0S 01S 060#0 R0 P 0R !("(  0!S0!B("( 0S 01S 0j0#0 R0 P0 0R !("(  0!S0!B("(  0S 01S 0\0#0 R0 P0p@ PU[qmq6q410@ Iql 0PM  0R !("( 0p@ qq q q qq;p9p7p00@ pl n0P 0p@ ppp0 000 S077@0D@iH@it@iP@iBi < H0KD@i -L_M` PR B @gK JY< 0 VpW  0 80S Y# 1hK@ J(K #00S. 0S hK$ mJhK  hK$Y  h0K嵂p 0 0p   0S  hK$ -LXMx t `@ppPPtW 0h W <Kt0|  <0K(K<0K<K|0 幸t 0W t0 <0KK 0S x<KW th, Kpl t pW<0Kp0 hl0偡, 0R(*R& LPK h0_ R t  0 x00h h, Kpl pWo h倡0, W0R030 "SP f@Pfd x,0pUh0,   0R030 "dSP3 @ R t 0x < K| <K }Ik< Kt0|  <0K}nt 0" Vp0 0#0Vxp@ \ R0h,0 l0 0Sl0 5Wb2| p0R\pKCi -pL@ 0   RP`0 0` 00gP U000@-pS`P @0 000   000 000  " @Tp@-`RP @0 000   00 0000  @Tp0@-PQ @  0 000 0@0PU0@-pR`% P 13 RP@0   "  80#440# ># b1#  @ 0@^ 0-@P LX 0#40 "( 00  0#40 "( 000 < -(0 $ , 08 40< 00^D -@Lz E02 -LM,PK` pE ,[  V 0R3000[00K–\< ,[  T 0R3000[00K 0Q1 0Q11 0#P1@1!@0#T1z xCK1 0#P1  0R3000[x 000#0K  0R3000[x 000#0K -pLP`@~Vz_1 0#P1`F SV@  Cb0`R1!~ C20VS  21!0#P1z_ +`h@ x -L@M\PK`p@lC!kC@0\0#0@@T(  BK -@RL@M@P`$p j 01\PK@7C!6C@060#0@@T PBKp CA -L@M\PK`p@C\ C@0\0#0@@T a ]yBKT -@RL@M@P`$\p Ev00\PK@B B@060#0@@T +JBK\pB@ -L@M\PK`p9@BX B@0\0#0@@TZ  BK -@RL@M@P`$?Xp 00\PK@}B |B@060#0@@T$ AKXpfB@G- 0$M0| l L\ ̠<Č4HX p%Č$h Px (*@&'4@%l,| @@ @ 0!0R#> eP@hT ` >>@D XTPT  o.> -L0MH@K`pPS 0 }K -L,M H D L0 `J@ LPH  Rr \PL7P 0: SP  @0 @0 0 (KL@1 0P80 0: SPt0D@ 0 ?Sʧ LQ  10P ?HKV@0,P ?`KUL20 R02 0 P\V L#0S0 P| VD0S0X0S<0 @0 , , 0O00p'T P @<0O ȟ P T K /<@0@Y80 4@ WQ @,0O0 p"XI8WF80< Z @0 L@@0 0t Mt0D 0 ? SEHRB0T R800  0$5@ 0p RT001Tx?>   cp i  0S0X d @JTb001^ pQ?>   cpG C  0`0CW^ Bb   R 01Q 0110l1X100`1$ő\ 1 0R 02S\0 P3Ѝ 1 >0   r  R 10 01 -L$MH L  p ?᫒0OO^P`1`>PL 0  BSLaeH L08`0?>   cpH 02ᠢ0!<PL0` p2RLH `08?>   c 02L!0<PP| 00`1ɯ D @ QL,0S PQH 08 bS180 1, !1!40 L00 0,<0 h1< PoQLL `0Oς  1>0PO>p@P` Q 804 \0 0S. 04  0 S ^,@ 0O QD  RH  0@|A ?(KLH,0p S0QJ 0H 0 @AU Cip>\>|> -LM ,  @_ 0ထ8  0z4  ?n0 0n`, p @ ,8P804@0\ BQLT4 ABQ0 CBĘ,0UPT@!4 V< ᰤx<0PQ`004P`1`#Z ,V`!@V`YL#20T 0U00 RH3 VHY@0SJL#20T 0U 00 RH3 Vt\AZ@0YL20 8@T@!@`02 08\Y YPL20 80S@@2 08` BVPZ,(K004`~,@]TP, ,L#2, \08`V04`V T UL#^08@T04`V  U  -L\MD< 5 Qp< @ <`000 00 0<@@P(0PpǏpP @p8@ ?@d_୐8 4 @ 8@`4!4P a, QU.QU10P1@ 80<Q8 4 < @0@P @ ?  b<@. _@Pp@ȟP q4 Q 8 <( @@8`04Q SPQ C` 0ݏ<0 \3R 2<0@, 0PD0 Z= 0d ` @娀ȟ 0 `@PdK ? |0 | <,,l0 h@  @ 0h@ 媏@ ` 0 F.lKP ȟ0),@@ ?ᐏD 00C0<0, 2R  B ?>0S @3CL#020C2 0;>P*iU >$>>~ -LHM\ 8 0pSPo0@0T8Z8Po0LO P` 0OVʲ 8@<4 S?0 @8\00 P4 'D0O0@8 ?L8`00p S 08'8S`0`0`QωX 0 !00`D  @0 @@40R<0 8 08PT0ZPp$P`p6^`0/ 1> R,6@^`0?0 0,p0P`W $ 0 $ 8 b4 D0@4 DL# 00 068Q`0 80/0cQD0@@< P088P`0%X3Q@_`08 0P+8@004(Ko8UJ\ 80 0Lx>>>>T> >> -L,M D `DL@ pP(K D P4 D 0S 4 0/ @GP00a0 S0`$Q\Q\0/ A ^6P  4PR\0/ R6P@ 3 ^\0`ω1/p0@00 ,@ g 0p@WXt:p;P ?ߋ0 , @30^\0/ ,0>L0 L1000 R!H \%2R> `2^ 0L1/0 H@040  B ; 0@4D@@L#0 0 Q0C0q 4V0D 0 K KꟋG0NL@ H 0x < 0Ox0K0@/TʲSt0PpD 0(080 ى P  oPOP`ಉ<ȉ`0d/ , l1 \00.QP8PP0 `D4x D0R @ Px PRLx00x0i   ?> 0@3CL#@000|0\ L10  YD0 09:P*iU >l>T,>L> -L$M@ D DPAP(K@D P, D P0 $h0U 0 S 0S P@Q0N 0R P3,׊02SQ0 @_ 0 <@ 8P hD @_P 80 UAO>@P `L H  Q  P 0@4 S 0R  0P  PU 0P0O0@`0D  `Yp 0@_@, 0[T P9Q800cO  vU80pY,嘋 %P*i> -L0M L `LLH PPT P0 00S  L PD D^U #0O0@00S T08U ZO 04 R40 p F0SFp W^ T K D@ < 8 Z?ʉ `0 , 0 K 1>0 108\` 2Rψ0O0K` 0@1 >00S 0@ <0 T Z p T K pQ8 4 }Z8PK` 1ψR` 1> 0 #0P @` ^$  j$ 4 D0S@4 DH0L# 00j 040Z0C40  j! 400400L8@K0AD@@ 0 0 R#A4嶈 0@ <0 S 0@ <0 @K(K80,@dYn \^ 1/X`0 0O0@1>0 AR!0 \ `! 400C40 i! 40040T0 RY3 1> 020$  B$ 4 D 0@4 D80L# 0 ^0C 0  0Rυ0O0` @1 >004姉0@ d! 400C4000 c! 400C40P*iU -LM080 00 @P4 P @ß 0q7|7 (Kj  V ,0P* 00 ,0 F V H#0S0C0ß0 K 0P`p40 8 (00Pl0dp 0 R RPn 0   R P 0P`04 H`6 0 Rl 0  P  00d0X0 0 QN 0P R R QK 0P  P  Q9 0P  r 3R QM @IP 0 Q P0S st0P0q 00 ,0 {H#0S00}j ^ l0S sX0l0U0h R 0l  r 30l R 0l  l  0 Bh  0h Po}@l 0 0 (05 6k@< >>>.>>> -LM d $5S. @pd`  t x02 f V@ SQS K l@0@ P 堆  10Ptpx7 K X\\\ (K^4KKx0K P0K Po0@@ 8K0K P4Q@K00(00 0K80`S 2 K Ze㼠 Ÿ ?p^ Z 1P` OP`@0R P R80P0(0 Sn A0S] , P0S[ 0އZ&`pQ d0 ctx> @SPQP#00d0  c6 0SQxd "t 80O`p X_000K n 垊P' 0 S@P0(0SK ,3H K@00,K冊P,0 D0@_0 ^,弇00嶇00D00 f0@000 R0X.Ci -LM d $5S. @pd`  t x02 f V@ SQS K l@0@ P ~  10Ptpx7 K X\\n\ (K^4KKx0KP0K Po0@@ 8K0KP4Q@K00@ P p00 80S 2 K Zo㼠  @K0@ P?@'Ÿ0 Pp_ Z1P` OP`0R` R80@P0p0Sp A0S_ , ^0S] 0帆Z&`pQ d0 ctx> @SPQP#00d0 c6 0SQxd "t 80O`p X[000K n xP)  R @P0p0SG , D K@00,K`P,0 D00  Z,唆00历00D00 Z(@000 RX.Ci00 R 0d  0S Ci M-L4M00T S@0,0 0T0 SH  `3Qt 0a0S QARQ< D?@Ğ@c.d 0PC0@0S@TT 0 Ry T1 0ppi @T HT00,K  ވP@ ,P w0,0 P@(K,0 4 b4ɯP L0 T  0`(P@ H@ ? @P 0TPD@ /< 8 N T 0 R T0 0 0 @0@T@0\00 H8@d0<s c>rc, StqQP @3T  0(0 ! (pǏSv~P@  H@ß 0c33@ {H@<4 Sʳ H RHd <@D4@D_@Ĝ0e.H@ 40`S H00ßD T@Q4 0 T塾 T 0 VT@ 0 R T 0 0 @0@T0Q00 H 0@d04# c::>k@<>>>.>>H>x> M-LM`  0 00SS p0S `3Q 0a0S QARQ< D?@Ěc.d t@0d P0@0S@TTD`  0&PP"<4 S<7 0 @ Q> 0 R5 00@0@000 (K#3 P 0@ 011P84S 0 ?%S h00h0P  0q&.k@<>>> -LEM P 8%@  8?0h1R 0  P4 UR00 0a QUQY00 @PP Pb0b1re R1nQW@Y0f00Y{,K 0KDP P,00C!,0  0PP Ԡ  \Kؠ  pK 000@K@\P `0 D,1 0Q0 0@0 ,P P+ @0P'008@0ЀP P `p000ԠTK Р @t Vp 0 P0@H>~ Q<   @4K00 ւ@P<40 0+d-̠00  4 d0# c4! 0S#Qx d03t04 4Da&408 0( '@TK00\@Kܠ 0 @}404DF&40 8 }47~@ T- -LM P8%@  =0h1 0 R P4 UR00 0a QUQY00 @P @ Pb@ 0b1re R1nQW@jY0N00YfڜpK4K 0P  04  B4 X`V# 0  LK0  @@ `00,K.P ,0D @4!\@_M R   >@- @\( ^  @ @@LT M-L`Mt t0P  l T l0@t 0T@ T`P0ST` pWDT@  ?0z\ X lPt`0@p0 DP@ ~p ,0$5şhP0`00(80 0(, @80<@p,040 9Q,0Kp0tx 可pby@P t` @  0Spp DD 0@ D D @0 t l 0p l0h D0 G"l@\Pt0P@`1D0!lPt0St@ 0 R000@lPt0S(0$ @p{H tpD @  0hSh0 D @ l@T0tP@P` `dP `` dpKOpWdp ` X PoV($ L p0X  ã?  t 0 R D 1ȟ h\  'L  H@(K\ UTp@@DP`!1<` 8p 0 40 0 L 0SM 0 0ȟ 0* @TlP`d0FS c8R SCQQdK,K0pt` PHpL,0PpHp L l@ t00LPP`PLP dpK<Kp4 0PJX 0O BPETdp ` 4 0P ʁ\`S~t  0S4t Pu`H` h` Rpx`H` A \ X pEyP| \p,0;,09ynl0T@d \ l8^ `\ ?VQLy`dKF0,Kt PkHpL,0PpHp L D@10=(,om> -RLMM@  0BRS> 0 P 00@S1 R4P 0(0( 0OT \&0h R"P00  (p5" 0 Rd 0@0@0 00 P(K -LM@0 q$ @t@310#4@ @V0 0\%1RU  s 0< 8 <O  < $"@ 0_@pP@Prxr`0d  , l1 \.Q00,Kx@P 0 00Q4R# xr,0D  4Q0 (0$ @ ,u(K,it,5Sʰ0 70xr,0D ,d,u@#T>A-p8@T`Pက(/.000b0X3 x x0  T0 S0 008@ TQCip0 !A `gPP@0A#O 1"1?0P HA`p-8PP`# P P 0 r3p1>0 R! "A@e0 0@A0#O 1#"1?0P01 FA` -L$M p4 P<0 7\ lQRl \@ R^Q V0 #4000400,K0 awPP<,0Q44 ,85D 0 <0, (K,r( 0 0S80 & 0H D 00@@,@^3*.D RH0Q84 Q0085@0L 0 U0H D  -L:">\5XX SS 0 R@0Rh0 S8P0!RTTcCiC-0 LS03Q% 5p00P5,5MS ڬ4S9Ӭ4հ4S@0Ӱ4Ѝ0t0/Oq,,REQ `PNo,P`PLH0` 0`O/0U4e85'o$>'o,>4&o -LM4 8 40@oP0 L, B0,0 80p800 \/0 0\40 j Pod0p4 H4LDP`, l5. 0\#Q0t @ DQ8 Rr,0P0,0 800 \, R ,(Kd TS b5 @l4  `\h0^Q^,@@@t @044DPDh L5DsP5,5S4 0054E80S Tpr,P, SH 00RP*i@-0` S@T,0 T:F@ -LLMD @ @@< TH0 Y Di'o>Ci'oDiT4&o -LM``@ -pRP =S>X< 8P 0` 4 @( X0<0 8P 0` 4 < K<@$0#= ,K ,0P@S Ҥ 07 0P@ b@ =S P@(K R/>P> p-0LS@Pd0 0D0S  d`P p0  P ң1p -LM, `2 !\5SS0 74d 00  8@_d t,`p`p<@D_@,n`Vp` p, ,0C@$0(@[`4P8`,P0`0(KaTTd> -$0L Pp`  |@P`@0 S@`V j@P  (0 | @O -LM$0`bp PUMT500#0PP00U  R@ $KPH0@T @ ֣ 0@@F 0Q 刡P Lh  $0`B:$0 -L> -L,M$0PH ,P L  (K`20D0 娡L0H DPPL DޠZu`2D0OO[/ P`$:,@K@vpP],PDpgPlL3P#L3P#h h0 S, ,0;,0,k(5`(0/ d,L  40@HjP@ L080p ` ,0 D,k80@`\ p@0\4 0f0PH4LD/d  `1, 0P#Q,@K0D@pP ,krB5$%R ,0PS$% ,0SL0K 8< K80 4@ < 0 3RD  H0>|a/ -L$M@pT嚉$K 尊P@ 0 XPZd, @ @i 04 0 4O  4$"0@<0 8@ @_@P< K @@Pixi`0d  , l1. @\$Q00 (Ko@P,0xqi,(0 D 6, , 0 R,,00000(k᱈> -LJM`L QKh p<P0$N5%0S' L `@0SPP6 (K 0$00(!$00$0%E  $03PH $0y$0$ܐKD Z 0I>PP=S3$0 KZ 0p @0,00C0 0K(P 00 PPp0SP3 ᓉ4 +PP   PH! P=S$0 `*5   (1PP , HH! oT  0 #40SPP $0 LM0(!uP U$08P1 p 0S T T 0SP/UBO@Z wKYOZ Z n Z QKh   0,L\& $ # Hp>|li> -@1LM8A4!00hq-PP1a&PP 7P } K⎊PP  PP 0   B  /b 0P 0u/ 00 `2@  , Cli,m,oiЖm4>\>>|m p-PLd@`P Q 0 R <q4n0d0p he0d0'o'o4&o -L0pSr 0SD `RI ,06,0 RD@T ?>hDP`U@6 , 1P0S,0I X p0S0S 0S ,0 P10S  P,07,0fp,06,0Y0SJjP XD 0S" 0 (P㢫D `R YIhT00S $0 d Q08mx>`> -LHM\ \T \ X  P@ dP X0S S S T0@0 UP  45 S:05S*P(KXT@ 00K{PP 0T R4 p 0d ` @  8  PD , 0H0 > 7Z 0jSXj ZXXRQVP 0,0T 8D @a<L0T@PPu8PoPL0 0Sf45 R , 0S 0 $t0t03U0S000T P PT850 p0L0 0cS0!S<0 PDD\D D 0D 0,0K  <0PP<0 T 0R* 00QRZ 0 0 RO 0XnH |@ T @0D,h,/i,0LD 00 Uj 0 \ 0pP00P @@b b3a R`QVRTUR\0P0  85@0L 0G0pP500 @ 0 R 00T 0 @ 0 \r 00"X  R R \T@0y 0 TC P,}f5T40P*\ 0S 0S 0;0T4 R U @(T000T0X0l H\0 T4Q8 R 0 T0PU P\ @80dK@ T04 0`@Q T0  0d d  R T0d ` 00q0 =>0Ei> -L MD < d @ @0 080 45Rp(K <Pp < , ^8 T^ @ 0p00@@ \3),XVS ,KD 40jpW@$P(`,4800cZS[ 0 D <  pPu,Uf<0,p ^p @ 0 @T? @0P`<0ppWX6885004 00 P41P `Y c PR\QZ!R` ?ST@0pW@$0  S(0S,KD 40vjp0P` ,pPfD(0$   @0` @ 00\RkW@@ 000O8 05RNpH,p -LM(D @ `œP0< 0@ DPK`?O# $Q R<` @$0@PPQ0@ ,P ʅ 0@K0`0@TPpW0@ ,P ZP8P @\D K X8P0O0 K 80 S0c0 jD@Xd 4 <0$@P 0%e`p 0K0e 8@0@8@ ce00T0O4PP4P $" 0@XDP@  R\ 4  $ 0@K0@TP7"0@ ,P 0pW`P8P  (K Qp0@VPwP`p8P V{@PY`4` D0Ky -LM (0 pd @ `T`P @  0004Mc@ Vl`KU,PK 0PP vPUP ,P t @ 0 R 0 10АAQ, S x` ?U Pdx00 40 fh ,0   0 R x ,0D0 1@ɯT   00 R 0$ 0pǏ0S#  x0@S,0 x x@ 0P` cP R d@(0c c9b SaQSP``(K@ 0 R* 1 0pP`( B b5A R@Q2  Q   00St p0  R 0@ T |  PK | \ t@ 0 R @0 0ppp ,0P`P`WX tK0t p | @Q0,( lß2 b91 R2Qx0@( ",t P(`80 0@(, 80<@!"h000bPP cP dV RPQx0@D, 1 0R00 @  ( R% 0$ 0pǏ0SR @^ ,0!P` P`Q 0S00 0@0$ p@0SR^ 0@D ,0P` P`Q0SR @PP 0 0,0 S00R U 0@D, 0 0Q @PP0$ p@0Sʬ0@0! (Po010X ɯW1 !0 ((pǏm,o -L M P0d  000S P K R0 0S  00<0 -,0L 00hyA(o(o(o 0-L8M@PK@D H d! D0K@H0K @ F 0 01K0(o(o(o -hp`@ LP R R 0S0S 0<0 R 0PP -h0Lhq`@P 0S0SP ᴁPP,o 0-LP@P 0S0S00 0-d@L0P Ml 0Phe000  -LM@dPQ 0Sp Q 0S0S00S ( $0@ p0 0P! 0 00 0p R0(@ 0@p0t@0 000   -L@M 0H QL I 0YIDpKP`(1hAL,K 0 @`匘P+,0S(\% P 0( (Q  R0.SR 0.SH0P 0@P`Y X0P(K0YX,o -L8M0P( @> P@; (p\@ K08@haP0 `p*@P ((0( R-0[.0[S "[0R4 0R R ~(04( (0K@P ( T (Q~$K@(@,o..> -(0L(\;;> -L M(K@Pp /,0K`@P,0p( (0S,00 0C000C0000( $0@( @000$K('b -L Md@Pt 00b/$0K0p 0K`P!t0S  0 00`0U 0 0C000C0000(0$ @ t0S$'b`000K$a -LM0(@(0  9,0 >> 0-0@00P0 L k0( (Q00հ "0 0 -L(M((@ D  \8 0<0 dD 000040 t RF;;S<0,K000/ <@P0 0 R 0 >L> -LXM@  04   < | ,0 8 @0H l dp 0:9S0S D  D(Kl@< 0=PD 409x0 l(0$  00CS D l@ iPD |0|S00t0 Q0Sp0  x Ra 0h X0 l |0(S`2 4A|\2 T 0SP L 0JP  0PL d0 ` \ U T R|P0 UT0 @,P ^,K /0Ph R;;Sd \0 0\0 d ,0D `0SA 9 R7h0S Q0 l (0( R000000000cSX S.0 d0 ` h Q l(0( R00 R4 P 00 LS L l P (;;`mt>- -LM0K@ P00 0-LMP@0K Pd 0 R 0S P 0R XyF00 8 0S l -$ L0S00k 0-L`PT @tP004  0 00d 0S 0` X  R R  0S 0000 d  R E00CS@/$/$//$/$/t/t/$/t//$//$////@/Ԣ/$/,/ 000( 4000( 000 @00 ;0 00 L00 00 00 :0 1s s s 40<0@l00l 0<0 0<0XEi8EiHEi@l R0l0 0S00@-@0@Qd 0 R 08 0 Q 0 $  00 000!0010@Q@- 0@ 0$@!00100000@Q 0 S 1 91 -LMd@ 00`i ,0KpP},0dP 0S]  0S00t 0 R 0 0  p  fpPO  fpPI0*000`1",0  R00  0 0#50S Q00t yPM 0pP4MOK  , 0ppP'0 > w,00  0S00ttk 0 ,w w(K[ wpU w00 00,0 ,w NP 0;0;D3im -L MPpd@0 0"&!R :R4 0 R00(p Ly`P d0 d00 d0xZxP`0(KS000\( \` 2 1C0 00 \` PKR-D3ix4i p-L M0d 0S 0P`@P dP@dkKp0P`0d   Y0d   t -LMPp0d0CSBl0tS q$ 0`T0 @ 0 Kp0S@t0@`Pt0sx0s4D@t8`r<@Yᒛ`,0<`;,0/@Yᅛ>0dh∯0dh n0d hh@-@d 0 \00(0(0Q S\  0 p @\(h0S  @Q -LUMx ( `( V|! pP0KKU p! p(KPK UPd Xd2@00K P0 @P ,P L@ <@ Ll xl0 PK0 @0p Pcl1ZKF/pla\p0 SI* R_0YA:ta 5@|Pp`q \ 0Q@h1 dA 00V1KV1K  U!KU!KNKLQU![(KU1[  c B( KZK 0tP`0ta 6Y R0&Y :0 0~?(K0S Rl 㧯p x0 d 0S 00R0p 00lp Qg0p 0Y - P0 @`L 0{pP0l( d000Xp 0 R0( 0Op0t@u0@@v@3i 0- @0@L JPP0l03i -LM 0P@  04P$0l(0p( Pd` 0 R00(p 0 R 0O0@000Au $K0@0 0D0 hA 0@R 0O0 @,o p-PL0@Sd 0 R 0 X R `T&  u up0 d Rd 0 R 0 X R0  0`lkl gT[vtp0 d R -LMPpd@d`VAvtT0S t00S Bl3tt P 0 R# 0T!X R# 0 R! 00!X R00C0  B  02P 000   0 d R 0 d R l'a 00C0000 00C0000( $0@00  a -LMM#dPp0 QQ@ 0;;  ,0K@P ` &t(K,0d` 0S 0 0  p   0 R  0S00t000l@P  l@P{0000ᰠ,000 000000 00@PA(0@Ÿ( <2RHK @0H0  0< 0 K   <@P" 0 Rg <@0@0 00 ,RV 000 D 0@P- 0N0 0C000C00000000,sa  0S00t00t0y? 0 ,xs vsN0 @PNK g0 , 0{@Plߚ ,0000 <@0 @mEihEi -LCMpP0`S ( (0R 9s(K V  PDd!0  QQ4P@ 0P!X  R R30 000 000 00P. 0 0C000C0000lrloV  Έẉᶉ0L d  R NK   0P m -LMMp `, 0 ( (0RP @ᆉ,0V r,Pr {t0t(KP (0Rd 0 R 0,X Rd 0 R 0,X R\  N@P0d@dP 0 \ P!0,,QQ\ P!0+X R 0 R 0+X R\( P 0: S00SD1 @1 lÙ,d PH! dL P0 00 RP  000000P!P000 P@P 0 4L!R L1rHrsD!RP 0000݉PPP!0 0C0 RP1P  000C0C00P00000qNbsA0*d RX @1P@- ᴈq,q0Ls00 0 0[ 000K f@P(>>>>hEi -LMq@`dP 0 vy \00 p00R] P 0 \w 0, 4 0 ,Tpp VpP (K 04Kp   0 R00t`` 0 R00p@@qPO ~ 0 R00t 0 R,00,p[P4KJ 0@T  TL\00p00S\00t00S  wP\00t`` 0 \00p@@u0h tp0,0 4 0 4K 0pP  P 4K 0pP,  VT0000Q 0S 0;0Pb 0S_ 0;0Zx$> -d@P 0` R00p00LQp 9P+Q 0S  ( 0 R00tP  0:0*000000  040#0S~O -LM`d@ 0 P00tp  0lK R 0 P 0p X  R R 02& (0$ gP 0 d  R  0-L MdP (0$  00K00 RS 0 K0CS! 0 Re 0K 0$@ 0 R 0 00D0 0 RS 0K(0,@ 0 R 0 00@0 0 RA 0K004@ 0 R00  $0H0\0 0@\0`@  0  0 h0 \0 0@\0`@ 00 00 0 0P*i -@L0S`hg -L MPp0 Sd`0s0s0s @(K0s(0sX0s\0sP0sT0sW (0$ % 0 Q00p00R @P 0 RQ 0X 00S 4 R@(0$ \ @Q 0X T 8#8RQ  d0X0#8#888d0X0 0 R%d0%X000d0X00 $00T0 R@ 0 R 0#X  R R q (0$  0_@Px p 0 R 000 ,@ 0S@g S S  0@PY$0,@S: ,0s (0$   0S00p00Q I@P l0;  0@P480s 000,0s (0$  0 0 00g8pu 0 R00(, 0 R @0 @00@0,p] 0 R00 $ 0 R 40 400D00@Pq@ (0$ % 0@l ᜓ0d  @0d 00Q T0 T0d0X0, 00 So*n0 d  R 2 000 ,@ Iq>]00s^80s[<0sXqq00ss|<0sik0s̮m -dpL   0@0@0 * 00 0S00p00 0 0 R00t000 0 R00(0p0X0 0 Rf 0 $0 0 Rf 0 , 00 0 R000D040 0 Rd 0( 8 <0 0 R000@0@0 0 RO 00 D H0 0 R00$0H0L0 0 R00d0X0T0 0 R00l0P0P00S:(0 S(084 (0(  0 R 0 dkT\P`` \0d0h@0 $0 0 R0 ? h0OdkT0 ?0 ? -L0S" 0-L^ P 00S \ R 1S1  01S  RZ(@K@ 0@@"00000 -LM, p ` P4S,@PQ@T@a 0 PP 0S,0PiK@4S@S 0 PP@  -L M @p0S Q#0 GPA(NK4倢 0$ 0,K4 OQP1(.K,0aDPQ8 8000   00* 0 R0$ 10C1,6N(K  =<-0S$L,L  =Dd>>8> -LM =  > -LM @`0PQ $0: _ KbJ4r$ 0 K4 PP$`J 0 D\2 20 01  000 M aL ̈́0>><> -LpMp @P P`, ! Ep(K: S3 (@J (0X  0P , (0  0pP40dPQ !R0 r00S0805 0d0ꠔ PJY ڸ$0Qp0 0^  \   0 ̈́ j >>/(oP*i> > -LM @p ` RP   Q 0R 0S pW $`I(@IP4 QP 4 $ 000>>l/ -LM P剂0@P(K4 4,K OPV40 RQ 4 $0pa00 ,0D`IY @ a 00qb P 0S<  0S6 \P Q@ Q 0SG QT 400c{IApd iPV 00`A@ 0T TP,KA0 #  00C 00 0C0$,oL$0"{T  A 02 100I!@P<0<  T 4a0I xp P@ = Z>\>\><> -L M P剢@P00 (K4 4,K OPW,0@TD% (H!\1@0! 00C000* 0C R0$ 101,K( 0 (0`00dq P 00`A @ 0T  h+dp P`  =40,PJ10>>>> -LM  @ 0 0  0 Q 0 F A 0( R @,K4KN`P,00(K(0 4K 0:`P 4 (0004K``M0, $40@2@t0x@ ,04D,08`8KK0K`P8 0 B18 0XPUX HK`  嘠KI 4,@K@!N`Pw,80Dp YA T 054K 0`P`4PP40 0@4``?M0 43@t0x@0 D4008`0-K`PB 2(K 0h 0P  Q3 ,K 04K 0`PR40K0@H0 4``M, $402@t0x@, D4b,08`,J`P DKH0KP ,J{,GIH0K Sp# *@p4Qp R0 w0P80S@K2@4L, ,0P;,0,I80@SW 04C0 00 0,IT804K 0$`P4@@804 (K20h  Ag ,JK4PPPL0 4 3@t0x@ 004D008P H7 0K4KM@P@00@0@ "(K4@pD,K MP2, h0D  ,AJo, Jl4 X 00DK` 0  4K``*L 0 43@t0x@,I0zH`0> -LxM \0d  00Q   p d 07{p ( Z `唠  004F@ ,Kp l0KhP ^,\ d0 10LX0\t0 , I LK 3T X-H00 40 pK,0  D,1@t0 \00T0S Z $ 0`0Skh 0LS,0 000  0t R@_@_p "GPXGt@(0`30@O(K `R00lK00 d0S00  p  0@0S@ P0 `@@ `3B PAQ0`pp 0@ 00((@Q V`0@RPQ0 ,0 S00PP0$ `@p0S ,vR U D, 0 0Q ,gt@(0, 3)Ot0x@, |1h  (0 0@(0,@`F@P3 OG@ hUZZc   R| x [ QX RTڰ|0! (0,(0PI   |`0d!p W:0^7 0,0( (`K `pP` p (@| K P 0| x0 0S,om@-P 0@T 00@T 00 :O0SSp- 0P@`@0  p -LM4 |\0 (0 (K00S,0 V < < 0 "!B B\ lB!100$000c?0"!B  0@ Ta^ ^* 0L 0  Pp` ~F0@Pđ`pP ,4@ 0 \48 l1.8.Q<JP;,0ND 8#8,0  0 000 R21C 0 C P `B!100$000c?0"!B 0@ T P 0@0u S B S B#F@h @-0 : Sl0@@0@- 4S:4S :: S ^l @L0S d  04d  -L4MH L HP T0 D PD D D0$!0 S T^T )DHL0/aI,0D}8@ $3ßhP0`00(80 0@80<@(, ,040 9Q,0P0Ot0x@z D@PT0DS࠳@ 0 < D "D0< $@D@$0"!h! B G0 <@ DL4 #`@ Xࠣpc4 *1@@4 PU  RD0$L0,K"Hc0P,040 4 H48 4 `FX p@DT 0?^00S<^* D$㇜40 00@(K@1S D D D`C 0B,KH #00P0400 <,0^4 ,0 ;,0D D p,om> -L M0( $%0 00 !00 !00 1 \0 0@\0`@000@(K 00P(` 0PEpBC@B4 4@C,K4 H@P40,00L DpR5 Ě0 00 0) 910#87 0"('LPQ` 5S`1`# @B0 p  Y , F@,E,fDP*i -LMpRP Px0 0BRSPqRr -  W# 0 X 3/ 4`| 47 c SXQ ,K 0PPL 0 D}~,0D f{,04@- ,ETW``1 G4D  0` PRQ0 ,K`PP  }~ ,E0 00P(K  (0( 0OT R0S~ ((   d0O0 @030@ `2 PT1Q&  PCl n(K< d4 > -L8MDpKP`Q /P0hA,K 0 @`xP,0SP Q  R0.S R 0.S Q0@P`(K,o 0-L M0K@/0KPP0 0 L0S 0  )w000K0`0 0#68#80C S 0000000000000000000000000000 -L Md@t0S 0KK/vP0 KKc/0KhP 000v000 -LMh 0d @h `@ ,0 \ 0@ dP0 d ĜX t0PT l0 I@  (0$  00CSh KPT T(K Q RQ D < 0(S`2 4Ap |@T@|@  t X00C0 X0 ? 0 0 ? 0  K :C <,,8  x0 0@H 4 @0 x R |0S(|@x@ | x R,P @,K/0PT  0, 刔D<@@HT 00CP0 @ H  SL @p`B8 R  L \d0 m 00\q 0Qq0 R0o<0S R0 0 00 0cSDS60@0 4 < R  0RA t 0 pR80080 @`P\\'0I0 0c`0S< 0@ 00<@ D0 9T $<Q@qHH 0H@0 D0Q0< @00a40 FP% 0 P00#0OT |p x| 0d+,0p@D 0@0  0 000ȟYli ,`\`@Q00SX@ 0d0|0\m ` 00S V`  0S  (000KPT lQ R\ t06000h@00  h K,P?Q 0\0"'T z h  K0T0 r,K/0PT } hSuXP$. /@P000 ,?T@ OV d 0rPT E0t 0bt00tS  (000KPT /0  f d Qb 0Q_ 0d0 Q[ ]0T0 W@h0@\ t 00K& (@ @PlQ VG00h 0h\ tPH0T@ 60d 0yrPT 0S0T0  @ (000KPT 0 hl 0\;0\ Ts0600l@hTl\ s060\ ot@P060 0\T@ R# 0!R @(0$ ud 0'rPT <\) 4 @08@P0t X 4=X0   x0l0Q; 0T xl\ ss0@6T@ 0n W@h0@h K  K @ <,,T@t04Eid><>>

t>>>> -LWM  dR 0t p!  |!  @4t0C PT| |(KPK @elA l@00K P0 <@ L@ , @ Ax x0PK 0 qP| J@0lx!0c0R1 >*0pS0|1 x5]?KP`(@K`Q \a PDtQ pa X?*0S> F/ZK0@h1 dA  0U!KU![KV1KU1[ 08#8(0K0 Q PoZK p]K xl!j!0 @d 0 S:  0S* || @tQ pa |A -LQMh! hA 0刔`1 ZKL0Sd `070 hY1KVKht 0R 00d1 U@pIh_Ÿ 0P@ LP (@K⼐d`4 8KX dXK NK 8@ D` < H T` @` 6q(0@`"00YP (K 0#68#80C S񟗾 0(0<000<080<0@0<0H0<00n0O Po 0?5!,@ n@P000,K/00KK@P0`t0 0R@Ppd)0S@1 M?C(K(Kp @`Kd!e,r0@P00xPU ) ?Q,h!x /0@00S0@ 0`p@ 0d Pp:t0S0G0E0C0A0?0=0;nPl >> -L8MH HD D 8 d PX P% D0@T T+ T T Q H  0S 0SX0 0;0UT Q4 R0000(K8X0 @0@PX Q } 4S| D 8 00KsPP0XT0 P L 8\4 < (~ D|w, 48D0a@X@@ F4 PR]@$ 0Sc ,=0t03U0SX000\ 4@00$@0 c4 n X !X< <0 0ãH< <0 0 ^UQ@X ,K<PPi`@0X@P3U0 X<PPWX0D vPPg8p4Sx*P\,=XP` U% PQ,~;T~X L8? HPK 40XT0l@Q  *V6 P)X P `>P>8> -LM  d 0 00 0vR@4S@(K  P@ P, 0S2U2 4S c8R SQQCQ ,K h0@@T&$`(p,h 80cZ Q Dl0 T@P,;,@ @0S# x@0PQd ` ڜ44c cb SUaQUs8 4 0Dh@ l  aZ!`P 0OTdXK @0S RP4S <0 t p0  P0S 0 ڜ@tP4p5 c S\Q\PTP P DT|@ xP Ĝ@ @ D0K\@ 6P d P P# 0XPKP^P`V  E0pP@@0`YT0 @P0 @  ;@T@ @P 4@#P c5, S.Q,K0V?@Pt|P\ 0lS0! ?KQXU , P800cPSl D @,:T0SqRz@4S:P@$0  S(0SP8K,@K0 0K h0 @>@ ,@P:P(0$  000d SdPP,4S:(3[Dp@P+PPD,4LD 0  ,00D ,K4  >@PP0SD,4LD P0  , (K,9d 00  0d  - -LM0@P p;pp1=`+DU 8KKh; -LMPp4S, `84`Sڈ4$ S/<$4@DdX:4`S0z03Y0S  (K p-LM`2 ^@@^@TP` (0$^Fx 0KP @xd0 R V0F0x0Sd 0Rx -L(MH D D@ \L0 d@Hp`P`LP@' @(#00KX`P" P0h#`f00 d00 00` Pp0`P 0WV (K`L @(@H K  0< 80 <KP 0:$?: `p0<K:4   `1, P.Q4,K<`P_, L0D S4 UP``DL0pS G ?<K:0&,4 @,u810'080'180 R6@00K `P 0Pd0S000S08050d00(0$ 000L s0UL00m5S1#0U,48L0`  0  l>Ei(o>)o(Fi(oP*i -,1#LR@ Q  0SLQQ T Q `?0S T d PTTd0 (S>>>>>8>d>>> -LM`p-`@V)8 K00 , 8` 4 NPZ8P  m  0k 0PPQl- 0S @0d0 PP(K T 10P*i>P> 0-0LS@Pd0 0 0S  VP  GkPU0D0S 0S -LM`2p1#RcL0嬔S, D" d0 T``\Pࠃ\ 0!P`\\ P\\`\`4ė0$ 0,f"0a0`0b@ 0@ P,`P`0@PU`P `P $( 0@,00@ Z BZ NYZ  t ~S> p-L@ `bOPP  Nl( 0j Pkp -L`pP.`R@-0ᤔS㈤( 0ST 00 &l-0Q ipFT d  $0 :$0`"P303 -LM 0 00Cpb0,0 4ˠQ L 0E^ OĊ4D$T4(4D4"0C40 p4S2P,`K $,0DT,B64,@ S#ڈD4 T/# c1 S,Q0`:@PP0 404,6(Kd 1@4D`0@$4!#/@1@4$L0S Y0 0C14 0 4 $< 8 4@00T4pK00  0 ,`t0 @ P  0O` ,S<K`R $Q 0< 80  -LMT0`R(@p NPP (KRTP2 TP 0PPP$0000  0hPP(KP, ;9PP ,P5 j00 S0h !jY 0!Ȍ  Č0`2,00D040 =PP  4+^PP,G5,P 00 S40 03S03S 04 0`删$ *<0(0$ @4#1$0$0,0( T0ppЖm -LM$0P@$K`2p  0OP((K ;[9@P(0$D`@P`2`+`@P08 K4 0 8` ,p |M@(4hT<0> -L M@TRP(K SPP 0  OP8d`@(p@D22P24 4PS 4 ,K8PP`,0@D@2L0S3  5@!S 1 # ,4 R > -LJMP QKh phPPA$ A ``0S  qPP. P3 # 04$ E0S $0 㖐P3 S0$#4DP T-K QP(KDܐK Z 0PP KZ 0p @0 ,0 0C K(P 000HPP`0SP S4 PP T 8 0 #40SPGP $0 LMWi0(!$gP hU$0V 0SPRU`,H p =L1 *LP,L0S`CBLZ Z  YOKZ vZ  Z n0Su 3TS. 00Hj@ i0(!fP ;hUH XK Z f P@@ `@ 7  6|liP*i4> -p1LMd1dhqTPT1TA TP @<< KzTPP _R  PP 0   B S /㘊 0P 0  0,0 `2` M ,L0S   , S0v@@ r @ li,o,miЖm`>>>|m p-@ MLP`P 0@ @0 ,0 @Kph3>(o>)o0d  0 0 0S 0-PLd@#= 0PQQd0)o(o -@QLTM0dQh -LM d@`0P0Y (0KBpPI(0d@ 000$1P!( 0 ! 0 $pP P 000( (P rpP0  O(00 哎P 嶎P 0;0$OD3im- 03i -pLd`P0 00 !00 !00U00  0@0@ 0:#:0 10 00 (0X0 $ 04@,00@ 0@@80<@ 0L@D0H@  T  0000T0 d0P00S:(0 S(084 (0(  0@+` \  \0d0h@00 \0 0@\0`@0P*i p-L M0@dP`P dP`CKp0S 2 00ʚ; p-PLd@`n(0(0S S0S  phd (ph* -LM 0P@  0`P  KA(0p( Pd@ (i/F`P000N0@0 0,0 hA 0`@g`,o -@L0PSd` 0 0 pU NNd0  opP0! B!!PN -LMdPd`VPNp0!R BpTNN P 0 0 0 p /pP10C1   ';iN@10C1 0^p; -L8M"dP0 Qp 0 ;;I,0KQpP 8 ;N(K,0 d`0 0 0@,0  !@! !000pPN DK0 D0 0> K4K L0S `0=@K.0<0K8 d 42K 0C3K L0S `01K0@ 0 0. 00 K/ KhA ,D K0@gpP (0d ` 00Q!/'pP 0! B! 01000,M~000  +pP ,00q m,o> -`@0LSPxdpM( (0R ldMpU  \epP-d0!R" 00 SdpU  d !0 00pP 0! B!H3dp.d  pP m -LhMP @, 0 ( (0pR` d,0T 0M,P-MdN0N (K\ (0Rd0 0 Nd0   PY  dP08dh d t !Ry 00qt 0 l0: S\ X  eN,d0P`0 dhd ! !h 000MPP Y 0 cPd0S d@L`L\ Rh@ 0000dPh0! B!h 0L0S$ cL,LN0N00 0 0L 000K sA 0bl0 .Rf 0cP  cK  cF0 0 bP 0c`X 0R` \QS  Rp T0 l  Zd0S,_L`h +P0 9 ,K ,AP,dP` dd d R d `0Rh0R@ . 0a P,00P00S+R#0S t0hS 0 0 0t h 0X  0\ !0M\P0Ql0 p T0  0c 0a d0h 0R ` 0   0 R `0R d0Rd0 0: S p0S`h =Pp0TQ00S ` 0! B!`0Kd@p Q10C1 10C8#8S1g d 0d 000,K00 0 0J 0K s@0PE dh@d0YL0 a p R\L RKY0KL\`0h 0R@l R `02!R !`000Ph PG l R `0! B!`@000DpQLp";` d fP d0!R\ Re 7Z&B^t"l0SP 010C100000(KsL@HK! B!00 00 0 0 h @0 0@!dP60[S#[0R    0T  0X 0C0< hA 0 0@c7>>>> >>,o..@> -LMP 0pS, d`0s0s0s (K0s(0sX0s\0sP0sT0s! (0$  0R `P 000 0T0   0000 0p$T0 R0 0 @t  (0$ dt@ 0 y㘐ST -P0 S R 0000R@ 0S 0;0Q 0S 0;0 p 0S S S  04P|,0s (0$  0R P l0j ,0 _Pc80s ,0s (0$      `"0 D"0 ,2 \0 0@\0`@008qh 0,q_ 0GPPu0 (0$ 2d@ 0R ᏈP R 0S  OZP   0:0000   0 0L (0$ _ fqO^0 S -P&!00sU80sR<0sO@04rr00sah<0sVX0s!P*i -LMd 00 GK p- Px0 @L0 `P d 000Xq0(1I0`6J`p3iA-RpP `$(@#00 bR:  Q3a0 R R0d0e S:0e0d  S:\  aS* 0P-L0 0a00P00a00P0a0 -LM Pp ?#P  t$0(,@ \`,K 0` `P e"P  (K褳ol,oh0+od-o p-P`L@f @` p,o`< 0-@PL W 000 00 00+oH< 0-@PLE @ P0-o0< -L$M@  p `nQ4 80  ":RE 0i^ ! \ʠ3hQ1!0l 0PP1Q: @P `0S:`0V @T (K@ R 0S@(0$ ,00U: R `0V@@0ST PP:%@ P$( ,0  0 R 1S0!,K0KP, 40U@:00U8P80 -LMPQ`p4 0^ 0^,:0^)* 00000 0000@P  K@ 0!P 0@@ @\> -L$Mp4 W80 `PSXppx a @P3 $ (0 U.:,00V,K0K '!@T# ( $0 U:,00VR 1 S0!  $: P X !@T (K,40W@:00W8pX080WxpW*Xp -L4MPpU@80 { 00%Q01Sr:0a bU,0 , 50 R 10 A>0 A7A``  0, 80P` UP(Kf4   40 ,80 P:P   0 ,80`P $P  4800P, P -L$M` p@ PZf ^ 3: @g `@ PpK 0-@ MLP  0 @ 0 @ 0 @pp 0 @X 0L @@@0*080 K0>-o>,o> ,o>`*o>0+o,ox< -L !Q 1S 01 0AS 10 ! 10A0(>H> -L !Q0 d> p-@L !ƌ\`"S  QP P 0 [" `p Q0S  0  0 00`p >>> -@`$0 L0b#6<@ SpTQ&0@ P P#"TP\P<@0!PR00R0S0 !P "\ -LP@!ƌ0C  0S0 !h > -`LVP`PV@p$4 0SPP 00 0A S 10  ! 1 A 00CS0 UX01SZP `F}U -@Lb 0P  0R000 00 0 p-"fL@P  00b0fS 0S 000  p >(> -LM@p, ,P'0, Q@TO 0S64`V3(04 0  !( ( ! 0,` ,P(K 9 0 B  a  !( A( ! \=,00,0 '`P  0`>PG, >>P>R -PL@hPP) $F%6@}0p0!a @ ppf b~PP@ 0 0!?< R$0(0$ (*P|.oL/o -b@L !~ 0@sb ~h|.o 0-0L@1$ R(0(0(0  R 0 P 0S P 0PS0!P 0S 0CS0S0PS0000h 0> -P1LXM@`TPpF pTK0K‐K( 0@ , (0$Q\ $ \0K((0$0^X0 $ ^0 !0SU000 0Rp0 P ^0\Q,0@(0,0\QX0(00P0W0X S(KmL/o 0-@P ML@4 ,0P@K0h%|.o> -LpQ$M@H L `D@ Չ1P< P0 S@CWeQ0 0a00P 00< 00@WTa 0S0C0@0 DP @0 DP T\LPpWAD!1P 08 0P 4 ,0 @W1 0 SQPC0WdP00 `00R4P004 8000 P 'JD 0S U0000PRH @W(K@Q Q,00,0000DP 0@0 >> -L@L\p`P \ RU 0S  0BsU 0h<0 00RUh 0h* -P0L00 0S@p` 0Cs 0h 0h 0S^ 0 -L M $0<@p0b#!& X 00Cs 0X4X(K 0@{d" 00Csa@Qeb u|P(T   b.| b 0|@P b !|0 0 0As Ye`\100 !1 000  0!0c0,0 4 P!,0  P!4 4 40T0 P !  @YbP10  1` 0b {0Esfb {h i 0H  i0A  ꫪ -L@\`P@z 0Ss Z$p P@P_ 0e#viz20!Q  pe b{P 00@P0Sq W0<00!  R 000 0  000W 0  c!N00CS0? 00Cs2D0`0 D0< @@ R$0(0$ @( $@l< P@ D00D0S $@0l#6S"(<x0#8\':WX: 0$  c"&<0000D  D 00C0o :# $@o #$@|.oL/o@-^ 4@T 0S (00  !( ( !D4 -@LP fS00 p-PL `P@US`0  !( ( !39p 0-@LTP 40S 0S 40 0C 400hx@P0Sh p00Cp0(0 0  !(  ( !0);P/o1o -L\P 0 0 P/o 0-TP M@LH 0 P@(0 QAK0hP/o>1o 0s0 0 p-0AL01 @_P ` 0S P 0S 0SpRpP P 0S00@ P`p 0Sp& 0o>< M-L M@00< D @ <0@S[D 0" 0@@ H0 SB2D4 00 H8 <@80 aV5  Y, ,s 0S(r X\ 4P_ pQ10@P0PSRR 0 B0 U@0S R0H00 ,`V8HP8 Z!p00jp0(KOW/`pD0OWVD Q<@0PR0OWPVZp p00jp0YD 4P0@Tp VX4@R 0o1o p-0LP@ R,`p0@S0a!p R P 010U`P V000V000C0S R000  r7 0o,>H> - L@PQ M-LM0 0`0 , P 0pO# @  Z (KY 3p PP (0 @ 00CS0000\0\0$000 0SC40S0QQ7 0 , !( (, ! 0C*0pW0p O &#*0@Z0pKp|0O#Y40S0Q  !h69>>> -`ȟMLVF &(*0&Z W0  pX(K - 0Ls` 0CS 0 f R$0$0$0 kf@T (4 0  !!( 0 (  !!`!0u@T @R&R00R @P P!p00Cp0 0Rc wi !80XpQU @T 10@P PH Tp00Cp0@0TPpWFi>1o0o 0ou 0-L MXPU@@DDT 0P, ((0P K0k> 0o>0o -A2LMpc S1 # $0KP(  $0R`0@P@RP0S  N0 000! 0 @RPc hw -LM0@C2A P # S<#Sp8 c 0Kޑ`P0 L2 S<#S PQ R000 R0QL2  S<#SPc #w 0`0p  -LM A B2 \̠# S<# S@p= c 0K⒑`P4  L2 S<#S PQ R000 R0QL2  S<#SPc v 0`0p ep p-`L@c 0~wPP 0S 0  0Sc v`Pp p@Q0@S: p-PL@c 0Sw`P  'U0 P c }vP`p p -`LPc 0.wpP,  V@ 501 P0 0S1000C0SP\000E@Tc Bv`p 0o@Q0@Sڽ -LP F& 0S\1 p`@U    0@S/D P #c0❐P@=  0@00`+ 0S5p0`0 .=d @R 0$0 p$d0c vP@ dT`p`@0,($FikFiFiFi0oX>>$>|> -L M@ YpP` D < 0  !( ( !D  D @ Xp :@P`0s  0@P (0 X  0 X<0 p<D\@ @(K0 0%@S8 '08 P  095@P 0  !( A( !.!( &(  ! P 8 0100@0Y`p4 4  R4 :@`p@T4 0R  & G&0 , T %0PP (0"0  !!( 0 (  !!@TP  0PP0 P4PPd>@0 , !( (, !0x!!@0  !( ( !@T0 00@S@ 60@Q30  !( @( !&Pt LS@P @ IL(0ӗ0  !( ( !C5  GP @010>> -`/ML&@!*$Kp 0K @ $p @ @@PP P  L 0 , !( I(, !  c3K -Lpvb1PUT `pZbV@P'P@@P0W  X R`P0@PLb @`T. P`P^ 1@P  W00X0S \P^@DZ(b`bU ~`FiFi 00 0M0Ѝ -LMD<0 0 @8  @0@(K800<40 #40#"B P0 4 09 0cP` 2P0#0 e` p,0 @ :@P`, @0X Y@| 04 0 p  0H 0 P<pX@ @8 0r0G @08 @ 0e0@9 <Xi> 0-LM 0@S 倘 0SxxaPd/`0 R000   ,Ra 8hs0C 08]Fi> - LàML pWP`P1W 1W V0S0:S0 :@P`  0ptat$aPUPU 0S06 00(/$1`  rPa R  R 0S` r /+000S0 00pP`00T` 0H0 0`000$`ϕ0Xi' 'FiFi>Gi 0 0 0C 0 k0@0h$0P,o 0-@PL \P0 00   (0R  ,0000001o 0-PPL@ T   0h,  0h0 -0 0 @ ,0LRP`5:00Rp2:0 @P$ 0$  c R 5D0 0@ @ ,0R:00R*V  ! @P (00 -LM` K@PP. T$pK2%* P $0T: $0ST0S h$0#&R :0R*0a"!B10b;1JVK(o> p-`@LP   phq -0LM0p00 R 33hh    `  1(0!n 0 !(  (  !  PU] 0 zl"0㲕@TK V 0 <acP]000@T 40S X@P@ 0@1PP<  0 K0 00O(0@&0 !( C (  !( , <Y(/T(K  00 TD0 000v: 0 ,00I001T  , 0j8T000  01o,o>>> -LMΟ @p> \ : P L H0 PKsP   0PKh p0S Ɵ0008@P4  4< D0#10#0#Xl 5h  Z< 14`01D0@ 40S 000 P008 Œ0L P  (00  !( C( ! 0CPK]4p h0R 7@0S} 0`.P w)W @400C400`0 !( 0&(  !,P0!!( 0&( !! , !(0 A0(0!!0pPK 97PK3PP@ 4| 0-`P@4p ,4(0D0  !( ( !!PK0ThŸp h0 @R 0400-7@  0-`P 4(@0!!( 0H ( !!4 !4(00!!( 0 ( !!4   @00 R( 0M(4` Ა(0  !( A( !<L 0 c<0r00C0&4p 101(04(00  !( ( !4+ <L 0 c<0DkL>(>@>|>p>,od>4>1oX>m 0hPK0 000$< @0< 00, D0 LPPa0X`p ,K400 0Q40KP P <0D 1 4 PKvPP@@\00SuUR4pO +4(0 40  !( ( !@ \>+PK 0P04(0 40  !( ( !4_+PK!00L00 6@ ʏ4l 10 1O46 ὏4*0  !( ( ! ᧏4 <L 0<cjP T PK0f{\"+(00  !( C( ! PK0C 0PKF5@p*(0 0  !( ( ! !(08<0 00W0X$XV@U Q-L`pP#*@JV  0*P T   ;@- 6(@004@ 5(@80<@ 3(@ 0$@ 1(@(0,@ 0(6@P0T@1o, 0S00000 8k,o -LM KL]H0#&R*0R*0a"!B10bo(o -$1L@T< Pp`D0! R"Q )00CS 0p0p0000P l l0R*QP 0l Q*QpP@TV \0 RUQ <0h<0` @THmDGi1o -@L<0<0 - 0@L@*0@1(Gi 0-LMXX0X P@h0*L @@P;@PK0,Gi(Gi3o.  . Q! X -L΂n^P`Up*S N@ Pe?N0,0 hT  h+o(Gi.  . Q : -L(M@ .  ^P U< p#: (K  P e!fV8  @,K , 0S0R*@VX 0 IPP  @TF (18P  14@K0@ 4 0@ `~&P)4 R @Q00000 0J8 I4 R|H< e<@ P 808Y05$8  00Mi(Gio -@dPN`@ RL @ppP .0 ! @ (Gi -|0LM R h ;KK 0'x P0  iU-.x2 K "1oo$Gi> -L$MD @ Xa 0H#Y*qZp1H`00X80 N J$J>00>0Sp1x# Z00 W0~Sp8  Wz3X@3 8 ,0K @P 0d,S0!D <0 ` c ,4PK@ 04@ 0P @# Z<0cX@ (K(Gi>00   -L$M DL 40KT4 p00 < 0SO h"h2QP8 \< \9 `,K,< 80,  000P!4@,`T 8 ,:,0 @T 0\ 8,:,0 @T`4K'%(K@A[W0S ((1@ S0S 0S5W4K %0C! S, 0 0 h0Q @ T00 /|W 0 S ` `R`^<0,  04K `$P_ ## >o3o3o>,o -LPp 눀`0t@V 0R 10 P Vj)V*`)(Gi3o p-PLMP*@`Kp ?P \0#&R*H0R*0a"!B10b 9)JUxo(o> -LPM($rV 0R Zl 2   V PqV 0R1   uV1ZhK@ @@8h`K|!p,*0 @P@0pP`8A1XfVP1 Q 0 hK!PR UW@VZ O8VU1h K@U@PQ 0*#1(K0@p  T0 000 @` P@VV3o## (Gi3o> 0f0o> -̡LM U Q 1 R R AR   Q;* 0 1 S0P1* p X00W0S1 $1 hWp,0`$K0!&0@P0 `<P?pX(10 0 Q *0h6 0(0  X00W0S X H 10  0 R0 0, S0, e$K3omi(Gi# 0 -LMP0,Nl@T`p(KT,K, Lh0   P, 0 |,3o#> 0 p-LMP,h`K! ̃.# 0@P0 PKp3o 6 0 -LMp@ `.` $PK @ 0$@ P @m) K -.L M  8 ,0(Ǩ0!Y# 0@P(0 kP0 ,(KZ1P ,0,`0ap`p |1ph  a(RP4K@  0 4@ "PA,P0U988 ,0Z0S. :@`p4@ R00000  0  0 &0  !( ( !Z0C 8:,0Z0S$7,8 q(Gi1oo -LM>0`~0^p@0P 0` `P @P 000T 0 U 00 0P  K0 @P,*(##,>>X> p-LMP@ *|`|0 h0$  `0R0 P b 0K@P0 P 0`Kp -P`pWL @P4 (0 0  !!( 0 (  !!0 0@P`:P@`XW% 0  !( ( !F&% q Pp00Cp0>1o -LMℑ,~h(K!ph 00  0@P0 P>41W ,,02 0cP`0  !!( 0 (  !!08 L:P@zG`W 0h %@Pp0x Dh1pS .W 00S,(K, `,,  a:3o#(Gi,o> -L M0`SpP6 0SA0SR4KP40 0 $*@,Kd P P,!&R*< 0R*0`"!B1 b 0 00  000 JU  0 0S(K0@R 0`S00R  ,m$0 0S o(o>3o 0Q-L@ 00SD00D0p@-0\ @!@1Q% \ 1 !R`#`3P TQ030 "SaP^ Q0#02SQ#3T0#0 2S%ppP 0 S(0$ ,00\1P -L`$@0@PS:b V@cp V:E  f@U>0e S 0SR F@ U0P@0F\2 lU" R!0e S9A U R0ST0l0U 0SS1:Q0P@U 00b S9R R0e SYD0S0e SI9@0S,  `0R 1P `0R 1 -@PL`@T `0P 0Q-L@ 00SD00D0h0@-D0DQ 0$@ 0TT0ST0SH H0RL L0RP P0RX X0R 0 00R 040c@P4@PP80S@Q 0S@ R 0S00 0- L@PP D0 0U:$0U#300< \00\0 Q-&:0@2 DP 0Q:0Q440Q*<0Q:@0Q:HP 0 R 0Q:0Q4^80Q*XP0Q:0Q4 0 Q:ꤳo$0(0@-P Q0#03 P 0S @@1 Q#3PQDQ 0T # 3P R0T # 3S RXQ T0#03P0S T0#03R0SHQ 0T # 3P R0T # 3S R\<0@T # 3P R0T#3S4P T # 3 Q R8T0#03\0S 0 0褳o-$ (,40 R:80\34<0R:@0\34 -LpPU/ 0S,`@T1 T R& @TP @0 Q 0` 0S0@  0S@@@`rP nPU 0 00p 0 0  R P; X> P@0T 0` @M0S0P  0SPPP`?P ;0SP040S0p  0SppP@&P#0Pp0p 0 0 z0S@00S0p  0TppPP@p -Lp` R 0SPU 0SY0 0`R 0S0S @TP R0 0@ T`@0S0P  0SPP`PP@@ PRi Q 0S R 0S 0R 00  S`00S0@  0S@@@`9R 0S0Q 0@ 0S0P  0SPPP@uPr@ 0R 00  S`0d0S0@  0S@@@`VPS R 0 00 0@ T`@D0S0P  0SPP`P6P3@y R 0S0P 0@ P 0S0P  0SPPP@P@ ` -pLWP8 @TD@0Sp`W`V p 0Spp U`P@ 0U@@ 0R@@V @@TX  p`W `Vp 0Spp` 0-PLP@" #3Q R  0 S R0P 0  Q@@000 0@0P  SP 0S0#03 P P 0S0SP0SP0S  0-,LP@P'0 Q00R03SQ PD0$ T(0, 00\ H00SP 0T00 -PL@p` 0!S8@ T- P $ (0,0 0S*:@@P` $ 0S X:W WP D0P X0P sV@ ;P@ A2P @ꤳo P 0S0SP0SP0S PQ00SQ00S -@,L P0 3H 0-P@LM0000hhM p-@`LtMP00\Mpphk0` -0L @`h`0&`0` -0LP@P (00(0` - L@]T0000<Э> -L` PP1 @ pT p  eU $0R P@T,(0, 00,000  0@@ 0-L M 0@RPP x0S UPK0$0( ,0 0 $ (,@ @ѴЭ>P> -00t @RLA>00 0- L M0 \0\0\ 0d R@P 0| @ۭl 0dd @ӭPŭH 0@d@ȭ$K0h3ok>xo>o>Ho -Z%ZULp`ec   < @$0X+*@0(PS$@d,P  << 6D05 0P004 48 ,0S  6  { E  os(P$$ bP!  b `h0@,408@ -LMQ` @D0 p$PW HQ T 0^Sy 0T0X@ y  @pPwP3XPU@ D0 $ Q H0S pW@  w  \p(K  T  bp  a  FV$ D0  $0R H0S T00CST0+ NP`X D0 $0R H0ST00CT0;@X  B  00\|pPTw $ U   ! Qp-LP` @ U@ T0S D00T0 $ 3U@p -LMPp `U8 +@" P P@ @T0SD0$0 0b@ P$$1 H R/  K@I000I@ n0,0 @I000H W 460W:N0,0 1o p-T0LS@PD 0`  00 r $ phY $ $`php0T0$ @ $ F40 $ ,00 ccD00`0D0po(Gi 0- P@!J3>0 dPtu00Le<T$0 -\0L@  Dh58h1E((\ P1\@0CP1h3EHoo3o1o p-0L1PU E`P\@T P10P1\E0\0T0000p0 P @P \P 0 y@Pd0. d0d0S0Ho0> -LMPQ`p,P  , V3 0@U@2 $(0, 00Q[ TO ,0S(0 S$ :(0` x, R00S 0@$1 V ,000f,0 `YU , T , O@ P f0,408@@ `$`( 0 D L H P T X < , y1 0Q 0f S :j(0(0ꤳo 0-LM@P P $ ,0PgP8 -L@P` 4P8`,o> -L`p \PX` 0@ -@QLP`p 3@0S@0A0 0\08@ -LMp ,@PF 0`0 Kxo -L MPpU0@`0 U (0$ ,0 0S PP / $(000 ,, -   00\ 0@0 U  o0 , 0 0 "(K $ X00R0S@ -LP`p J< @  w $ 0ie p-PL`@ 0phW S-LpQ,00 Q`!`1\ P1P!V: R F@P $0V* 0V  0  Xa@P 0U$0U* c S-LpQ,00 Q`!`1\ P1P!V:  $0@V$* 0VTP'@P 0U $0U* xP@P ! E @ -LM0P\@`p:\:,0Q:R*@  KP@   0T$0V :Q 0S @  /   $0S00S@0SD0 0D0 @0p  48 000 -. ^NP@LMU`P@O ,0U@3K:00TG0P c$pU@*D0=P 0T C 0TAD0;$T,0( 00S1t P-$0T'Z, T0S 0UHT0S $0T<:Z 0@<@@$K@ V @ T0S 0U T0S $0T :- 0^@ } x O J -QLM`p ,00 Q!1\ P1P!Z#:  $0@ZtT~ 0U P U$0R D0aL00Sd1 W0S 0U Y10SX Z:U?:0SH   L`H H`R D0T0ST0 $ A0 T 00V00S4@P) U&$R D00HSX Z $U* y@ vL0S $ 0P (Gi> -L M`0, Rp1 p!Q@!@1T00 :(K $0PS  Y RO 0TO0U,0 : 0W7y3',D0 0S,P  0@ 00S$ D0$0  0a c , K00X 0PW $ R 00S W* WD0 $ t@@`t@P  p-LM0`0CS0Kp PK,0 @0 @ P @q T -@LTPp`#)@P 0$ < c"&0D0 000S R0000 0 g@T V 0 -LMpP(`K [@(@ $` F  K -LM0pPAUPLD0D0P@HP`UH`@X @(PKTX`(` $P ' `$ 0 $@$0 P 00$00$ $ P 00$00$ $ @T X ~X6UW!00 KW> -\0L0CS@\0 hxo -LMp 0-LM$ 0P c0P PD @@ PD 0$ < c"&0D @P> -`@LQpP% #@ $0( ,$0( , 00  0P$0 aP`  -L`@pPP  PXPP @0S @0S P  0P@ 0P@ -LMP`p@ H 0 P@0 T X  0yP (K -`!L,MQ@0 DP:0U!3Q<,0 -L8MPp%D Z`@ F80K@40 8@ iP< < = I0 , A\ !QXW 0H T @  X3N@: DQ7 D, K00K@P%H D  O8Kz<0S <(K EP 0 , D, K00KoP 8K D,K0 K0@ PD, K00KQP D08K<,0 P [@P %20P0 D048 HLH  0%D0T X0  0<0D }@D0 00t@ h < tD 0D0 0D0 P SP 0S0#03P -L0 @ở1P  1S/000P $0 )0S"02 000P0,0 0l   `  l0000  c 0(0 $$0l R*000Lm1oDGi p-L8M` 0PP. Q)0@ S'T81818181L818181l917191918BK`00, jP\0X 0 0_S{\y! 4?2cT0`Kp-L@Ks0 0i 1iM? xiUϠ @1pi< 0iAKX00, jP\0` 00_S2\0 4?2cL0X@K\00, vjPX0` 00_S\X 4?2cP0\D 0i :i1oQo\)iDGi -LM 0GP t1t l/Qo K 㪞D1\ @E )00CS;1:1:1;1;1;1:11S l0S|0T R |0S@ @ \ ePp0 #50a,#50 ^T h!\31C0a 1 0a&1 %\  @ `P*iDGiDmLm\o<,o -SLMp`P@ 0@ 0 H&&R + b @  R 4 60R: 0L@P  B1o -L(M@8  4 <0 0 p `@ ~ 4 :#:S@: 8,0 e 0SD 4/ PU Ơa Z, ',  ,0< 48,0 Z00Č,0048 0 ~@P@048 <0(Kon0(KS/<0P0 &/T08  0PPʠ< T0Z8p  0P8 (, 0S0S@ @40, >0>00 -LM@P`p & :#:S  0(  ćć  P  0(Ko t0 R>0>0 1001 !:# -LM ʠ,ʠ\ 0R lR >0. R 0^  0JP  0-LM@ʠ,ʠ\ 0^* @l^ >0^ 0T.Ơ0 H R P (4d 6R0  0P 88`0S*#81o -L -LQ 00 (` P00 P00S#@-@ʠ,ʠ\  0R lR >0. R 0^ T$C1$C1$C10. R 0Q  0 0A@-@ʠ,ʠ\  0R lR >0. R 0^  0@ -LM ^0 ʠ,ʠ\ 0R lR >0. R 0Q  0 -LM@ ʠ,ʠ\ 0R @lR >0. R 0T`V0TK p  0P $PK0@ $@ P @O  -LM0 0 , SpP 0 _d`V[0`0S0 U > SR UP *ZI>0^PUF  j:#:S?0Q<0S93Q6,  > r1  t0(!6@ Q 0@T< 0H(1,K`  0 @ T,0 000S   BR - 0U@(K 0@pW P B-P @  0 S  @S @$ 0SS S R@S``> 0 Y   @ SA S T0 P[0 < 0  p0`0(1 `,K0@S0` t0(!6@ Q 0@TS0 @ nXʙW@c 0K(!$@P0L 0S  @ Lj 0 CR     # 70 ,? -L,MH T H P J$JT0D >0 Z< *2 P08 40 ^8 0IP L 4 T TD8 0P4 O4 PsP , KPw ,P. 0< R*L!0,<$ QSf 0Rc:D0<Y!0000 . 0 0 0 R( Y0 Y0,P,  0<Q PH T8 LD8 L G4(KL G@ Y@  Y@ 0R0 , < aP 0S0000S 0S,00 @4` @dP P00 PH T8  040 4  -LM`@00 SpP (K 00Q, K;PP00@0S 0 0K PP000, R 00CS 0,+0,0 00@SP 0 0 000@-P@ R( 0S%\ ) \ ^ \@ 00\0 S 0  0S  R 0000@00 R P, R/ 0\00 S 0  0S   0S 0P@ 0S@ @0  @0@000S 00S0@ 0\@ @  @0@- R 0S ^ 0Sk0 0R 0SI0SD \   R00  \0S0  0S    R( ^ 0Sm R 0S 0R00S 00 S0 0S    R 00000 \0 S0  0S  R 0S@0T00 S @0  0 S  0R0 0S00 S0 0S    R R 0S P0U00 S P0@  0 S  @ y -LXp5 PU?P0S `X`V 0S @ W`RP 0WP P 0RPPV 00SZ   `X `V 0S ` P 0S0SP0SP 0S  P 0S 0SP 0SP0S PQ0 0SQ0 0S0- @0 S0 UTR p-@LTP `P`@ @T@p 0-@LPT P@ @T0 p-@LT`P@P  R0T 0@ PP P@p0@0@ @P -@LPP`p 0  !( ( !00C0, 0 0, U ,0 `$p0,0P0  !( ( !000 -LTM@ < `Kw Kp@-d0 P0U#F"``@ 0T !P01Rb`0^pHGi(o0@-0 @@$!( (P@@$!0@* - rL\R2$ RP@L0R P U3 @0Q  Q*60 0 0R0 4 R0B60  B0CR0 \4 `LV`@DPV 0 SAP!@P@ 0R:P Ut\ `LV`@DPVʹ|a60 0 R \ `LU`@DPVHGi3o(o>0> -LhP \0*0  0P 0@ 0P "1oT> -LM0  4 0  P, 80 < @  (2(b$ȟ. 0PQ<0 @_TO T"vM g(00\Qh!D0R A0R @0 Uh!D0R 0R d+ (0 0R0HA :#:S 8 40Z C$1P*VR, 4B  ,F@u<00@ 8!"&0@(Ko 0@ ?SʭRD0@0@T P0U ?@P 0QʙP(KSLm1omT3o,o3o> -LMX`4 Vp@r V40S  0SQ21C  4000(K 4 Ph21C! c0 0 P; U, Y `FJ$&0RP08@@0D0H0L0: RYH 0  !( ( !0`VTY' 021C, T B 4,  44 (Ko.,4 0@Ph0#\(Ko h21Cc,0 g ؚHGi(o(GiX>>>><>> -LM,a0PS  A* pW$ >0n`0gV@P0U,>0 N@ U $`KP% $J aUa噚hh@i0>0>0 0U 倚~PGifmfmoo>>H> -錒LM™0 @0 ,  0 @@f0g^ p80 0b\0 "6!v21C!@cw `0SG 0PcW@"#<:21CcT F0 U` ` T 0P08@0D0H0L0 R 0S0!% 0%0" 0%^0 c21C cl0S 0pePcUg 0, >0>00 00 >00/0h 0 P00C $ (0 0, `\0T(XL(K,ϙ3oHGi@o5(o1o>fmd3ofmLGil>@-0 .!( (@.!@@-00S%(00A R0 10  0  !( ( !@00C0(0 00 000000 R 000 0 !( ((  !  B R 0  0 1o3o-(0 C RH 000 0  !( ( !00C000S(00  !( ( !00000  0 R00P00 0< R0 0 0 0 1o3o 0-(0LP R0 <10  0  !( ( !00C0(0-&,0   PP@0!!( 0(( !! 000(0 D0 0!!( 0 ( !!00  P P3o1o-000CS00h00`0 000 !(07(0 ! 00C 03o1o -L@\ $0 0  !( ( !QA 0  !( ( !A000A -L$MPŸL`D@0@VPU8 4 <0 /<0@PPOTFt 1@ ?S,) Z 0s ,0\(0\ʘ1!hD0QHP`0@K  0 @0 ,@ P'P @(KR1D0Q Po0RO 0@VUb0@< 8 K VV 0  !( ( !h0 Q0  !( ( !SLm1om,o3oT3o 0-L0LP@L|0&,0 0P Ed0 $0dE@da0h,1d3o -p0LSDP`(0! R& @0!!( 0c ( !!0,`SP' \ \ X4 (0 `!(0 R0  !( ( !`0PS0 !( 0 (  !0(0   0  !   -LM00 `pP@, 0 \     0 ,0  , 00 U~ 0 A,0`0 0W3 0, x 3X00S100v03 R0S ̠@w@3PVP, 003 (0X 0) X0TU(K0 , x 3X00S R   00 0v03R0S , 00 0$# X T 0  ,0`0 0 00 T -`LPp@T6U#:0`V @@d*$H04$ 00 F$0_0S |h*@l0*TX0&h<*0d#8 # _VLolo@o(Gi 0-,P& L@3O0ho -0@LO(Gi -LMp *aP U 0P 0S U@ P4# @TPU@$  0qa`P0S U@`0` hD0@Q@P404$0A* 8;*@oLo>,o3o -LM`@P V 0p @ZUJ 08 L0p[P  ,$ +  o 0-PLqD)@0` 8Pd `@0@0S T0Lo@o3oTGi -L$MD H0 80K@0H0p 00K@ ,0 PS0 , 40 Sʴ 0K80K0S @PoD#Q ʘ H 00S @#6:1< @ @@HTl P` P `@Q ,0S@ <0 0@ <0 40SX < R (KL D m@P (0   0SC 0  !( ( !(0 0  !!( 0 (  !!0 R @^0@(A0 P0 `00  !!( 0 (  !!00S80SD0 0  !( ( !PdH`0`0J00`SF*A80@SFP`8P 4` A -LHM,00 ;Bv <0S0p0 W,PW@hKD0@T70#0l0 DGl `0"p PR0!!( 0 ( !!`VP1 Y (0 @l0p  R00S   0  !( (@.! , !( @(, !DhK Y(Kdm0@-dd ,\O 0C2dS03S<0<<0!R?CQ@00@0,0dH001oVUUU - LM p 4 X W00S6 R< x6x&t0PQ0 `@ R00P0S F 10 1D `(@PU}   01001 X W00S(KW  XF 4 P0S0K,0 0 CT`p4P, K00K@ @P4upPU1 X? (0x@0!!( 0 ( !!( \U`o U~+V (0`04 S0K,0 0 `>8!00 0X8!0 (00```4  B4 0  !( ( !(@o$1P0$1(@00 7 p00p0'1Y0100Z@D@ @幾`\,10,1D0!!( 0 ( !!0@ 0S", hp0S l0Qb ( 0  !( ( !000Ÿ Yn P_W @' ( K10Y㌀00H @ (10(144tKP@, , K00K @P00 P  4K4 pP00 @0  !  ! 0P& !娿(@0 ! _@ H00  j !኿50(@Lmm1o -xLMp0lsPo!0PU` V0P!@ 0eS$S1011!,  d0S{P12d R@2DP^@"0P `lh0Q p2PU> 0O Q 0R0faX``W *T( X``W0P ( @0S; ^  0PGV 1<1T0H<1(K ! 㱾P 0  !( ( !pG PP~40A4  !( ( !( l  0  !( ( !( pGp0,PQ  \ RpndbfNLm1om$3o3o3o -LMph1L0%``V  0\``V 0C0`00d0%V ,00 0B6C0 P#@|s"0` jV@%,08@Y4ѧZ(D%,o3o1od3o\3o>t3o,3oT3o1o -,LMh1  D0i" P %"8p@Wk 0 00, 0 h% BQ4 0"@?CSD00D0W0 #0/Q R 0O0S@PoVOL 0KWQ |@H% ,0R0S@ZW 0T00000 0R0000<0 0 (Zx%d!04P\%L!8p@W@H1 p\18p0W1$00 ,@ Hj4PU 0a0c0KW 0 ȟ00X@T@0@PoPU`Q D0tPo0Q RO 0@V@U@P},o3o1o,3oVUUULmm>,Gi 0-0LMx hD0@QP `$\Y0TH/P[8@ƍJP (忍$0 Q,o3o,3oT3o1o>>A( 0@-P@ R( 0S%\ ) \ ^ \@ 00\0 S 0  0S  R 0000@00 R P, R/ 0\00 S 0  0S   0S 0P@ 0S@ @0  @0@000S 00S0@ 0\@ @  @0@- R 0S ^ 0Sk0 0R 0SI0SD \   R00  \0S0  0S    R( ^ 0Sm R 0S 0R00S 00 S0 0S    R 00000 \0 S0  0S  R 0S@0T00 S @0  0 S  0R0 0S00 S0 0S    R R 0S P0U00 S P0@  0 S  @ y -LXp5 PU?P0S `X`V 0S @ W`RP 0WP P 0RPPV 00SZ   `X `V 0S ` P 0S0SP0SP 0S  P 0S 0SP 0SP0S PQ0 0SQ0 0S0@-P@ R( 0S%\ ) \ ^ \@ 00\0 S 0  0S  R 0000@00 R P, R/ 0\00 S 0  0S   0S 0P@ 0S@ @0  @0@000S 00S0@ 0\@ @  @0@- R 0S ^ 0Sk0 0R 0SI0SD \   R00  \0S0  0S    R( ^ 0Sm R 0S 0R00S 00 S0 0S    R 00000 \0 S0  0S  R 0S@0T00 S @0  0 S  0R0 0S00 S0 0S    R R 0S P0U00 S P0@  0 S  @ y -LXp5 PU?P0S `X`V 0S @ W`RP 0WP P 0RPPV 00SZ   `X `V 0S ` P 0S0SP0SP 0S  P 0S 0SP 0SP0S PQ0 0SQ0 0S0@-P@< R( @0S%<4\ ) \ @^ 4\@ 804@0\<<0 S@ 8<0 < 40S48<< 4R 0@000@@0@0@8 R @P, 8 R/ 80\<@0<0 S@ 4<0 < 40S48<880S< <40P<@ <40S4@8@0<8  @0@@0@0@40S<80<0S<0@ <40\4@8@4<  @40@-4 R @0S8^ @0Sk<0 @0R @0SI0SD 4\  @ R0@08@ \<<04S<0 < 40S484<88@ R( 4^ @0Sm8 R @0S @0R@040@@S<80<0 S<0 <40S4 8 < 4 R 0@000@04@ \<<08S<0 < 40S488<4R @0S4@0T<@0<0 S@ 8@<0 < 40 S484<44 @0R@080@@S<40<0 S<0 <40S4 8 < 8 R8 R @0S8P0U<@0<0 S@ 4P<0@ < 40 S488<@88 y -4LXp5 8PU?P40S8<`X<`V@ 40S4844<@< W`RP 40W4P8P8 40RTP! @TV p80 #R 0Q:p '88 880 a0lS`1@P11TV@808 V0b#6P  Q00,000Q PUI Zg <80#6ZK:PT00 S) @21C!V c 80#6V*<0S0  0< "!B10b00< RA10aT  0Rp\1 dT,Y X(K R408 S00S40 0j 00 I00< c21C<c0<  f< 3o -pP8LP` 0@U*0V0 0 0 T00 0<00EOT3o -LM8a8hADTpP<@K* <0 (0 < 4 0p ,P 8 @<@$O(0 0 Q(0(000SZ% 0)$K %@PD@08 0P3o,oT3o\>,3od>0>A1o -p0L$ RD@D }0  000 00D +@3o -LpP 0WoxhP 0WH<o 0$ 0$ p`P&`P" 80#WY 8 <0"6W *@k  `V  p 2 T8@<0$FPd @3oD3o p- V!fL>S@P U 0UV 0V:,P000 H0004 ,0 $000$0@Pph,3o@3o3oD3o -x@`800pL<00`4p,`8`%6P 0`,d(0P @P3oNi -LHMpP\@@X \ `0   P 0p "10H0 0`W\00d0 D d0S \ x50`V P(0S XP 0P:,Q`DQ 0S  0 0S P D \Q 0QP0H 1L h0 h8KP< T < L P, K `0`0C@0 l L ,0X8 P"F, T@1),@0\8 <0P"F  \T@! R 0 b0T@!T e0`S@0` P 0U, , P X, KD0< P`BZ, T<PT < L HR  \L DPj,Qh $ $0Sd iB00e00\, K P#U (0 0009 0 !( (,( , !,0, ,,00,0, \, $ 0  !( ?( !,(0  0$ S B0R$ L,0 00,(K P8 00P 00  8 0P@ 00 4 4 \H X0WP 0 0S 0' \X  A&0LP |t 8 0  00 4 P W0P0 P(K 4p h 0 PRP kL,3o3o1o1oT3o p-@LTP#0  !( ( !.!( ,(  !@T (?4<S W5\` x` 08@)000\8 L0$S 0QLph>,3o1o1o1o -QL' @P0  !( ( !.!( ,(  !PUT@ (?4<S pK0$S 0QK8kxmlhp P`8 80 @#FDV@1<@ 21C! c`V@@P>,3o1o1o1o -@1LMh!$pK(0 $aD1$ p   1MP\$@T0  cPP n$@T 0  !( ( !@TPj$0S 0 a$0S$00$0G[,o1o,3o1o>0 \ PDP @4SQD$DRH4H4H40D$H4 d  Bd  \@o1oT0\ P ($R,40QDP \@o -L@P$40$4 -\0L\T 0 @ST0 00\ @'T@o p-$L`\P3 0R @'0S# @T 0  Q0P" 0@S 0  0 00PD4-H0t ` d00d0p U\ g'00 0 S 0  0@0@o1o pp-L`P j(@a0 0_lP 4$0e 4l  el p~1o> -LM`d0pSOL`VM PUDTU 0 4$0S0 @0,K@ @nP DTU `VZQ!00D$RH4H4H40D$H4 D$0-H4 P 40 4l0  l (,0(K1o@o0X[< 0-L@T4P$SE^P T40T4,   H00H0T$P4RP0000 -P@LR8408 0a c8 00C 0<0S00SNv0S ,0;,0 < 0 0S T40CT4i80S0lvHopo p-h0ML` @P0 K@ @TmP0,d(4Kp~~Do> -L,MH D d@ItL LH 040  DQH D08@0 0Oᄤᣫე< ~D LD  ?0 PD#<0eXtH0p, (To@ 80K, P(2"@`\tPx`|0 40<D\ H< 400b ccQ3R 3Xሀ H0 R  H<400` ccQ3R 3X᐀ L0 0VyLP0SWLL  00, 0D0E&D<\< " @0O@ D L$@D? 0 8K 0K,0K@P!80si40sf}:PL0 0R0  \RH,0< ;,0LuuH(K PL@fupoHo1!Ce|1(> -tx 4DK#6:Lp@rP# (4@$0cOF#J6T[Qd@ Qs}@Pj0Ot0x@@i  i,0 ;< ,0@8i,P> 0-0($@,0LP0P 0000(,.P $$4R@0S" 0@ P 0(!x$h00bh0@P (P0(,$0i0ll\, $0*@}Жm1oDol> -P"LM@d0Vp@ (!0PP0SR S P!0V 0(!(K$40"!B 0S p@ @0OD K4#R0 A0  ZP@QCN@ 0p $!{\0@ Ipp@l00S&  0kP |K(!0VPP(0 ,|KPP(0E4 0P44;L$@H: 04 000h0P0h0Жm`NihGi>>1o -d1LhMPu  K|P K%^PA %88#Č@ {pKa@0, [ @:{\ I$\` D$00@Pv\ 9$$^v 0@4 Lt0hP  &@"\ #\( #{pK[ 0{Ąi>,o> -ML MP`pO%0S= S (@P; \Z%(KL3Z ( `PUDTU W 4OF#J64; 0"ᯞ@PAn+0`@PDTU Z@2@d F~KpG pG+,0K⻟@P+0]D0H0  0CtKL@ l p0 tp D` @P0`0CSl1@111111@0ST0! @\ `#P8PR  z.P@ 0@@"P\ c#\P ^#00@0@ST00 000S,  j,\ H#, mu2@P <0S( \ "\P "@\ "@((`Gi@o1oi p-`QLP@@Tp -LMp`0@,P@fTK0$@K0@ $ @ `PV@$0  !( ( !@ R000 0  T ,3o1oMi -70#L0`M*x0 000p  t uP| > W0h$80 S%:S 0 80 S:SQxP tQ! Tp`P$U |lKe@ lK ltQ  PS|@(K@x3x#hD0Q x0ST#t0  0OF*p#J 6|Y, 3# ĠP(0 xDt\PP 䂟P@+ 6Q4000 t0SW 2"hD,2\@0"0,0| @ Pp |r @0P  H00H0 x0S0 Pq |Pp@`*or0  !( ( !`VZJ|@(0Kp# pP| GrE,0x;@@\,0 6|YpW$ PZZ Y **r| ! 0PS)0S P}X`ql .Y p|lKy|Y Midm,o3oDm!Ce,m@ u1 -Lp@Mt0q0 t0 pP09LK pP00P00Sp00p01o00  -L M0 S0d% @\0!@@@h0P  0@ar|Srt 0l@VrXHrKhD09P 0y,y,m@o1o>Do >po(>Holi>>0@- 0S x06BQ*0 a("400@_#& U x0T -LM0 p>0n`Q70 a(@P$0S, p060>0. V  b 0 K@P0 >P  ah*x K f 0p 0f#&Bp 0S* 0p 0c#&p 8> P-0L R.  . hx\> 00 0 -L4M0\ P `X Zj @<0t"0D 0S_ R@@ \&P  Z00ST K0R00n\0T0@0@T0 B? @ġ0 h< L  @00KP0 H` Dp ,@ 8 @@ 4 G 0SV (1@ XPK`0@H V @ T00T00S` T\r0 0C0 S V(K S@f X00R0S T0 `q0SB XB`Ph \T Xh!(1XPK `|>,o -LM= - 0LS0S\wxpD0 0@`,PXW> M-LM 0  0 0V@`  | 0 x t0 0 |Pt Uvzx0KpP` WP 0  !!( 0 (  !!:@p Q P`|@TH 0P,0 P x`K  .P" f ( f & D0P0!!( 0 ( !!( } R 0Qn :`@|p\b R 0S P0000$(C0S0  =0(KT`p00 @`P@00 |@ T0K0@x0 t@ 0P |` c|t Q 00 (  0 S@@   0  !( ( !0#B3@`pQh 90!!( 0 ( !! 0 S  pK, K00Kx@K00 0@K0, @P@T 0!!( 0 ( P!!T 0^I ,0TQ. (0n0  !( ( !.!(  (  !P    0Q0 0PP^P ,0TQ0 S  0T01 T900  !( ( ! p( l0\0$x Q {@TxA0FA xutu00 0!!( 0 ( !!A f@xPT~(>>>> -LM`0p @0U ` p KT0  0-LM@0/ 00H00 0 P0S P0000| A0S 0 Sj00    $Q(0(0(000 K0K0h@du4>@> p-LM 0@C^ :`0000P5  0   0 S 0 " P0  0 ]A0S    $ R(0(0(0  0 0KphKp0 Kph*@4> p-LMP8^414a@0TH>(0S $@T U0 0S3 0 0 R,0, 0@$@T@Tz,@T 01 P> 0S0  $Q(0(0( 0<0^,@TKph*| 0o(o o -PL0`X  p0W0 d 04@0 0h!4h!s,o -LMp 00@"0@0S{  0SQ 0 0 0  0S$0 $0(0p0(<0@600 R; 1hK 0(!P"PK`| 000P `@P0 @0S$0 $0(0p0(<0  K?0 0@0$K?? 0T0 h 40  L, K0 P(0P0, @(`0 @Qd&T 8 0#40"!B 0S@vl>(o,olGi`Nihd0 (oox> -L M@R \IpP` 0 0!!( 0 ( !!0\p:@P`0s ^,  (0  X 0p\0 0RP P(K0 0P0\`p \:@`pPUY  U YP, + (00  !!( 0 (  !!PU 00 , !( (, !0!`?P0 P^, PPU ,K 0PPP,0 , !( @(, !k,00 ,(0 >,0  !( ( !]>>Q00R0 S-LP P00S00S0P00r>Q00R0 S-LP00 P00S00r> p-`PL@ Pk00P30@ ep p-`PL@ Pk00P30,@ Lp -L(M PU`@0S 0S0S{0Sz GJTH DK0EUSP 8(@#h"x 4Ÿ40S;80S89 0 Qz 0@S.0S/+p 0P" R㲀 0S0s 0S! R 0SJ  0 4P 0 1(K 0 000  0, X,  (Ko04(4 S :0  02P @0 ,00 ,较0S0S AP ,o,o -L0M 0 , ( SP"0S/`0So 0S 0S0sf ,0,pSd HKH`K@K,0K Q@P `$K 0H(K0@ @`PH R d040,0 ,w0S$[00S40S5 @ 0P@峠P0`0S00S 40S80SQ* (@p0@4[p@30 Rc1`00S40s80S(%,<4 4:00p00h! R-L@p`pnR00Q KgP /.00 S 0bS1 RS> -0LS@ 0P P S T gPP P0P P P< -@L@Pԑ -LM8PK`@pg0K0 80K7KHP d 000S 40S 3HK/H 0-@LTP@T Q 0S fP0 p-LM0P0CS0 Kp?{+`P JKfNK0 (1K'!KN/KLP R000 0 0 6 2i -@LP6  -0LM0@T`p @T 0 R BXfPPT0007PP0P01 86 @P70P0( 00006 0KSf-KtPPPE0S 0  0 00 0@`i? K6 P1i p-P`L@ 6 0PP700  PP@ p6 aP -@LPPp# 0S 0S PRl0S 6t0$0P` W 600MP1S d `Pt0$0Pa0S K`P0000<3 i -@L0M* R0 00  0 Q 0@00|  BR|  00FKV00S 00S40S80S \ keP 0> K.0P8 l100S<0SoH -L4MP `qJ0 `0S01@T$ p@T 0 R00 4ePpWʘ@TW M R Q000 RuK J@P000 0J K.0 80@zlo|> -pP00`Q0LMSP, 6H0SyUSu HPPoHK,Q-0S x |0S^Rq8 RUV H0S |0SQ|HG@[T h0s \@0@0@0s 4@0@0@ P, 2d00d  '0@0Y@@b,G0[S@0[S?0[0S[P &04"48#P (K: P D7 R0,0 Y ,U  0 ) 0(0&(00@0@& `00 |0 0 p0P0 P >)dSABjP d0 006SA_P d0 L,0@0@k0@0@\ K.0 sk/-0S S/ @Kh cP5 000`)0 K.0ǡ  PkqKc<9KᛐK圀K&@K04"49K$0 0 $0C, K 0KP 0S0 0001 xD0KcxKdKကKKcHğ\KdKcK&0L0 04"45KdK E@P   cP DCOK@c3( 0 d0K1 0K ! 1 0 GP, x , K]P 0h0S 0010H3 d0K>P rc$ß0 d0Kc KL 04!45KdK QE@P   =cP_ DCOK@Qcd0K1 0K1 2( 0 ! 0 FP, *, K PC 0S0 0010X1 R j1 R  K.0 , 80pj, HP0 T1 R 0 K.0Ϡd Xj?Dj><<خmȮm<>0>> > -LM`Sp@ j 8#QP 8Q [*8T0CT*8T 0Ti-P 8Q 8QUX  @P(KT8T L8TL 1CTK 1CTF ,8T[ t4T, 0CT( 0T% 0CT" 7T[0CTp:X 7T1 7T 7T P1S  P70S-PT7TY 0TX !H7R/PUPU  0P|P6T :60SQ 0S0S 00Sm  6T $0CTd6T0CT*%0CT0CT*!1CTM1CT 6T 6TP[5T 0T~U Xq 0s % S $0s % S  0s L@0@0@0s $@0@P0@5T 9,0CT44T 8 0CTW 0T=0s !P`Q R@ 0A0@0s PaPU`V@ʿ 0AP0@1P4TH 0TD3T 0T@>a2.@aP3T 0T6`PT3T"0P0d0lO!@ PrU(P K Pa` P4K K@KK 0P 00 P@0[d0@0K@ [!|x0 @ KH0 D OP, a 0S,00, |00|0@P,S*$R@`2 `PG@D,=*P;0@P0@50@0@(RP)RP%U=0@P0@Q$0@0@#P &04"48#P R 6R00~ , KmRP:,0SgP,)&04"40liHMi iildiHl>Ni4WiHeiHii "i %i i i>Ii i Qi P*iFiRi Si !i > -R  S LNMR`1 \ `4Q 1CQ 1CQ -(K0  0Sm0Sj1SSf1SSb R_3X^ 1CX[ 1CX0I `P P@QJ@0`SE0SBpK_  _ K_@T00   1FSK00KC\ `1t 4 pX`K5 _XP80T@P40P@00L,0  XP T@ P L _P 8@K_0)D2X  XK _`!pWGpWD 0SY H`K _HP80D@P40@@00<,0 XK HP D@ @ < __Pp1X0 VOKr_  q_( (RKm_`!6 K_K`` d_|| `_\ `1 '1%!KS_T00   eK_KF_( (D_`!6 `F` <_00XfF,_pK`&_  %_K !_4iiii > -LM`pV 83PU,P  0 , PUE 0S@T@T@T 0S,0S 0iSl PJk `2 R ,  P00^00Sd V0 0w,@ ,0S3 ,  0S9  0@hl*P hl* Z 0@hl+P hl+, 0 0@+P +,(K 0@*P *1@P ) 0@)P ) PZ,0!e,` ^RlʗRV c0 0bSPRXWVU P y6i@Ji8o> -QL@R  UMRp` K\\0SY .SW T 0 \H .\F ^G  0 a?R0a 0PK0K_0[ K A [R A0B0S 00 RNK K []PK]00 <0 &04"4  0 ]0 a 0 p-LMJOK`L0 XPK@\ ]0000#0KpȮmخm -LM⨐K ]0 8 _ppX@KtPK`KDp0   pK嗀K,0 `pK_K|pK{K00 D b(K0 @o -PLU'@rV nV0  PU `\0 00 pW e PUTQ0 H00  0 00b0  00C0Lo@oHo 0- 0RL@ * CPP ވ070 V 0 0C 0 0 -|pL0Sd`00[P LP 0 0@ 0$@xP00hEfm@o8o -L80(qS003PU 90P0C0S90`(0 0@(0,@FUP 0R*0S`0 R 00 0@004@ 0) 0R:@`PPP 6P ofm@o8o(JiHo o -LDMh l P 0` Sp 4:W" H@K V0  @KG0KHKqU( W7PT  80S 0T0 6 0$0TP2 0 0@0@[(K ,0KP , 0R0%p *X \dP.` P)`,0 P00S0UP0 @L@ 0 00PlP` @  U`0 UL@P0D U  P  04 8<0 0\4<1X Q   048`@ <,<$"* <4#:Q  q3RP` PUk `0V@0V@T\ 0 00fS `0@T R000 庉 `@T`H00 O0@ 0$@` ȟQ`@0000`0 `@00 0b 0l(00C0TP " 00@0@ 00@( 0$@sG\00W 0@'00@T0@Q 2@0x x|  048#,("(04"48#8d0 + )$h0 0@T h0l@R 2@0  l@P04"40e 0 TQ 20Sx&00Ul6QL6 Qy@60S`0 G`P` B  0`@484 <S  SP  SP\ d R`@00J,0 8 0 `$("(04d@,"48(#8j"(QX (I0 0Sw0J Q(00UW5 Rşğ0R"0<0 0#PP `P 00S`@` 00@@ P 0488oLo@oHofm,Ji(JiQ@-; Q! Q `0 0@`0d@Q" Q(0 0@(0,@X0 0@X0\@R^ RS R@0 0@@0D@R\h28h2h2g2g2R00 0@004@R80 0@80<@ 0 0@ 0$@0 0@0@0 0@0@0 0@0 @ 0@P0 0@P0T@H0 0@H0L@} -L MQ@ KP 0@S P*0P P@0 @Kh_-0 KhIJiPo p-PPL` d00S p$@7phY? p-PPL` d00S \00`0pq$@7phX ? -LHM pPK3`P+ d0 d@K@QQ0`P 40 00\0 Nr P$0Kp4@T$LL|2$`D0 82P Kn2`j2`|Jii2 -0L C*p3pJiJijm -Lp:RP`@ P00T0SPPS *P0S  0 PPPS T *PT(P R(PP Q PPP -L4M `Pj5 R UVppV΅(Kd0 4Z D@KP0 <KC0KDKP , g/P 0S  p@PpP ;  @@Ńm0 P # 0000PP : hP 0P d0 0S L 0@H0 H `00H0:  H 000@@@ XPH0 SPHv0((0@@@@@d0 L R H00 ?PH @ :PL 0-P(P m0P 0@H0 c Q:d H30 S H P0bS w:P0`@0DS:/.00Sb@ PH 00b  0 000 0Sz 0Si 0S_ 0Sj 0H(0C8#8 $#$("<8#8"( 02 <2 0#P " 00@0@2P`00@0@"00@0@F `d$ahỄV ᶄH00  L OH L@ OX 00S0C 0 000S0C0000S0C00 00S0C 0 0} 00SL `A*[00SBP@ 0S= 1 0( 0*m XOP1oJiPo -LM0P @ $(,L<4,4" X@` K1.T, 10SPPo?? ?`??d?,?% -/RLpMp0 S 00 S0% :Pg 0 ` P0 3V ,+Vh ,V V( 0R0% :PP 3V000011`PP 0@S0% ~:P= 0$48#8 R`P<V 0Z0#X( hKL0 \h0Kg K `@Ke P hK0 P 3 Rቁ 0 00K"Pk3@P $((K 0R0%@ J:T 0 0Ra`P0S 0S0% :P 0 @2  0 00KP 0 00R6:0V 00K܆P 0 0R':0q 00K͆P 0 0R:0O 00K⾆P 0 0R :0@0 00R0% a*ySD@KLKK0 L0KKKK 4 LK 0n@Pd 048 <:0RH0 00  L0K\ㄠ P t |0 p 刀 l`K ( 21C0!10\ W hK( 0K OS6`@K  BK!0  <(4"4!<( K0"p  00KFP# 0 0R:0B(0@P $(`LiPo>8o -LM , p`0WPf " 0@,U(+P>`0@W 8$H 2  ,,} (K 0S `  H:XV @,: 0@ P, |! !=0@@8DH@T GTb T TIW 2@0  @T[222229 R)P(8,H`0@W(8,H, 00KuP 0 0R0% *` 8O, H9@P $(T2 T5 :T T 9 R^ 0,Pz,KzuW 2@08 8< @TW 8H 0@8H\U> 0@084HT TW 2@0( (, @T :TW  2 00@ 0@ ^ K.0@ 0LN\T1T:UTm W 2@0x x| ,&0~@Pg  }T{0DSjwW " @00@@0D@ R|gW 2@0  U{XWN 2@00 04 BW 2@0H HL @TN,%0X~P8  R>/W 2@0h hl @T4'U@,H%0<~P* W 2@0P PT @TU%,$0!~P  <W 2@0` `d @TU ,l$0~P  D1W 2@0X X\ @TU,#0}P  Z/W 2@0  $ @T T ^ K.0 K.0W 0<PM@,#0}pPy 1 0P p Tq{P 0Q PQA @@AQPQA  @( D00 @PE E0 0 000f0C0x ~0( p(000p8X`0@ 4$D8Xp?ʚ;? -ࣟL M`0@pA P0`p 0'Su1   V WV Nz(K0S 0SX 0S (0K  #* !P,0:Sb @P PQ0MSp 0| P4 r 0/Sj40  E E0Sk S 0Sn S  <( 4"4)<(##$#(`p 040  0 0@4(0@b 0S0S0S (E~P0 0@0@ 0R0% 4:PP 00R  3 0 0@0 @jMcaw0~P4 0 R_  KZ 00S0 0 000S000 00K4P 0 0R0% *lK00S St 00S Sh> 0@ 8$H#Po`Li?O> 0-PL @R 0S0S R  P @0$ S00 00KxJi? -L$0%0 %0tJi|JilJiJi -QLM# @P`p, ( -@P 5", K  "pf`0, K $K -`L4垳0@!0c48嘳0!0c4<哳0P 0c4D匳0 0c4C@@D0@ 00Q0 00Q DʳP@10 R 00d  SH,0 0C# L0 ҙpPP̙P@ꫪP*i -, 0LRP*L0 OR5, 0S*4@pD`@` 婙@X4<0,0 H8@H00 Qk,P*i -LJi(Q0( ,S  3S001 001 R0P -L MQ@P 03SP KA0Pt P0L/ScP2H2H222222222222222222222222222222222222222222Ĥ2L2H2H2-P^P 0PKh0 Kh0 Kh`0 `tpP0S @V"5\00 P@P~o8ox |< l0.  )0< PllS8@K  0ԆPD (@P  00Q|l0 1  )0㽆0SulDK0[0S S $KK0[0S8o 0-0L0@SP ڀS S ju0S00 0@0@ 0S 1  Ru0T@00@ P @P00 08o -LM`Rp"@3 1:S? S VM*  hp  `bV @0SV;0 `bV(KV0PU:0 =0K ?00 <4("4!<^00 >SM: 0V R*K?"[04"48#8 00@P  t+00h T`*0p@0@P0h @PC,0T0h `@0p@P@P2,00h 8o -LM@` 0)S0p(P 0 0Q( Q0%(":P*0@P  (K( ,0K zP , 0R:0( ,0KyP , 0R0% *8F0 EP00@8o> -0LtM40 ! 0S /9I 0@/9I0S @ l? \? #=0@8HX " 0@/P`0@p 0'SP00`S, .P0`0@X0@ 2  s(K(FxP 00@X0@ 2   >! `0p0@0@-\a Q0ST @pTh 0Se0Sb0S_6at-P0`0@X0@ 2  $ 6S -10@#P (l,#= 0@,8Ha,'= 0@,9IV,8H 0@p,8HK 0S$0S00@X0@l 2  $ bQ0S` \G ^ ^ T 0S[ Q0SZ 6 \ ^ ^ 6 \] \ ^T ^00S S $48#80@\ \ ^ ^ 3S$,KP *P0`0@X0@ "800@80<@"00@0 @ ,0t0S 0S0S0SI 0S0S 0S$0S= >090S i0S d0)> 0@)p00S S1X<1 " 00@0@@T @T 0 R  B;PTo"00@0@ ŸR{ @00@@0D@XK " 800@80<@ 0)S(hP 40`sW @2 R@R00S 00S&48#8 0 `TX  ;P0S!h 0-PL! 1@hT0 R*0hq\  @00C@0g@00C@0^o -,@L: ho$,3 p-L lPG AnA#!B30b0020aA00 S0P\!* n4\4*0 R0S 8ChV N#!B30b0020a4A\4:@ @0@D @"phBGi S 0S S 442 Rp pR: R. R,*RI*P 0@P  0Sl 42 0Sp pS:0S S:0 W 00S0 0 0 P PF 0 AP 9P0S PP  0NPA 40S " X00@X0\@`1@@P @D 0S 7^# ^@ (^  000Sp000l 00S Sa00S S_P mP80`0@80<@40S 2H HL W H00@H0L@W  oo8o0Ji\JiP*i?X?Ji p-L M)  0K@ `PP 0T Kp00e F TK :TP TP 0S0![ P P!K 0Kp -LM"3@0S0 Y 0 P0S "101202(K Y 0 z"00000202  :2<2) 00KP"0` ` ,< $4 !$ 4,̂&<4 80 Xpe XL 0p 00 000 00RT R= 00   804 88!   4#8!8  8#8"QA"A"8#VK V :V 0S0"gP0Sw 00S S00S S *0Kp"L 00S00So#o'0o0o - 0L(S``lpPl7Q PQA @@AQPQ100D000 00 (A(  ( ` \7` 0-0L@P nP 1 0'S 0S S% 0S S  00h (pP000S000 00S0 0 000S S 00S Sʚ; -@PLQ000i R5 hP p-PL`@l U  U U -p0V 0 00p0V 0  Q 00p0V 0 00pp 0 p$Ji -pL@60h00d0 -q``.Q00SLP@ P { 00/U00S00=U00S0d00U00S P 0 0P { 001U00S 0P { 000#U00S 4P { 0403U00S 8P { <pP8p U=U~;U <UP>U=Uy;U <U>d 0P 0 00@ 9P 0K0H @PPx#00P@KS 0 !.0040 d 0 .dP @ PU EPP$22l22X22$UxUv #U U 9P Ur U$Uel0X  0S 0PXS \0(K  !0 P Ps@U; 1UlX7 0St0 @R$ 0@1S SP P@dbPP_X 0SX P00T5U+7UH@U[ 0U"c0 0 ,0P05U.P-U 0ES'.X 0S.0P,  P Pl0P00l0!l0P0 0l0l0P 00l0P^P,o|<! (R-LPp( B(0dP @@0S1` *cP  0 0 7a`P 000 0 0 0 -LMP`UcP1 @0 0P <(4"4!< $K= 0 , 000)`P @ ZbpP ; Ub1a77 0 @0 0 000  ,0@aPp -LM @4 8 4<,$@a8#$@D  X00(@0 |R@y4`aPP@q P  `@Pl1 (@pp , @ 4 ,0K0@PZ400("Ƞ0l08#8 $#$(",0^!"( f , 04<8#,("(#8 0 0L08#8 $#$("<8#8"(0  0cP!  R4 000,0) , )<)00`,08^a@PP7@(Km -LMPPK p PK dK0 0 , ,W? 0Q  `K !?`P ` a\ aXaTa KP a 0R \ (K4Q  \K !`P8Q  XK !`P`Q  TK ! `P`\0Q S  0 X0 S 0T0 S 0 @@TP00(@CT0*8#8 $#$("<8#8"( 0T R UK 00T  T0 <00`0S U: 0 0 `  `00`\0S U) 0< 0 \  \00\X0S( U 0+ 0 X0X  XP P0S0K`P0 [@ H+ " B>+  L '0S$ 0S!0S0S P0@ 0K-`0  ,P2 Z 0U  w`P 0SK +X00 @*\X0\@0K 0  W 80S< " d \0 $(:0S    R *8#4"<# #$# 00s 0@KP*0 xK0K*00K( ,0K 0 K0 ( 0z`P0PU L0 0@L0P@0 ,0S " P00@P0T@0 R 0S W1 0S- 1<1,0S SD Q QG 0 S4KP0K8@K@`P40 S  4 W h0S 0S ` R 1@01,00 @K ! B<0K&PP`Z1 @01 ,6 0S S 0S Sf ,W l0 80SL,20Sp  p S:0SY RWS;: 0N P`!P" M #dP `P``g  a`PdPKAV &0Ɵ0 @0@,0S6 2PX0 0@X0\@  0S0S9 000 00S S%48#80P,00@ K-`P  P0S 1<<1,P " 00@0@,6SDş0 0 @P0@P3` 2P 3`X0 0 @X0\@00S60 48#X000, 00S6 0 48#80 0 0 0,d00 0P@K$E)@ @ K 080S44Q,$ 00S S00S S PS: 04O 3P40 X0S  ,00 40( _`P,0S " `00@`0d@P00^U",`x0p0@Px0|@ 2p pt , 0#`XPe 0V0 ]P(`,0S 2Ph0 0@(`h0l@@T @T 0 R B(PT  R 0S , N0S ,6Q00S]P\1  00S[ 00SQ "48#8 0 JW h0S  4 V  p00 @p0t@P 00S S.(V `0 0@`0d@R,0SO " h00@h0l@D\0S(`0S%,00%8o?$Ji p-LM@P 0`R :P" 0S* 0 @0@P0f @Px 0KbP  0R0% *T/D0@P0  x0 01 x8o> -LMP`4 P~ ؿPz 0>]pPr ]P  ( @@0( 0@0 0`0Y0 a 0* B'V{  '`0 0@4 P PPPPPPP '0S8 00`K0S P P2<2'4 p!0 0@&0@"K * K2@40P S 0 S% S Y00 @P(K20`K<2_'40 _'2  2B  !2 !` >'[Pojm< -@LT @T 0 R40S C R004   "000 @T4km p-TPL0Sp80 @`T  @TphT4km6i p-@L x04"40 d`04"400 PR ph9 &P 00S $Li4Li p-LP0@ Ġ#Č` &P 00S 200 40 00040ph$Li4km 0-P0P@LMKP0`0 00P& 00@84kmjmjm -LM 0R0%@P` ::VF  0S [ 00S0SB S1@0S 00S PU PU 0 R B0&PU 040S 00S0C 0 0 (0K`P ( 0R0%` *h-d2@P $(60ST 0SQ0SN0SK0SK 0 $("04 48#8! CP6 $#$ PU? PU< 0 Rpd B%P 00S0S0 0S-0S*0S'X8 40S S0 4 0SS 00S6 $#$("<8#8"( 00S@m0i  %P6 $#$("<8#8"( 0@ 0004>PoMb$Li4kml0GS S S S S 5S p-`@L(Pt%0V00@ 0`p0( pS\8 0,?2 -LLMl t p Ud lPp l00`0 2` pW\p  0\0 lP `0@ Sh $*t R@0  08R#21C@0\Z\ pWl R t0\p S @3@#du(K @% @  ^P[l00x < d0(0h , 063d0sW !\P`Q R@?< 0A 0$@|040p =0 t`V ) h`V! 8#X"B` 08P#(:h 00@   `08V#(21C@0#Q0@ 0$@V K.0rb8 +0@ 0$@\p0l@zLi,? -LMp0 匿W, 0`1P`U, PV,`U,$ W,0 Z:,l$0 0  *0V(02,200 @ &"P,`UWP 00S P3P#,壾(Kdo S-`Lp@`PQPR00S`RU  P ` V V*` X  l `P00X00S U  nN` | N 0-0L R$ P0;S000<S<00t0@T@T 6@ h0  ˻P @T0ho0LiLi6ilo 0 dLilo -L⿾ pU0`V 2P@T 0>CS0`Vh@0$E D Q0( #5#3 0 3o6iLiMb 0-|LP 800T0@  0@30< #5: /#3 00 000uMb P-L \  R @T 0 S *01 0 S00@ 0(F# **P?p? 0-@PL` 0S[ 0SQ P d1 RMX1P U 0SCP0 Q001 1Ba0 i۸P 000028!,10 1 Q! `V p p400 0 PlS p 0  00 00l0 d0BaO  04%0%(% %LLiAMbTLiPLi ??H ? ? -L8M@!P p l0S $S`KQS `(0 K P`P 00 R $ -000 0` 0 0 0 0 0R R N K.0[8  $0d ? ? -LDMpP@ Q 0S0S  0N`PK d ;`0 20 S<X 0PU 0S `(K0S 0S`0Z0S0 \0 h0 d <@Y`0S&\0!K ,2,"0  @T P P0 0T`   0`P d ` Z0 200CS+;3;3;3H;3,;30 m 6P V K.0 [@  08$@d R T 0S `Q02R 2S 0 R}h0 z ]x`0S `0Sh  02R Pm0 0 m sY 0x$v$ATLi ?Ji ? ? -LXMPP`0<4p d@ IP UG U U: U (Kd@  @PP 0S  P P$@ 40 S X R | 90l0X0 d0 0S 80(($#P;d0 0Sl0X060@ P@< 3 0 00 `( TUR 02wd0t;d0 h3 @ @ R80Rl aP PX00U02 0m :m0028 P4 ] ` 00 08WXU  ( 6S% LPK<4K&04"4 4KH 4 BD0 @ K@T @T 0 R BPT+!@00C000 @d0<@;d0 PP 4tQ^ 0 000P 2S0ðѰ2 Xsd0  P6S <@K<3K&04"43K4, K8 40 0PKP |0 R z K.0cY,08 L"< "< Li><l0GS S S S 5S80 P0S0SP@km o -LPo ?H???\ ?? ?? ??<? -LM@0P  <Kp0 LK `V# 7 R 7@P J(K  K.0R@ K.0R8 0pK 0R0%P W:Ue \pK 0 \[48\l, \j &300  L0[Sj @KH JPtL0[Sf |PP@ 0PAЭ0Pl 0; G PA 000T<[0[0S0\&04"45K6 R  K.0dR   ,0KBOP , 0R0%P *5@P $(p K.0@R|  Id[0[0S S,5 RP 4L|P5 RE  A4 R <K5P4 R0 ,U m0 00S l4 R  K.0Q m0D`~ 0P < R 0X 2# S <0m @R@U@T 0m Q 0 0 @ 8#8S2d00d0 P @PTp P0  0TfH PaUc 0SW 0 U  2SO2"0 E0,U+Q  K.0tQ@ 08 LU m0 00m \4 0 0 02A0"0,R00S d000m \P  @e @P4P$ ᵭ0U00S  "1!0 ^wd0  W 2 0N0 R0 4 40x  0:00L D00 /%`Lio4?l?>Po ????H?t?ATLi ?JitP0S0SP@-0s l@0@0s H@0@0 @0@0s0@0 @P*i p-P0L@`TP @T 0S Ppdo -LDM0P\p 0S K Pd0 `@K@`d 0P0@ 0 \ XP T` p -PL@pㅭ0`S hڬ00S 04!40 d3 -Lhd Q 0 R  0q |0@0@T0X@| T 0@0@L0P@0@T0X@0@L0P@`Li?P*i -LMx@p8Kጪ PP` ԩTW80K0   K0K 0K00K0 840 0`,X@  @ Ԁ 90 0000 4 0000 8 0000 < 0000 0 0K8K0K0Kh0d |0 0@00 جK@ ᴬP+UR K1 R[(K0H@K0 0  8H04D 0P,`@0P< P`0`@00 0@K 0K8K00K@ h0d |0 R 0|  R< #310" cb ` | `0 R Kv K.0>O0 DP`8 0 `Li: QN@?? 0-\0L@PT@T 0Sx x0RөP 0Li -LAMp0P, p 2 R v K.0Nx0 l (KT2@T@T T p0 x0x R❩P P[ HK @K(0H0KeP01 `  `EOK@ 01 `  !  ,0KbP,P ,p00p0Pl00Cl01 R, v K.0N` K.0x@N P K.0N8 0P ,X 0 R X@0 R v K.0bNx0 8 g`Lix?Li?? -LMp0 , 42 R  K.0?Nx0 P(KHpK00 @_ @Kd`KGKH@KZTPK (\Kd@KcKP@Jp `  ,0KPP%p0,0Pp0  41@T T p0x0x R @T, R l0S0l0,a0 R @K K .0Mx0 8Pe嗨P `P L0 R  K.0M8x0 8`G`Lil?Li?? -t@LT  0sP <P 2S@T p-L4M S@T @T l0 P @@2 R T5l0 p0K Pp00p0@T 0S00S@T@Tl0 p0PUK l02@T 0S00S@TQ@T 0@ 0S P6@T R 0@00 RKpuPp0p00p0 PP H1 R F K.0Mx0 P`P 0 Rp0@T 0@ 0S EP000000@TF K.0Lx0 t`qp0T l0 p00p0@To 0S00SLidoo`Li8? -PL h0@#10#T`p7 p@T 0 R0@ ⊦x0P 0bP 00Sp`0WV`|00C|0iPP|0`0|0yPP|0p0|0 -L8Mp0 bPh d |0SK@P 0 R J K.0XLx0 8@〩 pR000 tP @| ýT00CS0| 㷽ᾨ 8 `Lix??|\0 00塽 0- L@P |ֽP Pt0S0t0t@0hk0 -0L@pT&@V HS0S p0t0SPU P0S0@ 0S00SLi -L8MQ0P`r ?R=0S8ڀ| PP2  VP@xt@(D0( @0T0 8ը@0S0 00Pl0Z  r000$K 㷨@y  n`P P0 R R K.0oKx0 8`PJis3Li`Li? -LxM`P动U1;xP x0 &pP l0l00l0l0l00l0l0 T0dT0X@L\0hLP \0`@dhl0 p0 X PP l0 PU|P p   | PUb 0 R0x0P 0ǥP 0@|  DK  0 d4 ^*h00 @00T*|  00 @ KB R0S ʝ |0b cp2^R:R40 x0S 4 @DK0@ 0@Q h00 d0S h0| #10#0R0SP *(K|0!0|08FP|0P0C|0}PP] `1 RY r K.0~Jx0 8,PJd0,p S l0 , KPP 0 R r K.0^J,x0 8 3,,P l0p%dP,0hP,,pdhdh44    OR_ bP*i [<`Li,?x? -LMPK@ HK dpK,P   `K    x@K0 @H0KG K0Kd0K Kc KhP 开 ` p @   ,0K,P 0 , l0S0$0(K0l0,Y -$0L@T @Tdo -LM` dKHKpK,` O  K K F @ B x@K0P0 H0KHKGPK0 KdKPKcPKh` p 崠 ئ0P8 ,0KQ@,P 0 , l00Cl0T0$0(K -Lⷦ1pQ 1 RCil@T `P h0  V9 $00S0U  RPU00S"@TV4 U  0P <P 2Sq@nTV Ugx h0P <P 2S``ӷU `V`Ji`Lido?? -0 LRPbh0 *$0Sp" R 000  0 @T !P@TSWd00CS0 | hhp 8 dJidoLi8? -0PLr@"`PN BTf $0* SB* 00 @5 @T6 R0000 0l @T P@T P @ 0``00000  0``@T2S 0 R0R,| )P `H@`,0 Rh0  doTJiJio00C0S𠑴6@ -LUMP2<Kt p @`  a h0  0j?(K87 <R<pW! 7 R 7@P S?p K.0H@ K.0G8 0<0[S 6 R <K K.0Gp s;0[0S 0R0%p :W| d@KF P 0  48, K lN tK şf K 048#8 $#$("(@P@PVt@ pP &Kx  <(4"4`%&LT0T @y0$%#5$, $%#3 000 0 4 8  <,$!$ , PKXpQ# @`Q01`P:0SQF T4 R  \@P4@P $(/PQ 0S `\> 0 A< m0 00T7 3 R' <K K.07Gm0 D ,0KDP , 0R0%p E*l@T,3 R  D@3 R $ @ 0<K@ @gc0S S 0 S [K# 0 VK_1K`K"  t2l! 01[031K 1["# 001K[KK0 $ (,< 4!4"<1 0 $ (,< 4!4"<1 A Q ~P@D[K Q@>0 $(, <4!4"\ U*@1 RP p K.0F 0L E Rp0 p0R@1*TP%:*0 R6 p K.0~F 0@*@00Sz0 R  K.0hF @@Ti <0 R  K.0WF 0T@Li`Li(o`??P*i6MbLi?Po?>8???4??? -LMP`@p<K fX2 R h0  n=(KY! $2 R 2@P \= K.0F@ K.0F8 0<0S80S- 0R0% @:P4 d@KH P#`\B 0 A@ m0 00T; 1 R <K K.0Em0 DY40S00S 0 R J0@P $( ,0KBP , 0R0% *HX @ 0@ <K@nJi`Li o?$??Po> -LM`m@=P `R 00 000Sؑ ;%= @@2 <2( &00*K"K)@K0 0: pp @@@@ 00`0 0 * B0 (`z0(0@@@@@@@ P+ m@ 0 @@ 00P 0_!0@0 Hm $H 2W04$48#("48#80 L@0KP 0@@%ᚡZ "P`00@0@"00@0@80@P @D$(K;mpP5 @  @,0K  P/  ;Y @K ;(K 0S0( 0 0 =pPW?pP700 00 0 :RH00 @, 0 4@K 9P  4:H R d040,0 p0  0#$#̠`#8 0v00,R 0 :R0 q 0 R:(0 @P P4@0( 㼪 l0( 20 ,K` 0 :R 6@0P 04 g,0S 2 0B0 @0@\ 񟗥̚33ܝ33@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3@3l3433Ĝ33T3333t3,0S " 00@0@0S ,0S " 00@0@#0 0@0@,0S " 00@0@,0S " 00@0@,0S " 00@0@,0S " 00@0@,0S " 00@0@,0S " B?0@1 A,0S " <0@1A,0S " 00@0@,0S " 00@0@t,0Sq " 00@0@f,0Sc " 00@0@X,0SU " 00@0@J,0SG " 00@0@@-@ pϠ0Cl$ !B l10b1 0!0c"0 0cb# a10` bP@p,o_ N 0-@L P0h@-@R 0 0#\P0S SS0S0S  S 0SQQQQQ!Q1Q!Q1R 0S  R@R  0R\ P0Qc-R 0R^ U! !Q@-: R (2 R R -PPPP RrPP B PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R- RP1P P1P RrP1P  B P1P B  R010 1  B R0q0`0q0`0q0`\0q0`0q0`0q0` R 0\6 R B0-81, Ġ%̌T$\D#L0P  R0 Ġ01#̌  R R B0-81, Ƞ%ȌX$XH#H0P  R0 Ƞ01#Ȍ  R R B0-81, ̠%Č\$TL#D0P  R0 ̠01#Č  R8#8S    2  0<P P  0S  P P  0S  -R0 0c BSR48 R p-@P`x BRpR0 BRRR P0 P 0Qc R-L" 0S B@ 0S \ @`0d S:^ 0R B^a00@R0Sa@ R 0S0a@00 P0SbR 0PP  R0QcR0S0  RR B0 0Q0 0QQ 0S0S QbQ- * 0 0 QaR *0\ 0 S Rb` `!  0@-RP@# A0La L\0   S00`P0S 0zP R00@P0S ZP\\ ^0 `0ȠR@-,Ƞp` Q R2RHV}GR0pG@00 0 0  0 0 0  0 0 0 0 0  0  0 0 0 PU @"Vm> 7("B 1@W b`0`WK W300 0 0  0 0 0  0 0 0 0 0 0  0 0 pG0 W `W 0 R 0,8(2C"B0 cbR  0 R p0\d0LL'82C00c08 P @@ R,B B[q p-@PL 0T("( 0$H,8L2C! @\` 0%H c@`R,B BR,B B,0QA>A0AQAApq<0@-Q@; R,P0 0,0,! ! 1!4##!#$" " 1"4##!#$""1"4# # !@D#$""1T"#T (P0@T0,0!," 00<Q  0 " p-L`P@@Tp -PLM0@`. 0IK$1  0K0R0pK Pd@0 Pd@0  Pd@0` `&$K` S-L@P`0 @R1SVPQ00QppW(,0\h0p(S\0 p,00L  P  %9$0( 4`,p$P0p@,)4)40% -@PL$Q ,0S 00$0 -L@MPX \ `0 (K$pW 0 0,  P, P`4`< (0  0AS_$3333`3333333333333 U, `F0P U, V\,KX0`P@,` ,0H0PU8s, `F0PU, kV\,KX0`P0S0 8P U, `F0PU, V\,KX `P( 0P1:=0VPT0 # BL !0@UᲠ:,0`F,0 T 020CL01 @PT粠V\,KX `P `4`0P =("((8#R  = 0 K0̃"(<  \`d \(PERQh U, `F0PU, V\,KX `PH @< 0 h,̟0 \ 0 Q7h威PEP 0 000Php0P0 S.l0TL T l L T0H H/D DP L0 Pv  \; 0 < 0  ,0H,0(8S0b00l0 $0 #4i4$p@0,0% -$PL4p^@F (\ 0@c T#*0 ``T*:d C@T*00(0S, 00000R00#3,05$ 02,0(00@c T: l# (0,00 d `4d (0,00@$`0 (P4 -pPL`@$PU 0S0 S P#( T b4(0,00 04d ,@0 S 8 50P 00 -LDMPT  8 8(K$X PH QL  \ 0 @D@ P0P 8p<`<@ 8 S3$3 3h333p3d333T33333t33D3<3333H333333|3V_ L`F0zL Z0Sp8 ? 0 0VK L `F0zL  Z0\"'`?P  Ud 'w\`Pd JRh? 0 0V# L`F0zL Z'4,<'<$00 0 p80 0Sx  8T\aH  D00L@P(08pS<0S  l@L0T l0 T/^p0P(P8 7 0 07 0 0`l0pPX0Xd 0P P8 < 8 0 0G-|M00\`0 S\ 0 |0  2R0 Q2B@P0 RPU0@ @@@ |ЍU p0 RpW@0 00SJQS03<X 000Q\ 0|0 Q@ 4T $D@0 ^U010!W0!P808 0200@(0@L @$0, 840p  0@ , `Tp$(ń0@p@`p0 4 01# 1 l!c0  ll 0S@BpB @0 D4  4Q40A0 0440|0 2R0C8#(@Tw 000|08"C^B4 0@ T< P`0U |0S (aR  00 cRU  0( 0 [S 3 "R< 080 0  0bC1 @000000d0U0P0S PZ $(,80>P00[P030"S @  7 4^)  P0 4 @0S80 0  04L0#04 0 @!@00 4P @0 !0084 0@00400@̠$0(@,,<<#PD 0@H08XT0 H4."D H @ H0D 0@@U*0*S -PPL@$`Q00V0SQ0Sn 0Sh  :TRpp Wb0S *R(0P(@ ES_ IS [S gS. Q TRZ:Q Rt0ST 9QN )21C00@S90PPpp,P~0(0,0Sq00 0S {8 0 80 #4 0 8q000S 8 P T  0_ T XP ZB0SlS@ 8080 #4 080 #8 0; 0  0  "4< 0 "88 0 04 0BL0S0c00s3Y) 00 S&0B2l 0ĀRX'  c0#2c aq00aLl0S 8!EB C800SS@SP ?R 6 0S   0p W p  0 S,0S ^* n88 0 \p,0S ^:W0[0 p0$0S   0$ p0 0W p  0 S,0S ^b:u 0 \p,0S ^|:W0g000Se 1 R !"* 0   1S 0 S,0S \#= 0 \ ,0S ^* n880 R I00 0\U n8~8 n8w88!da 0SC{[00hg00kI00+ n8V8R n8N8z E8 000C 0 }0 0^a , 0R  S $0QPS 000 0 0  0#4 0 0#8 0 0   R  0S[   0 0S  0  0#4 0,0S6 E0 0  0   0   0  R 0 0S!0 00 q00L0D 00pCL   BD8 8RʟR0<`<B -LP@P$`V q@0 T00?Uʄp吐"!B 0h 0 P  0 T h 0 @ |P p< -`tL\EPPUl8 H 0XT 1#D04 H00 @ H0D 0`p0Xd0x` 0\*,0lpA?C0ChQ 0BSP``0Sxlp\`0 SdTTT4aLD4A  !t@(4, 0! 0A9!0P933;ӗӅ@! 0@D00tx0l#3LPlptxpTlp:8 H 0XT 1#D04 H00 @ H0D 0lpxLQx0NUp0`0hlp= tBPPX_tPUZB UPh0S 28l  @RP 0C!@ 909hP\l P80 `Z00b l0\00 RtZ\ R80 b0N l0\00 Rh0S( ||18  0@R0`1  @9H!0900CQ lptp@ lpt0Slpt0 @hl0t \l P80 `0 l0\0R0 R S xp00c Sx0`0 lpQ`Z<<  -LPptDQQl8 H 0XT 1#D04 H00 @ H0D 0pWl` ,0l`A?C0CgQ 0BSl```\spDCD3a83L  !3, 0! 0A9!P0922;ӗӅ! 0002 t`0 BQl\t\PZ0L`0l08 `l` 0HX T2#D04 H00@  H0&D0 ` p BR` l``l`^j \ R80 b05 l0\00 RYxx1 8 0@0`1  @9H!090tl` 0CA`Rtl`l`8 `0`0l` H0XT 1#0H0tQX Q!\l P80 `X00l0\00 R XR5Q3l``-X<<  p- 0!PCUQL@`tP7l0\0 Stl0 P0`Qt08000 al0l0\0B0 R l \,0 aA?C0CR:Q800l0\0+0 RpOt0p03VQS \l P80 `V00hl0\0 0 RVpVp 01P? "# $P 00S P0S p-PPLp$`V (0S ,0S 0@0 @0@040  0R b R0q0*0R0,  @8(@+L0D, 00 < @CL   BD`21C 0 0|` H@l@\@t@x h@p < -L M P\p` (K0@R1S  P(0 S0082(0,0S,2,0qV`f, V , `F, 0HSUV00V0S Y00é?Z00ê?40 0[-(V `@P@ 0Πh10 €0 $@B, 0A 4 TP 0`,40Xp00 L00(8, 0(@L 0(0#`D 0 (80!S  @0S D0S P 0`\ 00$P儐删(Ko404 00 0H_,)4)4`< -LM@ 0 0=KT>0``<  0ố 0Q09  d0xQxA H0LQ40 , ,0 0 | \0p@-P0P ;L0`&N,;<0 @P` B[$0K8;`p@LiLiMiG-X1p0\;^M0100110\[`1@ 0T'+ 0 P\[3P`1!0 \[\1!@0T:`P@0 R P0`T 0\+Ѝ0<0 R0 P\[PXA-\p10  W@? `P! 0 00P`  ^`  P0EW#10\^ \^ V P! 000< 000 \( +-Ӳ0Ѳ000²0Ѳ0| G- M0@SR 0 0`1V0ಐ Z > VEP 008#88#800 "$ 0 c\ 0C0PU0:0. \e0nPLuʰ 0PU00*Y   Z  0000C^ Zh \$ 10. ⨄pP0gUڔ058#88#800 "$ 0 c\ 0C00`F,4 pP0gUu $058#88#800 "$ 0 c\ 0C00sPUNڐF058#88#80 0 0"$ 0a PA~ VA$3pP0gU+= 0%r0P UF058#88#80 0 0"$ 0a P AM ЍTF0 5 0C4Ÿ82 % 2pP0gU/2 %qP UB F058#88#80 0 0"$ 0a P A T0 5 0A4D!058#88#800 "$ 0 c\ 0C0p0P Uʸ F0 5 0+-058#88#800 "$ 0 c\ 0C04p0P USF0 5 0 0@-0@P 0CU0 0 ! 9090 0@S0p p 0<010)EQ )<0803ӗӅ1(0  << G-4@ MP '!0t`P0fUڜ058#88#800 "$ 0 c\ 0C00,4 Q*04 0CⲐ Yp 3+ 0̣` P0fUڸ058#88#800 "$ 0 c\ 0C0 0\3QU" 8#88#800 0"$ (0a"(R#A IX223pӗqӅ!0` P0fU}t058#88#800 "$ 0 c\ 0C0 0$2QUq 2  e^`a`0>8#88#800 0"$ (0a"(R#At1  QN:0TkpP0gUF<058#88#800 "$ 0 c\ 0C00 0 Ѝ0 5 0S00 5 00x0 5 0X 0 >0< 0 >0Z 0 5 0<<<<|<< -LDMh 0& p`W6@d <d @0 SU 0 5 d  \ˁ\@ 0S0#d0Yd1!0Lşd \ @ ,5 B,UX 00b0 0S0d0h 00?@T  @TQ=0! ğ`K 10\ B ` Xğ` 0Q0CC!10 \K \  000@  0S 8#8  2 P 0 0 `{3p Rʠ`   B10 \ h pP T  X 0\0 \3 \㳐43 ! \ಐ0PU1> 0 L` A010 W`` 0 P0S0\0Yil 0Tl X0@pװ 0#!T R 00" PU`QO G@2 R 0> 0 0 Q0CRA 00 B 000`0 0C BS`0 W> 00L0 # L R 1> 00P!Q@@PE 0Sc0 N!! p^L Y BL pI H K 008#\d0S P@ 0^ `(K 0S08#x 0 ` 0R(K0 rC dPU@(KP=TX< 0@-P@0S S t0 0"$0C0 0< 0 #40  0 -bLP@ Uzژ058#88#800 0"$ 0a\à A882(RpgPPŸ+0Რ08#88#800 "$ 0 cZ"0C0 0!a0P 00eS' U:x0 %`Q XLL0>8#88#800 "$ 0 cZ"0C0 0a0  ;㳠 0 0 0 % 058#88#800 0"$ @P0a\à AX 0 >0<@-0@0Sڀ  0#4 0 L L000S00 0 0000 -@L@ ^pP`A 0>8#88#800 0"$ 8 a#8S2 A00  8#, #808#< U0 0 \  0 >0 -LM`pPP00 @2RU+t&(+oԅ@010> 0 R@DT0ş  5 0 ^ !0S  W R0QS38#88#800 0"$  8 a#8S2 A0,S@ T J048#88#80 0 0"$ 0a P AZ㠂P 30 10> 0 ("(("(  0#40 P0b\à B U  Bp P0 10> 0P U ,0P&M C@   00i00S(K00X048#88#80 0 0"$ 0a P A00058#88#80 0 0"$ 0a P A tJ0 4 0gT0H . @4A0 5 0 Q<<<0 ## p-L@MXPKX T0 H `l @0D ( 0 , @P KpP@ BT@D@00;@T> -LMO- Y I* Xb$\(  O-`Q* @@ P@ @Pp$DL%T\ @pP$HH @ PpD%\TP ` RPbin4_cksum: out of mbufs p pgQMW@PФP``$($,Q@Qx       x         @Q@ Q x        Q0@cA@0  0  0  Q@A 0Q@Х@PP484<  Q-L \> p-LM0PK  % @`P  0xHP4 0- L@Px 0h袾-?tP4F -0L,p3000 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 2 R 2 R 2 R  2P00 R@A0P0A Rbs_notimpl_%s: args at %p-(O k@mmap@r_1@r_2@r_4@r_8@w_1@w_2@w_4@w_8@rm_1@rm_2@rm_4@rm_8@wm_1@wm_2@wm_4@wm_8@rr_1@rr_2@rr_4@rr_8@wr_1@wr_2@wr_4@wr_8@sm_1@sm_2@sm_4@sm_8@sr_1@sr_2@sr_4@sr_8@|c_1@yc_2@vc_4@sc_8 -p@`@PL L8P$1( <0D $00H@!0C00wwww 0-0 hA  $0|  LPU0h#0  !$ $ !8P 0Pj9m 1PP0OxPa2 7@0@!t1*4 t t!40L0C0$KoDmo0^ 00\R 00$0(000 S-LP`% S S 1!p $pU4W @ PH `@H `@P h`bbp@ PH `Z* ` Pj $@L doo*"*0L,  080< P @,T> 0\:00Q^ (KP 00b, :#: :cS1!\, ,8  000`Q!0S P 0pW@21C0,0,0X ` 21C0 0@T\ 8,0 0 S0@ p 0 , KT p 8("(8Q, "*46*, (00S 0p o  -L$M$( 8 R`4 080 0 VR"PpPP%4V@1,K080K  `V 00pR00SP 00 4 $00( 0(K -LM`$(p Q,0W80,  PP p 3U00S 0S  @,K(K QR , 0 00$( p0$K -LM\@P$(`3*KpȌ$  K$K pP$0 0 $P(0`p.  0 X<< -L? -L>0^0P0@ +P* 0Y`p@00T*U U  0P J0SjZE Z p(o p<< 00 0 bR !. .0  00 >00 >a 0Q00> 000 -LM4 8 @<0  8 080S 0 Q 8Qꨂ44443p(K 80< R,` T: `@aQ40pPW ^ U:>0 >0 S00P`8< 0pdWp! <00S<0 @8<0\,` pT: @gpW PV:`e PU4 00Y00   ^e Q:>0 >0 S00`8<pd Wp!0fWp!U <00S<0 w @`8<0P,`k `gpWPU@ePU4 00Y,0  Y Q:>0 >0 S00`8<pf Wp!0dWp! <00S<0 2 `@ tt 0;c0 0 5, 0 / 00$*!00|P@pp0 R8P\ L0R  K< hp80 o00 `+.  0;>0 0p0 Rt 00PxP\ P0R  K@Q hp 00PxAK0@A P0PA 0`0` 0 0 0 0 0 0 0 0 @P`0?00?0 p4oHo oXoo o`olooo8o\o$oP40>0S00 q <>D 0+ 00)@ 03@pŸ0SxD &D JZS D0 @46ZS#PP @): RdP 8#8ZS#=)6?>14@D0 `p `V@# WU>000 p"Q0S P\ 1R , K, h`pV@D0J8ZD0 0(K)68; D #;1 4Q@p(0SD *JD P0\ 0R , K, hpnP\ 0R , K, hp\0\ 0 <0 P04 080 2 < 40oo4o$*(":X1 0"P- 2C 0S0$ *"%0L000Ppp0S P\ 0R , K, hp<   @< >80< S @@0(@ P@/(K4+ :#5p\8 Q8>0( &#&R+:0R(*0a"!B10b @PP 0T0U 0 D00D0  )G#&R:0R: 0a"!B10b @PP 0T0UD00D0  D1p81 R $1P1\ 1R , K, 0h0p 0h0$  0S@ 0p0` Rl0(`0P\ @0R , K0, hp(o *t00t!t t1 $ 0R10L o軳1S 0S 0S  R0000 0   0 0 0h@00#! 0dP0  00#!00$00o,o0oDmdoowm{m0S< (#&R:0R*0a"!B10b< R$ D0< 7\ 0  \~ @ @p%R5 SH0SL  0R01X'0QUD0`0óD0`D0`] P` < 0@V 6 Z0 0 4 R000$ $004Sc V 6 R 0R 008 00S o<QN %RD5S<SH0S6L R0R01&0AT/ 5V2  <<<D0`00D08VI  @ @D0`00D0W@d <D0^ @[<0L < 5< D0`L Rgg5S[[4q 0S  l 0Si  4La0S 48  @ @pd008 d0TDp0S44 Zi 0f *:$  0SpZ p0CSS P\ 3R , K, hp?0SA t3(<WL0P00 0P V <3 Z(30 0 \ P @ @p%R55SSH0SL L R0R01"0ATD0`0óD0D0` `"Vv  @ @D0`00D0 P`40 0Sp  0S r 1L厰<<D0`0D09@ 厮@Pp P ] !V*   %8P\ h1R 8, K4&8, hp8 <0< @p 0PSt `r40o Wm 0Pg 0S^ 0XX  @ @ h0HK 0S D0X ,0H0P0o(oo@o=0odo!00Pp0eS P\5\, K , hp@T0D6P0D4@G@5p:#:S/,5,%$PQ,K<P} '*(":10"P 2C 0S0 ,00*"%0㔤0@p0pTS*㺮hP :*#:"*S6*H4H$$@Q  0P? 8000 %*(":10"P 2C 0S0 000*"%0㔣0@p0pS*zXd#0@Pp9X< PX43<#$Q,KP p2 0<P 8, <!*(":10,\"s 2C 0S0j <:#5  X040 p0S]*<,p0S <P\ 2R <, K<,*hp  8 21C <0f0000 ;+ 0 0P 80,0 0KHPKpP\ 1R 0 K0 hp 4P0\ 0R 40 K|40 p0hdp*P\ H0R , K(d, hp%oH,?T,?@B+?,?,?+?$,?0,?+? 0-LM0PS K@P K0S@00p @  0@@~p@g00^0H PU@`D@ $@K(0  $ 40MZUzj KMiod,? -`1LM0800 0(0K pP (KKpP@0(4 P 4 Kp0p , 0 8pP0@@ 0_  Kp0 8pP0 00GHg 0-LM   $ h(0 @!P + 0.@ 0@!.@ @1:40d  4P@1L@E@0@!L $Q( 0800` E`0$0004 K0t,o4A- QQQQQQQQ RA- 0@P`pQQQQ R@-M Ѝ@-MЍ! !P: ZŒŒ#! !P: `B!,aB 0>ZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0 p@-@P`R p0-@P0R0-@P \, 0L 0l4 @P0R0-@P \4, 0L 0lRQ@P0QP: p-QLM@P` S 0V pxpS`@rP`&0-@P0R0-@P \, 0L 0l4 @P0R0-@P \4, 0L 0l51@P0 p-QL M@P`S K 0V Kp  Kp K@rPp`(Ƞ 8!"(,Ƞp@- @PpS`b `c0#3 Q. a l^#(8.(030# 80 (3#0"P@p.8BA Q ! C2Q -L@P-S'pU#`S PW0#03d g0U f  e00#2 S06"l P@X t@P` r0(@pP@-` a@ \B@-@0@-@QP a0 120^0 0100 -L\M@P`p d5`^0p(KS P  0W p#83K8#8ẃ[0 X$,8`K("X&3KK0<AZ0@L0"[[[2[x h[[$[3[xh\Nip@-c@bP`T !L2pQ:P: -LMz -L MKrK K0-@"P#040 $ R ((0"4Sli40 $ R ((0"4Sli 0li 0  ķ̖m -l LM0S 00L_H0H@ @@@0P ,0 $({m=mimipi  Al,? P0-L 1R 1 0xA00hQ 0M0T!S S00S@ 0S S00SQ00 R R 0 -R R0Q @a0AS5d555d5d5d5d5d5d5d5d5d5d5d5d5d5d55X٫ 0Q00@ @ + DSBO̖momimi,? -LMaPvB嵫, K00Kt;宫0匧,`.VtǟtP@fhhwhǟ$F@`XǟX 0E`PD呫$0 40b#6`P0X6 @T:00C)0`0*V0c140 ! I@9#9S &@0^:6BAD@L*T0 1`0b*V0PXw I$ITsş0 C\em:00C *0Х0 C\U\:0弥0C05 *㾥şl 0B10a\0TD:0 0C0T5*㧥@ş 0B1\0a0-:0 0C04*㐥ğ 0B1\0a0:0 0C04*yğX 0B1\l0a0:0 0C0L4*b8ğ 0B10a^0:4L*L#{SA Et2T PC  jZ @C0PßS@ ^xN@PƠ`@&L0@?  0e@5Ÿ: @.: @': @ ": @4 9@HB{o  @P: T,2 #<2 0H0>0>0 a"&1 p!A  $ T1!18@48!818 414!01 q !0 34 "0 00 P<t (K嘪喪唪,?pi,?oo omioxo,?ooloooooo|oo@oA?o+ o 0o=MiPmi .?mi-? -L(匊 0 h<?Ni -LM0$PK@%@(@@0  p'P@ W ,0;,0?1  $K(PT,0K` 05, A$,t0x@,0K40 0@ (P, ,090,04P $@P04K@$0D0e/, ,, ,090,0 @8m -LMPp:@P 0  ({0@ `p廓@P V ,0;,0$0   @8m -0L -0L000   p-0@`L P`@pxD50@- @$T P@  @ 00 0 00bS- 0 $400`S - L  @$B (0  -0L00p p-LM@P]0U` U U x1 x0 03R0S48 L#ȠRD,5,,5D,5D,5+5 MP pP) @P <1Q Q 0RS 0R S ע 0 啧0 厧 0 冧 0 倧 x@0@0 uP0 c0\ k 0L e 08 _,{m<=|=L.?.?$.?|.?.?.?.?.?/?/? -LM80,$ Q0 倧0/?8/? p-00P@LqT0`  0 lp0D0S 3S@p 0^5X20940386<5 0 \1PX!X E70S9088;<: 01@IP&>Q @?P ph$ 0ph20 @  xph20,X L20,H/?dd>0?/?>D>0?p0?x/?/?-?X0?D0?,0?/?/?/? -0L0S S S@ 0TLH @DsP 41CcJ<m0? 0-00L0p0C0SPࠃ @^   0.020 ^t05t050515D15h15151505/5/5050505 0$ R0@$0 @@@@X 0SC <0= P$RFD1R;B0CS0h<0= $R2 1R:BSV@< =04R SV@@ *<0= $R@@< =04)0"0Q] 0@PP7 04SP1Z00j 00S= ;<00S9  R00 0S 0 480 00S$ 08 <04@P(K  0P#PP"#P0 SP R00 0S 0 480 00S 0 480@Pp= N -LM0*S$ SD AS S08 <04@  (0, $  S (S S |08 <04@ 0$ $K0 480 @ P``0S<0S P` 0@,P (` ,H`P,0Kp0@PD0` p0@ L#D <P`0@(!(D#Lp4  0  8 <040P1? -LPp`@P P 000$ 0"U0P  0Pg -0LS@`LPP `G ^00 R00 @ ` 00  0#40   0 0`P=00;000` P`70:0 0p0 pN00( R00 R 0(P"0 00 0 000000C2Cp HP 0 0  V`P ` -0LSPpF 0SpB `P p=  S00 P600;000p PpP0:0 00 @ @[@B Z (0SO5P5TO5TO5O5(P5O50[0 R 06P  P p 0 00[0$ 00b $0[ |庞 Y (00[0 Y (00[00[0 pPIp? 0-Ld\P P1\ H1\00 0`Q! 0$ :P 0ă \ #\ @ 0S@ S Q PT $xhTP P p=4ni -LM0R pO , 4 P`,  VP- 0`S0S8 P 4 P0 0  84000P 0R ,P ,(K Q-L? -LM<0p @R= 9`R PßP Z`KD PK9@KL \  0P@咛2 p 卛"20 僛x@T ^ 0S[ 0CS2^5^5^5^5]5Rl20  Rt20 XvT_5\_5d_5_5_5$_5,_54_5<_5D_5 _5 _5 _5L_5l_5 _5 _5 _5 _5 _5 _5 _5 _5 _5 _5 _5 _5 _5 _5 _5 _5t_5Fx 0. 0SP U0S 6x 0PS@ QQ 0A0_S2l&x P0@S(K>0D!0<4ܛ0ڛ0SP x0P @Rx x x x x 꼠F긠D괠B갠@ꬠ>ꨠ<ꤠ:ꠠ8꜠6꘠4ꔠ2ꐠ0ꌠ.圛dd> ??t>x????????\?d?p?Ћ?? Q-L@? -LMp`P`' kCPP` 0ٓ@00@0@T4| (0|`庠p000 0S P W`` C(K0S 2W02 : {@P 3  <`: ៓:,V W`2 |000 Q <0 @R zR{ R   pwp30@P0S8p 2  xQ xP Q R 0S ! 0,K >0"0Q`C 202202  202,04@KS!2(022003 S2ձ02ű0 4P zpPY 80S 2 81 -+ 1Rz`2 `   bB}X1 -[`Rp0Sl$ BP 1!-2:2@2<2  P 0S:㴔P 000   뼠 :hx劙xP6 40 RdⱒP_< : 㝒P` W/54nix=p=R5`5(5(5>0@-@QP0 2T?\0S 0R00@ -QLp`@0P02^-?\0S' 0R$$@P! 2`U,w`P2 00 0SxP A` A -PQL`0p$2U!2S 0S @ P 0@ P00P00S 0S  -0`L2SpPP@ P00"P00S@PR@-qr@ \^  @@Z@ -L M P`0p7P  P 2 L 0S@ 0S P@(K>0 !0Q㒓P 0 0P)08 <041S,0  p @,0@S 0pS Z I >  p=4ni' p-0PL2`S@2@Spq00r S\ o80Q 0Q   0CQ 0-LP@ 0h -L@P T, hu0  !  !u -00 LQP`p p@ 000P @pR -3LSP`p p@ 3P@pS0@-qr@P\^  0@00@0@0 p-0LM` Q08`000 2S020 23 0S0 0s03S0 @00hd@040TP HYxh4T00$PNNi4ni?-?pj5??̌? -RL(M000 `  L0 \FpP  !PP D# 000 p 0@T08 <0$@ Y0H D0  08 <040֑>0"0H@Qt0@uL  R  pPm  PPe 42 0a0 p 0 @ @ @P P\s0@,0  Y0 040  8 0<0 P 0 8 <040P 刑 0@,H, P`0@D00P `  p4 0@ P#D p<P80` !(< 0@p#L4P` P`  R@0s PH K `P`(KY0P`0P`9P`3P`- Np= 0-0@0@PK@2L  0 0 S :;;S 0S (0@0@0@0cS -L@` 4PP p# @P p 0 0p00 R0 P0  !40 00pW00  ϐ0u -L`Pp@P P 0000P0 P0VB000%$00@0P0p P 0-L@P P }>0P0 0-PL@P P  00}.A0 P0Pl0 -LpP`@P P P 00 00G0P0p`0000xPJ N -Lpn`P @  0L 0'̠''D;0(T @0pPU@'@  p-L`PK@P P  0, 0f0C P0`:P p@ 0"200 0p0C0Ss0S 0@ <0= $$R 0A0 0; -pL@` +PP p @P p  0 0_0C p P0  0#$ 0 pW 4̏ 0$ R p00u -L@` PP p# @P p" 0 000 R0 P0  0#$ 0 pW 0 $ BQ p㆏0u -pL@` 㸏PP p @P p  0| 0_0C p P0  03 0 "4 0ypKW V+0u -@Lp ハP @2 ^PP @) p$00 0` S$y5 z5xz5z58{5y5y5{5\|5|5|5l}5[ 0  00 ;05@T0#30@@\0 @00 30 0  Bk0 @:0@T00 [0 0030 0 + @T G[0 0030 0 + @T / @\0 @00 30 0  B 0 @:0@T0000[00 0""Ġ " 030 0 + @wTr03 0 "#  0 #200b[0 0030 0 + @TTO000K[00 \0#? 0o@A= [0 00 ;0`@2T-0#30 !  000  00\00    0 :0=@ 0u -L@PT S`P e .@P \ T0 0x10 R0 `0  !40 00XDP@hpW0T00 T"" 0T00 T"" 0T00 T""  0T200 T  0T#20 TT T(0T, $ 0T T T8 T<040 TTT(0T, $ 0T@3T 0PT㬍0u0S55555 -Lp P`@P P l 00 P ` C0W0000&4 0`Pa p-ML@`0 PPP0\3 : c 0PKp -L M`S@P VP K wp PP% T%J 0S0a0a010 @ B Q0B RJ 0 @P P0D@T ;J -LMPp@`$@ 1P   $0K `@@@@P $Q 00  00  Ԍ K -L MP $ 2pL@1`P @+ (K $0K@@@ p@P$ R@ 00$000$ 0S (0S T0 @㒌 K0 @ N -L,M@`,@ p᷌PP @I ,KN 0@@@@ p@P7,\: 4 0 < 8  0K@@@ p@P, R" 00 0<0 ,  08,0 040  ,0 0Q t 0 @,(K@%(0 @ N -L M@`,@ pGPP @( 0K ,0K@@@ p'@P,0S@ ,0 ,   ,0 0 R T0 G@݋(K0 V@ N -`LepP/ d0( 008,d 0@40" P T  00 @00 '7<9r ֋@ $P0 0bQ 00  0  1R0{v'88# '40$ 80 i  㷋00܏?>WEV5? 0-@L!88#P!Xs@P 0 4( 40bS40 000hm0Lni -LM  0:Ԉ55 -LM) 0:Ԉ55 p-0( LP,@l` R5(5050555(50505Ċ5 0S0C 0, 4+0<0, 8, $)a0v^$@#ph)p0 0 00Cs 0 ph40, $)a0vi0K<0phdh0<0$ 48 P<$0480 -L$M 4 ,000 0@P^4@2] 0, NPS 0 t@(0D $@0 0D@04 020@iP@@p0D64D2,  Py6 0W*(( (h(%D P`@ W :;0@!0 D004 ,1 p0,l00v A00 <02 (K (Ko<0 2 0@Q  R0@L0 H@ L@[L0@S<0 8@ T W<@[ 000!!0@0,P 0 C(Ko0uȉ5 p-@L!88#P!q`P 0@ 0<0,04 ;,08 f#@"V phzl0"0<0 pp  CphglpF#@"Lni 8 8-#TL%`|q@P 0@ Ll0pmu h0 @\PqP 0P1S1S0ha0hp= -L0M0P<0 ,0 00 40 80 pPF0F~P Pp`( @@K P 80K @@@PP @0S 0S 202 /  0 + Pp` C~@ 0 0S<0S< 0 Sk d Sh  Se (KP000a~P Pp`<00S S| @3<#0S 0?0S:0 0@ #D<` pP0@ #Hp8!,P`0@0@<P0 P4p`<0  S S%0 48p` 0P - 88@#tLMP'd`P 0@ _P 2 _ P0 hPP p0W Z,p ppS 2WP , 0gdPQ0"42 02 h_0" W-.208#82.]PP W2"02OP 2P02..0 tPtni - 8 8LM#T%hdPp 0@ p 3_ P0" 2 p\  * 0P 20 Rp(PT00` @u(  0 *, 4P,tni -LMpT2pD2@"0 S2<24$S2ס(92ǡ n, 0!0Q000OOq! IX0" Z 2R PE 2=Y@ aN0 00 00`A0@7288L0@K  { %P00S 0h(K0 00   `  < @04ni 5p=-?595P?ud@vd|?? p-2 1C`L P hR0000 0  000 @Tph\o1o p-P@ `L0S R0000 0   phD) 0@p-LP`S555X5X5d5d5\b@ j)P 28 1C0P `0p@@@ꐐ?\o 0-0@LP 0 BPPU@0\o,o{mN  0O   ! -- -o 0-0L00@HP@ A`0S  00h -?5 -0Lzp3 p-LM @0Ps ,`K z00 ,0 02K0@ $0 0 P 0Q`Kpt>5 -LM ("(\`0 ,      0  P(K0S$, @ @DptG T,0Y+ 0S= T  PPp@DtGP0 PPp@ @T :  PPp  0SQ0 PPW  PPp0 PP -LMK@ K0K!(0K@ @rK -LMȠ@ K,(00K @@`K -LMȠ@ 0,(0@OK, 0S  R0o p-0LM K [PQPRPU`0@l0K  0KP PP01K0![04"48#Kpo|m|m 0-0LMK [@Q@R@TpP0\0 0KK @P00K0[K0o|m|m -L$M 5@P`@PXT d0`8T#V00PV00S (KmPjUpa@^@HT~ IV 4pPWZY00 Z8 ,0 pGC@@@HTu J83pP,, W, RZ 0R0ZY40 000 S@ L < 0  0 80S <Q 4 Rk L0S[000Z 0 k PJ4XJ PJ  xWzL R @  x @Tk P d@@HTv@@HTll@@HT@@HTuu0H P4 D  P -081@P' P "80@!0<4 0! R R R`̐P`|Py D H sD00D0 Rm@0j  x @T b PR [ 0@PTP< ?ܐ?Ԑ? 0-$P@LP 0t0|m -L@ 0P? PP-L +P)PpP`@P PP@Vp TWUNPLP @PU@T 0MP?? -܏0L>@0IPPW JaP; Pn P `NAP GP #P AP P HP }U# JxPs -U .U ,0E@Tl@i1 (0E0S-0E0S-U TTxpW ~0S V> P b#P AP.U,U``\ /UZ ,0E@TY.U =9'PF =5'Pf VLU6 .U> =+3P ='4PA T|0,S 0P,o .Ua V/U?P{@ |mw uUP \Pq,0E0Sm?iPHmi ?`P4mc ?P m] ?PWmVPS,0E0Sh|0,SLHPH?P ?P@@l< :?P6GP2@pl. ,JUHU KU,MP MP MP GPlLU MU"P?PkUP P| MP0E0)US+U*UP  L0E0SVH0E0S~+zTkOu\Pq OqPU@mNi kOcP<_ X[1P VETyPPQPL\P HP@D$l>AP*@:@PXj 3P /@ +'{Pl@#P@\P P@pkHW 0(S: H PM "`P00NPP@PV@\PXi~N`P}@PyV@\P$i@wNpPn$@P @lOP% OPuF@qX1Pphs j8P  |8P MP TP TP TP TP TP  8P 7P 7P 7P 7P 7P  7P* 7P2 t7P8 P> PE PL PS PZ Pa 7Pj 6Pu 6P3 P3 @PfA;P@=`9@6T 2@/T!+@(T"$@!TPf H0E0SP Pe00LUP|@xtplhd`4e[LUY?UP ePLU* MUB LUJ!PF@*B P>d9L0EpWl0E0)US@@+U*U T+U*U0P2 W? Pd00P0]P,E4P(&P$XPc,|P@xP tPpPlh d`@c ,0E0S?ViPI ?RlP"NPb?HPb.U,U /U?<P@7b H1P@-|0,Sxb?$ P AB0b |0,S|? Px' ptIPann@ MULUl NUniMULUC NUO@`P ?jPaS=pPpaMMULU6 NU4 8X1PF !P8a C0@St`zbP ?jP`/V@\P`k @L@XP`_H o??P?\???ܑ??T?t??$????1J h-(?4??|?,?$?D? ??̑??? ?ԑ???(????p?,?l?4? PP> @Q10Sa HI10 SFC10S$b >; >820SLb 7?6P0tb0W.$20 S)h20Sb{ ! ! P ! @ bp  20" S bd  P @P cY,C@T -P /P`cIl30 SoPc=43PPc2 P @oPc(?xsP ?trP ?phPd ?k`P ?gbP(d44P-P /P\dh40 SPd P @Pd" P" @Pd|4PwOPdq5PloPef(5PawP@5P1iL +*+ P'j> !rP jl 3@Pjh qP^$jd?P@Hj /@l php|j b yAuBj oj;0P1j7zPj4 P*j0\@3 j*\@z[ k$ 0,0cp|m|m|m -!H L P 4 L P 8 @P < H@@D LPp PP` 0 00 ? p-LM00 KP@4 `0K(0c K"(@P @P 00 sKp004? p-xLP@rs0`00 X04 @0P P0D H0H H08L 8@P`  phd?55H5@5|o 0-LMP@K YdPK0 p-LM@ PK `m P@ 00Kp -LM@0K 0K @GK 0-L@KM000dP0  `0K v0K 08 -LM@0K 0K @K 0-LM0@00 #\ K0PP[h !r 0 008r8\,r008ꘕ?-?? -L mmp3 ? -QLM0P@)0KQ0)0K)4 `()K0"(*Kp 0@` pP &2*[0 Œ4 0("( 0*K`` p00(K Q0 0)0K)0K p-LM00P`V000K0K4 (0K"(@0K @w00[0PKp -LM0@`SP  K0 `K0 P0f"pK0P MP P0 0!Kp PP9P -LM0`004@P%K&KU0L00C0HP%0K%0K4 (0"( p 0 pP P&0[US20T0@808 <040@ D08`(q00$K<6@6<6̕? 0- PL @kP0 = 0- PL0@j(0( 0$0 0P 00 =X66T666 0- PL0@j(0( 0$0 0P 00 =`6(666h60  0-LM@TP(Q*0R840D d00 8 -Lr? -Lr? -Lr@? -L rh? 0-N@0@@P@@eL徱0 0hCo(Gi -LM`\XVU*0Q`Q 0`0 . ~N,1@pd৲PP ? :#: 0T05*JWZ/ 〦Z,K 00KЧP`0`0L00p0 R P\l0 \P *, hJpWZV(K(Gio00>N0@!@`d&PP > 0d 0V05 jVJZ/  Z,K 00KPPp0p0L00p0 R P\0 \h , hpjVJZ0ְ(K 00b 00(GioJ"1d!Z0 !!@160 !! 0 !PU PP 0@  PU0!! & ?o`sZ|0  , !T 160 !$ 00, 1oooo1oloo -X L M0K@K<000S  P kP*i|o? -QLM`pEڌ0SJ 4KP 0 *S  R04` 0p ,0 =8j(K4@K0 , @K31C01@@ 8?>`? 0-L@ `0P?0d0D!s "Q 0 b 0hpooo(1@- @Ơ3 1C 0!02@$!Bb  @130` 0Na3QM0 RT d00 R00C0 R@TЍ&60cQ*d00 R00C0 R00C0 RYѭho -0L6f 0bSQ0@l  0bSp0 VZP帀b00C 0@ c0 ` u0 VJ0L0cR01 S 0 S$0`` 06 06$0`to}mxooo}moo -1LM졟d 1!\03 4K P,0  "!8 4`K04@K0TT f 40SG DD!0 fÁ0`S0c!S 18 0!! A00 V V 0  ~0 06 &06&0C6X 0@ 0@o9p0 (K00SUlm|opm poMbxoA?doi}m}m?hoi("6tooloio06 &0C6 B&0600 0 S  -@LP g -@LP [00 p-LM@P i400  `P  xhh`pl0@0h04 0\040 \0@ 4h0\xhȗ?ܗ? ? -00 LR 0cp3 p-0LM| @0x0D L0p p0P T0h h0@`(PKX \0H`<a@<@00 ( $@ IKp+6+6(6l(6*6)6)6А?(5 -Lh0040 \d -Lh0040 \d -L`{dPPU 004 ,@ 0;P0 410*0`PRhA0S 0P  0 K 0$$L04 P T0*4\@dplpt`0 H`X``h`|`x``` $3 d0l "3*pt`0 L`H`P`T`\X```LgDg< g4g,goo?o oi,?P?x??ؘ? -40LQ 0`p3o 0- @LP P 0  4     4P@0 -RL M@0 , 40 PPEpp W@ 0  P1("(R R ! ` % `Z0  Ph0 P` P  ,4000S(KV 0 p-LM@ `$0KP K0 0K$% P$0 reKp? -L(M` @0  P (0340 5|*0P<0 QWÙ0 ,0 10 40PUO 0@   00 cp08 #0R00 <0 cp, WÙ ,K80  p@ 0<00<0 80\  ,0pd0 40PU< \|30|30 <0\d(K8#8@ 0P 4 ~ 8d|30|3 4 uoiH?@??h?d?l?? p-<0`LP@ ,0 phFoi:6 p-<0`LP@ 0 ph1oi86 p-<0`LP@ 0 phoi96 -L@ `TpP  R T 0TP `0  0 8#8ST Qdoit? -L@ `TpP  R T  0SP `0  0 8#8STdoit? -LM`PV@p  0SPV0Q: 0L0S:1  c0S $K0 @nSPP`0 0 0P  0Hc0 ,c coi?ę??? -L M3#@P `D0@@@S#0 @@@Sq08O0 0 0&30S 0S30S 0S00|3 x0m\0 K|PKhVcDDSc|,Oc,$Kc??oiX868676Ě??,?? 0 000$00 ( ,0>6,>6`>6>6 00 -@0L  b}m? -LM Pp 0 4<L`, L,0K T0(0K$ K$D@$0S 0L< P@((@b KPP ( @ @P 0S P0S 0L<   00L< ?o -0L`PVp# 0S @1@S 0   08P `V\b0P @T 8b4 0$T0 0 ppiL?o̔?(piqi -\0LM 0 K00   00 0 0 s00 0 0sC KpiXA6 -@LWbq Sb萛??00  -$ L@Fb hpBo-?@6 -40LQ 0\p3o0  -Lb묛? -Lb̛? p-LP`?P pN@@N^P@@eᯠ0 ph(Gi -LM`@PN>00~N@1p@d~PP > 0d 0W05JWZ/ XZ,K 00K娘P`0`0L00p0 R P\0 \h , hJpWZ0.(K 00b 00(Gios&W6 -LM0 @ 0 ",0  9ᘀ, (`dp@F Q%00 t0 )X3@S0 1A0 04! Ӹ?/@c,00 (40 A;A0@ 0@ R8T ?< 0 ?8#808#8?@ ?8#808#8?0 ,0  ?8#8 08#8?0 040 100D 0$! D8PPP <6^(K/q(KoG6S 8? -8!L80Pd4qV , @)0C\h 0-<1LS@P<1 0C<1X#J<1SP0 -LBM 14aP80(!01KRhV6V6`W6W6hW6pW6?@X3S(]40, 8)a0Cᱮ<10<1K,Q  GOK8 ?Ah?x??-? p-@P!88#L!A?`P0<0 @30<0,04 ;,08 @J?V ph9i>p 04(P0<0@>#ph9p@#qi 0-L@P4C0C0pP6 Q-L@ Q 818Fj8n`8n818DjD0-n 1$0   'A̖m -LhM0<1t 8t $W 80]408!0 0#  BP]mK@ R P 00 (\  R00,\8Sq8j1S00t [{? 2 @ @@ @@;@ 2n/@H_DCHS%0P[yO0@DPKN fTb  U088#8 ϠD K8 3K%pP (tLI  2 0YC01$K1P0C0C0`|0 0h |`@PpHP`#H8P `DSHc0%hyO`[0@DPK DPK T08 Ƞ,ȠD0KU ?> K80 KoP ti[0   T 08 Ƞ,ȠD0K ?> K80 KoP tP[tL[0 0 p_DCHS%@ P7[aAȞ?О???TU6 ?X???FB ?8 00000S0C00000 000 0003 4 0  <040 0 8#8@08#80 p-L `@PKH3%k0 8#808#800 0 B4 p8ph p-0L @` P 0(0k08#808#80 8 phhK3 -L$M# 200l1 0(K@,0 siPLŸR00 y00! (Ÿ0 !X00 c X0008 < 00i10 > 600F 3@C 8^@4@ 0  @f@SdX@ ,0.iP 00 00! (\ 40S 0  0W<8@00i10 0 >@0400:@e3W3 0004 \XPH}<,(ȯl6?$?4??? ?D?ܠ??? -LMp 200l>@ TP 04 @`=Up20 hP( 00  G0@6 0T R P0000r P 0 TW000tU@ 0@>W0@000]$KP 0  00 00%W000G000>0$ eP` 0 0@  0@$ 000$ bQڰ08\{P000  0 @VWȯl?̡???P?|? 0- L0P@K/0h ȯ p-PL@8`+gP+ 00 00000 0 (0 S0$0@00 @ ,00( 40 ,0, ,00 40e0ppxo6l6^6 -LMP \`Qp @p @T V4 0`D @+V}QT(  !Vqiqidd> >$?? - 0L00S@ 00S00 00Sh0 0  -L M<`Kp@ PtO0<0K0 60K@?4 K7@KSK00 5 KjP3[8#8 K -L M@pK0@ `NO0  @ 09 K!@0K080K4  QPP 0l3K0P ,` [jP@ P K ^0@0K18 K40 9 K3[8#8} P O09 S" 6 04"40(Q(A 04"40Q. 04"40PP3(( SS{P 'NEFX -LP@pA@`  0S ,/c%@ -0LSP@(`p0\! 0>W"`P 0 S0%Ll2@l 0 0!rT@2 !  10`00S0 W00P0S@T R@@1 `@#`? -@ LP  0 0 - 0LS@ 00 0  000000$ 00sS 0S 0  $ (~m ~mQ - Ll0p0X00 SX0S -0@L0X@ -@0L R 000S 0S  0 ~m$~m(~m -,L\ \  ~m(~m 0-0 @@ @ @ @RLP t0S pl 0t@0R Q0 0#0@00 SQ00  0000 00 S (0"( R-L 0R 0CR h :h 9h : -LM`0 QPk U Rd0Ra0 0@ QP  00KPPP0; S Q Q Q K0<00 PUQ W \P\ 0l@L00Tq @PP ;(; S"  0 @0E8 U:S00P 2UP 30E8S0E8#X8UP 00Q108#XQ0 *@K  O ;q 0 9a0 0[0 0U0 0O0 0I0 0C0 0=0 @070 010 <+  0pC p>0Sa00 RLP hWD0W@ ; 80Q= 0Q1<  p-0LM R3 00S 0S, @P`0S0C00  0AoQ*0 R>;  S0S0C00K K 4 0 Kp ~m$~mXri~m(~mPH 0P 0Q \0SX0S  qi-00 Ƞ Ƞ,1XP qi -LHM\@`  #(4\ :40S P 4\! 63\k D3\ 3\ p  0lP3\ 3\ 3\ |3\@< Sh$0< S<1S7\P P,3\= 2\ 0\o 3\PIP2\ 0\z 2\2\ 2\J 2\|0P       00  0P0 0 0 0p  0lP  000p!0 tPPC  `m 0R 1  iiuGPP@[0P     00 Nh P$010H  0P0  =p | |PPz . 8 Jh$vh 0XPPh1W W WW @W W@WWW@ W @4riW WW$ri -LM\ 0\ 0\ XP, ,1 P0\ 0p XQ 00S00XP ,1 r 0, Q}f~fvt|f 0-LMP@@0@0CS088@- @.@qi -h0L Ƞ Ƞ,A0S 0400c00CS0qi 0-0 (("ALXPU 0 X0 \0S 0 0 PP Pqi ? Q-LP0? - (L(" PP#0AT PP 0SP \0SX`VP 4pi0H0PP X`RPqi p-X@LT` 0 ! PaU  " 10`"P^0S0Sp0, ph, phP00"0S ; SP 00S!= -L@Q 46L6t666000000<000000000000000000 -<00000@ L! pW`V 0S \ R P0 U*\ hui-00 Ƞ Ƞ,1XP ui-00 Ƞ Ƞ,1XP ui 0-D0 (("ALXPU 30X00ui -qL0PS0AT%  ̠@0`LP% V !0E T1 0T0V@  pDs@P ,0 A$KK@uiuiX>?? -L@P \0SX0S T Q0Q \0Sh -P`LMUp:@3U&4 03U' 2$3U= 0U 0CU X0S$ l@T `0 0 `@P`TV 2U 2UXP ,1 P P2U %0CU0S| S[ XQ 00S00lP `P 00 R 0R1U 1UlP \ 00  00`PXPU T`/",000bS XP ,1 r 0, ^m+ 2  @0V@@0@X0S0Sum0, 00aWbWvt}f`WcW@- @.@ui  - L@pPP 0S \0SX`V 4@0H0H 88 #Q 01S 00="Rui p-<2LS 00pdBP `G0S ph.000 0@@0 -LP 0@R 01S 0 10<P  ui 0-Lx 0@R01S 0 10<P  i PP  fC 0h0uiD 0R0!R00 10<P ui Q-LIĤ? 0-0L@050PS * R% 000 00S0 S 00S0 0hr R <0 R 0  0 ooo 0-0LS@00PS 0  0S0hAФ? 0-L@P0h p-L`P@T" @T" R0000 0      0P0S0O@T0  PT~moؤ? p-L`P@T @T' R0000 0 00006P 00S0@T mP(@T0   P~moo? p-L@P P 0S pO0`  R l05*  @@ 00P0R 4ph$R00oP~mT~moo0QD@2P 00 0-@0P@2L0@20 =R00800P8008P0 0-0 L80PS \ 0CQ 0 dP 0 0d20 0 @~uiT~mP~m -L M0P=2S @2* `2ST1 R8Ph$K0K0`Kl0(t `VpQ:J0P18T?D3cQa 0P@2 0=2@P V 0@00 @20@20 @2 `2S \&0 @20@28 T0, 0S0C00=@`p oMb -LlM0ğ @.`0 =rW@ 3Q 3Qz 3QH 3Qc @(K3Q 1Q 0B~S1 0< RN L@K3\` `0 XpKTp 00lPK80080 PU 00 00K0 @0^!0 @ 0 K p0 , | xp tp  @a 0B~S1 0< R 2@0 4p q<` 8pK00L@K80081S@ 0B~S1 0<P  @@  @  ZR 0< R Z@P 0@00 0Pd0 `@ 00K l P0 hP T , \ Xp DT0PS0@E 0 8@<#8 P@ 0Z Q T0Sl K8 @U<  7ό@2 0B~S-1 0< R 0@0 4p p<` 8pK00L@K8008n0S @ l K @P0uiUUUUU@|6t66 -HL@ @0P0 000}P GGx6uiؤ?ui`6??? 0-LM@0L04 P P@@ T0S008  K0F00 =2 0S  ,00 S 0C$0!0v03 K$ R PP0S pp<;D00D0$0S0H R0 0P ph9100$0S,0 0S  D0%0 000S <0@  _020Kh02Kb K1K/K,0K+PK0PK.PK-PKP_0[  PPp e 0>P4P L0W 0@@W  lPP @TJ@TZ*KP*0[ 4? -L ! 01 R101 01XQY QP@S G J30+1X P@0Q0U0SU2G? P0U0T R 1\\ T 0\  0S 0 4 \\T 01[O1H 0KhP!  -L^KBM@KPEp `0 0  Po72V@ p = p<0d a72@E0;:PD`d  TdT72@d !2PeP F72@ d2` 0 87$K? ?0?8?T?h?H?,>@-  @ 0 4$(8XX"(#!\ R0S$0\ Q "=XL&= 0-L0P@PT T 000h40h> -00LTpW1 44L \ ` P@ 0`SP 0 0 \P f `8P f ZP f T fP0 0T0 -LMT0p000 P40 @0S/ 0S-+T 0S&`0@C P P0  D;Z P T0S T ` 0S(K P 0h0 0   1 KP5 0  R6T ` 0S rT0S00 0 x ,  760S00, H.600 4(6T ` 0S P 04  <      0 00 00 00 Q00  0`PP  T0St p00 <5`00 (5 b???ȩ?\?? -LLM@P0@ JP5 Q4Q7 0S VpK uT`[P00V00Q [S[Sゐ`sXV85p8P f 9W P f 1f -0T0(K 5 0SVpK  T`[P00VQ [Qゐ  f DP` f 0`pP \` X "2Tp 0P `0S00S 0S$ , KP,P? 00S H>5 (55AtP ,5(5}B<f P8x <, 40 PP  5_fop5WQ00>0S S\f 0IPF V4p ` 0  p@0Sd  }? 0  00>0S0 S !00`00\pppV  P g 0T40 R 0@0|?0?6 ?Ԫ?\??6(??H? -@L0S 0 S 0 Pui0   @   ,D  -t0L \ |0x  -t0L \ |0x  0-t0L@\P 0x|  0 00h p-@0@0LQP`' Q 0CQ Q  t0V  ph0 000000p000ltmt -L~ 00s ^ 0 Q-L@3q 3t?? - p0P0aLV@/ 0P+$0S ( S ( 090S p pt00S | xP l0< 200Sui/i -LM@@Q LDH04  D6P K6 -L M`Pl@1 RR@p 0gP @ vN$KT @P ,@K(K  0 t0\  0x| @(00Cs(0 ,0,0 p( ,33P  *3/i?? -LMR@Pp` 0P [t00t0K@\& T 0K@fh0  c Dt @0t00t0 l0T 20 8H [  0KA/i -LMl!p00Q@U 0P Kt0pa`VMH0S\HP`[P t00t0d0P 0 t0\ 0Kx|` 00 X@T |@\`0  @\=` + \p`0 @ ui86 p-LMt0P`\ x| 0@  0 J@!xxl0 20x/i -LM@l` pPP(K 0VPPt0 \ x|  0 PPf(1@W1 1W1 0CW PP0W& ;1WxP0W! 0W|P00S P0P0P lPP00]P/i]t@yt \tzt  -LMAPTp` 0P P0000 a0P0CS0eui p-0LA`TP 0P Pp000l<0   0P0CS0=ui/i p-0LA`TP 0iP Pp000l<0  0P0CS0ui/i -0L @  0 h4A`/i 0-P@PL@P @@PXP XXPDP <0s HPDDP\P <0Ps`P\\P0 -`@LPp @r0@0XP Xj0X0DP <0s 0H0D0D0\P <0@s`@\\@,0@0CS0 W t0 0B)t0 Or0Q4 0SP-00S PU@ 0@m 0hW lp0p h!t0@0t0nP?GP00PliXiP7/i,o 0- 0LSP@ 00$ 0 (080 T 0<0 4 0L0 P 0d0 h ,0t00 x 0|0,I000 00 000h긫?-?@BX6@6?v -PLt ` p@l0  t0 0t0@ Pt00S x|/i -L|PApT` 0P P000 00P0CS0ui - (L4MLğ(p" aX0 2 PR2<q 8@0P@ }(K4<0l0@ D P0p0T \ h0d\dP@` t00S x|@P>00T@TPLt0pp @   X0P  R? t0 00b 4@̃tKNK,=L ,0 0@ 0TK<L0 0L08L0 0@L06L0 @2@"0 kG 0 K I8SF0tt@"\!1 ťt9H@0;PGT t  t t0S X l(1@PL E>ttx8T X0P@ @s0@0)<0s\\@D0D0Xe @0X0 @0|PD PPH 0rP\ui+h/i/i -PL\`p 0 AT 0PP(0P0000 0P0CS0pui P@ 0 ?S $0R@-@ H@\  *0lO 0$@ D0< 00b0lO 0$@ p- 88 #D$20QL0`mP1020!0D0 1s s p @00S S S`0<0 00S@@0<0@00`p0<0pvi$vi4vivi 0-@@PLz4 R040 0S000h - 88#DL$20Q`0pP020!0D0@P N0  RE` R R ``A` 0S ;`A` @ H0Svi -LM0 KrP  -LMp@0%KZPP T%0[T0P P$K0, KMPP&K, :PP&0[S @D`,0 31"0 0 &[0@ Q   ,dP! &0[PS ,@D` 0 3à1"0  0&[,0@ Qp , -LMR4 pE ,0K @0HS=:0  0$0 80 @T D P `@@`U@1 &@0D 0S@0<0Pd@0U`00080X00 0 4e4 00:(K,0QD @T<0% d 0 H@H0%0 0D7 -RLM@ R R K0K O< @V 00:/0 0 -LpPD`@00@ PhT^ U P00CS0ND3!D@TmOd0QX X0 S 00 S P0 LDliXi 7 -LAMP0@PiTP 20!0D0` L0SQ3 QP $K0pPL 0B^KDT@!PET = D 8#0PP L@ Pb@P OTP TPU@vi - 8L84Mğ#D$"0 R~0QUz 0`PvH 4Q]P040Y 3" 1 D00a 0S^  D 0 X 0SU p1"00W00@ D0` @L 00S5#7(#7"7$"7WD  0$< ; f < @ <@ OS`< <0Ÿ@ @P <f @S(K0 PpWȠH0401L0W  0Pp 0$, }f 0,(,,30n010D D0<@H 0pP44 0` 0 P`0?0PD80 3 0T0J,P8#408!2 \0P  0 0@XL@484 <004 0R00 <f 44 4P^4U 1Q "Q0PP0R@PJ/PU@DZ lvi7D7 -LM0@` 50S QP 0S P1 R  @@L) $K lPA%KPDP ,#%0[S p%0[pS0;P, KP#,&KP&0[S,@ 0&[ 3à1"0  0,0@ ^`Hث?&= -L=4Q *@$?4S0>48$P0R 0>4=4@4?4B4A4D0\0X0 0$0(0,0004080<0@0 0R` Pm p 10W,0  WIT17@1707`17P07p`P@HD@ ,0S 5*0JS(37372727\27@,0`S Z 񟗶<47H47P47X47`47h47p47x47475757(57j!a 0R@S Z 񟗓3783737373737/737373737H@Dt@0,0 10,"A @,10,#RA4>>0 0@4A$A4JL 0RP0 0BL00 h Z(K0P0T4T \04X00=4( Q0=4ȅ0=ȕ\0!L0 0P HL0,$0  h 80P0T0P0TB4W0B4 0$B4S!??Q/$ (0R+10,"( ,#?#B4W0B4 0(,048<@DW 0?$,?R10 ,?$ȕ,0B480 004P ^0W ! 0^P RN \P0M ! 0PF RD \0`0044<40C R<$21C01 dA`@0 0 4Ĉ!l@d <400S<4@ h 04X04\<$21C01 0z10` !10!` n h 0l`\X #`0 p@-0@SP S`1 `#01^0P5@10L\!N 1" 0f0#RppP p-P`L@ @8d0PpD -LhM ` PpK@P <0S SZp0S D0Sl@P$K -LlMp0 t 0  `KP@P @0S<p0St0 SZ80KYZ@Y @(K -LhMp Pp@`KP p0S<0SW,p,4 00*xPcg0P$K - 0Lq 0Q 0`00d 0-LMPP\0@ @X  @ @=X@PK0P' -L M@04 PP@$ X pp 0P" X GJ8@! 0K4 DTGd 0K0/K.K-K+PK)`K,@K*pKP (K / -L M@04 P`P@( Y0 hP'  pP! 0(8@^0K4HdDT 0K X0/K.K-K+PK)`K,@K*KP(K < ]T<7R00R0 Sp-LP@` <0 @ Q``F 0  ph4  -LMR@80 pp 98`0^3K04KFT,KGD4K 1K/PK-@KP2K0`K.pKP00P00S0,0 Y G8 ,(K -L MR4 @p ` ` p j8P!0000K40EFD 0K )@K/K-0K+K.K,PK*`KP @@X (K -h1L MQ@ P1Q& 1CQ K01Q800Q. Q< Q@00 * 4K K0 S;#0 0 Q Q Q@00  D00 8 040P D00 8 04;0PH00 H00 UDUU@ 0-90L4@* 090p PBUpP#TP LTPXP GXP@P B@PPP PPP<P <>X?-?|97?C7? -LP@ P 0S0  P@ P0 ?S $0R p-0 (L("a@0P1s s pD0pP<0@`P00@姳p0pP<0pXvilvi|vi 0-@@PL:p R0p0 0S000h至 -0L Ƞ Ƞ,Q@0`P@ A p@ P0S@hlk-Xvi -LMP0@`pPd1T X1T$ P1T:  0p K1T 1T 1TQx xP 0x00 #xP ,1 Q0$K0-P P @48 0K@0P|0-0|0|00|0}fpUAUvtnU~f 0-LM` @.Q@@0@0CS088Xvi p-LM@0P#PD0`V x L P xL048 `Px 0-\0L Ƞ Ƞ,A0000P0CS000Xvi -LM|0P@p @@K48 0m@0P` $K ``P0S P0)||`0P$V |00|0 ZP pKRP@0T0V0S T@#T@! xG `P >#``t? 0-\0L Ƞ Ƞ,A0000P0CS00:0Xvi 0-H0 (("ALPPGLf xP0Xvi 0- 88 #PL*0AT 0KP P0PPP }GDf |0L0|0xP0Xvi 0-PP@L G|0 l+xP  0hG0|0l+xP0 0-90L@0Q!ڌ 0 S00 S P0 ᲌0@0P0CS0PᏱliXicB80K1 0 !p0@ 0 1SWpp# 0P@Iφ  0 pΆ  0 p Oφ  0 pRφ 0p p(K80S00 1S480K^Eφ0 1 ᆕꨭ? p-L?L`@P€  00@0@p -LM0`S qWDq $ D  H PH!2@  D 0(KP0RFC Q<00D 0W@ !pPA \> R \ 0S0S  QD(K0 0F?C, D \\ P \ 0S 0 S  QD( K00F?CD \ KD1S BT\1S =`DP ]K0 \  D@Tᅯ(KK 'D_W - 1LSPp @`1"  1 S`@ !b1S 2S i/_ Yit 0-a1LS@P \PPP  -0X 0 ĭ?o 0-DPLMXa@ $K 0$ P  \K0vi6 -@Lp`PP DbW30, Xb10Ya1P ?o`[7 0 oQ Q 0S 0-@PL/P h1l!PP @  P@T0B= 0-@PL/P h1l!PP @  P@T0C= -`hl1pPQL @ ,P@T iB= 0X 0-PQL@ p00hpp p-T2@SLPP`0T2S0L P2ph p-LM@0PPD0SKp`KL P 8 40{ -L|M Q@pP` - Q `p 00L 0` KiW@ p-PQL@ 0dP` L`PU php p-1LS@`P 3SL phop 0-@LL90P0 -T3LM<00P40`,K00( K80@( 0,@( 0,D( 0,H2 LRpL 0,@(@ 0 $ @P#h2 R; \2R h0#Q01(BS,05&!P K0 S1At 1S 1 @M0zSp0,$K(p!PA $0> 0?C0C5S50e7e7e7e7e7e70e7e7e7e7e7e7e7e7e7e7e7e7e7e7e7e7e7e7e7e7e7e7e7e7e7e7e7e7e7e7e7e7e7e7e7e7e7e7e7e7e7e7e7e7e7e7e7e7\03 rL03 m<03 h`a7S-?B= 0@S<0S =Q X0S| S~ 004 D0PS4< @0PLX0St 00`@OP`@> VX 0BSSP2 X RW .:R,1T0Y 0BS7477747$7d!`!}@!{T!yP!w0Y0R0Y0N0Y0J0Y0FP< iui|X@Y@\@`@Y0PX0.Bni`ig>0S7=}`0T04> H0P ??t>???XC=?? ?00 01 0@0 T0%(KQ( 0 R* 0Q'0(00 (0SP( P0(0 (Ko,h`0(00(Ko00 0!0(00(0ꄇ7?40S840ń -LM@P4`0(P3 pW00 00 0! T@  0 P0(Ko0+ R  RW\0(0(KogT@$ 0AP(K7? 0-LM4 P0S K00K @Kq P,KR)@K0R L( 0 .rx? p-PL ㆸ@`@ @0%n02408P40012` 902`pL7$7vi p-LM`2 <2PK0@!2 00004  00CS0x,x[5 p-LM`022 < ;PK@ 200004  `00CS0xx[5 0-L(M@03PP=0 KKP4K KK2 K0PKPPKPKPKPKK0 -LM6`pI $K=004K40K3KC0 & K00K.K-K2K1K/K=0P4K4K@D0,K.K-@K3PK2@K1@K0@K/@K[P08 R06=04KP.K\@ 03K-@K2@K1@K0@K/@K@P64K,KP6L -\ LR`p@P<0PS 0\ <0R@ -LM0S  0 Ƞ8,Ƞ#8 P (I= -LMP@` P -d0(K, KpP 4u 08 Ƞ,Ƞ#8 a6 8 2 ,,;0P4帀K\0 2@>K ` Xp PP L H0 d D` 'P6 = [>0[4S\00\0  >0K 0S/̓77777,0[S\0w0\0@PtpK [10ERt0 T  !B200 p0 l p0 l !1\ <R@Pʃ1T0 P0p0 tP lP 0S;p@0@S,fP  0S00S0@pSWXtK 0< \0 S0 00 I0T0 0T0 0T0 0T0 p 0l \ T ,S+Sj(??(I=wi8??66t>???x??`?@-@0 , 00\#^? 0-@LPu20" 0 0-PLjP 2S BT !x0@Tru0 0-LM@ ?P  P K0 <P  A  \? @PP  T* ̠$(342. P0$??47 ?T7 -2AML@`3Pp0 :S 0#C403O``  P  4 KD30D3'7@? 0-PL@P%3S" 61S %kP8  P 6;601S kLP .6 ;&600  BQr0C 00S: BQ  10R`!d!  10C10 -@PL uP h^ p-L@hP_ Ⱐ`t3S 2 20S 1 S#9php0z -PL`p>@P ⇠9W;I9 WW" 0 0@0@ h* W iş0 0@0@ t: p1S0@i賟^X? p-LMP0 0@0@`X A0 K@U 1SኟKpq> -L`PP 9@ U UUpp4#R 00@`0@ 00@0@X30X39PUhXCX 0 Xst? 0-3P@SL SS #P 0P 070 -@RLp` D ; 0 0P7 P:PPPt 7; .:1 h 97; 00ꔲ? -LM`pPLP 9@ U UU(KT30T3P(Ua ̠A0L  @E 00KP 00 k00S0 0@0@TC 0 T+KA O)0[PU)PK00 0C00 0 00 0@00@54  [7P |P  f  Z4}'0 0@0@T7IJ? 0-@PL 0S2 47P $3S EP$ RP( 070 -LM0S  0 Ƞ8,Ƞ#8G P I= -@L:ʴP30CSP3hEP3 0:P3头 -L M@p`rP K@0F@*0K>0CGT*K" K)K(@K'K%PK$0K#K"@K!K&pK.P -L M`@KpP K@0ND)0K?0CHT)K! K(K&@K$PK#0K"pK!K'K%K P -@L {  h p-L M@`PP Kp?0F"0KB0"K K!KK0KPK PKPK`KP [0[ p-L M0P`0K@P Kp?0F!0KA0!K K KK0K@K@K@K`KP[ 0-LP z@@T T ?  ~$ f& ~b? (0h>~ V '? 0-9P=@L9 YC ?P /P5RP &P203P P03,P 70,3$P -0$3P 703P !03030 4\  V  P 8??? p-2LP%GDゝ9`@O qk00S 0@5P30CSP3pxl -L`   9 8#8  )2S<9 9  h@@ TP pp>QP@@0$oW -LP@P po @WT7P" 7P$  D =p2S 9@0;90ho@h&,h P hX?t? -`LP@peP@ 㬜01T 0CT!  00@4T& 0T 0T0/@ @ %@608#8@6 0 R @6@@@ y@Y@0.@Pi 5i 6i( -@LpP` & % (@@T ( T hYꐳ? -LP@`pP U %~@ (z@@T ( T &@,H$ꐳ? 0-@L. T20S7  I26S$  > 7PP? 0 08#8 0hgu m  0- L P # @@T #U T !0h*Pꨳ? p-L`@PP@4U0@p -LMP`pR Y@P , K2"t3#|CCCC:xcc哰$ K@P4 08 Ƞ,Ƞ#8G `$?!^0C p/pr0PS00S"0@S$fPf   0P" P"2SP 2SM 2SJ *@K}P H 414!9!,1,!|1!0` h1!2 1_0p@"2 A 0r 0Lo"R   +]|Y lT"0b"zij?77?I=?X?7|777x7ث7777@??2S -@PL OP h8 -2 @SL# # P P 7 -3 @SL#$# P P 7 0-L4@P ; 41P ; 0020[4@ -d2L(Md777777Լ77T7?`d?L?X?? -@PL 堸P h艵 -2 @SL# # P *P D7 -3 @SL#$# P P )7 0-L-@P ; -1P ; 00Y*0,@ -L,MPp`@=0P< 9@ T TT(K:⵹PT  0Ÿ  4˺ ,0K@x, R 0 0@0@0Rj!88#Ƞ Rp:8#8S80 @ 0@ 0 0@0@8 0B8#880 00000 41 00S[0SX@00 `&899V40 aP 040@C 0D0  < F2 08RR#8202 @|P  'D <>gc; Y0 0@0@dO8H~80@  B8q7?l??? -LMP  0 Ƞ8,Ƞ#8 PP `L= -LFP hϒ p-PL9`=9iP Ӹ垹P6bP ʸ啹P402P 勹P02P u+03P Ѹ03P i+03P Ÿ0203pB <B $B ?ض?? -LM`2p @傁C0 , P0KT  @@L30  *0@KLP c 3/|  @϶fP k(K,00 19,0   @03 003'7 0-PL3@S 61S ZP8  P1S ZLP 6 ;&606;600  BQr0C0 00S: BQ  10R`!d!  10C10 -pLP`BP ⋐V VV& 0 0@0@R 1V ȉ9i;9 * `1S 0 0@0@i跏0u_D? p-LM0 0@0@P`XB0 K@V 1SMዏKpd? p-L3LP4PxPuPrڱ7ױP3`0CSP39@O 9d00S 0@P30CSP3lNp] 0-@LPc20" 0 0-P0"LR3 BT Ef0@TcP0 -LM`PpqP @0?0(0K(0K:CJGĠHC6 (K%K#K"0K!@K'PK&pK$K0P K -@L⎥P30CSP3h P3 0P3h -LM*pK@d 3P K"K4 0! ["0[48 !#8 ! (  "(2S<8" #8( "h908#h 0p&Ġ 0!K"`K{"08P#h PP 0K Q 0 U AL= ! -LMPp`K`l (0ID7PB %7PD {s@Kx 0@60[[\Č Ƞ,Ƞ Ƞ, ,Ƞ 0KK@%J ?TP BG 9K ?C@P B6 ("~3d1. @僴9@0;C9F !????7 -PL@`p喎D1T% 0CT-  00|@4T ߍ0T 0T0/@4T6@ @ɍ @ ᾍ@608#8@6 0 R0@@ @!@i 5i 6i( 0-p  0p00LM P9@ 2#0S K0"0S S S03M0S<8# S 08#!40KKyK< "0<@`T !?6 p-@PL 壳P_ `a3S ph:p -LMP@pჳPcV KG4!0K"pK1"K 0,@T q!? -LMP`p\PCT K 0KL @T [0[W F $? -L M`!pKT 0p< 0p!0[@003#K &0#@K"@K  &0#K"@Kh 30!Kpd] $0!@Kp~ C0tx" [#0[48\##8S  4 0ph![Q Q Q5  K 30!KpT 30!KpLd! &0C"0[#@[ DH$HJH$̠&0$H`"K#@K2P30'0KL <0& K%K$0K(K(K  .04P U0!PKpR T0!Kg@p 0 !@Kp 50!@KpUh 0"K#K0PH $0!PKp$ $0f@Dp7 "0#K"@K寻 "0 00   0!K 0V0(0Kg0C&0K _0'K% K$0K0O (0K0C' K&0K8 B0C% K$0K|! `? @?Q -LM`0Pp2b 5@PK 08 Ƞ,Ƞ#8 "?`#hClCdSj2CCS|3-.⁲@P*!2 p/pT"` 0S:93 R00S"0@SBPk   0P" P"$K03c*@K0 @&Kd?0GH\\  0Ph414!901!,!|1(1!$! 1 1"!o20p0@"2 0rt 0`"R  h   YV|S"03"K`L=7|?7?`?po>h7T777x77h7877??? 0-L%@P ; %1P 0y%@ -X3 @SL`#Th# 0噳PX 妳P\ X7 -@3 @SLH#<P# 0~P@ 勳PD @奲7 -L(M< 8 0Pp԰4 P4 9@ U UU(KLPfUk <0#^< (08 ˰8b8 ,0KP,600#(("(, *B)@ , / \ j,:, dpP' P0`0@0@40 0"  NJPP @ 4,\ \ 0K0 0@0@  ^(娳07l? -@L≠20CS2h2 02c -LM0S  0 Ƞ8,Ƞ#8 'P L= -@PL 0P 0h 0-@L)PP^20" 0 0-PL2S BT `0@T)0h^ p-L M@0 !DP_`$K0 K$0K<0C@K#K0KK"K!K PK崳@P  Kp褸? 0- @L(,0 $BPP 00 $A0h 0-LM!P00 @ 尯P:98"#8 … <9)7 272 C "K0h2Sʄ:P2 @@ "0K! 0TK0L= -L M?0!DP^`p0(K(0K KD0#@K'K"0K!K&K%K$PK-@P  Z 00KԸ? 0-4pLM@P  KPP1  ((    :PP8 28 ,84?? p-)p  4p00LM `69@3 2#0 S#2 * , KP%0 "0,@@& "00000 0  PG @,@  dx Tx20S S #"0&%0@0 "?l? p-@PL 0幮P)^ `\3 phPp -LMp`P@$K$0 $dT   P@   p-LM @ PP @L}D yx  s  PPPU @g(0嶷PP `K PP @ R@M0: 0 E8 Al*= `P7 3 //`P01$ 0 #G , /`P#,20 2  " "@d Pz@L Ps@4 Plй?(??p?D?0?Ⱥ?? -LMP` 0P2@2bBBB2c 3CC/YP h K-00P R;J<330S@VP 4`l2"91!1 0O!2 B0B( KP4pL M 1!21)^" @2"t!t1rv 0!\"R=  jၽ 00S #0@S˭P   0P# P$# CA$ KP(0$#!$##Ġ"~}|2"0"(7T?7?88X?8T8077\7$7? -L@0 P Ⓢhz 0-@L9P=9YY(P (_P4(S,P ,VP10,30P 0LP003`P 6!0`3XP 0X3HP *!0H3@P 0@300n 4h b 8??? -LM0r:: @KqG:P0$` D0 ::$0 DD30 ^ @ Hc@D3,XP @ @唬@+P o Kt30t3'88 0-PL3@ 61S PP6  P1S PLP ѫ6;606;600  BQr0C0 00S: BQ  10R`!d!  10C10 -`L0@PP ^Up UU% 0 0@0@ᱸ U h蠅9Y;9 S P1S 0 0@0@h苅4x,3X? p-3LP4,Pt(Pq0Pn0֧0ӧ2`0CS29@)N 5Z40S 4@ᾼ᡺20CS2hJp p-LM@P}u7P% 7P(  ?8P , Kph  ?(`P  pKph iKphbKph(\3X\/ `fX9@0;9*Kph??t?X?07 -PL@`pzD1T% 0CT-  04`@4T Ä0T 0T0).s@4T6@ @᭄ @ ?ᢄ@608#8@6 0 R4@@ @DA@i 5i 6i( -RLU@p` E #P F%# EiE P h hx?\? p-LM0@0 P`^E P |[x%#EE PF K3[x F K (\?? 0-LM@ ?%P  mK0 =PP  L^̠(,3,/ Pd(??8 -2QMLP`3@p0 C#0#C4031^``  7άP ƶ 4K@30@3' 8? 0-PL@P61S _NP8  P1S RNLP l6 ;&606;600  BQr0C0 00S: BQ  10R`!d!  10C10 -@PL 審P h蘦 -PL`pᠩ@P 9W;I9 WW" 0 0@0@8 hW i'0 0@0@  p1S0kiX? -LMP``pP K0 0@0@\Z㝃0 K @屩1 1S7q> -3 @SL# # 彫P ʫP 7 -@RLp` D ; 0 0P PPPP 7; 1 W7; 00ꔲ? -LMP0,0 @p`P 9@ V VV(KH30H3WP/V] ̠A0 L @ۨr ,0K` 0,  0 48#8 S,0 0 0@0@HCK 0H0 0 @0@,00@0 0@ς0  ]7P |P   00 0 @0@8IJ? - @L$4#97P (3S P( P, 7(7 -LM0S  0 Ƞ8,Ƞ#8 .P wi 0-LM?0@ PK0KF0K0K@K@K@K@K@KPK0ػ? -L MPp@R /P K!1 @/@1!d3#hslps K⃨@P [0PS00S"0@S OP9   0P" P"&@K`~P  0 9!0 |1!0@ 0phᾷ! H= 0ij?088?X?8 8 8 8? p-LMQP` ?0@0 0K 0K0@EĠF K@K0KKK0KPK`K>PKp -LM`p[PP KG@0HD (K(0K'K%K#@K&pK$K"PK!PKP p-L M@`:PP Kp?0F"0KB0"K K!KK0KPK PKPK`KP [0[ -LP i@0``pk`p@_@P@Pm@P@PoP 0 0@0@ p-L M0P`0K@P Kp?0F!0KA0!K K KK0K@K@K@K`K壪P[ -LM@¦P K@0  K0KKKKKKKK冪P? 0-9P=@L9` Y4P 4P4RP +P102P !P020P 003(P 20(3P 03P &0300 4b \ V8??? 0-2L@MJ㈀9P@00S 0@C&0 0-LMP 8#8,2S<9 0@\2  ?8 0@Q2 P @@++!0T 8d #8 )@< ?Z8,;;1" "6i -LPǥP9@@  p" Sogd @MT9`   Dm7P( A7P z$ 6# 2" . *2S 9@0;9/hn@h%,hP ht?X? -PL`@pdP@ d1T# 0T  00Ⓑ4P@ ~6@(@ ~& = S2 @S# @ 6@3606b0 R @ ~@ ~0@@J3  `$ `3 ` i 0-@9=PPL9Y bP4RP YP102P OP02P 902P 02P -02P 0200q 4k e 8??? 0-LM@ ?\P P K0 ?MPP A L̠2,/ P囤2??%8 -2QMLP`2@p0 >B"-^ Ϡ,͠0 ?  lC4B0b2\\  gP  0J=K303#8? 0-PL@-P61S HP8  P1S HLP 6 ;&606;600  BQr0C0 00S: BQ  10R`!d!  10C10 -PL`pߣ@P (~9W;I9 WW" 0 0@0@w hW if}0 0@0@  p1S0yiT}X? -LMP`埣pP K0 0@0@\}0 K @- 1S&}Eq> 0-2P@SLRR P  P 070 -@RLp` D ; 0 0P PPPPP7;  1 D7; 00ꔲ? -LMP0,0 @p`&P 9@ V VV(K 310 3囤P2V\ ̠A0 L @嶥 ,0K`c, R C0  $, ,  R0 0@0@ C匯 0 00@00@ } a7P |P  E  9 \|0 0@0@%8IJ? 0-@PLR :7P 2S $P 1P 070 p-3LSPp|`P f 029@ 00S 0@}`03 |p^ -LM0S  0 Ƞ8,Ƞ#8! LP M= -L@ pP).آP = h茫? p-LMQ8#H`@0?0 0K 0KP$4& KPK0KKK@KK`KKp -LMp剢P6 0 4S ,K0 KIP !0(K,P  ̠8Č#Č"̌ 0P d  ,q <̠ČL8 ČD"̌#D!L  0@P h P,<4("!4l̠ <($Č"Č%̌ 0fP D P  ,* < 0-2P@SLRR P P 070 -@RLp` D ; 0 0P> PPPP17; 1 %|7; 00ꔲ? -LMP`,` p@P(9@% T2 TT 3S% TK 3@!z 3 S0 3ʤA0  @咡(Kdޞძ D c ,0K`01> ,`,``F,` V p  ,  R 0 0@0@0 0 @0`0@ `x0 R7P |P   01x0 0 @0@`68?? 0-@PLR .7P 2S P  P 070 p-LM@xPq 2SK 7P 7P  =P  DEKphw,>Kphw7Kphw ?ߢ`P Ӫ 'Kphw2/ `+ 9@0;9Kphwτd ? @yP  ,Kphw?t?X??`6848? 0-@9=PPL9Y yDP4RP p;P102P f1P02P 02P w02P 02P k0200S 4M G ??? -`LP@pᅝP@ w0T 0T  00ᳯ4P@ w @ @ w608#8@6 0 R0A @@ i@ i -邡ႂLM0j`@P2p 1.00 \  @00 0! Q " $K0j 0 f@j@b0"!B 2/LL  巟P $K303N='@8 0-PL@P61S NAP8  P1S AALP [6 ;&606;600  BQr0C0 00S: BQ  10R`!d!  10C10 -LMPp`᜜@P Kv9V;I9 VV. 0 0@0@3 V) #v$K 0ܜ P  `$0S 0 0@0@1S0kv0 0@0@妟X? p-3LSPpv9`@ 00S 0@L/03upK 0-LM@P PP  0 Ƞ8,Ƞ#8D  P 8P 80 SS8M= -LIMp`rPz 08 Ƞ#8,Ƞ P1>8@K8P pS /P 0$S0S1> 0SpPw (0S@(0@S֛P$05P 0S$0!"(0@Sʸ2S !02 `R@0Sڔ2sP  @ 00S0"20Sʸ@,P0pZ@P ""0`S0@0S"0SPg   0@0S"0Sʼ2s 2spW2s 2s uZ` =K0K0C PKX 2$KO0` {DK^< $8 #44"<,K ,0 l0}2@ 1!9!1!|1!0@ 0Ph(ይ03t Z0Sp $K222SC 0 $00B SAB Qa0B7 BSW B? x2"0 Px2O TH<M=*X?t<8>848?(?@?b> ?p??ľ? -@L݊X30CSX3hXX3 0X3巊P0y p-`L@0PၚP6@0 ?  #0 0 3S 00pH30# p0"00p 0-PL0]P?  2S BT K0@T0h`H0 -qLM0P(3@0`  ,C;QA40+ @(2.0(3$(3H   8X30X3$̜X3@0CSX3T ὦ d0 K(< a<0>ẞP30P34L8? 0-PL@0P%3S" 61S G>P8  P 6;601S 6>LP P6 ;&600  BQr0C 00S: BQ  10R`!d!  10C10 -PL0`pᖙ@P s=W;M= WW" E? 0@1A. W isC? 0@ 1A p2Sxvi sX3H0X3峜X30CSX3X? p-LMP0 0@0@`XLs0 K@$壙2$ 1SBrKpq> -$3 @SL,# 0# 0尛P$ $彛P( $ך7 -@RLp` D ; 0 0P P PPP7;  1 I 7; 00ꔲ? -LM`0pP֘P&U& UU h0l0h0PPCUK 0Ÿ0BD0  @ԘX30X3hX30CSX3'(K,0K P,0S 04 C, 0  G? 0@1 A R"A? 0@1AGh@0 0hX3D0X3ɛX30CSX30꿠0R P00 @0A, x@ @r =7P P  җ  ƫ qzA? 0@1A,O8IJ? - @L4D#7P 83S 0崚P8 ,P< 78ٙ7 0-LM@0 PP K0X340X38 D0ⷜP  PX30CSX3Ნ4< H0⢜PP  HP<8D<3,/ P8凚??,O8 p-LM@PP` 0—P Kp@ĠF@0  KK 0KK`KKKKX3 0X30 KX3P0CSX3d -LM@P`P 0哗pP KLN@0 ' K#K(0K%pK!K&pK$K"KX3 0X30(KOX3P0CSX34 -LM@P`pP 0cP K@$L?0 KK$0K!K#K"K KKX3 0X30$K X3P0CSX3 -0PLM @ K@b0P[ -LM@PP`p 0#PU  @ JGĠ0 K KpKp  >   7^ p-LM@PP` 0PU xZ @      K0 k4 [0[48#x p-@PL 0˖P_ q? ` }@0P㢵ph\ppD30 300S0#R00S 2 S# x p-LM@0唖PP KpM `K  '= 8#8  -2S<=4 =  0# 0[<<P0K PP\ K?0 Q0 U A 0-LP0?@P 0 h `qT @ 0hq' 0-6@=P6LVPuDP D{P+DPHP HrP0H0@P \ 0@38P 083,P P 0,3$P 0$3030蓢 ꍢ ??x p-L@Pp`0 -# x0 7P Sopr7PHopX P H ?  H0S D0S 6@0;6oP]pCWP opX?t? -`LP0@pYP@ o41T 0CT!  0x↧@4T& n0T 0T0/♫@6 @ @608#8@6 0 R @6@@@ @:@x@1i 5i 6i( -d0L@x`$00>oX3p0CSX3=@? _ !x0S ϣ~nP5_ LC -LM0S  0 Ƞ8,Ƞ#8  峕P $R= -LM`P(p0` ϟ@P 0塔$K2pCh3tClS 2CCS3( K$@PL(0 40 0 Ƞ8,Ƞ #8w?4080@0<0 `R>S4 0@S4ߔP/ 00S@8<0S80s$ <0s! @0s n.@K 0pP B mx;@\3T0@*  j xP1!=1!!1 1!!31 #x` O3"0 b/0   0PB"R  qP | mJ"0ͪ"b>ȳ?dW8,?X[8$R=ܻ??8?D??J8$]8\M8V8U8H8H8 I8tH8 -PL@` npQ *8@P 101Ym!1R"@10d!R`A@@10dA! !/00@ 0@ 7m@L1017@(m 0-@9=PPL9Y ߕP4RP ֕P102P ̕P02P 02P 02P 02P 0200 4B < 68??? -LP`"P 9@ V VVpp2/02嘔PVh_B巟 0 rt? 0-LMP ?⮗P  K0 ?⟗P  @ ?@ PQ@P | Tˠ24/ @֒m??f8 ?l8 -2AML@`Pp 2xR2+N\\  寒FP > 0K202i8 -`LP@pᴐP@ j0T o0T s0CT@ Ij& ("(8#8@@& @;j@ @@@x -R0R@p @@ i 0-@Lj9P@00S0bj0 -LMPp ኛP ]R KPP Ɛ0`S00S"0PS 庐PA   0P" P"32S+ 2S( 2S% lj0 101>`|!90p h|0@0@p0 0P t1!Ęi4 $ij??o8h88o8c8@?? -LM0S  0 Ƞ8,Ƞ#8 ՐP wi 0-@9=PPL9Y f1RP _*RP X#RP 02P l02P 02P `0200 p-`LP呏P p0 0@0@phq> -LP`zP 9@ V VVpp303PVh跒C 0bst? 0-LM@ ?P  NK0 ?P  ? = @婓PP ԛ T(̠24/ P.ő??t8 ?{8 -2aML`P"00p2@" • 0•C40 •B( 0"C<02 0B 2o\\  僑P { 0 K202x8X? 0-PL@岎P61S 3P8  P1S 3LP "6 ;&606;600  BQr0C0 00S: BQ  10R`!d!  10C10 -PL`pd@P h9W;I9 WW" 0 0@0@ hPW ig0 0@0@  p1S0yig儑X? -2 @SL"" 尐P 㽐P ׏7 -@RLp` D ; 0 0P PPPP7; 1 M7; 00ꔲ? -LMP, @`p؍P9@ W WW(K303OPoW| ̠A0 L @Ӎj ,0K,X^084 0LT l T ,084 0Z0$ Z   00 @00@ g [7P |P   g0 0@0@C 04V  P嚐{8??IJ?p? - @L"#7P 2S 忏P ̏P 77 0-L@P 0agP7P 7P 2S 9@0;90hf@0hfP 0hf0hfX?t? -`LP@pP@ )g0T 0T  004P@ sf @ @hf608#8@6 0 R0@@ @ i 0-@Lf9P@00S0=f0 p-LM@` ᶗP KpB K@P 0PS00S"0@S PJ   0P" P" ^2S4 2S1 2S. f0OPK0`  0}2@ <0 10)1 01|!0@ 0`h)Cᦞe@" 0ij??*xmX?8w8Lt8@?? -LM0S  0 Ƞ8,Ƞ#8 P xi -@L(|X30CSX3h裐X3 0X3| -@PL 0ҋP 0h軈 p-@LP0`ËP 6@00"00p930# p 0-PL0孋P2S BT d<0@T0h90 -qLM0@P `(3b,C ;R' @$(3H 2.  唋X30X3$(X3@0CSX3T  Tm0Q K(<b<P30P3X8п? 0-PL@0GP%3S" 61S /P8  P 6;601S /LP 6 ;&600  BQr0C 00S: BQ  10R`!d!  10C10 p-@PL 0P_ ?e` 93S 3 30S 2 S#Pȩphdpx -PL0`p͊@P e=W;M= WW" E? 0@1Ae W iTdC? 0@ 1A  p2SxMiBdX3H0X3X30CSX3QX? p-LMP0 0@0@`Xd0 K@$ڊ2$ 1SdKpq> -$3 @SL,# 0# 0P$ P( $7 -@RLp` D ; 0 0PC PPPP67; 1 *7; 00ꔲ? -h2L$M??t??0xi66L?(?? 0-LMPP :@9P00T0S 0 Ă\ 0\- 0\ 0S @K0 0 $R @ 0 4S @0S0S@0K K K0s 0 04SQ @A#a6S@00RA00 0-@PLP 0 0S00 0S0000|0 Q `0Q1!P P R 2999꓎¿ _,l8S=+8#+ p-LM P` Km K 0 SGT 0T@ T80Kp9#9 @`P`"1P80S=ظ@ -LMRH0H`i@0pATF@0 $K$0K#K!KPK"`K pK@K@K婅K -RLM` R R KSppt0@0NFT@0 $K$0K#K"pK!KPK `K@K@K傅 Spp 0 -L Mp0ᖁPg80Sv f*( K R xʖR KRd, ,`@FT0N@0 4K40K3K/K2`K1PK0K.@K-@KHPC ;PZ   \\< SP ASPHP0J@0ED ` 4K40K1@K/K3K2PK0`K.K-K#P0@1K2K 0< 0 @20K1 K20K10K@00@4K 4K3K0`K/@K.0K-0KP (KS(,Kp SP  SP(,Kp R ʖ R K R0,0 0,0 0,0 |0,0 yKR R0,0 r R 40R 0,0 j0,0 g0,0 d0,0 a -L4M`0@߀P,K0D4 @p'0K,K+K*K)K(pK&K%K壄PP $K=̠X K00 P 00+0K 0C,K(pK'0K*PK)PK&PK%PK刄P 0-L<P\@010< < 0000 0-L@ @QP @AD 00C00A0` `0S -@DLP 0D0 -L8Mp0@PT(@ v (ހ`(40 S0 80< S X T 0S@ tX 0 @4S@0L0 0S"(€PG 00S R00 SR00 S= T 0 <4S@00aD0 0@SX0sC T0sJ 0LS00\0 0\0X04\0 1,H 8p 4 00 < L D @ ,P P"  0}i0}c }P4  0|Tx0|N\K` `0`GP0|A<0|;?0???xi??|?X?66(?? -LM0S  0 Ƞ8,Ƞ#8( }P \=R`00Qa00 p-L0P@H`|PT TTpa@`@ \  0a0a0<<a0phDph 0-L@0{|PP DP ~D~PHf kDP0 o? -L M#1@R#R1K Qp ` 0 3 Q p ` 0 G Qp ` 0 K Q- p ` 08P00K@0EDK(0K<0C(K K pK`K'K#@K"0K!K&K%K$PKK 4 (` K0C B=0K< K60 `;0K: KD0CD B@P0K90K8 K2@K1PKc4Sf  Ss 1 S  S000K 03@K/ K.0K7@K6@K5@K4@K SV @S$ SC 4vt0PS.@  00Sp0S"4gtP@ @K S03@K00K/PK 0 /0K 0. K-0KN n04@K3K0PK, K+0K7K6@K5@K4 0K|x@P0OvPP? *v@000K/@K7@K6@K5@K4@K3@K000K0C/@K,0K 030K0 K/@K7 K6@K5@K4@K 0 70K0C30K1 K0 4@K00K, K'K6@K5@K/K.K-K+K*K)K(K?070K030K` 04@K0 K/0K6@K5@Kv`P@ ?K Ų  0P@ @sv@P uu$u{ mw -@0L@M 0K ?0CKK0K@K@K@K@K@KwPK -0L@M0K 0CKK0K@K@K@K@K@KwPK -RLM R KV0SV WV0^8pS@0NTGd!0" $K$0K#K!PK`K"K pK@K@KvW0S W p-LM0`@LPrPT TT"Kp0S PL@ 0 0 S *S<KphZHKphv 04SU@T@ >0U0U0 0U0 U0<rPD   00S7 SP 0@SP0sD L0sA 0@4`W@V@0 P ! 1@ ,` ( 4P T@ D < 8P $p 嫘< K$ 0S' 00S 0SHD 0 4P0 t|0zq0SLq@m0kq$eX^=yi66@??@??Q Q  0$ 0,B$ 'p.l.-08 ?0R<  C480t.x. 0-@LlKL P0CQ 0S0hJ =8. 0-@LPK4 ,0RP 00hJ.. 0-PL9K( 0S J0@@J0. 0-D0 L@$K0P 0000S㸂0hrJL'. 0-@0L@K0P 0000S㢂0h\JL'. p-t0 LP@J`P H 0000Sph@Jꂂ0 L'.A p-PL@JL`0 S Rph$J0=  ^|. -`LJ0pW ͠ @h]8P^xp 0 MpW<0  h0 oI0  oI.,o.t? -DpL`@P 0$@L'A 0-(P@L00hL'A p-@L]J`0` R ]0PH 0004 0 0 R0  phI..? -x0x`PL@0Tp0 @ ^80!P 0$00C 0@L'... -pL ^0T!`00`G,0S"=I0@").KI{PUI0@00 ጂP9I0S -00CS0\00k0X0 00<0,000 0(0t.yi?A 0\|8 -@LPI p`P00hH. 0-0@P00L000. 0-P@LQ  0 S 0  000S:R   Bp <0 0  0h  0000hl.p. p-L^ @`P  ^* ^&0 ^"1 P 0S :pl0P T0 ^ 0 R 0Cp 0PL'.... 0-LQh@PT0  0CR0 00 \L'.. 0-t0LP@nPT TT T 0M00 00q00CS00hLsl'' p-0PL@~nP pHT` TT "{ \vT phHphHM04 00q00CS0sl'X?' -LM0` 0 2Pp@GnP"T" TT; T9 TB 1A 0%͠] %L @In000p00CS0%K  0K@n R0 QF Q? 9CSX8H888(88888z0 rM0 00Hq00CS0r ? fl''\8IJ??? 0-@ 0L00PkpPcz| 0t嶳-0P0CS00L 0@ 嗀-0P0CP b $ C0?`% V Pq%-t`$K0S2*@KP0RK"K2K2R7 0R0SR2K?2K*@K02K00C SF999999999990@"02K0"K*@K2K A=0Sf  20SZ S08#*@KK!PK0`20pLK&_W?F K4KUtP`V000000 R  B<h61! M 0@] 0P `k 0@P @ d0 R08#Q 0*@K2K0"K2K?      L'' ?('(##'''8p.* -LM= ?Rp` 2RS 0RD Bp2"p 0 00@0ªP2P"@]0P4B4Ÿ   @k-0 0@? S+ = R 1R4 -d0CRD 0RI T1 @1 >$K0S@? *pK2K"Kh1 *pK2K"KP1PD!0S,1R 0R0AS9999999999999990 00 00p p <8#  'l.p.''8'(*(' -QLM0`(!(ְ$K1p 0 ?% X00DP\Z,0@ - eP 0-  jLmP Cw0( H喰 4%=㏰lb=l?.|.''''|8X?0? -LM?pd0 \`,0 N \D1Q  A1,A,Q0  X0 10Q @80 p0pᴠᶐ,0@000ሩ0 ]@0P}@ 8p  @Hj f\0@P@(K(Ko=L'..'t.'''8x. -02L PRc  R 00 0000S^CDAp0P 00`S` 0@zx=  BR` n|1Q 0A!ha XAP 0kX0 10Q (AP bk-lP+00AP Wk"lP,00@P LklP00JC奯CC{C`@p0?v X哯9v D卯3v 0凯'...'''?8??? -LM@P` tP j KipP8 1!@! 0 `p0C `d!(0CP\1p p pi0`S @00S1 0@S iP   0P=  P0 '0  "P  PyP ` TL0  @CVij?l'p'..|''?.t???X?'8 -LM0S  0 Ƞ8,Ƞ#8' iP Ta=-0S @Q 0 S  0S (zi?#=?c1P20`<Pr0` -TLMphP (K1^ xL0p 0 F͇ p00@01 0|8 0`h(1(!9$1|!1!10@!0tთ2 ?" f0 E 0C/X0 ,o-`E 0@أ0 F @00@0Σ0 @000hdp倪 0,X?H`h|i`<&919(9|939<949tr? -x1LMp!phA$ p0S@ R K$ K P=$0 SP@" `$0`0dS$0   S@ȠK8#蠑ࠁ,Ƞ@ 0PPPP  RK8 #H R@ h0@pPP0  0,W?CyUm`|i?d? -L M@03 @IK -LM 0 @K@8P[K -HLM@2 R< 1dl 0R0O$ ,R.K0 PP 0A P 1  @lw`@.K0PP (0P S@181#Ƞ1K#8!#8! pPT(00dpPP(0  $Q $Q|i`??d? -L M <#83  K p-LMP0@!`0P AnP x1cKp* cP\π P P0S04!4000 P P 0S PKP0[SSS0  # U? R K 0P 0 R p0 R `0P Pk8 0,k<ij?,zi?`d Жmp#9$*iD!9 -L M0 @" @K -LM@`P&pKUPD0k P!0[S S X0 K -L\MtK`@P  Pp0@A$t0KV0Cq Kp@KnPKm0KrKo`K *@ Ƞ,Ƞ 0@@ P$KG4k0KlpKV lK ᅡ -L M@Ƞ,Ƞ0@ K -L4MMpKP`0 ἢ@,0' IKKKM0KJ@KL@K_;: CK[3: 00#0K#0K Kp0|0 /0"K!0K0 K0KP K K[P0[S -0LM @RP `Ktp x0 S K U0 0KP [1PP`k -@LP<6p=`6vP Kcdp\@P Ccdp$ ~A yi6;48 0-9L@@0P`0 ]P0PcD0Pc00S 6gp084 -LxM%PKp ᭠χ 0@P  K葀Kl H2H" 0Q0Kh 42 K@K@K @K K K@K删421Cc!0 0K#0P+ K0KKKK@KPK8S@K SPK00KN~K @]`KP21CcP [U `#(}KSHdPE 0'K!K)@K&PK(PKl @P  Y@P@PP 0Pl@P 0c@P}p 0Z@Pt 0PR@Pl 50PJ@db=hf* + -LMpP:6@%P)P!818Aj4` 0OeP" ::6@0;62::@ 0(: K傦~}P :80 #ePp@p p0,\$ ` `u` cP 9, t?X?0(,6 9 -PL@`p:10&S629292929p2929292929292929292929292929292929292929292929292929292929292929292929@(@3!&A= @9 W4P@6A0AS?4@D60680 R0= S @S @ '<  :   -L@!4P 6A0AS 4@ -L4MPpK`4 K#(@P00FKP0KNKG@KL@KK@KJ@KI@KH@KOPKMPKh0(`0 KQX0&PK d0@%K% K"0K70C4 K@K0K$@K#@K!@KGKhf 0-0LPo_P?S S 0P P9@0⮳0h8x0h,0@ 00CS595959695969 6969 P P@7P,@nPX@l`0 $H0AhSw7989898989898979798989898989798989897989798989898989898989898989798989898989898989898989798989898989898989898989898989898989898989898989798989898989898989898989898989898989898989898989798989898989898989898989790 0 R Q Q0-L@P  7  0@-T  08#0`08#0@jPjx:9p:9:9p:9p:9p:9p:9p:9p:9:9:9p:9p:9p:9p:9p:9:9p:9p:9p:9:9p:9:9p:9p:9p:9p:9p:9p:9p:9p:9p:9p:9p:9:9p:9p:9p:9p:9p:9p:9p:9p:9p:9p:9p:9:9p:9p:9p:9p:9p:9p:9p:9p:9p:9p:9p:9p:9p:9p:9p:9p:9p:9p:9p:9p:9p:9p:9p:9:9p:9p:9p:9p:9p:9p:9p:9p:9p:9p:9p:9p:9p:9p:9p:9p:9p:9p:9p:9p:9p:9p:9p:9:9p:9p:9p:9p:9p:9p:9p:9p:9p:9p:9p:9:9      -(L`P@""4"̠00S0p a0V V 0  04Ƞ8,Ƞ< *;"*#"#? ## 000 0 000000BFTV Ƞ ,4V 0 48000L0Ba21C0aT  Q  R ,{0 0 颋.P<9<9<9<9<9<9<9<9<9<9<9<9<9<9<9<9<9840,($ t>t>t>t>t>t>t>t>08 R0-LP 0h^0 @0C 00h @ *0@08 x巐6]P 0C <0h|t?*(&D -LM"]P#*]j7j?p,K (K,KLP L0P+K@N'K0*K)K&PK%K6]_6a_$K0=9 0-AML(@P0PS ^000U00 -LMHP$lCt@$H(K(K'K%PK$@K#`K!pK&PK"0K`P }i Ѣ K? -LMPH.l$|.@0 $H(K(0K'K&K%`K$@K#pK"PK!PK`P Yi 孢 K? 0-0 @$(LL"(P0 $("(( 0$("(0h 0-0 @$(LL"(P0 $("(( 0$("(0h   0 R   >V p-X04(  Q@P PL0@`[o~ z phu> -X@L jx8#<,"(c, _D(R  hWfdh -LMHP$lCt?$H(K(K'K%PK$@K#`K!pK&PK"0K_P h  K? ,0- PL@0N 08a[@Q \00HS X00 0R B0HSQ[P 0C <0hz p-L M?0P.L.`"K K"0KB0!KK@K0K PKPKPK_P[Kp^h 岡? -4L@9$   08 #(hD -4L@48$  08 #(hT -LPp`@  @ThhvT @46%CA($H"(0H$(1 0pt>0 -?LS@ (0 )0 @ h04 $) (0-"(LXPl@Mb @T(/0T S0? -LPp`@ME @T,hT $("(h98u> 0-@LPT  T  ?0C0S 0h p-`LPV@ V@@/0B0RS@ L@  ("(,$  ("(ph p-LP@@?6dT mP dT8嬠p,`@0 @}@TpTu>b= -L@0 #`P00V0SNPF0E=/Qp1p#R,HJ9J9J9H9 K9I9 #3!3yDp V ""2! "D8S H8S FV  F"No5i<2!\  "" 2!#)D !!1!#@ !1!#)D zVH! -tL!oH1!j#@  c1!^#)D X0V  Q L H0!C#)D = k -70 340!. * -Xc= d=|d=d=,c=dc=c=Dd= -LMHP$lCt? $H(K(K'K%PK$@K#`K!pK&PK"0KW]P /f 僟 K(? p-LM@K 0P[0 0a[0aKA[ $$$ $ Ƞ! ,Ƞ 0e.`@ 0@/o0E-  0<E-0xtp 0-0h 60LSP0CS006 0hc("00 @0@0i> 0-PPH#CA- 0 ß  PYXZP [(KX3 P4X 0!R RT8S S0 { q#D0820 00\p4X 0k0@@ c@@ [@H$H@H$(@V4 8 41S#H L7 0@4(> <'< P0@0/.000b 0q @B `P2DAM0@00e1DT!040 84Qp '.0 4!P ! 0 P PWHZP@  S 00@@a @@H$@8a 4 < l00/.00ʠ< 0b0dh`W9>u> p-LM6P=@S`2 xH8S1SS P @2 R{ʬ1SR @LP  V K@P tP  V dPa1  060 Q Br0C  BQ h1 RE0G@T/0S*,00 tP  V 8P x 1ASq Bx 00S:A BT  10R`!d!  10C1 10R''  70C7,00 tP6;6xxQ00 0@0@x -RL@ ZZ Sc 姜Z& 0 0@0@00`p lPk 0@H0 @ m00YH? -LJMR`p \\ \9 h"ˠdB0L  @nVY(K ,0KV, #R0 0@0@0@ TD⠐PPj ; 1 11xY @! P lQ  0T48<#8@!:#:0 0Z0< 0S( 1  1xp 0 p0C 0F=0 01 1 0 ,1 (0KⲐ@! w> -@LZPp`QC $tC <t0 p`R  p-L@UP8T10P H8R*]9L]98]98]9\9x8pD8xhS +' D8S 9D(Rx8sxk0 px8px8pRUPC $tS$   { (f -L@6UP =UH8S hW0E 0-0@LW0P WP PP ; 1  `0 0P  08, LPXTl?? w>@w> 0-0AMLP00@PlWPp yWC=P0@ T08Қ 0 ˚ 0 ?? -LM`0S@0 @DTD@D@20dT` >SdTW  "PP@ $Kx|8p0x(Op,0 N\H Wo 0ᷓ21C! c. P0pUV:P@) :0 Y@P ` JF@zp 0X@PF@P <4` (.*P " @@ ˠ0A- (TVP@D8S  6 n ~ 560;@06D(R  @d B@^@Wb="VSD???d? ??PTX9D? -`LP@pSP@ S.1T, t10Sh1TH 0De@4T@ @1T" 81T  4P@" G-V606 0S0~6@ @@ @ ߞ4P@D8S 6A0AS@@ v0Ee@6A0AS|@i ϖ1i i i -L@ᶅ4P 6A0AS 4@ p-PL-0` .0 1O]W00S 0@"bJP T00@P TUl@P TU,pC $nq0  C <gq -LM %^P (Ko. S@P`S //0PSʧ0@0S/0SQSP   0@0S/0S?s ?s 8828"0 C $ o 2 "` C `< o  &1P pO_c0 p嗘1/88 H@hDhՑ t Б @㇁\1`/VN>0@<19\?`<`<&`c9LU9M9$=9[9He9q+ ?0?@? -LM0S  0 Ƞ8,Ƞ#8 SP d= - 00 LR s  0 0-$@0 TLP,00  0@T P0 P 00 0-$@LTP P0 0@T0 0-$@0 TLP,00  P0 0@T0 0-$@LTP P0 0@T0 -LMQ@ 0?.C""0厗 勗?? -PPppL* 0 $P `U 80S T V0@T404040@uTW H0 ST404040@u? -LM00`@Z 0| pp  0$  0QL< P$ R 800 QPR 4!P00P0S  Y00S P<0W)< < 4<8  4 0 4 @Kd d0, @@ 0 xP $000S$ 0040$0$40HP(00(0(K 婗Tl9j9? -LP00S 0 3@Ń 0S 0 S ?>#R 0-X0L @! 8T0 $4T0P $84X0Q;+S  ; S80  ;0R 0 S0@@@X  (RPH0RA0R #R!&R #X00X0lnLTf -X0L@ln 0-X0L @TP= \0 C K -  !`0   [ h v D\00L  00hgL0& g\0  L( 0gL0& f\0L0"f\0  L0# f\0  L0# f\0X 0@ X h00<0L 00fX0L0 h X0+0 Bf`0  LX  0h0X 0C+ f`0  X 0@ X h00<0L0 0f`0 x 0-TL,0@ 0P 0P eo0S|0 oP S | 00PP0S -TP 00LR`p @$<0 T ,00)@Xh ), \00Q0S 0-(0LP0)X0@08X0 T0$4P0T 0h( p-X0@L$!;98 T8}*P*dU 8 T0$4` PL0S X0  p8;T$8p 0-X LP@$ `0   @08#  P=8#0T$8 8T$8 <8TDX04R 0\ <C308#(  ;8#(`0 ;8#(0T$8 8X0@ `0T*, <8#(0$8 8T$8 <80 X000 XaI0@.*}T 8 T0$4 @ @000l@X0 k}Xm0A?Du9 0-LTP 6& 0 08 $4T0@8$ 4@h d0R 0h Sd0 P0d@Ap0 -T`L0@' 2 1C P ^{Y$8 80T$8 8X0@80T$ 8 $84  X0  hPe= ? -Tp@ P0P,@`L8 T0$4T0 P8$4@,0 0,0T0$84  00 P, 0P 00S0P 000 00P0P8 T0$4T0P8$ 4X0@@ ' 0PVP0P(0S  \0P`0  8 T0$4T08$ 4    0PVP0P  0PVP0PP0P 0PVP0P    0PVP0P@ 0PVP0P 0P0PVPP0P0P -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300  00000000T0$8 4 8 T0$48@T0$ 4  006000T08$ 4@0000000000600  006000 006000@ 006000  006000 0-@L8T0 $48PT0 $4<#38T$ 80 0-(0PL@ " 0ES<9T99090& 8T0 $4V>0$T8 8Z0090 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sp -L P e= p-`L@P  xk(0pL0 P8 TP0 X0h T$8 40 \pphe=H?e= -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300  000000008 T0$48@T0$ 4@Px9l9l9l9d9l9l9l9l9l9l9l9P9l9l9l9<9l9l9l9(9006000006000006000006000006000 -@L8T$ 08 0-(0PL@  0ESD9\99890&X0070 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sp -L P e= p-`L@P  pi(0hL0 P8 TP0X0T$8 40 \pphe=H?e= -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300  00000000T08$ 400000   0000000000660000 0-(0PL@  0ESx99܇9l90&P00j0 L0"S 0 L0"S 8T0 $48;T$ 80 L0"S-p -L P f= p-`L@P  p圐(0hL0 P8 TP0X0T$8 40 \pph)f=H?f= -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300  00000000T08$ 400000  0000000000660000 0-(0PL@  0ESꠊ99990&7000 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Scp -L  P df= p-`L@P  pҏ(0hL0 P8 TP0X0T$8 40 \pph_df=H?Xf= p-T` @00@,0P8T0L $4T0@8$ 4 ,00,0 0@0@C0@ @0@pX0 @0@ @0@ @@0@0@ F0@0S p6@0S0@8 T0$4T0@8$ 4 00<00p p-(0L@`P# 0BS949990& 0 8T0 $4T98$ 8Xppp L0"S p L0"S 8T0 $48;T$ 8p L0"Sp 0- @L8T0$4T98$ 8P}U z$T0$8 4 P8 T0$4@ R\ &RZ X0`0B%S& 9999999 999 999999999999999999999999999 9 &R& 0T$8 88 T0$4Tp08$ 8@0&S 8T0 $4:89T$ 80 < T0$8 4PT$8 08T -L P f= p-PL`@  Y(0$L018P0 0T@?>C2@0 0 X  8@0 SA S P0T$8 40 \ T0$8 4`phX0  8T0 $4T@8$0 88T0 $4=8$T= 80T$8 8X0 T0$8 40 S@09T$8 8@0f=H?f= -@L8T$ 1<8 0-(0L@P0  L0"SU U U 6000& c.p0E0v? p-@LP`ᦍ(0L0 P8 T@00X0( R Xph蕍 T0$84  \pph+?g=? - 0LT@;P0 3@50  S R ? ?Z -$0Tp @0 ,@0`L8 T0$4T0 P8$4@,0 0,0T0$84  00 , 0 000  0000008 T0$4T0@8$ 4   ! 000000 ɇP ćP8T0$X 4 000 0008T0$ 4 00@ 000  000?@ -(0Lp L0,S@R R R (0&  T08$4! 0&.R T0 8`$@8P0  0T$8 8gD ? 0- 0@ LhPP 00 3@5 ? 0(P  #P00g=@? p-L@P`uP  F(0xL0 P8 T`00X0T$8 40 \pph(g=H?g=H? -T` 0P00,T0L8 $@4 ,0p0,0T0$8 4  00 0, 00 00300 0008 T0$48@ T0$4 00000 0000000000 660000 p-@L8P$`T0 8@40 p 0-(0PL@  0ESP9h99D90&U0040 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sp -L P g= p-0L P3 LP@`( 0P?> S0P0  X(0L0 T`8 0P X0T$8 40 \pph?( P 0 3Lg=g=H?g= 0-0BPL@ S ꬞9L999 L0"S0&800 L0"S 0 L0"Szp -L #P h= p-`L@P  t(0lL0 P8 TP00X0T$8 40 \pphuh=H?h= 0-(0PL@  0ES,9D99 90&^#00=0 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sp -L P 8h= p-`L@P  po(0hL0 P8 TP0X0T$8 40 \pph8h=H?,h= -TP 0,00@T0L8 $p4T8 $4,0`0,08T0$ 4  00 , 0 000  000000 0000 00 -@L$8T 088T$ 1<8 0-(0PL@  0ESt99أ9h90&Q00k0 L0"S 0 L0"S 8T0 $48;T$ 80 L0"S.p -L P \h= p-`L@P  p坉(0hL0 P8 TP0X0T$8 40 \pph*\h=H?Ph= -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300  00000000T08$ 40000000000@660000 0-(0PL@  0ESꈦ999|90&=000 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sip -L P h= p-`L@P  p؈(0hL0 P8 TP0X0T$8 40 \ppheh=H?h= -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300  00000000T08$ 4 0000000000 660000 0-(0PL@  0ESꜩ99990&x000 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sp -L MP h= p-`L@P@  t(0lL0 P8 TP00X0T$8 40 \pphh=H?h= 0-(0PL@  0ESꌫ99990&K00e0 L0"S 0 L0"S 8T0 $48;T$ 80 L0"S(p p- 0`@LP奇 0?.C""均(0L0 P8 TP00X0T$8 40 \ \0 `0  ph$4phxT0$8 4`??h=?0 3$ A5S ?>S @ -T@ 0LP 0, 00•_ p,0S,0`0,02p , 2` , Q( "0B0 RSQ20 ,000000000020 , 00600 0060000000  @  \0  006000 , \0 @- 0060000060002 SS2BPp \`,0p 006000\0  006000 00000 -TL0h @”R`\p,0h 12R`h \@,0h  -T0X Lp Z @}Ty 2` ,: S@@2R@0 \`,70 2R@0 \`,<0 2BPh \`,0h \0 4—p 1\2R@h \`,0h 2R@p \`,0p 2BP` \`,:` —p 00\X00X0 -LM(0p R R1 R  ` L0"S'  L0"S6 @2` ,Pd@d0h 0Sd0X0d@0X0' L0"S6 0X00š0 ,0q,Q,  Qb Q{ 2R@h \`,0h 2R@p \`, 88p 06S\ 2R@p \`,C2@0( L 0P80TP 0h0X T$8 40 \pph[i=H?i= -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84 00300 000 00000$8 0T8T08$ 40S9|9|9|9|9|9|9|99|9|9|9|9|9|9|9ؽ9|9|9|9|9|9|9|9Ƚ900660000 5;00@ 005<000000000 0000000000 000 -@LP0X )  `0> T$88< 0R# C2@0 T` D 0 X0|2P0xX0 0h0h0X00X0P T$8 40 \YL0"+MX0 P L-+0MwP2\L  0mMwPX L# 0ML#,0ML&*0ML0&!,MXL00@ ML00-MT0$8 4`twP 2#(x0(Rp0P0y h0Rd0P0t \0P0qL 50{M0E?k=H?|i=?Wi= Wi=i= -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300 000 00000T0$8 48T0$ 4 ! $ .  0060008 T0$48@T0$ 4   006000006000006000@ 006000 0-0BPL@ S P9989,9 L0"S0&^0z0 L0"S 0 L0"SQp8T0 $48;T$ 80 -L P l= p-`L@P  t{(0lL0 P8 TP00X0T$8 40 \pph=l=H?l= -Tp@ 0,@00`L8 T0$4 P8T0$4T0@8 $4,0P0,08T0$ 4  00 0, 00 00300  00000000 0000000000 660000 0-0BPL@ S T99<909 L0"S0&N00 L0"S 0 L0"Sp8T0 $48;T$ 80 -L *P  m= p-PL@`  z(0L0 P8 T`0 X0h  T$840X  \\0 pphwL' 0KL' 0K m=H?m= -dT`0LSP, 000,84!T0$4T0@8$!4p,00,00S ,0 00 zT0$8 4 000 z8 T0$48@ T0$4 000000000000000660000i78?4?@?\m=$? -1`LQPp@(0 0GS 499L9$9 L0"S0&X ,zL0 S  L0"S0& `8 T0$4T0@8$d 4@d`d0h 0Sd0P0d@pilm=$?7 p-L`P@y0 R$(0L0 P8 TP0 0h X0( R pphy T0$84  \pphg yT?iPm=?|m=$? -0 3B5L  ,0ktP ? T? -@0LSp D0S8T$ 08$8T :8T$84 8$@8PT0 8`4; 8T0 $4:8$T#: 8$8T 08$8T 08$8T 38T$8: 8$@8PT0 8`4; $@8PT0 8`4; 8T0 $4:#:$8T: 8$8T 38$8T 28$8T =8T$8w0 88T0 $4:#:$8T : 8$8T `28$8T H28$8T 028T$8< 88T0 $4:#:$8T : 8$8T 18$8T 18$8T =8T$80 88T0 $4:#:$8T: 8$8T 18$8T 08$8T 08T$8< 8$@8PT0 8`4; $P8@T0 8`4; $8T 08(h e A` -L@ h 0-@0LSP D0S@ X0T 8 T0$4@ 0$T8 ;8 : -@LP0\ X0,B# 0;8T $8 8T <$8 8$   L0"S 8 T048;T$ 8 L0"S 0& P0T$8 400S.l9x9x99x9x99x9x9x9x9x9x9x9x9x990& PXqP>T0$8l 4>d0h 0Sd00d0@ 6S0 0S, ]S% 0$8T 8<$8T 80T$8 8]`T0$8 4  dPM0 +0S, P@ -L P m= p-`L@P  |v(0$L008P0 0?>C2@0 TP D 0 0h X0 B40 \ \0 `0  P0pT0$8 4`m=H?m= - pLT08$48?N T$4$0 0pP$} 0I+S,P999P99999999999999999999999999999999999999999, ouZZ q8@$PT0 8`4: $P8@T0 8`40 ZZ =$P8@T0 8`4: 8@$PT0 8`40 $@8PT0 8`4: $P8@T0 8`4< b$P8@T0 8`4: 8@$PT0 8`4: ?? -L!h -Tp@ P0P,@`L8 T0$4T0P 8$4@,0 0,0T0$84 00S0P  00P0P T0$84 R0P@P0P R0PP0P R0PP0P lu0P V0PT0 8$40 0S  <00H6P0P? -RLpP`$ R5 R  00R ^, W00R0SP L0"S5  L0"S 8T0 $48;T$ 8 L0"S 0& n 0St9\9T9L9\9\9D9\9\9\9\9\9\9\9\9\9d9p@6S$8 0T8$8 0T80T@$8 800S 0$8T 8L0S (K0K4KDK,0 `P0Q ,0Sp l*D0 P 4 0`P P,0P 04 0`P,0P P0H0 0H0 0`0 0P0 0 0 0@No@0d Q0 4 R P 0r`P P 04 0i`P 8K< @0@p0 0xSP 4 0O`P 8K< @0p@p0 ,0 0400 @0  XJX00@$&&Q020a00#40 540 %0 P Q 4 R 2 *0*Q020a00#40 540 %0 P Q 4 R$ 82 *0*Q020a00#40 540 %0 P Q 4 R@P Q 4 R8   ( @P0Q0U0S   d0_P 8< @0`0 p8K< @04@p0 ,0 P0 ,00_P 8K< @0@o$ 00_Pu 8K< @0@o0 f0}_P{ 8K< @04@o 0lh??(??? p-LPN`P TP @ ;T0T0p -LM<8K 0 0 K40K   P @(K    3("(R R 40dpH@4 8DL@PPX`0 h00 00 0 8 00| h0 0` x L  X t@ pP l` 儀 d0 WT \ Pp l0p 0H0 D Hp D  <  4 RH00C000@ K@0K> K?K,K  <0KP ,0 h 0 00 R( PK@P00\00S T Lh<   < @P  pQ d T0pS0T 00T0QT0L (3 5:QQ00     <Q`P  0@  4 0  PR`ʨ0S@,<S S!80S Kt t0O@    0 0 ,80`0:9 -LM`0, S`<@F`0S@0\  P 80Sp 0("(R R  !XP  pYpP U0\  ,0 P00SP  -\PL0pS` @0 \@ P0S茀i p-L0P@`mT`000 4 080 < 0@0 D 0H0 L $0P0( X ,0\00 d 40h0 ,`80Pl0< Pp  \ 0v] 8L (HP 0 Pph@-?t:9o p-LAM`QP FOK8<̠0  \m0 ,PmKp,0 FOK0m<8̠ 0 m\>P?`> Q0-L@P Q Q 0hJJ@0J@0l0hJ 0-0LP@hP  0q, ,QP00 p-@LP`  p p -LM@ P`,0 m 1 0  0   p 00  W% ,0S$ 0,0  0  p 0 sW -RL M@PpA?QX@  ,   `<  0  8 0 X04 00 P<QF,, z @0 Q (KFmX] 00@8@P` H D HpK pPw`0@0K 0 S SM S0S00 R 80 0b00 R 0 000 @ 4 0  0  40 0p80 0b0'SZl40 rQ d?? -L M@00@2K R-LP@`ca 7 / 0  p 0 o< 00c0 3 Q000S  Q0 00   0   0p0 Wl?@- @ @ @@ -L M@00@vK -L MP4`@ 4K0K 0QpP00S,a P  40R !Q30 ZP p(K 004 0S 0 4@ 04 Z3 04 0@  R4  4 0S 14 5,0K00 0Pp\@ R,00 0S00 0 R400Pp 04 0@p,0 S!0Q ᆀ.@n=< 0P8#Q0S P\7>T 88Q #Ƞ   Q 0RS0R St= -LM Ƞ Ƞ0!8 ,Ƞ 4 p0 <0 !lP,  , "0Sn 0VP0S P0S@XT ,Q$ ,0 <!6j e<00! `(Ko,jP@T 0S 0W0S 0S @40 <!j8, 0Q0R0S <  e We0S( T \ < ` i Ge<0 `00(Koi Ƞ,Ƞ4 <l l0iP<T `pi<0< `0pis=????`?x??? -0L8 $0EW0S. 0" $0P`@! Tp$0! @@L@0 @`@ àP 0" T0 8 T0P@! T`$<<0! 0P@; T`$<<0; 0 0P@ T`$00  -L@MP`8<T0 p 4VP@ 0 0  00  00 00 00 3101 4P; X8 @0K8KP@KHK0  @RPZ7 <0D4  0 0,K$P9 XhQ 000YlZ  40<L (K@4K̔?@-?@@@X@@@? -mL0@Phtq -<L8[P -0L@ @A0 -@` L@PpA $ 04 |! 0S  R R Q0,Ƞ\ Q0 S R N> -8@8 #8SL P 0< "<S "8 R R RPR 8 SB 0-L8@PP|00<0p0 @.:.:p.:.:.: 0-L @P 0 pQ h 00p00 -Lx0 | -x0!L|$ -Lx00!|T -x0!L| $ -Lx0!0| T -Lx0! |\ p-T0L`0C@P #20010 %p p-P@00L$ ` p  @0@ &$ 2$0$ &$ 2RS>US>XS>]S>A-08 `P@ ^0@ 0rP|0| 0QTT 0<T0< ,110008XS>RS>]S>US> @0 80!$0 0!US>RS>]S>XS> 0-0LSP@ lP hLl0P hU0hdlW h@l0W hI -L 0@ 0 @c<0@$21C0a 1 0 !  $ 0-L0@P 0 @c<@0T021C0a 10 ! 0 T0 -20 1C0aL1x0D $ -80L L ax@0D T -20 1C0aL1x0L $ -80L L ax@0L T -80L L ax@0T \@-@8x 8#8S  \ Ƞo Q 0 S <0S! Q0 P 9$ip~m84 8#8S !8S<0S9 p-x0LP|!$ x0!`| $ 0x00|!Tp 0-@PLxQ0| Tx0| $0 -2`001p" P5L@ x0| $ 1x0| T5%$x44!0 |\ h -@"|!BP1L0bx0`X3:3:3:44:4:@ p-`PLP@00H H0 <0<<0T4@,bT phb\@P@p@d@D@8@@-? 0-3L@, 0P 0$bT0r@ -L M@1`pPP@(KT , > 2ᇓ  00 !20@ 5   1(Z   $0   $ 0@, R @0  0010 %0",0 @0  0@ P&>\ 07 '>>07  06@:A 414!D0Ǡ1ÀD @Ό@ `VOph0l@ h@H0lD hD0lH h@l@0T (K8d0  \  0)1H  H :Q0:0L  B>B>B>B> -LMp,0 Pt@`ph0l hl0 0X 0  0  P#0 0X 0  P,0  0 0(K$@_ 0  $_v@@ -8 LR`p+p@PPLR@"ڰ5Sx0! |$8  3mP8 p $e_8 PLR@@ -80LS@-Pp80PSp$x0 |$0S`3mmP 82_x0 |T80PSp@ - 1L@0@ ,8#8@ p\0` ,0` \80 PU@`$PU@` 3B@ @mP80 0^80P@ -0pL0@ ,80 PU@`$PU@` 3B@ @lP80 0^80P@ -8 LR`4@P5S)#200%10Rp 0 0QQ+ 0Q( <Q% 0Q" 9Q :Q x0! |$8 PLR@lP8  4]^8  ,  hMhbiMu@ -x0|`L ,8pQ&@PPLQ@ڰ5!S;2 3]lP8 $0 ^8PLQ@@ -80LS@-Pp80PSp$x0 |$0S`3(lP 8]x0 |T80PSp@ -`u Lhl8 R$@ PPLR@ڰ5pS5 3kP8  $]8 PLR@ @ -P `lLhW plh8 R$@P 3kP8 8 PLR@ ڰ5SU UPLR@ p-LM`0 P$p0 4@0$0 0 P $xhS] 0$ 00 P $<xhA],0( 0  ,0xhs@@i -LM1 P$$!`p0ba p  aH1@!  0 P $ o]04 <0N>00 P'4@@0  !  T 00   P@T10 $ L ( (s04$,o\$o\xP>@i$@H@ p-4LSP`p @(03@TTp -pA Lhl8 R@ PPLR@ڰ5SX5#20010`P8 PLR@ jP P Z8 -8 LRp@PPLR@ڰ5S5S #20010`P8 PLR@ujP P X8 -L@qPhaj -d2 @LTH` D2p\4 <\0@ ,0PS[:[:Z:Z:Z:0 i[ i[0S@   s0S> 000`@VT330033j [0#P P[ i[ i[[  0T 0 $  $ 0 $ 0` $@P@@@@-?t@@ p-1PL$+` 0\ $+ 1\ $+ <\` 0$+,0S^:^:]:]:]:0 phE[ ph@[ 21CA@c@$0 T 0 (  ( 0 ( 0 P (@ZUT330033ph ph[pP@@t@ -t0 L@Pm XpX`$ H0\p $ <\hdP#20 0p-L!0 00P0@!Q%`qPP p% ZpR>@@#200 1t p-Q`L`@ń`qPP 05p%Zp8@D@p@ -0`L0PSp  0\h@0l hPl0 h p-0L P0`S 0 ,Pph@0l h0l P -B"100a`10LxP\"T,100`10x "100a10|0pSc:c:b:b:b:0 iZ iY0S@   z0S> 000@XT330033q Y0#P PY iY iYY  0T 0 $  $ 0 $ 0 $@xP>P@@@@-?t@@ - 0L@p4 PP0`b@D@ 0SP :0S:  Dh  @ 04  0480 ` -LMP` [2p 4 >04 @L 84 ( $ 0@ P Y$K00 Y Yy0t0 S0 4 !A> 000\ 0 506 l1l!<X0d 8 0(K$P9 0( ( @p(  `@1,Pp* W  X80S P@ʯ80PLS@P #20010p5S X\XPXW @XXP@@-?h/::a:Y:@@@(@?0h -L`P@p3& Wh儀l 000 # '8Q 00B90908 809 80h40 lpWOi# 9080Q #:0881 # -L@`p]# 000  083 08P 00B8090908 \^ x!0| Th{ 908PU Ѷ# -P@h0Ll@ p# 000 %8P 00B8090908 \^ x!0| Ti: 908`V Ѷ#038 0:0S0:0 -LMPph0l@ 4 h0lH h0lD , h0lT 0 8 8`#' 000 rO8@080T8@00C9090T080@ 0,0 0  0Xoh00lT h@,0lD h 0lH h@ 0l@ 80S 4x!0| T(Ko 03   90 ,0.8 08@, 0  T  @8 0 00<  :0080 80 80 8@y[O>XO> -LMP`h0@ lph0P l@h0WT X l, ,0 - 000  :0 S#5!2!50 008 020, 0, 88\080900 808 0CR900G^h0l@ h@P 0lhWT X  0l, R ,x!0 |T(Ko 90800 Y 0  Ѷ -LM`ph0P lhlX h0Pl\ hl` @f0h!2# @0,@ 0 Pc@+ 000  :P! d00@ 00, 8 ,  #0  0$0 / 0d8Q 00B90809008  P@Tό00S x!0 |Th0lX h@l,0` (KoT 908 Q 0dж#ѽ 0d `O>gO> -L$MH 0 R h0l@ 4B40h< D l!02018 L0 L 0H4 D0 , 0@ #+ H000 aF003 0S 8P3P#0<02 < h0l@PH @ (6H @ 0,Z㏏0 , 4 RLH0 RU h<0l@ h@l80D (K 03 0S 9424"002<0< 4  0*4 0 RV :1!1 D  0<1Ì8 < 8 4 04 x4!0 |TH~0 RLh@ <0lh@l80T h0lO 010 BL 8 < ;80 0<04 "Œ< U:0 0 <  28,0 < 8 9404 0<04 "Œ< ~O>O>O>O>lO>sO>zO> -L M< h0l@ h0`lD h0PlH <h0l@T H H0<  < 01D T" !0 0  @P04@ , 8P 00 @` 0D 801P %₡140@0 4  F5003`VOh0l@ h@80lD 0`!Q h40lH h00lT ,0S Hx 0|T (Ko 90 , 08 , *8 30S:0 %90@ 08 0 ,*ƌ8 , :\h0, l<0  020:0 O>O> p-L`@P3P UOphD303p -LHMP V(7 0K$P S(K 00 (H 0&Q 6Q e0CQ   D 06,p6QK0CQT:  0D   P6,pp0S. @x|,K  0 @@PPtlS 0p 000 0@ @@PVS5%00\ 0 405 0t%60X <45P9 [0CP =0CP  l 5\0H ,008080$SH 4$L0P D 4 < @ 8 @ <2001T 0p 0L0 00%5@ 䐊 jP @04X 40@0 2\0  `10a8000T0/0 PX\ P0@TplU  U !00 @ PP tD@ RU4 01040\ X0!c83 01@a<000T0&.0 PL000T0/0 PP vLhx04@CQ1P%0CP*z>CP01` \080!1` d0D@ R8pD@ R8pD@ R8p0P 0P0` \00P 0P|@t55hO:=DN:@@D7:,{:3B:7:8:,@Ѐi@@@T@?-?s=^:\:T@@@p5 - L@`pP 3  0UP/^ x!0| Th 0:0S0:0… -Lp0t#QQD d3QA `@P* Z 0:e03 (3  (Ƃ83#00P0U05 h  !` lPUOV x!0| Tmx0| $hl@P ;: Q-2 dQ1 :0S. 03Vʠ 0e91 0 0(Ƃ W1  v"R:0SQ0v2 Q :0Sv"וR0 v2DžQ41 ( 020x0| T 0    9x ! |\O0 K  00S0v2Sv"R:0S0:0Dž00S0:0Sv"ׅ0R:0 8M0MO>O>O>O>rO>O> -LMPZ `lh@ 00CS::::x:P(Ko!ܡ0 , @p3 pWOX  x!0| T||!|0 , 0DSGTK \!\1\0 ,0  h0  !@ l3  03 0bY3:# 01  h!@ l 8 R90S0B909 0, 1 800 1:Q0:0ą P0PP00 , 0  00 , @iii|iiiiȁiԁiDiXidi -LMh0T lP$0"00 g` p2 @ 001.0#A#0 0^8 0 ^4 03@0  ! :\ 00P8֕I 0\!Z 0 hlpWoh0lT Y  x!0 | To9 80P808SP0@00909 0R8 @@hl/B0P :0S0:0ȅv2S0v2ȅh@lK , 00,K @8rO>O> -LMB0 h0lD 0 24 , @pP3Z_p4 R 004x! 0|T(Koh0l h 8 l000! #*80 \8000C9090,80!h@  1l h8  0l#  4 04 :L08 # #4  0*984  \O>O>O> -Lp` @ 3 F81!0P h  !D l0 0  !E hlXOY:Zh@lPA 0 # 00A x0@P|pA@ T`$0 8 R 9h0h 0 2P9B0S9 x!0  |TP>P> P> P> -LMP`20`,0 @p0 3 0,,\ |:|:|:T:T: TNpWO h!@ 0l0 R  0x!0 |T(Ko ,980 S8 80RQ8,, 0 00 81 *0#8 0 9:S0C0090903H hl 02 :0S0:0ą, 0LS\:\:H:4: PM,0:0D :04 :$0  @(P>#P>P>P>P> -LMp`P@,` hlW 3@@p 8 80D!1h! l0`VO,0S  x!0| To980 S8 80RS0C00909,  0&, 103 h Q l|: , 0, 0080! 1 :\0:0ąLP>`P>0P> -LM010p,0 `uP@3  0v90 90S`80 4 21 PU@h0lL 0u290,0v`P  Q10Y  x!0 | TqP>lP> p-L@P% `3  0 ` 0 `PR @0 100b 10t KphD xP> -LM 4 8 hl ! 8P`p8 000    @0 < I : 03R  :0S0@ 0 100T0C`  PŸT i:@"008#0 8 0Ō<@8 `PU !  08P 4 x!0| T(Ko < @9 Ap1@ @ X@D@00  ` d0 ,4  ^8 08 <@8 A@0 @ \@D@, 0  ` E,  ,4?: 008#"` B   #0:0  :0S0@o0@m00   0@0:0_R>R>R>R> -L`P@p# 820 000PQ$9 1 00hSlWV T  0pWOX  x!0| To3W[ X 9 0S0A9003 h!s l:\(60S007 00!0s hl l!s h 0!l0s h8hly P0:0:\070 S>S>S> -LM`Ph0H lh0lP 0"0c2#p@r3  h2 qp@ d, + 08 00 C9080\ #,  02\ 00B9080908 Ѹ1a 0 # 00!p@DtZ  x! 0|Tph0lH h@l 0P    #0儁0c@0< <6 R! R& R : 008:0Sv2S0v2Ņv2S0:0ŕd :008 :D 008:, 008r7S>4S>/S>"S>)S> -LM`p0h0l00 0H ,0 hPlP 0dŸ0c2à h@ < l@ 4 @8 Pe2 08 00 K 0,1#QPf 9080\8  08080 \ 00B9080908 p1a 0 #T 00!PEuO80S  x! |Th 0lH h@l<0P (K  03400(::Y0:0ąa@ !0!X8 00!<< 04 I3803 tHS>MS>AS>@ -L MPph0@ lh0@lD h0lH `8 h0  lT H H41 (K  00$!00` H0 <` c4 0 , , 00 , 01D @ 88 0 8 0@  @$4QQM 4Q( 0Q% )0Q" 0Q ?0Q 0Q @0Q 0CQ 0Q 0Q e?Q >Q q0Q p3Q`3Q T3Q L3Q 0Q @0Q 0CQ 0Q 0Q e?Q >Q q0Q: RxR::<R0 D0v"2QQ:0S0<D  00 j h :X"80@D 188 @ 4, 04 , 3b4Z,0`S  88,`⏏, I 8H9a<  < ,0Q4\:h0l@ h@<0lD h80lH h@l 0T (Ko50<:< : 0@ D 0, 0Q3@ 9 `4x!0 |T0:0D 0 t@ 9 )H 9b<00<0 {%&$vJ$K$$bS> 0-@LP3 0 3 h0 0@ 0 R 400h  @ r  -LMp @%x2hl$ P  $ 0A P 7H 3HU .H,H K(H6#Ht0 S01A0\000506 1!`<0X0d 4`8` 0$K$P7 0$ ( @P$  p@01,Pp U! G0 R 80SP80PS #P 3B@@A@@]DGP \`,7  0\@(@?-?@h/::Z:Y:@@@ S2 #a 0-L @P 0 pQ h a0p00 p-LM@`S1 x0400@`PP$gGTY:@ 0-@LP]4S 0h0h2#0010PH^ p-80LSP`@3 80@S0P  php -LM@pPU`c T 0ph0 4!   0Pp pPP! 4!  N0PP Pr`P $F 0 (K$lF0 00 P  0 0$F 0    0,K$P F 0, (0 p ,p0 ,PPp 0\ P PFpPs@F00S ,}F({F@@$@@@@(@?-? 0-LMP@  0?4S8 l4S 0 $0( 8h\ -LM< 80S 4040  2ሓ4   80 !81`4X@ `.]P2pP@4  0h@l/T4 0 408 S 00P% `@F,0K0K 4 @5S(K  40k%(E8@D@S>P@\@d@p@t@Y:L@ -LM@hPlQ < "80S"4 4P @ rc  !|1xUP@0L!Q U5ň50010%R> U 5 001 `p05 0 5S(K\0010@,0K0K @ 5S P U0 4Q  0%(dE%_E8@D@I,T:@p@ -<@PL$Dd`pNE@0 <00 tp8g80S@ ]80@S@ -LMp`4 @P T 0t0#E2 4P K 0PPPPt' 0  Q#* 0x|@P @ Pp3t0P0 H0H H0D0P L0D`K0D(DtPD(@B:T@:/:@@@ -LM8 <0`#4D80t0 S0  A> 000!1\ H00401 X0<6 5880S$Pp80p\SP P h0@ l"9 4 %D80p\SP(K#2001080  5S @,0K0K8  @5S 8 0 P 5S X5S4 h 00l@ @h/:B:G:@Y: -LM<0P#4`@D t0 S0 C0CS:H:`:`:::T:0601X0<x1 R080080`P80PlS`( P #20010pA0K  ,0K@Ŗ \  0" 5S 80PlS` (, 0 0@Pd `:9d (K0S060060@-?h/:w:`M: -LM0`XH< PP+ xPA 8P> 8P 9P :P h0lP 4 0PP P' X8P$ P8P 9P :P 4  4 (8PP 8P 7P 7P 9P :P 40 8   8 ?<000 7R 0RR700t0S 00l'A>000\ @4@5,7,'QQ  0& 7Q# 9Q :Q 6QPPQpp06Q <Q \R6Q00SW6 6@060T&T6QQ H6Q <Q 86Q 9Q :Q4&0&0X  <08 6RR 0CR 88g0%5QQO 5QL <QI 5QF 9QC :Q@ 80Sp`Ph lt5h@ d5l80pSP0$5QQ0(5x| \x0| $x00| Tx0| $x00| T80SPp8 .P 00$,4QQ 4Q <Q 4Q 9Q :Q 4QQ:74 ᇣ 0010<80 45S| 0#QQ# d3Q <Q T3Q <Q D3Q 9Q :Q PC0K<8 ,0K@ ,3,#L0P B C0K<8 ,0K@5Sx 0"2QQ% 2Qa <Q^ 2Q$ 9Q! :Q P 0`"QQ:74 < 804 0!1QQ9 1Q6 1Q3 1Q0 9Q- :Q* 80p\SPH0l!h1QQ \1Q <Q L1Q 9Q :Q hl40P (K 280p\SP 80<[80p\SP0CRIF0CQ07' 4)%=80p\SPʰ060s0CQt080Q07xthMhbiMibu@3Mh/:0M8M8:l: sE s Q:t6:B:8P:@ -LM8 < "80S"4p4  00S S S S S 4 0BSP=8_@=t0 S0 ,#,3\ (#000X <04504  SRm6800 R{08080`P- P! 0 2ᅃ0010 Ÿ8, K00K;5SE @@A0 @@1!S80PlS`Ss!P hlC@%7=80PlS` R5 R7 R5 R3 R1 0BS40RS l@hP[ 0 0[ %(K8 0BS06080SR4 R060R <40ASh@lPQ 0Q h@lPU 0U hPl@Z Z 00 @Y0K 8,0Ki@-?h/::tR:@H@ -LM`< 4 <<yt0 S0 40S0004 00R;00L#L3\ H0h@lP<#040X <85S 000S h@lPP 00P h@lPC z0C h@lPM o0M xh0l h 8 0l h0l  8n40S]80SGPp %><80p\SP: ~P 0S #20010<0  5S 4 P1RLA0K@<,0K  @5S VP-5S  0 <^80p\SP(K 4 0R000C60J40S006060Ch@lPK 00K 8  40h 8 80l 5S@h/:(E::@Y:XS: -LM<0P#4; t0 S0 \!\1\ X!000840<56X (18R:0004 80S4`p80plS`+ P #20010 0 5S @0K  ,0K@Ŗ\  080plS`(KX@h/: :Y: -LMpN; t0 S10 !00\ 0hlT Qh@lPA =00A Ex!h040X <85 l Dῠ8 Al@ h@@0lh@ %80S4P`80`\SP+ LP #20010 0 q5S x@0K  ,0K@wŕ\  0;80`\SP(K@ 5::4X: -LM< plJ h< 8 <0#4040 P4`@T 0S 00600::<kt0 S0  3#00\ 0S3000 40< 850S::::::h@lP@3X0P 0P hPl@R v0R 8480STP` 80%\:80`\SPD4 P V VB ᆣ 0010<40 5S 4B,0K0K<4 @5S! xP V808 0 8 80 hlJ 8045S X80`\SP(K< 40e8 h@lPP1X0I 00I h@lP1X0R 00R zhPl@W 0W 0 Q00 060%9U0 606@ @hP0000  006060 p~m4:̔?@h/::@Y::Uh@d5: -L M`@ 000\ 0 506 D1D!X0080d << P"80S"4`80`\SP! P #20010@,0K0K  @ 5S X80`\SP(K 04@  04@ (]8:P@-?h/::a:Y:@ -`Lp@J8,E8t0 S0  1 B00 16 \00<00 4 5X08hl| 0?0hl :h@lP &00 .80S@P80PS 5LS@ 3+80PS@-?h/:: -< L"80S"4p`@P P 4@ PP7t0 S0  !00 |!Q7 t1QF 0CQd1\06 0<0T1 X04 8580S@P80PS 5LS@ 380PSlhq 0h0 0006 \0T0 006 T h0\0X0 00P06 \0hls 0hl{ 0@HIh/:ؚ:1: -L M@ < p"80S"40@< <0 80$#Q :4Q= 4Q: 4Q7 @0 (,  h0@ h0 P <S  @,0S P4%P @4P 0P \2R:0R60RP0CRH0CRV:00000#20010840 5S A,0K0K84 @5S8 40\d1Rz 1R |1Rs0CRp*90CR060l4P"5S X5St1R M:=B 0CSI0R 0CRAi0CR 0CR99:h00 l@ |0R 0R'T0R X0R =B 0CS@h/:$P(o&$.0;:@&$Y:v'$qʄ -LM<0p#4 兀3 O3t0 S00A0\000406 0 `<80X0 580`S P 3B@@A@@PP(0K,K  P80`S$K@-?h/:::Y: -LM< <0p#4@ 443 ,4R <t0S0 &30 t@@ 08<00 4@5@ <8P`Pß00K<, K5S"8`\PPv HP 02C80 0010,0K0K< 5S 0< ]5S 0010040 EP㼢 h0l h0l @4Eht2Pl0 Z 0%<205< 00, 8 RY 00 5S 0 1!4H8`\PPt0S5 P3` PUOZ!80`S'چ2#0010@ P3   P0 `2 050 80`S(K0 J230300 5S4 0@d620 t@T12t0S 0 @0+ \00 @B>@Y:p@@@@ @L@\@h/: Q-LP Q# h@p@`h0 l`XV@0#Qg 3Qs 3Q 3Q 3QE @@`h 0`lXV@ T3Q- H3Q* @3Q' 83Q$ 03Q! (3Q 3Q 3Q 3Q 3Q 2Qu 2Q 2Q 2Q 2QS 1h%h0 lhl\ h0l` h0l hl l hl hl h|h0l hl@ uh0lT mh l0h@l0\ hl` 0hl0 h@l 0hl0 Ghl0 Bhl 0=zhl0 hl@ 0dghlT 0_ꤹ::::::|:::@:`:::::8@P -0LS 1`@ -LM`h0@ l |2"209R@7 P"0@T u29 S0!u2%0K&0K900}"0x&[Pp @Pp3F@T_W  x!0 |Thl0@ m p!0 u8\1\!0%KQ&K4 &@K8@80S5t"R%K&0KtƕS0!t2%0K&0K809t0 0&KQ%K %@KtB3d43 0t0 0Qp0p 0Qt2&K%0K8%[ 0$ K0S ~rXS>RS>]S>US> Q-T L Q ;@ {;  p-@Ly2T`S+^ +^ ጘKQ : 080$*4p -LM P`p4  N⼽@84 0P @PpP 0  @PPdPw 0,K$@P /(K, (0P,  0`H2,P o 0<04  @0@廻P 8"8#8S1!S 0@  4 1 SU9098!8#8S, 84P 0T804S $9+ !84P 0T8!(? \P 080$*40!S\/804S T8 004S TH/Ux xC/t 0@ 4 @ ) @ 0@J6 4|@x$!69@@? - 04@, L8x0("(R h0R ` h P0!SL0  P  R (0!S<0 S7hS>27$95%Q0b 5% -2LPh^`" ,2@P<"C.,T 2" R  ,2"qaR@  ,T2!,2@!,T2|!,P2+,2@0+\2"R  5\2"R  5\2 5\2 5\"0+\2 ,5E0 @5E88844(4 404 -N> LR 5% c>.Q@p3 0-LQ@4 0d4PST\4dTS T4\TS 3P$TT03X$3`$ 0-LM@\# Q (PU $0 B  $  8 00 008 -l"L0PTPEL" 2,p\$^P`"0 \2"RB.+0\2^!0 \2P!0C.\2@SE*2p0Cl!S00"A.\2P0!4-\2S00C$QS0%Q 4S4052 ,"4 \ Q00+\Sp0Sd02\ 4\2.(8$8888 ` ` 8(8 p,80@-@Q: ; <0! 4S04. $U 04Ŕ000!00 0 04AS10 0 S&00 052 0 0| 8#8 0C8R #80$%000 <0$ 4S04000 ,. p-2L`,0\"4P1"B/\Q 4S2 z?\"@0QHŖp"F/2,P\Q0@08"E/\2"R. +0\3#6I@R0A@S5C SDH @  SDH @  SDH @#1R @Q6QF 0AQS Q "0,\2P(!.0\2P!|5J/\p2 ,"4 \2*,"<*\Q2@  0\28 4\T (((((((,(2S 0 02@ 0@02 0 0  0 202 -2L@ ,"1 \ -2L 0\ -2LS 2 0\2 0\ -Pp(0` L@P8 8  (#8880P  0-0L(@PP  800 - <L0(8P#8  - L(@0P0   Rp@-P`0 0  0AS R 0ASN0@0 @ 0@0`00 p0`00p -LM2@0CS0 0K%PK4  020CS;;;;Ĕ 00  -d2L M\ p R (U4200 !C0(@8 T#8@,0 Y `  $0  B 200, 0K U9  0PS 00@0@(0 S85(@T $085 $X000!00"UPB45 % U`~- 0 "0S P 0(\  $0  B X0(U X9;ô9R09 00 R098 #80(K P., -LM@ 1PP4Q0c000‘ 0Rp`R$R 0M0 0$|#Vtu#$R000$R  Ke# 0 CnC`FR p M KW# -LMh%l3R8 K< P<0 Dŕxe(@T 8#0H2 `5" pY ŕ1B(`@V  $0  Bŕ $` V h5"K0Ch50 Q0aࠑ2K20CS0A8ࠑ#蠁 0B #P0@@0R00S \Sg 30CT&5P05 W055W!h5XSDŕ(@T x!0H2 8K0x(K30T^0N8# * K5S4 101[Q % 00a 0"[00b05`e0 00Y  E 0 0  R8KU3T30T 00ee|5 h%)U>8@ -LME`T0 0 R&p0pS  5(PU $05$aW005`0 @ RʈET  055S05P DW055 -LM4E`T9 0 R/p @Q (0S8Ŗ(PU  $0  B8Ŗ $P W00Q 8%00D0p R4ET  <04585S085. -LMĐ@p  p 0` PP  <(00 0(K 000p p *,PP  0i(0 0 04PP  0S(0  0Ę0  P00PP`  (;(0 8l@@@(@ -L MAP  0|P( `K0$S%@p0` @Rڌŕ 00 0 `Pp  L'D(\ ` H $0  B ``@@ -@0@L  03P4' .@ -LM%r1G@`P`U  <'7 ;wVP5705; 00#0CR6Ŗ 0P*(\  $0   D(\ 0H 00 P  ,0@D(\ 0H 0 0 UrS@ -x0PVL|E`Pp p`V|Ep 40@ T@P h50fh5 p-PL @"`!`P p 0BV|5xePP p ''p0@ -L MP6P%@ W 0$S8%4Ep0 R8ŕ?0 0 ? 0 `Pp @ p&  KH0 0C $Ņ(Ņą(@ T  5 .X@ -LM20CSO K K![  1[ ; S 1[; S ($ S1[; S@@@ p-LM4@S2S xk3S 1  $R R<  R0$4_`K  s1[S  l1[S  e![  10 1K$k3 S$ $P MP1[<8#8 1Kx_`K  <1[:8#8 1Kk3S$#P &P1[<8#8 1K$N p-@L h!!1!1Ô91!!LA|1PP0! 10@0`P P P0 1F^P,1$!20CS- 0# 0 0& 02S 0 00 0  phK2`S\0 0+@.@ 0.K;xM;K;<;I;#&0.+ p-LM_@ 305PPMP\%x"0BRSR R R  K00br![10 1K2*,3?;C0C?;c? "]>@R 0C/000 /  0 3"0 5`P V TS%xP4J%x#x7&x@VR@|@ -L M0p P -%(KE· 0>EN  @P妹P % Q, !|20S& @S@@'T 4 00 D`E·E 0O_  0P`xP $0AS40 ` $F· ?0OF^  P`SP 4,K$PP D$ꤒs, (0@,  0p1,P $T $$o$2S g04K 00K嗰P 0 ė 0 002h 0\2L 0\C@@p4@P@|@hO;@?-?̔? 0-4PL0 4ĕ5> ,D00 4j0, \0 /2P "R44#80j3 0BS020 -$bfl@ 0-9P=9J0L9@wK tTY1*0h p-LQP0`4 0@DS O p -2Lp ,0 4S 00C0SN> R00004S$ 0S 00iMN@N.!0S 0P 5`E$ 0@00C0S$0@0@N>0l S"0BRSR2-,"6-\@B p-LM@Pol$0 04Sx  20CS00dS& S0 S#N> R 0S x2&S 00x  K/1[ 0<0x@_F 0-L@tPJ 0hŶ -LM2@SX 2,,98#8 `2S+<8#8 `9`"0,\2S K2,,"0,\k5>  i"RʀP2K 2KPpP Up"0 2,,5> P "0,\4D -2L`^! ,$58 X# U+ p U' %20 0!X PP("x =P0–@h\d  \u Up]>K0 @ 5Em88. 0-LP㔶@0h -LdM,E,U 0`R _2 Sf $%421C0 h  t 8Ŗ0 @P T 5052 S7 (K Q@P8Ŗt 0@Pt (P$08#80CQʔ2SS;S9 S7 S5 , K00K2 $%58%05t$27@ S(\  $0  B 0R57@05(\  $0 B 0,0 00 t%(0$URS th@ x | # %,0@4Ŗ000%0000, 2 @ R @0 0xP PPt |(0S| ;^ ,dpK0 00Pp $2 R plP 2 lP R} 54Ŗ00 0(0"80, 1 @p0PUpP @W 0 0 lx %R$UC T!00j8#800h 0t008(\ t $0  B 0 4004%x2 S@ (\  $0  B N> R 2–@\ 0 \ @t0@( 00b8#800h@x0 Q@,.88 -@L3p2 0CSG;G;\H;\H;LH;TH;\H;\H;\H; H;\H;(H;0H;0H;DH;DH;DH;3 S0("0*\7 PP$  hZ#x1R 3#,3 ,#03#5%"3 S   28 <\ 1 h`P  Zh!1P x KhE9J@0;9F03h@ @@ Q0-L@P Q 0h9@ 0h90I0 0-PLl$0 S 00SJ;hJ;hJ;J;hJ;hJ;J;hJ;hJ;hJ;hJ;J;hJ;hJ;J;hJ;J; @C00| k3 006S`0 00k#m3m36S40 0k#m3m#0 k3/00@N 0-@L2P , 0605050@ -PL@p`1TQ 1T8 1T(  00@4T)6@@Q0CT+ 0T9 @B z2S? 9@F.0 @4T +qP @6 0 R0[E@V>0++@@ >@06mj@i 5i 6i(@@ p-LM6@=@SP x4S 2 S (\  $0 B 1`S }P PK1S3 }LP 061`S0  BPr0C2 S (\  $0  B V 2^| $5 \x 00S: BQ  10R`!d!  10C16;688 p-2L@ ,2PSP 9@0`0 @5`059@ 1S+VpBP 2P J/|5\p03@5`059@  ` 02V ( -@LMT J K  "R 4 0Ó 4Rp4, |$<0t4/ @ +k%„ĄnÄPPy"0BSaS;S;HS;HS;HS;HS;HS;HS;HS;HS;HS;HS;HS;HS;4R;4R; S;4R;4R;4R;4R;4R;4R;S;4R;4R;S;4R;4R;33D0R3Dd#On0 `2=?0? 0uPD%S^ % # P02>0 0dP? 2, "<0 0K c  2[ " 2"3?<3RD03P"On0 `2>0 00P (23:3@5`5 P #X 2SS  ( S& S$ S#! ^ PQ_7 X' 03QDvP32S2 05032 , PHU;8U;hU;XU;@03x0 0 0@ p0 `S2S0C5<I=;|A;.N$@x@@U;po>@@ p-L@dO1PP S0;ph'P$Q 0TS O ph0@ S>-7RR 7R-7Rk0CR*"0CR [ 0CR 0CR 0R  ?\0CR2\7R fB R*0CR*0CR0CR*0CR00$0CR0#0%*6Rl6R0CR *0CR C=B0CS000 \0h00CR:000`00 \0M0CR h 0CR .L6R p0CR 0R0 0!q6R" 6R> } R:5R0R 00P!!\5RU 0CR0CR*0CR 0 00CR*F0CR0CR*0CR  0CR*0CR0CRx*C R;0CR*0CR_00004R;0CR]*0CR  4R0CR 0#0%*0CR0CR\: 00|4R 9:0R60 0!0 0CSX;X;X;X; X; X; X; X;Z;Z;Z;Z;Z;W;W;W;W;W;W;4R 0CR000d0K N3RD 0R 0CR00=3Rz 0CR :0R:00/A=B 0CS000 0)H3R S 0 0!000 03RR 002Ro rC=B/0CS0 0P!2R 0R 0CR0 0D!0 0D!0 0D!zp2R ]0CR:0R 0Ri  82R0CR0# #0%* 0CR 0R0 01R:0R1R0CR*:B0CSz0 0U=B;0CSr 00P!!9|1R\0CR*0CR,  T1R~ I* @1RT 81Rf  (1R0R  1R G:0R* 0R R 0R\  R  w0S0 0q S-0 0k0R* f;<L)A{DP'( 3 -0LS@? 0C QS!0  ,%R R: R7  0 \Q -01R $1R5 1C=B0CSQ!0 ,  0 1 -0R0080CR 80CR00!p00S  T0R 000040R 0R0R@P?DP{ 0-0@LTP+?JG, 9:0+\0 ,0 -0L@ ,(0S,b; b;b;a; 0S0 \32 -0P1PP0L@`p` ,0S ?Q0d0 0000000 B - L0BS0BS0 ,P0Sc;c;c;hc;00CS<0 #1 00CS*0 #2 00CS0 2 00CS0 #3 0 #2 0 1 0 #1  0  - L0BS2@@0R,R,apP , 0Qr 0Q,R, 0\0 ,  0DRL , 0R,R, 0\0 ,0 SL\ 0 -P0^Ld@p .00S-a 8^4@0!< \0 ,0@ S @0;! 0\0 ,81S -LM LR, \㔐Ppp \k X0`\@0;! 0\0 ,0@ S @0;! 0\0` ,V LR` `@\r4B,8 0R0 0  R0 0  D0B `K 00 0 0 0  \0 ,B~c@ 0 0 0  \ 0-L@P(08#XH0U #p 0U00 -h0!XSL@hd0Si{ip0,0 7TpW eP<  0 \"\[ 0-LPP 00 , 0BSR8@TB T4 0 @0 \0 ,0@㣦0 ,30#@0T # 2RS  @0 \H0 0 \z00@ 0\ 0 \0 -L(\P@!h"x V:@0w03 fW0SP H0S 80SI SM S- @H0S]P W@  0,0 X  1 0\R@P  W #$!U0W 0m"P 4SVQ #g!$bW `* 4`4V0(@p -LM0PSD10208#x 0CSp7@`"K! 0DP`/"[V"40 @0S #00S 0 , 00#0 0 0L1S0ps p-LM`KP 0@Px1[80 0 P0![00x 0-LM0@ ,0P0CS,@;@;@;@;x;x;x;x;x;x;;;;;P;P;;;;;;;;P;P;P;P;P;P; 0 480#0 0 4$440L0H08 R 80S;51K1[ R028#8ʼ38)#8  0 8020#4,0@ 0#4#4080@03030 420L 4H   0480 0 0444#0 $L0H0CP 8 0+#V 0\0 4800 3 0$4$$0 H0L 0 , 0R80;HL3  0    \ 89))90b06#1&$ 0e@030KPr1[;#5S1K01K`@0f -L(\P!h"x V:@0w03 fW0SLQ' 80SMP@P0S W  V 11p02: \0 *0 000\ 0@P @W@  \O@P0 Z @FH@ 1@P" #@P80S@ W1 P8#q4SVQ #c!$]0 "! T08#H]P W@t彣^rW@# ("(5$ B("(.]W- #$!$ I@ꌣ08#HT# 0 ,2 T 308#Z# ("($ B("(@@,' p-LM0P@`K1K![1[?T08#K  0P@x 0K a c P80S S xx0 , : \꺺' -LM `0BSpK40BS RPP 0@@@[  @P1[@Q08#X 0 08#P@0U  0KqzSP pKpK0 h1[  # 0^[ Ɍ #0KOX 꺺 -l(LP@"hpP  8804 \㛢ZN -鈀LP@`~pP  8864 \|04 ,3N -LM K0@0b`pP T1[1[001K1K![pP P0 ,0P , <@ ;\0 9\- 0 \ 0 \ - L0@6 \0 , h - L0@6 \0 , h("(  B0-RLM0@p ,U! 4`K0& 0 066 0  0   \0 , 㽡P -0L@B,, 0B,\0 , 0 \0 ,h舡 -LM0@0CSd;d;d;d;d;d;d;L;d;d;d;d;d;d;;;;;;;;;;;;;;;;0 ,-1 R45 Q8 9 S0,0  S0,0 S00,0,0 0000000 04 ,00 40,  KQP1[0?>C20000 00 40, 00040,0Q00,0 00,0 (Qp-L@"hP50S4 S"x0 :380 \@0T* 0 ,@ 00CSp x ppD 0pdȠp -LM`"pPp;0SS0 ,0L@0 \0 ,坠 0 \0 ,㌠ R R( R0儠0S S4 02. L1SV SV SWWd@l@T 0#, 0,, <4<,\ R 0S0 ,#,3PP( C@, P0 ,@DP@$d1U@@&T0 , < \0,,@0T", 0,,2P0ࣇ*KpPqpPm["[@n08#XZf@@H$H 0s@HpP$,0K  P G W\0\!, 00!\09 1P p40 ,0@ 1\0 ,0S嘟 0 \0 ,0SL0Dd|Tp'IMP[N -QLMP@0(0Sw S% x0:38 \P1Ub 2O0 ,P QT00CSY0 Lx E0 , pK 60' \0 ,`P8#h 0 ,0 8#h$ 0PU0`0D 10d0 -LM @KxdP`!p ZP "[00 2KP"[ ("(P+&(0  ("(PW P, "[  ` - LȠ ^,Ƞx? ppP`j@PV  b@T0 @ @`@ -LM`pPJP*28#H2TF  T0#03x0%x05&80  T0@8W# 0 S VW  %@ @ *"(PW t0S x0S0  $ K<0bC0~P  0%@ -LM0P0CS"K` K0@XqP @ 0SS S S( S @"[1@t0SV(*("(@P V("(@P ~@T0ST(*("(`V 40g@(*("(`N -L@0LSP`0i)\\ wP p 0SSUBS) S p p1S0 ,t0SU(*("(ApP pW0SW(*("(/PU p("("pP (*("(P -LM 0@ 0CS@ KP P1S1[1[::1K1K![` -LM0`@ ,0 ,TP| $A0AS|@ " KL@P2[ @ <2<2K2K"[||@P 0 \" K0@P2[\  @P ⺜ < \"[@R` 0-LM KP@P1[A=A S 80$ , 1[ 00$ \8 p-LM0@SP x`K 0P1[UP 0 S S ,aP x|A,WP x P1[M=I SP1K P1[3;# S1K 0 0PS` 0-LM 0@ S 8PK 1[  P1[3;8#8# S01K$$ P +8@ a -LM8 K@lP1[;8#8 1K0` 0-0LS@P 0PPd PP 04 PP$ PP PO$ -LM P@P t!@P @P`pK @P  @P1[0S 0F8#h嘛 @P君 @P创,@P倛 x@P r@P` @P @P(1[b0F8#h@BP 0-LM@ KPPPT1[1[001K1K1[;8#8 1K98` 0-LM0P),0 ),0 t),0 X),0 <),0  ),0 ),0 (,0 (,0 (,0 (,0 x(,0 \(,0 @(,0 $(,0 (,0 0CS0',0 ',0 ',0 ',0 l',0 P',0 4',0 ',0 &,0 &,0 &,0 &,0 &,0 p&,0 T&,0 8&,0 &,0 &,0 %,0 0CS0%,0 %,0 SK00t%,0 P%,0 4%,0 %,0 $,0 $,0 SS0$,0 $,0 x$,0 S0A,,0 0$, 0 0CS00CS0$,0 #,0 #,0 #,0 #,0 l#,0 L#, ]08#,0 #,0 ",0 ",0 ",0 ", 0",0 h",0 L",0 0",0 ",0 !, L@K ` \ X T P L H D x@ l< `8 T4 H0 <,&@@@@@ @(@0@8@@@H@L@P@T@X@t@x@|@@@@@@@@@@@@@@@@@@@@ @4@<@@@@@@$AAA AAAA A@@@@@@\@`@d@h@l@p@PaQaRaSaTaUaWaXaYaZa[a\a]a^a -LM0@S`PZPP0S5 0( ,0.,p KPP1[ V !K @@01K1[01KP1[;1KT![+P0,,H@01K1[01K` p-LM0@SS  `x0,P Kf`P1[+  PP1[9 S\  S\ 0 \x -LM K@CP; 0SE   K:P31[ 0K1K1[![@01K1[01K1[ <1K <K1K(0S;,;t;,;1[;1K![P 0S  ![1[;;1K1[;1KK -LM@\p`0S\?0Ǒ00 PU! 0S= S 0Sn 0 ,?0@d0 00000 PU0S "K P2[P  P0dS S2[@00\0Sl 0 P2KtP0A., ?0 0A.\$ KyPU2[2[;;2K2K"[\00S[/ N5W>V>W>U> 0-L M @0BSGR R K00S P0SS0S PK HP BP1[   K9P K3P![  1[  |0S! 0(0K K-P1[S(0S; S  S |0SS 1S0 0(0(01[; S0(01[; S -L M0@S0S(0 ,0 `, p0BSP#RR1SER R 0BSR PK K" K1P17S @  0^/0\ @0 \010S0^/,P0 , P`K PP PP[0 !S@  0 S! 0S t$U=A0C8QS\4Q 0SS S SS   S S S  0BS0BS&0S&0S 0 \ 0 , 0 \0 0\0S "0SSPPK1Sk $K& KPPB2[S 1S_ 0,, 0,\ QN0^/,PE ん0-,0 3715 rP0P0  01^/\0 , A0 \JPP 0-, PR0S 01@*PP6 & KP=2[?09 PPo & KP.2[ 020)PP[PPP [PP PP  1S 0 1,, 0,\ -0LSS@P Q P h8 -LM<@/0S-0A B8(#8"(p-08#8 1K& "   ,| pp h \? P N[/s q!y012 p-LM@KPPP  R KCP( Px026  PΑ 00CS80S) S- SS0 ,i嶑R1[98#8 1KP㥑*P0 P0P0 'T[ 0-LM0PS@ 8 0BS@T7 R R 0S b@P0 x0d@&Tl K@PT [T@ 0St00CS+G@P+A@P Rt 0BSR!4 0!, (!$  ! h! L!  0! !      ot 0BSo @P\ @PV R`t0t0S SY-R@PB F1`#$%'5439`1DP` p-LM1@S xP x@奐 0BS0 0S@ 0BS`Rc0BS KPX00CS 0.\0S SI KP![40 1Km80,, <4<,\ R R} 0BS0.,0S S 0CS 0.\0S Sg  PPK P0 S SF 1[ LR00:K1K R:1K:1K![Pk0Sh X0P`S0XS0C0< Sj   hPW![ 0  00VT0 V V;1K![ x0.,R1[ :1K  K>P- K6P%![10 1KP![10 1KP3 KP ![t10 1KPd![L10 1KPY P![00 1KP  P![00 1KyPt  KP1[08#8 1Kg2 KP1[08#8:1K![j:;1K![e: -L M0`0CS.@P  K$ K@P2[?08#8 2Ky@P0 ,0SJ @0; \Q QQ QQ Q Q Q01Q 0SS7 S5 SSY SW SU S SS S S)1S&@P& KL@P2[#;8#8 2K@P  a= \ @P@P@T @P~P"pK  @P s@P o"["10@108#X UbQ00CSJ&PK @PTp H;R  P2[;2K2[ $R 0K2K R@02K R`02K0"[S0K2KP2[;2K"[i@P) 0St0S-p :R)  @P 0ST 2[t p08#RKD:p R<:0; ,:0<8#8 2K:@P 0S S G@Pj0S ( K2[08#8 2K Q>Q.2Kd@P 0(@ ,P& Kp@P"[(ɟQQ; 2<<K2K2K0A0S2[L=2K 0 \ 0SS S SS Sj *K =@P"[d80 2K@P"[@PÍ0SI BKP(pK @P r@Pn2[60E8#X 0SSS  @PZ @PT @PN2[P 2[8再 @P ;0E@P86#X 0SSu Ss S U@P&0"[S00K2K2K2[08#8 U2KQ@P2[L:8#8@02KU*K @P"[50 2K4@P2[92Kf &0K@P2[%9C8#R5 : @P%@PA 1SK& Ku@P2[#;8#8 2K@P0P@P 0,\)1S 0S#$1@P&PK F@P"[40 2K@P0 , 5 \D '@P}P2[08#8 2K@Pn @Ph"[30 2K@P^ @PX2[08#8 2K@PMSP)@E2[08#8 2Kz@P: @P42[ ;2K*K @P("[20 2K^@P&PKU @P2[08#8 U2KK@P  @P2[ "Q "K Q 0`02K2K"[0S0K2K"[+@P=@P9t0S @P @P 0 y@P2[ 08#8  K@P2[08#802K ^@P2[p08#8 2K@P M@P0p R2[2[;;2K2K"[@P00CS0S0S @PS4! A A A:40R? -LM0PSD1@0208#HP`>( R Q ( 9 Q7Q| & p0S6  R4`00CS)0.<\ 00CS(0@0P,Z/0\0P,0.\ K$1S ( Q0x0x00AS R 0BSQQ0 0QQ| Qz 0&@Kx0x00Sx0/ P2[p&$ KP2[p 0 Lt0pR;<;;;;;;;;;;;;;;@;h;;;;;P;P;P;P;P;;Rp Q00 AR0SQ0 ,0@S S^ Qp0Q2K Q (0S񟗊;;;;1S(  <P14*Z/\0P*<.\TQ "0KAP2[:j (00P)Q0#,>  xT3Q t0S0 02Qi 2Qf 2Q  3Q '!>CQ 4p0CQ v2QP 2Q 0 0`2Q 2Qz 0 02Q  0 0}`O42Q" 2Q aP0CQ% @0Q 0 0j 2Qe H 0CQ 0Q1Q D`0CQ 0Q0 0R 0LS0 0M0 0J0 0G 0 0D l1QY t1QV \1QP ,  "0KP 2[02 \0Q 0Q0Q 0Q7A9>CS|0Q 0Qu 0 0 Sm ( `!h!@_;`?B' T AP A0 A0 T AT AT A AA@M A APT -LM0PS 40S  0BRSR 0 0\0,0\ 0+\0 @, A؇0 , p R R 0BS%RE Rf 3 \P Ro RPm Rf0嫇0A S  Q R Q Q Q 0 0\0 , R 0BS0&, 8p&\ 0BSU0BSI0[,, }  8[,\b@"50Sq 0l@  0\0  3\02  <0 , : \0 ,}$0A S  Q Rx 0$, :$\ Q Qh0,, <4<,\QT0P$D4\K ~ %? 1S  3 \ӆ0S1S0#,I†^ 3 \l峆0 1\ 姆 0BS0,, ` 0 ,\0,,@ }`V 0 R0*0\0|"0\ < n P" 00CS @ ]0ASW0 , J@TP ?0 , : \0 , 30 6\L1 S03$08#$0K0 ,1[ 0 \ WP0qS 0D , '0p XP_eeeeT[ Na -L M pRe 0BSRRILPU1S 0ESU   R 0BS``R`F R` R R `PQ@0;! 0\0 ,0@ S @0;! 0\0P ,U: R% 0BSP P@ R -(0L@0  hUlU - 0L0 hU90 Q-L Q 9@  -L@0  0hUpU -LM:pᐁ ` 41 4 yPʆUL t@0P @PPt{P $ K 0$K$P00$ (0@$  0`0,0P  0 0 4, <0?8 |0"( Ƞ 0XPT @<hUlUL@#pU̔?- -L:@ -L4@OpenBSD5.7RAMDISK#34 @(#)OpenBSD 5.7 (RAMDISK) #34: Mon Mar 9 03:59:17 GMT 2015 OpenBSD 5.7 (RAMDISK) #34: Mon Mar 9 03:59:17 GMT 2015 miod@enfer.gentiane.org:/usr/src/sys/arch/armish/compile/RAMDISK %2K} }}}%}2> > >>> > > >>4x5x7r x@t xxxx4x5xxxxx6x 7xT8 t4j 5l@`@`7j @`6j@`4z`<<4t5r@`X@`TT``\\Pdd@4zll5~~4|X4zll5~~X4|r\jr]jr^jr_j\rj]rj^rj_rj|`@`H@`DD@`LLxx5r6r           xxxx(C|zHl>\l>pl>l>l>l>l>l>m>m> 4m> Tm> lm> lm> lm>lm>m>m>m>m>m>m>m>m>m>m>m>m>m>m>m>m>m> m>!m>"m>#m>$m>%m>&m>'m>x4q>08Hq>tTq>4\q>4hq>Dtq>$q>Dq>Hq>\q>$q>$q>4q>q>tq>0q>8q>@8q><r>@<r><r>H,r>LPLr>@`r>@`r>(lr>(|r>,r>,r>Pr>r>r>|r>r>r> s>!?$,dbEaL 8pP-%!T1;? 8#2!U#4@\ 0HP#+ "#P'()`5689:=`>K #(-2>'()*+,-./@ABCF'()*+,-./@ABCF/@ABCDEFGHIJKN'()*+,-./@ABCFMNO`abcdefghik*++,,--../-@@A&''(())**++,,-@02D0H0L0\0;51.`0,***|00 0 l(000400000#0  00 `4H< 4s"$4D#(444!,-./0 8  "%')`56<=>KVXZcfk3 3 3 3 3 3 3 3  3  3  3  3  3 3 $3 f`(3 h`,3 i`03 j`43 k`83 l`<3 n`@3 o`d3 h3 l3 p3 t3 x3 |3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3  3  3  3  3  3 3 $5 `(4 `,4 `04 `44 `84 `<4 `@4 `d5 &h5 (l5 *p5 ,t5 .x4 |4 4 4 4 4 4 4 5 B5 D5 F,?  04P H ,Fs"D#4 ?LGdthtt@tx@l@tp@@?XD + $3A,B8EF IQ7RbSjTV[\gij5:: u <<4400$,,0,,H((`((l((pLJ p eSL#< @p  A ! {X,              $ f`& g`( `, `. `0 `4 `6 `8 `< `> `@ `d f h l n p t v x | ~                    7 dKZ-B"5*#    a.@:4@x}CCCCCCDDDFFFGGG G%G CCCCCDDF G G eS./`xZYXzRC./`xZYX zC0&* ZYXzRC   MLKJJIHGGFEEDCBBA@?>=<;:987654210/-,+)(&%#! MMMLLLKKJJIIIHHGGFFEDDCCBAA@??>=<;:98765421/-+(%!  )ZYXCQR bwi_rf_workaround)ZYX +RCz i )) i ) I i i I) i) I I)i)i(h(h(h(h(h(h(hHH( h !H!!!("h""#H###H$$$H%%&h&&('''G((G))'**G++,g-G.g/G2&5F6&788F99f::f;;E<<===E>>>E??@E@@@EAAA%BeBBCECCC$DdDDEDEEEFDFFF$GdGGG$HdHHH$IdIII$JdJJJ#KcKKK#LcLLL#McMMM#NcNNN#OcOOPCPPPQCQQQ"RbRRRBSSSTbTTUBUUUBVVV"WWWAXXYaYY!ZZ[[[a\]] ^^_`a<1??????????*?7?D?P?]?i?v@@@@@@@@@@@@ @@&@2@?@K@X@e@q@~?????????????!?.?:?GT@<wlbQ@;53-/**'%!!%'**/-35;@Qblwzuqlgc^YTPKFB==========================BFKPTY^cglquz˓dfX&ئ͟8ʴ)ǎi+jlbsCv ViDz#((?-җ1h5u85;5=f>?@?r>e 5=5;/u8h5#1E(?- -(1#4T8;i= >C??b?l"?+=;85&Z2X.dϚ)m$bwi_phy_init_11b_rev2"u#k#d# n bwi_mac_testexpand 32-byte kexpand 16-byte k n;AvXaM ְdx %0%,%؛%8%4%@%%%H%%'l%Copyright (c) 1982, 1986, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. Copyright (c) 1995-2015 OpenBSD. All rights reserved. http://www.OpenBSD.org %%8%T%x%%%%%0%x%%&p&Mi $$p-i-iextent_freepool_p_freepr_find_pageheadpool_do_getpool_init@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~!#$%&'()-0123456789@ABCDEFGHIJKLMNOPQRSTUVWXYZ^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{}~Ͼ󨷵ǎԐѥ噞᷵ǎԐѥ???????????????????????????????? !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????Ub*V*Y*dW*'Y*W*'$W*V*(*'V*n; &C vkkMPG&"֊/aK+d 5ӆ1 q^h,`@yFgKrޔԘJk*OņךUfϊDx%K]?!HpcwucB0 mL5&/ᾢ5̈9.WUGz+2ўfD~T; ʌ)k<(yv;VdNtے lH]nCĨ917Ӌ2CYnڌdҜI%ϯʎGooJr\$8WsQ#|!>ݖa B|qؐ_jiX':'8+3"p3-"< IxPzY e1ƄÂ)wZ{m:,PPPPPPP>>>>>>(>4>@>H>P>\>d>l>t>>>>>>>>>>4?>ieee80211_newstate?@>,@3@0 9@G(4@9$?!>08\@0d>40>`>RD?UL9@p>T>|> >50>X>R>>@?7>6@7(>7> >4@>72>@7 >6>7>>6 >0,>@ >X$>!T(>,>6\0>5h4>t8>7x`>d@p<>lX>R`@>7|>7D>AH>HL>CP>JT>KX>\>`>@d>Ih>l>Ep>Et>x>|>>5>pb>7L>7>0?@>0'>>!>>.>>7B >7*>"l@O>\Ԓ>`|@J>h>7v>l>7X?z>`@>>H@7>B>7t>6>0?4d@E>6:@6 >0>G$>:>7H|h@Z>E\4@:^;@V>w>>7>@@@ @@ !" 1:7 25@608 943 @ A BC D@EFGHIJ K RSTU V X`abcdefgh ij>T>U>S>R>$>F,>I4>V<>EH>P>GX>`>Bh>p>Xx>>D>> >7>@>5>>2>6>>8>0>>9>>4>> > >3>h$>@,>4><>D>"L> T>!\>d>:l>t>1|>>H>@>J>K>A>>C> >>@> >>f>g>`>a>b>c>d>e>i>j$>,>,> arp_rtrequestigmp_init}E#(DoKgpqrstuvwxyz---l~-PQSeA~ä^':k;EXKU0 mvv̈%LO*ŀD5&bIZg%E]u/LFk_zmYR-!tX)iIDɎjuxyk>Xq'Of ɴ:}Jc1`3QESbwdk+XhHpElޔ{R#sKrW*Uf(µ/{ņ7(0#j\+ϊyiNeվb4ъĝS.4U2u9 `@q^Qn!>=ݖ>FMT]qoP`$C@wgB谈8[yG |B| H+2pNrZlV8ծ='9-6d !\hT[:.6$g WҖO aiKwZ *C"< Nj򹨶-ȩWLuݙ`&r\;fD4~[v)C#hc1cB@" Ƅ}$J=2m)K/0R wl+pH"dGČ?,}V3"NI8ʌ6 Ԙρ(z&ڤ?:, xP_jbF~Tؐ^9.Â]|i-o%;ȧ}nc{; x&Yn쨚Oen~ϼ!ٛ6oJ |)11#?*0f57NtʂАا3JAP/MvMCTMўjL,QeF^]5st.A ZgRے3VGmaךz 7Y<'5ah,4$8_@r %⼋I<(A q9޳ ؐVda{p2t\lHBWЧQPeA~S^':k;EXK0 Umvv̈L%O*D5&bZI%gE]u/LFk_眒zmYRڃ-!tXiI)ɎDujyx>Xkq'Oᾶ f:}Jc13Q`SbEwdk+hHpXElޔ{Rs#KrWUf*(µ/{ņ7ӥ(0#j\ϊ+yiNe;b4ĊS.4U2u 9`@q^nQ!>ݖ=>ݮMFT]qoP`$֗C@̞gwB谽[8y |GB| +2HprZlN8Vծ=9-6' d\h!T[.6$:g WґO aKwZi *"4$8,@_r% I<( A9q ؜Vd{a2p\lHtWBQPA~Seä':^;kEXK0 Uvm̈v%LO*5&DbIZ%gE]/uLFk_mzRY-tX!I)iɎDujxyXk>'qᾶO f}:cJ1Q`3SbEdwk+HpXhEޔl{Rs#KrWUf*(/ņ{7ӥ(0#j\ϊ+yiNeվ4bĊ.4SU2u 9`@q^nQ!>ݖ=>ݮMFTq]oP`$֗@Cgw谽B8[y|G B| +2HpZlNrV8=-6'9 d\h![T6$:. gWҖOa wZiK *"$8,4_@r %<(I A9q ޳؜Vd{a2plHt\BWQP~SeAä:^';kEXK U0mvv%LO*&D5bIZ%gE]u/LFk_zmYR-X!tI)iDujxyk>X'qOf }:cJ1`3QbESwdk+pXhHElR{#srKWf*U(/µ{ӥ70(#j\+ϧyNieվb4Ċ4S.U2ኤu 9@`^qQn>!=ݮ>MF摵Tq]o`P$֗齉C@gwٰB8[yȡG ||B 2H+plNrZV8=ծ6'9- dh!\T[$:.6 g WҖOa ZiKw *h8,4$_@r %(IKy xZݨ31Y'_`QJ -zɜ;M*q//^SShѹ,` @ȱy[[jjFˍپgK99rJJLLXXJυkл*媪OCCMMU33fEEPPD<KKܽa ppB>>|ĵqffHHaa_55jWWйiX':'8볘+3"iip٩3-"< I·UUx((PzߥY  ڿe1BBhhAA)w--Z˰{TTֻm:,ccƥ||ww{{ kkֽooޱőT00`PggΩ++V}׵bMvvʏEɉ@}}YYGG AԳg_Eꜜ#Srr[u=&&Lj66lZ??~ÃO44h\Q4qqثs11bS*? ǕR##FeÝ^0(7 / $6=&''Niuu ,,Xt4.6-nnܲZZ[RR;;vMַa}))R{>//^qSSѹh, @`y[[jjԾˍFg99rKJJLLXXυJлk*OCCMM33fUEEPP<!KKݽa܋ pp>>|Bqff̪HHaa£55j_WWiІX:''8+"3iiһ٩p3-<" ·IUU((PxߥzY e1BBhhиAAÙ)--Zw{TTm,:cƥc||ww{{ kֽkoޱoőT0`P0gΩg+V}+׵b׫MvvʏEʂɉ@}}YYGG AԳgԢ_Eꯜ#Srr[u·=&Lj&6lZ6?~A?̃O4h\4Q4qqثs1bS1*? ǕR#Fe#Ý^0(7 / $6=&'Ni'Ͳuu  ,Xt,4.6-nܲnZZ[RR;vM;ַaֳ}γ)R{)>/^q/SSѹh, @` yȱ[[jԾjˍF˾gپ9rK9JJLLXXυJлk*OCCMM3fU3EEPP!KKaܽ pp>|B>qĵf̪fHHa£a5j_5WWiйX:''8+"3iһi٩pَ3-<" ·IUU(Px(ߥzߌY  eڿ1BBhиhAA)-Zw-{˰TTmֻ,:ƥcc||ww{{ ֽkkޱooT`P00ΩggV}++bM櫫vvE@}}YYGG A쭭g_E꯯#Srr[u·=Lj&&lZ66~A??Oh\44Q4qqsbS11*? RFe##^0(7 / $6=&Ni''Ͳuu Xt,,4.6-ܲnnZZ[RRvM;;a}γR{))>^q//SSh,@` yȱ[[ԾjjFgپrK99JJLLXXJϻk*O媪CCMMfU33EEPPxD<<%K㨨QQ]@@?!pH88c߼wuBc!! 0mҁL &5/__5DD.9WU~~zG==Ȭdd]]2+ss``OODf""T~**; FF)kӸ(<y޼^^ v;dV22tN:: II Hl$$\\]½nCשּׁĦbb917yy2CnY77ڷmmd՜NNI੩شllVV%ʯeezzG鮮oպxxJo%%\r..8$WsǴQ#|tt>!KKaܽ pp|B>>qĵ̪ffHH£aaj_55WWiйX:''8+"3һiip3-<" IΪUUPx((zY  eڿ1BBиhhAA)Zw--{˰TTmֻ,: @6؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHG"(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDlɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~[/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxqg jgrn<:ORQhك[ 1Ѭߘr/Ḗ~&jE|,G$l iciNWqX~=t XrX͋qJT{YZ90`*#`(yA8۸y:`l>w'K1/x`\`U%U攫UbHW@cj9U*4\̴ATr|*oc]ũ+1t>\3֯\$lS2zw(H;Kkē!(f a!`|H2]]]u#&܈e>#Ŭom9BD . Ji^Bh!la gӫҠQjh/T(3Ql n;zP;*~ev9>YfCoEå}^;uos D@jVbNw?6r=B$7H ۛIrS{y%P;LylO`@ž\^c$johSl>9oR;Qm,0DE ^J3(fK.WtE9_ ӹyU 2`yr,@%g̣饎"2u<kaP/R=2`#H{1S>W\o.ViB~(2gsUO'[iXʻ]=!lJ[-ySeEIҐK3~ˤAb Lw6~д+MەqՓkю%ǯ/[{AI~-%^q h"W6d$ cUYCxSZ٢[} Źv&ϕbhAJsN-GJ{RQ)S?Wƛv`+t恵oWk *!ec.4dV]-SGjnpzKD). u#&İn}ߧI`fqilRdVឱ¥6)L u@Y>:䚘T?eB[k?ҡ08-M]% L&pc^?kh >\D}W7: P tAu8/;21>8TNmO Bo ,y|$ryVw.?rU$qk.P̈́GXzt}K:zfC cdG27;C$CMQe*P:qUN1w_V5kǣ;< $Y,n<pEㆱo ^*>Zw=Ne)։>%fRxL.jxS<- N=+6&9`y#RnfE{7(2åZl!Xeh;/ۭ}*/n[(!pa)uGa0a4c\s9pL ު˼,b`\ndi#PZe2Zh@*<1! T_~}=b7w-_h)5ǡޖXxWcr"ÃF T0.SHُ(1mX4a(s<|J]d]B> EꫪOlOBBǵj;Oe!AyMjGKPb=bF&[$ti GV[ Htb#*BXU >ap?#r3A~_;"lY7|`t˧@n2w΄PU5ai Z .zD4Egɞs͈Uy_g@Cge48>q(= m!>J=+hZ=@&L4)i Av.khq$j 3ԷCaP.9FE$tO!@MpE/f m1'A9UG%ښ ʫ%xP()Sچ, mbhiHפh'?Oz|Ϊ_7әxB*k@5 ٫9N;VmK1f&tn:2C[Ah xN جV@E'H::SU kKмgUXc)3VJ*%1?~^|1)p/'\,(H"m?H܆AyG@n]Q_2Տd5A4x{%`*`lc´2Of#k>3b $;" r(-Exb}doITH}'>AcG t.no:7`L knU{7,gm;e' )̒9 i{f} ϑ^و/$[Qy{;v.97yY̗&-1.Bh;+jLu.x7BjQ满PcKkؽ%=YBD n *Ngd_ڈ鿾dW{x`M``FѰ8Ew63kBqA_^;Z4ٷ,Q+:Ֆ}}>(-}|%rZLZq)GW;()f(.y_xU`uD^mm%adâW<'*:m?!cf&(3uU4V<wQ( gQ̫_QM08bX7 z{>d!Q2Ow~㶨F=)iSHd$m-if! FEdlX [@X̻k~jEY:D 5>ʹrdfGof,ҏ"W##v215VbuZ6ns҈bIPLVq z2E{Sb%ҽ5iq"|˶+v>S@`8G% 8vFšw``u N˅؍芰z~L\HjiԐ\-% ?2aN[wߏWr:j?$.Dsp"8 1).lN!(Ew8fTl 4)P|ɵՄ? Gy ~tn,fy3jXDD1Zs"*ˁc8:$zi HIĀ@8HުL H_%A@N$A UeQr% 9jyMc@hV 틕Z Vqק)N-fcqw*7 5Wa"ɠBր[t!h!hl iwW~@PճMװx QV$AV ʔUWnྵa$ XK'aU{whkldMDfd~i/IO70j5,s@IvM;B(HDLns) _ɋ}oaOw.+rץ<}+FYYEEهTNoHm| ǥcs_DVj͈prͳ]ny` E`1©\1BN"r\,rN@%/N2g@#x\n܃"ukMxnXO DH?{vw#Vu*F_( +8=6 JRft;QZylu eX&hJpFS(l\v0k)h76*g$ k%ֿh,DUueI40" WIbuU~bڨv^FESGml,gHL|3ەCh\SU2` ߝWc9^28aI37~^b<#NygCHKJf-ۄoH Ja)Yfc(` 0qt&@3/C~A^ l( ؒ0~of˜os*`ژ46K-%#= %IH6Jo8C@TzWOpA:Z„TU|5YŗZ:G:%Sj~=eI&TwQ[P]vlDȨ!帊iX`[ŗY)L;]J5ULkD$5鰽bעT/I18T(q)9H[/u@g+3-fVo*ɛ`( ')dMP˲,\26K_A !PNhذy\CPIMAC8wn\e0Rԋ@+>`xT7}02m-yyS"wuXȃoxkcZ\3]ùzv٣Byqj3ƚ`'PC=+mvN%ύHf6AN( aϩI=߹_d: }+p?PO+Zbbyj.H@,Z@"ғ-ES4n)olIIBr~V>olbfLTq*+9)XLVRf.S9v.i硦>iFt+LVvuOx39]O#2]2=&K/~~<O^?vf)o=E4ӷ+4grN=U"g`k8=ü0}8QcÐӝXyTGָaYwSW-XVcNx.F~eyUڑ0@5㶼P?!@=LXI6QpӱڍyKoqK 0ݻ맕d5w$,ϩ/ tцB*v:-7ޚ, )p@ :$7ѴyN] h1 HZ޻Bf1畏?r 3uQB}\cmd!@ WS1zݨ]3CoFq"8ԚέiGb[UgfN G[oLĎnrWxzdD]Ջ` l_9 ]c2֋~ pIPӻߘ)* mS~H~X.t;/RG'~[!<8zvOB9`55'{ɸ6g {pqT3^-ZId, =4pBwbO&Ҹ$d%FN`7>͕xE_{ ۫v"{.1ן%$r_m L=mPO%os#(ĴyI%4aĘnzn|l6AT޾'VAJJ{` ,8I%vK$%Gv XY f 0NndQ& #Phꃢ@0 /kz%?/?!M@`Iɟ'Կ@uИcnafŽ"o;h(Yy#P_w@CV/|-ҢɡHl4ma/T"2*kT:V"AӢ@f/9/Mҹ-?JDvR7,YQoz Zh{.T"5Y/mKdPIf-徐"3;䎴]4K@E?1.eUʱծ-mԢP @"8On ׿r[O/LVSTIiFXEŅc]ՊSW9j7=T*_}x:vbj Bz)^'rgP8ƌDŽZ*'JkѢ*V`C u\B&Ʉq-ls5&5 M{n0f&%HVV^c ϲc|E pPr(pH# yM;-AB G&LjMG\^ |Y#јr8S#/nqFnEV 9q +A|iCHy}B{BIZݿe\ [ ~iC?9zaz UQry吝5rNcZպ60ę _}֡{/6Y DYD̃Aѱ* ;{ B[A%zzӤ0XޘN?wiy{$[Ĭ%5P_aT1bcKU !h]Yfsc=4·~!+g\ab906;Wd/`:5F- 'zy㠌l0^7%oo;j tE'4:NiOM>dY58EfCr3c%N? (Υ'R¦սTUdpfM w&ۄgC!`X0TroSUGڿ]bVhkʃ;n-Ӧ\= wL3{9+^S_aodC x^c"&gI{ڷ"%-U^7rRyL H[k0 cq/޹ S E!5(T<)c)A|-nRPf4,0P1`sY&D\dwR3A+ٺ|o!PaH?ek«dv&4{^% ;MM1$~I,;jx`]sVz\/1Co0TyXR^/2zj0>՚1B°I #ڸ(0q_`ɣaM/Ǚ."płNؼ40y;'ƸaiH?;(ZC/v7ܱӧßn>ƼB7Q(heRwj-K'5.n\ )^XOX{iT̨g&H`K`8# ~8lI `s5GƱVL>#8d^BFzk Od^AE#\;]>rC|m~ll9`qpsv#E@]%=`GK6DήPQH<p}}d^(O= &g.yr?U+HԼ?^!@WNFRWs3NɷdŸW1O g_?@k{C=K۵cUȗn-J(JqoCCl< _P/~׿PZG.Q>pX.0_|r *,]I鎸P'WIoyR}}Yr@EEt]>uOiVA#. '`vteyvvwHNma}/ 4H<0(Ow Vܒ M"7)}V'|@|硴f^aÝ <є`AFv\;x,WGl"}NC~8<=Q8d{h'فI]j~vh]9K9 ;#Im<Eub'z\aBΒ~Brrp }ȡ[(Ob<51)BSjO[}m(Ki\j#MŌ?,-ҖXRg[HJI \EkӉ7`:SRqDIK @sg4|~q6UO/Т`?mPьGnU?墼38Wg} =3{r3O̫]ňv{{uWBdBc+ri/n+_mazgaq%9̸L!gуb>ܷν8\ =Dmn`I:T`H'W+8$ ږ%Eh;}E `P/(b4 ٠m+1+dZ0RXBA\1>26F3S75 {s{OJWdCQz(~c5_ yCdcdJ$_(͸O@C " 0 O7-{$MgQLq_-_d !S^>'_aB%rqK=;&o~~TLmDl߫I&Ǡ36~?Pa w8Pr.PwWFgOT3ɏ1 i5M\=fȦ[]oڑo/"F}F9mOCCN!и  ?X(>nH&p׋wt|% - y#;(8itb߷@!{7Ȋ@ YVvO@/{U MVi35'#WȯVeka^u˅nwU2?-ɿ[%;з$;mc fÀ(82 Tɪס2Zb,gTzuw11&o6F HjyZVLj~CRv/ t,t* M|k .TA5B=!&|,aRe1i%& !\1cr ^Iy p1 d>>̶Ոî 0rlqn/kءDVÈ9/ű1(x⤣2}o~X$Ū{s0a!-!)۳*)e\,0?Б\,ԩT _w:^VxV޾\!uQųåҶw#)Ei/z毲p[v F98/gsD)k)/Ifingӛ/~p%Q^$Slj>!DYܷ)eyCy9A+MWN )zkS< ~U3rŅ?~                               A@@@A@@A@@@@A@@@A@@@@@@AAA@@@@@@@@@@@@@A@@A@@A@@@A@A@@A@@A@@A@@@@A@A@@A@AA@AA@@AA@@@AAA@A@A@A@A@                              @@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@                                        0 0 0  0 0  0 0  0           0  0 0 0 0  0  0  0          $$  $ $ $$  $ $             $$  $ $ $$  $ $                  0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0                            ((  ((  ((  ((  ((  ((  ((  ((          """"   " " " " ((((((((    """" ( ( ( ("("("("(  ##%%&&))**,,//1122447788;;==>>@@CCEEFFIIJJLLOOQQRRTTWWXX[[]]^^aabbddgghhkkmmnnppssuuvvyyzz||66666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\Z H!x-ML.RN8D( `hz=Skc|j9{Б/Uڅ?AZX_f ؐ53eiEVmv° GJBnI[#Q")yq~ ruo7ӎbwO$26󦻬^lW%㽨:Y*F?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@hc//@U///Pd0b0b0lc0>8i0\c0>b0b0>uao_find_swhash_elt(GiX)i,GiMiMiMi,Gi|3ovmmapbsy\nd6_rtrequest0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-     A@!  @a`10  @`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O      A@!  @a`10  @`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O @@ !1Aa  0@` #+3;CScsx"4$4$4 $44 44 4 4 4P?`?dd>l?x?????dd>   L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c            (08@P`p   0@`  0@`_bus_dma_busaddr_to_paddrA?=A?= A?=`A?=A?=`A?=`A?=`A?=PT?=A?= A?=D?=D?=i?T= i?= i?= $i?=0$i ?= ,i?=0,i ?= .i0?T=0.i@?T=!iP?= !iX?=)iP?= )iX?=-iP?=Ai`?= -iX?=Aih?=Aix?=Ai?=`A?=`A?=PA ?=pA ?=A ?=A ?=/A ?=?A ?=A ?=A 0 ?=/A D ?=?A X ?=OA l ?=A ?=A ?=/A ?=?A ?=OA ?=t> ? ? ? ?!? !?!?!? !?,!?4!?@!?H!?X!?`!?p!?l!?x!?!?!?!?!?!?!?!?!?!?!?"?"?("?8"?H"?X"?`"?h"?p"?x"?"?"?"?"?"?"?"?"?"?"?"?X"?"?"?"?"?"?"?"?"?"?"?"?"?"?"?"?X"?"?#?p"?x"?"?"?"?#?#?#?"?"?"?"?(#?`"?h"?p"?4#?@#?L#?X#?d#?p#?"?"?"?"?"?"?|#?#?h"?#?#?#?#?#?"?"?"?"?"?"?"?"?(#? $?4#?$?$$?"?"?"?"?"?"?"?"?"?"?"?(#?4#?h"?p"?x"?"?"?"?"?"?"?"?"?"?"?"?(#?`"?h"?p"?x"?"?"?"?"?"?"?"?"?"?"?"?(#? $?4#?@#?L#?$?"?"?"?"?"?"?"?"?"?"?(#? $?4#?@#?$?0$?0$?8$?"?"?"?"?"?"?"?"?D$?`"?h"?p"?x"?"?"?"?"?"?"?"?"?"?"?"?4&?|4&?4&?|4'?04$'?D'?04\'?|'?04'?'?04'?'?04(?$(?04<(?\(?@````` ```x1?1?1?1?1?1?1?1?1?1? 2?2?,2?82?H2?k@\2?|2?2?2?2?2?3? 3?D3?`3?3?3?|6?3?3? 4?,4?L4?p4?4?4?4?4?4?5?85?h5?5?5?6?06?d6?6? 6? 6? 47? p7? 7?7?8?T8?t8?8?8?9?89?h9?9?9?:?0:?L:?t:?:?:?:?;? 0;? H;? `;? t;? ;? ;? ;? ;? ;? ? ,>? L>? l>? >? >? >? ?? ?? T?? p?? ?? ?? ????@?4@?P@?d@?@?@?@?A?@A?XA?pA?A?A?A?A?B?(B? @B? PB? dB? B? B?B?C?0C?LC?lC?C?C?C? D?4D?PD?dD?D?D?D?D? E?(E?DE?dE?E?E?E?E?$F?PF?F?F?F?F?$G?LG?G?G? G?H?@H?xH?H?H?H?I?$I?PI?lI?I?I?I?I?I?$J?J?``?>`?>`?>`?>`??a??4a??La??la??a??a??a??a??b?? b?? 0b?? Pb?? db?? |b??b??b??b??b??c??c??4c?@Pc?Apc?Bc?Ce?Dc?Dqc?Ed?F d?G8d?GLd?Gld?Gd?Gd?Gd?Ge?G4e?Hde?Ie?Je?Ke?Ke?Ke?Kf?K f?K0f?KDf?K`f?Lpf?Nf?Pf?Pf?Pf?Q g?Qg?RPg?S`g?S|g?Sg?Sg?Sg?Sh?S h?SP?\?dd>p?|????dd>??dd>??dd>?ȍ?dd>?ԍ?dd>dd>܍?dd>??dd>? ?dd>??dd>$?,?8?@?D?dd>?L?dd>T?`?t?x???x???x??Ў?؎?dd>??dd>??dd> ??dd>?$?dd>4?$?dd>X?`?dd>4?p?dd>4??dd>??dd>??dd>?ȏ?dd>ԏ? dd>dd>dd>dd>dd>dd>dd>dd>dd>dd>dd>dd>?dd>dd>dd>dd>dd>dd>dd>dd>dd>dd>dd>dd>dd>dd>dd>dd>dd>dd>dd>dd>ni5ni5@666666@$@eaQ@X@W@@0@ w@Q2@U@4@F s%^^D@6p6 6D@6p6 667x7L7<.7`7ugen_set_configtI7E7C7D7I7,S7dR7=*=R,= 6-=]J-=.=:/=Iz0= 1=J1=R1=7T2= 2= 2= 2= "3=K23=3=@#3=3=3=3=3=3= 3=3=H@3= N4= _4=r5=6=\l8= $9= <9= $9=ER9= 9=m9=K:=Ad;=[;=<=0<= ==*>=j8/?9:;<=>?@ABC D E FG HIJK,L.MN-OPQRS T/U*V-W+X Y1Z2[3\4]5^6_7`8a9b0c.eh i jklmnopqrstuvwx yz{|}~ mMqQ@zy2" 3#6&$7/{%8([&9)]'0=}-?\./0+*1#'2#'345 6,;7.:8-_d<>| .'`0+*~5^q,?azw&12~ "3#!'4{"(5[#-6|$7`%_8\&9^'0@-)].=+}/0$1*2*3m4%56;.7:/8!d<> bBeE hH iI jJkKlL|,?nN~aArR,sSzZyY2 "3!'4"(5{[#6$7%!8&9%!8'0-)}].-_/0$*2`@#3mM4%5@#7:/\8=+g= aAkK~xX}iIpP& eE ,; c d tsrqQ'?ljbB|oOuUv.:yY{!\"12< 3>!(4[")5]#@6$+7%-8&/9'*0, _-=^.%`/z0w123n4m5$#6gG7h8fd/ 2"@ 3#!4$#6&$7/{%8([&9)]'0=}-+?.|/01'*2'*3456,;7.:8-_d<>\ .'`|0^~2" 3"5%#6&$7/%8(&9)'0=-'?.^/{[0+*}]123@4#5\|6,;7.:8-_d<> 1!2" 3!4$"5%#6^$7&%8*&9('0)--_.=+1#~2#~4'@5``d\|2"#6&$7'%8(&9)'0--=.^~/@`0[{1]}2]}3;+4:*5\_\|-+?\0345d<>| .'`|0^~.\0345|d<>.\`0^~xje.> u i d c htnbrl'"poygk,<qf;:-[{.]}//?0=+3s4-_6w7v8z9: ;<=>?@ABCD E 1!|2"@ 3#!4$~#6&$7/%8(&9)'0=-'?./[0+*]1}2}34{5\6,;7.:8-_d<> q,?azw&1|2@ "3#!'4"(5#6^$7%!8&9{'0}-).-_/[0$*]1`2`3m4%56;.7:/8=+~d<>\ aAD$bB8cCA!dD2eEC# fF0 gG? hH@  iIH( jJ>kK;lL4mML,nNB"oOI)pP7qQ9rR:sSK+tT5uU3vV<wWF&xXG'yY=zZO/#6^6,$7&7./[{E%0]}J*3;:64'"M-6,<17.>N.8/?Q aAD$bB8cCA!dD2eEC# fF0 gG? hH@  iIH( jJ>kK;lL4mML,nNB"oOI)pP7qQ9rR:sSK+tT5uU3vV<wWF&xXG'yY=zZO/#6^6,$7&7.--_V.=+T/[{E%0]}J*1\|W2\|W3;:64'"M-5`~6,<17.>N.8/?Q eEzy1+|2"@ 3*#!4#6&$7/%8(&9)'0=-'?./[0!]1$}2$}34{5 6,;7.:8-_d<>\ -'?.^`~0!]/[34{2"@ 3##6&$7/{%8([&9)]'0=}-'?.<>/+*012345\|6,;7.:8-_d<> .+*/2\|4eE a`~}kj!1@-2_ /3#!;4$":5#,6^$.7&%=8*&[9(']0), -?+'.xX%//.{0wW}1qQ|2qQ|3sr4"5`~6   7fF 8\ qQ@1!2" 3##6&$7/%8(&9)'0=-'?\./0+*~1}]2}]34{[5|6,;7.:8-_d<> 1!2@ 3#!4$"5%#6.=+/0[{1]}2]}345'"8;:c.d\|/? 1IqQ@2' 3^#!4+$"5%#6&$7/{%8([&9)]'0=}-*?\.-_/0~1,;2,;3_^4i05"678.:d<>| /1,;`2,;`3_^'aAcCeElLBAnNDCoOsS[ZxXzyzZ|{ bB{cC& fF[ gG] iI jJnN}qQ\vV@wW|xX#zZyY>1'~2" 3+^!4!"5%#6/$7=`%8(&9)'-./QP01qp2qp3$4506,?;7.:8-_*d< bB{ fF[ gG]kKBlLAmMnN}qQ\vV@wW|zZyY1!~2" 3#^!4$"5%#6&$7/`%8(&9)'0=-'?.+*/a`01~}2~}3  456,;<7.:>8-_d<> mMoOpP1!2"@ 3/!4$"5%#6?$7&%8*&9('0)--_.=+/[0']1<>}2<>}3;:~4{5#|\6,'7..8d /^^[0]4``{8aAcC  eE gG#" iI+*kK76lL<;nNFEoOMLsSa`uUkjzZ~} cCmMrRsSxXzZ1!2" 3#!4$"5%#6&$7_%8({&9)}'0'-/?\.'/0*|1<>2<>3+45@6,;7.:8-=d][ .~/"^4'`eEqQ@2"#6&$7/{%8([&9)]'0=}-\.-_/0'?~1+*`2+*`3456,;7.:8d<>| 4^    _7T_7@_7`7_7h`7xe7a7a75dd5(I*LBCDOMPJQNRK(I*LCDEOMPJQNRK`Dm7|k7jm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-_8_8^8hF F hF fF  s8 q8p88p88x8ؙ88url_int_miibus_writeregurl_int_miibus_readreg@@9WP P Q@888L888`VV !y`V'V%V&V3V4VPVIVVVVVVVVVV}  H(02135HPPQ nY ol\k] ih^_mZ[Xj 2``` ```x     tq?=:>9;<8pq8     JKLIؼټy`ؿۿٿڿHIJprsq"`r``xȽPW8P3 & & & & & & & & & &     < < < l F F ! ========== = = = = =================== =!="=#=$=%=&='=(=)=*=+=,=-=.=/=0=1=2=3=4=5=6=7=8=9=:=;=<===>=?=@=A=B=C=D=E=F=G=H=I=J=K=L=M=N=O=P=Q=R=S=T=U=V=W=X=Y=Z=[=\=]=^=_=`=a=b=c=d=e=f=g=h=i=j=k=l=m=n=o=p=q=r=s=t=u=v=w=x=y=z={=|=}=~=================================================================================================================================0 B9 !PPPPPPPPPPPPPPPPPPPPPP PPPP PP PPPP PP PPPPPPPPPPPPPPPPPPPPPPPP: :  !R R !R !R !R !R R "R !"R "R ""R "R #"R $R !$R 1$R A$R $R "$R 2$R B$R $R #$R 3$R C$R (R !(R 1(R A(R Q(R a(R q(R (R (R "(R 2(R B(R R(R b(R r(R (R (R #(R 3(R C(R S(R c(R s(R (B@  >d l888G W WnPnPA   !^y 4Xhp9{#{{{{ rS#S&@'ah 33.U 1(Ex$ #h8880    \888   &  l! eT`88h8@P888 B  Q  X888=beeK #(-2>'()*+,-./@ABCF'()*+,-./@ABCF/@ABCDEFGHIJKN'()*+,-./@ABCFMNO`abcdefghik*++,,--../-@@A&''(())**++,,-   Pp < @@???l@?Pt@??? ??? ?$??,?4@0B@4?d@@D?@L?T? l? ?x????4@??t@???????? ???? ??(?,?0?8?@? H?0P?@`?l?x?D@|?D@l???8l@ ?????? ?!??T@??>???(?0?D?T? ?`?Hn=l?ln=|?n=?Po=?o=8-?o=?p=?p=?q=? `q=? q=x? q=? 8r=? r=?(s=?@s=>|s=?s=?`?)g?:g?%h(?2h8?6hH?rh`?3it?ri?q?q?q? q?0q?4q?5q?6q?#r,??k??k@?kA?kB?kC?kE?kF?kG?kH?kI?kJ ?kK ?kL(?kO0?kP8?kQD?kRP?kS`?kT`?kU`?kVl?kW?kX?kY?kf?kg?kh?ki?kj?kk?kE?8?8?D@푠?홠??? ? ,?08?`D?pP?\?h?t??? ?0?`?p???????[?! ?!0?!B@?!P?!Bh?Cu@x??P1?Q1?R1?T1?U1?P>?T>?p>?6A$?7A4?DAD?EAT?FAh?GA|?HA?IA?JA?KA?PA?QA?RA?SA?TA?UA?VA?XA?dA?pA$?qA8?rAL?sA`?7Bp?BB|?CB?6C?7C?AC?BC?EC?GC?HC?IC?LC?MC?SC?TC?XC ?aC,?bC8?cCD?eCP?gC\?hC\?iCh?lCt?mC?nC?pC?qC?rC?sC?tC?uC?vC?wC?xC?yC?zC?{C?C?C ?C,?Cg@@@gP@Ag`@Bgp@Cg@Dg@Eg@Fg@Gg@Hg@Ig@Jg@Pg@Qg@Xg@Yg@[g@]g@_g@`g@ag(@bg8@cg@@dg@eg@fg8@gg8@hg8@pgP@qg`@rgp@xg@yg@{g@g@g@g@g@g@g@g@g@g@g@g@g@g@h(@h8@hH@hH@hT@ hd@hH@hH@hH@hH@ht@h@ h@!h@"h@#h@$h@%h@&h@'h@(h@)h@*h@+h@-h@/h @0h @1h@5h@7h @8h@9h@;h0 @=h@ @?hP @@h` @Ahp @Bh @Ch` @Ih @LhH@Ph@Xh@Yh@h @h @h @h @h @h @h @h @h @h( @h8 @hH @hX @hp @h @h @h @h @h @h @h @h @h @h0 @hH @h` @hp @h @h @h @h @h @h @h @h @h @h @h @h( @h8 @hH @hX @hh @pt @p @q @q @q @q @q @q @q @q @ q @ q @ q @ q @q @q$ @@q4 @AqD @BqL @Cq` @Dqp @Eqx @FqL @Gq @Iq @Jq @Kq @Lq @Mq @Nq @Oq @QqD @Rq @Sq @^q @_q` @`q @bq @qL @q4 @q8@qL@q @q\@q\@qt@qt@q@q @q` @qt@q@q@q@q@q4 @q@q@q4 @q@q$@q<@q<@q4 @qP@q`@qp@q@q@q@q@q@q@q@r@r@r@@r@Cr(@Dr@Er(@Fr(@Gr(@Hr(@Ir(@Jr(@Kr(@Lr(@Mr(@Nr8@Or(@rP@rd@rd@rl@rd@r@r@r@r@r@r@r@rd@r@r@4x@5x@y @y,@y8@yD@y8@y8@y8@y8@yP@y`@yp@?y@Ay@By@ly@my@ny@oy@@@@@@ @ @@@ @A@B0@C@@DT@Fd@Jt@K@L@N@P@R@V@Z@[@^@`@b@j,@k@z@{@<@T@T@l@|@@@@@@@t@@@ @@ @,@<@ÔP@Ĕd@Ŕ|@ǔ@Ȕ@ɔ@˔@̔@͔@@@,@<@X@ p@@@@@@@@O@R@S@U@W0@_@@X@p@@@@@@@@@,@D@\@p@@@•@ĕ@ŕ@ƕ@Ǖ@ɕ @̕ @͕0@Ε@ϕ@<@L@\@L@l@x@@@@A@B@C@D@E@G@H@I@J@K@L@N@O@ @8@H@X@p@@@@@@@@@@ @ @@ @0@@@P@P@`@p@ @ @ @ @ @@@@0@`@p@@@@@ @0@@@P@`@p@@@@@@@@0@@@@ @(@0 @88@PP@Xh@`@h@@@@@@@PG@C(@P8@D@ L@!T@\@d@l@t@t@t@t@t@t@t@|@@@#@$@'@)@*@+@,@-@.@0@2@4@6@\@t@\@t@l@t@@@@ @i& @iH$@ib(@ic,@is0@i0@i4@i<@iD@iL@iH T@i` (@ib (@iX@`@l@x@#@#@@#@@#@@@@0!@P!@R!@D@D @D@D@;Y@`@ `@p@$@,@4@@@VH@4l@vP@\@d@9p@:x@;@<@=@>@@A@B@C@D?E?F@G@H@I@J @L @M @N$ @O0 @P< @SH @TP @U\ @Vd @Wl @Yt @Z| @[ @] @^ @_ @b @c @e @h @i @j @k @n @o!@r!@s !@t,!@w4!@xB3@$ 3@$03@$P 4@$Qo@$4@$%,4@$<4@$L4@$\4@$ l4@$!|4@$"4@tq4@tP4@tX4@]4@]h4@]i4@]x4@]4@]5@]5@]5@],5@](<5@]8(P5@](l5@|5@5@o#pH?5@85@?5@?5@?5@?Ā5@?Ȁ5@?5@?5@R5@T5@X6@'6@'6@,6@W86@WD6@WL6@W\6@Wl6@W|6@W6@W6@s6@s 6@s6@6@6@6@6@7@ 7@7@6(7@47@@7@L7@X7@FPl7@pt7@|7@<7@<7@<7@< 7@<(7@<)7@<07@<18@<H 8@<T$8@<48@<D8@<P8@<\8@<p8@<)8@<*8@<.8@<8@< 8@<!8@<"8@<#9@<$9@<&(9@<(<9@<)P9@<*d9@<!x9@<!9@<!9@<!9@<!9@<!9@<!9@<!:@<!:@<!(:@<!8:@<!L:@<!`:@<!t:@<!:@<2:@<2:@<2:@<2:@<2:@<2:@< 2:@<"2:@<#2:@<%2:@<02:@<12:@<22:@<32 ;@<42 ;@<524;@<62:@<72 ;@<82:@<92:@<:2:@<;2:@<<2:@<=2H;@<A2\;@<C2p;@<E2;@<G2;@<I2;@<J2;@<K2;@<3D@<3;@<3;@<3<@<3<@<3?<P3 <@<Q34<@<R3H<@<S3\<@<T3p<@<U3<@<V3<@<@<@@<@<@<@<@<@<@ <@3 =@3!=@3"=@3|@34@3`@T=@T5 =@T5,=@7!8=@@=@D=@T=@ d=@p=@t=@=@=@ @=@"=@.?6=@>=@W=@=@p=@=@?=@=@=@ >@$ >@4>@D>@P>@.\>@:h>@@j>@>@OI">@P>@`>@>@>@>@>@ ?@ !(?@ "0?@&P8?@'P@?@(PH?@IP?@SX?@(`?@5p?@?@9?@@?@A?@B?@C?@D?@E?@F?@H?@I?@?@?@?@?@?@?@@@@@@@@@4@@D@@T@@4@@D@@T@@h@@ D@@ |@@ D@@@@@@"@@&@@0@@1@@2@@3@@4@@5@@6@@7@@P@@Q@@R@@T@@U@@V@@X@@Y@@Z@@]@@bA@fA@jA@ (A@ 4A@&,K@',K@)HA@*HA@,\A@0pA@2pA@5A@@A@AA@pA@rA@?@?@ ?@ ?@?@A@A@A@?@A@"?@&?@*?@+?@.?@8A@:A@<B@@B@(B@8B@LB@XB@dB@pB@pB@|B@|B@B@B@B@B@B@B@B@B@C@C@C@C@4C@4C@LC@LC@hC@C@Z C@[ C@` C@b C@d C@S C@ ?@ C@ ?@ ?@ ?@ D@ ?@ ?@ ?@ ?@ ?@ ?@" ?@& D@* ?@+ ?@. (D@ xG@@G@CG@HG@IG@JG@KG@LG@MH@PlG@QlG@RxG@SxG@TxG@UxG@VxG@WxG@XxG@Y H@^H@_H@`H@d H@elG@fxG@gxG@h,H@iN@AN@pN@qN@rN@N@N@N@N@ O@ O@ O@N@ N@ O@O@O@O@O@O@O@O@O@ ,O@"@O@&PO@-PO@1`O@:pO@;pO@=O@DO@FO@IO@JO@SO@UO@VO@WO@XO@YO@]O@^P@_ P@P@P@ P@(P@(P@(P@(P@8P@HP@\P@ lP@!lP@"|P@#|P@,P@0lP@1lP@2|P@3|P@8P@9P@:P@;P@<P@@P@AP@EP@"P@#P@##P@&#Q@0# Q@2#Q@4#,Q@5#,Q@B#8Q@C#8Q@D#8Q@E#8Q@F#8Q@G#8Q@H#8Q@I#8Q@`#DQ@#Q@$TQ@$`Q@$lQ@$xQ@$Q@$Q@$Q@ $Q@!$Q@"$Q@#$Q@%$Q@&$R@($R@@$$R@B$0R@C$(\@O(\@0(\@1(\@2(\@3(\@4(\@5(\@6(\@:(\@?(\@A(\@C(\@E(\@G(\@I(\@K(\@O(\@P(\@)\@)]@)]@)]@),]@)8]@ )H]@!)H]@")T]@#)T]@&)H]@()H]@))T]@*)`]@-)H]@.)H]@0)l]@2)|]@4)]@5)]@6)]@7)]@8)]@9)]@:)]@<)]@>)]@@)]@B)]@D)]@F)]@H)]@J)]@L)]@p)]@q)]@r)]@s)]@t)]@u)]@v)^@w)^@)^@)(^@)4^@)4^@)@^@)L^@)X^@)d^@)d^@)t^@)t^@)^@)^@)^@)^@)^@)^@)^@)^@)^@)^@)^@)^@)_@)_@)_@)_@)_@),_@)8_@)D_@)P_@)P_@)\_@)\_@)h_@)x_@)_@)_@)_@)_@)_@)_@)_@)_@)_@)_@)_@)_@)_@)`@)_@)`@) `@)0`@*<`@*H`@*T`@*T`@*``@*l`@*|`@*`@*`@*`@*`@*`@*`@*`@@*`@A*`@B*`@C*`@D*`@E*`@F*`@G* a@.a@a,Pd@b,Pd@-Pd@-$a@-0a@-k@-k@.@a@.La@.Xa@.Xa@.da@.da@.pa@.|a@ .a@!.a@".a@#.a@).a@0.a@1.a@2.a@3.a@B.a@.a@/a@/a@/a@/a@/a@/a@/a@/a@/a@ /a@ /a@ /a@/a@/a@/a@ /b@!/b@"/b@#/b@$/b@%/b@&/b@'/b@(/b@)/$b@*/4b@,/Lb@0/\b@2/pb@3/pb@4/|b@6/b@7/b@h/b@n/b@o/b@p/b@q/b@}/a@/pb@/b@/pb@/b@/b@/pb@/pb@/b@/b@/b@/b@/\b@/c@/c@/c@/c@/c@/b@/b@/c@/c@/,c@/,c@/c@/c@/,c@/,c@/8c@/8c@/8c@/8c@/8c@/8c@/8c@/8c@/b@/c@/c@/,c@/,c@/c@/c@/,c@/,c@/Dc@/Dc@/Dc@/Dc@/Dc@/Dc@/Dc@/Dc@/Dc@/Dc@/Dc@/Dc@/Dc@/Dc@/Dc@/Dc@/Dc@/Dc@/Dc@/Dc@/Dc@/Dc@/Dc@/Dc@/Tc@/Tc@/Tc@/Tc@/hc@/hc@/hc@0tc@$1c@e1c@2c@@3c@A3c@B3c@4c@4c@4c@4d@ 4d@ 4d@ 4d@ 4d@ 4d@4d@4d@4d@4d@4d@4(d@"48d@#4Dd@%4Ld@&4Ld@'4Ld@(4Ld@)4\d@*4\d@+4\d@,4\d@-4ld@.4xd@04\d@14\d@24\d@34\d@84d@?4d@5Y@5d@ 5d@5Y@5Y@5Y@5Y@5Y@5Y@u5d@v5d@w5d@5d@5d@5e@5e@5(e@58e@5De@5Pe@5\e@5te@5e@5e@5e@5e@5e@5e@5e@5e@5e@5e@5e@5e@5e@5e@5e@6f@6f@6f@6f@6f@6f@ 6f@ 6f@ 6 f@ 6,f@ 6Df@6Xf@6df@6df@:pf@:f@:f@:pf@:f@:f@:f@:f@ :f@":f@%:f@&:f@0: g@4:g@5:g@6:g@7:g@8:g@9:g@::g@<:g@>:(g@@:;h@?;h@B;?@D;?@F;?@H;?@J;?@L;?@N;?@P;?@V;h@W;h@d;h@e;h@f;h@g;h@Pll@?Pk@@Pxl@DPxl@HPxl@Rl@Rl@EXl@el@el@el@el@el@el@el@el@el@el@el@el@el@el@el@el@el@pm@pm@ pm@0p(m@q0m@q8m@qLm@qXm@qdm@ qtm@!qm@"qm@#qm@$qm@%qm@qm@qm@qm@qm@qm@qm@qn@qn@q n@q,n@q8n@qDn@qTn@qTn@q`n@vhn@xtn@n@n@n@ n@n@n@n@n@n@n@n@n@n@n@o@o@o@o@o@o@(o@o@o@4o@Ą@o@ńLo@ʄ`o@˄to@o@o@o@o@o@o@o@o@o@ o@ o@ o@ o@ o@o@o@o@p@p@p@p@o@p@p@(p@4p@@p@\p@xp@xp@p@p@p@p@p@p@xp@ xp@p@p@p@p@p@p@p@p@p@p@ p@"p@$p@&p@-p@1q@:q@;q@< q@=0q@D@P@Q@R(@S8@TD@UD@VT@WT@Y`@Zp@[p@\|@]@^@`@d@e@fȈ@gԈ@hԈ@j@k@l@m@n@~@(@8@L@\@h@h@x@@\@@@@Љ@@@@@,@8@L@T@\@l@\@x@x@@@L@\@@@̊@܊@@@\@@@$@8@܊@D@X@h@x@@@@@ȋ@Ћ@܋@@@@@AX@BX@D@F@P$@Q4@R@@SP@a\@el@g|@p@q@r@t@ǔ@v܌@x@y@z@{(@|8@H@\@t@@@@@̍@@@@@(@8@8@H@T@`@l@|@@@@@@Ď@Ԏ@@@@@@@@@@@@4@@@P@`@!\@@l@A|@B@D@G@P@QЏ@S@X@Y@[@`(@a(@b(@c(@d4@e@@fL@gL@hX@iX@kd@lp@m@n@o@p@q@r@~@@Ȑ@@ܐ@@@@(@8@H@H@H@H@H@H@H@H@@@@T@T@T@@@`@x@@@@đ@!ؑ@"@$@&@'$@(@)@+4@,H@-\@0p@1@3@C@GĒ@HĒ@`ؒ@aؒ@bؒ@cؒ@dؒ@eؒ@fؒ@gؒ@h@i@j@l@m@n @p@q @r0@s0@t<@u<@v<@w<@x<@z@~H@H@(@8@T@d@t@t@t@t@t@t@t@t@@@@@@@@@@@@@@@@@@@@@@@@ȓ@@@@@@@@(@(@@4@@@@@@L@L@X@`@@@@l@|@ @!@"@'@(Ԕ@@@A@D@E@F@H @I@J$@K$@L4@M4@N4@O4@P@@Q@@R@@S@@TL@UL@VL@WL@XX@YX@ZX@[X@\d@]d@^d@_d@p@3@;@A@B@C@G@HЕ@Lܕ@Mܕ@Nܕ@Oܕ@P@Q@R@S@T@U@V@W@X@Y@Z@[@\ @] @^@_@`(@a4@b@@c@@hL@i\@jh@lt@m@n@o@@@@@"̖@ܖ@@@@@QL@R @S,@TL@Y@@ZL@[\@\X@]X@^X@`d@ad@bd@cd@tp@up@vp@wp@x\@y\@zL@{@|@}@~@@@@@@@@@@@@@@@@@@@@@@@̗@ܗ@@@@@@@@@@@@@@@h@E @G0@I@@Kܖ@LP@a`@cp@l@}@@@e @ @ @ @ @ @ @ @ @ @ @ И@ ܘ@ @ @ @ @ @ @ @ @ И@ @ @ @ @ @ @ @ @ @ @ @ @ ,@ ,@ ,@ ,@ 8@ 8@ 8@ 8@ D@ D@ D@ D@ И@ И@ И@ И@ И@ T@ T@ T@ T@ `@ `@ `@ `@ l@ l@ l@ l@ x@ @` @h @i @v @y @z ̙@{ @} @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ ,@ ,@ 8@ L@D\@Ep@F@G@H@Ip@K@M@Q@Ԛ@@@@@@$@@4@D@T@h@x@N@@@@!@EWŰ@EXż@Ehț@Ehԛ@E!@E@E@E"@Ea@1 @@$@,@ 4@!<@@D@L@T@\@d@l@x@ @@@@ @ @ @̜@@@!@#@$@ 8@h L@ X@d@!m@Bl@Myxt@Mxt@@@@@ȝ@fԝ@fܝ@f@fܝ@f@f @f @f@f@f,@f,@f<@f<@fL@f6\@fh@fd@fx@f@f0@f2@f@@fA@fB@fD@f@fȞ@fО@f؞@f@f@f@f@f@f@f  @f!0@f#<@f%H@f'T@f0H@f4`@f@l@fAt@fB@fJ@fK@f@f@f@c@c @П@@@@ @  @ 0@1a@@1b@@10qL@13qX@14qd@15qp@11r|@P@f@f@f@f@f@Ƞ@0PԠ@@v@w@ e@ @@$@0@<@$H@%T@2`@3l@Gx@H@@@@@@$̡@2ء@H@$@@P@@ @Z0 0@Z8 <@ZuH@Z3T@Z3`@Zq3l@Zr3x@Zs3@Zu3@Zv3@Zw3@Z5@Z5@Zp5̢@Zq5آ@Zt5@Zw5@Z=@Z=@Zs=@Zu= @Z ?,@Z0M8@Z3MD@Z8MP@ZhM\@ZiMh@ZuRt@ZS@Zhb@Zib@Zf@Z f@Z!f@Z&fģ@Z)fУ@Zurܣ@w@w @w"@w@w @w@@w @w!8=@w"(@w#0@w#8@w"#@@w"$H@w2$P@w%X@w"%`@w2%h@w0p@w"0@w20@w@@w"@@w2@Ԥ@w"T@w2T@wc@w"c@w2@@@ @(@0@8@@@H@ 2@@P@X@`0`@b0h@0\~@0p@0x@2@2@b5@5@5@S@@@̥@1إ@`@p@1@@0@`(@!`4@%`@@1`L@@`X@``h@a`t@ R@'R@)R@IR@RЦ@R@R@)@9@) @6(@80@90@g8@h@@iH@rP@X@`@vh@xp@,@,@|@6@6@e@f@u@vЧ@w@x@!@Q@R @0@"D@2T@Cd@Rp@0|@"萨@#蠨@2谨@R@z Ш@3S1V@3S@3S@3S@3S@3S@3S= @3S,@3S4@3S@@3SˆL@3SÈX@3SЈd@3Sшp@3S҈|@3Sӈ@3S@3S񈠩@3S򈬩@3S󈸩@3Sĩ@3SЩ@3Sة@3S@3S@3S@3S @3S!@3S" @3S# @3S%,@3S&<@3SL@3SX@3Sd@3St@3S@3S@3S"@3S$@3S&Ī@3S*ت@3S+@3S,@3S- @3S.8@3S/P@3Sh@3Sp@3S|@3S@3Sʜ@A@}@Mȫ@Mԫ@Mܫ@#@O@O@O@H@?HC@H C@HD@H@H!$@HC,@H4@H<@H@!\@H@\@p@x@ @ @ @J@J @J@JF@dȬ@Ь@#@9@9@9@9@91@9 @9@9 $@9 1@90@9<@9H@9T@9`@9l@9p@9t@9@9 @9@9%@9@9@9@90@9@ȭ@9PЭ@9ح@9 @90@93@95@9@@9E @9F@9H@9I$@9P,@9Q4@9R<@9UD@9VL@9XT@9a\@9bd@9ql@90t@93|@95@9@@9A@9E@9F@9H@9P@9Q@9RĮ@9U̮@9VԮ@9`ܮ@9a?9 @9a @9b @9c @9d @9e @9f @9h (@90@9<@9H@9T@9S`@9Sh@9Up@9Ux@9U@9U@9qU@9U@9U@9U@9U@9Uȯ@9bد@9b?@9c k@9ch@9%c@9&c@90c@9p@9p@9p@9p,@9p8@9pD@9pX@9pd@9sp@9u|@@@@@o@o@oȰ@o а@oذ@o@o @o @U0@U`@Ua@Ub@Uc$@)4@)D@)BId@) a@M @M9@M@Mı@M̱@Ա@@@@@@D@+@P @TT@UT @\,@8@D@D@P@d@x@@ͫ@Ĝ@@@!x?#@! @!x? hq@ hrIJ@̲@4Բ@ܲ@@b@@@ @@e@W @=!(@=!(@!4@"4@ 0@@0H@0P@)X@ id@l@;'t@;4@;5@L@L=@L=ij@Lس@L @L@L@L(@L <@L!P@L#d@L$x@L%@L&@L'@L)ȴ@L*ܴ@L+@L.@L1@L2,@L3@@L4P@L5\@L6p@L8p@L9@L:@L;@L<ĵ@L=е@L@L1@L2@L3$@L>D@L?X@L@l@LAH?L@L@Lf@L@L@L@Lȶ@Lض@L@L@L@L@L(@L8@LH@L \@L!d@L"l@L#t@L(|@L@@LA@LB@LD@LFķ@LGԷ@LH@LI@LJ@LK@LL@LP@LQ(@LR8@LSH@LTX@LUh@LVx@LW@LX@L`@L@Yd@ĸ@/ ظ@/ @//@yd@y4@y@y @y$@y4@yH@y 4@yh@y`@yt@y|@# @# @#@# @#@# й@#@# @# @# @#P(@#`4@#@@#L@#X@# h@#@t@#%@#`@#@#@#P@#P@#к@#ܺ@#`@@ @@(@4@@@L@ 2`@ 2l@ 2x@ 2@ 2@ G@@@@ ̻@ ܻ@P@PP@R @RR@SPW3,@`8@`H@`X@`h@`|@`@`:g@`@`j@`@`@`ȼ@`м@`ؼ@`4@`@`@@@@65@ @ @` 8@`L@\@8h@Xt@Y@i@@@@@$Ƚ@'Խ@6@Q@S@d@@@(@0@a<@qH@vX@d@p@@@@@@о@@@@@@& (@8@H@"X@\@8h@Xt@Yh@ix@@@@$Ƚ@'Խ@6@Q@S@d@q@@"\@8"h@X"t@Y"@i"x@"@#@#@$#Ƚ@'#Խ@6#@Q#@S#@d#@z(@{(@|(@}(@~(ȿ@80ؿ@@0@C0@D0@P0@Q0(@S08@W0L@X0\@Y0l@e0x@h0@t0@0@0@1@1@1@1@1@1@1@1 @14@"1<@#1D@G1P@H1\@I1h@W1t@d1@h1@w1@x1@1@1@2\@2@2@2@'2@02@82h@I2@J2@K2Ƚ@N2$@S20@X2t@Y28@i2x@2@2D@2@$3Ƚ@'3Խ@63@73P@C3@D3@I3\@Q3@S3h@d3@q3t@r3@z3@{3@24@B\@8Bh@XBt@YB@iBx@B@C@C@$CȽ@'CԽ@6C@QC@SC@dC@8R@S@$S@'S@6S@7S@QS@SS @dS@rS,@a?8b@b<@b@'cH@Sc@dcX@r\@rh@s@'sԽ@6s@Ss@ds@8rh@Xrt@Yrt@irx@r@s@$sȽ@Qs@1@5@@$@S@@ @@@@@ @@0$@Е4@8@@'H@S@dP@X@d@p@|@@h@@@S@@@8@@'H@S@dP@ @8@@8@@S@8@@S@%tq@@@@$@4@<@D@L@T@ \@ d@ l@ t@ |@@@@@@@@@@@@@@ @,@8@ D@!P@"\@#h@$t@%@6@7@8@9@:@;@<@=@>@?@f@g@h@i(@j4@k@@mL@nX@od@p@|@@@@@@@@@`@a@@ @ @@@(@8@ P@ X@`@h@p@x@@@@@ @@@p@t@xH?yH?d@@@@8?@w@@@@@@1@1@2@B$@0@Jh@P8@P@@@P@ P@Ped@Pt@PZZ@Pf@J@E!@E$@SX@ @!@@@]@]@]@]@] @] @]@] @]8@]@@]L@s\@s`@sd@sh@s l@s p@s x@s@sT!@s d@@8@ @@W`T@ a@{!@{!@{!@@=@p@W@u@@ @@@(@,@<@D@ T@ X@d@l@p@?@@"@#@%@(@)@+@,@/@1@3@6 @7@9,@<0@B@@CP@DX@E\@Hd@Jl@Kx@L@M@N@P@T@U@W@Z@[@]@`@a@f@i@k@q@s @t@w(@x0@}8@~@@L@`@h@p@t@@@@@@@@@@@@$@,@0@<@T@\@h@t@@@@@@@@@@@@@ @$@4@<@L@X@h@ l@ x@ @@@@@@'@1@7@8@<@?@B@H@O@Y @](@c0@f<@rH@y@P@@X@d@l@t@@@@@@@@@@@@ @@4@@@H@4P@?X@D`@Md@Y@[p@]ܨ?`x@l@o@t@y@z@@@@@@@@ @ @(@0@8@H@T@J\@Mh@Zp@`|@q@t@v@@@@@@@@@@@@  @(@4@@@%H@2P@=X@Ed@Ml@Ot@a|@b@@@@@@@@@@@@@$ @8@;@b$@,@4@@@H@P@\@d@|@@8@W@`@{@}l@@@@@@%@7@ @;@T @}$@,@4@H@\@`@h@t@x@@@@@@#@$@1@W@i@q@{@@@@;,@0@<@!H@6P@K@oX@s`@p@@@@ @3@==@@D@3@@@@@HCp@OI@J@FP@SP@3S0@rS@SX@tc@ff @4@P@X@`@J@.u@l@l@t@@@'$@Y@@@@@}}}} } > > > >  >> ! >> >:2L:":0:.:v:p:q:4:q:ʄ:$:!$:J$:K$:$:$:$:$:$:$:$:$:%:%:%:&:o&:S&:Q&:R&:':':':':':':': (:!(:"(:$(:%(:((:)(:*(:P(: ):!):&):():-):.)::::: ::&::&: ;:!;:&;:(;:-;:.;::::`:::: :::: :::: :::: ::: :!:0:1: :!:(P:&#:#:: t:t:At:it: : x:@p:C:F:H:I::1:5:@:1e:q:q:d1::$S:: ::I1|:I2|:|:7S|:rS|:I3|:,:U:|:|:|:|:x::)R::::::3M:8M:0 :0M:hM:hb:iM:ib:u:uR:ur:3{:3{:q3{:u3{:v3{:w3{:s3{:r3{:={:5{:={:5{:w5{:q5{:u={:t5{:p5{:s={::::: :@:@:@:@:@:@d:Ad:Bd:Jd:Kd::e::::S:5:e:n::H:`:l:Y:|:|:|:T|:U|:6|:>|:f|:g|:~|:|:|:|:|:\|:]|:^|:_|:P|:Q|:R|:S|: |: |: |: |: |: |: |: |: |:::IC:iC:vC:C:C:nC:yC:zC:a#:c#:e#:f#:h#:P@:`:C>_"xG>G> 8H>H>9H> (I>@I>LI>J>f K> ZI>K>-M>M>{,N>hN>tN>w! ]G4" eB"   w! ]G4"    XD31P@0qw!! rq! 2r!qq! 0          JtT4$&(`& 0&0 0 `"0 0    @DHL  @DHL  @@@@2""  222CC @ @WD2?2?  YCC6higW xv|w   &'(yz{u^_`}~&  3678{|9:;ZY'8:<@ !"#$@EALJKMIL)@PDPHPqqqq (((((((((2222222<<<<<<<<<FFFFFFPPPPPPZZZZZZZZZddddddddddddddnnnnnnnnnnnnnnnnnnxxxxxxxxxx   #&) !%),036:=#(,159=ADHKOR(-38=BFKOSW[^beh<BHMRW\`dhloruwySY_dimqtwz|hmrvy|rrrr;Y2w2(w2Xw2'w28w2Hw2hw`0b0000b555C C!CC$CCCCC%Ctargetlunsizewidthxintchanneldriveconsolemuxconfigurationinterfacevendorproductreleaseportnoreportidphydevfunctionwsmuxbioloopbpfilter%s:%d: %s %s(%s:%d:%d): %s %s(%s:%d:%d): using BIOS timings using PIO mode %d, DMA mode %d, Ultra-DMA mode %ddrive at %s channel %d drive %datapi type: %s c_bcount: %d c_skip: %d missing untimeout%s channel %d: reset failed for drive 0 drive 1%s: transfer error, downgrading to Ultra-DMA mode %d %s: transfer error, downgrading to DMA mode %d %s: transfer error, downgrading to PIO mode %d wdccmdwdcxferwdctagged DT %s: target %d now using %s%s%d bit async 80.040.020.013.310.06.675.03.33?? MHz %d REQ/ACK offset xfers %s: bad offset in siop_sdp (%d) %s: ppr negotiation for target %d: no DT option %s: ppr negotiation for target %d: offset (%d) or sync (%d) out of range %s: ppr negotiation for target %d: sync (%d) incompatible with adapter %s: ppr negotiation for target %d: transfer width (%d) incompatible with dt %s: rejecting invalid PPR negotiation from target %d %s: rejecting invalid wide negotiation from target %d (%d) %s: switching to differential mode %s: switching to single-ended mode %s: switching to LVD mode %s: invalid SCSI mode 0x%x %s: timeout waiting for DIFFSENSE to stabilise clear fifo failed %s: unable to allocate script DMA memory, error = %d %s: unable to map script DMA memory, error = %d %s: unable to create script DMA map, error = %d %s: unable to load script DMA map, error = %d siop: can't find my sync parameterssiop: resel switch full%s: can't malloc memory for target %d %s: can't alloc lunsw for target %d %s: can't alloc siop_lun for target %d lun %d %s: untagged command already running for target %d lun %d (status %d) %s: can't allocate memory for command descriptors head %s: can't allocate memory for command descriptors %s: unable to allocate cbd xfer DMA memory %s: unable to allocate cbd sense DMA memory %s: unable to create data DMA map for cbd: error %d siop_start: bad status%s: request sense failed %s: unable to load data DMA map (for SENSE): %d %s: scsi bus reset cmd %p (tag %d) added to reset list cmd %p added to reset list from urgent list cmd %p added to reset list from ready list cmd %p (status %d) reset with status %d, xs->error %d timeout on SCSI command 0x%x INTRF single step dsp 0x%08x dsa 0x08%x %s: DMA IRQ: illegal instruction bus fault parity DMA fifo empty, DSP=0x%x DSA=0x%x: last msg_in=0x%x status=0x%x current DSA invalid %s: scsi gross error %s: unexpected phase mismatch %d %s: phase mismatch without command parity error %s: selection timeout without command %s: unexpected disconnect without command %s: unhandled scsi interrupt, sist=0x%x sstat1=0x%x DSA=0x%x DSP=0x%x %s: script interrupt (0x%x) with invalid DSA !!! %s: command with invalid status (IRQ code 0x%x current status %d) ! error, DSP=0x%x %s: reselect with invalid target %s: reselect with invalid target %d %s: target %d reselect with invalid lun %d %s: target %d lun %d tag %d reselect without command %s: reselect with invalid tag our reject message was rejected scsi message reject, extended message sent was 0x%x scsi message reject, message sent was 0x%x unhandled message 0x%x %s: extended message too big (%d) MSG_IGN_WIDE_RESIDUE: bad len %d invalid retval from siop_iwr()invalid retval from siop_wdtr_neg()invalid retval from siop_sdtr_neg()reselect failed %s: done without command, DSA=0x%lx unknown irqcode %x != NULL%s: siop_intr() - we should not be here! istat = 0x%x, dstat = 0x%x, sist = 0x%x, sstat1 = 0x%x need_reset = %x, irqcode = %x, siop_cmd %s %s: unable to load data DMA map: %d siop%s: %u (%d dBm) Unknown PRISM2 chip%s: Firmware %d.%02d variant %d, Symbol %s: %s%s (0x%04x), Firmware %d.%d.%d (primary), %d.%d.%d (station), %s: unsupported crypto algorithm %d %s: wi_do_hostdecrypt: iv mismatch: 0x%02x%02x%02x%02x vs. 0x%x %s: wi_start: dropping unassoc dst %s %s: host encrypt not implemented for 802.3 %s: wi_start: xmit failed %s: wi_cmd failed with %d %s: wi_scan_timeout: %d tries %s: invalid data path: %x %s: failed to allocate %d bytes on NIC %s: device timeout %s: init failed %s: wi_mgmt_xmit: xmit failed wiiocwiscan%s: tx buffer allocation failed %s: mgmt. buffer allocation failed %s: wi_cmd_io: busy bit won't clear %s: timeout in wi_cmd 0x%04x; event status 0x%04x %s: received packet of unknown type on port 7 %s: received packet on invalid port (wi_status=0x%x) %s: oversized mgmt packet received in hostap mode (wi_dat_len=%d, wi_status=0x%x) wihap: failed to copy header %s: oversized packet received (wi_dat_len=%d, wi_status=0x%x) %s: Error decrypting incoming packet. : unable to read station address address %sWaveLAN/IEEE nodeIBSSwlanwiLucent WaveLAN/IEEESony WaveLAN/IEEELucent Embedded WaveLAN/IEEEPRISM2 HFA3841(EVB2)PRISM2 HWB3763 rev.BPRISM2 HWB3163 rev.APRISM2 HWB3163 rev.BPRISM2 HFA3842(EVB3)PRISM1 HWB1153PRISM2 HWB3163 SST-flashPRISM2 HWB3163(EVB2) SST-flashPRISM2 HFA3842(EVAL)PRISM2.5 ISL3873PRISM2.5 USBPRISM2.5 ISL3874A(Mini-PCI)PRISM2.5 ISL3874A(PCI-bridge)PRISM3 ISL37300PPRISM3 ISL37300P(PCI)PRISM3 (USB)%s: unknown imtype %d%s: reset never completed! %s: PHY write failed %s: PHY read failed %s: stopping TX poll timed out! %s: stopping TXQ timed out! %s: bad phy register %x %s: tried to map busy TX descriptor %s: tried to map busy RX descriptor %s: unknown bus speed, assume 33MHz : unknown ASIC (0x%04x): %s (0x%04x), %s, address %s %s: can't allocate tx listseg, error = %d %s: can't map tx list, error = %d %s: can't create tx list map, error = %d %s: can't load tx list, error = %d %s: can't create DMA map for TX %s: can't allocate rx listnseg, error = %d %s: can't map rx list, error = %d %s: can't create rx list map, error = %d %s: can't load rx list, error = %d %s: can't create DMA map for RX %s: no PHY found! %s: watchdog timeout RTL8100RTL8100ERTL8100E 2RTL8101RTL8101ERTL8102ERTL8106ERTL8401ERTL8402RTL8411RTL8411BRTL8102ELRTL8102EL 1RTL8103ERTL8110SRTL8139C+RTL8168 1RTL8168 2RTL8168 3RTL8168C/8111CRTL8168CP/8111CPRTL8168F/8111FRTL8168G/8111GRTL8168GU/8111GURTL8105ERTL8168D/8111DRTL8168DP/8111DPRTL8168E/8111ERTL8168E/8111E-VLRTL8168EP/8111EPRTL8169RTL8169/8110SBRTL8169SBLRTL8169/8110SCdRTL8169/8110SCeRTL8169S%s: probed fifo depth: %d bytes : unknown uart : ns8250, no fifo : ns16450, no fifo : ns16550, no working fifo : ns16550a, %d byte fifo : st16650, no working fifo : st16650, %d byte fifo : st16c654, 64 byte fifo : ti16750, 64 byte fifo comattach: bad fifo type%s: console %s: can't establish soft interruptcomcninit: mapping failed%s: %d silo overflow%s, %d ibuf overflow%s comprmRT5222unknownRT2522RT2523RT2524RT2525RT2525eRT2526%s: could not write to RF %s: could not read from BBP %s: could not write to BBP %s: timeout waiting for BBP %s: can't map mbuf (error %d) %s: could not enable device %s: could not allocate protection frame %s: sending mgt frame failed 0x%08x %s: sending data frame failed 0x%08x %s: could not load old rx mbuf%s: could not create desc DMA map %s: could not allocate DMA memory %s: can't map desc DMA memory %s: could not load desc DMA map %s: could not allocate soft data %s: could not create DMA map %s: could not allocate rx mbuf %s: could not allocate rx mbuf cluster %s: could not load rx buf DMA map%s: MAC/BBP RT2560 (rev 0x%02x), RF %s %s: could not allocate Tx ring %s: could not allocate ATIM ring %s: could not allocate Prio ring %s: could not allocate Beacon ring %s: could not allocate Rx ring ralRT2529 (MIMO XR)RT5225RT5325 (MIMO XR)RT2527ral-rt2661ral-rt2561ral-rt2561s%s: error %d, could not read firmware %s %s: timeout waiting for MCU to initialize %s: timeout waiting for NIC to initialize %s: MAC/BBP RT%X, RF %s %s: could not allocate Tx ring %d %s: could not allocate Mgt ring %s: could not load 8051 microcode RT3053RT2820RT2850RT2720RT2750RT3020RT2020RT3021RT3022RT3052RT3320%s: timeout waiting for DMA engine %s: could not read RF register %s: could not read from BBP through MCU %s: could not write to BBP through MCU %s: timeout waiting for BBP to wake up %s: can't map DMA memory %s: could not load DMA map %s: radio is disabled by hardware switch %s: timeout waiting for MAC %s: could not allocate Rx mbuf ral-rt2860%s: error %d, could not read firmware file %s %s: MAC/BBP RT%X (rev 0x%04X), RF %s (MIMO %dT%dR) %s: could not allocate Tx pool %s: reset rx ring timedout %s: can't select regwin %d %s: invalid max txpower in sprom %s: no tssi2dbm table for 11a PHY %s: bwi_rf_calc_txpower failed %s: only BCM2060 rev 1 RF is supported for 11A PHY %s: only BCM2050/BCM2053 RF is supported for supported for 11B PHY %s: only BCM2050 RF is supported for 11G PHY %s: unsupported PHY mode %s: %s is not implemented yet %s: unsupported 11A PHY, rev %u %s: unsupported 11B PHY, rev %u %s: unsupported 11G PHY, rev %u %s: unsupported PHY type %d %s: too many MACs %s: %dth MAC already attached %s: MAC rev %u is not supported %s: can't select regwin 0 %s: no BBP id for device id 0x%04x %s: no number of win for BBP id 0x%04x %s: bus regwin already exists %s: no MAC was found %s: no bus regwin was found : 64bit bus space not supported %s: MACs bus space mismatch! %s: config PS failed %s: can't stop MAC %s: invalid IV image, ofs %s: invalid ofs (0x%04x) for %dth iv %s: invalid IV image, val32 %s: invalid IV image, val16 %s: invalid IV image, size left %d %s: load IV failed %s: load ExtIV failed %s: firmware (fw & pcm) loading timed out %s: firmware version 4 is not supported yet %s: invalid firmware (%s): invalid size %zu %s: invalid firmware (%s): size mismatch, fw %u, real %zu %s: invalid firmware (%s): type mismatch, fw '%c', target '%c' %s: invalid firmware (%s): wrong generation, fw %d, target %d %s: base tssi measure failed %s: TEST1 failed %s: TEST2 failed %s: %s failed, MAC status 0x%08x %s: %s failed, intr status %08x COMunknown regwin type 0x%04x%s: %s disable clock timeout %s: %s wait BUSY unset timeout unsupported rate %dbad paddr 0x%lx impossible lna gain %dunsupported lpdunknown PHY mode %u%s: zero tx id %s: wait for TX ring(%d) stable timed out %s: reset TX ring (%d) timed out %s: can't create %dth tbd, %dth DMA map %s: can't create spare RX buf DMA map %s: can't create %dth RX buf DMA map %s: can't allocate %dth RX buffer unsupport modulation type %u%s: invalid rate %u or fallback rate%s: prepend TX header failed %s: can't load TX buffer (1) %d %s: can't defrag TX buffer %s: can't load TX buffer (2) %d unsupported modtype %u%s: zero length data, hdr_extra %d : could not allocate TX mbuf bounce buffer : cannot create TX mbuf DMA map : could not allocate RX mbuf bounce buffer : cannot create RX mbuf DMA map : could not allocate ring DMA memory : cannot create ring DMA map (error %d) %s: can't load DMA mem %s: can't create txstats ring DMA mem %s: can't allocate txstats ring DMA mem %s: can't map txstats ring DMA mem %s: can't load txstats ring DMA mem %s: can't allocate txstats DMA mem %s: can't map txstats DMA mem %s: can't load txstats DMA mem unsupported bus space type %d%s: %dth TX ring DMA alloc failed %s: RX ring DMA alloc failed %s: TX stats DMA alloc failed unknown LED event %d%s: %s invalid channel! %s: can't set channel to %u bwi-airforceucode%d.fw%s: error %d, could not read firmware %s! pcm%d.fw%s: no suitable IV for MAC rev %d b0g0initvals%d.fwb0g0bsinitvals%d.fw%s: no suitable ExtIV for MAC rev %d %s: PHY calibrate failed %s: can't initialize %dth TX ring %s: can't initialize RX ring %s: can't initialize TX stats ring %s: invalid MAC address: %s unknown phymode %d%s: can't drain TX status %s: intr fatal TX/RX (%d) error 0x%08x intr PHY TX error %s: EO_ATIM %s: intr noise bwiuhci_alloc_std_chain: mps=0 uhci_device_setintr: 0 interval uhci_device_isoc_close: %p not found uhci_abort_xfer: not in process contextuhciabUHCI root hubuhci_device_isoc_enter: xfer=%p in frame list startstop%s: cannot %s %s: controller did not reset %s: unable to allocate pool descriptor uhcixfer%s: interrupt while not operating ignored %s: host system error %s: host controller process error %s: host controller halted uhciohci_setintr: 0 interval ohci_device_isoc_abort: early return ohci_rem_ed: ED not foundohci_add_done: addr 0x%08lx not foundohci_abort_xfer: not in process contextohciab%s: isoc TD alloc failed OHCI root hub%s: %u scheduling overruns %s: resume detect %s: unrecoverable error, controller halted %s: blocking intrs 0x%x ohcixfer%s: reset timeout %s: SMM does not respond, will reset ,, legacy support version %d.%d%s %s: unsupported OHCI revision ohciehci isoc xfer being freed, but with no itd chainehci: isoc xfer suddenly has 0 bInterval, invalidehci_check_itd_intr: not valid itd ehci_check_qh_intr: not valid sqtd ehciiawehciabehci_open: bad device speed %d%s: Error opening low/full speed isoc endpoint. A low/full speed device is attached to a USB2 hub, and transaction translations are not yet supported. Reattach the device to the root hub instead. ehci: opening pipe with invalid bInterval ehci: zero length endpoint open request EHCI root hub%s: port reset timeout %s: halt timeout ehci: isoc descriptor requested that spans the entire frametable, too many frames ehci: unexpectedly ran out of isoc itds, isoc_startehcidiehci_abort_xfer: not in process contextehciaw%s: disable schedules timeout %s: run timeout ehcixferehcidbehci%s: unable to start background operation invalid data offset%s: %s: illegal block count for %s %s: %s: illegal cmdlen for %s %s: %s: %s: invalid chunk state%s: %s: invalid volume state transition %d -> %d could not requeue I/O%s: sr_wu_enqueue_ccb got active wu%s: sr_wu_init got active wu%s: invalid target on wu: %p%s: i/o error on block %lld target %d b_error %d unknown optional metadata type%02x%02x%02x%02x-%02x%02x-%02x%02x-%02x%02x-%02x%02x%02x%02x%02x%02x%s%s%s: %s: %s: invalid chunk state transition %d -> %d %s: sr_startwu_callbacksr_schedule_wu: work unit not in progress (state %i) sr_sync%s: invalid optional metadata checksumunknown old optional metadata type %u %s: no in memory copy of metadata %s: could not allocate metadata scratch area %s: could not write metadata to %s %s: save metadata failed OPENBSDSR %s%03dsr_shutdownsr_down%s: roaming device %s -> %s %s: sr_scsi_cmd NULL discipline %s: %s device is being deleted, failing io %s: wu %p not on pending queueunable to allocate work unitsunable to allocate ccbsvolume %s not found%s has unsupported sector size (%u)could not allocate memory for metadatacould not allocate memory for foreign metadata%s: sr_rw: failed to allocate vnode %s: I/O error %d on dev 0x%x at block %llu failed to get DUID for softraid volumeinsufficient boot storagefailed to write boot blockfailed to write boot loadercould not save metadata to %s%s: sr_meta_rw: invalid metadata pointer cannot clear foreign metadatanot enough memory for metadata buffercould not read native metadatanot part of the same volumenot all chunks are of the native metadata formatsrc_dev_mm == NODEV%s%d%cdiscipline does not support rebuildrebuild already in progressvolume not degradedno offline chunks available to rebuild%s: sr_rebuild_init: can't allocate vnode %s partition not of type RAID (%d)%s partition too small, at least %lld bytes required%s partition too large, wasting %lld bytes%s is already in userebuild of %s started on %s%s: no offline chunk found on %s! %s: %s volume degraded, will attempt to rebuild on hotspare %s sr_hotspare%s: pending I/O failed to complete on failed chunk %s, hotspare rebuild aborted... %s is already a hotsparesr_hotspare: cannot allocate vnodeHOTSPAREcould not save metadata for %sunsupported state request %dchunk not part of arrayinvalid foreign metadatanot valid softraid metadatainvalid metadata checksumcannot read metadata version %u on %s, expected version %u or earliersr_meta_native_bootprobe: cannot allocate vnodenot enough memory for fake disciplinesr_meta_native_bootprobe: cannot allocate vnode for partitionnative bootprobe could not read native metadatasr_meta_probe: cannot allocate vnodesrdiscould not create discipline taskqcould not initialize disciplinechunk %s already in useinvalid metadata formatdisk %s is currently in use; cannot force createfailed to clear metadataone of the chunks has corrupt metadata; aborting assemblychunk sizes are not equal; up to %llu blocks wasted per chunkvolume level does not match metadata leveldisk %s already assembledtrying to bring up %s degraded%s was not shutdown properly%s is offline, will not be brought onlineno free target for %sscsi_probe_lun failedvolume %s is roaming, it used to be %s, updating metadata%s volume attached as %ssdwd%s: failed to allocate boot volume %s: failed to allocate device array %s: failed to allocate ondisk array %s: failed to allocate hotspare %s: found duplicate chunk %u for volume %u on device %s %s: not all chunks were provided; attempting to bring volume %d online sr_locksr_hs_lock%s: controller registration failed%s: bogus rebuild restart offset, starting from 0 %s: resuming rebuild on %s at %d%% %s: could not create read io %s: could not create write io sr_rebuild%s: could not save metadata to %s sr_yieldsoftraidsr_concat_rw%s: %s: too many ccbs queued %s requires two or more chunksCONCATsr_crypto_rwcannot open key disk %s%s has unsupported sector size (%d)%s partition not of type RAID (%d) %s is not a key diskCRYPTOKEYDISKunknown crypto algorithmunable to allocate CCBsincorrect key or passphrase%s requires exactly one chunksr_raid0_rwinvalid strip sizeRAID 0%s: retrying read on block %lld %s: sr_raid1_intr_cb%s: permanently failing write on block %lld sr_raid1_rw%s: is offline, cannot read invalid volume stateRAID 1%s: permanently fail write on block %lld sr_raid5_rw%s: %s failed to get read work unit%s: is offline, can't read %s: %s: invalid volume state transition %d -> %d%s: %s: %s: invalid chunk state transition %d -> %d%s requires three or more chunksRAID 5sr_raid6_rw%s: can't get wu_rDisk %llx offline, regenerating Dx+P Disk %llx & %llx offline, regenerating Dx+Dy +Q singleDisk %llx offline, regenerating Dx%s old_state = %d, %d = %d, invalid new_state%s requires four or more chunksRAID 6RAM diskfictitiousrdattach: out of memoryrd%drdattach: device name too longhfsc_enqueue called on hfsc-less kernelhfsc_purge called on hfsc-less kernel%s: insufficient message buffers %s: %s /mnt/etc/firmware/%sRRIP without PX field? SPIEEE_1282IEEE_P1282RRIP_1991ARRIP with incorrect NM flags? RRIP with incorrect flags?isoinodefhtovp: lbn exceed volume space %d fhtovp: crosses block boundary %d fhtovp: bread error %d fhtovp: directory crosses block boundary %d[off=%d/len=%d] cd9660_vget: alien ino_t %lluCD001%/@%/C%/Ecd9660_mountroot: can't setup bdevvp'scd9660root_devicetag VT_ISOFS, isofs vnode cd9660_strategy: specOpenBSD#!/dev/fd/%d/dev/consolewarning: /dev/console does not exist warning: /dev/console error %d initexecinit: couldn't allocate argument spaceexec %s: error %d init: not found no initswapperfork initcfpendcannot mount rootcannot find root vnodepagedaemonfork pagedaemonreaperfork reapercleanerfork cleanerupdatefork updateaiodonedfork aiodonedzerothreadfork zerothreadscheduler/sbin/init/sbin/oinit/sbin/init.bakbqquiesbqqueuebqwaitbqdestbufq_init: type %i unknownbufq init failbqinitinitclocks: unable to register softclock intrfdlockfileplfdescpldup2: fdallockqreadkqueueplknoteplwaitinit died (signal %d, exit %d)thrdeathcpu_exit returnedprocprocessppwaitunable to allocate kthread_qWARNING: thread `%s' (%d) exits with status %d %d,malloc: allocation too large, type = %d, size = %lu malloc: out of space in kmem_mapmallocarray: overflow %zu * %zuphysiochgproccnt: procs < 0procinit: mallocprocplprocessplzombieplucredplpgrpplsessionplplimitplcpu_switchto returnedfork idleidle%dsensorssensorsuspendpauseissignal sigaplsigwaithashinit: bad cnt%02hx%02hx%02hx%02hx%02hx%02hx%02hx%02hx%s:%s,sysctllksysctldlkthrsleep%s%s(%d)Timecounter "%s" frequency %lu Hz -- Insufficient hz, needs at least %u Time stepped from %lld.%09ld to %lld.%09ld dummynanosleepdenied attempt to set clock forward to %lld denied attempt to set clock back %lld seconds boredunexpected %s tq state %dunable to create thread for "%s" taskq unexpected %s tq state %utqdestroysystqsystqmppreempt: cpu_preempt not yet implementedsetrunnablefailing resume cannot be handled resume %s config_defer: can't defer config of a root deviceconfig_defer: can't allocate defer structureautoconfconfig_detach: forced detach of %s failed (%d)%s detached config_make_softcconfig_make_softc: allocation for device softc failed%s%dconfig_make_softc: device name too longexpandcreatconfig_make_softc: %sing dev arrayconfig_make_softc: duplicate %s>>> probing for %s* mapply: no match function for '%s' device>>> %s probe returned %d >>> %s probe won >>> no winning probe %s at root%s at %sroot device %s not configured not configured unsupported /dev/%s%s%ccannot obtain vnode for 0x%x/0x%xcannot open disk, 0x%x/0x%x, error %dcannot read disk label, 0x%x/0x%x, error %droot filesystem has size 0filesystem type %d not known.. assuming ffs use one of: exit %s[a-p]dkopendisklabels not read:root device (default %sswap device (default %s%s)root device (%s) not foundnetbootroot on %s%ccan't figure root, hope your kernel is right (%02hx%02hx%02hx%02hx%02hx%02hx%02hx%02hx.%c) swap on %s%d%c dump on %s%d%croot device (%02hx%02hx%02hx%02hx%02hx%02hx%02hx%02hx) not founddisk_unbusy: %s: dk_busy < 0 disk_detach: disk_count < 0dklkdisk_attach: can't allocate storage for disklabelwrit%s%d%c: %s %sing fsbn %lld%lld of %lld-%lld (%s%d bn %lld; cn %lld tn %lld sn %lld)extnt%s: start 0x%lx, end 0x%lx %s: region not foundextentplklog%s: %s: page empty%s: %s free list modified: page %p; item addr %p; offset 0x%x=0x%lx != 0x%lx%s: %s: page header missing%s: %s: incorrect page%s: %s free list modified: page %p; item addr %p; offset 0x%x=0x%lxphpool%s: too much uptimepoolsdma%d0123456789abcdef%llo%llx(null)0123456789ABCDEFbug in kprintf: bad base%s: table is full panic: splassert: %s: want %d have %d spl assertion failure in %skernel %sassertion "%s" failed: file "%s", line %d*FOUND**UNKNOWN*0%o0x%x%3d free slot (for add) %3d %s count %d disable (pseudo device) Unknown devno (max is %d) %3d at ??? %s flags 0x%x %s [] ? Unknown argument command args description [count] number of lines before moredev add a device8|10|16 base on large numbersdevno|dev change devicesattr val|devno|dev disable devicesattr val|devno|dev enable devicesdevno|dev find devices this message list configuration leave UKC[attr [val]] show attributes (or devices with an attribute)[mins [dst]] set timezone/dst toggle verbose booting don't know--- more --- Error unknown state already enabled %3d can't enable free slot %3d %s disabled %3d can't disable free slot already Unknown routine /%c/ Value missing for attribute Unknown attribute change (y/n) ?out of memory. flags changed %3d can't change free slot count%3d %s changed Unknown pseudo routine /%c/ %s ? Not same device type No more space for new devices. Device not complete number or * is missing No device of this type exists. Clone Device (DevNo, 'q' or '?')Insert before Device (DevNo, 'q' or '?')Unknown command, try help Argument expected Dev expected 8|10|16 expected DevNo or Dev expected Attr, DevNo or Dev expected timezone = %d, dst = %d disautoconf verbose %sabled Unknown command User Kernel Config UKC> Continuing... addchangedisableenablefindhelplinesquitshowtimezoneverbosev?pollselectpipeplpipelkpipeclpiperdpipewrttckoutqload: %d.%02d not a controlling terminal no foreground process group empty foreground process group runningrunnableiowait cmd: %s %d [%s] %lld.%02ldu %lld.%02lds %d%% %ldk ttyrub: would panic c = %d, val = %d m_copydata: off %d < 0m_copydata: len %d < 0m_copydata: short mbuf chainm_copydata: null mbufm_copym0: off %d, len %dm_copym0: short mbuf chainm_copym0: m == NULL and not COPYALLmbuf prepend length too bigmbufplmtagplmcl%dkm_apply: len %d < 0m_apply: off %d < 0m_apply: null mbuf in skipm_apply: null mbufWARNING: mclpools limit reached; increase kern.maxclustersrequested tag size for pool %#x is too bigm == NULL in m_pulldown()unixsoaccept: !NOFDREFnetclssoclose: NOFDREFsockplsbcreatecontrol: message too large %d sbdropsbappendcontrolsemi-panic: sbcompressnetlcknetiosbappendaddrnetcon2netconacceptunp_disconnectunp_connect2unp_attachuipc 1uipc 2uipc 4piusrreqinconsistent bufpage countsbiowaitbufplbiodone alreadyneedbuffernobuffersbuf_get: dup lblk vp %p bp %pgetblkbuf_needvabufinit: can't reserve VM for buffersnchplwtf? leak?vop_generic_revokeallnameilf_findoverlap: defaultlockfplrelookup: null namerelookup: lookup on dot-dotbrelvp: NULLbgetvp: not freevflushbuf: not dirtyvflushbufvinvalbufvinvalbuf: dirty bufsvinvalbuf: flush failedvwakeup: neg numoutputsoftdep %d vclean: deadlockvclean: cannot reclaimvclean: not cleanvgonemissing aliasvgonel: not cleanmissing bdevvgetvnodevfslockunmount of %s failed with error %d WARNING: some file systems would not unmount retrying syncing disks... giving up done vnodesuvmvnodessyncer vnode syncermount: lost mountunmount: dangling vnodevn_lockspec_badop calledspec_ioctltag VT_NON, dev %d, %d spec_close: not specialspec_fsync: not dirtyspec_fsyncspec_read typespec_write typechkvnlockdead_badop calleddead_write: lockdead_read: locktag VT_NON, dead vnode dos2unixtime(): month value out of range (%u) detrunc(): can't truncate root directory, clust %u, offset %u deextend: file too largedenodedeget(): pcbmap returned %d extendfile(): attempt to extend root directory extendfile: pcbmap. .. doscheckpath(): .. not a directory? msdosfs_sync: rofs modRRaArrAatag VT_MSDOSFS, startcluster %u, dircluster %u, diroffset %u (LOCKED) dev %d, %d, %s msdosfs_strategy: specmsdosfs_rename: lost to startdirmsdosfs_rename: lost from startdirmsdosfs_rename: updating .. in root directory?msdosfs_write(): bad file typebpfattachbpf_mcopybpf: ifpromisc failedbpf_detachd: descriptor not in listbpfbpfszifa_update_broadaddr does not support dynamic lengthegresstoo many interfacesall%s: can't handle af%d looutput: no header mbuflo%dunable to create lo0loifmedia_add: can't malloc entryifmedia_set: no match for 0x%x/0x%x ifmedia_set failedcan't establish softnet handlerrtmaskrn_init: radix functions require max_keylen be set rn_initrn_init 2rn_delete: inconsistent normal annotation rn_delete: inconsistent mklist refcount rn_delete: inconsistent dupedkey list rn_delete: inconsistent annotation rn_delete: couldn't find our annotation Mask for route not entered rn_addmask: mask impossibly already in tree %s %p at %p rn_delete: Orphaned MaskNon-unique normal route, mask not entered raw_usrreqrt_timer_remove_all: rtq_count reached 0 rt_timer_add: rtq_count reached 0 ifafreertfree 2rtfree: %p not freed (neg refs) rt_timer_init: already initializedrttmrrtrequest deletertrequest1 RTM_RESOLVE: wrong ifa (%p) was (%p) rt_timer_timer: rtq_count reached 0 rt_timer_queue_destroy: rtq_count reached 0 %s: wrong ifa (%p) was (%p) rtentryroute_init rtable_addroute_outputrouteunexpected mode %uUnexpected mode %u%s: invalid channel freq %u flags %x %s: invalid channel (NULL) Bad IBSS channel %u%s: bad channel ignored; freq %u flags %x number %u Pairwise key expansionPMK Name%s: Michael MIC failure %s: %sassociation failed (status %d) for %s %s: received %s from %s rssi %d mode %s 80211scanfreeing bss nodeunable to setup inital BSS nodeactivepassive%s: end %s scan %s: begin %s scan invalid group data cipher!invalid integrity group cipher!management frame too large: %unull node%s: sending %s to %s on channel %u mode %s %s: failed to queue raw tx frame %s: no node for dst %s, discard raw tx frame %s: station %s deauthenticate (reason %d) %s: station %s disassociate (reason %d) %s: received msg %d/%d of the %s handshake from %s group key4-wayEAPOL-Key frame too large: %u%s: sending EAPOL-Key request to %s %s: sending msg %d/%d of the %s handshake to %s %s: open authentication failed (reason %d) for %s "0x%s: no recent beacons from %s; rescanning %s: bogus xmit rate %u setupassociatedsynchronized%s: %s with %s ssid .5 channel %d start %u%sMbshortlong protection enabled %s preamble %s slot time%s assoc_reqassoc_respreassoc_reqreassoc_respprobe_reqprobe_respreserved#6reserved#7beaconatimdisassocauthdeauthactionaction_noackreserved#15INITSCANAUTHASSOCRUNauto11a11bturboaeazbgbhbnbybzcacncocrczdodzeeegf2fifofrgrgthkhnhrhuidieiqisj1j2j3j4j5jmjojpk2kekpkrkwkzlblilvmcmkmomxmyninlnzpapkprqarusasgsisvtntttwuaukuyvnyezazwAPL1APL1AAPL1_ETSICAPL1_FCCAAPL1WAPL2APL2CAPL2DAPL2_ETSICAPL2WAPL3APL3WAPL4APL4WAPL5APL5WAPLDAPLDEBUGETSI1ETSI1WETSI2ETSI2WETSI3ETSI3AETSI3W,ETSI4ETSI4CETSI4WETSI5ETSI5WETSI6ETSI6WETSIAETSIBETSICETSIEU1WFCC1FCC1AFCC1WFCC2FCC2CFCC2AFCC2WFCC3FCC3AFCCAFRANCEMKK1MKK1_FCCAMKK1AMKK1A1MKK1A2MKK1BMKK2MKK2AMKKANONEWOR01WWOR02WWOR0WWOR1WWOR2WWOR3WWOR4WWOR5_ETSICWOR9WWORAWWORLDarptfreearp: ether address is broadcast for IP address %s! duplicate IP address %s sent from ethernet address %s arp: attempt to overwrite permanent entry for %s by %s on %s arp: attempt to overwrite entry for %s on %s by %s on %s arp info overwritten for %s by %s on %s arp: attempt to add entry for %s on %s by %s on %s arpresolve: %s: route contains no arp information arpresolve: %s: route without link local address arpresolve: %s: can't allocate llinfo arp%s: bad gateway value: %s %s: malloc failed %s: no mbuf invalid argument to in_lifaddr_ioctlin_pcbinit: hashinit failedin_pcbinit: hashinit failed for lportIPv6 pcb passed into in_pcbconnectinpcbplinternet%u.%u.%u.%uicmp_do_exthdr: m_getptr failureicmp_redirect_timeout: bad route to timeouticmp_mtudisc_timeout: bad route to timeouticmp_erroricmp lenipqeipqip_initaeshmac-sha1deflaterip_attachrip_detachrip_usrreqsyncachetcp_pulloutofbandm_pulldown malfunctiontcp_output REXMTtcp_outputtcpcbtcpqetcp_inittcp_usrrequdp_usrreqipip_input: should never reach herecryptocryptopcryptodesccuio_copyback: off %d < 0cuio_copyback: len %d < 0cuio_copyback: empty in skipuio_copyback: emptycuio_copydata: off %d < 0cuio_copydata: len %d < 0iov_copydata: empty in skipcuio_copydata: emptycuio_apply: len %d < 0cuio_apply: off %d < 0cuio_apply: ind %d >= uio_iovcnt %d for offcuio_apply: ind %d >= uio_iovcnt %d for lenSoftware crypto device cannot initialize!DES3DESBlowfishCAST-128Rijndael-128/AESAES-CTRAES-GCMAES-GMACAES-XTSARC4HMAC-MD5HMAC-SHA1HMAC-RIPEMD-160HMAC-SHA2-256HMAC-SHA2-384HMAC-SHA2-512GMAC-AES-128GMAC-AES-192GMAC-AES-256MD5SHA1DeflateLZS1.2.3start = %d, len = %d, fs = %s ffs_alloccg: map corruptedbno = %lld, fs = %s ffs_alloccg: block not in mapffs_freefile: range: dev = 0x%x, ino = %d, fs = %sdev = 0x%x, ino = %u, fs = %s ffs_freefile: freeing free inodedev = 0x%x, bsize = %d, size = %ld, fs = %s ffs_blkfree: bad sizebad block %lld, ino %u uid %u on %s: %s bad blockdev = 0x%x, block = %lld, fs = %s ffs_blkfree: freeing free blockffs_blkfree: freeing free fragcg = %d, irotor = %d, fs = %s ffs_nodealloccg: map corruptedffs_nodealloccg: block not in mapffs_clusteralloc: lost blockmode = 0%o, inum = %u, fs = %s ffs_valloc: dup allocfree inode %s/%d had %lld blocks out of inodes %s: create/symlink failed, no inodes free dev = 0x%x, bsize = %d, bprev = %lld, fs = %s ffs_realloccg: bad bprevffs_realloccg: bad blocknodev = 0x%x, optim = %d, fs = %s ffs_realloccg: bad optimfile system full %s: write failed, file system is full ffs2_balloc: block too bigffs2_balloc: unwind failedffs1_balloc: blk too bigCould not unwind indirect block, error %dffs_indirtrunc: bad buffer sizeffs_truncate: newspaceffs_update: bad link cntsoftdep_flushfiles calledffsinodino1pldino2plffs_vget: alien ino_t %lluupdate: rofs modffs_statfsWARNING: %s was not properly unmounted WARNING: R/W mount of %s denied. Filesystem is not clean - run fsck ffs_reload: dirty1ffs_reload: dirty2WARNING: soft updates isn't compiled in ffs_mountroot: can't setup bdevvp's ffsffs_fsync: not dirtyffs_fsyncffs_write: nonsync dir writeffs_write: typecheckpath: .. not a directory First bad Second bad %s: bad dir ino %u at offset %d: %s bad dirufs_direnter: newblkufs_direnter: compact1ufs_direnter: compact2mangled entryi_ffs_size too smallufs_strategy: specufs_rename: lost from startdirufs_rename: lost to startdirrename: EXDEVufs_rename: same fileufs_rename: lost dir entrychown: lost quotaifree: range: dev = 0x%x, ino = %u, fs = %sdev = 0x%x, ino = %d, fs = %s ifree: freeing free inodebad block %u, ino %u %s: freeing free block: dev = 0x%x, block = %u, fs = %s mode = 0%o, nlinks %u, inum = %u, fs = %s ext2fs_valloc: dup allocext2fs_alloccg: map corruptedext2fs_mapsearch: block not in mapcg = %d, ipref = %u, fs = %s ext2fs_nodealloccg: map corruptedext2fs_nodealloccg: block not in mapext2fs_indirtrunc: bad buffer sizecheckpathrec_len is smaller than minimalrec_len % 4 != 0reclen is too small for name_lendirectory entry across blocksinode out of boundsbad directory entry: %s offset=%d, inode=%u, rec_len=%d, name_len=%d i_size too smallext2fs_direnter: newblkext2fs_direnter: frag size%s: nonsync dir writeext2fs_write%s: typeext2fs_vget: alien ino_t %lluext2fs: wrong magic number 0x%x ext2fs: wrong log2(block size) %d ext2fs: zero blocks per group ext2fs: wrong revision number 0x%x ext2fs: first inode at 0x%x ext2fs: unsupported incompat features 0x%x ext4fs: only read-only support right now ext2fs: your file system says it needs recovery ext2fs: unsupported R/O compat features 0x%x ext2fs_statfsext2fs_reload: dirty1ext2fs_reload: dirty2%s: file system not clean; please fsck(8) ext2fs_mountroot: can't setup bdevvp'sext2fsext2inoplext2dinoplext2fs_mkdir: blksizeext2fs_rename: lost from startdirext2fs_rename: lost to startdirrename: linked directoryext2fs_rename: lost dir entryext2fs_rename: mangled diruvm_addr_invoke: address selector %p (%s 0x%lx-0x%lx) returned unavailable address 0x%lxuaddruaddrhintuaddrbestuaddrpivotuaddrrnduaddr_linuaddr_rnduaddr_hintuaddr_kbootstrapamap_unadd: offset out of rangeamap_unadd: nothing thereamap_lookup: offset out of rangeamap_add: offset out of rangeamap_add: replacing null anonamap_add: slot in useamap_lookups: offset out of rangeamap_splitref: split at zero offsetamap_splitref: map size check failedamap_cow_now: non-resident wired page in anon %pcownowcownowpageamap_wipeout: corrupt amapamapplamap_pp_adjref: overshot targetamap_pp_adjref: negative reference countanonpl%s: can't allocate entryuao_set_swslot: uobj = %p uao_set_swslot: attempt to set a slot on a NOSWAP objectuao_flush: strange, got an out of range flush (fixed) uaoflshuao_flush: weird flagsuao_detuaoeltplaobjpluao_create: kernel object already allocateduao_create: asked to enable swap on kernel objectuao_create: hashinit swhash faileduao_create: malloc swslots faileduao_getpageuao_getudv_faultudv_detachudv_attachuvm_fault_unwire_locked: address not in mapanonget1anonget2flt_noram1fltamapcopyflt_noram2flt_noram3flt_pmfail1fltagain2flt_noram4flt_noram5flt_pmfail2uvm_init: page size not setkm_allocvauvm_km_pgremove_intrsafe: no pagekmallockmthreadvallocwaituvm_km_suballoc: unable to allocate space in parent mapuvm_km_suballoc: unable to create submapuvm_km_suballoc: submap allocation faileduvm_km_init: could not reserve space for kernelkm_pgrmkm_alloc1wkm_free: unmanaged page 0x%lx uvm_map_clean: weird flagsuvm_mapent_addr_removeuvm_mapent_addr_insert: entry still in addr listuvm_mapent_addr_insert: map %p entry %p (0x%lx-0x%lx G=0x%lx F=0x%lx) insert collision with entry %p (0x%lx-0x%lx G=0x%lx F=0x%lx)vmspplvmmpeplvmmpekpluvm_map_splitentry: split address 0x%lx not on page boundary!uvm_mapent_alloc: cannot allocate map entryuvm_mapent_alloc: out of static map entries vmmaplkuvm_map_setup: rw_enter failed on new mapuvm_map_protect: kernel map W^X violation requested uvm_map_teardown: rw_enter failed on free mapuvmspace_fork: no space in map for entry in empty mapfork: encountered a submap during fork (illegal)fork: non-copy_on_write map entry marked needs_copy (illegal)uvm_map: kernel map W^X violation requested uvm_page_physget: called _after_ bootstrapuvm_page_physget: out of memory!uvm_setpagesize: page size not a power of twouvm_pglistallocuvm_pglistalloc: Upper boundary 0x%lx not on pagemask. uvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX uvm_page_physload: can not malloc vm_page structs for segment ignoring 0x%lx -> 0x%lx uvm_page_physload: tried to add RAM after vm_mem_inituvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: pmap_growkernel() faileduvm_pageboot_alloc: out of memoryuvm_page_bootstrap: no memory pre-allocateduvm_page_init: lost %ld page(s) in initsize 0 uvm_pagereallocpagersegpgdaemonuvm_wait emergency bufbackoff pagedaemon: deadlock detected! pagedaemon: wait_pla deadlock detected! pmrwaituvm_wait: failed to free %ld pages between 0x%lx-0x%lx uvm_pmr_split: lost one pmr Flags: 0x%x, will panic now. pgzerowarning: resource shortage: %d pages of swap lost swapdrum_addsw_reg_strategy: swap to sparse fileswstrategy: vnode type 0x%xswap_off: swapdev not in listswap0x%04xdisklabel reserve/dev/%s%d%cblkdev0x%xuvm_swap_init: can't get vnode for swap deviceswapmapuvm_swap_init: extent_create failedswp vnxswp vndswplksbrk: grow %ld failed, error = %d uvm_deallocate with null mapuvn_iosyncuvn_cluster: offset out of rangeuvn_flshuvn_flush: obj=%p, offset=0x%llx. error during pageout. uvn_flush: WARNING: changes to page may be lost! uvn_flushuvn_termuvm_vnp_terminate: io sync wanted bit setuvn_attachuvnsyncuvn_getpageuvn_getNULL pointer passed to ip_ecn_egressNULL pointer passed to ip_ecn_ingressin6_prefixlen2mask: invalid prefix length(%d) in6_are_prefix_equal: invalid prefix length(%d) in6_unlink_ifa: interface address %s has no prefix in6_purgeaddr: failed to remove a route to the p2p destination: %s on %s, errno=%d in6_update_ifa: a destination can be specified for a p2p or a loopback IF only in6_update_ifa: prefixlen should be 128 when dstaddr is specified in6_update_ifa: valid lifetime is 0 for %s in6_update_ifa: the prefix length of an existing (%s) address should not be changed in6_update_ifa: failed to remove a route to the old destination: %s in6_update_ifa: addmulti failed for %s on %s (errno=%d) prefix ioctls are now invalidated. please use ifconfig. nd6_prelist_add succeeded but no prefix invalid argument to in6_lifaddr_ioctlin6_ifawithscope: output interface is not specified %s: got interface identifier from itself %s: borrow interface identifier from %s %s: interface identifier generated by random number %s: failed to get interface identifier %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x %s: no ifid available in6_ifattach_linklocal: failed to configure a link-local address on %s (errno=%d) in6_cksum: mbuf len (%d) < off+len (%d+%d)in6_cksum: out of datainternet6icmp6_redirect_timeout: bad route to timeouticmp6_mtudisc_timeout: bad route to timeout(src=%s dst=%s tgt=%s)ICMP6 redirect sent from %s rejected; must be from linklocal ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) ICMP6 redirect rejected; redirect dst must be unicast: %s ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s ICMP6 redirect rejected; no route found for redirect dst: %s ICMP6 redirect rejected; neither router case nor onlink case: %s icmp6_redirect_input: invalid ND option, rejected: %s icmp6_redirect_input: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s icmp6_notify_error: in6_embedscope failed sanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d ../../../../netinet6/icmp6.cicmp6_reflect: source can't be determined: dst=%s, error=%d ICMP6 checksum error(%d|%x) %s icmp6_input: unknown type %d(src=%s, dst=%s, ifid=%d) ENOBUFS in icmp6_error %d icmp6_mtudisc_callback_registerip6_nexthdr: m == NULLip6_input: packet to an unready address %s->%s ip6_initcannot forward from %s to %s nxt %d received on %s cannot forward src %s, dst %s, nxt %d, rcvif %s, outif %s assumption failed: hdr not splitnd6_setmtu0: new link MTU on %s (%lu) is too small for IPv6 scope error in prefix list (%s) ndopts == NULL in nd6_optionuninitialized ndopts in nd6_optionndopts == NULL in nd6_optionsuninitialized ndopts in nd6_optionsduplicated ND6 option found (type=%d) nd6_options: unsupported option %d - option ignored too many loop in nd opt unspecnd6_lookup: failed to lookup %s (if = %s) nd6_output: can't allocate llinfo for %s (ln=%p, rt=%p) nd6_init called more than once(ignored) ln->ln_rt == NULLln->ln_rt->rt_ifp == NULLrt_llinfo(%p) is not equal to ln(%p)dst=0 in nd6_timer(ln=%p)nd6_storelladdr: something odd happens nd6_storelladdr: sdl_alen == 0, dst=%s, if=%s ifp == NULL in nd6_cache_lladdrfrom == NULL in nd6_cache_lladdrndp info overwritten for %s by %s on %s %s: failed to join %s (errno=%d) %s: DAD detected duplicate IPv6 address %s: NS in/out=%d/%d, NA in=%d %s: DAD complete for %s - duplicate found %s: manual intervention required ifa == NULL in nd6_dad_ns_inputnd6_na_output: source can't be determined: dst=%s, error=%d nd6_ns_output: source can't be determined: dst=%s, error=%d nd6_dad_timer: called with null parameter nd6_dad_timer: DAD structure not found ???nd6_dad_timer: called with duplicated address %s(%s) nd6_dad_timer: called with non-tentative address %s(%s) %s: could not run DAD, driver problem? %s: DAD complete for %s - no duplicates found nd6_dad_start: called with non-tentative address %s(%s) nd6_dad_start: ifa->ifa_ifp == NULLnd6_dad_start: memory allocation failed for %s(%s) %s: starting DAD for %s nd6_ns_input: invalid hlim (%d) from %s to %s on %s nd6_ns_input: bad DAD packet (wrong ip6 dst) nd6_ns_input: NS packet from non-neighbor nd6_ns_input: bad NS target (multicast) nd6_ns_input: invalid ND option, ignored nd6_ns_input: bad DAD packet (link-layer address option) nd6_ns_input: lladdrlen mismatch for %s (if %d, NS packet %d) nd6_ns_input: duplicate IP6 address %s nd6_ns_input: src=%s nd6_ns_input: dst=%s nd6_ns_input: tgt=%s nd6_na_input: invalid hlim (%d) from %s to %s on %s nd6_na_input: invalid target address %s nd6_na_input: a solicited adv is multicasted nd6_na_input: invalid ND option, ignored nd6_na_input: multicast adv without TLLA nd6_na_input: duplicate IP6 address %s nd6_na_input: ND packet from non-neighbor nd6_na_input: lladdrlen mismatch for %s (if %d, NA packet %d) in6_init_prefix_ltimes: preferred lifetime(%d) is greater than valid lifetime(%d) in6_ifadd: wrong prefixlen for %s (prefix=%d ifid=%d) in6_ifadd: failed to make ifaddr %s on %s (errno=%d) nd6_prefix_onlink: %s/%d is already on-link nd6_prefix_onlink: failed to find any ifaddr to add route for a prefix(%s/%d) on %s nd6_prefix_onlink: failed to add route for a prefix (%s/%d) on %s, gw=%s, mask=%s, flags=%lx errno = %d nd6_prefix_offlink: %s/%d is already off-link nd6_prefix_offlink: failed to recover a prefix %s/%d from %s to %s (errno = %d) nd6_prefix_offlink: failed to delete route: %s/%d on %s (errno = %d) pfxlist_onlink_check: failed to make %s/%d offlink, errno=%d prelist_remove: failed to make %s/%d offlink on %s, errno=%d prelist_remove: negative count on %s nd6_prelist_add: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_update: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_update: nd6_prelist_add failed for %s/%d on %s errno=%d, returnpr=%p defrouter_select: called unexpectedly (forwarding=%d) defrouter_select: more than one router is installed defrtrlist_del: negative count on %s nd6_ra_input: invalid hlim (%d) from %s to %s on %s nd6_ra_input: src %s is not link-local nd6_ra_input: invalid ND option, ignored nd6_ra_input: invalid option len %d for prefix information option, ignored nd6_ra_input: invalid prefix len %d for prefix information option, ignored nd6_ra_input: invalid prefix %s, ignored nd6_ra_input: invalid prefixlen %d for rfc2374 prefix %s, ignored nd6_ra_input: bogus mtu option mtu=%lu sent from %s, ignoring nd6_ra_input: bogus mtu mtu=%lu sent from %s; exceeds maxmtu %lu, ignoring nd6_ra_input: lladdrlen mismatch for %s (if %d, RA packet %d) nd6_rs_input: invalid hlim (%d) from %s to %s on %s nd6_rs_input: invalid ND option, ignored nd6_rs_input: lladdrlen mismatch for %s (if %d, RS packet %d) rip6_attachrip6_detachrip6_usrreq invalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchincorrect data checkincorrect length checkneed dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionmainbuscpuNo support for this CPU type (%08x) in kernelUndefined instruction in kernel real mem = %lu (%luMB) avail mem = %lu (%luMB) Warning IRQ's disabled during boot() WARNING: not updating battery clock _bus_dmamap_load_raw: not implemented_bus_dmamem_map: size botch_bus_dmamap_sync: mix PRE and POST%s: curaddr %#lx not in range_bus_dmamap_sync: ARM32_BUFTYPE_INVALIDunknown buffer type %d _bus_dmamap_syncProcessor failed probe - no CPU ID %s %s (%s core)%s: IDC disabled IDC enabled DC disabled DC enabled IC disabled IC enabled WB disabled WB enabled LABT EABT branch prediction enabled%s: %dKB/%dB %d-way %s unified cache %s: %dKB(%db/l,%dway) I-cache, %dKB(%db/l,%dway) %s D-cache %s: %s does not fully support this CPU. %s: This kernel does not fully support this CPU. %s: Recompile with "options %s" to correct this. unknown CPU (ID = 0x%x)ARM810ARM920TARM922TARM926EJ-SARM940TARM946E-SARM966E-STI ARM925TARM1020EARM1022E-SSA-110SA-1100SA-1110IXP1200i80200i80321 400MHzi80321 600MHzi80219 400MHzi80219 600MHzPXA250PXA210PXA27xIXP425 533MHzIXP425 400MHzIXP425 266MHzARM1136J-SARM1136J-S R1ARM Cortex A5ARM Cortex A7ARM Cortex A8ARM Cortex A8 R1ARM Cortex A8 R2ARM Cortex A8 R3ARM Cortex A9ARM Cortex A9 R1ARM Cortex A9 R2ARM Cortex A9 R3ARM Cortex A9 R4ARM Cortex A15ARM Cortex A15 R1ARM Cortex A15 R2ARM Cortex A15 R3ARM Cortex A15 R4CPU_ARM8ARM9TDMIARM9E-SCPU_ARM9EARM9EJ-SARM10ECPU_ARM10SA-1CPU_SA1100XScaleCPU_XSCALE_...ARM11JCPU_ARM11CPU_ARMv7wr-thruwr-back**unknown 3****unknown 4**wr-back-lockwr-back-lock-Awr-back-lock-B**unknown 8****unknown 9****unknown 10****unknown 11****unknown 12****unknown 13****unknown 14****unknown 15**rev 0rev 1rev 2rev 3rev 4rev 5rev 6rev 7rev 8rev 9rev 10rev 11rev 12rev 13rev 14rev 15step Jstep Kstep Sstep Tstep Bstep Cstep Dstep Erev 10step Gstep A-0step B-0step B-1step B-2step B-3step B-4step B-5(IXP1200 step A)(IXP1200 step B)(IXP1200 step C)(IXP1200 step D)(IXP1240/1250 step A)(IXP1240 step B)(IXP1250 step B)step A-1step C-0step D-0step ?step C-5step 0badaddr: invalid size (%lu)userkernelFatal %s mode data abort: '%s' trapframe: %p DFSR=%08x, DFAR=%08x (imprecise), spsr=%08lx Fatal %s mode prefetch abort at 0x%08lx trapframe: %p IFSR=%08x, IFAR=%08x, spsr=%08lx r0 =%08lx, r1 =%08lx, r2 =%08lx, r3 =%08lx r4 =%08lx, r5 =%08lx, r6 =%08lx, r7 =%08lx r8 =%08lx, r9 =%08lx, r10=%08lx, r11=%08lx r12=%08lx, usp=%08lx, ulr=%08lxssp=%08lx, slr=%08lx, pc =%08lx Fatal abortUVM: pid %d (%s), uid %d killed: out of swap data_abort_fault: Misaligned Kernel-mode Program Counter Non-emulated page fault with intr_depth > 0 uvm_fault(%p, %lx, %x, 0) -> %x Vector ExceptionAlignment Fault 1Terminal ExceptionAlignment Fault 3External Linefetch Abort (S)Translation Fault (S)External Linefetch Abort (P)Translation Fault (P)External Non-Linefetch Abort (S)Domain Fault (S)External Non-Linefetch Abort (P)Domain Fault (P)External Translation Abort (L1)Permission Fault (S)External Translation Abort (L2)Permission Fault (P)mmrwpmap_map_chunk: no L1 table providedpmap_map_chunk: no L2 table for VA 0x%08lxpmap_map_chunk: can't find L2 table for VA0x%08lxpmap_alloc_specials: no l2b for 0x%lxpmap_bootstrap: No L2 for L2 @ va %ppmap_init_l1: can't get PA of L1 at %pCannot allocate L1 KVMCannot allocate L1 physical pagespmap_bootstrap: No L2 for va 0x%x, pa 0x%lxpmap_bootstrap: out of static L2spmap_bootstrap: WARNING! wrong cache mode for L2 pte @ %p pmap_bootstrap: WARNING! wrong cache mode for primary L1 @ 0x%lx pmapplpvepll2dtblpll2ptpplxscale_setup_minidata: can't find L2 table for VA 0x%08lxpmap_map_entry: no L2 table for VA 0x%08lxpmap_map_entry: can't find L2 table for VA 0x%08lxpmap_enter: failed to allocate L2 bucketpmap_enter: no pv entries dump to dev %u,%u not possible dumping to dev %u,%u offset %ld dump area unavailable device bad device not ready area improper i/o error aborted from console succeeded vunmapbufvmapbufcan't init serial console @%lxunknown option `%c' cpu not recognized! OpenBSD/armish booting ... initarm: Configuring system ... physmemory: %d pages at 0x%08lx -> 0x%08lx initarm: out of memoryinitarm: Failed to align the kernel page directoryWARNING: powerdown failed! The operating system has halted. Please press any key to reboot. rebooting... boot device: lookup '%s' failed. boot device: %s cdDiagnostic Failure on Component 0x%02xTagged Overlapped Commands (0x%02x = TASK TAG)Decompression Exception Short Algorithm ID OF 0x%02xASC 0x%02x ASCQ 0x%02xCDBParametersError in %s, Offset %d, bit %dActual Retry Count: %dProgress Indicator: %dprobe%s(%s:%d:%d): %sCheck Condition (error %#x) on opcode 0x%x AT BLOCK #: %d (decimal) SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO: 0x%x (VALID flag %s) COMMAND INFO: 0x%x ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s DEFERRED scbusyunknown error category (0x%x) from scsi driver scsi_done called twice on xs(%p)unexpected xsh state %usyncxspendxsscsiiomvscsi_xfer pool exhausted! scxsplscsiplugscsi_cmd_rw_decode: bad opcode 0x%02xNo Additional SenseSoft ErrorNot ReadyMedia ErrorHardware ErrorIllegal RequestUnit AttentionWrite ProtectedBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare ErrorNo Additional Sense InformationFilemark DetectedEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnCleaning RequestedErase Operation In ProgressLocate Operation In ProgressRewind Operation In ProgressSet Capacity Operation In ProgressVerify Operation In ProgressNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Not Ready, Rebuild In ProgressLogical Unit Not Ready, Recalculation In ProgressLogical Unit Not Ready, Operation In ProgressLogical Unit Not Ready, Long Write In ProgressLogical Unit Not Ready, Self-Test In ProgressLogical Unit Not Accessible, Asymmetric Access State TransitionLogical Unit Not Accessible, Target Port In Standby StateLogical Unit Not Accessible, Target Port In Unavailable StateLogical Unit Not Ready, Structure Check RequiredLogical Unit Not Ready, Auxiliary Memory Not AccessibleLogical Unit Not Ready, Notify (Enable Spinup) RequiredLogical Unit Not Ready, OfflineLogical Unit Not Ready, SA Creation In ProgressLogical Unit Not Ready, Space Allocation In ProgressLogical Unit Not Ready, Robotics DisabledLogical Unit Not Ready, Configuration RequiredLogical Unit Not Ready, Calibration RequiredLogical Unit Not Ready, A Door Is OpenLogical Unit Not Ready, Operating In Sequential ModeLogical Unit Not Ready, Start Stop Unit Command In ProgressLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorLogical Unit Communication CRC Error (ULTRA-DMA/32)Unreachable Copy TargetTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureHead Select FaultError Log OverflowWarningWarning - Specified Temperature ExceededWarning - Enclosure DegradedWarning - Background Self-Test FailedWarning - Background Pre-Scan Detected Medium ErrorWarning - Background Medium Scan Detected Medium ErrorWarning - Non-Volatile Cache Now VolatileWarning - Degraded Power To Non-Volatile CacheWarning - Power Loss ExpectedWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedWrite Error - Recommend ReassignmentCompression Check Miscompare ErrorData Expansion Occurred During CompressionBlock Not CompressibleWrite Error - Recovery NeededWrite Error - Recovery FailedWrite Error - Loss Of StreamingWrite Error - Padding Blocks AddedAuxiliary Memory Write ErrorWrite Error - Unexpected Unsolicited DataWrite Error - Not Enough Unsolicited DataDefects In Error WindowError Detected By Third Party Temporary InitiatorThird Party Device FailureCopy Target Device Not ReachableIncorrect Copy Target Device TypeCopy Target Device Data UnderrunCopy Target Device Data OverrunInvalid Information UnitInformation Unit Too ShortInformation Unit Too LongID CRC Or ECC ErrorLogical Block Guard Check FailedLogical Block Application Tag Check FailedLogical Block Reference Tag Check FailedLogical Block Protection Error On Recover Buffered DataLogical Block Protection Method ErrorUnrecovered Read ErrorRead Retries ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block ReadNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite The DataDe-Compression CRC ErrorCannot Decompress Using Declared AlgorithmError Reading UPC/EAN NumberError Reading ISRC NumberRead Error - Loss Of StreamingAuxiliary Memory Read ErrorRead Error - Failed Retransmission RequestRead Error - LBA Marked Bad By Application ClientAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRecord Not Found - Recommend ReassignmentRecord Not Found - Data Auto-ReallocatedLocate Operation FailureRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorData Sync Error - Data RewrittenData Sync Error - Recommend RewriteData Sync Error - Data Auto-ReallocatedData Sync Error - Recommend ReassignmentRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data Without ECC - Data RewrittenRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With L-ECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteRecovered Data With ECC - Data RewrittenRecovered Data With LinkingDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationMiscompare Verify Of Unmapped LbaRecovered ID with ECCPartial Defect List TransferInvalid Command Operation CodeAccess Denied - Initiator Pending-EnrolledAccess Denied - No Access rightsAccess Denied - Invalid Mgmt ID KeyIllegal Command While In Write Capable StateObsoleteIllegal Command While In Explicit Address ModeIllegal Command While In Implicit Address ModeAccess Denied - Enrollment ConflictAccess Denied - Invalid LU IdentifierAccess Denied - Invalid Proxy TokenAccess Denied - ACL LUN ConflictIllegal Command When Not In Append-Only ModeLogical Block Address Out of RangeInvalid Element AddressInvalid Address For WriteInvalid Write Crossing Layer JumpIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBCDB Decryption ErrorSecurity Audit Value FrozenSecurity Working Key FrozenNonce Not UniqueNonce Timestamp Out Of RangeInvalid XCDBLogical Unit Not SupportedInvalid Field In Parameter ListThreshold Parameters Not SupportedInvalid Release Of Persistent ReservationData Decryption ErrorToo Many Target DescriptorsUnsupported Target Descriptor Type CodeToo Many Segment DescriptorsUnsupported Segment Descriptor Type CodeUnexpected Inexact SegmentInline Data Length ExceededInvalid Operation For Copy Source Or DestinationCopy Segment Granularity ViolationInvalid Parameter While Port Is EnabledInvalid Data-Out Buffer Integrity Check ValueData Decryption Key Fail Limit ReachedIncomplete Key-Associated Data SetVendor Specific Key Reference Not FoundHardware Write ProtectedLogical Unit Software Write ProtectedAssociated Write ProtectPersistent Write ProtectPermanent Write ProtectConditional Write ProtectSpace Allocation Failed Write ProtectNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedFormat-Layer May Have ChangedImport/Export Element Accessed, Medium ChangedPower On, Reset, or Bus Device Reset OccurredPower On OccurredSCSI Bus Reset OccurredBus Device Reset Function OccurredDevice Internal ResetTransceiver Mode Changed to Single EndedTransceiver Mode Changed to LVDI_T Nexus Loss OccurredMode Parameters ChangedLog Parameters ChangedReservations PreemptedReservations ReleasedRegistrations PreemptedAsymmetric Access State ChangedImplicit Asymmetric Access State Transition FailedPriority ChangedCapacity Data Has ChangedError History I_T Nexus ClearedError History Snapshot ReleasedError Recovery Attributes Have ChangedData Encryption Capabilities ChangedTimestamp ChangedData Encryption Parameters Changed By Another I_T NexusData Encryption Parameters Changed By Vendor Specific EventData Encryption Key Instance Counter Has ChangedSA Creation Capabilities Data Has ChangedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedCurrent Program Area Is Not EmptyCurrent Program Area Is EmptyIllegal Power Condition RequestPersistent Prevent ConflictPrevious Busy StatusPrevious Task Set Full StatusPrevious Reservation Conflict StatusPartition Or Collection Contains User ObjectsNot ReservedORWrite Generation Does Not MatchOverwrite Error On Update In PlaceInsufficient Time For OperationCommands Cleared By Another InitiatorCommands Cleared By Power Loss NotificationCommands Cleared By Device ServerIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledCannot Write Medium - Unknown FormatCannot Write Medium - Incompatible FormatCannot Format Medium - Incompatible MediumCleaning FailureCannot Write - Application Code MismatchCurrent Session Not Fixated For AppendCleaning Request RejectedMedium Not FormattedIncompatible Volume TypeIncompatible Volume QualifierCleaning Volume ExpiredMedium Format CorruptedFormat Command FailedZoned Formatting Failed Due To Spare LinkingNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorEnclosure FailureEnclosure Services FailureUnsupported Enclosure FunctionEnclosure Services UnavailableEnclosure Services Transfer FailureEnclosure Services Transfer RefusedRibbon, Ink, or Toner FailureRounded ParameterEvent Status NotificationESN - Power Management Class EventESN - Media Class EventESN - Device Busy Class EventSaving Parameters Not SupportedMedium Not PresentMedium Not Present - Tray ClosedMedium Not Present - Tray OpenMedium Not Present - LoadableMedium Not Present - Medium Auxiliary Memory AccessibleSequential Positioning ErrorTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyEnd Of Medium ReachedMedium Magazine Not AccessibleMedium Magazine RemovedMedium Magazine InsertedMedium Magazine LockedMedium Magazine UnlockedMechanical Positioning Or Changer ErrorRead Past End Of User ObjectElement DisabledElement EnabledData Transfer Device RemovedData Transfer Device InsertedInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetLogical Unit FailureTimeout On Logical UnitLogical Unit Failed Self-TestLogical Unit Unable To Update Self-Test LogTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has Changedcomponent Device AttachedDevice Identifier ChangedRedundancy Group Created Or ModifiedRedundancy Group DeletedSpare Created Or ModifiedSpare DeletedVolume Set Created Or ModifiedVolume Set DeletedVolume Set DeassignedVolume Set ReassignedReported LUNs Data Has ChangedEcho Buffer OverwrittenMedium LoadableMedium Auxiliary Memory AccessibleiSCSI IP Address AddediSCSI IP Address RemovediSCSI IP Address ChangedRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureATA Device Failed Set FeaturesSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorData Phase CRC Error DetectedSCSI Parity Error Detected During ST Data PhaseInformation Unit iuCRC Error DetectedAsynchronous Information Protection Error DetectedProtocol Service CRC ErrorPHY Test Function In ProgressSome Commands Cleared By iSCSI Protocol EventInitiator Detected Error Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorInvalid Target Port Transfer Tag ReceivedToo Much Write DataACK/NAK TimeoutNAK ReceivedData Offset ErrorInitiator Response TimeoutConnection LostLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureErase Failure - Incomplete Erase Operation DetectedCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedMedium Removal Prevented By Data Transfer ElementMedium Thread Or Unthread FailureVolume Identifier InvalidVolume Identifier MissingDuplicate Volume IdentifierElement Status UnknownSCSI To Host System Interface FailureSystem Resource FailureSystem Buffer FullInsufficient Reservation ResourcesInsufficient ResourcesInsufficient Registration ResourcesInsufficient Access Control ResourcesAuxiliary Memory Out Of SpaceQuota ErrorMaximum Number Of Supplemental Decryption Keys ExceededMedium Auxiliary Memory Not AccessibleData Currently UnavailableInsufficient Power For OperationUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change InputOperator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedFailure Prediction Threshold ExceededMedia Failure Prediction Threshold ExceededLogical Unit Failure Prediction Threshold ExceededSpare Area Exhaustion Prediction Threshold ExceededHardware Impending Failure General Hard Drive FailureHardware Impending Failure Drive Error Rate Too HighHardware Impending Failure Data Error Rate Too HighHardware Impending Failure Seek Error Rate Too HighHardware Impending Failure Too Many Block ReassignsHardware Impending Failure Access Times Too HighHardware Impending Failure Start Unit Times Too HighHardware Impending Failure Channel ParametricsHardware Impending Failure Controller DetectedHardware Impending Failure Throughput PerformanceHardware Impending Failure Seek Time PerformanceHardware Impending Failure Spin-Up Retry CountHardware Impending Failure Drive Calibration Retry CountController Impending Failure General Hard Drive FailureController Impending Failure Drive Error Rate Too HighController Impending Failure Data Error Rate Too HighController Impending Failure Seek Error Rate Too HighController Impending Failure Too Many Block ReassignsController Impending Failure Access Times Too HighController Impending Failure Start Unit Times Too HighController Impending Failure Channel ParametricsController Impending Failure Controller DetectedController Impending Failure Throughput PerformanceController Impending Failure Seek Time PerformanceController Impending Failure Spin-Up Retry CountController Impending Failure Drive Calibration Retry CountData Channel Impending Failure General Hard Drive FailureData Channel Impending Failure Drive Error Rate Too HighData Channel Impending Failure Data Error Rate Too HighData Channel Impending Failure Seek Error Rate Too HighData Channel Impending Failure Too Many Block ReassignsData Channel Impending Failure Access Times Too HighData Channel Impending Failure Start Unit Times Too HighData Channel Impending Failure Channel ParametricsData Channel Impending Failure Controller DetectedData Channel Impending Failure Throughput PerformanceData Channel Impending Failure Seek Time PerformanceData Channel Impending Failure Spin-Up Retry CountData Channel Impending Failure Drive Calibration Retry CountServo Impending Failure General Hard Drive FailureServo Impending Failure Drive Error Rate Too HighServo Impending Failure Data Error Rate Too HighServo Impending Failure Seek Error Rate Too HighServo Impending Failure Too Many Block ReassignsServo Impending Failure Access Times Too HighServo Impending Failure Start Unit Times Too HighServo Impending Failure Channel ParametricsServo Impending Failure Controller DetectedServo Impending Failure Throughput PerformanceServo Impending Failure Seek Time PerformanceServo Impending Failure Spin-Up Retry CountServo Impending Failure Drive Calibration Retry CountSpindle Impending Failure General Hard Drive FailureSpindle Impending Failure Drive Error Rate Too HighSpindle Impending Failure Data Error Rate Too HighSpindle Impending Failure Seek Error Rate Too HighSpindle Impending Failure Too Many Block ReassignsSpindle Impending Failure Access Times Too HighSpindle Impending Failure Start Unit Times Too HighSpindle Impending Failure Channel ParametricsSpindle Impending Failure Controller DetectedSpindle Impending Failure Throughput PerformanceSpindle Impending Failure Seek Time PerformanceSpindle Impending Failure Spin-Up Retry CountSpindle Impending Failure Drive Calibration Retry CountFirmware Impending Failure General Hard Drive FailureFirmware Impending Failure Drive Error Rate Too HighFirmware Impending Failure Data Error Rate Too HighFirmware Impending Failure Seek Error Rate Too HighFirmware Impending Failure Too Many Block ReassignsFirmware Impending Failure Access Times Too HighFirmware Impending Failure Start Unit Times Too HighFirmware Impending Failure Channel ParametricsFirmware Impending Failure Controller DetectedFirmware Impending Failure Throughput PerformanceFirmware Impending Failure Seek Time PerformanceFirmware Impending Failure Spin-Up Retry CountFirmware Impending Failure Drive Calibration Retry CountFailure Prediction Threshold Exceeded (false)Low Power Condition OnIdle Condition Activated By TimerStandby Condition Activated By TimerIdle Condition Activated By CommandStandby Condition Activated By CommandIDLE_B Condition Activated By TimerIDLE_B Condition Activated By CommandIDLE_C Condition Activated By TimerIDLE_C Condition Activated By CommandSTANDBY_Y Condition Activated By TimerSTANDBY_Y Condition Activated By CommandPower State Change To ActivePower State Change To IdlePower State Change To StandbyPower State Change To SleepPower State Change To Device ControlLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackPacket Does Not Fit In Available SpaceIllegal Mode For This TrackInvalid Packet SizeVoltage FaultAutomatic Document Feeder Cover UpAutomatic Document Feeder Lift UpDocument Jam In Automatic Document FeederDocument Miss Feed Automatic In Document FeederConfiguration FailureConfiguration Of Incapable Logical Units FailedAdd Logical Unit FailedModification Of Logical Unit FailedExchange Of Logical Unit FailedRemove Of Logical Unit FailedAttachment Of Logical Unit FailedCreation Of Logical Unit FailedAssign Failure OccurredMultiply Assigned Logical UnitSet Target Port Groups Command FailedATA Device Feature Not EnabledLogical Unit Not ConfiguredData Loss On Logical UnitMultiple Logical Unit FailuresParity/Data MismatchInformational, Refer To LogState Change Has OccurredRedundancy Level Got BetterRedundancy Level Got WorseRebuild Failure OccurredRecalculate Failure OccurredCommand To Logical Unit FailedCopy Protection Key Exchange Failure - Authentication FailureCopy Protection Key Exchange Failure - Key Not PresentCopy Protection Key Exchange Failure - Key Not EstablishedRead Of Scrambled Sector Without AuthenticationMedia Region Code Is Mismatched To Logical Unit RegionDrive Region Must Be Permanent/Region Reset Count ErrorDecompression Exception Long Algorithm IDSession Fixation ErrorSession Fixation Error Writing Lead-InSession Fixation Error Writing Lead-OutSession Fixation Error - Incomplete Track In SessionEmpty Or Partially Written Reserved TrackNo More Track Reservations AllowedRMZ Extension Is Not AllowedNo More Test Zone Extensions Are AllowedCD Control ErrorPower Calibration Area ErrorProgram Memory Area Update FailureProgram Memory Area Is FullRMA/PMA Is Almost FullCurrent Power Calibration Area Almost FullCurrent Power Calibration Area Is FullRDZ Is FullSecurity ErrorUnable To Decrypt DataUnencrypted Data Encountered While DecryptingIncorrect Data Encryption KeyCryptographic Integrity Validation FailedError Decrypting DataUnknown Signature Verification KeyEncryption Parameters Not UseableDigital Signature Validation FailureEncryption Mode Mismatch On ReadEncrypted Block Not Raw Read EnabledIncorrect Encryption ParametersUnable To Decrypt Parameter ListEncryption Algorithm DisabledSA Creation Parameter Value InvalidSA Creation Parameter Value RejectedInvalid SA UsageData Encryption Configuration PreventedSA Creation Parameter Not SupportedAuthentication FailedExternal Data Encryption Key Manager Access ErrorExternal Data Encryption Key Manager ErrorExternal Data Encryption Key Not FoundExternal Data Encryption Request Not AuthorizedExternal Data Encryption Control TimeoutExternal Data Encryption Control ErrorLogical Unit Access Not AuthorizedSecurity Conflict In Translated DeviceXS_SHORTSENSE scsibus at %sscsibusprint: qualifier == SID_QUAL_RSVDscsibusprint: qualifier == SID_QUAL_BAD_LUdirectsequentialprinterprocessorcdromwormscanneropticalchangercommunicationenclosure servicessimplified directscsibusprint: device type T_NODEVICEvendor-unique targ %d lun %d: <%s, %s, %s> ATAPISCSI%dremovablefixed %d/%s %s%s naa. eui. t10. serial. wwn._~ offline: %d targets, initiator %d, WWPN %016llx, WWNN %016llx%s: unable to register bio scsibusPLEXTORCD-ROM PX-40TS1.01MICROP 1588-15MBSUN0669DEC RZ55 (C) DECEMULEX MD21/S2 ESDIA00IBMRAID 0662SIBM 0663HIBM0664H3171-S2KZ-CDFRSS2FQUANTUM ELS85S iomegajaz 1GBMICROP4421-07SEAGATEST150176LW0002HPC3725SDCASSONY SDT-5000 3.WangDAT Model 1300 02.4Model 2600 01.7Model 3200 02.2CR-2801TE1.07CREATIVECD3630EAC101FX320Sq01GCD-R580B1.00MATSHITA CR-5741.021.06Memorex CRW-26421.0gSANYO CRD-256PSANYO CRD-254PSANYO CRD-S54P1.08CD-ROM CDR-S11.70CD-ROM CDR-N161.25UJDCD87301.14ATAPI CD-ROMSCSI CD-ROMNEC CD-ROM DRIVE:260SCSI opticalSCSI disk%s %s(unknown)%s: %lluMB, %lu bytes/sector, %llu sectors, thin, readonlysoftintr_establish: unknown soft IPL %d"%s" at %s addr 0x%xiiclm75alm75lm77eeprommax1617xeontemplm93lm81lm87adm9240adt7470adt7476adt7475adt7462adt7466adt7467adm1033adm1034adm1030adm1031adm1025adm1024adm1023adm1028adm1022thmc5047m192sch5027emc6w201asc7611asc7621ne1619ds1780adt7460adm1027lm85adt7516lm63lm86lm89lm89-1lm90gl523smadt7461adm1021adm1032g781g781-1max6690max6646max6657max6642tmp401sa56004xw83791sdw83627dhgw83792dw83781dw83627hfw83782das99127fw83783sw83791dw83l784rw83l785rw83l785ts-lf75375asb100gl518smadm1026se97se98max6604mcp9804mcp9805mcp98242mcp98243mcp98244adt7408stts2002stts2004stts3000cat34ts02cat34ts02ccat34ts04ts3000b3ts3000gb2ts3000gb0ts3001gb2tse2004gb2at30ts00at30tse004gt30ts00gt34ts02lis331dlit8712lm96000emc6d100sch5017it8712f-amtp008w83795gw83793gstts424e02stts424%s: addr 0x%x %02x=%02x words %02x=%04x: %s%s: ricohrtc_clock_write: failed to write rtc %s: ricohrtc_clock_read: failed to read rtc %s: ricohrtc_reg_write: failed to write reg%d : RICOH RS5C372[AB] Real-time Clock ricohrtc: F75375 rev %d.%dunable to read reg %d fintek: PCA9532 LED controller pcaledi80321_mem_bs_free(): not implementedi80321_mem_bs_alloc(): not implementedi80321_io_bs_free(): not implementedi80321_io_bs_alloc(): not implementedpciiopaauiopiiciopmuiopwdogi80321_intr_establish: IRQ %d out of rangei80321intcresettodr: failed to set time WARNING: preposterous time in file system WARNING: preposterous clock chip time lostgainedWARNING: clock %s %ld days WARNING: CHECK AND RESET THE DATE! clockstattcr1: I2C controller %s: unable to subregion registers, error = %d iopiiclkattempting reset %s: unable to map VERDE registers%s: unable to subregion MCU registers%s: unable to subregion ATU registers%s: unable to map IOW registers: i80321 I/O Processor %s: unable to map PLD registersiopxs%03d:%02d:%d %04x:%04x WARNING: unknown PCI device header. mem %02xh %s 0x%08x 0x%08x NGOK [%s] Resource conflict. No available resources. fixup failed pci_addr_fixup: fixup failed. (new address=%#lx) new address 0x%08lx PCI I/O memory spacePCI I/O port space[%s]----------------------- device vendor product register space address size -------------------------------------------- System BIOS Setting--------------------------[%3d devices bogus] PCIBIOS fixup stageirq %ldiq80321_pci_intr_map: no mapping for %d/%d/%d (%d, %d, %d) board id failed Thecus Nx100I/O Data HDL-GCertance CP3100 addr 0x%08lx intr %dobio_bs_free(): not implementedobio_bs_alloc(): not implemented: failed to map registers: %d %s: unable to establish interrupt at CPLD irq %d com_obio%s: standby command didn't complete %s: standby command timeout %s: standby command: drive fault %s: flush cache command didn't complete %s: flush cache command timeout %s: flush cache command: drive fault ST506wd_get_params: bad return code from ata_get_paramswddump: try againwddump: polled command has been queuedwddump: device timed outwddump: drive faultwddump: DMA errorwddump: %swddump: unknown error typeST506/MFM/RLLESDI/IDE disk__wdstart: bad return code from wdc_ata_bio()device faultdevice timeout, retrying %s: soft error (corrected) %s: IDENTIFY failed : <%s> %s: %d-sector PIO, LBA48, %lluMB, %llu sectors LBA, %lluMB, %llu sectors CHS, %lluMB, %d cyl, %d head, %d sec, %llu sectors %s: enable look ahead command didn't complete %s: enable write cache command didn't complete %s: freeze lock command didn't complete %s:%d:%d: bad state %d in _wdc_ata_bio_start _wdc_ata_bio_start: bad state%s:%d:%d: timeout waiting for DRQ, st=0x%b, err=0x%02x BSYDRDYDWFDSCDRQCORRIDXERR%s:%d:%d: not ready, st=0x%b, err=0x%02x wdc_ata_ctrl_intr: state==RECALpiomodedmamodegeometrysetmultirecal%s:%d:%d: %s timed out %s:%d:%d: %s drive fault error (%x) %s:%d:%d: bad state %d in wdc_ata_bio_intr wdc_ata_bio_intr: bad state%s:%d:%d: device timeout, c_bcount=%d, c_skip%d %s:%d:%d: intr with DRQ (st=0x%b) %s:%d:%d: read intr before drq error not notified, no media/write protectedaborted commandmedia change requestedid not foundmedia changeduncorrectable data errorinterface CRC erroraddress mark not foundtrack 0 not foundbad block detectedwsevent_read%s: can't attach mux (error=%d) wskbd at %s%s: event queue overflow wskdetwskbd_detach: %s didn't detach mux %dcannot load keymap %s: cannot load keymap, falling back to default %s: console keyboard%s: attach error=%d wskbdwskbd_get_mapentry: %d(%d): bad entrywskbd_load_keymap: %d: recursion too deepwskbd_load_keymap: %d(%d): bad entrywsmux_getmux: no memory for mux %d wsmux: attach out of memory usb at %sendtaskusbatskusbtskunable to create usb abort task threadusbtaskunable to create usb task thread%s: root hub problem %s: root device is not a hub usbpalock: USB revision %s, not supported %s: can't register softintr pre 1.01.12.03.0usbusbd_desc_iter_next: bad descriptor usbd_desc_iter_next: descriptor length = 0 usbd_desc_iter_next: descriptor length too large usbd_start_next: error=%d usbd_transfer: not doneusbsynusbrefusbdetusb_detach_wait: %s didn't detach out of dataiface desc0 lengthusbd_fill_iface_data: bad descriptor(s): %s usbdly%s: device addr %d (config %d) exceeds power budget, %d mA > %d mA %s: port %d, set config %d at addr %d failed %s: No free USB addresses, new device ignored. usbd_new_device: cannot find HS port%x.%02xvendor 0x%04x"%s %s", class %d/%d rev / addr %d port %d configuration %d interface %dNORMAL_COMPLETIONIN_PROGRESSPENDING_REQUESTSNOT_STARTEDINVALNOMEMCANCELLEDBAD_ADDRESSIN_USENO_ADDRSET_ADDR_FAILEDNO_POWERTOO_DEEPIOERRORNOT_CONFIGUREDTIMEOUTSHORT_XFERSTALLEDINTERRUPTEDXXX%s: illegal enable change, port %d %s: port error, restarting port %d %s: port error, giving up port %d %s: connected port %d has no power %s: port %d reset failed %s: device problem, disabling port %d %s: hub depth (%d) exceeded, hub ignored %s: unable to set HUB depth %s: no ports, hub ignored %s: bus powered hub connected to bus powered hub, ignored %s: no interface handle %s: no endpoint descriptor %s: bad interrupt endpoint %s: cannot open interrupt pipe %s: port %d power on failed, %s uhubucom at %s portno %d%s: lost %d chars %s: read start failed , %sucomlkucomugenri%s: secondary, not changing config to %d %s: setting configuration index 0 failed %s: setting configuration %d failed ugenuhidev_intr: bad repid %d uhid at %s reportid %d%s: could not read endpoint descriptor %s: unexpected endpoint %s: no input interrupt endpoint %s: no HID descriptor %s: no memory %s: no report descriptor %s: iclass %d/%d, %d report id%suhidevuhidrea: input=%d, output=%d, feature=%d uhidno usable key codes array%s: was console keyboard ukbd%s: pid %#x rev %#x uslhcom%s: got polled xfer %p, but %p already pending %s: CBI bulk-in/out stall clear failed, %s %s: CBI intr-in stall clear failed, %s %s: CBI reset failed, %s %s: CBI bulk-in stall clear failed, %s %s: CBI bulk-out stall clear failed, %s %s: Unknown state %d%s: Invalid CSW: sig 0x%08x should be 0x%08x %s: Invalid CSW: tag %d should be %d %s: Invalid CSW: status %d > %d %s: Phase Error, residue = %d %s: transferred %d bytes instead of %d bytesBulk-OnlyCBICBI with CCIISD-ATARBCSCSIUFI%s: using %s over %s %s: isdata not configured %s: command protocol=0x%x not supported %s: bus attach failed umass%s: Unknown status %d in umass_scsi_cbumass_cmd: large datalen, %d %04x%04x%s: failed to set configuration, err=%s : failed to get interface, err=%s %s: device is neither visor nor palm %s: init failed, %s GenericDebuggerHotSyncRemote File System%s: no proper endpoints for port %d (%d,%d) uvisor%s: open rx pipe failed: %s %s: open tx pipe failed: %s %s: open intr pipe failed: %s %s: aue_send error=%s %s: usb error on tx: %s %s: %u usb errors on intr: %s %s: no memory for rx list -- packet dropped! %s: %u usb errors on rx: %s %s: reset failed %s: close rx pipe failed: %s %s: close tx pipe failed: %s %s: close intr pipe failed: %s %s: tx list init failed %s: rx list init failed %s: MII read timed out %s: EEPROM read timed out %s: setting config no failed auemii%s: getting interface handle failed %s: couldn't get endpoint descriptor %d %s: missing endpoint %s: address %s aue%s: usb errors on rx: %s axe%d: close rx pipe failed: %s axe%d: close tx pipe failed: %s axe%d: close intr pipe failed: %s axe%d: usb error on tx: %s axe%d: watchdog timeout axe%d: rx list init failed axe%d: tx list init failed axe%d: open rx pipe failed: %s axe%d: open tx pipe failed: %s %s: media change failed axe%d: write PHY failed axe%d: read PHY failed axemii%s: couldn't get ep %d no valid PHY address found, assuming PHY address 0 AX88178 AX88772B AX88772 AX88172axerxeof: too large transfer invalid buffer(pkt#%d), continue checksum err (pkt#%d) axen%d: close rx pipe failed: %s axen%d: close tx pipe failed: %s axen%d: close intr pipe failed: %s axen%d: usb error on tx: %s axen%d: watchdog timeout axen%d: rx list init failed axen%d: tx list init failed axen%d: open rx pipe failed: %s axen%d: open tx pipe failed: %s axen%d: write PHY failed axen%d: read PHY failed enable auto detach (0x%04x) unknown uplink bus:0x%02x axenmii AX88178a AX88179axen%s: warning: Failed to write register 0x%0x %s: warning: Failed to read register 0x%0x %s: warning: failed to read SMSC_COE_CTRL (err=%d) %s: warning: failed to write SMSC_COE_CTRL (err=%d) %s: warning: failed to read initial AFC_CFG, error %d %s: warning: media change failed, error %d %s: warning: timed-out waiting for reset to complete %s: warning: timed-out waiting for phy reset to complete %s: warning: failed to set the MAC address %s: warning: failed to read HW_CFG: %d %s: warning: failed to read HW_CFG: (err = %d) %s: warning: failed to read ID_REV (err = %d) %s: warning: failed to read MAC_CSR (err=%d) %s: error: smsc_chip_init failed (err=%d) smscmii%s: warning: MII is busy %s: warning: MII write timeout %s: warning: MII read timeout smsc%s: cue_send error=%s %s: read MAC address failed cue%s: kue_send error=%s %s: warm boot, no firmware download kue%s: failed loadfirmware of file %s: errno %d %s: cold boot, downloading firmware %s: failed to load code segment: %s %s: failed to load fixup segment: %s %s: failed to load trigger segment: %s %s: loading firmware failed %s: could not read Ethernet descriptor %s: no memory for multicast filter buffer %s: usb error on rx: %s %s: too many errors, disabling %s: open interrupt pipe failed: %s %s: close interrupt pipe failed: %s extra ethernet descriptor %s: no data interface %s: no descriptor for interrupt endpoint %d %s: interface alternate setting %d failed %s: no descriptor for bulk endpoint %d %s: could not find data bulk in %s: could not find data bulk out cdce%s: udav_send error=%s udavmiiudav%s: upl_send error=%s upl%s: ugl_send error=%s %s: bad header (length=%d) %s: bad packet count (%d) %s: bad packet size(%d), length=%d ugl%s: url_send error=%s %s: %s: bad register %04x urlmii%s: failed to get interface, err=%s %s: couldn't get endpoint %d url%s: Invalid notification length! (%d) %s: close notify pipe failed: %s no %s: data interface %d, has %sCM over data, has %sbreak %s: no endpoint descriptor for %d %s: Could not find data bulk in %s: Could not find data bulk out %s: could not set data multiplex mode %s: status change notification available umodem%s: failed to set configuration, err=%s uftdi%s: failed to get configuration descriptor %s: failed to get device descriptor %s: failed to get interface, err=%s %s: Could not find interrupt in %s: failed to get second interface, err=%s %s: reset failed, %s uplcom %s: failed to set configuration, err=%s umct%s: uvscom_intr: abnormal status: %s %s: uvscom_set_line_coding: %s %s: uvscom_set_line: %s %s: uvscom_shutdown: %s %s: uvscom_readstat: %s %s: cannot open interrupt pipe (addr %d) uvsopuvscom%s: this device is using CDC notify message in intr pipe. Please send your dmesg to , thanks. %s: intr buffer 0x%x 0x%x 0x%x 0x%x 0x%x 0x%x 0x%x %s:notify serial state, len=%d, data=0x%02x %s: ubsa_request: %s %s: failed to set configuration: %s %s: failed to get interface: %s ubsa%s: unhandled set request: reg=%x onoff=%x %s: no proper endpoints found (%d,%d) uipaq%s: this device is not using CDC notify message in intr pipe. Please send your dmesg to , thanks. %s: umass only mode. need to reattach %s: truinstall mode. need to reattach %s: no endpoint descriptor found for %d umsmwiusbthrwitxlwiIDLwi_usb: received USB_BUFAVAIL packet wi_usb: received USB_ERROR packet %s: %s error=%s wiTXsyncUGH TX UGH RX write_record buf size err %x %x invalid packet len: %x memsz %x max %x %s: %s: error=%s %s:%s: invalid packet id sent %x %s: already detached %s: open pipes failed wi_usb%s: could not get card cfg! unknown-device%s: %s loadfirmware error %d %s: reattaching after firmware upload atuatu-rfmd-intatu-rfmd-extatu-rfmd2958-intatu-rfmd2958-extatu-rfmd2958smc-intatu-rfmd2958smc-extatu-intersil-intatu-intersil-extatu-at76c503-i3863-intatu-at76c503-i3863-extatu-at76c503-rfmd-acc-intatu-at76c503-rfmd-acc-extatu-at76c505-rfmd-intatu-at76c505-rfmd-ext%s: could not retrieve Tx statistics - cancelling automatic rate control %s: could not write MAC register: %s %s: could not read MAC register: %s %s: could not read BBP %s: could not read EEPROM: %s %s: could not transmit buffer: %s %s: could not allocate rx xfer %s: could not allocate rx buffer %s: could not allocate tx xfer %s: could not allocate tx buffer %s: timeout waiting for BBP/RF to wakeup %s: could not allocate AMRR xfer %s: could not open Tx pipe: %s %s: could not open Rx pipe: %s %s: could not allocate Tx list %s: could not allocate Rx list %s: could not queue Rx transfer %s: could not set configuration no %s: could not get interface handle %s: no endpoint descriptor for iface %d %s: MAC/BBP RT%04x (rev 0x%02x), RF %s, address %s uralOUI 0x%06x model 0x%04x rev %d at %s phy %dmii_detach: phyloc and offloc specifiedmii_attach: phyloc and offloc specifiedmiiautmii_phy_setmedia: MASTER on wrong media: %s, rev. %d nsphyDP83840 10/100 PHYqsphyQS6612 10/100 PHYinphyi82555 10/100 PHYi82562EM 10/100 PHYi82562ET 10/100 PHYi82562G 10/100 PHYiophyi82553 10/100 PHYeephy88E1000 1 Gigabit PHY88E1000 2 Gigabit PHY88E1000 3 Gigabit PHY88E1000 4 Gigabit PHY88E1000S Gigabit PHY88E1011 Gigabit PHY88E1111 Gigabit PHY88E1112 Gigabit PHY88E1116 Gigabit PHY88E1116R Gigabit PHY88E1118 Gigabit PHY88E1149 Gigabit PHY88E3016 10/100 PHY88E3082 10/100 PHYPHYG65G Gigabit PHY88E1000 5 Gigabit PHY88E1000 6 Gigabit PHY88E1000 7 Gigabit PHYexphy_service: can't isolate 3Com PHY: 3Com internal media interface %s: ignoring this PHY, non-zero instance xlexphyrlrlphy_service: attempt to isolate phy: RTL internal PHY rlphyRTL8201L 10/100 PHYRTL8201E 10/100 PHYIP101 10/100 PHYlxtphyLXT970 10/100 PHYLXT971 10/100 PHYluphyLU6612 10/100 PHYmtdphyMTD972 10/100 PHYicsphyICS1890 10/100 PHYICS1892 10/100 PHYICS1893 10/100 PHYsqphy80220 10/100 PHY80225 10/100 PHY84220 10/100 PHYtqphy78Q2120 10/100 PHY: Generic IEEE 802.3u media interface, rev. %d: OUI 0x%06x, model 0x%04x %s: no media present ukphy: internal PHY dcphybmtphy3C905B internal PHY3C905C internal PHYBCM4401 10/100baseTX PHYBCM5201 10/100 PHYBCM5214 Quad 10/100 PHYBCM5220 10/100 PHYBCM5221 100baseTX PHYBCM5222 Dual 10/100 PHYbgebnxbrgphyBCM5400 1000baseT PHYBCM5401 10/100/1000baseT PHYBCM5411 10/100/1000baseT PHYBCM5421 10/100/1000baseT PHYBCM54K2 10/100/1000baseT PHYBCM5461 10/100/1000baseT PHYBCM5462 10/100/1000baseT PHYBCM5464 10/100/1000baseT PHYBCM5701 10/100/1000baseT PHYBCM5703 10/100/1000baseT PHYBCM5704 10/100/1000baseT PHYBCM5705 10/100/1000baseT PHYBCM5714 10/100/1000baseT/SX PHYBCM5750 10/100/1000baseT PHYBCM5752 10/100/1000baseT PHYBCM5780 10/100/1000baseT/SX PHYBCM54XX 10/100/1000baseT PHYBCM5481 10/100/1000baseT PHYBCM5482 10/100/1000baseT PHYBCM5722 10/100/1000baseT PHYBCM5755 10/100/1000baseT PHYBCM5761 10/100/1000baseT PHYBCM5784 10/100/1000baseT PHYBCM5787 10/100/1000baseT PHYBCM5706 10/100/1000baseT/SX PHYBCM5708C 10/100/1000baseT PHYBCM5708S 1000/2500baseSX PHYBCM5709 10/100/1000baseT PHYBCM5709S 1000/2500baseSX PHYBCM5709CAX 10/100/1000baseT PHYBCM5717C 10/100/1000baseT PHYBCM5719C 10/100/1000baseT PHYBCM5720C 10/100/1000baseT PHYBCM57765 10/100/1000baseT PHYBCM57780 10/100/1000baseT PHYBCM5906 10/100baseTX PHYamphyAm79C873 10/100 PHYDM9101 10/100 PHYDM9102 10/100 PHYDM9601 10/100 PHYAm79C875 quad PHYacphyAC101 10/100 PHYAC101L 10/100 PHYAC_UNKNOWN 10/100 PHY%s: %s: enter updown%s: %s: link %s : RTL internal phy urlphyrgephyRTL8169S/8110S PHYRTL8251 PHYnfe%s: unknown CICADA PHY model %x %s: unknown PHY speed %x ciphyCS8201 10/100/1000TX PHYCS8204 10/100/1000TX PHYVSC8211 10/100/1000 PHYCS8244 10/100/1000TX PHYVSC8601 10/100/1000 PHY%d:%d:%d: mem address conflict 0x%lx/0x%lx %d:%d:%d: io address conflict 0x%lx/0x%lx %d:%d:%d: bridge io address conflict 0x%lx/0x%lx %d:%d:%d: bridge mem address conflict 0x%lx/0x%lx %d:%d:%d: bridge bus conflict %d-%d dev %d function %dpci_mem_find: bad requestpci_mem_find: bad 64-bit requestpci_io_find: bad request%svendor 0x%04x product 0x%04xunknown vendor "%s", unknown product 0x%04x (unknown class 0x%02x, subclass 0x%02xclass %s unknown subclass 0x%02xclass %s subclass %s, rev 0x%02x) rev 0x%02xmiscellaneousfloppyIPISASethernettoken ringFDDIWorldFipPCMIG Multi ComputingXGAvideoaudiotelephonyhdaudioRAMflashhostMicroChannelNuBusRACEwaySemi-transparent PCIInfiniBandserialparallelmulti-port serialmodemsmartcard8237 DMA8254 timerRTCPCI Hot-PlugSD Host Controllerkeyboarddigitizermousegame portgeneric386486PentiumAlphaPowerPCMIPSCo-processorFirewireACCESS.busSSAFiber ChannelIPMISERCOSIrDAConsumer IRRFbluetoothbroadband802.11a (5 GHz)802.11b (2.4 GHz)standardvoicenetwork/computingentertainmentDPIOTime and Frequencysynchronizationmanagementprehistoricmass storagenetworkdisplaymultimediabridgecommunicationssysteminputdockserial buswirelessI2Osatellite commDASPundefinedOZ6729 CardBusOZ6730 CardBusOZ6922 CardBusOZ6832 CardBusOZ6836/OZ6860 CardBusOZ68[17]2 CardBusOZ6933 CardBusOZ69[17]2 CardBusOZ711Mx MiscOZ711EC1 SmartCardBusOZ711M1 CardBusOZ711MP1 SDHCOZ711MP1 XDHCOZ711MP1 CardBusOZ711EZ1 CardBusOZ711SP1 CardBusOZ711E0 CardBus3c9853c9963CRDAG6753CRPAG175V.90 Modem3c9403c3393c3593c4503c555 100Base-TX3c5753CCFE575BT3CCFE575CT3c590 10Mbps3c595 100Base-TX3c595 100Base-T43c595 10Mbps-MII3CRSHPW796 802.11b3CRWE154G72 802.11g3c556 100Base-TX3c556B 100Base-TX3CCFEM6563CCFEM656B3CCFEM656C56k Global Modem3cSOHO-TX3crwe777a AirConnect3c940B3c900 10Base-T3c900 10Mbps-Combo3c900B 10Mbps3c900B 10Mbps-Combo3c900B 10Mbps-TPC3c900B 10Mbps-FL3c905 100Base-TX3c905 100Base-T43c905B 100Base-TX3c905B 100Base-T43c905B 10/100Mbps-Combo3c905B 100Base-FX3c905C 100Base-TX3c9201 100Base-TX3c920B-EMB-WNM3cSOHO 100B-TX3c980 100Base-TX3c980C 100Base-TX3cr9903cr990-TX3cr990-TX-953cr990-TX-973c990b-TX-M3cr990-FX3cr990SVR953cr990SVR973c990BSVRVoodooVoodoo2BansheeVoodoo3Voodoo4Voodoo5GLINT 300SXGLINT 500TXGLINT DeltaPermediaGLINT MXPermedia 2GLINT GammaPermedia 2vPermedia 3Wildcat III 6210Wildcat 5110Wildcat IV 72105000/6000 series RAID7000/8000 series RAID9000 series RAID9500 series RAIDFE2500 10/100PCM200 10/100FE2000VX 10/100FE2500MX 10/100PC4800 WirelessPCI35x WLANPC4500 WirelessMPI-350 WirelessACCM 2188 VL-PCI2051 PCI2051 ISAATP850U/UFATP860ATP860-AATP865-AATP865-RAEC6710AEC6712UWAEC6712UAEC6712SAEC6710DAEC6715UWMPX 5030/5038EN2242EN1217RhineIIrtl8139AWA-100M1435 VL-PCIM1445 VL-PCIM1449 ISAM1451 PCIM1461 PCIM1489 PCIM1511 PCIM1513 ISAM1523 PCIM1523 ISAM1531 PCIM1533 ISAM1535 PCIM1541 PCIM1543 ISAM1563 ISAM1573 ISAM1575 ISAM1621 PCIM1631 PCIM1644 PCIM1647 PCIM1689 PCIM1695 PCIM3309 MPEGM4803M5219 UDMA IDEM5229 UDMA IDEM5237 USBM5239 USB2M5243 AGP/PCI-PCIM5246 AGPM5247 AGP/PCI-PCM5249M524B PCIEM524C PCIEM524D PCIEM5261 LANM5263 LANM5281 SATAM5287 SATAM5288 SATAM5289 SATAM5451 AudioM5455 AudioM5457 ModemM5461 HD AudioM7101 PowerAL981AN983AN985ADM8211 WLANADM9511ADM9513AIC-7810AHA-2940AU/CNAHA-2930CUAIC-7850AIC-7855AIC-5900 ATMAIC-5905 ATMAPA-1480AIC-7860AHA-2940AUAIC-7870AHA-2940AHA-3940AHA-3985AHA-2944AIC-7815AIC-7880AHA-2940UAHA-3940UAHA-398XUAHA-2944UAHA-2940UWProAIC-6915AIC-7895AHA-2940U2 U2AHA-2930U2 U2AAA-131U2 U2AIC-7890/1 U2AIC-7892 U160AHA-29160 U160AHA-19160B U160AVA-2930LPAHA-3950U2B U2AHA-3950U2D U2AIC-7896/7 U2AHA-3960D U160AIC-7899BAIC-7899DAIC-7899FAIC-7899 U160ServeRAIDAAC-2622ASR-2200SASR-2120SAAC-364AAC-3642Dell PERC 2/QCAIC-7901 U320AHA-29320A U320AHA-29320LP U320AIC-7901A U320AHA-29320 U320AHA-29320B U320AIC-7902 U320AIC-7902B U320AHA-39320 U320AHA-39320B U320AHA-39320A U320AHA-39320D U320AHA-39320DB U3201200AABP-930/40UAABP-940UWASP-3940U2WASP-3940U3WWaikato Dag3.2Endace Dag3.5Endace Dag4.22GEEndace Dag4.23PhysXAT22AT24AcenicAcenic CopperBCM5700BCM5701AC1000AC1001AC9100AC1003AMD64 0Fh HyperTransportAMD64 0Fh Address MapAMD64 0Fh DRAM CfgAMD64 0Fh Misc CfgAMD64 10h HyperTransportAMD64 10h Address MapAMD64 10h DRAM CfgAMD64 10h Misc CfgAMD64 10h Link CfgAMD64 11h HyperTransportAMD64 11h Address MapAMD64 11h DRAM CfgAMD64 11h Misc CfgAMD64 11h Link CfgAMD64 15/1xh Link CfgAMD64 15/1xh Address MapAMD64 15/1xh DRAM CfgAMD64 15/1xh Misc CfgAMD64 15/1xh CPU PowerAMD64 15/1xh NB PowerAMD64 15/1xh HostAMD64 15/1xh PCIEAMD64 15/1xh IOMMUAMD64 16h PCIEAMD64 14h HostAMD64 14h PCIEAMD64 16h Link CfgAMD64 16h Address MapAMD64 16h DRAM CfgAMD64 16h Misc CfgAMD64 16h CPU PowerAMD64 16h HostAMD64 15/0xh Link CfgAMD64 15/0xh Address MapAMD64 15/0xh DRAM CfgAMD64 15/0xh Misc CfgAMD64 15/0xh CPU PowerAMD64 15/0xh HostAMD64 14h Link CfgAMD64 14h Address MapAMD64 14h DRAM CfgAMD64 14h Misc CfgAMD64 14h CPU PowerAMD64 12h HostAMD64 12h PCIEAMD64 14h NB PowerAMD64 14h Reserved79c970 PCnet-PCI79c978 PChome-PCI53c974 PCscsi-PCI79C974 PCnet-PCIGeode LXGeode LX VideoGeode LX CryptoCS5536 PCICS5536 ISACS5536 AudioCS5536 USBCS5536 IDEElanSC520 PCIHudson-2 PCIE751 System762 PCI761 PCI755 ISA755 IDE755 Power755 USB756 ISA756 IDE756 Power756 USB Host766 ISA766 IDE766 USB766 Power766 USB OpenHCI768 ISA768 IDE768 Power768 AC97768 Modem768768 USB8131 PCIX8131 PCIX IOAPIC8151 Sys Control8151 AGP8132 PCIX8132 PCIX IOAPIC8111 Ether8111 USB8111 LPC8111 IDE8111 SMBus8111 Power8111 AC97Hudson-2 SATAHudson-2 SD Host ControllerHudson-2 USBHudson-2 USB2Hudson-2 SMBusHudson-2 IDEHudson-2 HD AudioHudson-2 LPCHudson-2 PCIHudson-2 xHCIRS780 HostRS880 HostRS780 PCIEMegaRAIDMegaRAID Series 428MegaRAID Series 434ADSP 21535 DSPAD1889 AudioSafeNet ADSP 2141TC9021BanditGCOHareHeathrowPaddingtonUni-N EthUni-NUni-N Eth FirewireUni-N AGPUni-N GMACKeylargoPangea GMACPangea MacioPangea USBPangea AGPPangeaPangea PCIUni-N2 AGPUni-N2 HostPangea FireWireUniNorth FirewireUni-N2 GMACUni-N ATAUniNorth AGPUniNorth PCIIntrepid ATAIntrepidIntrepid USBK2 USBK2 MacioK2 FirewireK2 ATAU3U3 HyperTransportU3 AGPK2 GMACShastaShasta ATAShasta GMACShasta FirewireShasta PCIShasta HyperTransportK2U3L AGPK2 AGPIntrepid 2 AGPIntrepid 2 PCIIntrepid 2 ATAIntrepid 2 FireWireIntrepid 2 GMACARS106SARS0303D1000PV2000PV2000MT2000MIARC-1110ARC-1120ARC-1130ARC-1160ARC-1170ARC-1200ARC-1200BARC-1202ARC-1210ARC-1214ARC-1220ARC-1230ARC-1260ARC-1270ARC-1280ARC-1380ARC-1381ARC-1680ARC-1681ARC-1880AX88140A/88141ASM1061 SATAASM1061 AHCIASM1042 xHCIASM1083/1085 PCIE-PCIASM1042A xHCIRadeon HD 6310 HD AudioRadeon HD 6500D HD AudioMobility Radeon X600FireMV 2400Mobility Radeon X300FireGL M24 GLRadeon X600FireGL V3200Radeon X600 SecRadeon IGP 320Radeon IGP 340Radeon 9500 ProRadeon AE 9700 ProRadeon AF 9600TXFireGL AGZ1Radeon AH 9800 SERadeon AI 9800Radeon AJ 9800FireGL AK X2Radeon 9600 ProRadeon 9600Radeon 9550FireGLRadeon 9650Mach32Radeon 9500 Pro SecRadeon 9600 Pro SecRadeon 9600 LE SecRadeon 9600 XT SecRadeon 9550 SecRadeon IGPRadeon 8500Radeon BC R200Radeon IGP 320MMobility M6SB200 AC97SB200 PCISB200 USB2SB200 USBSB200 IDESB200 ISASB200 ModemSB200 SMBusMach64 CTMach64 CXSB300 AC97SB300 PCISB300 SMBusSB300 USB2SB300 USBSB300 IDESB300 ISASB300 ModemSB300 SATASB400 AC97SB400 PCISB400 SMBusSB400 USB2SB400 USBSB400 IDESB400 ISASB400 ModemSB400 SATASB450 HD AudioSB600 SATASB600 AC97SBx00 HD AudioSB600 PCISBx00 SMBusSB600 USB2SB600 USBSB600 IDESB600 ISASB600 ModemSBx00 SATASB700 USB2SB700 USBSB700 IDESB700 ISASB800 PCIERadeon Mobility IGPMach64 ETRage ProMach64Rage XLRadeon 9000Radeon 9000 SecRadeon X800Radeon X800 ProRadeon X800SERadeon X800XTFireGL X3-256Radeon Mobility M18Radeon X800 SERadeon X800 XTRadeon AIW X800 VERadeon X800 Pro SecRadeon X850Radeon X850 XTRadeon X850 SERadeon X850 ProRadeon X850 XT PERage128Mobility M3Mobility 1Rage P/MRadeon Mobility M7FireGL Mobility 7800 M7Radeon Mobility M6Radeon Mobility M9FireMV 2400 PCIRage 128 MobilityRadeon 9500/9700Radeon 9600 TXFireGL X1Radeon 9800 ProRAdeon 9800Radeon 9800 XTFireGL X2Radeon Mobility M10Radeon Mobility 9550Radeon 9500/9700 SecFireGL X1 SecRadeon 9800 Pro SecRage 128 ProRage FuryRage 128Rage 128 PXAIW RadeonRadeon 9100Radeon 7500Radeon VEES1000Rage MagnumRadeon Mobility M300 M22Radeon Mobility X600 M24CFireGL M44 GL 5464Radeon X800 XT PERadeon X800 XTPRadeon X800 XLFireGL V7100FireGL V5100Radeon X800 SecMobility FireGL V5000 M26Radeon Mobility X700 XL M26Radeon Mobility X700 M26Radeon X550XTXRadeon X550XTX SecRS300_100 HostRS300_133 HostRS300_166 HostRadeon IGP 9100 HostRadeon IGP 9100Radeon Mobility IGP 9100Radeon IGP 9100 AGPRadeon 9200 PRO SecRadeon 9200 SecRS480 HostRX480 HostRD580 HostRadeon XPRESS 200Radeon XPRESS 200MRX780 HostRD780 HT-PCIERadeon 9200 PRORadeon 9200Radeon 9200 SE SecFireMV 2200RD790 PCIESR5690 HostRD890 HostSR5670 HostSR5650 HostSR5690 PCIERS400 HostRC410 HostRX480 PCIERS480 PCIERadeon X300Radeon X550FireGL V3100FireMV 2200 5B65Radeon X300 SecRadeon X550 SecFireGL V3100 SecFireMV 2200 SecRadeon Mobility 9200Radeon 9200 SERadeon X800 XT M28FireGL V5100 M28Radeon Mobility X800 M28FireGL R480Radeon X850XTRadeon X800 GTO SecRadeon X850 XT SecFireGL V5000FireGL X700 XTFireGL X700 ProFireGL X700 SERadeon X700 PCIERadeon X700 SE PCIERadeon X700 PCIE SecRadeon X700 SERadeon X700 SE SecRadeon HD 8670ARadeon HD 8730MOlandRadeon HD 8790MRadeon HD 8530MRadeon HD 8600Radeon HD 8570Radeon HD 8500Radeon HD 8670MRadeon HD 8500MHainanCaymanFirePro V7900FirePro V5900Radeon HD 6970Radeon HD 6950Radeon HD 6990Radeon HD 6930Radeon HD 6970MMobility Radeon HD 6000BartsRadeon HD 6900MRadeon HD 6870Radeon HD 6850Radeon HD 6790Radeon HD 6730MRadeon HD 6600MRadeon HD 6610MRadeon E6760TurksFirePro V4900FirePro V3900Radeon HD 6650ARadeon HD 7670ARadeon HD 6670Radeon HD 6570Radeon HD 7570Radeon HD 6510Radeon HD 6400MRadeon HD 6430MCaicosRadeon E6460Radeon HD 6450ARadeon HD 8490Radeon HD 7450ARadeon HD 7470Radeon HD 6450Radeon HD 7450FirePro W9000FirePro VTahitiRadeon HD 7970Radeon HD 7900Radeon HD 7950Radeon HD 7990Radeon HD 7870 XTRadeon HD 7970MRadeon HD 8970MPitcairnFirePro W7000FirePro W5000Radeon HD 7870Radeon HD 7850Radeon HD 8800MCape VerdeRadeon HD 7700MRadeon HD 7870MRadeon HD 7850MFirePro W600FirePro M4000Radeon HD 7730MRadeon HD 7800MRadeon HD 7730Radeon HD 7700Radeon HD 7770Radeon HD 7750Radeon HD 7670MRadeon HD 7550MRadeon HD 7000MRadeon HD 7400CypressFirePro V8800FirePro V7800FirePro V9800FireStream 9370FireStream 9350Radeon HD 5870Radeon HD 5850Radeon HD 6800Radeon HD 5970Radeon HD 5900Radeon HD 5830Mobility Radeon HD 5870Mobility Radeon HD 5850Radeon HD 6850MFirePro V5800Mobility Radeon HD 5800Radeon HD 5770Radeon HD 5670 640SPRadeon HD 6770Radeon HD 5750Radeon HD 6750Mobility Radeon HD 5730Mobility Radeon HD 5650Mobility Radeon HD 5570FirePro V4800FirePro V3800Radeon HD 5670Radeon HD 5570Radeon HD 5550RedwoodRadeon Mobility HD 5470Radeon Mobility HD 5430Radeon HD 6370MRadeon HD 6330MCedarFireProFirePro 2460FirePro 2270Radeon HD 7300Radeon HD 5450Radeon HD 7350Cedar LERS100 PCIRS200 PCIRadeon X1800Radeon X1800 XTRadeon Mobility X1800FireGL Mobility V7200FireGL V7200FireGL V5300FireGL Mobility V7100FireGL V7300FireGL V7350Radeon X1600RV505Radeon X1300/X1550Radeon X1550M54-GLRadeon Mobility X1400RADEON X1550 64-bitRadeon Mobility X1300 M52-64Radeon Mobility X1300Radeon X1300FireGL V3300FireGL V3350Radeon X1600 SecRadeon X1300/X1550 SecRadeon X1300 ProRadeon X1450Radeon Mobility X2300Radeon Mobility X1350Radeon Mobility X1450FireMV 2250Radeon X1550 64-bitRadeon X1300 Pro SecRadeon X1300 SecRadeon X1650Radeon X1600 ProFireGL V5200Radeon Mobility X1600Radeon X1650 ProRadeon X1300 XTFireGL V3400Mobility FireGL V5250Radeon X1700Radeon X1700 XTRadeon Mobility X1700Radeon X1600 Pro SecRadeon X1650 Pro SecRadeon X2300HDRadeon Mobility X2300HDRadeon X1950Radeon X1900AMD Stream ProcessorRadeon X1950 ProRV560Radeon Mobility X1900Radeon X1950 GTRV570FireGL V7400Rv560Radeon RX1650 XTRadeon X1950 Pro SecRadeon RX1650 XT SecRadeon 9000/9100 IGPRadeon RS350IGPRS690 HostRS740 HostRS690 PCIERS690M PCIERS690 HD AudioRadeon X1250Radeon X1250 IGPRadeon X1200RS740RS740MRadeon 2100Radeon HD 2900 XTRadeon HD 2900 ProRadeon HD 2900 GTFireGL V8650FireGL V8600Radeon HD 4870Radeon HD 4870 X2Radeon HD 4850Radeon HD 4850 X2FirePro V8750FirePro V7760Mobility Radeon HD 4850Mobility Radeon HD 4850 X2Radeon HD 4800FirePro RV770FireStream 9270FireStream 9250FirePro V8700Mobility Radeon HD 4870Radeon M98Radeon HD 4890FirePro M7750Mobility Radeon HD 4650Mobility Radeon HD 4670Radeon HD 4670Radeon E4600Radeon HD 4600Radeon HD 4650FirePro V7750FirePro V5700FirePro V3750Mobility Radeon HD 4830FirePro M7740RV740Radeon HD 4770Radeon HD 4700FirePro M5750Radeon HD 2400 XTRadeon HD 2400 ProRadeon HD 2400 Pro AGPFireGL V4000Radeon HD 2350Mobility Radeon HD 2400 XTMobility Radeon HD 2400Radeon E2400Radeon HD 2400 Pro PCIFireMV 2260Radeon HD 3870Mobility Radeon HD 3850Radeon HD 3850Mobility Radeon HD 3850 X2Mobility Radeon HD 3870Mobility Radeon HD 3870 X2Radeon HD 3870 X2FireGL V7700Radeon HD 3850 AGPRadeon HD 3690FireStreamRadeon HD 4550Radeon HD 4350Mobility Radeon HD 4300Mobility Radeon HD 4500FirePro RG220Mobility Radeon HD 4330Mobility Radeon HD 2600Mobility Radeon HD 2600 XTRadeon HD 2600 XT AGPRadeon HD 2600 Pro AGPRadeon HD 2600 XTRadeon HD 2600 ProFireGL V5600FireGL V3600Radeon HD 3600Mobility Radeon HD 3650Mobility Radeon HD 3670Mobilty FireGL V5700Radeon HD 3650 AGPRadeon HD 3650Mobility FireGL V5725Radeon HD 3470Mobility Radeon HD 3430Mobility Radeon HD 3400Radeon HD 3450Radeon HD 3450 AGPRadeon HD 3430Radeon HD 3450 PCIFirePro V3700FireMV 2450RS780 HD AudioRadeon HD 3200Radeon HD 3100Radeon 3100Radeon HD 3300Radeon HD 3000Radeon HD 6550DRadeon HD 6620GRadeon HD 6370DRadeon HD 6380GRadeon HD 6410DRadeon HD 6520GRadeon HD 6480GRadeon HD 6530DSumoRadeon HD 4200 HD AudioRadeon HD 4200Radeon HD 4100Mobility Radeon HD 4200Mobility Radeon HD 4100Radeon HD 4290Radeon HD 4250Radeon HD 6310Radeon HD 6250Radeon HD 6320Radeon HD 6290Radeon HD 7340Radeon HD 7310Radeon HD 7290ArubaRadeon HD 7660DRadeon HD 7640GRadeon HD 7560DFirePro A300Radeon HD 7620GRadeon HD 7600GRadeon HD 7500GRadeon HD 8650GRadeon HD 8670DRadeon HD 8550GRadeon HD 8570DRadeon HD 8610GRadeon HD 7660GRadeon HD 7520GRadeon HD 7540DRadeon HD 7420GRadeon HD 7480DRadeon HD 7400GRadeon HD 8450GRadeon HD 8470DRadeon HD 8350GRadeon HD 8370DRadeon HD 8510GRadeon HD 8410GRadeon HD 8310GRadeon HD 2600 HD AudioRS690M HD AudioRadeon HD 3870 HD AudioRadeon HD 3600 HD AudioRadeon HD 34xx HD AudioRadeon HD 48xx HD AudioRadeon HD 4000 HD AudioRadeon HD 5800 AudioRadeon HD 5700 AudioRadeon HD 5600 AudioRadeon HD 5470 AudioRadeon HD 6670 AudioRadeon HD 6400 AudioRS100 AGPRS200 AGPRS250 AGPRS200M AGPS5933 PCI MatchmakerMyrinet LANaiAST1150 PCIAST1180AST2000AST2100AR5210AR5311AR5211AR5212AR2413AR5413AR5424AR5416AR5418AR9160AR9280AR9281AR9285AR2427AR9227AR9287AR9300AR9485AR9462AR9565AR5211RefAT76C506IDE-2015PLL1EL1L2CL1CL1DAR8162AR8161AR8172AR8171L2E2200Vortex 1Vortex 2Vortex AdvantageAVL2301AVG2302ALG2301ALG2302ALS4000Dual SerialQuad SerialBRI ISDNFritz ISDNFritz v2.0 ISDNPRI T1 ISDNRT2890F5D6001F5D6020V3F5D7010F5D6000VME 617VME 270655015601BCM43224BCM5752BCM5752MBCM5709BCM5709SBCM5716BCM5716SBCM57811BCM57811 MFBCM57811 VFBCM57787BCM57764BCM5725BCM5702BCM5703BCM5704CBCM5704S AltBCM5706BCM5708BCM5702FEBCM57710BCM57711BCM57711EBCM5705BCM5705KBCM5717BCM5718BCM5719BCM5721BCM5722BCM5723BCM5705MBCM5705M AltBCM5720BCM57712BCM57712 MFBCM5717CBCM5714BCM5714SBCM5780BCM5780SBCM5705FBCM57712 VFBCM5754MBCM5755MBCM5756BCM5751BCM5715BCM5715SBCM5754BCM5755BCM5751MBCM5751FBCM5787FBCM5761EBCM5761BCM57762BCM57767BCM5764BCM57766BCM5762BCM5761SBCM5761SEBCM57800BCM57840 OBSBCM57810BCM57760BCM57788BCM57780BCM5787MBCM57790BCM5782BCM5784BCM5785GBCM5786BCM5787BCM5788BCM5789BCM5785FBCM57840BCM57840 MFBCM57800 MFBCM5702XBCM5703XBCM5704SBCM57800 VFBCM5706SBCM57840 OBS MFBCM5708SBCM57840 VFBCM57810 MFBCM57810 VFBCM57761BCM57781BCM57791BCM57786BCM57765BCM57785BCM57795BCM57782BCM5702 AltBCM5703 AltBCM5781BCM5727BCM5753BCM5753MBCM5753FBCM5903MBCM4401B1BCM5901BCM5901A2BCM5903FBCM5906BCM5906MBCM4303BCM4307BCM4311BCM4312BCM4315BCM4318BCM4319BCM4306BCM4309BCM43XGBCM4321BCM4322BCM43225BCM43227BCM4401BCM4401B0BCM431358015802580558205821582258235825586058615862425/825/42B/82B1010/1020/1007/1741415/815/41B/81B1860410/420BT848BT849BT878BT879BT878 AudioBT879 AudioBt8474 HDLCMultiMaster NCMultiMasterFlashPointGPPCINITROX XLNITROX LiteNITROX PXOCTEON Plus CN50XXCinemasterNx10 10GbEPE9000 10GbET302E 10GbET310E 10GbET320X 10GbET302X 10GbET320E 10GbET310X 10GbET3B10 10GbET3B20 10GbET3B02 10GbE643106554565548655506555465555685546900069030CL-GD7548CL-GD5430CL-GD5434-4CL-GD5434-8CL-GD5436CL-GD5446CL-GD5480CL-GD5462CL-GD5464CL-GD5465CL-PD6729CL-PD6832 CardBusCL-PD6833 CardBusCL-GD7542CL-GD7543CL-GD7541CS4610 SoundFusionCS4615CS4280/46xx CrystalClearCS4281 CrystalClearVIC PCIEVIC ManagementVIC EthernetVIC FCoEAAR-1210SAAAR-1220SAAAR-1225SAPCI0640PCI0642PCI0643PCI0646PCI0647PCI0648PCI0649PCI0650AUSB0670USB0673PCI0680SiI3112 SATASiI3114 SATASiI3124 SATASiI3131 SATASiI3132 SATASiI3512 SATASiI3531 SATAGigaCardEX110TXSmart Array 64xxTriflex PCIQVisionQVision 1280/pSmart Array 5300Smart Array 5iSmart Array 532Smart Array 5312Smart Array 6iSmart Array 641Smart Array 642Smart Array 6400Smart Array 6400 EMSmart Array 6422Hotplug PCINetelligent ASMCPCI HotplugUSB OpenHostSMART2P RAIDISAPnPNetelligent 10/100TXNetelligent IDENetelligent 10 TIntegrated NetFlex 3/PDP Netelligent 10/100TXProLiant Netelligent 10/100TXEmbedded Netelligent 10/100TXNetelligent 10 T/2 PCISmart Array 5300 rev.2Smart Array 5i/532 rev.2iLONetFlex 3/PNetFlex 3/PBCompexeRL100-ATX 10/100PMAC 9871356k WinmodemSoftK56 PCIHSF 56k HSFiMUSYCC CN8478MUSYCC CN8474MUSYCC CN8472MUSYCC CN8471CX2388xCX2388x AudioCX2388x MPEGCX2388x IRCX2388582C599 VLBCY82C693U ISAFEther CB-TXD 10/100FEther II CB-TXD 10/100CG-LAPCIGTRTL8192ERTL8190PC-Bus II-PCICache Coherency FilterSoundBlaster LiveSoundBlaster AWE64DSoundBlaster AudigySoundBlaster X-FiSoundBlaster Audigy LSSoundBlaster Audigy 2SoundBlaster X-Fi XtremePCI Gameport JoystickSoundBlaster Audigy DigitalEctiva 1938Cyclom-Y below 1MCyclom-YCyclom-4Y below 1MCyclom-4YCyclom-8Y below 1MCyclom-8YCyclom-Z below 1MCyclom-ZIQ80310Cx5510GXm PCIGXm ISACx5530 SouthCx5530 SMICx5530 IDECx5530 XpressAUDIOCx5530 VideoDM9009DM9100DM9102DM9132PCCOM 2-portPCCOM 4-portPCCOM 8-port210502104021030Zephyr NV-RAMKZPSA21140TGA2DEFPA21041DGLPBZLXP-L2Memory Channel Cluster Controller21142/3Farallon PN9000SX210522115021150-BC21152211532115421554SWXCR RAIDPERC 2/SiPERC 3/DiPERC 3/SiDRAC 3 Add-inDRAC 3 Virtual UARTDRAC 3 Embedded/OptionalDRAC 4 Embedded/OptionalDRAC 3 OptionalPERC 4/Di i960PERC 4/Di VerdeDRAC 4DRAC 4 Virtual UARTPERC 4e/DiDRAC 4 SMICPERC 58139Viper/PCIDFE-550TXDFE-530TX+DFE-690TXDDRP32TXDDWL-610DGE-550TDGE-550SXDFE-520TX C1DGE-528TDGE-530T C1DGE-560TDGE-530T B1DGE-560SXDGE-550T B1DGE-530T A1Memory ControlSmartCache/RaidPCI-PCISmartRAIDSmartRAID 2005SPCI-SCIDMX3194UIS64PH ISDNRT2860155P-MF1 ATM25SS-3010 ATMSpeedStream 1023QuickStep 1000 ISDNLPFCLP6000Lancer 10GbELancer 10GbE VFLPe121LPe1250LP952LP982LP101LP1050LP111LP1150LPe111LPe1150LPe1000LPe1000-SPLPe1002-SPLPe12000LPe12000-SPLPe12002-SPLP7000LP8000LP9000LP9802LP10000LPX10000LP10000-SLP11000-SLPe11000-SLPe12000-SLP11000LP11000-SPLP11002-SPLPe11000LPe11000-SPLPe11002-SPEndace Dag3.6DEndace Dag4.23GEFlash memoryMemory StickSD ControllerCB-1211 CardBusCB-1225 CardBusCB-1410 CardBusCB-710 CardBusCB-712 CardBusCB-1420 CardBusCB-720 CardBusCB-722 CardBusAudioPCI97AudioPCICT5880ES366H ModemMaestro IISOLO-1 AudioDriveMaestro 2EES1989ES1989 ModemMaestro 3ES1983 ModemMaestro 3 AudioES366H Fax/ModemES2838/2839 SuperLink ModemES2898 ModemRoadRunner HIPPIRoadRunner Gig-EFreedom GBusWL11000PSST-64PSST-128PSST-16PSST-4pSST-8pXR17C152XR17C154XR17C158ATM PCA-200ATM PCA-200e801 SoundMPC8349EMPC8349MPC8347E TBGAMPC8347 TBGAMPC8347E PBGAMPC8347 PBGAMPC8343EMPC8343FL1000 xHCIFL1009 xHCIFL1400 xHCIPW008GE5PW008GE4PRIMEPOWER250/450 LANioDrive v1.2ioDriveioXtremeioXtreme ProTMC-18C30GL24110P03GL24110PGL24110P02Pulsar G7370 ADSLPR103WinTVPN672TX 10/100Visualize EGVisualize FX6Visualize FX4Visualize FX2Tach TL FibreChannelTach XL2 FibreChannelJ2585AJ2585BDiva Serial MultiportElroy Ropes-PCIVisualize FXeTopToolsNetRaid-4MNetServer SmartIRQ82557B 10/100 NICPluto MIOzx1 IOCMercury Ropes-PCIQuickSilver Ropes-PCISmart Array P430iSmart Array P830iSmart Array P430Smart Array P431Smart Array P830Smart Array P731mSmart Array P230iSmart Array P530Smart Array P531Smart Array P244brSmart Array P741mSmart HBA H240arSmart Array P440arSmart Array P440Smart Array P441Smart Array P841Smart HBA H244brSmart HBA H240Smart HBA H241Smart Array P246brSmart Array P840Smart Array P542tSmart Array P240trSmart HBA H240trSmart Array V100Smart Array E200iSmart Array E200Smart ArraySmart Array P800Smart Array P600Smart Array E500Smart Array P400Smart Array P400iSmart Array P700mSmart Array P212Smart Array P410Smart Array P410iSmart Array P411Smart Array P812Smart Array P712mSmart Array P711miLO3 SerialiLO3 SlaveiLO3 ManagementiLO3 WatchdogSmart Array P222Smart Array P420Smart Array P421Smart Array P822Smart Array P420iSmart Array P220iSmart Array P721m7751650079517814/7851/785480658165815479567955/7954HB6HB4MSVCC01 Video CaptureSH7751 PCISH7751R PCIISP2100MCACPU - Alta LiteCPU - Alta MPISA w/PnPCPUAuto LANStreamerGXT-150P82G267582351Miami/PCIOlympici82557B 10/100RSAFireGL2133 PCIX-PCIX4810 BSP4810 SCCCalgary IOMMUEnvy24 I/O CtrlrEnvy24PT/HT Audio77201/77211 ATM89HPES12N3A89HPES24N3A89HPES24T689HPES4T489HPES5T5ZB89HPES24T3G289H64H16G3WDT 50x Watchdog TimerINIC-850INIC-1060INIC-940INIC-941INIC-950VirtualBox Graphics AdapterVirtualBox Guest ServiceIPN2120IPN222050265027502888498853Twin Turbo 128Twin Turbo 3DEES ISA21145Core HostCore PCIEHD Graphics3400 PCIECentrino Advanced-N 6205WiFi Link 1000Centrino Advanced-N 6250WiFi Link 1030Centrino Advanced-N 6030Core 2G HostCore 2G PCIEHD Graphics 2000Xeon E3-1200 HostHD Graphics P3000HD Graphics 3000Medfield VideoCore 3G HostCore 3G PCIEHD Graphics 2500Xeon E3-1200 v2 HostHD Graphics 4000HD Graphics P400080303 IOP80312 I/O Companion6700PXH PCIE-PCIX6702PXH PCIE-PCIXIOP332 PCIE-PCIXIOP331 PCIX-PCIX41210 PCIE-PCIXIOP333 PCIE-PCIXHD Graphics 4600HD Graphics P4600DH89XXCC SGMIIDH89XXCC SerDesDH89XXCC BackplaneDH89XXCC SFP82375EB EISA82424ZX Cache/DRAM82378IB ISA82426EX ISA82434LX/NXGDT RAIDCentrino Advanced-N 6235Centrino Wireless-N 6150Centrino Wireless-N 2230Centrino Wireless-N 2200Centrino Wireless-N 135Centrino Wireless-N 105Centrino Wireless-N 130Centrino Wireless-N 100Dual Band Wireless AC 7260Dual Band Wireless AC 3160Dual Band Wirelsss AC 3160Dual Band Wireless AC 7265i960 RPi960 RMi960 RNSSD DC P3700/P3600/P3500Core 4G HostCore 4G HD AudioHD Graphics 5000Iris Graphics 5100GMA 3600Atom D2000/N2000 VideoAtom D2000/N2000 HostCore 4G PCIEXeon E3-1200 v3 HostAtom S1200 PCIEAtom S1200 MEIAtom S1200 SMBusAtom S1200 UARTAtom S1200 ISAAtom S1240 HostAtom S1220 HostAtom S1260 HostIris Pro Graphics 5200E5 v2 HostE5 v2 PCIEE5 v2 UBOXE5 v2 I/OATE5 v2 Address MapE5 v2 IIO RASE5 v2 I/O APICE5 v2 Home AgentE5 v2 QPI Link MonitorE5 v2 RASE5 v2 QPI LinkE5 v2 QPIE5 v2 TAE5 v2 TADE5 v2 ThermalE5 v2 ErrorE5 v2 PCUE5 v2 SADE5 v2 BroadcastE5 v2 UnicastBay Trail HostBay Trail HD AudioBay Trail SMBusBay Trail TXEBay Trail LPCBay Trail SATABay Trail AHCIBay Trail VideoBay Trail xHCIBay Trail PCIE8254282543GC82544EI82544GC82540EM82545EM82546EB82541EI82540EP82547EI82545GMPRO/10082559PRO/100 VEPRO/100 VM82562EH HomePNA82801DB LANV.92 ModemPRO/Wireless 210082597EXICH8 IGP M AMTICH8 IGP AMTICH8 IGP CICH8 IFEICH8 IGP MPRO/100 M82571EB82801FB LAN82801FBM LAN82801GB LAN82547GI82541GI82541ER82546GB82572EI82573E82573E IDE82573E KCS82573E Serial80003ES282573L82575EB82573V82598ICH9 IGP AMTICH9 IGP MICH9 IFEICH9 IFE GICH9 IFE GTICH8 IFE GTICH8 IFE G82598AF82598AT82576ICH9 IGP M VICH10 R BM LMICH10 R BM LFICH10 R BM V82574L82571PT82575GB82598EBICH10 D BM LMICH10 D BM LFICH9 BM82577LM82577LC8259982578DM82578DCICH9 IGP M AMT8255282815 Host82815 AGP82815 Video82806AA APIC82559ER82092AA IDESAA711682452KX/GXEE Pro 10 PCIEE Pro 100EE Pro 100 Smart8255x82437FX82371FB ISA82371FB IDE82371 ISA and IDE82437MX82441FX82380AB Mobile ISA82380FB Mobile82439HX82806AA82870P2 PCIX-PCIX82870P2 IOxAPIC82870P2 Hot PlugICH8 82567V-382579LM82579V82576NS82583V82576 SerDes QP8258082599 T3I350I350 FiberI350 SerDesI350 SGMII82580 QFX540TI210I210 FiberI210 SerDesI210 SGMIII211I217-LMI217-V82599ENI218-LMI218-VCore 5G HostCore 5G HD AudioHD Graphics 5500HD Graphics 5300HD Graphics 6000Iris Graphics 610080960RP ATU82840 Host82840 AGP82840 PCI82845 Host82845 AGPI/OAT6 Series SATA6 Series AHCI6 Series RAID6 Series PCIE6 Series HD Audio6 Series SMBus6 Series Thermal6 Series DMI-PCI6 Series USB6 Series MEI6 Series KTZ68 LPCP67 LPCUM67 LPCHM65 LPCH67 LPCHM67 LPCQ65 LPCQS67 LPCQ67 LPCQM67 LPCB65 LPCC202 LPCC204 LPCC206 LPCH61 LPCC600 SATAC600 AHCIC600 RAIDC600 PCIEC600 HD AudioC600 SMBusC600 ThermalC600 USBC600 LANC600 MEIC600 Virtual PCIEC600 LPC7 Series SATA7 Series AHCI7 Series RAID7 Series PCIE7 Series HD Audio7 Series SMBus7 Series USB7 Series xHCI7 Series MEI7 Series KTZ77 LPCZ75 LPCB75 LPCH77 LPCC216 LPCQM77 LPCQS77 LPCHM77 LPCUM77 LPCHM76 LPCHM75 LPCHM70 LPCNM70 LPCAtom C2000 HostAtom C2000 PCIEAtom C2000 RASAtom C2000 SMBusAtom C2000 RCECAtom C2000 SATAAtom C2000 AHCIAtom C2000 USBAtom C2000 PCUAtom C2000 PCU SMBusI354I354 SGMIIBraswell SMBusDH8900 LPCDH8900 AHCIDH8900 SATADH8900 SMBusDH8900 ThermalDH8900 USBDH8900 PCIEDH8900 Watchdog82801AA LPC82801AA IDE82801AA USB82801AA SMBus82801AA AC9782801AA Modem82801AA Hub-to-PCI82801AB LPC82801AB IDE82801AB USB82801AB SMBus82801AB AC9782801AB Modem82801AB Hub-to-PCI82801BA LPC82801BA USB82801BA SMBus82801BA AC9782801BA Modem82801BAM Hub-to-PCI8256282801BAM IDE82801BA IDE82801BAM LPC82801BA Hub-to-PCI82801E LPC82801E USB82801E SMBus82801E LAN82801CA LPC82801CA/CAM USB82801CA/CAM SMBus82801CA/CAM AC9782801CA/CAM Modem82801CAM IDE82801CA IDE82801CAM LPC82801DB LPC82801DBL IDE82801DB USB82801DB SMBus82801DB AC9782801DB Modem82801DBM IDE82801DB IDE82801DBM LPC82801EB/ER LPC82801EB SATA82801EB/ER USB82801EB/ER SMBus82801EB/ER AC9782801EB/ER Modem82801EB/ER IDE82801EB/ER USB282801ER SATADual Band Wireless AC 8260Dual Band Wireless AC 416582820 Host82820 AGP82850 Host82860 Host82850/82860 AGP82860 PCIE7500 HostE7500 Error ReportingE7500 PCIE7501 HostE7505 HostE7505 Error ReportingE7505 AGPE7505 PCI82845G Host82845G AGP82845G Video82865G Host82865G AGP82865G Video82865G CSA82865G Overflow82875P Host82875P AGP82875P CSA82915G Host82915G PCIE82915G Video82925X Host82925X PCIEE7221 HostE7221 PCIEE7221 Video82915GM Host82915GM PCIE82915GM Video6300ESB LPC6300ESB IDE6300ESB SATA6300ESB SMBus6300ESB AC976300ESB Modem6300ESB USB6300ESB WDT6300ESB APIC6300ESB PCIX5000X Host5000Z Host5000V Host5000P Host5000 PCIE5000 Error Reporting5000 Reserved5000 FBD5000 PCIE x85000 PCIE x16E8500 HostE8500 PCIEE8500 PCIE x8E8500 IMIE8500 FSB/Boot/InterruptE8500 Address MappingE8500 RASE8500 MiscE8500 ReservedE8500 XMBE8500 XMB MiscE8500 XMB MAIE8500 XMB DDRE8500 XMB Reserved82801FB LPC82801FBM LPC82801FB SATA82801FR SATA82801FBM SATA82801FB USB82801FB PCIE82801FB HD Audio82801FB SMBus82801FB Modem82801FB AC9782801FB IDE6321ESB LPC6321ESB SATA6321ESB AHCI6321ESB RAID6321ESB USB6321ESB PCIE6321ESB AC976321ESB Modem6321ESB HD Audio6321ESB SMBus6321ESB IDE82945G Host82945G PCIE82945G Video82955X Host82955X PCIEE7230 HostE7230 PCIE82975X PCIE82975X Host82945GM Host82945GM PCIE82945GM Video82945GME Host82945GME Video82801GH LPC82801GB LPC82801GBM LPCNM10 LPC82801GHM LPC82801GB SATA82801GR AHCI82801GR RAID82801GBM SATA82801GBM AHCI82801GHM RAID82801GB USB82801GB PCIE82801GB HD Audio82801GB SMBus82801GB Modem82801GB AC9782801GB IDE82801G PCIE82801H LPC82801HEM LPC82801HH LPC82801HO LPC82801HBM LPC82801H SATA82801H AHCI82801H RAID82801HBM SATA82801HBM AHCI82081HBM RAID82801H SMBus82801H DMI-PCI82801H USB82801H PCIE82801H HD Audio82801H Thermal82801HBM IDE82801IH LPC82801IO LPC82801IR LPC82801IEM LPC82801IB LPC82801IBM LPC82801I SATA82801I AHCI82801I RAID82801I SMBus82801I Thermal82801I USB82801I HD Audio82801I PCIEICH9 IGP C82946GZ Host82946GZ PCIE82946GZ Video82946GZ HECI82946GZ PT IDER82946GZ KT82G35 Host82G35 PCIE82G35 Video82G35 HECI82Q965 Host82Q965 PCIE82Q965 Video82Q965 HECI82Q965 PT IDER82Q965 KT82G965 Host82G965 PCIE82G965 Video82G965 HECI82G965 PT IDER82G965 KT82Q35 Host82Q35 PCIE82Q35 Video82Q35 HECI82Q35 PT IDER82Q35 KT82G33 Host82G33 PCIE82G33 Video82G33 HECI82G33 PT IDER82G33 KT82Q33 Host82Q33 PCIE82Q33 Video82Q33 HECI82Q33 PT IDER82Q33 KT82X38 Host82X38 PCIE82X38 HECI82X38 PT IDER82X38 KT3200/3210 Host3200/3210 PCIE3210 PCIEGM965 HostGM965 PCIEGM965 VideoGM965 KTGM965 PT IDERGME965 HostGME965 PCIEGME965 VideoGME965 HECIGME965 PT IDERGME965 KTGM45 HostGM45 PCIEGM45 VideoGM45 HECIGM45 PT IDERGM45 KT4 Series VideoQPI LinkQPI PhysicalQ45 HostQ45 PCIEQ45 VideoQ45 HECIQ45 PT IDERQ45 KTG45 HostG45 PCIEG45 VideoG41 HostG41 VideoB43 VideoE5 v3 HostE5 v3 PCIEE5 v3 PCIE RingE5 v3 ScratchE5 v3 DMAE5 v3 Address MapE5 v3 Hot PlugE5 v3 Error ReportingE5 v3 I/O APICE5 v3 Home AgentE5 v3 QPIE5 v3 PCIE MonitorE5 v3 QPI MonitorE5 v3 TAE5 v3 DDR BroadcastE5 v3 Home Agent DebugE5 v3 RASE5 v3 VCUE5 v3 PCUE5 v3 MemoryE5 v3 TADE5 v3 ThermalE5 v3 ErrorE5 v3 DDRIOE5 v3 UnicastE5 v3 Ring AgentE5 v3 SADRCU32 I2O RAID3124 SATADual Band Wireless AC 316531244 SATA82855PM Host82855PM AGP82855PM Power5500 HostX58 Host5520 HostX58 PCIE5520/X58 QuickPath5520 QuickPathX58 GPIOX58 RASX58 QuickPathX58 QuickDataX58 IOxAPICX58 MiscX58 ThrottleX58 TXT6321ESB IOxAPIC6321ESB PCIE-PCIX82830M Host82830M AGP82830M Video82855GM Host82855GME AGP82855GM Video82855GM Memory82855GM Config82854 Host82854 VideoE7520 HostE7520 Error ReportingE7320 HostE7320 Error ReportingE7520 DMAE7520 PCIEE7520 ConfigE7525 Host3100 Host3100 Error Reporting3100 EDMA3100 PCIE7300 Host7300 PCIEI/OAT CNB7300 FSB/Boot/Interrupt7300 Snoop Filter7300 Misc7300 FBD82801JD SATA82801JD AHCI82801JD RAID82801JDO LPC82801JIR LPC82801JIB LPC82801JD LPC82801JI SATA82801JI AHCI82801JI RAID82801JI SMBus82801JI USB82801JI HD Audio82801JI PCIE82801JDO VECI82801JD Virtual SATA82801JD SMBus82801JD Thermal82801JD USB82801JD HD Audio82801JD PCIE82801JD LANP55 LPCPM55 LPCH55 LPCQM57 LPCH57 LPCHM55 LPCQ57 LPCHM57 LPCQS57 LPC3400 LPC3420 LPC3450 LPC3400 SATA3400 AHCI3400 RAID3400 SMBus3400 Thermal3400 USB3400 HD AudioQS57 HD Audio3400 MEI3400 PT IDER3400 KTE5 HostE5 PCIEE5 DMAE5 Address MapE5 Error ReportingE5 I/O APICE5 PCIE MonitorE5 QPI Link MonitorE5 Home AgentE5 RASE5 QPI LinkE5 TAE5 TADE5 ThermalE5 ErrorE5 DDRIOE5 PCUE5 ScratchE5 R2PCIEE5 QPIE5 UnicastE5 SADE5 Broadcast5400 Host5400A Host5400B Host5400 PCIEI/OAT SNB5400 FSB/Boot/Interrupt5400 Coherency Engine5400 IOAPIC5400 RASGMA 600E600 HostPRO/Wireless 2200BGPRO/Wireless 2225BGPRO/Wireless 3945ABGPRO/Wireless 2915ABGWireless WiFi Link 4965Centrino Ultimate-N 6300Centrino Advanced-N 6200WiFi Link 5100WiFi Link 5300WiFi Link 5350WiFi Link 5150Turbo MemoryEP80579 HostEP80579 MemoryEP80579 EDMAEP80579 PCIEEP80579 SATAEP80579 AHCIEP80579 ASUEP80579 ReservedEP80579 LPCEP80579 SMBusEP80579 USBEP80579EP80579 CANbusEP80579 SerialEP80579 1588EP80579 LEBEP80579 GCUEP80579 LANi960 RDPRO 100 ServerQEMU NVM Express Controller5100 Host5100 PCIE5100 FSB5100 Reserved5100 DDRI/OAT SCNB82371SB ISA82371SB IDE82371SB USB82437VX82439TX82371AB PIIX4 ISA82371AB IDE82371AB USB82371AB Power82810 Host82810 Video82810-DC100 Host82810-DC100 Video82810E Host82810E Video82443LX AGP82443BX AGP82443BX82440MX Host82440MX AC9782440MX Modem82440MX ISA82440MX IDE82440MX USB82440MX Power82440BX AGP82443GX82372FB IDE82740 AGPUS15W HostUS15L/UL11L HostUS15W VideoUS15L/UL11L VideoSCH PCIESCH USBSCH USB ClientSCH LPCSCH IDESCH HD AudioSCH SD/MMCE600 PCIEE600 VideoE600 ConfigE600 LPC82450KX/GX82450KX/GX Memory82451NX Mem & IO82454NX PXBEG20T PCIEEG20T Packet HubEG20T EthernetEG20T GPIOEG20T USBEG20T USB ClientEG20T SDIOEG20T AHCIEG20T DMAEG20T SerialEG20T SPIEG20T I2CEG20T CANEG20T 158882802AC Firmware Hub 8Mbit82802AB Firmware Hub 4Mbit8 Series SATA8 Series AHCI8 Series RAID8 Series PCIE8 Series HD Audio8 Series SMBus8 Series Thermal8 Series USB8 Series xHCI8 Series MEI8 Series IDER8 Series KTZ87 LPCZ85 LPCHM86 LPCH87 LPCHM87 LPCQ85 LPCQ87 LPCQM87 LPCB85 LPCC222 LPCC224 LPCC226 LPCH81 LPC9 Series SATA9 Series AHCI9 Series RAID9 Series PCIE9 Series HD Audio9 Series SMBus9 Series USB9 Series xHCI9 Series MEI9 Series IDER9 Series KTZ97 LPCH97 LPCC610 SATAC610 AHCIC610 RAIDC610 PCIEC610 SMBusC610 USBC610 xHCIC610 MEIC610 LPCX99 LPCC610 MS SPSRC610 MS SMBusI2O RAIDRCU21 I2O RAIDRCUxx I2O RAIDRCU31 I2O RAIDRCU31L I2O RAID8 Series LPC9 Series Thermal9 Series LPCPineview DMIPineview VideoS21152BB21154AE/BECore DMICore QPI LinkCore QPI RoutingCore ManagementCore ScratchCore ControlCore MiscPowerstorm 4D50TIntense 3DExpert3D5526 FibreChannelPRISM3PRISM2.5Prism IndigoPrism Javelin/XbowPrism GT/DuetteAEONGV-BCTV3AGX016ITT3204 MPEG DecoderIT8211FIT8212FIT8213FIT8330GIT8888F ISAIT8892E PCIE-PCIIT8893E PCIE-PCIJMC250JMC260JMB360 SATAJMB361 IDE/SATAJMB362 SATAJMB363 IDE/SATAJMB365 IDE/SATAJMB366 IDE/SATAJMB368 IDExDKTIHSSIDS3SSIDS1HSSIcAppian LiteParallelDual ParallelS3 805Leadtek WinFast TV 2000Leadtek WinFast TV 2000 XPLXT1001EG1032EG1064PCMPC200PCM200PNICPNIC-II8031K56flex DSVD LTMODEMLTMODEMVenus ModemUSB 2-portUSB QuadraBusFW322 1394FW643 1394ET1310LS242 DVD DecoderPMAC 98715PMAC 98727MX86250Smart 16/4 PCI RingnodeSmart 16/4 PCI Ringnode Mk2Smart 16/4 PCI Ringnode Mk3Smart 16/4 PCI Ringnode Mk116/4 CardbusPresto PCISmart 100/16/4 PCI-HS RingnodeSmart 100/16/4 PCI Ringnode16/4 CardBus Mk2Collage 25 ATMCollage 155 ATMi740 PCILibertas 88W8300Libertas 88W8310Libertas 88W8335Yukon 88E8001/8003/8010Yukon 88E8021CUYukon 88E8022CUYukon 88E8061CUYukon 88E8062CUYukon 88E8021XYukon 88E8022XYukon 88E8061XYukon 88E8062XYukon 88E8035Yukon 88E8036Yukon 88E8038Yukon 88E8039Yukon 88E8040Yukon 88E8040TYukon 88EC033Yukon 88E8042Yukon 88E8048Yukon 88E8052Yukon 88E8050Yukon 88E8053Yukon 88E8055Yukon 88E8056Yukon 88E8070Yukon 88EC036Yukon 88EC032Yukon 88EC034Yukon 88EC042Yukon 88E8058Yukon 88E8071Yukon 88E8072Yukon 88E8075Yukon 88E8057Yukon 88E8059Yukon 88E8079Yukon (Belkin F5D5005)88SX5040 SATA88SX5041 SATA88SX5080 SATA88SX5081 SATA88SX6040 SATA88SX6041 SATA88SX6042 SATA88SX6080 SATA88SX6081 SATA88SE6101 IDE88SE6111 SATA88SE6120 SATA88SE6121 SATA88SE6122 SATA88SE6140 SATA88SE6141 SATA88SE6145 SATA88SX7042 SATA88SE9120 SATA88SE9123 SATA88SE9125 SATA88SE9172 SATA88SE9230 AHCIMGA PX2085MGA Millenium 2064WMGA 1064SG 220MHzMGA Millennium II 2164WMGA Millennium II 2164WA-B AGPMGA G200 PCIMGA G200 AGPMGA G200eMGA G400/G450 AGPMGA G200eVMGA G200eWMGA G200eHMGA G200eRMGA ImpressionMGA G100 PCIMGA G100 AGPMGA 1064SGMGA G400 Twin HeadMGA G550 AGPMGA P650 PCIeMGA Millennium G200 SDMGA Produktiva G100 SDMGA Mystique G200 SDMGA Millennium G200 SGMGA Marvel G200 SDIS200 BB16PCI958PCI32PCI509PCI511PEX511GPS170PCIConnectX ENKSZ8841 10/100KSZ8842 dual-port 10/100 switchRT3090MN-120 10/100MN-130 10/1002IVDC-PCX1MiroVIDEO DC20Media 3DMiroVIDEO DC10/DC20Powerstorm 4D30TGUI AccelSerial MCS9865MPC105 PCIMPC106 PCISM56Raven PCICP-114C104HCP-104ULCP-104JUC168HDMA4 serialDAC960P V2 RAIDDAC960P V3 RAIDDAC960P V4 RAIDDAC960P V5 RAIDAcceleRAIDeXtremeRAIDZ8EMyrinet LANai 9.2MTD800 10/100MTD803 10/100MTD891 10/100/1000MV1000CH352CH351CH382NCP130NCP130A2PCI-GPIBNET2282 USBNXB-10GXxRNXB-10GCX4NXB-4GCUIMEZ 10GbEHMEZ 10GbEIMEZ 10GbE MgmtHMEZ 10GbE MgmtNX3031DP83810 10/100PC87415 IDE87560 Legacy I/ODP83815 10/100DP83820 10/100/1000CS5535 HostCS5535 ISACS5535 IDECS5535 AUDIOCS5535 USBCS5535 VIDEOSaturnSCx200 ISASCx200 SMISCx200 IDESCx200 AUDIOSCx200 VIDEOSCx200 X-BUSSC1100 ISASC1100 SMISC1100 X-BusNS87410PowerVR PCX2I/OVersa MaestroVersa Va26D MaestroMagicgraph NM2070Magicgraph 128VMagicgraph 128ZVMagicgraph NM2160Magicgraph NM2200Magicgraph NM2360MagicMedia 256AV+MagicMedia 256XL+MagicMedia 256AVMagicMedia 256ZXXframeXframe IIMA301GA620GA620TNm9805Nm9820Nm9835Nm9845Nm9865Nm9901Nm9922CMI8338A AudioCMI8338B AudioCMI8738/C3DX AudioCMI8738B AudioHSP56 AMRCMI8788 HD AudioNSP2KNetVin 5000Universe VMETsi381 PCIE-PCIPEB383 PCIE-PCIFalcon PFalcon SEF100253c81053c82053c82553c81553c810AP53c86053c1510D53c89653c89553c88553c87553c151053c895A53c1010-3353c1010-6653c103053c1030ZC53c103553c1035ZCSAS1064SAS1068SAS1064ESAS1068ESAS1066EMegaRAID SAS2208SAS1064AMegaRAID SAS3108SAS1066MegaRAID SAS3008SAS1078SAS2116SAS2308SAS2004SAS2008MegaRAID SAS2008SAS2108MegaRAID SAS2108 CRYPTO GEN2MegaRAID SAS2108 GEN2SAS1078DESAS220853c875JMegaRAID 320MegaRAID 320-2EMegaRAID SATA 4x/8xMegaRAID SAS 1064RMegaRAID Verde ZCRFC909FC909AFC929FC919FC929XFC919XFC949XFC939XFC949EYellowfin61C10263C81553c1030RPacket Engines G-NICPI7C21P100 PCIX-PCIXPI7C9X130 PCIE-PCIXFNW-3603-TX 10/100FNW-3800-TX 10/100NX82C501 PCINDR4600 PCIBS21 10/100E-mobility WirelessImagine-128Imagine-128 IIImagine-128 T2RImagine-128 T2R4NV1DAC64Riva TNTRiva TNT2Riva TNT2 UltraVantaMCP04 ISAMCP04 SMBusMCP04 IDEMCP04 SATAMCP04 LANMCP04 AC97MCP04 USBMCP04nForce4 ISAnForce4 SMBusnForce4 IDEnForce4 SATACK804 LANnForce4 AC97nForce4 USBnForce4nForce4 PCIEnForce4 DDRnForce2 ISAnForce2 SMBusnForce2 IDEnForce2 LANnForce2 USBnForce2 AC97nForce2 AudionForce2nForce2 FireWireMCP04 PCIEnForce2 400 ISAnForce2 400 SMBusnForce2 400 IDEnForce3 LANnForce2 400 USBnForce2 400 AC97nForce2 400nForce2 400 SATAGeForce 7800 GTXGeForce 7800 GTAladdin TNT2GeForce Go 6800GeForce Go 6800 UltraQuadro FX Go1400Quadro FX 1400nForce3 ISAnForce3 PCI HostnForce3CK804nForce3 SMBusnForce3 IDEnForce3 USBnForce3 ModemnForce3 AC97nForce3 250 ISAnForce3 250 PCI HostnForce3 250 AGPnForce3 250 SATAnForce3 250 SMBusnForce3 250 IDEnForce3 250 USBnForce3 250 AC97nForce3 250GeForce 6600 GT AGPGeForce 6600GeForce 7800 GSGeForce 6800 GTGeForce 5300 PCXQuadro FX 330GeForce256GeForce256 DDRQuadroGeForce2 MXGeForce2 MX 100GeForce2 GoQuadro2 MXRGeForce 6600 GTGeForce 6600 GoGeForce2 GTSGeForce2 TiGeForce2 UltraQuadro2 ProGeForce 6200Quadro NVS 285GeForce Go 6200GeForce4 MX 460GeForce4 MX 440GeForce4 MX 420GeForce4 440 GoGeForce4 420 GoGeForce4 420 Go 32MQuadro4 500XGLGeForce4 440 Go 64MQuadro4 200/400NVSQuadro4 550XGLQuadro4 GoGLGeForce4 MX 440 AGPGeForce4 MX 440SE AGPGeForce 4 MX 420 AGPGeForce4 MX 4000Quadro4 580 XGLQuadro4 NVSQuadro4 380 XGLGeForce 8800 GTXGeForce 8800 GTSGeForce2 Crush11nForce PCI HostnForce 220 DDRnForce 420 DDRnForce 220/420nForce APUnForce AC97nForce ISAnForce SMBusnForce AGPnForcenForce IDEnForce USBnForce LANGeForce 7300 LEGeForce 7200 GSGeForce 7300 GoGeForce 7400 GoGeForce 7300 GSnForce2 PCInForce2 AGPGeForce4 MX nForce GPUGeForce3GeForce3 Ti 200GeForce3 Ti 500Quadro DCCGeForce 6150GeForce 6150 LEGeForce 6100GeForce Go 6150GeForce Go 6100GeForce4 Ti 4600GeForce4 Ti 4400GeForce4 Ti 4200Quadro4 900 XGLQuadro4 750 XGLQuadro4 700 XGLMCP51 ISAMCP51 SMBusMCP51 IDEMCP51 SATAMCP51 LANMCP51 AC97MCP51 HD AudioMCP51 USBMCP51MCP51 HostMCP51 PMUMCP51 MemoryC51 MemoryGeForce4 Ti 4800GeForce4 Ti 4200 GoGeForce 7900 GT/GTOGeForce Go 7950 GTXQuadro FX 3500GeForce 7600 GTGeForce 7600 GSC51 HostC51 PCIEGeForce FX 5800 UltraGeForce FX 5800GeForce FX 5600 UltraGeForce FX 5600GeForce FX Go 5600GeForce FX Go 5650GeForce FX 5200 UltraGeForce FX 5200GeForce FX Go 5200GeForce FX 5500GeForce FX 5100Quadro FX 500/600GeForce FX Go 5300GeForce FX Go 5100GeForce FX 5900 UltraGeForce FX 5900GeForce FX 5950 UltraGeForce FX 5700LEGeForce FX Go 5700MCP55 ISAMCP55 SMBusMCP55 MemoryMCP55 USBMCP55 IDEMCP55MCP55 HD AudioMCP55 LANMCP55 PCIEMCP55 SATAGeForce 7300 GTGeForce 7600 GoC55 HostC55 MemoryC55 PCIEGeForce 6100 nForce 430GeForce 6100 nForce 405GeForce 7025 nForce 630aMCP61 ISAMCP61 MemoryMCP61 HD AudioMCP61 LANMCP61 SATAMCP61 PCIEMCP61 SMBusMCP61 IDEMCP61 USBMCP61MCP61 SMUGeForce 8600 GTGeForce 8600M GTQuadro FX 570MGeForce 8500 GTGeForce 8400 GSGeForce 8400M GSGeForce 8400M GMCP65 ISAMCP65 MemoryMCP65 SMBusMCP65 IDEMCP65 PCIMCP65 HD AudioMCP65 AHCIMCP65 LANMCP65 USBMCP65 PCIEMCP65 SATAGeForce GTX 285GeForce 7000MGeForce 7050 PVMCP67 MemoryMCP67 SMBusMCP67 Co-processorMCP67 ISAMCP67 LANMCP67 SATAMCP67 AHCIMCP67 RAIDMCP67 HD AudioMCP67 USBMCP67 IDEMCP67 PCIMCP67 PCIEMCP77 MemoryMCP77 PCIEMCP73 USBMCP73 IDEMCP73 PCIEnForce 200GeForce 9800 GTXGeForce 8800 GTGeForce 9800 GTGeForce 9600 GTGeForce 9300 GEGeForce 9300M GSQuadro NVS 150mQuadro NVS 160mMCP77 SMBusMCP77 Co-processorMCP77 IDEMCP77 PCIMCP77 ISAMCP77 LANMCP77 HD AudioMCP77 USBMCP73 HostMCP73 MemoryMCP73 ISAMCP73 SMBusMCP73 LANGeForce 7100GeForce 7050MCP73 SATAMCP73 AHCIMCP73 RAIDMCP73 HD AudioGeForce 8200m GGeForce 9100GeForce 8200nForce 780a SLIGeForce 9400GeForce 9400mGeForce 9300ION VGAGeForce 320MGeForce 210MCP79 HostMCP79 MemoryMCP79 PCIEMCP79 SMBusMCP79 Co-processorMCP79 USBMCP79 ISAMCP79 LANMCP79 SATAMCP79 AHCIMCP79 RAIDMCP79 HD AudioMCP77 SATAMCP77 AHCIMCP77 RAIDGF108 HD AudioGF116 HD AudioMCP89 HostMCP89 MemoryMCP89 PCIEMCP89 SMBusMCP89 Co-processorMCP89 LANMCP89 LPCMCP89 SATAMCP89 AHCIMCP89 RAIDMCP89 HD AudioMCP89 USBGeForce GTX 460MGeForce 425MGeForce GTX 550 TiGeForce GTS 450GeForce GT 550MGeForce GT 635MGeForce GT 555MGeForce GT 640GeForce GTX 560MGeForce GT 635GeForce GT 710GeForce GT 630GeForce GT 730MGeForce GT 735MGeForce GT 740MGeForce 825MGeForce GT 720MGeForce GTX 750 TiGeForce GTX 750GeForce GTX 745OTI107OC2325OC2183OC232682C092G82C557 Host82C558 ISA82C568 IDE82D568 IDE82C621 IDE82C70082C70182C82282C8613G+ UMTS HSDPA010L100L110L200L210L400L800Lx10H100H200H400H/800H800H200HV2011HOX16PCI954OX16PCI954KExsys EX-41092OXCB950OXmPCI954OXmPCI954 DisabledExsys EX-41098OX16PCI954 ParallelOX16PCI952OX16PCI952 ParallelOXPCIE952 ParallelOXPCIE952 SerialQStor SATAPMC/GNIC2ToolsRZ1000HSP MicroModem 56Virtio NetworkVirtio StorageVirtio MemoryVirtio ConsoleVirtio SCSICMIC-LECNB20-LE HostCNB20HE HostCNB20LE HostCIOB30CMIC-HECMIC-WS HostCNB20-HE HostCMIC-GC HostGCNB-LE HostHT-1000 PCICIOB-X2 PCIXHT-1000 PCIXCIOB-EHT-2000 PCIXHT-2000 PCIEHT-2100 PCIEOSB4CSB5CSB6HT-1000OSB4 IDECSB5 IDECSB6 RAID/IDEHT-1000 IDECSB6 IDEOSB4/CSB5 USBCSB6 USBHT-1000 USBCSB5 LPCGCLE-2 HostHT-1000 LPCK2 SATAFrodo4 SATAFrodo8 SATAHT-1000 SATAHT-1100HT-1100 SATAVerite 1000Verite V2x00SH7757 PCIE-PCISH7757 PCIE SwitchuPD720201 xHCIuPD720202 xHCIT1/E1/J1Dual T1/E1/J1Quad T1/E1/J1ISP156x USBSAA7130 TVSAA7133 TVSAA7134 TVSAA7135 TVSAA7231 TVPS5000PT80C826PT86C521PT86C523PC87550PT86C523_2PCC-ISESPCI PC WDES1849I/O 1076I/O 1077PCI 6520PEX 8111PEX 8112PEX 8114PEX 8517PEX 8518PEX 8524PEX 8525PEX 8532PEX 8533PEX 8547PEX 8548PEX 8603PEX 8612PEX 8613PEX 8614PEX 8616PEX 8624PEX 8632PEX 8648PEX 8724I/O 9016I/O 9050I/O 9080Cronyx OmegaPDC20265PDC20263PDC20275PDC20318PDC20319PDC20371PDC20379PDC20378PDC20375PDC20376PDC20377PDC40719PDC40519PDC20771PDC20571PDC20579PDC40779PDC40718PDC40518PDC20775PDC20575PDC42819PDC20267PDC20246PDC20262PDC20268PDC20269PDC20276DC5030PDC20268RPDC20271PDC20617PDC20620PDC20621PDC20618PDC20619PDC20277ISP10160ISP1020ISP1022ISP1080ISP12160ISP1240ISP1280ISP2200ISP2300ISP2312ISP2322ISP2422ISP2432ISP2512ISP2522ISP2532ISP4010 iSCSI TOEISP4022 iSCSI TOEISP4032 iSCSI TOEISP4010 iSCSI HBAISP4022 iSCSI HBAISP4032 iSCSI HBAISP5422ISP5432ISP6312ISP6322ISP8432PWDOG185008580RT2460ART2560RT2561SRT2561RT2661RT2760RT2790RT3060RT3062RT3091RT3092RT3290BluetoothRT3562RT3592RT3593RT5390R1010 IDER1011 IDER1012 IDER1031 PCIeR1060 USB DeviceR1070 CANR1331 MCR1710 SPIR3010 HDAR6011 SBR6021 HostR6025 HostR6031 ISAR6040 EthernetR6060 USBR6061 USB2RTS5209 Card ReaderRTS5227 Card ReaderRTS5229 Card ReaderRTS5249 Card ReaderRTL8402 Card ReaderRTL8411B Card ReaderRTL8411 Card Reader80298139D81298101E81388169SC816881698192SE818081858188CERTL8192CE8187SEQemu PCI-PCIQXL Video5C465 CardBus5C466 CardBus5C475 CardBus5C476 CardBus5C477 CardBus5C478 CardBus5C521 Firewire5C551 Firewire5C552 Firewire5C592 Memory Stick5C822 SD/MMC5C832 Firewire5C843 MMC5C852 xD5U230 Memory Stick5U822 SD/MMC5U823 SD/MMC5U832 Firewire5U852 SD/MMCRS56/SP-PCI11P1 ModemViRGETrio32Trio32/64Aurora64V+Trio64UV+868ViRGE VX86C92886C864-086C864-186C864-286C864-386C964-086C964-186C964-286C964-386C968-086C968-186C968-286C968-3Trio64V2/DXPlatoTrio3D AGPViRGE DX/GXViRGE GX2Trio3 DX2Savage 3DSavage 3DMSavage 4ProSavage PM133ProSavage KM133ViRGE MXViRGE MXPSavage/MX-MVSavage/MXSavage/IX-MVSavage/IXSuperSavage MX/128SuperSavage MX/64SuperSavage MX/64CSuperSavage IX/128 SDRSuperSavage IX/128 DDRSuperSavage IX/64 SDRSuperSavage IX/64 DDRSuperSavage IX/C SDRSuperSavage IX/C DDRTwisterTwister-KProSavage DDRProSavage DDR-KSonicVibesSafeXcelMagicLAN SWL-2210PS4LN053X01XP941SM951A10xNeo-4Neo-8SK-98xxSK-98xx v2.0SK-9D21SK-9SxxSK-9821SK-9843SK-9ExxSK-9E21MBladeEngine2 10GbEBladeEngine3 10GbEIOC3Rad1TigonIOC4ImageSync 1STG 2000XSTG 1764Kyro-IISTG 1764X64GXDVDmagic-PROSC9230186C201 AGP86C202 AGP648FX AGP86C20585C503 System5595 System85C503 ISA180 SATA181 SATA182 SATA183 SATA1901915597/5598 VGA6215300/305/630 VGA315 Pro VGA85C50185C49685C596530 PCI540 PCI550 PCI85C601 EIDE620 PCI630 PCI633 PCI635 PCI640 PCI645 PCI646 PCI648 PCI649 PCI650 PCI651 PCI652 PCI655 PCI656 PCI658 PCI661 PCI662 PCI671 PCI730 PCI733 PCI735 PCI740 PCI741 PCI745 PCI746 PCI748 PCI750 PCI751 PCI752 PCI755 PCI756 PCI760 PCI900 10/100BaseTX961 ISA962 ISA963 ISA964 ISA965 ISA966 ISA968 ISA1182 SATA1183 SATA1184 RAID1185 AHCI540 VGA530 VGA551155125513 EIDE5518 EIDE5571 PCI558155825591 PCI55965597/5598 Host6204650 VGA6326 VGA6330 VGA5597/5598 USB7002 USB7007 FireWire7012 AC977013 Modem7016 10/100BaseTX7018 Audio7019 Audio7300 VGA966 HD Audio83C17083C175FDC 37C665FDC 37C922Voyager GXLynxEMLynxEM+Lynx3DMLynxELynxE+Lynx3D910Victory66 IDEVictory66 ISAVictory66 USBVictory66 PowerPirahna 2-portTulip, power, switch extenderFPGA I-Bus Tracer for MBDSZB6120CXD1947A FireWireCXD3222 FireWireMemory Stick SlotRS780EasyIOVelocity128PCIO EBus2HMERIO EBusERI EtherGEMSimbaCrypto 5821Crypto 1KCrypto 6KPsycho PCISPARC PCIEmicroSPARC IIep PCIUltraSPARC IIi PCIUltraSPARC IIe PCICassiniNeptuneSBBCST201ST1023ST202140XX4018A50XXNE-344S2P4SSpectrum24 LA41X382C10182C10382C10582C565 ISAMC322TC9021 GigEB2C2 Sky2PCTN3009TN3010TN3014DC-290(M)DC-690CDC-3x5UTerratec TV+Terratec TValueTerratec TValue RadioTLAN3DLabs Permedia3DLabs Permedia 2TSB12LV21 FireWireTSB12LV22 FireWirePCI4450 FireWirePCI4410 FireWireTSB12LV23 FireWireTSB12LV26 FireWireTSB43AA22 FireWireTSB43AB22 FireWireTSB43AB23 FireWireTSB82AA2 FireWireTSB43AB21 FireWirePCI4451 FireWirePCI4510 FireWirePCI4520 FireWirePCI7(4-6)10 FireWirePCI7x20 FireWirePCI7XX1 CardBusPCI7XX1 FireWirePCI7XX1 FlashPCI7XX1 SDPCI7XX1 Smart CardPCI6515 CardBusPCIXX12 CardBusPCIXX12 FireWirePCIXX12 Multimedia Card ReaderPCIXX12 SDPCIXX12 Smart CardPCI1620 MiscXIO2000A PCIE-PCIXIO3130 PCIE-PCIE upstreamXIO3130 PCIE-PCIE downstreamXIO2221 PCIE-PCIXIO2221 FireWireXIO2001 PCIE-PCIACX100AACX100BACX111PCI1130 CardBusPCI1031 PCMCIAPCI1131 CardBusPCI1250 CardBusPCI1220 CardBusPCI1221 CardBusPCI1210 CardBusPCI1450 CardBusPCI1225 CardBusPCI1251 CardBusPCI1211 CardBusPCI1251B CardBusPCI2030PCI2031PCI2032PCI2250PCI2050PCI4450 CardBusPCI4410 CardBusPCI4451 CardBusPCI4510 CardBusPCI4520 CardBusPCI7510 CardBusPCI7610 CardBusPCI7410 CardBusPCI7[46]10 CardBusPCI1410 CardBusPCI1420 CardBusPCI1451 CardBusPCI1421 CardBusPCI1620 CardBusPCI1520 CardBusPCI1510 CardBusPCI1530 CardBusPCI1515 CardBusPCI2040 DSPPCI7420 CardBus5634PCV SurfRiderR4x00TC35856F ATMR4x00 PCIToPIC95 CardBus-PCIToPIC95B CardBusToPIC97 CardBusToPIC100 CardBusFast Infrared Type OLongRun NorthbridgeMem1Mem24DWAVE DX4DWAVE NXCyberBlade i7CyberBlade i7 AGPCyberBlade i1CyberBlade i1 AGPCyberBlade Ai1CyberBlade Ai1 AGPCyberBlade XP/Ai1TGUI 9320TGUI 9350TGUI 9360TGUI 9388CYBER 9397CYBER 9397DVDTGUI 9420TGUI 9440CYBER 9525TGUI 9660TGUI 9680TGUI 96823DImage 97503DImage 9850Blade 3DCyberBlade XPCyberBlade XP2HPT343/345 IDEHPT36x/37x IDEHPT372A IDEHPT302 IDEHPT371 IDEHPT374 IDEPyramid3D TR25202ET4000w32pAET4000w32pBET4000w32pCET4000w32pDET6000/ET6100ET6300IGA-1680IGA-1682IGA-1683CyberPro 2000CyberPro 2010CyberPro 5000CyberPro 5050CyberPro 5202CyberPro 5252Santa CruzUM82C881 486UM82C886 ISAUM8673F EIDEUM8881 HB4 486 PCIUM82C891UM886AUM8886BFUM8710UM8886UM8881F HostUM8886F ISAUM8886AUM8891AUM9017FUM8886NUM8891NUS201USR9979023CP5610V961PBC i960 PCIV292PBC AMD290x0 PCIV960PBC i960 PCIV96DPC i960 PCIK8M800 HostK8T890 HostPT880 HostPM800 AGPKT880 AGPK8HTB HostVT8363 HostPT894 HostCN700 HostCX700 HostP4M890 HostK8M890 HostVT3351 HostVX800 HostP4M900 HostVT8371 HostVT6415 IDEVT8501VT82C505VT82C561VT82C571 IDEVT82C576 3VVX700 IDEVT82C585 ISAVT82C586 ISAVT8237A SATAVT82C595 PCIVT82C596A ISAVT82C597 PCIVT82C598 PCIVT8601 PCIVT8605 PCIVT82C686 ISAVT82C691 PCIVT82C693 PCIVT86C926 AmazonVT82C570M PCIVT82C570M ISAChrome9 HC3 IGPPM800 ErrorsKT880 HostVT82C416 IDEVT82C1595 PCIPM800 HostVT8251 PCIVT8251 PCIEVT8251 VLINKVT83C572 USBVT82C586 PowerRhine/RhineIIVT6306 FireWireVT82C596 PowerVT82C596B PMVT6105M RhineIIIVT82C686 SMBusVT82C686 AC97VT8233 AC97RhineII-2VT82C686 ModemVT8233 ISAVT8633 PCIVT8366 PCIVT8653 PCIVT6202 USBVT6105 RhineIIIS3 Unichrome PRO IGPVT8361 PCIVT8101 VPX-64VT8375 PCIPM800 Unichrome S3VT612xCLE266VT8623 PCIVT8233A ISAVT8751 PCIVT6420 SATAS3 UniChrome Pro II IGPVT6410 IDEP4X400 HostVT8235 ISAP4N333 HostVT8377 PCIVT8378 PCIPT890 HostK8T800M HostVT8237 ISADeltaChrome VideoVT6421 SATACX700VX700 HostVT6655PM800 DRAMVT8251 ISAVT8237A ISAVT8251 SATAVX800 DRAMChrome9 HC IGPVT8237S ISAVT8237AVL80x xHCIPM800 PMCK8T890 IOAPICPT894 IOAPICCX700 IDEP4M890 IOAPICK8M890 IOAPICVT3351 IOAPICVX800 IOAPICP4M900 IOAPICVT8237S SATAVT8251 AHCIP4M890 SecurityP4M900 SecurityVT8378 VGAPM800 PCIVT8231 ISAVT8231 PMGVT8363 AGPCX700 ISAVX800 ISAVT8371VX855 ISAVT8501 AGPVT82C597 AGPVT82C598 AGPVT82C601 AGPVT8605 AGPVX900 IDEVX800 SD/MMCVX800 SDIOK8T890P4M890P4M900VT8633 AGPVT8366 AGPVT8361 AGPVT8101 VPX-64 IOAPICVT8363VT8235 AGPK8HTB AGPVT8377 AGPVX800VX800 PCIEVX855 IDEVSC-7174 SATAGDT6000/6020/6050GDT6000B/6010GDT6110/6510GDT6120/6520GDT6530GDT6550GDT6x17GDT6x27GDT6537GDT6557GDT6x15GDT6x25GDT6535GDT6555GDT6x17RPGDT6x27RPGDT6537RPGDT6557RPGDT6x11RPGDT6x21RPGDT6x17RP1GDT6x27RP1GDT6537RP1GDT6557RP1GDT6x11RP1GDT6x21RP1GDT6x18RDGDT6x28RDGDT6x38RDGDT6x58RDGDT6x17RP2GDT6x27RP2GDT6537RP2GDT6557RP2GDT6x11RP2GDT6x21RP2GDT6513RSGDT6523RSGDT6518RSGDT6x28RSGDT6x38RSGDT6x58RSGDT6x33RSGDT6x43RSGDT6x53RSGDT6x63RSGDT7x13RNGDT7x23RNGDT7x18RNGDT7x28RNGDT7x38RNGDT7x58RNGDT7x43RNGDT7x53RNGDT7x63RNGDT4x13RZGDT4x23RZGDT8x13RZGDT8x23RZGDT8x33RZGDT8x43RZGDT8x53RZGDT8x63RZGDT6x19RDGDT6x29RDGDT7x19RNGDT7x29RNGDT8x22RZICP82C592 CPU82C593 ISA82C594 Wildcat82C596/597 Wildcat ISA82C54182C54382C53282C53482C53582C14782C97582C925SVGA IISVGAVMXNETVMCIEHCIUHCIVMXNET3PVSCSIVMIP9000P9100WD33C193AWD33C196AWD33C197AWD7193WD7197WD33C296AWD34C296WD9610W83769FW89C840F 10/100Linksys EtherPCI IIW83C553F ISAW83C553FW89C940FW6692 ISDNLinksys EtherPCICF32APlatform DeviceVolari Z7Volari Z9s/Z9mVolari V3XTX3201-3CardBus EthernetMini-PCI V.90 56k ModemMini-PCI K56Flex ModemCardBus 56k ModemCBEM56G Modem724734738737740740C724F7441221PCI-ST32Genie TV/FMDVDZD1201ZD1202ZD1205D-LinkMartin-MariettaHauppaugeTTTechDynalinkCoregaRhino EquipmentCompaqSymbios LogicATIULSI SystemsVLSIAvance LogicNSTseng LabsWeitekDECCirrus LogicWestern DigitalAMIAMDTridentAcerDellSiemens Nixdorf AGMatroxChips and TechnologiesToshibaMiro Computer Products AGNECFuture DomainHitachi MicroSiSHewlett-PackardPC TechnologyAsustekDPTOptiElsaSGS ThomsonBusLogicTISonyOak TechnologyWinbondHitachiSMSCMotorolaPromiseFoxconnNumber 9UMCITTPicopowerMylexAppleMitacYamahaNexGen MicrosystemsQLogicCyrixLeadTekInterphaseContaq MicrosystemsBit3OlicomSunIntergraphDiamond MultimediaNational InstrumentsCMD TechnologyQuantum DesignsBrooktreeSGIACC MicroelectronicsSymphony LabsSTB SystemsPLXMadge Networks3ComSMCAcer LabsMitsubishi ElectronicsSurecomNeomagicMentor ARCAdvansysFujitsuMolexMacronixEvans & SutherlandNVIDIAEmulexIntegrated Micro SolutionsTekram (1st ID)NewbridgeApplied Micro CircuitsTviaRealtekNKKIO Data DeviceInitioCreative LabsHighPointSigma DesignsVIACogent DataSiemensZnyx NetworksAcctonAtmelVortexEfficent NetworksIDTFORE SystemsPhilipsCiscoZiatechCycloneEquinoxAllianceSchneider & KochDigiMutechXircomRenditionServerWorksAlteraRicohCorollaryAcardZeinetOmega MicroMarvellLite-OnV3 SemiconductorPinnacle SystemsAT&T/LucentDolphinMesa Ridge (MAGMA)Analog DevicesZoranPijnenburgCompexCycladesEssential CommunicationsO2 Micro3DFXATMLBochsC-CubeAVMStallionASIXIntersilNortel NetworksSilicon MotionEnsoniqTransmetaRockwellDavicomITExpressPlatformLuxSonorTriTechAlteonUS RoboticsNVIDIA/SGS-ThomsonPericomAurealADMtekPacket EnginesForte MediaSIIGDTC TechPCTELBrainboxesMeinberg FunkuhrenCNetSilicomLAN MediaNetgearMoxaLevel 1HifnExar3wareTechsan ElectronicsAbocomSundanceC-Media ElectronicsLavaSunixIC EnsembleMicrosoftOxfordChelsioEdimaxTamarackWorkbitSamsungAskeyAvermediaMSIAironetGlobespanMyricomVScomAvlabInvertexBroadcomPlanexConexantDeltaMyson CenturyTopic/SmartLinkENEAralionTerraTecSymbolSybaBluesteelVMwareZoltrixMellanoxAgilentQuicknet TechnologiesNational DatacommPacific DataEumitcomBrocadeNetSecZyDASAtherosGlobal SunSafeNetMicrelVitesseLinksysNetoctaveAltimaAntares MicrosystemsCaviumBelkinHawking TechnologyNetChip TechnologyI4ArecaNeterionRDCINPROCOMMLanergyRalinkXGI TechnologySilanRenesasSangomaSolarflareOptionFreescaleAttansic TechnologyAgeiaJMicronPhisonServerEnginesASPEED TechnologyAWTFusion-ioQumranetASMediaRed HatEtronFresco LogicNanjing QinHeng ElectronicsTekramTehuti NetworksHint3D LabsAddtronNetXenIndustrial Computer SourceNetVinGemtekTurtle BeachMosChipXenSourcec't MagazinDecision ComputerQuancom InformationssystemeIntelInnoTekSigmatelAdaptecAtronicsNetMosParallelsTigerJet NetworkEndaceBelkin ComponentsARC LogicINVALID VENDOR IDcy82c693_writecy82c693_readcy82c693_initcy82c693_init: bus_space_map failed (%d): broken match/attach! : unable to map device registers : couldn't map interrupt : couldn't establish interrupt: invalid memory type %d , using %luK of on-board RAM, can't map on-board RAM: can't subregion offset %lu size %luchannel 0channel 1configuredwirednative-PCIcompatibility, %s %s to %s%s: %s disabled (no drives) %s:%d:%d: bus-master DMA error: status=0x%x %s:%d:%d: bus-master DMA error: missing interrupt, status=0x%x %s:%d: unable to load xfer DMA map for drive %d, error=%d %s:%d: unable to allocate table DMA for drive %d, error=%d %s:%d: unable to map table DMA fordrive %d, error=%d %s:%d: unable to create table DMA map for drive %d, error=%d %s:%d: unable to load table DMA map for drive %d, error=%d %s:%d: unable to create xfer DMA map for drive %d, error=%d %s: couldn't map %s cmd regs %s: couldn't map %s ctl regs %s:%d: bogus intr %s:%d: bogus intr (reg 0x%x) %s: couldn't subregion %s cmd base %s: couldn't subregion %s ctl base %s: couldn't subregion %s channel cmd regs %s: port %d: device connected, but communication not established %s: port %d: PHY offline %s: port %d: device present, speed: 1.5Gb/s, speed: 3.0Gb/s%s: port %d: unknown SStatus: 0x%08x %s %s channel: cannot allocate channel queue%s: %s cannot allocate channel queue: unable to map BA5 register space : DMA%s: couldn't map native-PCI interrupt unknown interrupt%s: using %s for native-PCI interrupt %s: couldn't establish native-PCI interrupt: couldn't establish native-PCI interrupt: couldn't map bus-master DMA registers : couldn't map IDE registers : DMA %s: channel %d: cannot allocate channel queue %s: couldn't map channel %d ctl regs %s: couldn't map channel %d cmd regs %s channel %d: can't subregion DMA registers %s: no known timing values unknown SiS IDE type %d %s:%d:%d: multi-word DMA disabled due to chip revision %s: no compatibility interrupt for use by %s %s: unable to subregion %s ctl regs %s %s: cannot allocate channel queue%s: %s %s to %s mode %s: %s ignored (disabled) : no DMA, unused (couldn't query registers), unused (registers at unsafe address %#lx), unused (couldn't map registers), (unsupported maptype 0x%x)%s: unexpected PCI function %d : 5597/5598: unexpected PCI function %d , (unable to map ctl registers): cannot allocate channel queue , %s %s to native-PCI compatibility %s: bus-master DMA support present: ATA133: ATA33: ATA66: ATA100 (unsupported), (partial support)not responding; disabled or no drives?other hardware responding at addresses%s: %s ignored (%s) %s:%d:%d: cannot allocate DMA maps, using PIO transfers %s:%d:%d: using DMA data transfers %s: restore for unknown chip map %x unmap not yet implemented for this chipsetpciide540620630630S633635645645DX651652655658661733735746748760962963964966968port 0port 1port 2port 3: can't map mem or i/o space em_rxeof: NULL mbuf in slot %d (nrx %d, filled %d)%s: em_dma_malloc: bus_dmamap_create failed; error %u %s: em_dma_malloc: bus_dmammem_alloc failed; size %lu, error %d %s: em_dma_malloc: bus_dmammem_map failed; size %lu, error %d %s: em_dma_malloc: bus_dmamap_load failed; error %u %s: Unable to allocate rx_buffer memory %s: em_allocate_receive_structures: bus_dmamap_create failed; error %u %s: Unable to allocate tx_buffer memory %s: em_get_buf: slot %d already has an mbuf %s: unable to fill any rx descriptors %s: Unable to create TX DMA map %s: The EEPROM Checksum Is Not Valid %s: EEPROM read error while reading part number %s: Hardware Initialization Failed: mmba is not mem space : cannot find mem space : cannot find i/o space : flash is not mem space %s: Unknown MAC Type %s: Unable to initialize the hardware %s: Could not setup transmit structures %s: Could not setup receive structures %s: Unsupported media type %s: watchdog timeout -- resetting %s: Media change is blocked due to SOL/IDER session. %s: Unable to allocate tx_desc memory %s: Unable to allocate rx_desc memory %s: EEPROM read error while reading mac address %s: PHY reset is blocked due to SOL/IDER session. %s: No GCU found, defered attachment failed Could not write PHY the HV address register Could not read data value from HV data register %s: phy read timeout: phy %d, reg %d %s: unable to read phy %d reg %d gcu0%s: init failed, error=%d : can't map i/o space : can't map mem space %s: timed out waiting for BIOS %s: pre-2.0 USB rev : can't map interrupt : can't establish interruptpciide_machdep_compat_intr_disestablish calledpciide_machdep_compat_intr_establish calledod'({^~: PX>XX>>\X>dX>lX>tX>|X>X>X>?X>X>X>X>X>X>X>X>X>X>  5'+,()*-.&#KINMOH J AA AAMi,Mi AA@MiTMi AA ni ni AA8niLni AA`nitni AAnini AAnini AAnini AAnini AA oi oiAAoioi AA oioi AA pipi AA \qi A AA qiqi AAriqi A A"=ui AAP&=ui AAd&=ui AAx&=uiAA#&=vi AA&=Dvi AA&=XviAA7B=viAA7 C=viAA78C=vi AAI=(wi AAXK=X>X>Y>l@6D% +0*\C%2`Z>  H ( p( ' ( )+-/13579;=?ACEGIKMOQSUWY[]_acegikmoqsuw ! g> E V \Q Dl>  T H X l @X@%%K;!;!*!`x>VVVWWWWW XXXX[[ \\\\]]]]] ^^^^__ _ ```` aaaaa >?A>,#T6###### ##H##@# ####4##x####x#,#<#(####H#<#H#p###0#|# @ @  ) 2܍>     #\#,#####L#########p$$ #X##$#####$ $#(###h####,# @ @  )(>@+$P$$P$(1$pK$`K$h<$1$H$L$x$$T$x$t$P$|F$F$J$\K$H$D$\C$I$TK$$LW$E$D$I$XK$$V$0C$8>$|"$|$$ @ @ @   )`Y$`$$>$8$hY$$ $̙$$$(WEVrdroot2.5M@%WEV   08`uT<  _Te`/mnt0|y uT`@@<@T 08`_T<  _Te`[~ [~_T`@@<@TU rTph brTewh6XA `T uT3> uT3> hmA`T<` `T<` `T<` al GAS`T!`T~0uT3> px srT.hrTbrTbbk~rT|ArT\ rT\ i5q[rT<~ rT rT!{n(rT rTurT!{ <(^֡rTurTrT (08@HPX`hQTdփ>ǘ+;vIC&=NlG etRN ' L4n @%þvhit}GL:j;AY0cDA#0*TWY8 ̦Sͥ]VN[Q\dhvsDyG!;W[/̵{Gu+݃DF>q/mzj&5bONu98%@3JfZQ*ؿ-P#J `aI짊(8%$O*^ wImm S'#orZ[q(-UΩ 2kM=:}FQ<eBW+H8j? s=1fAE4_x4Kjl(@r̚䖪])bfOT܈K%`<_Sb ta!i)~!봿gzۑѭO~,oB-7ê0}YyR7*DO|[Dh_NPz.`C^<}Rz;w3kO/$w|MxΡ} v ... export VNAME=$(sysctl -n kern.osrelease) export VERSION="${VNAME%.*}${VNAME#*.}" export ARCH=$(sysctl -n hw.machine) export OBSD="OpenBSD/$ARCH $VNAME" export PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ umask 022 set -o emacs set -- $(dmesg | sed -n '/^root on /h;${g;p;}') rootdisk=$3 if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES mount -u /dev/${rootdisk:-rd0a} / echo ! : > /etc/rc echo 'erase ^?, werase ^W, kill ^U, intr ^C, status ^T' stty newcrt werase ^W intr ^C kill ^U erase ^? status ^T cat <<__EOT Welcome to the $OBSD installation program. __EOT timeout=false timer_pid= if [ ! -f /tmp/noai ] && { ifconfig netboot >/dev/null 2>&1 || [ -f /auto_install.conf ] || [ -f /auto_upgrade.conf ]; }; then echo "Starting non-interactive mode in 5 seconds..." >/tmp/noai trap 'kill $timeout_pid 2>/dev/null' EXIT trap 'exit 1' INT trap 'timeout=true' TERM set +m exec 3<&1 4<&2 >/dev/null 2>&1 (sleep 5; kill $$) & timer_pid=$! exec 1<&3 2<&4 3<&- 4<&- set +m fi while :; do echo -n '(I)nstall, (U)pgrade, (A)utoinstall or (S)hell? ' read REPLY if $timeout; then timeout=false echo REPLY=a else [ -n "$timer_pid" ] && kill $timer_pid 2>/dev/null timer_pid= fi case $REPLY in a*|A*) /install -a && break ;; i*|I*) /install && break ;; u*|U*) /upgrade && break ;; s*|S*) break ;; !) echo "Type 'exit' to return to install." ksh ;; !*) eval "${REPLY#?}" ;; esac done fi  . .. bin@ dev etc mntAmnt2}آsbin}B tmp usrvarinstbin.profile. install.mdupgradeinstall  install.sub md_installboot() { } md_prep_fdisk() { local _disk=$1 _q _d while :; do _d=whole if [[ -n $(fdisk $_disk | grep 'Signature: 0xAA55') ]]; then fdisk $_disk if [[ -n $(fdisk $_disk | grep '^..: A6 ') ]]; then _q=", use the (O)penBSD area," _d=OpenBSD fi else echo "MBR has invalid signature; not showing it." fi ask "Use (W)hole disk$_q or (E)dit the MBR?" "$_d" case $resp in w*|W*) echo -n "Setting OpenBSD MBR partition to whole $_disk..." fdisk -e ${_disk} <<__EOT >/dev/null reinit update write quit __EOT echo "done." return ;; e*|E*) cat <<__EOT You will now create a single MBR partition to contain your OpenBSD data. This partition must have an id of 'A6'; must *NOT* overlap other partitions; and must be marked as the only active partition. Inside the fdisk command, the 'manual' command describes all the fdisk commands in detail. $(fdisk ${_disk}) __EOT fdisk -e ${_disk} [[ -n $(fdisk $_disk | grep ' A6 ') ]] && return echo No OpenBSD partition in MBR, try again. ;; o*|O*) return ;; esac done } md_prep_disklabel() { local _disk=$1 _f _op md_prep_fdisk $_disk _f=/tmp/fstab.$_disk if [[ $_disk == $ROOTDISK ]]; then while :; do echo "The auto-allocated layout for $_disk is:" disklabel -h -A $_disk | egrep "^# |^ [a-p]:" ask "Use (A)uto layout, (E)dit auto layout, or create (C)ustom layout?" a case $resp in a*|A*) _op=-w ;; e*|E*) _op=-E ;; c*|C*) break ;; *) continue ;; esac disklabel $FSTABFLAG $_f $_op -A $_disk return done fi cat <<__EOT You will now create an OpenBSD disklabel inside the OpenBSD MBR partition. The disklabel defines how OpenBSD splits up the MBR partition into OpenBSD partitions in which filesystems and swap space are created. You must provide each filesystem's mountpoint in this program. The offsets used in the disklabel are ABSOLUTE, i.e. relative to the start of the disk, NOT the start of the OpenBSD MBR partition. __EOT disklabel $FSTABFLAG $_f -E $_disk } md_congrats() { } md_consoleinfo() { } #!/bin/ksh MODE=upgrade . install.sub while :; do ask "Root filesystem?" $ROOTDEV resp=${resp##*/} [[ -b /dev/$resp ]] && break echo "$resp is not a block device." done ROOTDEV=$resp echo -n "Checking root filesystem (fsck -fp /dev/$ROOTDEV)..." fsck -fp /dev/$ROOTDEV >/dev/null 2>&1 || { echo "FAILED."; exit; } echo "OK." echo -n "Mounting root filesystem (mount -o ro /dev/$ROOTDEV /mnt)..." mount -o ro /dev/$ROOTDEV /mnt || { echo "FAILED."; exit; } echo "OK." for _f in fstab hosts myname; do [[ -f /mnt/etc/$_f ]] || { echo "No /mnt/etc/$_f!"; exit; } cp /mnt/etc/$_f /tmp/$_f done hostname $(stripcom /tmp/myname) THESETS="$THESETS site$VERSION-$(hostname -s).tgz" enable_network startcgiinfo munge_fstab check_fs umount /mnt || { echo "Can't umount $ROOTDEV!"; exit; } mount_fs feed_random install_sets rm -rf /mnt/usr/libexec/sendmail rm -f /mnt/usr/sbin/{named,rndc,nginx,openssl} finish_up ELFa(4P"4 (JJD44PPPTTTۣeOpenBSD -L0! MP@ - bR KR MR GRkR gR  mR wR $T0@ (%T%@%T!ER00 !T00 @0xS S *ST8,0 (^R800" < P$) -0L00(PdP -0L0~0(P,P -Lu04 -Lm P00P -Lb0P -LZ 00dP,P -LM$`K✠p圀&7 @P~P @Q` 0 D Q 0R00 (0S(PP0 R0 ,PdP -L Q$) -L Q$) -L Q$) -L Q$) 0-t0LP d0  a0R00BAq 8@0P 0R0 : 0P,PdP -L1P``8q8L  OHPP  / ]0S P00OU0@0V 0000 00 0U0 0 0 0S0|0T 0  `IQe0 f` R*Rbi0 00dPP8 $)$PL p  0-LMPKI[P \R0: S D4 K@=P0: S S000K0$)m @ - ELP 50  =PD40S0o DP4000 T0$ 4y=P 0 4l$n=0000S|8T$D0$D4 0S 0@Pd0S 0P 0Pϳ뀃S $0   $0 `0; S 0 @c$ #"Q0Hc`V <|P0x,Z$Zv#0sy3Q 0Ss*0  Q b ´P a "0  x弦0 0L0 0 0 0  P0 0 0 0000000 0 00 00` 0 B000Q Q@0A AP0 0081А(q@00Cs0~1 1R0R0R 00 l R R *p bQ 0 00$00S1ぼ,Pd4 dP (P P  P8 P$)PP@Ԑ -d2LuM0Pb4K▩4K 0( P,04 0  bR, 0@=94 0 =,0 4Kf 1@,P 0s 0+(yOKP PP0!dPP T@  P R T1TRMKd0p$) -2LdM0ŸS2@P |x2T 4P < 00X@80 4@ 8`K0`pL0 H@ @r`0` ,p  8K1\ X , 0\Kc 1q0 , @T T * !  0{D @ (TD @0 9#@0 T *  08K 80㐃4`T㐖) T *  0LKmd `  L@$H`d `0 6&`` TD`K0d`Kp`p0`K ` p p$ p*4<_< < P0Ro(Kt8,D|Y@ p-LM`K @P p  4 4Kpc -P 0`㓅p @E$0L0@!0 @ !k -L8ML L@P  03 P`L@L00U@p80 4@ 8K2Hp D 0pS@p <  LLL @T T * S 0᭞ H㐅T㐖) T * > 08K蘞`p 380c4T|' T * ' 0HK@P H BD0S%P 0P@ Pp3@@0SM0S 5 A 0K NsP'f00#4 P ~+KA AUDUX00S NK@D @D_KFsPE(K , |h t$)thW(8 - AM44VLM`p@4$ ]oP+ aPW AP NPSdP fPNtP+ rP sPF#vP5 ,wP@44D <5@:TPt/ 2l@/0S&)LCP8 !0%,0S %A /P $@ $Pp$pp40PcAU`` U UYB T`9P@lP @gP 8bP)0S S  P  PP PP 4 0 !0  01P `q@P,K#`P P@`F ,tP,POU20SBKAA翘P@OP  B^KPEPPE* P@, D 0  PAq@P PX㒣,0@t00,000,0 ,0$'q@P :q@P6q@P PP P P 2@@! 0 0  0`10S @(ݩP4 P@ 0@@`W0V0X0S O4P4PP 0 KGP@ 0P 4pL0SW᧬dx(t`uh t, hAx0 |t pHMЍ -L q~\C -L0GM@K0$<1 4q41`P oP !:op0 0bAS`GK0 A A0 幗P  GK00 A0  A0K \6PKPl -Pd P\ K2G>K 0C 0C8 d?$Ax(|( hH$\ -LM@pPg yq`P 0S nS0oS` =PP00 @ዓP @Q  0U0P P00 00 X 0000X  ?U 0 %K00 ,Kɨ, ?R0S@pK0"S4 0>@Px p     -LMp`aP@( P(K,K  0mP(0S$KMЍ -$0L0S anu\Cl -Lp00p3 P``0PP @@ kP@ sP P aP @ nph00SUTT%.DFA< ,@A)l0 uACMЍ -L2MЍk0@-XP @0 S S 00 ӑR\00 \00A- 0S Br Q-0L(  Q: > -LMP`p4J $KK1@-J0S 0S $00TS#T 0= -0L E㩪\C -@kM<LMB0@3S$$Lht 4TtH>  <> @0P P   P &G= =hT? D?`PU@ 0!0T PP U0U0T0St `=>`}@PL >@r4=.6$=j = /=c =(< < << <<(.<-<7<-x<0 l<dPv Zxp6 X0 ,Vv  & 6 @r  &0D0 q&F0G@$i6@C#Q 3R:Z&XV2 ?U|2O@LJ6vC#00W #*Y/ L0S 2嬆X H0XL  Lp2Q &R@FH RD2TH@ (2R R H 2R T@F|0S~ Z P3T@1|@ wx(uudu(Tu<H\tLuHuTdDu@uKR0C6 |T x0"& A c% Z``0S00S H0S &R X :@X  0 &@$&0ST#3* p&L'0P &0'  X ZH 6R X0 # 00V0|$!40x00t!40p!4 0l0 0h!4 0 d!40 `!40\0#̠##0X0###Ƞ0 T $0""Ƞ"$ P @""̠"  L!$ H!$ )0 `,00S880 @0 <D0v> $ 0@0 (  4 t(08Q* 0( ;0S 00 o0(08Q @(T )U01U01hL08S X R 0XU0 RaAr1U0!1!!!!!!!C| X030#X0#S hbQTPl0 0 Z0S0 00 V00R:&Xh:Q (0 0 520#$ 00 0 P B240#$ 0 -p, 0P , 06 Z600X: D+& B(KMЍ< -LM04PKpa@d 04 `PD 0`PG p00@TN9P`uU<U P 0(0' 0FS(K QP@ -9(00S x%900(@ ^U 0(P?P@ -P 0(0 0$K t! (D(L(T(x( P-L J6G6 )() -LMp0 :P0 000K0,K00 e `hPPc 0S` =@P l `cVTPC,00HiV0P,00? P2 ,0$03lVxP$,0 0)oVnP,00 gP ,0(00SYP0, 0  @P@Q0Sy 00S(K!@)D)L)T)A\)d)l)  0-LMP 0X P@00  08S @E_@ 7 8ht) ))$ 0 0~0 +00C -0000$ 0 0~0+00-00S $::  00 $ 00S <<  00 0$ 80 0= 0  K$00  0$@+0S  $", 0 0 $ -LM0@S00 K0 !0 0`t -L!PMot ) -L!P@nt ) -LM K00"!P/t) -Lb6hFb0$@) p-L ML@`0KP 2|0S 00Kp) p-L ML@`0KP |0S 00Kp) -0LS@ hK 0 << 0 p-L M@0K`P {0S a[0 0Kp) p-L M@0K`P {0S *0 0Kp* D0  D0 -LM0Pp0`-S000P(K 0(P @P 00S `6t0 0 0S0(6fKpp* ( p-0PQ`L@ P  00 0 0 0: P0SP P  000 00& P0SP pP  $00$0 0$0 P0S`P\P  000 00 p P0Sp!#$$' 0-,PL0@S ^I000@0putu -0L0CS0 6Ql M00-00Q0^   ?00Q@0 0^0 000huL( p-l`L@PTX0 P5HP80 pputu.$)hW -RLMp`P 0BS     P\@4T ~Z@ w@T Hh @WZ P8 Z08Z 8 Z7wZ 7nZ 7eZ 0]Z t7TZ@ T7@KZ  47 BZ  7 9ZPP? 1U 6(U 6U 6U x6 U  X6 U 86(@U  6 U 5 U@ 5@U 5U  5 U p5 U  P5 U 05 U 5 U 0U4U 4U 4U t4{d@4UL0pU04gU 4^U@ 3@UU 3LU  3 CU3:U p31`@U H3 %< S S$  S  S2  U  2 U 2 U  2 U  |2 U \2U <2Z R`K 0 P0d!@Ty.vaPKZ  \ 0wP0t! UK P `A0Kdpd0\4!U KK(K..// /,/8/X/h//-- -,,,,0-@-h- -----./<./+,++,$,<,\,,+++++/L..l...|.../*******8+P+*`+t+/ // -0L ゝ\C/ - 434L\Mp| x a0@S(| p p 9Px  tp"0S|`AFPKUt" `p\2x@K |0x1|0 審P<u08x P$sD xPۆW|00S xKD0t xKDt xpK0|K`,Kl0 h0 >P6~P1P,|0@000C S1 |w,0@SP |0 NV& Pl 2?|00|0 |0Ql0S x` K5XPl&h0S xT4 KPHc(KAx(A/00t@0ht@$0$)0080P0gt\0MЍ -0L 0+㏜\Ch0 -MML Mh20`S@PP2P"K\D20P0: S PYT2"1Q0T KP0: SUpPbNNK @D@D0!p P`1: 0?x&Y*KYP'@10S#414!Q(1K0P: 0R 0R  |0R 00S, 2'00S PUPq;0Sp00S 9 T0c\ 0PP  墅Kuu4~l$)|u00xu0 -TTTqLlM`@PfP LP PP: nP sP hP30PPPP ^p00 cR1P R R 1@KSP \0: S`  P`Pማ|uuuxu0Ap$)MЍ? -LP(@`pB@D 0T4 (p 0@8P 040 ,0 $0  0P?>>p= *Q-LI7< @@0Pຈ`p 0@0  VUP`Wp(0 4p 0QPK 0QPM  0QPGTQ000ӑA -@L¤|忤t弤l幤d嶤`c [T TWH嫤@娤88 M㱚\CNN0O\OOOTPPdPPPQ -LMe_~K@ oK t K l0 d d0 \ 0 D31 2 ,1 2$1 2 1 2`1 2\1 խK`$& -LM(Qt ,QdT00QP 4Q0 8G00 80S00, < 807@@00@4 80CW@<P)00PP0P (OP 0P00``0` (@Pp0Qp 4p ZP 09 @@004@a00,0 9 @P@`0` ,/9@@<0P ` 0@VU,/0pp0p p9@p@W0<p `p `P0@XW,/00 44 84 R20P `0`@p 0p`@P@ @@P8 0/84p\a W4 00S(K$Q4QHQ\QpQQQQQ0R`RRR -(0e/S<(0<0(0L@ 0 S,eRR 0-LMP@XP%00 0 00A0a A S WAR A0A0S7 A? K Q02^0A@ 0K K0 M-LM`0 PP@T t 0 00 0s@KB 0-HLP]q0@S @00yB0S0S - L@lB0PS -BML:M 0D 0'0P@4 ,  @Z`^`@@TBKLL4d H 8d H徕8$P0 8$ 0H#fP 00P<  0/S 0<4 H@Pw :SP( 8.l00PQP,UY &9PPI<`P P90cC10P @T,K9 D,00 PS t 8\.#[ 9\P0  "Q@@P000  P00000  8;.44044 PU 0S00X0P` @ ,K0 ,00 S|8 .00\0`@PU 00S0V0S(0 K.P 0 0BS(ʑ8-4$0 4$ 8ǟU PP P WP P atP0,K ,00 SP;;S( JP 0,K ,00 S, 7oP 0,K |,00 S8w $\P 0,K i,00 S0d DIP0,K V,00 S4Q  08l-4$ 4$ H.PC )P> $P9 P4 P/ P* P% p P  `P 0aC0S0S 8X :X08ʑ 8(-44044 U8-44 ,K`0 ,\  8-4$ 4$ "V8d,44044 ,KP0 ,\  8,4$ 4$ "U2`P1 C`XpP u~P3"0cC1 @T000C S000 0,K 0 ,0S00S 88,000 00"02pW Wr+Vo ,K@0 tPP`a TL ,K0 e000 P  @@A@2EV0 q,K@0 FPP`3 T _,K0 p4000 P  @@A@2PWp8>,4$ 4$ 9,K0 <$R ~x0 8",44 HD$^pPd 4$@T$@X@T(K蜚P\ S48S@SDSLStS|SSSSSS/\ST$T4TS@TDTPT\TlTxTTTTTTT U0U`U -1LM00 -BL┐(M < P   `0@ 08 4 0@@00@0 0  0 00C#0 0S 0 00C3 0 01 0 0 0 00C<, @,@ 8K 0"0S(0080S"0  3 *#*00&#0 0S 0Ph@P 0S HHȚT8#00@ӑ3@ #0#00 #Sp"0 S0 @b0TQ ڐ20S 0SS x20STrQŸ 0 `P B00CSH I(I|I8JPwT]nTgT10S 1 0R0DS|e/@ftˊpP `彆f0PPD0@0 ,PP $ !P$00S0Q X 0DSOT e/@'pPP `Px(|||{|[[\CA {[A|{C|H$)edAhY8 200 "P:@-0@@0` p @ `PpW 0VUT -LM4P @@0`d0p4T @@0P<0@0 ,00S 0 P2 zz {\ -LM@ p 0P`ὰP, i BT 0 @ 4X -LP`Dp  0@-K8 0 P 0d  0LLL @  T0 0@zl]z|]]]nXC -@hpLP` w@T`7< @@`p@`{輜 0-PPL @@@T0h0 p-LlM`KPd,pL e!@P49" , P^@Kp]rdATYPQQ p-L`P@0 SRR P@@Tpp -@LP`pNpP vP! @@T蜚 -L h ]] -d2LJM0S @K 8Ÿ 0S00Q0SP @10S 1@G`A BCDEFP  P`@Pk@TJK0!@-'@ tfP 0rSJKL!D1@/A@P@ PrU<000JK0@ PJ~KpG5(0K@K 0L7E0圈`P P$K2\a0 t岄@T ^ P訄PU᷇(K|{{`b,hOH;$3bb-0 CR 0R0 S%700 0-LPH $0S S 9 @@00@0 20018\Q  0P$0vlKb -LM (R  P`P`20 @P`x0 @@0P` V U`,` 1Z,  0 @@00@0 @P0`@P@0` P` P`ZY P `VUP` R 0 0 @@0 0ZY  S Q R Q,P2 `, \,P 0 2 zuz -R`pL`b9 @@p S R  QPP   0  p-L;P`00S@P`0 0 p -MLM, 0Sfhp0@p@P0p `p ` P0XFWD,00 c 0c#r"Raa  3 !/ , 0Y, 0TBNK@D    (KfP 00S  5'4[($[ SSa B RR,2ࠐ, ^\(KbnXPXCcBB M-AML M@ @DB^K8@PEfĖ !R  `P儑 'o@PA @QT <pP @T a 0tt~0/S @@7oP8(0T|8hc\Clhh -LM2, pR,A,!(P( @P` nP`, 2 @2 @ PXV& `@P 00 Ppq  pq``, 2  @,0" 00 (K2hhhhc\CcDi -LHM2P L R+P@ 50S| 00C C`p  `@P0@P @PDPH0P$Pkp@Pqpp子tuPP夐VQPO( @}WVVW X\TP @Q< R XY  0!}0 o9#@  @@A@@PPLH 2@@@#0NSnS PL2  )8 \0 40 @ 0 0C C P0(s"@P00@ ,P S0 S( 0 K n0pK0pWP   W0X 00 L P0 @@0P`PU` p `P弉pP0L@r0@@0P  ` 0@0 K n PU``P9 @@0Y@PZ 810S0,0KPn PL 42 80 P@@` 0@ST 0@T00K`P0O&'"< 0H D Q@ঞᆁ@P X0 T@ D (K{Tdic\Ccii@j`jRzjj -LMCDE@FPG`@A B0ptP@ P`` \0P 0S<<KhcP$$ ]KjPkSc\Ck -L>@P 0rS@]q0`0 P` !0S`Pla00C8SS #P!LHQ@@ T@44T(10S * F.젟p PP lP00@lP@@T|@d T@XXT0S< , .x*3(\kk3kdNCBkk@S$lDl -LMe/oKH5H\044!06 P!   (Ko讎SlP@P u@` P@ PT`U" @lP`@ P)U T@ PTpUhT0ST D - D`p,@ $P0 0 `ppq pqS,`p0@#P0 0 `ppqi pq@h70`p8@T#P0 H0 `ppqM pq8`p4@"P0 0 `ppq1 pq`ꘒ484 7b@< @0pQ@PP@P`p `p0 (("p0PppP` qэ oKe/[uvxō7< @@0pV  U x0S)0S&h#R Q0S0S 7< @@0p 0 R0SR2z 0S0S`dTP@C 0C` F   ! \1SU 0SSPPQ N 0@@0@0  B 0P@`@1p p p,Z#Y!0!@`@v_K`0@0@ TḀp S P `PU`A `P wlfoK y  !1 R! oKe/l(K8q\pn\CLq`qqqczqqr 0-LM H(K K0K0(@ $P py KK04@r -LzM g6 66`9 @@0  "Y 0ᘠ! 0@@0 0@XWTS !K0@T SVU5 YU0O?P`P``4;D1 A %0@ ! 2 A !  ! @L5]@ş @@Te/oKn`P (K0S)0%@@0@0 (K0(KS )(K0D&@@9)`0C` eKe eK5gNKS:5 5@DS:@D <5 Fe/qKe/K 9KN.KA0 BA B:  *  (%XPȟ0S  'q0:K0:K [BP |VB0`uSUS OKe/  e/   hQC #XQ MQ AQ<  Q ?Q4DQRRQ UQ[cQG aQ= bQ>eQ] X:gQ\qQ mQ` iQZ lQsnQ\ pQcuQ^ rQ sQxQ zQ wQj LP Ke/t 000500C0{ =w Ut p  -P x&0Hf@0@@T^ HfZ (V dS0 ,%M J `Fş0S  <V @@. 0 1V d0( r0p00 @P 0STE0KP Vp 0<R:`P  0$ :f0~ L40S @ 40S40S gNK@D@D,e/0`P')D$7P P0000ӑ yS P00 ӑnRP,400ӑyPgNK@D@D  M`Pde/@0S 30S Qp~ `@0p`p @TP0(p@ Ps  0  z 0,s}V `Pu 0Sr v@Pfi  0ubqOK e/㦏PbPe/  Ie/ Ee/KA kh e@ OKe/ 1e/ -e/) lS `P M&0S  0P 0( e/00!0|0s03Sp0 XyOK e/CP P e/ @  ,P](K{Trr2frjrNC~BBsrdA|s|\CDs|sssH;4sssAs tR|0t{Ht|ttttL t u{@u4uHuXuMЍe' -T0L0S@ 640P (0 0 06@$v؝hXv -LM, ,0Q 8P60P300S.00RdQp P0 `DV U@0`, 0S@P,0P0 03dQ 4 5 0 H@Pv p-1LM0SZta0SV h100CSXHTQL1  D1\5\\1Q0000.1@ KK@ P@#0T@0T0\ L` 0cQ_ 0V@TP 0cQ T0T0 <00SPM5@I5KpH`v @Pmv(w -?MLMC`pP30S9 SQV5QVp3 0cQP#N500 Q R30SŔ 20lcQ"]P ?KK(@DR@D?+rP78@K0 3K4 #P0 : LK4 P0," -?KK(@D@D?+qPPʑ0! ?+qP @!8K0@ 3K4@ Ps0x!4><1Y@B %P K7 4 P0V0 !40 @_ 0U f4 0Kᅫ0, 0 KP3 ,04  ,0 `0WPV(KH@\wPwDwwmPx|xx(xxxy؝ 0-0L@T 500S @qPڼ 0P0# ;;S 0@ +qPp0 @ L0P@TP0D 74 03@0H@P؝D(yLy 0-T0L?M0S@00S ?KK0P@D?+pP 0K0@HP -lb0LPPP2 ?P@8"000"0P002PU GUE&Pڀ;;SB a 0bQ8pPď P01@P1+f0S! b0S ^0ESPX0 SDt3 $1 L0S H0S D0S  0@TT0 0 00TSPP T0 E3 |00t ~3 l00Q PL/38*3HP<@pyyDLyydy0z -t0 0LSd0 \@ 0a R) P$ @3@<Pdz -3LM0S2 2 2mP2 20S 20S 2"2Q 220eAR0S d2BP 0: SH0D@@d2s1@X20S L20S @BP0012P K < 0#4 1 10S 10S1 t1 X1 0S<1 41 R(1 DhQp0S1X!p0p00000S2 @0S 0 p`V 0 0 @PP 0 \0 B00 @00@P0  0|@0pKP ԝt@4xzhT̝`8X0zdDzz p-LMP K`@ P0Pm T  T  h@L@  0&6P mKp,{X<{\L{P{ -L M0U@p 5 005 5 5 5 5 4 QdꈮTT$4@  $Py0$1h4pG 4Q !ATF1#PYX@PPN@T PU+T)P1H818!0(0p0P7000 0R`:``P&0 0 0 0 00000x0h 0S @l 0@P P0 @$0؝\`܃ -0 0LS0 0 R ? R?;ʂ;;S <$t0P%P<0L H0@08000`@̝؝ - 0LS0 0000 ? R?;ʂ P P00 0"00|=ȅ -41L0`SP5 1q0PU R$0SXR"@0S㠚000U0(@VP᎛P U 00$`0 P 啹X DU$` b00|=t  -ML,MQ` p1 Wd1}K0(pG S1 #,pG@P E_P  0 R@Pa- 0S0S 0 KP00 a h0R d0R l0t ! 0[PQ00< 0" 0(Kl{8 R0-LP@  0:PQD 0 0 >P 00h!0Tl -LMp`, T0S000Z PP0e00S @@T*0S Tw /0OQX 0 $`&w* w@'O]\Pb! 0p P 2 0P !` eZ,0c @pW ꄆlȆlp -@L!P 0hl!؆ -*@L"*c0SP 0hW!؆ -L@ x^Pd0d7P 0SD00Sd+P 0 0!h -LM@0 cs&Pd0dP 0SD00S5+P 0 !h -LM \ 0  (0 $@ @ P00S0 0 @00S00 (K(Pw0  Khl -L MpQ`:0P 0 00j 0P0Q0S 0;0Q0 100S00S a=0 800VP24 0Kh K`,hlH M-LM0 0S   (0 $@ @ \00 S0 0 L00S00 c( K0*P0 ] Khl 0-LM0PS@ 00D00S +8 00a0K0  p-LlM`@K+"Pl0PU\0 0R |0R  x0R Kpp -LlM0P/Sp`K/@P+ !P# P p/0p0ĵ 0S  1%P!P 0@h w/00(K`? 0-LlMPK@!P 00S0: SPU GL 0 P; 0K0 -3LM0 {=K0C 0C`$ '{4 P$ #00CSKl,4p`Pp3paP"`#0S ( Kp@0 0$#0ZlCTKQ!P"0: S 4S <zz2 Q   x  P 8"@[P 40S4 ("0S20 P0!l1P 10 A0P0Q0Sp!0;0Q\1P10S9D1tֶP3 0$PK P s 00!d 0]0S 0  0S00S00S  V00S0P ;80a- 0@@(KhXԇ44,\`t|?hl -LpMpPK@v P*410SE 0R  0R 0R  20: SuP PX'0 Lꔐc 0P 0`S ,P X 00 @.(KЈ(0 P0C 0 p-LKpM @`KP P000H 0: S ( 0lKp -0@0Lk&kP P!0P pppp Pg0pS  P0$ ,0@0 R00 -BLP 00儢r"@Tfx"0Sp2pP` &`"0S 00CS00@Ӥ0<@t0Xy 6S0`: V0`0H <Pc  IP@'!0S0  9P ``qHA0S 00CS00Ӥ0H<P p %U(20S@ 0S0* 0S 0P  0Px00x  H0 ` < 0Pc B( BT|@ -d#L M0PS 009Pb { p 3P n0S j"P40C S7\0S H00K080KPT2 0000K@8K ,W0"` "0!V0@@L LHl 0 `: S*  S%  S  SJF S*  S@  SCt1  T10S; a=0+8 0 @1+0 $1 ]( $ "0a- 0 00+P 001T0 L   p0 L@p 0 P;00 D0 (K蜝 ܉(  0-t0L0Sd0P@0S0S 0SU,P W@T0 D\CPd0 R00T00SL0  D00S800S,0Q 0 '8 p-PPL` 0Sb@Ptjp޳@P0/S00D0< S0P `@@@@pt -0 0LS0000000S 00000S| 0@00x00S lh0PX# PD00S PXdT  @-@P*00S S R  PA0B0B0 Sa0B\7B0W BS0@S: P*0/S0 C7SS0@-C@C  R̕0̅ N 0 S0W0* 0L 0\00*0L00\*PG- \*00S S Rpp* 2P0L0A@L S"'.pΏ"'.aLZ`P0  pPo0@pS  0Opp0@ S: 1!>p \*0/S0C7SC-p 0RP`C!CR00 Q0%2>&B P`L 0S W*` P0@ 0P!00*0@00P*-S0!P \P0307 p-t0LM0@SPQkP`K 0;hi0S _iKpB -LTMpIHPa=0`P`VUTSd@`@a pPK 0@ʠ<0PpK0@K[ 0K-0 CR 0R0 S_00 -LlMDŸ@Ÿ^ \P`p^q hp28Ka=0  RQTSAAa ₐ 0@xKk1PxK0C@t1P[ 0P8 KP PiU8100CS (1 ,8,$8 #4YUa=0 RUxKh00S y 0 0BSRh  h00S [ i$K(,0 4$0B8@ p-4L0S$1`@ PP>000-S 00 00 00S  ph.! 0P0P! P P00:U0S ll00:SLQ10 0 $(0T?Pp褝x(A\CH` P00H 0P-L 0SEpPАРP(,ᯰ`P=㪰@P p P|xဤ@P0VPPS0    Up 0Sh|HL -L g]ԋ\C -L g]\C -LlM@P㐀K/p-@6`0@P 0pS P  P0: S 0( UVp$K|$) -LM K`h8 00s@PIrF 0SC kR bR&mR wR!$+%$+*$&U*T'0@P 0 !$/UT0 0 @P 0xS S *S d1#pUT@P@P 0-LMK@!WPP00S0#3 4Pp0@ 00S S00 }0P@80     B@0 0 C8B -LM8 8 4 /\/P800O0啯Po匟p , 0 00@JS$\\,8\DP\\\\\\\\\`L\\\\lx\\\\\\\\\\\\\\\\\\\\lx\\\\\ ,\Dp,^,NP 040 = |(? = 0-S0S, c 0,0 i=W= pe-00-=  X=bPVT \-00P= 0-00-0F0=1,,0 00== Z  0W P0 G<00 @0< 00< < << <0|, x<0 p h`, 48L,pp,0S=;0S , ,<4 ; 0BSPZ [0B8 SaW`00JT000 3xP/@TK D`plPx[ pVPP ` ,PyPRPBU+0S  @PAP  R h h0`0 0L*eP`ZPY :{{h*Wd:0`*W0T DP9P` ^P\Z00J@T000 6P2@TQ `P CPfPP |UPP l /PQP(֭PT0S"  @PƭP P P10`00 P`%8x唘儈ZP49 ,PlG0S 0Se`|P 0S]70Z88儧P0c00@JS^L%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%`%#`%4$D$`%$$`%`%`%$`%`%$$`%`%`%$$`%`%%$%8%`%`%`%`%`%`% !(!X!h!`%|!`%`%!!!!`%!!!`%""""##!`%#p膟@~P6PP 6P 6P 5P5 P %d6@P X6P 5\ 6P\@phv`*a0BS!T""""\""""""""x""""`00000 ` 00$00tS@ R[[,PZ45Z (5Y h4Y X3`P ᲬP @T 4X` pDcd@ R,yP@@ Tcj#3lQh4QPL O84@44@00  ,BWK 4W K@k@dP0V0= P8)3%PV/-U0"U0##0T0cPT\PSS0 ,#R00 R00 Q0048"BpB @1("(2 P  " R  2R  B P/ T1Q ) (1 \OXr` `0 S|@5\OkP(20S`00CS0 \0  0 =P00S!1 |00S񟗏('(' ) )(8 P8000hA04Szh̝Нx(,`Dl`8DDȝdX pTLXdp|\CCtȏBH̏d ,h$ <<ThWOܝp$ĝ(Ԑn9  0v(B0LA`040S04 80 B4 !L0 8P000|@04 S0 (K -L@L0S 8 0R, 00 NHX\C -0L`p0 PA?R R *RJ[RG!QQG (10SE /QCP0QS50@0*S SP0 0S P*Q^' 0!S@@TR 0-S 0S ]S R^R ]R\ P0QS  p-P/Q`00C@ nL R  0Tdp0P0 P0A*00AQ@*00p蔑 p-@P`L 0P <000CS   0Ppp 0-L0L@P 0U(P  /N@T0T\CP -LcMbMKKM(@D"@D 8 3 ( p#3mK`F`F K*K  0K Pm0 0R0A`KpRV1 :*K(:KVx P,&RP \R0/S 9SK00CS& KP2SP  0KQ S @`T K 0fT  '` KV* R V ZKQC :K(=K 0` c Vp]  K0SX 0PSU 3KLL X0I  KP(v0@P *0S0R00S :K8S  K( 0U0(KQ 0 <[S:K(WM3=K0CK0Cll(NM<[S 3K*KAA(NK0(KP ܑ\C4 -CMLM`Pp.0S ᆩ i00C00SӴ0S 0/S  <S  l i<0C<0S HKP,r0 @ P.0S  P @T T`\0@0S dP00ppp00s3pT8 -PPLp 0St|@P\``<0` p`( P0@@@@ TX -LM`P R@\S@ S @0S O_?PPxF p uP00 BNK ; 0$08\R@ 0S @ R)0 00PP GP gP pP00 00 ~ 0d 00 P@08 S0PPPP K<XxؔP\ -PLPMPPP `@K`KO Y00Sf(  0-L MP K@θP 0S ĸK0 -LMp,$3P#崦PP 0SR @ @DT 0r/S ~bPT  /002 0S80S50S-10S(  0R# 0R!  0R S  0R 0R   0R 0R\pp,=0| -L@᭥p  Q.SW|p 0S0C 2W` PᖥPl 0##!>C=S0Hbp0H S]0BtB BtBAtBAtBpAtB(A 0 <#d !>Cv.B B 0@<#!>C0  0#"@!>BDS0k?B0  0!!!.A0r03 R0S )0B0@ 0#"!.B0r03R0S @ 0##!>CS0@ 0#!>C;S0pq -pPL 0Sd&/R`P00  S,UXB .UQ   w PR00EU0s@Pz ZV 0SP00MR CR cR mR00000X\ $0` R: 0S P 000X% 0S" P 6 >#000  0R  0R 0p (\0P P0@@@@, (Tx|Ԗ 0-@PLD 0SA Q0S匚P4 0#S \S0#S@ᶃP@   # @'|hp0Q0 R 0S  㷚P 00@ 00  0=Dl 0-@PLD 0SA Q0S:P4 0#S \S0#S@bP@   # ~@ᝃ|p0Q0 R 0S  eP 00@ 00 d 0=ė -@Q@0@L@ M@!Qp$`K 0^0\$0 QT 0 K0.00P:$0 › -h LM0S T`p0PU 0P` V$K - LM0S0 0`0pC 0 SPpG1S | 0Sp 0S 0X `V*X 0ߖ  00 0(Khl -` L0S `Lp0PU p@ᾖTP` V' -0LpW- 00S)00S% S# S! ; 0`(@T h0S0S 0R 0@S 00傖i(  -L@LP @08 0JP\  -LM@`Tp. ݚPU& 0S0S 0 S 0PS(K00@K0! 00 0 0(&(K= -MLM\10SPO D10S 0/S BKAA:PP & 1a0Q䠟0 IJpP 0@K,K ՟00 0p͟0p 0&7P  00PK1,0,K 0 0 @嶑㮟00 0姟(KD8P -LM@PU`p= 9P 0S0S 0 S- (K00K0! z$~PP 6P 0 @ 00@P0 0 0P_x0K Xg (K= -0L@pT` QP 0SW =@P@D 00 0` 00@= -2LM0PS0 { ; 01pW@X ,  00,0 `P 0 S0 S R30`+ 0G0 0@S@,00I 0!`P< 0$00 ܗP2 0@ 000 0 xP 00 P oP@00S0x@0S㵗P +0 080( (K -0L:P -@@L0S 0)P=T -@@L0S 0Pq= -@@L0S 0PZ -@@L0S 0PC  -1L@`Tp0 Q@@T WPPQP' #[5P  @P O5P J5P @0 00@$Hd -x0L@`TPp X AT  P  P:0E0@ -1L@`T^ 10S\ |10SX; 0dI P @U, H0S0S 0R 0@PS  ! 嵎0  S;00 S00000CS000厓ጓrPP 4P p0+0 0L00040 00Pn(a(   -MLM1@Tw pP!@T; nK`F⼑`F0S 050S0S !  KDP  L!_GꝟP @T a= 0R0S:5 1`P% @ 0q5Q zP a=00 @l0 00`\ L <ޒ (KGĚܚ 0-@LPU 0WPld0d@` 4ZaP0P08 0Y0G@PHl| 0S P  PR00S0-SN S S  L0 00N L0 L 00N00N L 00L0B 0R00*0B00R*Pp@-^P`@L ^ ^ A0 00LA0A 00L 00LA 00AP @0@ 0P!00*0@00P*@ pp@- @0R\  0R: -5L~MP0C  Pt50SVPP PR@00S 0 K00XH;HDdMЍ]M 0P Q0A000  B@ Ѝ 0-P`L p 07v  0O?0@@c0@0S@ 0 @TpS 0@S 0S  O0 R 0 Sᴟ -L CNPD뀟\C -l1LM0l  y 0D8z YhK0 0(0 0,00$(0480P@`p $,00< 0 Pp 4@`p3PPp e @ 1Q0^l0  L00@ @l4@T (KB<Tp| -|0LM0 K Fj@P1D0@ @坕@10 哕KT$)t-0 CR 0R0 S00 0-LM@P0 !P*))$ 0 00PhQUTPE@H00S< K0h( K0hꄠȠ|BC -@L0 0Q 0 $0Q0 $ h 8 -L@Q񟗤l~t~hp <hpxLWQ6~~~~~ (08@HPXYWUS0SO #SHFDB@><:864;0Q xtllhde0T!PhH0 $#$(,"(hQ Q Q  0S=hC <8#"h$dpС,@P`p 0L` 0@`ܤ@htĥ -3LM,MQ (K@ 30S  lydM K(@T*T IK@3(@D8#0  K(@*K(HJK0#(@Db*0"*20S "*۔P% `V"ٓꯟ@P᫟ 01{ L2u| 0a{ 0(" KK(@(A*㲔 K*(@孔1 Ra 10S] 1K@1@P 0sp` 0s6(J@P/1)K0 B0/0ms9K00C/0/0_s/0/0 Ss/ 0 uK0L/0Fs)K0 B0/gK 80 T K(@ *GJK(@Dန (KBCP \<XThY@ -@LT  p3xp3PA\ -L$M@H <KL .H000T ,70  L x. %HP@j 0 `S@@ D` &0 S6 0 S pP D0 K0,0,<4 ,!4$ !$4 <,,c<0K0S@ P< 8 4 0@ =9< 8 =40 <08 P@@$4 pWş` P`^`0S%0S0S*D`0#p5 ` R0 H 0 0 B0 00 0403  rL-D0 04!48#8@!HP|40S /03r/@0U h Y`\D@`0 FRL5;DD4p0 S A@PR P@0 T$*0T@:@PQ* Q:L30  D`@0010QPL I@ X徽DH0HP`Q @11:Q1 Q媽p@WJ*P 0@$4,<4("4! 厽pGW JiTO "0S0l 0 JR !pR@T 0W T( 9SP 0b00@ c>'W` pӏT*P 0@$4,<4("4C! d=pW\ J TX4BS$3  % `4E 40K00@000 ' 0)[R00@ 0  0 00  0`40030 ! D40<2S\L@K(P O|#K K0 KPPM!;x30 3@ *0K@P830 2@ )0K@oP20 2 00K_PDpB@KP,#<0K@P CP|< 80R"80KPCPn0;CS0eaBP"00P-P 2Q"Հ "Q0S@( 0T D @80$@p A0 p\Kl`KTKPKLPK 0   0 \0 05KP8 0T @'@P0S l : P0 寋 @ ᦋ@ R 10S:넠@x(T{Gz?LCtA?$)̨!(@XA.ApP|`ة(\pȪԪDdT|\MЍP -0LS1P`@t( 0S3T 00,`T'%X% L0S `00S 0 T$0/S 0S : 0 S /S R| - @L R000 P -LM0 ,  )O P`4 0CL 100R 00 `0001  L0 S  `0 X1  00H 0P,1p(0@S0  O0001{U V   q0p t'@0 00C0S  c 0000S Pq0 p 0000K101E(K|X` M-LK0C 0Cp4  0pH.`<$/ PA(0S| 1x Pu (0PqlT (0($4@_ 0(000@S@异PPxx-C:9$C 0@S *$5PP(0@S4 0$p00S P 00DdKlt1!(Ph@((P$00b04pPÏ 0 0C0(K|^\C p-4P0`L@ϋ0P7 ҋP10 0L0S' `0$ 0 000C S |tttttl0 0 000000  00pp|< p-8L@ChH1PS  0D P6ph 0S 0 R0 0 : S&L f|00S V 6`"\:L00SHP10f1php|,D\h -ML Mp$ l4 dK< t  0: S00h4 h$5R@T 0S + 0S P! T  V0`00 0,0K4pdK`0 \` Xp vT0K;8DP0S@eP1 44 0S ?P $ P 0S 岵0TU 10C1_l3x#0@S0 X3 @@d @3i0: S= Dp@ P 3 Ÿ0 "@_P`0Y"0 PPLR0,0K\p X 2 `0 @dKA0<"',2 X200S H+wE~KpG82 pG0p@P 0EKH`G H @ PG 0 0f@PV 0dQ# 0M@P|xBP1 h4S00C08 HA   p|l$r @(@101>00 00 p4sl| GK{000S (Kp||0ĬX`Hl~ -ML Mp`@Py AK @ @0/W  V V0W 00 0S:0S:Q@P A.KHH0 Q B B4NAK AA HK ̭ -LM0  -LMXb0$p, 0 (@{P4$0S0 0S-,0T*0PdPP#0So H,@(0 TP0PPP0(0 0(04PQo0@ 0$@O$0SJ 0SG(,`YC00 P`  (0 PU` P$`0(P1 ,0Z00,V)U' P"Pd(P 0 ``0SOPR(P 0$@ L,@D0T00000(K|ԭ -QLp?P?58Q,0ST 0E0 @0 o 0 Tg5!"@ 0$@$!0$ P 0 0SO 0$@ |5( `"P Ꮕ0 (0@  e}`tl0` {P {$0S 0S|\C -0L`00qP`00 0S0S 0 P0V:T 0Q 0 0S Q PTL` 0-L@4,!PL00S' `0$ 1 000C S T\LdLlLtL|LD0 0 0000000S0 0 00 aR08#80 0cP 0 4҄ 0|< 0 00H 0-LM@P0`P~ P00 0AS ꌸ0008 8`  0-\0L @?P$D000S0S P 0\H8 0-P0L@T 4)P T00T0S 4 0S0S: 00 p-0 0LR@`PU p 4N40Pp 0-h0L0S XX 0 0CAPz T@D*@zz0000HTL -@LPz00茬 -!LM0P`@0@U V!0S:0S* \2XXJWG@Q@(0@ 8 4 0@ @h$0" 0 ~$P, d0 0P0O0 0P0O 8 K N ?B00, 7@d@d0 09 L0 D0 (K萬P|P - q@4$8 00P``0 0L`0~(@0PP~`pp~0P@00 00PS|PTA(@QP|t -QLMp  P W0X 00!0S:0S* hZd10 R QD14PoV;U8 a(0@P 0 42 0R,0 0d00  0  ?x, 0`To 0 i5!"@0 @@ <0<$0@?@^ 0 |H -0p0LWP/`$`}@E # U*W!00S .0 t2"@#0WH00S @0 42" t|ܫԮ -0LL@Tx?d0 X00S L%DP $ 4@d00d000|$Xx -0L: SpP` R@l  q PRq hP蔯 p-0 : SLP`l0@@0P`Vup 0-PLM @囯U  T T0U 003 0S/:0S+:P}0'HeProx00S dg Pa0K@ tc ,WK0įЯ دܯP -Lp`81$0B?; P4#{PP? 1 ?60V 0 P0 00W0 0@0@0@ 0$@`p U!(,0 (4⊁h0h 0R X@d0 0S,P8 $(00 Q |\HL@T  -ML MH 8`\0< H( <(  H8PPBHY4`F#@ 0h ` 0`p08 PA0 ZY8 0 0@ @ 08 H42 R'8Q$*@(0D 0S H8BK!@00@PĂBKAHP@  D8X:1@@K8(A!A4( L L R 08HS H<H0 0m5 @(0;H80S00  ) H(L@00 08L/PPH8i@w  Q Q冮|0@Pt0 0  P Y4X:@(000(K|<,PtxH -KML M0S000,0P> $0: S S  S S1Q;P@K c%RKK$H0B?  ,` Hp Rg80(S00Q0S+ @0 040( $P@1$C1/!0@@ S  Bdp W`@PK@pK.K4 B$ `4\P 0CD PŸT 4  R    0 , <80S00  ! @00 0W NPP@ Q qx妭t0 l0PP@P 4 #1@`pX(K|PtHx -L`p@UTP  *0 R  H n@0SxP0Sd`` 00C0H z<00  ,00 U@`H -L0S4 ߫0000 $000000l$p0\40@T12 P4 40St2 @ #0S 0S np P0S  0S L0S Pޫx#0S 0Sd `ӫ0SPΫ M0S@ɫ !0S0ī 0S  > 3 3 0 "0S "0" 0 0b2QMT"0SP6@K P4bU2 0 0hcQh2,"0S T,2@@&@T q("0S 2@@T `!00!Q0!090S 0KXA00@000 00b1s1s1s0S" 0Sp@ l10Sd;` P TK=P " (4,0K ^P 0S " 2I02 Y0P.-Tx(D ܫ|0DdA st: 0  P$` P, 0   00C0 P 0 0000C0@0 @$P0Po%X:(K`LdpPĵTL|\hX$~4 -ML M,0S0 R0 0S-0.S*0@ST H)0@ 0 P8  8 )L0Sh `0e 0Sb (00 P89089 U(0L 01 R0*1K `000JK )1Ki0*a[S @dzP T8 / 0@`T0%TK8(K @w8(K` w,0@f0,07 00C0  z@? P8  8 ,0SpP L0S0! *K `0)K0)1K(JK Ei,Q0 0 0PF0b(K0 ,00,06 00C0 y(K@@@T4 `V zP+0@ 0$@L&L0SW `0T 0SQ @&`  P8 8 EV%0 S Ɵ  0 S ş z 0@ 0$@0 $ş j\%(K>K$ P88 ,00,0P4 5 00C0-0S(  R(0.S%,0S"R$00 P8 8 8 0.S$00@m P89089 8,0X$0,00S`p0S: QQP ğ 0CSsc< 0 0AS,``,0Sڴß0. < ,0SQ 0S 0T P< V0 : S0000 0 0 ) ,0S&ڒ~KpG pG@0 00RnK@`FP `F 000xx""T20S dCH P< p ,0S00@!L0SU `0R 2 0 0B S T\LdLlLtL|LD0 0 000000Q, 0B S 0 0 000000 006py P8 8 |0  00C00(<Q89008 (KP|lp~ĶX$<hx`зܷ<  -HH1 0 BLF`PQ>  0  !000S4 000S. p@00 000S 0Wp` Gl 0@ 0$@X0  00C00 0 0 J 0Z*TL`\|X -Ԡp`L,P$ Q00S8 0S 00@00kT  R<0 08, 000C0`pGW 8d -L@@B R R 1 !! :s P 00C   %lppWo``Fe`tl@G!_v3 0@4l DTk`0@dkp8S P-L@ ,00S 7hqP̺ -L M3X㠓,  ; @P|c+ p#`3R,XpW,D PU,, +'4 0@c00 k4@A ?$4@2 0$Ć4堤404k4~k04(ykX?004Z0d2  0 TB+40S2PUy0 000 0 00 000 ,0,00 00000 330 330 330 330 @0L@00 D0QD00 550 550 55 d00d00d0d 0 d  ` @d0 00Sd0\n,%'@P+23P 00S 峝p`P@ 0R@| aAM T,` 40 (KP|SX\ܫ TĻ -p6SMLM@`V`@X6K`Pq ,0: S M Px S5Pپuq iE0S 50S9P0`S$l50S / l%0@dUde`5pp pppph h0S P4P(0$<0P @9D0S40S4-K B BP PP@  ,%854# 20dP@0T0T <ğ<8ğ8$4ğ444倜4$@40S4s43ST# 3R0S c$(0#@3P=PP [||3|#*Y@|C2PP(3$ R DtB0S 20Sl2RBgPPT`p4 S  ӸĔ    P VDP|| `P4U<2 00B10@g<2P0Q Ayg2P  og1P:cg1P0@+!0@P04 21004Qh1 \1 ,ipPp0S 00CS00@Ӥ0w@t@00S0#3 PP 0h0 0S0 0`00<00SL06#3 0PP<kBЬܬجԬCBĬB̬$)Ȭ  - P0ĐL0`p@T jPP KPP|00U T 0S0`00 l0S̬BdȬH$)B -Lp`hT>h膹BC p-0LxMPK`@ Kb00 @PPKbP1 K0400  @T0S Do @K< Q00 (PKp,i@ 0-LHM\@KPH XbD Q Q(0 ڏPlK0iH  0-LHM\@KPH 7bD Q Q(0 幏PKK0iH4 p-LM*@KxPx` bh @埏pP  b0 01Kᑏp "Kp8i Di P -L M K0, @0$0 x\p  0Ӣ06@K|P`x  `ad @\pL  @rKSp0 K\8i Di P -LM"@K aTT0 L@2p [Q"0[S "0[ S ݌K8i lt -LM0@KQ a!a  P P0 P - 0崌`p@P0S 婌0  夌 0S-|-/0lS  P%PU@KiBC -81LM@8Kq`P  $aV@! V/P  0pp@ 'PK 0`P !d400`ᯕP5@P 0 ^ 82P ᴉ ١$K -2ML M`K`K@KH `@ `H PK0C 0 5Pn` K0 Q( K18 P݋WKً10S 2 d0S ^KPE`@pH`4@K"CP< 2W[H[w[ᴇ[ᰧ[C[[f[ 0 `娋 Tࠋ$ 0S  '@HP0T00S xދ@`PKh@​8T WLy(KiHi@4BCDL p-L M.@K ``P0 @囍p'  aO00SA[T 0K <0SK XT001K,0H sp4Kp8i Dx* i P -L M K@,0  $`\p  0宠 S0@0P0S ph`P\0@Px`h@lP @`P,0@Pp@tP|` K@BL`|| -LPp`@P0 SP 0S@ 0-@PL0 p:0 Q0d -L`d00XCTp@Pp 48 00 0  2 ش 0-@PL0 p0 0 p-PPL@0S00pd00X L<8@P`RPPPp萵ش0\ -@pL`@1P5P@Td p-L$M@`P xƟ <@K$ dP^` "NT PP@ 4` GP$Kpi$0i$D -Lp(`PP hd po0 @㆟80 0P(@PRD -L@D008 ,d$00ش -L@D008 ,G$00ش$P  p-L$MPP& p`@ C0P % `b@TP` 8P` ؞@TB{KD@K$pG@pG B[\ \ 0P ,p K P "4QBKK$@D`@@DP 09껇0xS  \EP@40LUZ@$KHi i 0DBt/CLP - GL{M  WC\0K0 K ȉKp8 3\ K 庉BOK`4 %\ ~K 嬉t@K  \T pK T垉F@K   \ bK 吉\@K [ TK 傉@K [ FK t@K  $ [x 8K fpwp3`v`3  2"RS XZ 2SP@00kW @[e T KZ[Q 4Q.@K [X:LPK P3 4 4KK>OKކ [}K 4 J 4 TP[P Q[ U@, @ F@ @ FF3Gf峆VZ 01SW]K -K0  0S X3 Xph>,AT 1S1S1S(Q$!000C S0:S Q $ Ps`T 0S,,Q;V@P T"R0S x@0S,PK "2S*0S' ,0  0 .0 0~hy"Rd0S`  2S |[`1P|!A t0l BP01S H10S N 倱|0[ 10S ? xq00S 00S `p@Y(K8i i8i4iiiii$XCdlxiB08i BD -ML MPHHpᒅ@5@ <54%A05Q($5Q5Q{ 50S  U 0S 0SS0`=`L@Kbd7( ZP hIx ᖇPW PE|,P<塝uPP   ( yP + <0 <0R$ 30S | 宰30St(q(`声0 lD30S8)b)$唰30S  W 剰V20S@p `Q00S W3p؄ 7 "@,0T `V@pMZh20S`B`R 4T0@$0$@SFNKP@D/LRKLQKaY H1 PYK4[S` SoKL[ <PP<P,HK[1K[!Q``P?K@ P@OK@@_KL[K <<P,~H0 S/KdT$^0@ ំPQRt0 唆P0QF 㔯$KPxXԴ ,$BC06i(<Lp`lL,8Ki€4\i i  0-L$M8@KP$ X #H0S yY0P00C SX8@K HP8㧙00 (:p K0i$ 0-L$M8@KP$ X G0S DY0P00C Sh8@K GPHr@0 8p0SK0$Ti$t -LMpK@P4 [XtH A ` SXA0K0 G1 ׅ@PCXBP 00S0xS 0K`# rP 0 S 80A7S$A0[S K Ό@ K1aP00@KP 0 eG 哅P$h@K$ W\ SGt ၅P`0X X0 wP@K8i i4(i$0i$D -LM`pK@8 P`KW@ W0tP0 L0 0P0 b  P1 P0 0 L H @ 8 T Px1PP0 00 C R0:S@L P$pK@` 80$ PD $0@@T0P0S+0(0 9XP000S00S  (Kp(P`K $0K$ @(KT $0D` H0 `@KX FL0 Dބp< K<H 0hpi8 0-0LM0Q ' APKPP C @0SlWP 0S 00StPU< 08`0) 0-TPL0@S s<0) 㸎 0P@0000 -LMpp0S0+S DP`IOK`` <(:P,F307 OK.V FK *P 01S@K V032K4BKOKI_K4[ <9P ,E征_K.qV EK2 P}01S Kv囁OK.NV` EK,2L ΃PZ01S ,42z42v42r42n42j42@f42bZ ^10ST OK. V\ fEK(1 p千P01S: Tb7,"(2 4"02 / @ P/K0 UTPK0 UTP S$K"i %i ,Ii <P\htXQi Q$)ꤳ 0-LM  >0 b : S SR  x> 0-S`C0` S 0V`0 ` @\1  pW3 RQ 0@PS| x@ P 8 `U@K` PK`P ` `0,!`lNOP`0!t p lP `^NO0h  VNO0d 0S0`0  0 FNyO` \ 0K80 0Sd0  @B@T(Kȵĵh\4 ̵NP \6$P \fPX@L6 10@GS 4̟`t|ԟp ؞@0<HTh5 544?4 44444 0s4  x4 04 4 P4h4D4T4P4 8404,4444 333333 33 3 3 E3 3 3 3 3 @40@1 h3 @43 P3 D3@3 83 0#;$#00000#00"0"0000C"vp 2 `r00X2Pf0Sp20S{p20Sw<20Ss20So10S@j20S@iX,K 1 R $ 1!0S 0S S S! &!10S!h1!0S110S S S!t1 x!10Sh!1H!0ST1T1000SD!00S 0!01 00S!0 !0S110U  0(Kd00S p00Shht@ܵеĵ ص̵ԵȵpA|\̑ؑD$|< -0 CR 0R0 S00:  S-L  S# S  S00S//00S|| x00S@@\00S= =H帢I 000S* * 婢BC -0`LPpHP  w0@0S 0L 0B?+ 0hv@L T0@0SD00S 0: S@ȵе -P1@0PS$0pp41400S0L0p1`0Sp/ 0S+ T$0S,J,@@(0  R :@T  1 @ 0Sx / d%$ {@PU000S, o oȵBC p-\`@LP 0S $ X00S  @TpBC 0-0P0S$0L0x00S00d00SX00S H00@T0CC0ȵе -LM,K`PS 0<0S <10S010S $1 0B?  vpP) 0S% ,0W @T p 刡 p$ ,0pW@ 0S du@ TT PU800S, l bȵBC -LM,KpeP4 b0QQ @P0@0 >0@@0-g1 000  0S00!000  R,@0>C0 C0P<0S 410S(10S 1 0B?s qu !8 -80 ` $0 T00X,0PU @ 0 S |@40T\ 0SP  <֠ Y aP(KȵBC p-LHM@` \ P{00000S@P0`P``KRQRQT@P@`K )XPK0 @8PXK$tKp  -LM0<0S t30Sh30S \3 0B? 8tCK.KI B BI@( 0S #Hp0S$  t"0S 2L 0B?( 0t<K5v( 0<K@t"0S|0 t  h t`"0S Tt0: S S 4"8"8 #$ 0,`SD@0 0f!0wt10S  &Mp  ht 0bt!0S 10S8,L@"rh10S\10S 0: S0: S&<0S0 !rH0@0  jH @ upH0 ,(0K 08Bt@900S  壟Z?(Kȵ ̵صе$)0\C@BC -0L R\C -젟쀟p@L`P/0Sr 0000S?`0 CR` p0R0 S X0X0d` r 0000S?(;P RBܵBBCMЍ -pL@P`nP`  θp00pT@P a@Tl0 P @ HP@0㕓#PU`pW*@\CA 0-LM@P  K0K PPrp (00S8s 5sK0\b -L MP@ `$K 0PPQp $?pP 0 PPDp ,00S  s as K\MЍ P P P   000DlH@00    00 p0 $04"4 8 #R$@-@ T 00R  0)S0/SR 0 0^P@-@ T 00R  0)S0.S R 0 0^P@- 0c\ 0@=9 =00S@ -L \C p-L_M.PGPG`e?VE eK̴0K 0|1B q 000 Q00 ӑ @PQ@KX FK`a 㝖 )PK☖<@K\ WP  e_K  4#83p`00``6!00020Z t0 0w00```` h t00w0 0PPPP;("(-[ x2 t00\x00``;8#8 Ġ#Č( |;2 p`Lh t0 0PPj;&(04"401pP51& ("(04"4! 8# !̠R#8! 0 0Ks0(̠,<Č4("Č!4 ̌.<$K $ 0 墪00p@0@PK000 \=00 @0 0 0PܞD D D D D @@E0@2S$$h$$$$$$$$$X$$$$$$$$$$$D $$$0L$d$x0P:;M;0/SS" CS AS%!GS LS gS aS cSlS sS 0<0;0 0;0:0:091P0SSs000K 00 p@8 i0S 00S 00 80SR; #1 4K{4 =R* 0P 0@005006aqP 90 0 }00 0X  08 0K< 0S 000S 0 S0 :$ 0KW p0S 000S $ ; PqP ; cK`P` 0" :#$Vx: P:Pʄ X*; 00pP 0X00K bP00S 000S  9  X 08^07[0 00v00Q@K q; Y   70 P ` *00  9<9 |k09* 0K)P00S 000S 8 8P4 0:;7 0< 04Kk4 < R 0h|T(<0Kap <30:;:0:;8(呫p27$@dXX HP 00 4!A$7D 0 0P 0PP @K : $g   70 :P'0S00Q  {8d60  D66 PQ/ @K :   7@0K P dz$\0q@00S 50 4/~@%0)0 ʅP@j`50  @U@`K@)p' 0@@ p嵅P)0( p嫅P~4 0Sx9  h}4`%0 R0HS004 0 5.$ 0 %00;0>4 a1P N ,40l$0 0B0 SV}$8#8073@0,@ @ 3 ,0KT4 @0R,0 x3) ,0KFp DQ,0K ), * 4p )+ , 'p BK0  9 d30S:00  9B:  0KP0`20  )@& @0K@@ P30Q sZ P 02Pz 1P$Rp p 9 00 00!000, 0R PP4S  P$ : 8"0s 0000000 ! 00 0RPPX`Ӟ@He 00)00 00 0 `PP@K@Kh% 0P i< 'z@00S BPP@g @(px(tdLC?.A'' ,0H d!(Ahة$Lh $8Tp$) 'u8\0PlLTlDHp t||@\C@hUxD00)`0@0 p@P0    0W  )0. P880s 0 )ԃPpt!0s 0) ŃPV )03 嶃P@ oP@ KPym8 $R 0S({A8PK8`P"0`參Pdbd0h"`元PX 0 S{d"(0K) #"r(@K0b0$P)$ 0PgP0)% P^P xf(@d @$Mc,4Gc<cAq ` p d30@3pKdK H30S 3#cXpKPU 00@T P0S @0  TP0HKH0 TK _P0 0 0K0 7M>K0C0 40 5@K X0 T p P zP0S dx rP0  $b <5 R @E0SX5X \50 c0BQ x50S&{lp3 MЍ 0-8P8@L4 7  0\C - LzhH -BMLMpP4p0e0,@00 ,0 4rP dP jP4@+ aP( uP zP! tP!P, @g4 kp 000C S0 L$vp00S84@,0S 0KPP Xkpq 1 dR 0+S 3L4  L$ H@TPp00F S.VWprP`V@W0P 0p `S7Pa 0RR!>C 2#=S0XF7@ PR0T TTT\T4@ Td0 T?#C0 2#0@0TT!>C 2"0r03 R0S !00C0@0TT!>C 2"0r03R0S @0TT!>C 2#S0 0RR!>C 2#;S0x1@PQ0GT1pW*@10S HKpLJ 1HPK`<K0S@<0 8@ 4p -ap( <K<@ 8P 40 OP/6 P %HQ 0+SL HXä Y ` ^P6P|vMK@D0L$%zax(p\`tA(MЍC0 S S  -`0@P@@T0 LQ <00S 000S.6:W -Lq,@PD/ p-L@?6P `$p -2 B 0LP@0`P 0S00d2M $ -2942@60P/S @P5P 2 B 30S ),',%,#, 1R]P @5PPE ,U 0+S-S0Sf*Pc*Pp+]@P@`%p`T)UPE00S3PZPP700S 00St0Q. /'p9v8P6PP$\ 000 00@` 0-L@PU0 0 Ahx -|@L0p0h A0\0L A0D00 A0,0 A00Hx`XP -L@`0X AP0@ zA<0( tA(0 nA0@LxT\D -L@$000P h 0 0S00JA(x@< 0 AA<x0 09A8x 00S 0 -Ad x 0 %A0x 0 A,x -D0L0S (0@ThVh{0 0@(x  0 @$x -h@L0S X00SL0L H0@@00S40$ 0@00px x - 0 @L0 0@ 0 p-0PSL`0S <0 S @Tp00Sg, 0-0L0S0 0@|00Sp0` \0@\00SDP@v,0 T@J$0 0tx l - 0 L@ h]@4x p-LM``P& 0S0@ 3P& @T P3@0\ 2H 00P (@K 0l" 3,Kp@T\ -L@P h}00Sh|"  `p  @100 0 P"^H2 K@)1 `P0`S@ 2  BX>!  `M  @100 0 Q :1 @K1 P  `PPPp0P0ASP `100ST1  K|8SkLH,(\48 0<D R(0 l,ptl x.<@8O4DH@.p8LPTX\`d.h-$v ,+0u( -2L,M0P t2pPpLPK `2`b0S HB00rP2pR nP2 2P+ KP+ P1FP+ PA%P' KP<& P. 1P$ KP2P K P- P# K P' P X1P!              0 09[7[0@H 8@[0G  @0@ H ,0K1K+K.KX0,@L K0 K P($P -PRLp@q*pq P U* ( P pU P@DTUt`l`@ P@ P@TZ@U  ip i()0P! L0@-T0P?0" 0@0S0S0 R0@0P 400S4CTp@-@00Sp($$,F6PI`pP<0 5-=?0S> 06S000,0 0@S200 @-0 4D044D 0P 0- L0S( 4 @ 0   05#@0Q@ DLP 4d 0T4#0@0h0 -0L yp0q 0 -0LPU5 40 0@044D 0S"040P`0$44p Td$T(d,t$0@044D $ 0<pqh1(` -0Lp`PP#F%0 4@0$($,T044Dt T$= P 404(0$00 4si8 p-L@ 00s'0@p -4LpMP0 Q $$0R($0R,0Q00:$($? 20€0 S 0S0,$R030 5: Z02Z00 L R 0s0s* 30S 4 3 R 4S$P3 3@ 40 400@000  83   0 0 0 $4(D0@0 00 2P$($6F`IpIpq QʡP4S4S 4?  0=p@Pq@1'M20dtŸ q 00010*b%pl P'-1 4D0O4D0P0030d4t|10S) 0SN+K X&nL10S@1mK/P(0 S 0S1 0S 0 +00 00S$00 S 0 0 0  0 0  02 0 ,0PN*0(K t T$)X`d 0-0LPU ,4S0C$(QP40@[P $4(D 0@$4(D0,40h0 -l@L0S~p D0,$R0,4$4(D 0@$4(D0,4 -1LpPW`Z 7VYp q  V0U00I0O(?   69F$4S4S  P4S* 4S&p" 0ꀀp 4S4S:AT0Q$(080@00,00 -LP l0 P 0R 0R Q0$4(D0,4 -p0L@T 4 x 04pq hW0 @/pp$ 0 010#BQ0S4:Ss0p 0 00 B p-L 000 x 0Pd `P @ r 0 04 (0$ + BL<040 0 ,0(0 00 $00 00  -LMp@P `@_00C0 S%"0 .S0K0 $ K K p-RL@Pq0` +TUp -LM`p$ @PD0 `p -L|@||PM$pK(`K  [(0S0C(0 0$ 0b0 0R 0 000 K -LMP@p`+   e0` p-L@LMPK@%+`@@00S x -LMP@܀,pK(`K, 0(  R,00# (000 0S( ,0S(00#D@(`K,PK 0S'@0 S$K@ -T0L0S<0@@Y0 0@(0 00  -P1LMH!0SK$@K0$p,`K0PK%,0S(0S 0 ,00R$ 0 ܠ p@4`K8PK4 80@00l?T 40S4 h0 c\0@d0 YH,0 ( c,0 0 b00S C$K@ 0-P0@LT0 0S0 P0D@ (<00 0P0s300  -0L M 0 PK Ѐp %@(`K(0@00l?T $00S, (0S ,0$0 ,PK(@K$ 0S$ (0 c,0@0  K@ p-LM@ 0S0 K K 0P 0 0 R0AR00S t 0 d@0000"`K PKy 0S ʈ"000 0SKp@ - 0L00S H p-PL`@)0 Rpx00 AP@*P0P0A0Q:$0 \p  p-2b0@S2LTP00P P} P PS PMP $ Po  P> J1PD eP PyJ{}yFB00S S=A00 S njQA0S0S S _QA0S\0S SXx1@@`1pDA00SG?#=!p1 1R0R S P@0S00S S ,P@0S%0S S!( 00 S@ h@00 S 00 SS 00pPphp -LMP(|||p`,K  ,P i@TI!,0PT@:0S0 0 0 0S0PP -0LMK0 ! K -LZ#P x0pq  T0 hH00S <@ e nD ^00.@0S0> G*.0Sed.0S:  _P  P d> PM T>0S P (> P> N0S $@$P T 0S:n B-0SD0eS`p]`p-@TD0eSe @D 0S Sf Sc S S/S 7S[ S00G.W S}dPx Q@H,0SP0!W@  +W W R0R00@0#0<0WT t<0WP h<0WuK* ,PN@ 4 @K0@0SP +aGQ0+V0;/P%WQ W W W !WG W*W @W07S,; 07S+607S 1*. W W !P 0#0CSXP;0S P LP )0K*pK*K 0K0 @0PT 0DcSCPBD8FAIKIIDBADD(FEDId;pGEKG FD(IIEDCCFIA0BJJIlHhGCJTK|FFFFHKK,DEHIIlF4DKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKd; 0RQ80S0SX80S88;  2RQH80S0S; +0S0S0@,70S 0S0Sh7  0S0S0@ 0S0S0@$70S'0S!#0S 0S0S0@0S0SD60S86 D RQ5,60S5 5RQ55  # 0S0S0@!0S0@D50S0dSd0@55U xyQP o mn0S0@4 b_`!8 8K@XYnU00SN0S00S00 0S0@440[0S 0R<00S0@("d3P0  0S@3P0   ,S3 0S0@{2P&0S0S0@=P kP P ^ 0S0S220S0S0@P 0S0ST202P8K80 b0S0S0@PT1@P P ` !001 8 0;C01p0P 10P} 10 PPx Pv !t0( #+0p0Pi 00Pe 00 PP` P^ _Z 0sR/Q-03 h$ |$) <DThx$@xdi 00S(00գ?0O<0 R0S0p  0c0RQ000S00գ?0O0 000 0S  0p9 !0S,00"00S -LMS0 0`p"(K00p  80 @0P4 < @0 H4 80P00S T @DT70 3 R0S -<Q PP,00,0  ,0 P ,0S:@ R r 000 R00 ӑ0Q0 f 0g1@UP1,Z:U00! 0U SPE0Y00f0(KBA -L@0 !0S@-P@p`E5 p-0SS%0P gP' 00dP ^S0gS 0S 0S  0S  \:QfPd 0 0 -0LM0@P3 00P/ 00P`+ P=pK,KUڏ@@ PP`  0@Sd`0dV0S0E@WU@DPE,P ``(K$ 0-LM@PK ^P8#!P  0S NP 88 -LM@R,  P @- R P`Pp W!Pڤ`0 C @R`0P R0  0S0@  0R@S  TP1:, 00 - LPh - LPh -Lq h  -LQph- 0-L MP0S& @K 0s0s alP&@T T0SP0 ca000 0@$0 0 K0X`PI -@LPA -L|MB0PP 0S U P0,K0 K00 pYP@@00S`R`> PX2`0 H6 P`0,0 AP8  8Kg8X 0 8 Z g -MP, 8 8K10SP ,P X8K8p yPYP ,T`Z,1 o 10 @1 P0 , KYP 0K 0 0P@ P@0 0R0 O{0Up00S,8K8p (K$)X`4 0-LP@(@P NP0h0 -`LP`pW`V@ZP PT 0  0  0   0  0   p-L@P`P U  P V  P php -L@uh P-L 0h -00LP L h(\ -L@A 0r/S@ R -LlM|K@iP8K 0&K -L0PT -L@%P 0@sS @ 0-D@L0PS0kP(000P0dt -L M`, @pP@0S 0S P W @P RX Y"@rXP@ d \00T @ P  d,U @000S0(K  -LM@pP 0S `PKh@@@1L0H P`G  Έ@KH\ -0LM0Sp(Ry`P" ?PڄiQT@Q@N@@P 0@T iR -2LM0pS d2@T+PP0`|S -S` P} Pu@@@ P0T`V_ X$ 10S@ Ị@)K P X00P0SF 04000)[ `@p9dvp@d0S 00CS00PӤ0ᆤiP U g0H u RS @G 2p@P00ᯇ0SpB -LAMPP2  0zpq) NK,PKp@%`@ 0S PP   0S*P P` 0S:VK -HHaLp@P#R %RT0TS 0S %R #RP +PP@ R묐0ਠ`P@#R %RU0US 0S %R #R P  d @ P R  -L@ 0 pS` R0S000S`PUP@000S 00  0-LlMKPP@0: S@@;K0 p-LlM0`0SP @@ P4  KɁPPl00S0: S x*@! P , /PKp<00S,0P 00S00C '00Sn 0S00\l -Lp@P`WV 000CW`K@tPuZ UX`yoXpWZVX (00S@ md  -LMp`p@P qV i 0 0-t0L0Spq p@Pq0T0U0000T -LP  00SR -L@pP`\T p200CW `20SWD200CW @w$200CW yUV UV P@ 1P @1@T@ ZZP`!hpP`qXUp4q2P P AP!XT 0 0S0uv 0 0S 0S0x  \p 00pWZYT+00 oi 00Su lh -LMp`P P 0@IP9  Kiop@P(q&V 0ATP 00S dP@P 0p@Pq Kif 0 K T0PP0PP< P000S SP000S00(P0000000   -0L`Pp@P `VV'(` W  00P`p0@ 0 @ `000pW 000( 0-@PL tP 0T T00 00C0 R( 00C0 0h 0( p-L@Pq P`pp P P@P40`0ps@Pp P P00 -L$MpXxWv`#0S PHC0S <#0 QPW 0L@ P08 40 TP ~B0S ('@ T T "06 P P p/ PB0* P 000 ,0 py0 , 0KP0K0PK`p@ !00<0  2\ P P=tA0S9h!0S5@H 00D @0  @P!0S !0S<@0@X P ` 0P`@DTʵ0@0Y@XW<0KPp2D00S 0K8 K PP*(K,x -LMpwx 0S P#0S t3tC 00S@_ 0drP0p , @P0p PA0 K  00 ,0 80K0KS0@K00* x @0P`Pɯ`V* @T PXW5p@q P P`pR0gt T"@tTP`80S4!P00PUo-c  8 TPPx1@Tl0ST!0; Pp@@G41P`@ @ P?P`@&0K3@PpA00S ( 000K@P*00SZ 0 P` D@ P P pc(Ko(K,Tx -L MP`, EP,0@cT D dq~@P X(Kopw0x0XW0@,@p(Xy z  V0 U00 1 ,0@c 01pP`q @,0T (1(,0@d@ 0@7pP`q XW 000S (Ko&@00CT h00SeD0@@x$0 0@@(K ld p-L`@PP  P p #@P$00S ph -L`ppq|Dp@PqTh 0AUT0 h(D| -L MKy*K  K p-LP ph P`pqP0  Bph4@  B@PQ php`  -LM`pp@Pq KP |00Sh0 W V @P,0 $K!uK||P\0 0TSP0 H0 D0 @0 <0 80 40 00 00000 @00d00S X00S P~0 @P 00 0000000 0  -p堀0L@ PP  `P Pk `A `<P`@, Q-L?P=0@P60 `Cp3 PP 0p V@P  @P@P 0`d0`FP@PZ<0000Y$000C0f0@P, p-Lpq0 @PP-p@) 崠`t T 0 @P00CV]P z@P@P0@`@40W 00 X`@P, -L0<0  000 $00 00 0D  -L0<0  000 $00 00 <8 Pp-LP@1 00S PP@&` Rڔ@00SP 00S@@P @0 R 4000SP@p P-L0P P-L@ P0{P  M-LMp020 ` @0,K]P W @"st VU`@p20S52 0@ ,PK, PP P% ,0 S P0P,!0 xA0,0 ,0 SPP b@1 F(10SXX 11 0,K,  &PPp00S 0@0@0@Tʔ0Z 0$K0 0CjRh`0 0\0L0p0 0 0P  $Kp@, -LM0@`p P@D\0@@0@T (P \ 0  @ -PLM@`pS3 R 33\ ڼ0Sڰc000S0  R0  RtS(@K  00$ !@ p,0 0l0 0`  u0P0`0 2 \0S000S0 2 Ÿ0S#ڔ2 t2Rx2  d2 0TP _TPP^@20SPPX_TP@` _RP0P0P TJ10SnSSjK11 1 1Q0cڨ1!0\A1!1@ `S `` 0 B\AQL!01`l  @0J$!00 0S10! GP`F(V(00S TP 00S STT0  0 P(K0@i -2L M@xx2 0 d0dR R `, mH"0D"S PP(2  fP`p4 04 p00P`K 00WH 0SDPP PpP3V!p0x!0S0Wp!0d!ӷ0 P#D! 0P(!0*!P0W!0P P  P0W P, 0iSɟ@,0Y| T0  000 @ `@HH0T,80 0i `0 (K -qL0PS`@ 0 2Pp1 T 0P0p@0`$0Q 0p00\p0p 0 ?R\0X0 00lW 00psp3x@0 -2LM0PS`prp10S' 11 001st TS !0S0S1 @0t1 0l0 L1  010S (1 @ T 0S0S: p\ 000  P`0 Rh0P0 RQ0@^0 00 04 Q-LP`pr1P PU 0 S0S:Q R`\ x1U 0Q 00X@R%Q#@tPE(`@0 0`p9pq7  0@P Y0$X!QP"`@0 0`ppq 0@P U0T 0/`p$$0S0  00ed 0-T@L0S0dS0 PP(000P60008< -2L0`Sp pq WVP2 X 0S0S:0S 0S{ 1X1 0 0Q 0 @0S@T6S4P[1刡@0_0@P3pqI  0 W0V  0U5T30@. P'0帠@00@P Jpq R 0 U0T 0 Z <8 -L@P`p@Pt 0u 0 X00S L0XR@P*TU0@ 0 50SP, -50 S  RPa0@ S-00LA0@S0?@8 0-L MPP @K0 000K0 'Pp-L7 $P'.P ^P"L1L!@00 0%VP 1 !1L0 0 0  P- 0s0sph0^ ND3s H3s 0@D3HCP0 d00@#L3800 `P0 #P php@` DL| -L M@KV0s0s ?00@3KP -,0L R000 @B| -,0L R000@@B0P 00 P Pk 0 \ -PL M P P"P00  R 0ShX0RH0  80< (0K0 K0K0 0K0K0 8 K p -PLM@) T TV\Q@p ` "00C0 S10R!@œ0,STT901 0b 00@0PK  0Sp` T  1` @0|T @K aT @K ,0`04 0$K$@ K0$) -@PL Thd0 \.X,T*P(L&H$D"@ <8h2XP6 P P0 0-PLM@& P P*0mS MS hS =S sS wS pP hPdP`P\PXPTP@808 0K10 SK0$) P-L800S (0 0 h| -PL M0 " P P>00K.S K 000 0S0-0S $0 0 00S00K,@Kp   @P0t @0S  K0 4 CK,0K0 K,HP -PL M0 " P P>00K.S K 000 }0S0-0S $0 0 00S00K,@Kp t  @P0t @0S  K0 4 CK,0K0 Ktx|HQ PPP0SP 0 - 0P$0$0S0S -Q0LM00SK0 M K -Lp@P000C0 S @ h,,@0`0 C0 ST m@DT  0@TU0 `0 p-L`P@0-S000C0 S ph!!00 C0 ST00^ap -LMK  K  -LM 0R0*, , 0* (0 -0Lh -LPPM0 pb @`V0@ , `,KWV0  , <,KM 0S SV000S`B V? i e fV V V 0 1 0 0s03 V V V&@  00 0FSPV V V 0K$ KD$0S0R90S V0V 0= @00SSS 0010,K0,0 -V 0 \0   000CS̬hT K<Lhd -@LT`p" |0pP@W \S0 S@$S X P 000S00 -Lk@0  -PLM8 B Rp,Kz 00S S 0 8K@|2 @9P8@ 0P `!80 %5*$P  P P+P -PnP! `$0+SX080 u!000 o0Pn ,80 0+S6!;,\!0Sn`z`@^PPh4K4@ `P,p 000CS;꼱رX X@ 00s03X@ 00&aFQ 800S8 80 S  0P 8 800S\0P8K @0S,,P 80Pd(K< S 0 Q $ 0S C  -dL`P 0SL0  D@  R000 $@$0TS -p@!`PL{PQ s 0n 0i -LM d 0 K p-LMP`d@002 0@?Kp'@B -LMpT`@@@/0 P`G -LMKY K -锠PLp` 0@SP0000STT0ST0#S T\ -L P P Pp h -0LMo@p@`!0K!PK N 000ec@PV-00e  K -QLM@Pp@tPp0%0K%`K 0ڐ00 f0@PW-00f $K -QLM@Pp@tPp0%0K%`K 0㰐00 f0@PW-00f l$K -\0\0L@S L0 P>P p> 0 0 d 0-L L0PS000@00 R+0 P00 0 -L@0@S -LMpP`5K+%P0 p`$ pnR sR dR @`0@SP  U 06L`P K 0-0L0PS@ t00Sz P0@0S @00S b$00S0 Z0@d 0-L@PUD 0 0` p-0L0 S P` 00S 00S /0@@ct0P0S h00S ph1XJP0 @@@ 400T,0 ph8| @d -0LM0  l0 `0Pp `K  0T0EPZ@PCd p3 -LM@ ` `\Q  0R QZY!X11: \` 80K@P8@ 4P 0` ,p (p3Q 8 00 0 00 00S0!P(K -@LP:F00 -0LM0@Sp S00S $f 0PcP@`0 ` r 3D@P 4@PE`U p p p @00C000C 000C?001 0@-<0  0h0@P4 p 0q-  + Q 0%P#4p@q 0Q 0r S 000 )P LP808 PHZ0P:jx #(0$0 0b0c0AV@8  -p0p 0LS@ 0@s@3H0H0@0<0 80b0cA6$0 @8 0& -XL'P@L#D <80400,(0$p8@-p^ 001`0S10tu 0S 0Sqr, R*Q'00S  0S qr 0S0S:\^00H00S 0S000s3 0-L@P5<0  0S0S0 R0 -0L @p30S -L h-  0R 0RQ^  QP 0 0S  SR 0 0 0R 0R 00 0- LP@ R  0@ 0 -@LP00h$00S0 0   -LM@QPp@  PP0T0 `Kp@&0P@ p 000  0S : `0R  T00S S@00S 00 0 0 B 0-@LPT 0S$  0 0d -L M 0R\4 0 ,0 T  A8 0@i{ @ip4K0PO8 a# U  S R 0 O4K0@ 0@ U S4Kp0OP` U 0S, X D0,@ 0h @ @P(K -L@MP`X T0 *@P <` @p < P`00X r T0s  T@0TX\00 Q R` 0@0C 0 , K00K p 0@, K00KJ p 0@P`wx R@0K0S @ 0bS0c S  0PB0SH 2Q H l20SHH  S H  H QH ,B00SHH H-@L H@D ,LD 00K@%P  AP 8K00L 4@K @2P m` p\XPB H008KL 4@K@ P3 PQ 4H@8D00L  @"AQʸ00S 4H@800DL  @LD QP 0 `LD@@(K -L4MP43@(3$H D @ < nPzP Z 08 40 `8 4 8 4 V8K0`2pq tu Q P`2YXtu 42 0@_` pH D *tu UT@P1 0@_ QP1 0 QP`p` p`VpH` Dp t u  80s04q 00 4 U80T8@K0t u U0T00" 0 0K 0 )Ph0qr ,0S00S0K@ < 0HK@K 0(K, -LLMvwJ 010 @0R0 , (Ko00S )np@Pq f, R00Sp q Q0P 00 V58 00CXZ (Kon(Kl  -0L0@SBPTpW"0000S `3p@tPq G`00CV80pl  0-LM K @K0tu  0K0 -0QLMp 0S#BP 0y:*R B0S 0S"0S002 d ZP\B0S vH2 00S 3P `@P1p@Pq}@P$10S S  1 ````%vV@P 0@PLa0Z c@Pt u Z JX@Ptu t,@ (P u(8$,K  0pP h00S00X0S  D0,K * $0P$K  |   -L 0 0S0 h -<LP(h 00s030h  0       000 000 000 -LM0 $ KK0 0 TP$ K -@PL \TL h -1LX@ @@ _> Q60  @`Pp0S0S 0` 0?0080  000S id@  -LMLp`KP p@P0[SPKT[  - L( P00X MЍ -0L 嬟\C  -LMp@ኰP= 0S<0S S5 ┱1 bP) 0B?S%⇱P (KTP P`$KMP  $0SP(0V`U S0S P00 K -L 0KM#+ -L@M0pD[ ,0 OZP,;@T@PP :N@PP> 00/P b@P{>0 #3 RD K∣L P T t3 hh0o,PH 0  0S004P !PH 0' r0 S@ 080 4@ 0 0S ,0K{ 40K,K80 $PP0L僇Ir@P 0`D0 @@ `0L"<0 T@ 0 "@P" TPP 10S L  0%@P t(= lR/P/N/d000<: 0SLʘP 00@ 㳧 d%Hd0,4"40 0  000D0(K$0Dt8(40<$)| -H7LGM@ǟM pK,X , 0 gbP] LP 3P2 2P4DP| IPnTP5 PPt RP~UPl aPy-oPx gPF cP= dPn=iPg lPigtP rP sPawP) xP\90S00I0S t0 < 4K0 婁40S t0X :t0 *000&t00t0;4K0 勁40@S <1:\pt0\@ 04K1 u40S t0h 8t0@0t080TD00 ~0K8K$,0K7 PK P1 P' P( Pm@P;  Pg&P00b P@  P9  P$  PY/PE PS;PE PNH000It00t0;t0 Bt0@00S 90060St0 < t08t0000 00##[L t0 7t0 < H D @ t07t0 80H0 t07t0 80D0 t06t0 80@0 t06t0 80<0 00S}i4K1 Ԁ40S I82W4K1 €40S @7t0l 0t00"0000 ;4K1 妀40S t0d 04K1 哀40S t0p 04K1 倀40S Dt0` 01 !hpn 1 0bS mK1`F@`FP6P  @K P 0, /P E0-S x8 t 뮥'(x(<8 $,0 <4XpA p $) -LM@pPg j`P 0S nS0oS` =$PP00 @P @Q  0U0P P00 00 X 0000X  8U 0 D00 ,KC, ?R0S@pD0"S4 0`8@Px p     -LMp`یP@( P(K,Kr  0mP(0S$KMЍ -0L 凛\C$* -LJMlTM@`p,K  弄 帄 崄 射 嬄 娄 ec0@S`X\<L D\\\\\\\\\4\\\PD HFD D $ A 77, R5 p <(, R & 87 ?0, R  "@ 0@ , R  072@w"Cgp2 @K@ 0dS$1@0 dX" 0,R00S HA:X@K$ 0  YR $R 4< 8 00 4 $R "3<0 080 ?040 0 00S <0S 80S 40S 10S|V7$ 00S@K[4S #p@5,嶍$9 K, }+InK@P@pK`F `F0 K0`$ $pIX IK@PA A 0@K0_ =Kp(Kx(++,L4,PP,A`,x,,$),@,- -GMLM\K@PJ/KJ`p$  ?Kfp 0 K h! @P 1SS1 @P`p4$P  *(K- -LMr #^K 0 )@*tf mK`F `F 00`0V1!!x1|Q * h兮,K0Kc,p0S`PP `,!@ PTP` 0 R I.K0  B4P P P 00 P|00l 0S P I.K  B0P y*<  00C0(K,-TL-C@-\-- 0-RLM@P 80P  0V8-- -LCMß@lD 8D T @ BKLLL4 @S0!P 04 H 4 T H0$2 P#|Px5 PP @(0K 4R S@DB,4[S *S+4[SL0  @@(K0$SR00 ӑb0BS|||,|||||||||P 1( K@T0c@DC*(K8T0b(K0PsD4 S4T DP(K0kCD(KP0m $CDu(K0PCg,[-X+XTP , A ,KD`pAU<  0@P e 0o@P`p+X 0 0?@P -X0 0"@P`p<$"R L 0P  0 P 0PHd 0,00S HD 0WO0 0(K\0B(Ah00 p-1L0S p<00S 00CS00@Ӥ0k{@@`P0S 00CS00Ӥ0W{@ Ppp  t00 (4YTyTpP0CBB( -PLhM@oPK$Kp 0d {P4 QP 0@ Kh0P S0h0@0[?S $P N$0 S@@R D@T,T K00B(01 -QL|MP p`Q`` ? 0 吠Kȟ 0` d :{P?4 P 0@(@Kh0P Sh@0[S@,0  K,@K0 @y{, @R, 0q,0S(K1B(01 -@Lpd {P|4 P @0 S00H@P:JP@y@`@`$P.J@@B(S -`PL @8pPNP @0S P@ -LM@`p 0C)@0S$ @P 0@P 0TZ00 W0S0( >(Kt11111 0-LlM 0@pP  K=p ,奖0: S S o3K0$)1 -LM0 p, 5 P p̉(4000000, <0  Z0 \ 0㌈0 p50 0 8F$5 0( (0 ,(Koq'(KXrdA12 -L@_d"0p @ЈPQ   )p00PP %?00 -0L0@_ d"p PᨈPQP @ Hp00P0S %@ -oLHM`PdK@ p`0[00SHP0[00SC@0[00S>00[00S9 @P3  $Kr$ 0R  0R  0p @P  $KU$ H0R  <0R  0SKEFI PART 0-LPq@P0,10 -LM ?KP@&t h@KK@ P`p$ Ό P 0U@(K -LPM p`l @` p1!o$h@K&> @ P@$ Ό @l 0TP(K -L`p@PP,0  =sd -&>LP`@/ @$p@ T02 -PLM@x U01U01`$0pK0pPo` xV K p-n@PL 010100C1ph} -01L`\@ h!&> .>C\2&0]280S0<2<0S0S00@20D200CL200CH2 0P2 x0TR(0Ġ  0SR 0X2e0`TX2h-LUX8 0 S00 _Q4H0S0?S< 0S 0S0?S0S -!0LS PU $ m  p0@P@c@@cPE@@PcPPcP@ -P!LQp$ h0 @ A0C2. 0 $&Ts300d0@D2 -LHMpD WVT(KoP! 08 @  `0 @P0p4p  V< 8 `*`, pN040(@00@P 0@<P 0, D 80$(Kh22243 M-LM@0Z P`VV`Z!0SSp P 00 ,?0"1000 00 0,?0"1000 38 00!0000g00 0`$Kp3 0-LM P @0?000 1<000!00! 00RR?000 1<00 000 000 8 -L M`Hp SY.DDwD B 1P @@ ^W 8 gEp`W`$K3433 0-LM 9PP | p0R dKKvp PY@P D0D 0;mY 98|sssH; * -LM$, ,Ka(PK0 @Pv(`\p  ,P( 0 PvP(@Q , t Tᔬ#@T$ X$0㖣#A 8 @$$KS4 484X4 -(@L |0S @H4 -@L  &> U4 -L4MD( (K8a(0@S$$pK0 pJv$P\`  @10 (p8v@$0Q( S`  $㓌.LPKp薌$0N0`0LK000 KS444 -Lr -LM1@"S92RS]2SPpL1P00 "^K`/0~p :@":0@h00S   B0 @001"0 K 5<5P5l5 0-PL@d05 -L M KP`p0 @u 0S  !$0c#!aRR pxh@0S`VT Hk@h@_ ?0_K45X555 -L M$K0 pJu$@PT`  \@ 0$0P (31P K4 -@LlP  ;Te <@_ ?0 ,Y 0 06,6<6H6 -LM,K@`0 Pt,8 4 Z  t8$0p0 `Q$ 8\PH @ @D 0\P0 PE\ 00\00 \0 \ 0\00 0 S8 Sh!0&0P0`! (K4X6t6666667707 -LMK`8 00`j80 0(D $K@75d7MЍH 0-LM P"p ANK@D+0&q P  @P@ᇔ@K0 -0LS@,h ,9 -0LSht,9 -0LS0Sh,9 p-0L@T PP[0`00ṓP@`p$) p-@PL`l l`\ 070P0ქXP@Pp99 -0L 奏 \C9 -2LM00 S Q 10S 1 o1 0RA00 0Y 0 00S SI|10S? p10S;00^SY,  0  00S$S00,0 (p0S00p`P@ 00Q0P, Z00QP0  @j@a ` P@Pchp\P`@ 00 0 !0 0 000(K 0  ( 8 l L @ ::lx:: 0-L@c@ PPd`0hV -8L$M8 0D eSH  fS8 8 `㠈堘p@ < 8` 4` 9eU *HU BUAUi00E S$OEU CUuFU GUUU LU RU IUaU VU bU cUsU lU hU iU fUoU nUqU rU|xU vU  T7uU U yU,'U $7UW00F S7 6 6R6 0 00C00 ,KҔ, 0R& P00R0Sp AU|6P\&00X&& ,Kⵔ, 0R P00R0Sp655 @55 @5z%00%0w5 q5 @5<0F@j 0L|5 ]t5 Z8 Z004 80 M4 04<@ 1Lb0$00< 0A4 ;$0 $04 @4 4 *4 ' 4$00#4 $0@P xP0\P00DK*<4 ,4@0`pSp@0 @DH$4@YpP3D 0c40}@ T4z(3P)`pT@P 0 S 00KِP`0S0#3 GnPP  (,lMPU< @R@X00SX00SH0  7H 2 0S`"0000SH"0000S 10ShdBd\RL2p` 04"0QP 0B1 *(P !<*!)Anp`0Wt10S 0X 10S00S0  X\p3 0P @P PMPHx@U0 P 00S0S` @ L x(`l   :| D t  \C:< , H  T P  $ p   ::;;X A77HB$),; h x 8  C\  00 00P$ 00C0 R0 c -LP -LP@P-  p-PL0` 00 0@ 0T0000D S0`8``0 0 0S0ڬphp -0 CR 0R0 S>00 -h1L0`SPp@DV@<10S T (10S x>@00S T 00Sc>@T 00Sp`Q>Wc80 400S h  h:>H CP B<  30S:S0S6R) 20SQ b 0R20SR p2 2R T"p2HR 0R08 KPK:h D2b PKR8 K-_00C020S 0S0`KH Z\ 0S00R0S QPK000`` ``` `P 0S!0S D10S`10S h10S`@% X`"`0P d 0-d0L@PT 0P<00s300S @00S0d  -LM,Kp `P+ |Y Z [P Z N UP!Wt Q,00Y Z DPWt @,00?, ?CP@OD⍏H_E`VZ -GML MPPMK @D @Dy}PppKIJP`0: S, KpP  S`,@K P pP |Pp  upP'6`,@KLP0  @P@yPP @䘸@00 :n@P P匸:00`P T00SH :@0 P$T{KX=<=p = $) -LM K?`P?pOC 0PPZ P tP VPpOD`VZ| -L`p"88P@!hP aPP fPtP vP0 P0 0S$0@< Tp0@d  P00S +\00S P00SXe UA oPP@Px(  d =ApMЍ\ -L T>\C -LM0@00C0S0@0K 00#?00S  %$x(> -L@8P   00A SQh.  $> -L@ P   00A SQh- #> -L@OMpKx ,@ xRE `,@K6mP) gP! lP 9P,sP oP& uP xP! 00000 0000 e k  X !K<P/Pl -Pd P\ v/A >|H$?\ -LM@pPg YU`P 0S nS0oS` =PP00 @kwP @Q  0U0P P00 00 X 0000X  "U 0 /00 ,Kᩌ, ?R0S@p.0"S4 0"@Px p     -LMp`AwP@( P(K,K؅  0mP(0S$KMЍ, 0-LM@PP 0S 0K8 2ip$岅 TU8h -PLp`@0 0 00@ -3LM@4(   PP @TKP0C!0C 4? @: @T 7 p@ P :PxU+)Rp10!NK@DlQ@D0d!SL-0S Y 0 /x +x0S-0S KAYA xxdU R@,K ,SPx ,0#4 P ]   T6$(Kxd? d $?(?hWtK0 #$ 0K\ K~K` p-LM@KP`d Kp@-P`pP@0000100 "#  010 " 00000#200 #  000 " 0#1000 200\x0@0P0x010P0x "# R |0100#R0|0340P0|0#20P00000 <- 0@0#1C0T\T00T00@-@P0000 "  010 " 0#100 #  000 "  ""  020 " 0000 "#  010 " 0100\x0000x " 1 |0100#10|0#10000000 <. 00#2C02\200200@-@ 0 010 0"!#1 010 0""#2 010 0"##3 01|\0| |0 01|0| |0"!#1 01}0| |0""#2 01~0@-@ 000  |\#|0| 00|0@-@0 <0b0  |\#|0| 0b0|0-   00|Q"Ġ|0 00|0|  00|\"000G-Pp`& !0\.@0 .Q@ TPG@ G-@pP`&! 1B$0l\:  !0LJ$ ^: 01 @ 0 0:#P`@G0@-P 0@C0  # 0"00 "  \0 -ML M HK00 R)0[H [0 @0;KH K)0K A 01 R;K KA00 R02 0/K0S0H4 =K0C/KSY0HK 01 S20>  KK-K?K@A BMK@D% KK @A#mK`FK A)}KMK@DpGK A'KHK A+K- K%KJ@A1]KBPE >/MK @D%-K B 3mK5 K `F@ K%rOK-KA  RK04ş,"00|Q"$L1,"0  RK  0 0|P"0-MK@D0 K]K0 PE+-K B K K@rK!MK@D5KA;mK`F K@K  KI 0@K yXK H00 Q9}K`KpG_KROK rK oK !MK@D p`@@ TMK@D!-K BX}z@v@rT-K BChe@a@] TMK@D!-K B,QN@J@F2TMK@D-K B:7@3@/dT-K B%"@``2V-K B  9MK@D;mKr/K`F7 K @@ 10 R7 K@p rL=K!00"0 0#P1 1@0 R(KAB M-VMLM@00 Yp @h?XfKPa 00 P 0 Q 0 @ @P 0 0Q R@K 0B_KQboK` @ K 0@KH@K`KA 3P ?  ?  ?00RP` 0@Q5 R 0@Q(KC -LMpK@JK‐joKP 늏K J= C HP C 3  ;  7(K -LMp`ᨠKPOK  တ&  "JK  =   j_K 0-OK+t ',#  2  2 2 (KE -}P`L@    h 0-L@P ,0h -LMM KK(@2 " P" K(@ K(@}K! K(pG(@OKzK,(Jp0P1 @RO V  eP00pS`` P ?X@pV Na{Ix(JJAMЍL 0@-<1PR P @ P \ l0B^ ^@51:^1@3:4SD 8#8S@@@  <,4$ !4 $X$,,<0  0ASP 00b008l-0000qS00l0 Q000S0 #h00S 0 00bR 00\ q00l\8 P Ptp51PhP  (PT$P0P 8P40,($hK0TK+`KpKxK p-@L M0KP`  @U0S =VƠx 8 l, #44,< 0 8 , #444 ,<0!0000Kp|K8D p-L,MK0 ^U@|0TP` d8 <K K$0K, (P $ < 4@ 0@ @@s|pKpK -L@"000 0BP  0;0K8 -0@LP p `  0B0 S` a0B0SW`BA0B0S7`BR^ ꌡȡ †  PP2:0d0 -X1L M `R R p(} p @_0 K T \  0h 0`PU U'@ $ d 0f #<4!4"<00P0l0 P A PLT G Ri>i"B -QL@B <84!010S  m"pP WP Pp0 CS   ^P` W UpZ t0  CS @` VP<00S$ W 0"mN$LCBhW p-LPL`@LD8 T0$ N phC4L@L p-+QL M`Z  QW Q Q;0QP -0AS4K2Q1H@K0P WS1\%  0K1 DS@PP 0  0 at0 h dd0 0 S L00S $ 000, 0S00KpdLLhLL(< -LM` @ Q (Ko]Q X P e (KoN 0\ p P , 5p P,p @ % Q Qp QP Q Q,   Q Q 0S0S0S0C000  ^ P @U@00R F |T pB0P0; XPW 0 0 0Y $X $ z, R X @,  n  Q! Q! !5:Q! Q (Q! $Q 0Q! 8Q! !|!x!xJtHpl! ZX>0@00@P `@TP,(8<0 L L0 #00S (Ko 0    00S (Kot (Ko (KDLLL$M, {Q Qsp , j 0 c -|00S 0@00@P _@TP8 <0 L L(h0 BKp,LD$)4NPN\NhNtNChNNNNWNNO -L@p&.`aT cT gT 80S, 0 0000T4(ß0 0c3 @  p 330 @0`0$ 0 0`P h3lC0\S0C0PP JD3P0S(4E30 30S0C0@@ 42P0S/20 20S0C0@@ 2P0S|T20 @204S0C0@@ <2P0S<10  (20S0C0@@ 1P0S10  10S0C0@@ 1P0SL10  10|S0C0@@ 41P0SLL1`0@fS@s$10S-Q P 10SM_ Yp@&.:mP 0S 0R 0Rp1_<8d(@Dl4,4O P0S: 1 `00 0PPyYR* `0S 0S 0 P s80S0C000t-p0@P0T:&(K$tQ4RLRO<R,RS 80SHS4`SlS -PLM`'P4뤒2rR@ nP TP dPtP vP qPX2T2@ L2H2y@@~"#2p 2P2A341pPk p1`e0@SZPP P 1 eP> PQ`1tQ R d+H1p< 10SZ  0 pgeT T T T" T  TT 1T Fk0 >d0@@(?nx(@84,0tSA$|S4S4Q$00S P"!P 0@-p0Q h@ .P0 a#2 B0L0R00PL0L OQ00B0JP $ V-VVV P-L   <4("4#6 / *h\ -LQ 0S 0S Shԣh=0 W -LJM2CP8@K Ծ 啼08PKS7`K00[S/0[0SS/0[0S S  Q"[-K04"48#8 0 .K8KT"SH <0 K$dW -L-KH $M0R 00S \:0-K0 KJ p-L`!\P@+0R0S   p X0S 0,($  phpV-VVVlW p-L^P@` !^p0S 00SS 00S S 0004"48#80   "10Q0S T@phF800S (ph=0 ph7$)tWP P P !P($ |WWWWW,-0 CR 0R0 S00 -PL$M !P   1f!1 R10S PA !P B P !P" !P6 P  S S0  00S00S Kh~ Kh&"P   KWWWWWtXXX|XdXXpXXXXXXXX,hWXBC -L ?L0SPKPP |2P t"0 S00`\1T`ɫ"0@LK P KP 0BP0 P R 00S S S R  LPP@c=PP0 ?L0!S V X LPPz2D @շP0 L@P #㕷d1PP0SH1 u[ \P ^QDZZYYY@Z\Z|ZZZZ[4[[\?8S[[$)[[[[\D\T\\x\\\\H\\3]\\(]S<]YH]h]]QH[BC?X[ [?D FB]DDF]?]^<0s< 4 P  F00 S 4 H@ @0S 4N00S0/$@ 0D0 H0 YP D0SDH0S H8Q0D0 @0@a@J̪㴭P 0P0 뀑pǏH B8 "b0OPP @ $p@4 MHpPP `P`U<"0S H0S T0S#%# "0pÏ0S0S*+oP0SHA20S/ 20S+2R&Q$ 30OTS (30S(3#<3# \30S\3 p3  3nPQ YM/3qr P0S0S0S 30S 3|m40SDP ,p02 2 2 P HgP \ ]<0s <`8(K -LM0T ,0 X \$ dN@P X70S,080 (ٵPH  0 S H$ ϵPD  0 S D$ C>K0C0CLD `4 PD ,0X$:̵P P婩L姩,0X$JP|L x JP d JP T6@ D\$@@pLD  ( J@PH$R  \$/pLD PD $,0LD PD Wp/Ꮅ:`ኵ@@ᆵP00T00S4 T2*P0#03V0S+ H40@0nP@@iPTT* W 0S ,0X$,0 L$ P$ FP CpL 0L4 P4 0[S]@P P0#03V0S @T 0:S+0p0@T$ :'/P# U P00S P:R V  R0305P1 : :  ` pPP$ L$ PW 0S V @@V 0S /8bP@@@`@#0S}0#U0 @0 K  8K DK0 K40KpKܕ P 00Sd40Sa80S^  [0[[(,[ D0[@[$Č<4 4 "<, 0 K0 p @P`$,0( 0( ,00 K0KK4 80< 8K4 80<p@LDKX0 K40KpK@P`$DH倕P 7Md00S40S80S  ᓬ[[0[`[ [P[[p[@[h1 [唠[lXᤀ[[[\`@p[D0[H[L P [T d4@1 D|<, ă $x q  1,(p,4Ɵ&<.  01*$t$%,.t0pOD屬@Po86D@ 00CS, Kq4L K1@P 05c-0[ [R~[Q}0[S o5 @ Ƞ,Ƞ0 4,40$0S le@T <$ 00 t`C`'D  .PP0S((0K  # -PFC`K` |ğt\hğ\pD 8$P,'CV 0t0t0S `,0KPP4ȓ0S S ß,  ,0KP |, ) ,0KPB 0RS 0S Q00-S ? tN R>dN\>0S D0S   80> 04 S< 0@ D00S0H0 PN0SpNPW00<0S<,80S8'`= `= *xp0<0 08 SLjPQ 00|SM P>0S 0 S  LA<8h= /W@P000T  T T/00P<0S0 SPP<0S 0 S ,<0S  0S DQ;0S  ;;0S q|;P @PHD0S ;0 P}Q  d X PjL 0 00S*  R'թP;,0 :)00|S m@ \, ,0S  H*0S00@:: fQ, ,0S:< @40 d:0S,0,K=P0S;0 (j0 SJaIP0P0 y@P0: S L)0S00H9  90S ?9P90S S@9 00 L90S,0,k90?Q0hDy0E,@0S,0,S p X@`T;(0/S' 0S 80S0S#'T@K00/@0T0 P@ 0TKS#0S*a0S0007 MPPX``u000  70S3 60S 60S+6R&Q$60OTS 70SD7#K07#,60S7 >6 6=aU Q&0@VD X>>4F  , `RPP@",p60S,00#30#,F-p3P '00 P@T@, :RP0S H`?840 S4 4 40,; TL00L0 Q N0S#`T0K 0OT0 P@ $0S D0S H$0S 0TKS#0S*0@0 P@H0S 0S,00#3 ,,PP)0S, , nT t T 0S,|,^0@(S吃̣ `p0Rp@h30S000@0,P 430S,00@,,P s L0S (CL K^20S. @20S D20S&,TK0S0S *p20S2#"2#<20Sl2 X2 H2`10S000#3 0C,PP 0 SD!0@10S,00#3 ,,,PP (40S0 0 40,<8@0S@ 0Q6NNQ11P @0SP@Cf^_ 0 00 FDZDD:D\`?xccFDJK   _|pDt?L?8cU$)HCH;xB--@D?ccccQXLPqFdD:8;,4JD0T@(0RtD0Sq RQSp00Sf 4 0Rbv p\ X qY <0l h lK\0Kd0 `@ pK0\K@P呅뷒 0J?@0S,1 41 @ LIP10SX1<  #tQ01@P@Y@40S ,0S40,00S0sM!0S0S<8(K -\4LWMPpP` X@K8 $4X  00KT P LP Op!xPKIP DP#xK 0:P#xK P0Bx0[S xKX K00K+P pd  PUH3 004`Q,,#30P ^K E000S  <P,ޔ0S2 IJ`P( P0S* 0S 0S  <㹈P(, <q@m@`PUV<1 0 j\xq 0040 @^4 K0@ P<B0S (0K  # mPL<HU@A@P00QS P 00S 00 RI~PP_LP [L 80K8 ,9T0<0 !(KEK\f@dHdPd4J?-?8SF[[ld$)J_HKH;Qdd -0L  IoR\Cd 0-LP\10S 0P 00S(@L00@P000 (t00S h0P \00SD@K00$0 (0  P0DQB,hJ -LD0@0<S0( p@ BF_D -&6LAM x&x60 pᓤh&P 0SP60L6+ D6<6PP464vP060fP,6,P(6($6P6PPm@P 0S 僤PP |P uPP oPPP5eP`5  BP|5|%@U00S 0@TT@L0@P 0S 4FP $AP <@p@3@50SG]4P4  40S447]P TPH4   D4`,pKH40@BS񟗭FHFHHHHHHHHHHFHH GGHHHHHHH|GHHHHHHHHxHHHHHHHHHHHGHHHHH$GH0GHt >Pd!?"P T\ (0KP@x0[SPG0x@KU @p PVG`PT=@pP 0w03T0S P X0 SpP h00S`0  (KD!jjjkBF kk k(k4kt2 ph2 R`2`2PR L2P 0S0P} 20S MPt10S 11 >1@ @1 @1 @1 @1 10S1@1 (!0`h0PV P @P< ۙ@PP 0T.S@D0P00 !=TP P00S00  V 80 = R00  00`pDFPk?4J<;? P. p. + p. p@. T\@KQX0 0X0 d!T1P_;0K 10S 00#40Sj@(K@! xどPb0S .X @ npO0S @ TC;Yt0p@RlA$)llmmhim,m4mDmLmTmU\mpmmMЍ -L NDn\C -L0GM@K0$<1 4q41`P oP !ip0 0bAS`GK0 A A0 /P : GK00 A0  A0K PPl -Pd P\ aG>K 0C 0C8 SDAx(|(m dn$H\ -LM@pPg  `P 0S nS0oS` =ٖPP00 @+P @Q  0U0P P00 00 X 0000X  4U 0 T00 ,K@, ?R0S@pD0"S4 0@Px p     -LMp`+P@( P(K,K':  0mP(0SA$KMЍ 0@-PQ @p`0N S3. P P 0 CS @ Tp@-PQ @` Q 0 CS @ Tp -L MPa0KG,00K!PU`V\2P`@R0 @(K](,<4("4!<@;S0 @<0@0 @ 0S0SP `0/  @a0P0@ (K2@0(,<4("4!< 0S 0R@P0 R 0b 0O? š 1>A\0@ (K@0(,<4("4!< 0S 0R@P0S0S* 0KppP`P0`0@0@p P`$K Pp-L@P6 PQ5 0R14 40 0R+((P P% Q# `P ,,P`@PP Q QP 808PS <<UP`@ Upp -\LMP` #p 00P  0]" 0@T K -LM0 ̠K" K -LM` 0K'4p00BP0@ T,Q a0"<4!4"\P ,K@0pW,00,0  40 R, (,0 " R:(K -LM@   @ K@ KdU00P' 0!K -LM`P @ppM o p@ܓ tP 10151m;p-ɓ0 T`  9p廓  0Qo54xLxpxxx -L M@T<Khb@D0 .@Kx  -@̠Lp`.0'.TP! .U.S Ut! 000t0 00000s03-T0S _T _TX0#0`@TBy -L M0@SHKh  P @L0i/BKLyly -`0 MLȠ ,Ƞ0p# KhByy -`0 MLȠ ,Ƞ0ɘph Kh#yy -LAMJ_K, ,KOK3Xp`P#0S @ r(P @T T m R 0SR( K0ACp <.`V440 JKp, ⾐(KdN4py p-40L@P(3,10/`@<`* V@ph$p -\LP㭉pP`N 00 @0 0@4 40 0040404 00 4 ( 0$ P` 0$  1(P(# ,P *(P, 0P #(P08Q 8pP< <8 TPU@ @P40040`8 -LM, pP BR00S ,嶆0',0tR0S (嫆0'(0P<8S 00`<S$0 00S`A<呆8< 0V 0V^18SYpla@<w01800Aa@<m, 0188P<@ 0!׏0<8 <.ꅁ`<Q,0@188وP<$ <8 彏< 8 0!a@80S1S 800羈P< 0!砏PU `W40040$npz\` z -LM@P4K 㺑0S  7 KOp0 0 -' 0SD 0S  !4@K$ $`K PP 0S -pt* @T `P;4pK@0PS 4@ UT $1 1P (@ᶅ`40(K  p (P5`P ( Α(囅  ȑ 啅@4pK0S  犅@ T<0 80Q K Pp 00\PD8, php{l| -L Mp@፻p P 84p, (2(勇@P –Q0Ka( 000 0 2K᧷p _0S [ P 2[ pLl`P q#0S @AZ0S  㤻p/ˏ @0S0(K0(0 2 PU00@0 Ǻr@ 0u0@ 奏 tH0s 孺TX=$K{|{{({ {{ |<0| @|\| -L M`*式24 PB2 @*rP0"0-p P*J`P$*0"!pP*,0``Sp! `"pP0*,@P``A0 pPv*@`P"pPm*``p(0Sj !pP0`*(@P``0 pPQ*@`Pl!׎pP``0p0H:E1=U80 80S ,1 A0 !弎pPp``+*P Ujn0 e~P @`P_n0 Z~P @`PTn0 O~P @`h 収pP 5:L P(KSh|t|||||4p||}(}H} p-0LM0@S`* ZKPE*P *S Px%*pNhP  K@*C PD%*<>JK@Dv>Kp L}T}|}}}} 0-LMA0SI GY7KA%0P0040 0R  0RP 5F00@Tl@Gt00S0@ @,A  80P& 808Q 1 0S{S0000S ? 0S  0#S ,K x00P 0@T 0 ᫆8zp` \, K@Xxȁ ,\| -P7L|M@7P P(W G w `FiPC cP dP LP;#qP2 uP&`5 lP2 0&0.0S 000'0&K0p 0: S t6t+d\Kp 0: S 440S `` &p5@ 0dSDA|eP 8@3S d@<0<+p0<@f d\ 40KzpX8044o b|EP 0嗋{DP 4PP$]=00{DP 0P 000P 0 0 㑲4p峄h hdgP\ 0S0D0@$ p8 Y (opp 0SH 厄Kp億e70\K@0@T-s*Tc@{S00SgdH0\ *pZ4; P( \0SX0S .˹dR2.p`@< ,2P@,  q᧹@F880S  -HBpt,(0K* #P Ppc0<0 PpT p p  Rp|  oph  ᦓpP kd@<去408Q 000[(K x(D `Alx(ȂdPT S 4<T`xXȃ<\H;sx̄|{@$) -LM␀pP(K` P  z@PdH (0`0 000@0@7,Pa,P T0 -LMp 0 儃,KJ;PXP; 0P P0pP ,`@0P @T T00X U R 0SR@  ,PP ,PP P;Uc(K4pPh -LMP$@Kp A?@0CS@P@ T ;P% :P0P $` R@X ƀ  @4 ;T $ @|؅ -BMLM`,KL  D4@P P0pP,Pp1@@P p WjC.K@ B B@D P$ D 0K@4H4 AQ SQ^ CQ BQaIQ/ LQEfQd XQlQ5 tQP$+hap ,K] 3@P Y,PB@0 S P4 E D$ {4KsP 4K @ TP42j  RPl  JP HR {  =P    3P  ,K !@P P1pP+ ;T] ,P|P wP0 00KpmP `hP  0KD9KP7 9 [9K00B1 } H$ H$ H4Q? H$0AS,P H$0AS,P- 2P D4Q`yL$P@|{ CKAA L4p(K4p,@\Ȇ/ (P p-LM@PK} <@0C`SZPh40040BKU 1`P40P3 40-r * oP(x$iP"x,x(xxx x8fx0H ;V oxxx -PL` {P@ . ;Tp hTx@P  0s }S ` "`1R0 Q R$"BP " =Z h 1 p400S U 0  0 040040Q 0PR40 0 V4 t  000@0@ 00S0@0 @0@000؇8( p-LM@} <@0CP&S      | 4p     80 0(@X` 3Sp 0 1Rp 0 1(Ryp 0 1Rop 0 1`2F_K,p (,2 , F_K,px 1 , }mF_K,pe 1 , t1$\1rO@1,(141<0]09.*+' P@0`|P@0`!t0`X0D0P 4 ;U Kp \`\ p-LM@`Kv 0PP 0P g {PP l ;U xP* 0s4 x}S K xx؇t 0-l@L\'@P PP6 0s S ( 0h&0H  p-aL 0<$0 <0, @ 0,4 @0@<<0 K?,,  0]- @ 0, @81 , (A 00 0   000   000   y00 0P0 P0   000   00 00 '@P  p $phB&pLH0 0    -LM$KP^ $@崀`p00SP%P `0S0S  R0d| @00@0@TV02 $PĈDj p-L M` UpP9~T 8@K u~ m (p@(@Kp؈i -L M@0PSD0 p``,KP ,@!P~P 00SP0 0 00 40  Z R4 @T,T(KĈ -LHM` pP <@K  ~ em 哫p} 2[A0ASp0@0d@K( } Gm `up @00@0 L0  K i 46i( p-L M` 㖵p@` 8PK } m Bpj}2[0 2K3p[}\ 2[ 0@2K$pL}$ʲKp i Ti  p-@LP`0@P0`p 0-LM@K,Kp|P@!}@ \ 0000000S 4 0P00 [(K0 -L444r MHKj0<@T  10]0S! 0K00KR Q0@0`GPQ1Px/2A$d0 \0@ P!H0 0K80 KK B0 S0 3KVp0#S 0S |_ 4[j3[3[3[ 10`PV 0S |00 唧d?0s 劧@5p*(KD  `lx\| -LMPap@K" 0@ 0 1d [P {@ H$H08#8d K#d[0c0K0d`K\0K 0 [0K0dKK6K5K5KX T % @ @H$H Ġ$Č Ƞ,Ƞ(K 0K$t0;x`,$3KC<  2K0K2K \P  0@K   0(K!x0K`t0x@tpxPpKP0 @K {P0K 0 0|0 xp tP  p@L{ (K p-LM0 0 Op@3{` 0K`p${TPP0<0@ `px{ 0@Kp蘊!̊ -LTMPnpK02 z Ш`PP W0S SztlP<@K j L峨P @>z@0 KlB  p-LM(R0 0 @0 K⏨Pz1[S1[SQ @K0 xPz0 kPzpt0h$ K^PzDg $0$0@$q 0S$Z 0@(@0!,@0D0D0,`K, (  7P_z@0< 0, Q0( <00  PHzx)0 hP`!KpqB@0LpByBfB@ gB0$?wBXvB  -H1LM@Po., N/, , xj0S9 1 "860 006. 05WS P6s0 P% 0` ,U@@p@  wPd0` ,U  @pWNY, 0 @ 0·p@(o7 -L$M`Pp@K2@00B1S^3\ c+, w,  KiX  0Kw0t Wp00d @^ypp 0H`p P*P`SU ,KC(KdN -LMpZ@`P & 7yp. P!P`0`01:(@T zP0  0-Kt -0Kyp`p P *P` W@:Z  yp(K\$) -LDM0h PD)oyU,EhQ ,yU`  U 5%1 @ pX`Kd@ \ ` 0>p P!$W4N dSSd 0A BS@ AS?IS6 LS:3fS5 XS eS26lS) tS-#T d p Bd '3 0s \ 0 QQt0:p@p0` p @@@\3ho 0 ST(38 0T00w0S 2 0WqpWڔR 20C Wbp @YX J SQD IQ LQ0 BQaLfQS XQ[JlQ tQVh 0Q 0Kbv0 "0  4KWv4,<4("4!!< x@5 8KFv8,<4("4!!< *K7v"[04"48#8T!w@@!8!00$!$S!0w'pP$d0`:\Z`P` wpP`P`dZxY `0wpP`P`Y)#x(Ks4pBԌ4X$)h\č ȍiL - LM, [W0W , S *P0S :\1 ToD1HjJ,!100tS  RPa 0 BS a0S00 n@P m  u000@Pn@Pt Z  {u vu0 00 k@0p,0WX:(K4p(P -MLM2@F pR~2`8Px$ H0Rt1 10Wl Q^KPE+tw 8PMM.\P x6S 6S 0  MP 60p@ Dx6S 0S S SP``P`P`P PP` D0 S0PP0``&@nZ 0$Kp VKA$ $akNK@D[@[kT KPt|M  -0L0 S 00CS00Ӥ0r \00! P 0 000p0 T0 p LPQ(0  B000B$[0  -PQ@`Lp v v v0|0 `t0Pp0pl0 h0d0 `0 \0 X0 T0 P0 L0 H0P [0(,8 4$ -3LMؓ ԣԃp@ 0`bPep 0  0#PWp P "P9X3XPT3`L#Dv@8@`"U00ST P@`\U@@ V 0pP0$T2 00d "ާu 2P"2堂 \00A S-Q5T"d2PP"@tH@ @00S (%u  / + K$) --LM 0 dd@ tXL 0S 8u0  ( 0S<-!$)\C0p@-@P` 0S400 0 CS @ Tp p-P@L`{P00#S p 0S10'0 S #0S s 0phv00Sp4 -00|0L0t3@00 0 ᤫp 0S s(0PhkLd -LM@P!  }tpP 1 pp`P@PV p0S K脐 0-L" @Ps00Pʶ 0T  sp@s40P0 0萐 -LM <p s@q귯K&. Zsa0( K`p2K1p2 ڂKp1  1@8PK(K Lp Ђ P >s( K0(K 00 0PK 70K@P <@ 8@KHP D@ p I0S7 Er'] P@ &.p6rP2[S2[S2S2SP r\u|KKT,P@ @ ,(KLT(Dd -LMP 00 X0  K0IxprA K -LpMh0 K 0 %xpĿ`r Kđ -d0ML K .0xp?r` KБ -LlM@d0K@ .0wpr=K, -L$M0  h0  $ $K  0wpXq K<X -LM K00.T0 0wp7q Kd -L@M pR0 0!5  ϩpq`@K@ q0 `010P ,` h00KPKjp  @q 0K  0 K<i@ p-L@M` ㋩pPӾoqPX@K@ q0 e0 @0000\H0K)p 01S @ᮾJq ǦKp蔒i Ȓ p-L M8@K` xq0 `0 (0 >pP"qL @P@yq ᒦKpi  p-LM K P bpl @d`00S  P0SqP00  @T Kp -LM` p3p`@E_K  q20 1KKK0N! P @ 1KAN p @0PK pK1^ 01N, P @ 0@K/Kp0 @@PK p0"St T@ŕK0 -LM@,KLT BTe ST lT` A  @ A @0KP0, 0p0PA<0@L$ @@80L#D< @@40D#L40 0@@#4<$D0 0L@#<4$L H@$4D@P`$<p80Kj@P 8@ 4P gk(K 0-LMPL K@~P<8,<4("4!<@8X p-L@`PB _P. PU4 2.P UtZp/P XR{pB <P 0 SpAjp脣 -LM@0PP +;U$ !P:`&pKP PU :P`UcP &K j:V  / Ḳ|؅ -LM@P.`(KB pP PU .P`U(00.V ( p-LMPK`0@P T;T` E`P0] @Pa`x, -LMhhqP8@K`_@P`0 @0O蜚X\`1 P-L`h 1 @0Q0S 1 00P\DX` Q0DQD0 Q@L00#bpP00CS04@030, )0@0CSp0@0 0@p00 PP \, 0O00D`X\إG-鄠儐Pp0 0S0 0 BS00R \P@`Ah x l -D0D@00  R P h p x  p-P@0|`00t0L@l0@d0@`0@Y^0@0CS0 @@00 ph!px l p h t  -1q00SL.@`0\0 0| P+00CS0#@0g0 0P0CS 0`@0U0(000   h t x  -LMP@0 2jPB ,K A@P ;hhhrhb`"PYm 0 P40S0`00DP, 000S SPp PiP aP iPTAZ,KPPU 1 ,0Q.0 Q@L00` PRH00CS0<0A004 U100CS@ 0@00C,  f@p0P@ 6 Pn P \0uP 00S Pp(K  B4 B  -LMP0@ T T.YpP- 弐0帠S0@0*@P`P 0S  0~  0p3PPP0T@     -0 CR 0R0 S䉿00 -@0LP`rPeǓ`Z !`0Vh `c0SUJ L0SF I0S\\<@U`T xhP 0`!Sb/*0S@,0@00US80800US00`zUPX*\00S` lP  U 0@0^S00\P0SBL5<C@ -LLrLLL`~@0S 00CS00PӤ0iPuG  Q/0 Q@L00D_ P00CS0^A0T0V S0`0CS@ 0 L!0A800 S0!00 U`!00000 +0S0#3 PP 0S0`00F` 0S0`00<V @V00 00 0 <0 `BB   8 dX  -3LM, 0 0 S@`TA3P, `3@, P00T$00 R0 Ch"000S 00CS00Ӥ0Ꮂx0S0  P 0S0@ P X R/ڈa刡0 RP\00\ Pld00CS0J@A00B o?0P0CS 0P00^ X00p 00S0#3 dPP 5sW d0 00l0 pD0 00@00S <00SWpGpB|     -L M4 pRŸP2 0A`00 p30!00P PXP1 dP00CS0W|A0^0O L00CS0  00CS@ 0 "005"0 0Pp0L0| 0P:Ad"0S\ PP_$2 , Q#0 Q@L00]V P100CS0A00CS@ 0!0e0 0P0p,00Cs,0 @00p 0 SD R/ Qa0 R@L00V P00CS0+@0*0# V0@0CS 0x@00P0T@ >\H0 p000%S!S     L0  -"LM00 S2 100 r 0 R R$K!P\ 0!S 00ZPT`1$ ΉL1$0 S8u, Q. Q q0K00U`P#a00CS0.@00& &0@0CS`0@00h0H0$0 $ 00$  Q000 B` t -0LMP@( pX 0@T@@T@ET P`P ` 0S  0i  0pP  0T@4    -2L 2ŸP pqb匢倒刂00 QP0@.TR 'Tf $TL  T T%T,Te +Tp 9T0T1*B?T@ ^T ;TdU!0   r 0 R00B S  1@s^T-T`Pt 0^T-T00PS@  1@s 9S6 .TPP00S. /TBPP) 0T00S 0000XPPS 0;T0 0 0\ P00wPP U(00S(8PB4     X -0 L`pP0 @000 00 ,S;S;S "PD 0S0S0 000S 0 0 p4      -Lϟ @ t 000 Tpo iT  &WT HT ET !T =Tb TGTbQTt VT^ PT@eT cTI |aT gTP rT mT kT9 dpT UnTvT< tT *xT P:zTPD0 nR pR lR 0P0P00PP =  Q Z,>0S t>0d>PuP0 nR pR lR 0P0P00PP 8=  Q /=0S ==PK==]PAP0 nR pR lR 0P0P00PP h<  Q <0Sj <<VP,0 0SS0|<0S <0S* t<0S r ;000 <@P P0 nR pR lR 0P0P00PP 8;  Q ;P RPPP0S!SL +J0S0 0S @P ; ::;0S0 re X:000_ P 0!S8 ! P0 nR pR lR 0P0P00P\ 9  Q P0S+ tJ W9`V :PcGTPPgTPZVTP P0 nR pR lR 0P0P00P\ 8  Q  P(000)90SP0 nR pR lR 0P0P00PP 8  Q ) 80SP0 nR pR lR 0P0P00PP x7  Q x'00cS0 d'0S XX'P0S000 nR pR lR 0P0P00PP 6  Q 60S @7@b(7PP\0 nR pR lR 0P0P00PP 5  Q `D60S 66P~ %0h&@ 0R P0 nR pR lR 0P0P00PP 45  Q .5SK5ePI 0 nR pR lR 0000P 4  Q $5 55:PT`pP40Sc @Ti40SeV`pT P0 nR pR lR 0P0P00PP x3  Q 30S. s3P( 0 nR pR lR 0000P 2  Q d3 \3H3P 0 nR pR lR 0000P 2  Q h2 220SP0 nR pR lR 0P0P00PP x1  Q ?10S |1 Rt1 d110S 0 nR pR lR00P 0  Q L10S d10SqT] P7q 0000 10S1  1 j@P# P0 nR pR lR:0P0P020P Bh l (P\C8( x(L $  X BԧLH;l hb    d24   P 40  Q 00S 0S0!S+G0S0S @0P 00P 0 @(q0Q`0gS  S &:00C S#pS rS`0`0`0`0 1@s|P000`00V SV 00 S20S< p,2  1 0 S 0 Sl lRV000x2@  z@P00CS0PB00H ERT P ,L3 @ #00CS0(C0h0VLL0P"P3d#0 S0000W0#00#0#00# 00 0nS pS lS0 00 00 0 0\ 3PP0 nR pR lR 0P0P00PP T4  Q 40S 444 oj4PD|P40S$8pW40SD/P0 nR pR lR 0P0P00PP x5  Q \50S &50SPhr0 nR pR lR 0P0P00PP ,6  Q /PTRpqW QWPl6 P|60 r 6000`P8 60S6 R6 6  6BP&0 nR pR lR 0P0P00PP d7  Q 0S0!S+F0S0S`7WT7 70~P8(0P00 0S 80SqWP@80S^0 nR pR lR00P 8  Q I 8 8 P010C0S  I1@s P00$ 0 nR pR lR 0000P 9  Q Y9)00Q0 mP0 nR pR lR 0P0P00PQ 0:  Q .L:X 0S<:d:;Mp:0SPEP0 nR pR lR 0P0P00PQ :  Q  \;e;$;0S0 [8; @; &P X; PPx P -LtM d U\e\5\\\\u\U@sP xP pP00 @ , 0 3$ p0 10 00b0 0S 000-S 0@S@ʜ000 00C0 qxTP@KhP0: S  0  01TP 5OLIF|@P  q2b#000S 000S 0PT30S 000!S 0+H^D0S 4 000SC 20SsRbT0S 6࢟"P   PB-"0S& 4"0S"ls 420S  l2Rhd2 0 L20SD"0`004w"0@0v"000 S 10S!@0`00[@00@P @P  @Pt t t$ GGPpp  X (( -L Mğs@, 0 40 0&S903` 0hQ0 QP\00J P{ 00CP|S 0l#0X0, $3 0P0@ 0Sv\SC00S@9S>400CS:0 2`2 0hQ0 QP\00<P <@d`,00S_"(Kl h p$)t x | \CBB x  MЍ -0LM`0p 0gSR :R'P 0P 0@ @tJ 0|| PX\ T0P 0\P 4P 0 0(,WV0\CP M-LM00, 0S  (Ko*00SP W* 01@PO* 00, 0dld0 0 S0@ `p0  ,` p(Ko\CY@̶ -D2L$M04 SP$20St!40S0L 0S0(K@ (0 S0 00000 ^t P` 0Pp\&G T4 P( I< 0 00(00 >%P;0075\+4 P 3H( 5.:0E,p 00.S.0@0K`8,0 , g bt40,0 0x 0 0E000 ?H%000!P P D(5P|p@P5@X;P 4@0H8S 40TS4T 0HST 00 R|š$0s400s030 !P CK.KI B BI`X( L(00 @0-S 0SH8SCC000S40C S;(l30S|2 g0S.*P,  @KDP @KX$#0C P *XHbPH00: S D JH00: S S0S2P" 8XH0S d"0SP d(H8S)0S @+3!0S  +P10SPɇ @pK !0pC P: ệV`<H!0S t0S<10S Q H0t\0l10  P8 P P`0S00S 0S ֪P |0S?V`PPX00S }pxL|ix(ظA$dHdp ̹\CT 0-D0LS@ 0PUPHP)PP0D00 0C0 0 -L`pP@@PHpD@ R-LP` q@0@P T@T cO0 0VX1Xq 00 @0D00 00 0@T:p VOp@@0P00 V4vpV00 0P00 d@ep _]8 000DP  O00  H@L@ -鈁LMPpH,  F@T @ )3PD p` pߏ 00;P'  gIp:0P ̏ 010P 000 <@PD`  (PD0S0S(@  g0, cP@L@ -PPL`p/ (0S 00wSp rS"ppV 000x000p000 0 0@00@ 2Wwpw6T@H@P@L@ -`QL MH p0rSwS ?R@@T WB00}8Pw 1,@@0@0@4@@@@@@D@ 1嬑0 PwS 0 !@0q`P C6TH0090` 0HwS:XW@ W@@0 #020Kt0"̠10K"$}000K- K0 ` )0KX20K/K,K+K*@KD0 . K@  < |B 08 0X  DK╎p  05P  KP  0(P(KX@H@P@T@HL@ -RHL`p$H X 0P @@ R,B BQRQ0Q@P`Fvd2TLDX@DD:00 0 0 0 0 0 0 0  0  0  0  0  0 0 0 @^Pl :d@:V}VmFP0p0`F@@ VV1E0\\0\ 0 \ 0 \ 0 \ 0 \ 0 \ 0\ 0\ 0\ 0\ 0\ 0\ 0\ 0\ 0 @`FPV 0 0R@P`Fv  9@9P[ -PpL 0Z눀H`$H9%XL\8@#8P@'XPfTPLD@DTLD@D(0U[E>^E0PEU\EPE@- 0S  00 0 0cRÌ`@0  0"0Q1 P0 0S|$x$  -0L0Sx$  -`QLp@00SP(0^ ^0 01^ 4# # !^#$""1^"4##!^#$""1^"4##^#! ! !@D!$""1"#T T $0@T0 01 #x$  0 "Q p-L`P@@Tp -pLAM0`, . 0J/K(1 |00R0@KJ_K   Pf@0    pd`0,1((K 0@-@P $^ 0 SΎ809P  L0  ( , 0 8 < lPP0P@-@ $P Q < ^ 018 0C0,0<8 0 Rp-PL@4 0@Q1S``.Pp(0 `S00`(0,0S0 ,00(PpUE20Pe$00E`S0,0$0p040$Pphp|0%0  -@PL $Q ,0S 4Q00$,0$0P $P 00  00 0@-@P \00^ ^l\P:0 -LMpPL $`VI 0S<0S0S < 80 0(K08< 80080< #4 B80< <0 S0 h0 hh0  `h0S @ 0 0P 0@P0P $P 0 S<0s3 -P00@Q0SLT$PUQ (\N ,0SK 0(! `P 4P $ 0(P0,p -<LS.Q :%<,0Q P0b0bS.00 L P0l0S.0b0S>0Wl0 $0 #4 <4p$`0% -$@L40pS` $P0 (P47 (Q$ 02,(000( PcU4:b ; (0,00 0e0`U`1`!  ;PU 4e ;(0,00P00( 0S00, (00PR:0,0 -pPL`P4 $@T1 0S 0 S+0 S  > ;0P P 00( 4Ub;(0,0e };,P0 0 -L0MPP  $PU 0S 0S0S0 S00D < , 0H0 8p<`@ 0S񟗗llllllll,8pLHH0l< y< !  ;< 0S  0  Z  0RJv`V0'!6P0S'r0$ 0SH͟`F 30 `  0 0p8Z  0RJv`V'4<'<,4<0`80 00p 0S < H  D00<`8p k 080P\ 0S  07s`0Z  0RJv`V 0 S 0 0T0 0+X0 00LP 0; 000!q`F<07s` Z } 0RJv`V@˟("('8,Rc`0@ 0p@0Sg DQ01 S@1 @!T`  Hf:@0D H0d d dD H @0Z M 0RJv` V"'5t  0 0Q\0`d 'w`FR0 0h Z + 0RJv`Vʟ00 0'hq`Fh\0Q* h00h0S S.0L T0l T/p l0PZP< 00<0h0T03L@ C 01QZ  0RJv`P Z  0RJv`V:7q 0`ah UP  Z  0RJv`V:^`a7q< 6 0n00'q`F(P   Z  0RJv`V:71a q`AZ  0RJv`V:71a  s`AL 0S \7 000 h0 0h P*d `0h ^L x:0S! S>/΅T 0 l@L0T l0p` 0P< Kl0`P00X0X 0  p0d P0< 0 h6 05T030CL01 P0 Z . 0QJv`S4  03 @C403<1 R0 Z  0RJv`7|`lS``@ 7p0  0@ L% 0H000HQ Z 0RJv`V:1H0C07q@ `a @ 00X030CP01 P0 Z 0QJv`8 03 @C803<1 R0 Z 0RJv`7|`l@``7p'0H00D 0HQ Z 0RJv`V: 1H0C07qD `a D @,0DD 00`R00< jD Rr @D0 bSH @c 0 bR a(00b@40bRD@0 Q10l@0D0H0lD0 0 R0@0HS 0L H DQC @0H AD 0H 010S4  Z 3 0RJv`V@0Dl00@0@0Q00 H0 a8'4<,'<4 <S D@  00D`@ p0 0< H00D(08pS<`0S 0@P @P0< 09,0@ pc`b0 00@ 0@0 0RV0 f q8 QS@00<`P  \ 00R40 <P<  < <(Kh¬BG-|M⠀P00\ 0 S |@0 2R02BQ0`\ @00S@T@ \0@ @@@'@\ 00S@T 0 sJ QR0Q0P0S< # 000 Q | 0S4Q 0$A\0P P 3ß(0,  (,0 3ß(0,00S0!Tp!p1' PP#0 \00LS`$P08 8  8 800@0i^040@(,Ŏ0@`@0ià0%3l l 041 R @0@# R@0B00|0 02S0C8#(@  P P@@a800@|0T"C$ \ YPi0 \00cSPR :  0<Q00SA 0P0 0pa 0bC1 0wY $ 0S0`4 @8914 @00Q  0A0000S@010p|Ѝ´~@H 0`,/MЍs -0LP00S x0xP pp00l h0hH0P DT00P<00S0  4\C|к < -L M0@S :P  K0d R0 yKp 0-L M0@SP P K0F R U0 x K0耻 -L@Mp` 36@8P@`L P H W0p&oS0000\&gS0000H&mS00004&fS000gU) PU HU LUAXU fU RU:uUrUhU% oU1w0ES- P@ L@ h50S ``V1@A8@0TS0F0H@ ` %pP5` 0bSP0SH00 HQ`xYX00HD D0 4PU5 080 000C0Sn004K 8k@f0S@8 ;400S  < X @ 0@ o8K0K, KP 8 ;0<0 ,00X @ ,0 \3@T/ @000C0S54KP LkPP-"00*0S T *400S 0< TP X0 @ 4iP\ < XP + w20S P:O7`P@.H7@P <  p0@ <0  `< @ < @   $`P  p d mt40C S*P0S  0SN 1p 0S  l(?HQd R:Z <0S00D0 0S X0PSTH0\rh D0c} 0S D0c0@ <09P LQ X RH00 X0c0,  D0P hp႘@Pc0S @dAػ>$)\MЍp@-`0@S8 <0S9\6 00S0C;ౣ;0 `\'P <3 ß0#@P0"0 PY@0,0K2D0 T` Pp /&lKA&&0TŸ0D2&0S \{F~KpGL2pG0tp@P 0FKH`GH @ PG k0 0f[@PV 0Q# 0$@P`\ %p$0R0C0= `A   x4st| @00000%0 00 "x$rt4s xt$\xt%000400S R(KpT|\$$ĬpHl~ -ML Mp`@P AK @@ 0%WV 0S:0S:B@;&P 0A.K: SD0P B< B4AK AA K ̭ -LM0  -424 0`40L  8 ;;S0 0S,0S) R'PP!<0Si & @b80 TPp<00PPPlA 080P<  80K 0SF0SC8 Z@0@0p0 8;;@TPS@ P1 \.U+T) P$80 < R B+ౢ+ \b 00SOQ8 0 @ H& @0Tp0000 0pԭ -LM@pQv 0 t0 @0 P `0O?  4D;$+4 0A40 4P 00SO0 @/8/늟KP 2-,(  80@ e  -X0  P 0S0S(K 0 0 00 0-h0L0S XX 0 0CAPu# T@D*@n#l#0000HT -@LP^#00 M0-LM0@0P0b 㙅#00CS`t#0#00# K0о  0-\0L @?P%D000S0S P 0H8 -LR,M00Q P 02ZY 0L Q OTS2p8\0@/  0@ /0@D @ /TS P20S 0@@ _ 0 , Y0 Po 0   ?< 80 <0,  ,@8< 1! 5 @0O TL H 40 0@ 9 S70DPK` P `LKpÏV@NUL@10SF 0@40  (@~Y1Y(KP $D` 0-P,L@T 0R.PT 4 0S0S: $ 00 -, 0LR$0S  0 }+ -1!0@S00 0L 01085H :`0 `\0X3&400@P&0ppf&x0| Xx034P0`0T0PP0  `$0P4A xlt|Thdt -42L(2\`Pp0 0B? PX4 1,y$PPe 1 ?1V 0 P00W0 0@0@0@`p 0$@<1 @41\%pR00 X1 # ` 0( \5 S(0 ?p  , 00` V: X \5 SX0 ?  Q 0pt0t@0Q dpd` |P`@,000 Q THT -,2L$M0P Q!0S:0S* 0|qTH0 D@ _S\!1P@PP0HKȟ 0@ < t1k%HPK`dP0 x080 4141`@  (1(14@ 0,0 0O 0Op  / S "0@Q@pΏ`p@ K HK8`@ ?4 0 0, % d0 <0X0\%L0R0<0(Kl̿xd|htPT -QLM P@"0 S:0 S*  20 R  Q 10x0Po VZ UWa ` ,` 0@Po 0K `vp0CXh Tx 0Cp`0( P8 zB0\œ\00 S 0 0 R \00O008(LRLHL8 0C 0PLH@0S00ZY 03 LP@0, 00YP{X P#L00\%0R0 0S @0 @0 0S @0@U00 0  XT(0(p 0( `08DHS000(KpLFT,$)PtX0 -LM<0@S0<000@50\%5R000 @|5`0\: S SU SX5^00(Ŗ /RHQE\ 5^h0S< 0 74^ JKQ'K,JKJ'FK0 J?K45 0B?FoKRNK@DX T K< 8 4@D`E D @e 0 X%0H@RP5 (@ \5DS8% L0/T V408040#0\P0(00s03t0p  0S. @0TS>@0` 0T0dL`DcP/0\%00RP%O0 @PEO0@TŸ0 P0%(0/p@0S ( D050 X05 HH08040 \5SU\0?0 0 A1 0<  0j0C V 0 V  V00000002@ @2P0\%2R< (8 pt20\%2R(00s03t0p  0S p00<00820\%@2Rrpo 20\%2R5t210K0\%1R00d0X0J10\%1R00000K 0$@10\%1R000D0d10\%l1R00000K(0,@810\%@1R000@010\%1R00 000K004@00\%0R00$0H000\%40R0O0 @0O0@00\%40R4h04O0@tt0 0@0 0+F60p(KU $T0 -L MW @RSDq 60S 0Sop P60SqFp L[00Fp E[000 ST6@P6 H6H=QP4Q0Q1(60S 50S 60S ?~QJE0SxQ 0SsQ b 0SnQ , 0SiQ  O080B R OT dR b \ 0#K`P``0H`"d0B !} 0/R0O?0@l&@@c0 0 0B K2@P<40S 0;0 @d4 Q PLP30ST 30,OPso/1"p@0@_004@?p8/3`"<KP@  huP$C0S ToPlP@@T {0C0S $`P]P@T {2@@2@2@20S lR@坻004 020S- <" 0S&P`PY`/1"@ 0Od A 0ZPap ,0 X1倁0qSl1  `1@01@0 ,0TQ@@0@Lp1P10S+ 00SL9P 410S00S(/P-P K1P " (0K R\P $00SP Y(Kxp|P$Lı,Ll@dP$T4LX@\\|d p-L@M P`K0S 0S  x踰 -L`pYD"DDDRD0@0[dS3 YSM NSODbS cSJnS= fS& mSB&pS yS=7!0 0 00" 0 1P(xt!00!000X >0SD1 80O 000000001 Np00PnP@en00SnnTQ  0e@DTPl0PJ<x(D |$0D@A -L M`4 pP,  0l"`Ud"0@0@Q P 0,20SM N0 }4 0 u,0S  ~P0 a!0 0S1 0 @010M0x!`p1l0 @R Q @e 10S N 0 : <P c@P000 .`0 R0000  0S0S R0S0S p 00 @0@P `JZ0(Kس@PP $)4 -LMp-0 O !S0`¯  ï^ 0Po xΟ1>0 20 P`ZY 0p>,0W4HTLd@q͟p 1>0 2 P0 `XWD lK`",>- 0,0Kp=D0 h=h͟d=  0x@mɯ P0pO`xp.0 0 ` /l} 0O0̟\% R`` p 0x0OWV0 @ / l,0S< `L0S8 DlP| K0@S\0/ 00@1>  0S P` p0@00K0@ aP0 @ `K`p` p  Bp p 0@`  @0p0  AP @  ˟0 t p 0 e:ZY P ,K0\%0:0 pWFʟ R(0 P!Xl P0S 0 $ R(p4` P   P0S 00   P   4,)0\5S , 6009I000PO@? O/ i0y\Ő@ \00T"S\45S:05S:  R8\ 0S 0 0S0s H0S Hh\\x0S \@4P  h0\%40RO0 @O0@70,hǟ`|` \u W|00 0B?QpP tG0SO S C| Bt0R 1!(0p P`@ W00S0  0SP %0S 5W1(0/1pK ^ @@|`@t7P1!X0 PW00S0  0S $0S 4W1X0/1@TP Pd 0@ 000S00S /P XV T3PDD <$00  RDDc0\5S 00   0S 0 00  e 00  pß'603@P00lKT P \Kl404Oa#p\` Xp \%Rh0O0STG 2Rh0@_@00lB  P 0S 'KP. Rb(r0\5S\0h0\0K0@ `  O00P@  E @ 1 Ÿ0\5S ,0@t`K`pt` pp tp WpPX10 @P!00`0/Rr Q pnYZj x ?SR@P@TP0` @0 0\0MT UJ  `P1 _ @YLFTU lT X D|$)lL0$0U pT唠! i L00`0K@  |0@ x@ ,0Ta0 (K p-D0 ML08, `L0$ 0`PKp  -LDMl@KD 0 0p 0 0,0K0D0 $ U0TD`P T@ PP M0lKS  0@P0 g0Rp0,0Z@P0 (K$([[  p-D0 ML08, `L0$ 0`PKp < -LM4 萟, . Y,0PP0,0 0S \  p@0U PUT0 R 0S  0`pHX0,0 ,(KP4@-0 ,,0PQQ0P0 -UML M00CS@@]]D^,^\]]T PP% @ <P 0P/  P ş 0PQ c Pe\0:0090?aJ [tU pE l5l`K3D k 0K1bt5 V>K0C0Cx5 $5A| %5 0,0K5D0 [oK000p00 0S S$< 0-;;S< @00 x0k0S <0ttx% 0 <0\Tx% 0p LD0SDH 0?0?0 00SLP0 \5 S0@0 @0@0@,0\5 S33( K)ɠ(K 0 \5 S 0@d1 `A P0@\1 XA 0\5 S,0(0,0p0t@P( R01 0#\: R 0\5 S0X000@|5 R0T0 P@ lK0L0 H@ tD" XT: 200\\"2 P0p00P`G 0SD 0ST> st: 0  P$`lP,  O00C0P ?00090@!0C0@0 @$P0PFtX:0 P00a0 @ 0S0S P0@0PU:F(KLdp$)ĵT\,d$dTX\h$td~4 -,0LM 0 0yP -<0LM000 0@fPh -MLM 0 ,|@T( <P#0@ST (m00P 8)  089 0S_ (\00lP88 RP(O0JK01 0*1K$0,)1K 0)Q[S @ P 8 400P`U)UK7(K P77(K` 000 @0@PfB00C0 XP$P089  8) 0S0Se0,01 0pJK)1K*K )1[` 00`"0 00 0RV0`(K00 0@0@00C0(0K (KPP@T) P|P0@ 0$@0SW %5P8) 8) JcP ş MB 0 S \ş ?P50@ 0$@0 $ş /5(K KP8) 8) 0 0@0@P 00C0890S   R*0.S'0S#0S R@$B00P88 8) 0.S #000P89089 0 0@0@0 @PR0Sß5 10128:scP;00CS񟗱j,m(l(lDkDk0S0S $ß0{P0S0S0S  0S"0SŸ 0ZPP @0: S00S000  0 - 0S)0S&~KpG pG@0 00RnK!@`FP `F 000!*x10S rE<X PP7 0S0S00@@0S 000P89089 00C0 0hU8008 (KpPl~Ķ$<hxTзܷ  -1 0 B!1L S|!000PPQG  0  40S?.0S9 `00p !0S  0V`SP P 0@ 0$@00C0=00P @ 00-J 0Z*0 T\8p$ -,0LM 0 0vP -LM4, `: P , -1 >p0S:  0S 0S @00 T RX  0:0D 0@, 0@P`HX,@ -LHMl@KD 1! 0,0K1pD0 j0!Pop [VSUQTP P` ] 00CS?|strrtrrHsO Q  A 40S 0S00  R# @ 0\5S00  00S     0|0@P`d@p 00Xp40 ,0W 0 (K$tpT@L  0-80 ML, (000PK0  D -ML__M>Kp0(HCHHK \1X>0S`XKPayX0S$5S(N0S %0S P  K0P! $5 KPXQZ$UUȭUTURʴQQ$PE``0P3  BaB00B $"11000 0S 8 $U.M0S P& 0S  $QPEP`0\3  BQ@5 B0$   B110L 000< K P!Lq QV0hK  B0 20 P`ZY\: HK ND 0, <:<*d: "XKLaZ`0KO Hat,0 0 Po/0 hK\aɟ0 S 3 S(K L0XKL!OL8<KHS."KL` `XKTa`P`KLV` U8K=CHK\AhK0 0ta `,00CVNKD!Xa$5S8]p  $  HK\A(0, S0Q (0Q,`,`0\58S K\x0  R0R0  !HK\A x00Rx x00Qt0Q04hK  '0S\08Kl!L5XKsGCLQ0aXKtO a3 Po 00CS|D|8|8|8|D|000 0ǟ0C R 0\0R\0000 P20 Y  0tfK0 0ZKt^@T6 LVR\0R\0000 20 00CP 0hKnFKP n5 1> 0 S2$ ER`0K@5ARK!! `0 0(K(K1 0K1 ! 1!2(K1 0 0`8 0iS^000$5S*8bl  0@00^$0 d0R$0`0KU0018a^! BB.A.A BS8K!080ïPHK@A ThKDa V `$5S+l0h P0@` Q $%Q  !0000SPp0PQ $%Q  !000$ P0K0OP0 L@ `0K K0O`0 \@ X0K `0OX0 T@ h0K 0Oh0 d@ L3L 2%P MK P0 0KPP K\ (K\p!P K P HKp!\|2 a0S K\  M0HKS\0\A8K! Q0 SK\hK\010 0 0 S5 1(K-BP`05" HK\A40 SK\K\010 0S58KLL/1 KH!"@(K-B0@ 0P@`UVHKdAZXK\QψoXKag(D\d|T@(,0$T (LU $K\$0,PS(K\!K`0@ 0!S`0hK10 0 0 S1 1(K-BP`05 0@S`0K10 0S5KLL/1 KH!"@(K-B0@ @0P@`UVHK`AZ0\QhKS\0\at0 SK\\0 8Kl!P K P HK\AQ0SK\\00S\08Kl! 2 KL0`@P``K,0LPtL2@@L5?^s h!h`KP% P MKb P 2 @@ (K -,0LM 0 0P,(h00 0 $$$0$0$ -LܨPy 蔹 R-L@ PTh褹 P-L o P[费 0-/LP@P000+0/00$++00Ĺ p-LlM/`@P KyP0: S 0PrS@ Kp p-`PL@P00S 0 R +>'>;V \00S liH0H R 8>,>(0( >{p$$$ȹPԹ --LM0 0 f --LM0 0 K --LM0 0 K -L@_H hꨎ -41LQM pK  txP@`K>8`fxP10: S 0R 000(YK@SxPd1: Sp l=VPP S00S )@P U@ K$|  --LM0 0 ܿ\C -T L@H?P4T 1_`0edA@T -L M`Pe@P 0Ta0C0S0T00C SdMT00@ Sa>A, , , R R3#!5 ", P 00C    4,  Q0 0C#0 0 004800000,0 0 B4 0(P T| ,(P0@@T0p`?!ܧ8<0040(0, 40(08 40 ?i 400e 000 000R ʤ |`0B000@\ 8@0DW Pp0P ,0 @@0 ?ᓧ0E ?፧ ,d d00d0V`$@QPU`0P3  BB00B %"11000 0S Rڬ0 0 0(Kp8S|d P-L@ ,00S J<h]P̺ -5LM Rppp= h5huPoʠ 0 @PD0(\%$5RR1 T04Poğ4ʠ 0 P(4 \5 S S ST  S 3S3S |ğ @p?t0 T4*` ,P@ڴQ0\%4R  S0@Sh` VŴ0 0B RR40AQR00QT30S0 @ O0TS¯0  y 0S3 0R[ 0RW 0RS 0RO 0RK 0RG, ,0RC0 00R?4 40R;8 80R7H H0R3L L0R/P P0R+T T0R'` `0R#d d0Rh h0Rt t0Rx x0R 0R 0R  0R 0R\%\5R" 10S ;`!1@h00p`P   \0PaA;@T4:010\%R& 0O044D $0O84 KdZP ,@g\ :D0: S t,lt@PqD@>0S ,<q:,+P$i:> R0C=P = 0S= l S:=0S e -0@}崍=P` ` ` ' $0 S P\ = P(0@-<0P @a$]0S<@T{<_.K B B,Pr Pn |l00P 54 S0 5S6 @Tlp@5O,505 ï @% p P5PW5U ˟˟+˟; 9&; @;0S|; 09h;00 T(+ ;R  0Sp  h+848@00@ S2,@ @P @ P 00S>@ P,0H0PwD@ P o 00O D,D@0p 0 Po/D`0j0!0S 3S1 0  p?ŏP0 `t!1>,@0 200L1 DR0@`0R1 0 >`0@  0#0p@P`H@ ,\,  H0O0080Q0 0@0$0HP0C0e0$0L\Y8K@ K 8 4 40W8@V (K@PU $ -0Lp@P` d 0S0S @ T @ 0 @Tpw 0X L000 0 0000 @  @ G-P8嬐 稠p`@10CB>A>A0B0W3! Q 000 80\@80P$p@-8PP` P P 00Sp001 #@e0000 #%1?FA00 0Sp03 0 Rpp@-8PP` P P  00pe@0@0A#O 1p"1?0FAp1>0 !A pp@-8PP` P P  00pe@0@0A#O 1Ìp"1?0FAp1>0 !A pp@-8PP` P P! 00s3p@e00@@00A#O 1# "1?0  0@ #p1>00 S20#ApMЍ6 -LP`  PT  P P@  P8  P( $ 0 @@8P%$0 000, RD0  -@LP  P $h~ 0-L@0PP HP[vP@@fPOvP0 -\0LM@(0K( 0 @ K$ K0 P K$K -0L@ P  h --40LM K 0  N K -`0LM00 0@0 K P @Px K -t0LM $0K 0  $  K K0P $0@PU K -0LM0S P P=X@0 @00P P*  -LM  K K0K Ͳp@mP  dK< 0-LM 0PS    KK0娲p @IP0 >K0d -L@-3CC 0S00 % -p-LM@0`P0 RPP0200  0S CKp -0-L$@KM0 0 0P@$0 S000 @ * 00 0SK0 --LM0 0 -" K p-PLP`  0PpѦ uP@@p0S PP@ PpXP@$0  @ppUT - 0LP`p, 0S) 0S& 0CP 00p@xt 0pd{PP@ V0,0,0(`@,@(`@p,T -T1L000,Q,p5@p 0`P0 ,@T"0 0R0 0Dp 0 0S 000EP 20005 {MPPM@000" ,@T D 0-|0L@0S,@TH0@;PP 40LP@MP P`M0D --LM0 0  B K -LM@,p`PK! 9tP4$0Rm$0 dB4`| -LM@0pP0KDpt P,p`lP Uh ,60!K æP 06`\06!0[ 1S000SU% 06@!.pPbN0S ^N0S ZN0S ,8,r62 ,8,k6i6BX W WQPHA 0S fA0 (K(0 60l0 ,EA` KQ`L p-`L0S+ @P(  k 0P00 (0, S , , R(0(0phJp0 00 pc ph p@% -LA0@000,@T p`PpM0S P^ &sp0SM0 SM0 S @ T mhi, 0-0L 0R P( 0 @0 PU0st d0  0 ,@Trp [@0S 0%@ -L@|KA-p$ psA\p -X2L$M0  D2$ ,0 (@  $K,K0勯p-M0-S<1@0000;,@TA! mp/ +p`+ P#8@K P 4` 0` 8P 1 -P <0!$14`l,$!1@ KUr 0 @p`P#40S 0:0pL0S Pm 5rp0SL0 SL0@ S TP0岣@K%mhi,m4mU, 0:0P%0 K% -L$M*pP*0@K gP ,p (p 0P  10aS1 @0 8 <` 4p x@K k @w PK l`T!T qP@3 qp@ 5TCL0S  0S( IOQ 0 0R0$0 $@K e\ |p 2"4 H0xxx pQ00 SK4m%,mUP%tm -LMCnKЁ+~K(+$_P|)PP|(K 0@K(P  tt0p ,P &sjX<0 ,P kj<(?=u 'qP 00p$`K qp@ TK0S $0[S0S p0@T$00 S\XC?>?D0 @ KU4mp%<p%d -LDM@3P H D吢wAP 0(  㕔pP ]P W fVP sVp MБЁqP !np`10S<   P 0 P0T  P< (@K `$ ` 0 p , $(p`0P 8@K  4P 0P 8`   22200+w\C$m,V 8%%PAT<MЍ 8 200 "P: -LM@pPg p`P 0S nS0oS` =PP00 @᷒P @Q  0U0P P00 00 X 0000X  1>U 0 QJ00 ,K, ?R0S@pAJ0"S4 0>@Px p     -LMp`ፒP@( P(K,K$  0mP(0S>$K -000 0LS    6㚪Tp\C --LM00 @%P 80 / 0%x@x p-\0L0`SP@8 ,;*Pphppgd( 0-t L@h&*P\PP P 000:@P 4,$@0edAtp  -MLM0@<0 8@ =P = = = % P |ˬ =t* P-] p4`Kh* dz -N0@&S:dt<|<|< +0 `^40S<0t:  .t L"p RQ`<@0@0 L  @< 8 `04 <R 1 ` 4 ;R  1 `4 ;R 8 `4 d;RX 1 `4 ,;R 1 `ރ4 :R o1 `΃4 :R _c0 `徃4 :Rx O0S \\*TF@PP@ @000:,P*:1  o-xɟ00)<Kbp 80S<0S [ 0s 0d  0SpxP 0d h*kp0S89P ( 0e 0bS t80S \@KePT0K\0 X@ ^ 4(1 R0`: -W pP& ]P! ^KPEeNKPE@D@Dh(0_\(\8PpXf4(88pOf \70S- 2PP(OKe/r?K: 7x* (K |J lZ p <42 =C02 =$2 7P00C,0P 0 1K," ("  6 Rp A 00KPp G?  ,K0pP#G2  ,@ P-PPP P,  |,0?,0 d  P ``rpWZt50S EP P| ` |  x l* c  0ZPx JG  Ix K:EP>G  x=40S 0: Sh 3 0: ST =`:@nPl  P`P`0P00@ Sx Sl| 00A Sa>@2 : 0 @@00@0`:   0 S`l:   |(0@S`Ld <`KP h30 0 0@ 0@ 0 @@*0 @@0Y@P X 20Sl` 0PP|2|`0O?   4D;S##t`2^`V u2 (2 R P 00C  K R |*(0 S;30 R 0S1  0#R ʄ101 S90!0S`1010p10S xA0S d10s<00!0S00S00#1ѣ10L@Kp:  x* `00S  P |*p8,00Sp 1. x /.㧦T &XHhx(%Lt%%h%@&X&tl%$%&l%%(BdA$0 <Rn<L,4 H`\`80@S000 10B 0# 0 100<80@S|dX000 10B 0# 0 10< -L80LS$\D$0S01S 00  00 #A10 #1 0S ; -0LPA@`|  `   0BOpcP VB?㖃! p    D -LMp`Q pD4K iP00SDDT[0 P'/P 0$TdX -LMp|`Q D@X4 iTP8D0 PP 0"қTd -LMxe@D lUd ۱ 0 L5QD60S 0@p4 00 0;@040 0@ 70PS`08 `?4K P04K80Po4P 0` 0P0o ?S4 Rl; 4 0 @4@84 `R`0_P 4K$ ß 0S0C0 ?0@3C  00C0 000 ?>0@3C 000t30SvL3 Q`0P0 20D080U00@ d ጰ0 0G4K(K|U 4Lt% - L0R  P%7 -2LM00 S8 4 p0ll0 P2R@ d S 0= 2P)7 00C 08P4`\\0`"1>\\0?0 80(R0! @ d *2 0; 0@4D1 00C04P ,0OT8`S8 K 60O,0 (@ 8K 00 O Pop@P <` @S!.Ǐ@ 0@W< !@p`p, K 8Kx `?ߋ` ׯd ӯ0 0@P0 0S 08Kx ?ҋ00 08Kx ?Nj00,8$000 (00$Kkh%|U 4D -LMK@P,V0 K`0@ P A P @ P g n 0!C p  0 K4 0@ 0 @ ^K`pL =0@0O$+41 ! d a004 0 KA&D -LM@PpGK,`$1@ 0 A SA  9 K00` 0  0K g jn ,K01B00@S  0K42P L=EK0@0O4;0 dH04 0GK DKTA% (&D -:L0MP0OH0 D@ P `HL` ȟH08d 10S70܀80P)0p@pl@`x0W0HOH DpP,0 /0Od R00 0 080P0x `RU(KH\|U %DT -LM  p@<P ,;P4Kz;0S ;RQ:> 00d: @P0):p   jd;:Qp: `: Sr\ mQ (:  S4Z@ ,02ttJ @P@PPjɟ 00T 0L59 0$ : 049 0B90A  _2`0UT T0PD R@: R08R0A2Y00 8 04 000cH0 400cL0 H00O854H&\pTT$ xht@hHD$)C &XT% ؐY }2400S40|  00 00 ,00p0$@QPU``0^3  Ba0B 5 =0 B110L 000@x0`S0 0OH4LD ,L=2 000_`1Pm P=LV>00h0 h0 S:h0@2 0<0L2 0\ X2 0 0R0PT0XT0P0P0HU 00 400@0PP40@:0, 0a84 0 =(0 H4LD0 ?>0 ?0 ;0 4 D0,40S0 ,d@8t<#4P` 4  4d U0O?`@P$+4 K ФTp @p4P`Y 5P`8, 0D @ , DK< K,0KPTK8XP LK<0KQ  P0 @ 5K< 8 p6, 08dP A0`@ @c0 0@` R pQ 0ȐĠ J)F#Z **0P070S@P'  *0\%$8R48\5*0%H*0P<8(8Q0\5h80Sb |8PզP 78ppD K?p [P P 7PP8 0(Y0 ,i R01:0PT&~ 0I *Y`p㸐K:4K`0S- 0O ,00 /0Od ᤦ*P0d PcP@c@t 0 S BL  T J@P`pPZpJ0P,0V0S B :0S :P :4K0S P  ?>0 ?0 ;0 4 D0P , -0K*0`PTH4LDVKd 600 f0 R P000`P pV`0 008P40  @@A@p< 008#80(K 0-LM8X0@K P0,L 0P< P=p z#8PK0xMЍ7 -0L X\C$ -LP`p' @@P0/S /3P@0.S0S .S 0S `V4/ p 0S0 PPD -1LMXp tt媏'l10SR 0: SN YPJ g80 SF3`K* [1 RA@RPR 0P偏+00S 00CS00@Ӥ0r8@`P0S 00CS00Ӥ0r 8 PpYTyT$Kd\CipBB -LM0@P, U`pT` pX,  "P @TPU T -L1M@QPK@UPpPQ@0: SI0S HZ.M< =pP; K5P7 0S  0S 0S0: S 7p00#K*p $3 S`!k3P  pD0`P \P p4Ӂ(0   K$) -LqlM`KP4TP$0: S0S-#0S P 0: Sp 0S\QP 0S =70S ,允P@T(K$) -@2L0S 020S$20S [MPPv g40C S0, <- <- , <- 0- , <- <- , 0!Z( 0S 0SO @ l{-A0SDH aP> H p8 0S0SH OP, $0BS- - - - - - - - A 0S R HPP 0S 60S \pX<`pK@P60S ,㡍ovH$)\ -L`p 0!P@0dP PP RPiP@ rP fP P0@0@ Yp0 0bSAX00S 0S FD0U $0ږAMЍ -000 0LS    Y㽖4+\C-0 CR 0R0 S?00 -@RLP 0S D% 4 TH UF 0@SB 10S<p `(<?0C3@ R 0S, ,?0S|?@ l R @0 S0S400S(>h>hk?BC 0-PL@0S(0hBQP xt d\00SP e <?? 0 (0h8+,LD6hBCl - L Pjm @ me -LM@/"P0002Pp2 lR dr`XrT2T"PPPfP tP  Xp2 10 bSP PP P 0@SX :XP10S Ya@a,@ pQl 4  PP `@a0<S 00K@P 40S 1 0S0%+0S% 3KP ,K u 04 P,00S (040 8K[P @00S d 0X峋=C4+@x(XA+0**0+$)MЍR -0L 忋#\CP -LlM`p@/>@gm r3X0 @qP0W)P]4KP4MP V4 P0: S N40 0X  (K| -LMp`c[[h0,0 mP pP,  @P (' $PE!Wp001 @R Ԁ@`p)qL @P0/S ,0S  j P00U00S )P8+~`@Pqx(>xA$)MЍ -`LV@pPq \V Vfb[RC[VS  0 ^S0 0]S0 $0[S0.P =P:P 0SE  0]S0\\S0nS  0S ]S00]S*@P"\R0[S  S nSP \SW0R0000P R @| -`RLp00@P0@ s0@0S S ;S s0@0S S\ 4R0gPV@ @OB -L`?0rS aS bS6tS {S1-000, XP & 0R0 S 0A 0Sp 1P 0  @T0S04  ` V! p-L`@S5P @P 0S0 (T X0 R $P +4 0$ 0S5px!! 0-LM0 9SP0S*$S /S\S @PP 0@00 00 K@@80 -LBKCM@\M @ 50KP T L$ X4 Lt 447P@, LPwP>@,~PLt ,0S , ,0 r T000,0 R#R ;R Pp0p000Pt 00,0WPPL ,tP,  , ,0 r 000, 0,S0P0-0S,0  , ,0 r 000Q,BP, , ,0 rP 000,00S ,0L00,R @0 S0U,  P0 SKC D |B B \C |? G G F E H M ,00S,0  , ,0 r 000 0"0 00,00S,0  , ,0 r 8 000L ,0P$ 0S0L0P0` L0pL4 ,00S,0  , ,0 r 000,0 ;R  R  a,00S,0  , ,0 r  000,00\St E,00S,0  , ,0 r 000,00S  *0P`0K00 ) 0eS * e 0`S01:6`   \S0S S@000S0lQP 4K@P000M,00S,0  , ,0 r D 000,00S , J PU00B,||(p;,@0! 0T1,00S,0  , ,0 r l000,  ,00S,0  , ,0 r 000,0S 0 , K {,00S,0  , ,0 r 000,, K 0S_ `  0b0 S&01@ 0S 0 P eP B @T0 @, 6, 0,0 0\SSH. r,0P,  # ,0@,0 P< Q<H l 00  `84 @4 D4 o8$ 0hS * h 0`S8 01:@!@ @4 P<D$\SQ# RD `@T`FD + ,P \  0 S0@B 0T0S@\T&T\00<Si@`Hd  S 00`0Sxxj`P0i`H$0, P4 ` 0p40S 4 40 r 00040 gR 9R1R*Rn R;RcipR wR^Vt`YpWV`k44K ٌ0@s@<a`@0S40 4 40 rTD 000 S XT#%A+40  40 400ST$0T02 T^w$2@TT"dp .0T$40 40040 sS,0  , ,0 r 000, 0;Sy0,0@,@ 0\SS R4` @P\jC%D PP40 P0s 0)@&T F 000 S 4d!Ll|X+@t|! \l!0<X 0XBD!!!!0 0QnligPU,P  , ,0 r 000,0 ;R0,0 R T@ 0`S0 I ;@TP U 1 r01 81jH1(K -"LM0S>̂r`P y @R"2 0  PP@-q 0ld"0S 00CS00 Ӥ0)h- r@ z00010S 00A,KD1P0S00#3 ePP h1@-0S -( 0H 0 , c4! 0qa00!彇0P 0 0S 0pPP@[- 0| 0S 00CS00 Ӥ0g'- r@ z !p!BdHBh!l! -@L 000@, 0-PL @ 0P@000, -LM0S`p00S; :SiP 000S S,"PP 0@, 0l0 00T2 0DD"8P<< $"0 00001,Kb@P# Q000 ,0S:, -, Q,0  RO0#SL0nSt1 G0H00ކ@$!0S 0#S0nS 1  0,0 ,0S ,0+;, a0 @\ \0 0 0^0^ d 0000H000 0 00,00C, !!l!H!p! k X! -霁圑圡L`Pp@,fP aP eP EPrP uP nP @1 @@p 1@  0u唖1 wOp0 00@pQ @0S@Pd0@'P +w< nx(|!t!x!!C`\CAd! --LM0@``0 H0DSL0@ D0D0  w ["TCK\Cl!p! -L@P+6 $) -L @P+& $) -L@Pz+ $) -P@Lp`8 0G P 0> ! -LP`p/0wS {S& sS'0 p eP 0@?+ 0pp0 pp RP @-+ 0(^pPU -P` PLpK i@ W000  0 0 -LM`0PPp@0S! T 00S S@D 0@0V l0 l00 T000P S  0P$ h`!!!-0 CR 0R0 S|400 -L`zK((MP$pG!0 0R R0 啅@P *0b P0ῄ` P0V00S06#3 dbPP b*0S ]*<  00$ 0$KT!!CHBB\! -l/LHM<K0l 0D00d /.00d0Q0Sm d@PT 0" R 00$P RΟ 0S40SPL d 000> D R000P R(N 0S͟0SP) d0QM 0Sd͟%!%*dd000 R000 R͟lM 0Sd0 p3Pd  i d@0=0C>S񟗣pp p p p p p p c p p (d pd p p p p p 0g p g p p p p p p p p p p p p p p p p b xc c c p p d `d |d p p d p f p xg g 4h h hn p p o o ,p p n [k 0S K00 000Pl 0 0 0d0 0 @d @ Md  d @00d@000S4 ʟ0S1 /0S3 R  BFP00'0` c ** J0S 0 ʟ 0 0 d  J`0s 9P & P Kh P4[S 0yЙЉPD9< 0U dPVp )000 \P 0S2P" P 0St\ \`~2@V P 0iS,m2PP`0VS80S$$X2l80S  M2@80SL86#3 t`PPt ~(0S y( g$80S0S 8 jP 00S aPM70S0S7 0S>0S: R  B SP  ` <7@@& 7 70S|0S 6 |dƟdf 0STF0 0~P0 0 0 0d@0 0 @d @ PP6d 0h0 @T\@ X 50S  0S0d 00  \X0P< E0d0  @` `PX0 DX0T0   00 `Q{d D0p`Z&Up% \U 000C SS p0&S\SpPğ0@0S :K@ l0@` T$P0001 P 0s3 \0@8 -PaPQPPLM@pdP ?P aP tPp;` ` 5ep0pQ9y y@Pp 000 000P@TY 0@K+yP 000 <000"y@P(K8VVWPWV -$L M 08 , xxx0@P`p@ 4 0 0!0- + pP0  UP dP ?PtP@  xP,p  rP 0<0 @ 4` 8` #dp00  P +\-\0S0 X3@QX Y 0S 8D < b(Ko80S ,0<0 H @x, Rp`=00S40S l l0+Q H0S C l@0H @0 cdRD@T=/`P <2e  i`Pv3p)Vx0 ,Q- @x@P! 0 4 Rkk00+S H R=kt B@0H =  @0 Uc\DDT D < >0V0 @D0 xDY00@0  8 R000 Y 0 0/P00 f0 000000+QH ,000D RT0wPUw<(KVPW8VWUHU8,lW@VU -L,M0`0rS tS eSƟp Ɵp< Ɵ0p<0 |Ɵ{< p& 0 0 P8 4 0DiP/ UP' LP RP ?P#hZPP() fPrP+# lP( pPuP' xP  tP P)P) '  @,8@ 0 40  X0p+p-0E P LcpP@U,@  ,K+fP 8 0@ R 0K"fP 0 1S +R-R0S00Z 070S d$CT400S w y9S,4y0S4 0Z`.SZ  w@ g/ P ` Y0D000  3# 0~ 0,0PtBP@T P3D08s@ vPV 0 -Y0    y~B\T@T20 H L vx 0 R pV 0j 0P a H R24zB0 (vB0rB0 nB0jB0 eB0 `B0\B0XB0TB0PBMB0 * .40S L0!S?B06 h 8B\5B-Y0 P8+B0< S$Bda BW @T@TTX|``<0*{'9P0 `@0 D 6 00Spq(KTVhHUlWP  $)d, -L M00X#wSPPL3 UH@pp `0 pP ?P VP vP0`  ap0U0,0 00 S0?0,0 00PS,00,0 4P 00p#40SP u Hu0p03P u uPP 0 S ,.PV 0BRSiA00CSUꄍ $ Ќ V'MV 0|1|PA40ShKA `<V: PDA0D@A08 4>U4 1.*00SD )<0/SP0S d@P<@T dH hd<@L K>U \0(KVV,Tpt|,|4WXlWlP0fP p-PLUhd0 0S 9`s@sT Q@NT >pVGpVt -p@QL@ mP@pP@ f!]p001 PR@'@1ST00pS@` T`W  V  *[ ;[W@ 00 , =$=@VJtV - L0 0S p`@0P 0@PH00s03T0S 0 00S @ T0 0 0lWV -LMD@KP[0D0 ?P pP :P  000<= _]pD0S pp`@@D0T!0S00S 000P(K ,lW -LMQp@ 0V`  0 gl0V< 0 `< 0W ,q  0f(K'0@ -L^MPp@K`YhK?OK?Pp` #0@@@@ B+p0S0LK``7hK?cK?@K0- 41`ßOK P`( $ 0@ =9@( $ =C 0 0(!K 0K R4 0 , c0=)B@ -B4 0 , Y0K`Q P( $ 0@ =9( $ = 0 T 0 PŸ (0K R( $ 0@=9B( $ =C 0 0 K c0KPR4 0 , 0@=94 0 =,0 ,0  40K R4 0 , 0@=9B4 0 =C,0 (D 80LK c@0KPRL H D 0@=9L H =D0 L K 00@( K4PK @0@l 0@ dL0P4 0lbKUU?BXxU`hpx -LXM@tPK`ሀ>  0lp 0> 0 0$KHUi -pPL@` fP vP ?Ppp [p0aW zP0 [ D;aPMy(`@TV -LM 0 S@p K^P 0S  D1 `@ P^PU0fC10C0 0S000S0lWVW 0-4ALM,!P2[?PB 0AT00  K^P7 Q';00 SQ" 000 R 08SQ 0S p0:P000  a0<:0bPTK0V,lW 0-@LM PZ?P0 0AT K]P000 0:00rS0  00C8S@  RPP0Sw>P0@0@aSS8V,UlWLW -DSL M@p`?PM SPp#Zp0aV.@W# R:K@=p,` 0  <0 0RL@D`tP@p@N:KS:\N:0H"00P `0 A0SQy O:wx@v(3D0 1I@ H0 `gW aW oW uWI@`pW |PlZIPC `@rU@ gU oU XU wU@ xU uU D0H0@0@Y @`PU P0-W =W +W00,U` \P 0S0S@(KVPW p-@L PY?P. 0A`P@] 0S 9 X9 @TpP @@`T 0-S 0S pP<9po0S`pV,Y< -`L| @nY?P@ dp:G01 0D0P0S80 40 R@V,lWVWU -L eT0  W0  xWp3PlPÉ$K 0i-P (K 0b-P000v0GS(꼿 Կ 0  $ (0Rf$ (0Ra$ (0R[$ (0RU$ (0RO$ (0RIK*PCK*Pd 0R8h 0 7K*P1K*P  d0R&( h0R$ !K*PK*P 0R 0R 0R 0  KVVL-0S70#0Q0 54 14$) -1L M40 1 00 1@,0 1P(0 @ P1SPPEP  4+U180 < @`KNR4@POU! 0p4@P  0 0  ,@0 /<00C<0 U 00p0SP P 0, p3p3 4P PUZ< @Kx$K0 \ PV 0-LM@P$K.$K Kpq$t3 ?1Z m3K0 -@LM`NP@Q $K 0,P0 $Q 0 00]3"0C4pK.4@ 0P ,@ (P hP@ PT@B3^ 93 KW -0"L0@S rP`"H00 000#00PA0A 0R SP ?Pc HPaPPPl!Rp01S X2MDQ8a@q SR ?RB HRaR0S 0S20Q  QP (( Rp Z@ 2@0tSQ@T  8-P$!V(DP0 T0@-@ R00#SP 0 S 0#S 0 00 S00Q00 SP\\࠱# 00Q SL 0qL 0^Z#000000 -L@`=qtpP@P P Pl 0`pcPPW40W0P0S -LM@S00ä?P`@W@D@TP00 'Q "Q `Q =Q :QTʌpP 0P\S \Q0SPPU00 'Q "Q `Q =Q :Q1 D0 BR 0QAs 0P`  0/S @TT``Pgp0`UV Vlh  ,0K P 0S`,0 00 00WB Q-L@TA@P 0/S @P0/S0/S0S1d -`PLP@pt  0RQ\ -HpL`P@1@ST0hlW -pQL`00  U0`P0\T0 SP[T*T ?T $T 0(STP/TP@T0~SX  *00@lW -RLxMaApP>0ppx0@ P dP0@OP@1,K0!$ ( , ,@$0T :( @`DA A0@$@ ( ,0 ,0@@( ` ,0 P 08`_T<  _Te`[~ [~_T`@@<@TU rThhbrTA`T aT&k(aT&k(` yA`T<` `T<` `TL a=bHA`TL bT0bT0b݋A`T<\*rTrTc6wW`A`T<\*`T<\*`TdA`T`T`TeOLC`T`T`Tfn{`rTuT uT   EDB?f^?'hyht}u\j6NbQAKvGhAA!7eZy1+v&Y74I'unP~#p3Q)Z 1GQ3,$ڐj䞄Sw(1;4Yy f:;jiUW|\\t2?$iTۣX[/W3܌ZV5]O(qs% -"}` vjS<HhxV.|J@< joIGff[a?.4UWd,A+NCy;.};SQ Be}2RO$x^ eɖ9q*%̫ [i\'bk f}%FE=: &*i-H`XfBKQE߉gߢ~3@**ќȼ@ֽvk19 $Njmߘ#\dr{m\˾ur5F}bŕlyȋkDB(# 4w:1DןP&R~!L . ..arch@ catdate@chmod@chgrp@ cp dd df edhostname2 ksh sh ln ls mtsha256sha512mkdir@eject@ mv pax tar rmsleep@stty@sync@ ... . ..chown@dhclient2 disklabel2dmesg@fdisk@fsck@ fsck_ext2fsfsck_ffs2ifconfig2init@mknod@mount@ mount_cd9660 mount_ext2fs mount_ffs2 mount_msdos mount_nfs2newfs@ newfs_msdosping@ping6@reboothalt@route@sysctlumountbioctl . .. dbإemptyئ tmpF runtzlist ... ... ...aVP@ K+P00SM@P<0$TPU >@ KlWVhW  0-@ 0PLHP 0c0 -LM,@KpPqd똀RP @0T : @`DA 'A0@@0@1S@ VdP` $KlW -L,M`L P PJB 0 40 0 H 40`0T` <0 8 n:P8@/ YD  <0  cR <K4N@0S000 P:/00D  D H0 <0 cR<KN@LH P 80@ @cP0DAp0hC1a@0 0,0 [P,0ST PRQp D0@ G` P`@0Z, KP 100S PU80=(KlW -RLM p<0 8 f @S`$M4@K0"00 40 , "" 0PTPU 20 /lnqd2P0 %0`400fC180 < 0 2|@; 18 0 p@00Z 0P YP P @80Y d1J$ 0 1 80R1 !8P8 쐟pBP @ۿPAp P X 140 8 4@,0T :p00 @`DA A0@,@ 0 40 400,00 ` 4 <08(KlWV8V8WU0,  -/L`lHPDp`@P繿P@  iQ T -d1LHM Rp O P@AF <@K lKX0[l0`0 Y@[WP[T`[Sp[\[b?`0 l K0l K0KLK0 `pNKMK(0 S0S 0S0 S0S0S@K P $0 'p(K!]UD. 0-LPL@ x0S C0Ux  Tp0 p0@TP0UxU(x R`Up0 Bx p0U -@RLM`PJX `P@TT8`FV000S/SAP pR :@e DA A P1p00WR :x0@e DA P!0@0@ T T 0oTlW*TxU p-Ld`MPK0S bd %L@P$ 0S T[x(W -L M0S, 0@ 0@0R$0 KxP1[S S|ࠁ ࠓl 0@pP[n1[S < 0zpP[nKTxWVD.ht@,h 0-L@PX 0S0S : 0S@ |@0Vd0 -L ! 44bP, 303 0 h U4 ]YT Pp 0 00 B 0-L@PP0@S0 0 `2<0 40 ,0(0$0 0001111110@-p 0P@0^R0>S@?S00 0 @ R0)0 0 12 -p0L R`0PpX0`T0@TPT *U@(0  00011111 -00 LP`p@?  r 0  ^000@S 0@00 @PᅽU:B!D2p -p  L2 20R291@1P៵10S 1 19a威P@Uድ0c00D0c!S000p1HA jG41@0T@1 <10RpW1 1a 1P0S0d@cp@`PU 0 0CR0 00R0 0R>* 0R <CP@?@TX0XP@t0T0 111HW11p2l211111 -\0\ X0LP0/0A00808 Q005 Fh1111111 - P P0  0L 0@0R_0DS X 00CH 000@00S (0 R000CRh111 p-40LP@`0@S 0U p1 -L - L 0   1 -LMP@p-0`d K"d@P P00<0P 40 T 11111,00$0 00 c0BAVpW12 P-L@Lhp < 0 00  ^JT?@hCB -$0L U -D@LP`4p0S 0UP*0V 11 -L@@T* -0L0\ 0@ 0 @ @\ q 0_Q $Q\@ q 0_Q $Q ^*011B1 0-0L @P:000P:t0@0hd 0PP1: S0T C:0P(P00Q0T0111 -1L1`PQ p1p@llqKPQE r 0_R $RLVr0$r" 0 R00 ӑ UV r 000 R0 r 000 R00Q r 000_R $R @T0%"*0@n111BAACLU -0 LP.000R21 -0@ LR 00R 00S 0aS!R0S0S0S0 SS CCR00S0S  C111V -0L 1 -0L1 -D0L <00S$0S111 -D0L <00R$0S`111 -0L0P 0@ 0 @!@@P Pq 0_Q $Q@P@ Pq 0_Q $Q \*011B1 -L -0L@J1 -LD0 <0@ 40,0(0$0@111111 -Ls -0L0`P:00Ph$P0@t0 p dz@X0@йL0 DPD0@@@TDh,VpW1111111 -D0L0S8000,0 (00@1VV1pW -0L 011 -0L 0B11 -0LpW -0LV8 P00$ 0S P0,h2 -LMpP` ȀȠ04 <0 8 0 00 , {@@@@E4 0 b00e<08 040 00 ,0@ 0<0T T(0@(K11111, 0-0L@0ϠP|0x0 R  BR 00S H0F 0S@Q*0d01111 -|p|0L 0SP`:'L@  `Gy Cy0 0 0 111 -L@ǸP嘀`@Pt0 pp 0 R 3 #P0 0V@ t0T0 11111 0-1L0@Th10SP' ሸ0D@P R R "R 'R @P R R "R 'R R R "R 'R<P0S0  S S "S 'S P0S S S "S 'SP0S S S "S 'S  B0ST0 P@T T T "T 'T00Z@0pW11 -d0d 0`S00L0L  B P4$0 0 9X2\22812 0-PLM8 4@0PKK0K!00Cs081 p-L0L@ xK<@<`0PP N0Qp11X22 -tpPlp@LX`d@D0 <0 40,0p p*1111112 -pPLQ DP 81 P0S0g 0Q 1 `gP@UH@DtP f w0 0 ~0 0 0C0bSZ PP@@T *@@T*D0 D0 P@tr0T2111111 p-0L M @0 K0$KK a(K0a `P 0 P$0 `}0APX PU<BPMU'Kp111 , 0-T0L@T8 800TPc@PdXH0@021 p-0L 0R 0R`P0P0 x0 EKɶl0@d/ 0R  BP 0 p1 \22X2L1 -p0Lh0Q`0` \0 `0S 80 `0@SZ@d11111 -L -L -D0L <00 R$0S 11100 ,00R00S R111 -P0L H00R 0@0S`111 -l1L M ``10 l0lp ,K0K(K4K `PY@W(4 50 ,0(PcVP00S@  0,gW(0  X (0000S/S d 0"W00S (4 R X(q$K111 , -L -L -L -L} -Lu -Lm -Le 0-0L^S@P @ድ ᑵP0hPe0 -0L0Q @a`pPPW vd0@d@0@^SD @DT* 0P 0 1V1pW -@0 P00L0p|@`V U PPPPo00Cs01111 -L0`p 0 S 0809\- 0P@ 0U [uP @T0@TD#I 劣` 00000@@ @ <~W0@0 P ,1d1 --LMM@00  00 RK0N0 0  0 0Q K 0-PLM00 @R 00 |  Rd0 RH0 R80 R$00081  -d8LM X P8  @P 4P $ P8  ȟ@0 |0 w 0@q b0@k <0@e0 ` C0@Z c0t@T #0`@N 0L@H 08@B 0$@<0 7 =0@10 ,0 ' 0@! 0@ h0@ d0@0 l  B0X@ L0D@ l0,@ >0@0 0 0  0@ *0@0  C0@ f0@ g0p@0 (0 H ?08@ ?0$@ 0@0 0 0  .0@ _0@0  0@~0 xy0 ht 0X@n0 Di0 4d A0 @^ U0 @X u0@R0 M0 H0 C y0A@< [0B@4 [0C@, [0@%D [0@ O0@ O0@ O0@D O0H`@ [0`FP@ [0P@ O0`@ O0P@ 00,@ 10@ 20@ 30@ 40@ 50@ 60@ 70@ 80l@ 90T1P;`5p@ [0@ [0x@ [0@D [04@(K112V, ( x $ $ X   ,  <  0 d 8 x X \ 0   4 \ -0L0@c0 @h 0S X Sh  -0 S00@  0L0Pz h^,1 -MLMP`Qp| SpB_ Q 0P @TP82@ @TNK @D@D0"{U1`@dPP@T!f ^0S1`@S@TN BPP0V,A ,1`@ @T .P0q.K B B"0S @ P0^K PE@PE^ @T  P0 0.KH0 B B$`9V< K1P,$)|  -3ML M3|3|x3@p3pSl3ld3 \3 T3@L3,KX-,04#0hP0(s(3(#P`@@30c0 B0E0b02 >-0S0 0C0 2BQ 2\"0 2 a00cCR@00>Kp0CllŸ48 00 4`A-(K4 CpPo0(K s`0xB"C00!00S1 @ PV 4 pPUX@T@Z@X00S 0l\ R T0S   XVnP P PT0 000@ t0 `00c+VY820 -8KR0``00(K111pW11HW11,112l211p2112VV1`211,| h2d2 -LJoK⒞K`F MIM,0Ip0) )1KX\/PPM@1@0)9K*K帯P00 @T 1U5 S* S W/ 00gW   S09W:0X0 @6P0f)![^R@/ ?40PX7(K,  1, p-@L `P4$0 00@ S/@`@P 000$0 0 @ p11,d2 -PLp0`P& @eT(* წP(R @pP00 T@0gS4` R 0gS:00W  -LMp `PUW\@0 S<KPT U0U/S0: S SKhP1: S  0 SU0U/S 0: S SR  KJP1: S/0000@0T :2 @`DA A0@0p2 ` @B@0U/0 bR;P000/S /P 0 1 00@® @6=P0g   aR;P  e"ᩮ! 0 QI000U1 $1SP0 0 1 1:0.S 0S* .S0S% 0.S"?P }0@  cRڇ;P  |!00C0 X 00!PP X 10H(KlWp -0LM<`,0 ( p B@ ,T @@0 4K$K4 0 $ @0( PhcEQ@e KlW -LP`@pP0Q :x0 @`DA A0@0 @x@0dC1` Ach=lW -L$M< 8 P`@㖭P  0  0{S0 R  {R0 }R0C ,RS  RS0S0Z0S" < <08 +(Ko@0T :1 @`DA eA0@08@ `@JQ 8Pj `p @ DP 0p , H 90S5 0{R,0GHl4 , ( }R,00S,0  ,,R\ @ 8@P`w0 s D o40D<0  c0 p W(KlW -pp`0@Lp)@@PP4, P0p0mlWVhW -LMP HK hU   XP?0 /0S 0S0S @O0  00 , 00( 0 `Kpp P  80 4 L   80  cR 8K9 Rk# 3 T3 \3 P4 2 3 00 \ ],$ P$ d$ $ & 8$ |# ' / 2 2 < d p 00 C   ; 0$  (00 80 cR8K§9ː0 00S0 p)0-P]/)0@00` Ot͟pW`R 0S*00S&0@T" 0S 00S 0 ,V  00PG`Pp tp3@ K 7G`v@|P  | 2l ! 0D` 0   ̫p p 5@ 0$     80 cR8K9ː0 0 0S0 )0p00,;0 ?C|0 d@K 0K>嗫PK]@ 80  cR 8K8000SPp0 P 0z`Vd #V Q@pTM 0SY[hP 0@S*S0]SWY: 0@S@0P@T*T)@00Y\9@P@pɟ00S0Q0S T`  n8|)00 F= p  Q0 0 0 0 :S  0  0S   ~ 0 00     @ 000 0S  00R   R 0SQ@V*V#0 #0CS #70S0 0SAY@Vp@@V0@V```  @0p D0 s[㲪P_ 0@S*S Y0]SV0#0CS # 70S8'P WY@p`0 V :6@e DA A`P@[pWe0S Ɵ0@S@@3 %V:\6AA  hPap DP 0@@S000 0=S%00 5Xp[@ 0ş 00@ 00s03ş P00S -R=R ?R+R@  0S 0\ş SQP+R QPHQ @0P@ $TP 0  SC0S   00\0 40 0c0ᴐp 0 0 %S #S=S ?S 00?0 0 pA.0 ( SpP(  0  x0 t x0`0 @ 0 | 0  cRڀK040`00S0/S T :S000SS@/|P0Sd +S0Sx -S0SUX I J0@ ?P@ 80 00 @(T@|tMT@  80  cR8K30TS00T@00TSV 0Z00 ` P 0 00 0 0S0000   ) 00 3  1(K 0-x0L M0@P- 0 K 0 0 Q 00`0S0@@K0lW, 0-0L M0@P  0 K0 0  - 00`C1@@ S@ @0K0lW, -L M0@Sp; P P$ ( :  $ ( (0  (`K(0 PU @(@ 0T :h0$ @`DA A0@ @ $ (0 (,0P$ ` ( @KlW p-PLM`@PT@^0 P3KpxUD@ -@LMp`ե@V`1S0P P0 S ,$ (0K(p $` P f3KxUx@ -@ L1 >@$) -LM@0 ,@K p-LlMPK@` P@@PU  : SI  S @PV 0SKp -SL0M@< /0 P < PRND1  000 , 00P080 4 ::pP4@6pW `e80  cR8K=2@ 20/  @80  cR8K,2@ !4< |P4 `,  PP PU4,x(KlW p-LM @KPlG`  U 00/S 00 (Z000G@PKpPWV p-L@`P0=S\ *SZ +SZ@G [H000 `0p8W -0L0p@`GPT 0r03X0S  0D00 @80000tVHU W,WV 0-@LPOF $F@P  0h8W0PR000AS , 0-PLM0( 0 , mAF/$ 0 0 0S   0S$0 Ph1RdA@!0 D 0SF ==C(100 *@P  0  *0, R ( 0P( 0 0! P0 0P Q9p* =p ^$0@:֡ 04hK0lWZTmVhW -0LM  00  P,0 W 0P,K  0 00S  0.B*?0S2H00SF? PPx?  AA4 0 4K?#0S# 400S PS! O 4;o 404 0S00%;P400S7400S 400;0 0 0S00S 00S LN@P 0 @ y0 0S 0\ K 0 0 0pX` \>$Q `X(#0SX0 @R_T 00 00#T0S쀟PA f ~.@0<0 000 @ KP C`'0T  P㚕% ȚP0`  0S`)0BWlW 0-L$M@8 0 0K, 4 $@ @ @ "0w@P  R050" T40S* "0PK?(0(S'0(0  j(0(S 8 0   [_KK4 8I!K0lW, -0LS@P 00S  `@KP0u @050VK0 050p@ -`Lp@T @P00D 00    K JX @ - QL MP4 O@T``!0DS00ST4!T 00 "T 00s03V$ 00c 0 #T  0$S 0%T 0&0DS4  Q0 0s(40p0C00 `fY @  H@ I R,   5 YY Y 01`0IYSY  0S 0S0 0# 0ISr r Xt q q q r 0r @r Pr r r s @r Pr xr r `r r s ps q q q r 0r r r s s Xt 0 P 0sq 凑 P 0sp cp 0p 0pc 0s 0Rs~ 0Rppx 0Rppr 0Rppl 0Rppf 0Rpp` 0pRp[ 0pW 0p"S 0pO 0S 00 00` P 0p^ 0pSp: 0S 00 00 0`S 0pI 0Spp$ 0SX 0 0 0X 0@0C 00%S zX 00 0 X`@ 0! p,  R 0 p   I H@Y p0IS < 0##4 0S 0C 0 (Kdp -L0 M@0 00K, $00K02-<0<80 0aC!P00? 10pW2V - @L!002 -L SP, -LMP* 4 P0A0PUU  0$.!`p P' EP 0@0ŪpP8 d!0 R =/DA i0 0C0N 0w=1`@H̠H0-K HT-0K,K+K*PK)K44 0-0~0@P 01Q:HD00 010CQ:4 0 (KV222pWVtW -LM@ `, E\ @x x x x x x 0TS60Tl20Th.0Td*0T`,@ %TX"0P0U: 0FS 0aC1BVV0bqPP,D<)``, !J@ZpWVV -GMLM3 0S 3 |3|uEfHpCP d)KJX JD3L-@PqP0 '-3PP  0@P0ũpp 0S0S 2<l2FP dXx `P@Rl{ { |{ { { d{  0S     0S @P1\NP PEU0SU8  RU2PEU.`<T!0 J1 @-`PbP@g@d P ) KP| ;0 =P0P0<,FX0 H\0;D@G0 p,(0(KV222V2 2tWxW -8@L0S (0}/ }0 @ VtWVpW p-0L0S `P P hPP X0@T@@媼D0@ <0 B40 @$0php2222VV2pW -PPL\0U PpP`0`CAU!bqV@ 弼1P0tWpWVV 0-L0LPD0@8 P 0dCRB0R00pWV -LMQP,0 ``pϕ @gDAU00?PAa,0S ɕPផP 0gC@T : TpWV -<0L 400R:PR B| pWV p-LMPK`@2'P,  1R 1000c00PU QV0xP U xIxV P@x0hP?SX0 b@@0 @k P0$ &xxpW2V - @ 0LSp:P`0 S 0B00坻0 0C000吀`Pɔ@P  P0S@0P\T 0`0DV ,P@@VpW2,VPV -d8LM$0 SP HxH`     CgP- 0P>9P2?P eP8nP 2 lP/rP ) sP'PwP ᷔ @ M( x p  000 `  </Z Y'o#p00 VaP 0^S   z0@T 0S =&pP |6P=&00c  㰀 ZZPY0SZ   P@r XU&hA > 0 00 , ܺ004 080 pP8  bR:!P@ . * 0 PpP`g 0  )8K ^00SY)80@  cR8K !P 4`, 娺Q 0 dZZPYYP0S ,Z^  8P p @Q@Y %P Y   R Pp X0~3p Q5 D#D3^4Q``$#$0 0 fB!C O,@L,@ 1PP0 d >,0S00`V@3@#V@T(H2F/PU@\ L7z^@@ ,Q00@T`3`#T`Vh-p<A B ARP>PPL 0i.PPx@K uP`0,10 0(08`K,0 尹00@080 4 8 @0dS 400c0bS  @8d ,P $@ -  -004`` 4(KVVlW H\x5(-pW2HU|PV0     V$PQ00V -0L`0V`Ppᕒ@@8P,@ p0PP -T P x-$00000V|u,xW -@@L c-0 _- [-0 HUU2 P-L h 0S0S L@P00P00@P00V -$@L0SP00V -4@ LP0SR00V -,@L0SP00V -@Lh p-L`00L S@$ R!PPTP0$%0&P00S 0P0&10P0` T \ \0PP0 p\0SphT 0P0Pp<Ph -LlMxKPx0: S K --80LM0S 0 0 e( & K2xU -@PL 0P P 0CP l0l0h -R  D*T <@Q R 0$S0 5* 00VWxUP --LM4@0 0 ( '&KxU --LM@DD *0 00 ($ '&T>KxU --80LM0S$ 0 0 ' K,WHU --0L M 0@0S u0 R)0 h0 ' X|'PO&P0  D00S   0  K,WUtVxUP WV --`0L M P0@0S <0 (0 ' I'&,WUxU P-L@  P 0 S ݸ -LM@KP@0P 0PK 0-LP(@P0 S U 0 P0-L@P4% UT  0h0xU0  RRR00Q QD 0000  R 0S 2 -LM@K 8㰍00 R000 㦍 0V22 -LM K4嘍00@  @RK㍍V2 -QL\M`p  R<P  (0@003 Q3# V+x p  0V 0-0p0 l 8@hK0Sꘗ З   0"#402 @ w~ P'X PhK; 0#40 H@ i~ @4"T* 3P00X00S 0 SShK 02 @ M~X 80T p0f(x a(X [( X h0[S tUp1p0 M(L!UPD1@\04 0P<(l  t PX\ 0x P%( X 0S0 (@T 0t S0S T]l0S `( P(Kb2$,Y4<H$)T\,l0i@0K (KVTh,,HU2D.]22 -LM$PK@p ܈`T`00 0S 0S# P $K  KP 0 S  㷈 㲈 RX0!P@ @ $K@ 㡈T0d0KV2xWT -LM K⍈x0P 00 XLK z}@, K@ pV2 $< p-8@L`P P iPP@Tp -LM$pK` PK Kx@P  B 0!@ R 0SUUX UP@屉 (@$K KVT-08 00\ $< 0S0 2xW -LM@K 400 R000 V2 -LMp0  @7, Kԇ$`V00@`0 0000 D0S4  $P0``:x$PU00tHݰPT4 R 0S A0@ 0$@,00@ 34 (  0000003@ 8`P3`0#004눣@0@S 눀[PV0#ST ,,K Wb23 0S 0S 00 .20SX 2 Y0$'33 @TR  Y,K &T20S  HBHHb -@DT 20S   10S - -O ]`P  R1@p!@l1 @@@4. 0dl5+   P\P Ο0S00 1 P P #Pp000. P\P TΟ0S00 P P00C0x,> $0 0$0=0S     K D0  cRDK p" RH x d  P P=0S \=!Z  $01x P\P ͟0S0@0 @ TTc Ta !TPG00D-T S tV x,0 00Nt L,0 00CKR AK`h, P\P 4̟0S0@0 @T T T T@UYCKC/K0)P;0QU 00!S 0(000 0 0< 9[Z9"`6 @+P ,KP  0 ,@pP D0  cRDK p0P  p0S:,: ʟ0(i,00 000<0@Z*Z ?Z+Z !ZH* P\P ʟ0S00 (P@ 00 j'Z \ZG "Z' 50 Q0S009 00xɟ X 4K0p2 0000 X4K0\Z `Z $Zz>  P\P ȟ0S0@0 @$T "T  \T `T0  @p   0@0p~D0 cRDK@ pTt  \00p@j$( P\P ǟ0S0P0 P(U3 P\P ǟ0S00 n(P @00T4K0 @00c0000T4K0 000 00" ${U0  `PPp @T\T Ɵ0S00 /@VK0 < l 4 T #T`R D00 `L `I900A[T2,KQP @,@ D0  cRDK P000S%,5 @T\T ş0S00 @L00V 00AP%p P\P D0  cRDKm P@ğ0S00 :P@00 P\P ğ0S00 p%P#P  00 X4K 0 @ PP00T4K 0T4K0000@. 0  Q  @D0  cRDK @#P P\P hß0S0P0 ]P0$00 0   P p   D0 cRDK p 000XPp@00$0000p00 X4KT000000D20S4  0S0 0 BR CC'Z40 HX4K  R" u 000p0C00  <"Z40 HX4K0 0S6t  (Z "Z 'Z*)Z \Z%0000C00 0 000000C"Z00 \Z0 'Z0d 000C0@T40 HX4KG02 @pBV\hW|3`WLVV3V 8VUVlWhW(Z000 )Z00CS0D P\P x0S00 f)P 40 HX4K 0 @`P@ dM=00%000 0p00 " g}Z!40 HX4K  }Z40 HX4K0 2 00p|Z (Z 0@00000 X4KC 0p,`Z 0040 HX4K \Z" P\P P0S00 $P "P \P `P0S P 0\ 6)Z0S0C P\P 0S00 )P00 '(Z000d\Z< P\P p0S00 P 0  'Z00 X4K 0 00" 00i"Z 0 0p" _00pZ"Z0 0" R\Z D$ P\P x0S00 e$Z "Z\Z `Z Z 0  [  p0  p))Z  0040 HX4K p|Z 00(Z 0@00000 X4KZp 00 % P\P 0S00 Z P P0 00 D0  cRDKp =KX `"<Z>Z R " @@i Rg`W Vc0S`0&00Z 6V0P00C >Z0006 P\P 70S00 Z >P00 S>ZP$L7 P\P 70S00 -P0 0 &PY000 |P00X  S @0000 0@8咡7EP[WP008兡(Z  Z &Z;Z |ZGh8 P\P 80S00 ] P ;ZȠ1 |Zㆠ. 8&ZK)|Z&PF% "p F, 0 4,0! 000B01 o1 0 1 P0,` 1cX T 0T 1  cRCKP@`9 P\P 0S0@0 @T0S TT 0`!E0. 1Y T, } 1  cRCKP@  P\P 0S0@0 @ T 1  cRCKmP@( 00C0<+ 0\m:T;0 Gd;0SX; P\P ;0S00 (P㨫w u0@8 `K0ASb  @00P  PU LA  `XyU000SI " F 2P l  6@P  <R }R<<f 1&  @P 0 ,  0S < 0S ( 0  @000 <08 8= ;`Y0S (K0,3 -\1LlMP`@T< 0PUAPh `9:AypP0T\Sy 9%2y@PPD 0S?(y@P xK@`PP0: Sh0K 0@  `00PV(K 3VV 0-LlMP@PŸPpd 0T K{P0: ST0K 0@  0@ 0@K03V -LlMxP ` `d PRN0SJ41`PU$3'PA 0Q= 唠KpP1 9`P-0: S)P L0 0hKS0S p0St0S& @g(P X$n%h0K 0@ pPU(K$3,3 33P 0-,PL@ 0R @T0xW - 0L@@TlW p-l0L@` 0S P 0P@P@U  `@T00@plW -(@L0 01h lW p-L1L@`0S  0R+ 0S P 0QAP U 00S 0S$PU0 0S0 00@CTT 00Px f᫉VQ@0#%VJ0   ph萞lWxUVUVY -P`LpG㮞P@pPx0 P000Q0@lW P-@L 00S PP@ P 00S|00SvB;@lpl`P0S 03nᬞT000S00VY(WlWV -LM< @ <0$ 2   0Q, 00   @0 S 204 80 40S2  2v@P1 T&04J40S TT <2 0S <00S,0S< 00<0"< 8 1 R8 1  aQđġp!0S<0<0S0S< < $0$000$040S l1b<<@P5 0S4,0S 0S 000C00 00S ~<0 ,0S 0SP <0p@P <0$0  M 40S 0S000S0S80 0$0(KVVLWlW,,U(WT 0-00P0@L@PP0hlW 0-L M, 0 40  00 ( P$ k 0Q10 0   00 0 0 x1ⓝ@P) P0 =0S < 00 0 0 T4E  1;  40S 00S2 60Q 000, 0 P% 0$( @= 0@ 0S 0 0 0 0 K0lWU -/L@D#P@PvP @vP 0uP  up3 -LM0S8 8  OK嗜G/du8(K K⍜x8xX@d))R\H P8 D( 4@ #PP X@PTg7 0P @ᅜP P$ b%`'7@   |uP luP uP0 DDvuP(7  ,',7  7 @6T! P 0P'@PƟƟ@0 @'<#`&0@/SKP|KP 0R 0R 0R 4V 0S 0S6T  $4U@#e%# $P0S0S8El#0 0S V& t5P\U `cX5QT% P5P Q#0@ 0S;&#tP40S1&tP4 $딩40P@T0 0@Dp  0pb`P!0S 31PS00P `!RI  2V @T3P  00P  3p @+s 3` $ 30s@@b3P 0  .P .P @$@$0 0$00000 0KP1: S|2 0ShBP 0S&2 I1@0tP "0Fpc0 000Q 01@ 0f0@ 1 0`p00P 0ShA 0S  0g@T 0]1@T 0  0S T"E%0S  0FPDD"5%PV (0  Wx0  l 0S00 C(K-WV lWPW8VW8WHVpVU,! VxWt|pp4W,V,V-U$4VPT(U@Ht -@LVP@r  -LM0@0cSz bSz+ PK  0`R R    0R PU  40$Ă,40S,((0 "4S \W  P@οjr EIIII T 000  R0000000S W -L4<0<Q808 R` `;0;LD<4 ,@$hWx* ( 0 4 < @ P 0-0@pL@`Pk00e*k@P3T  0 0     p-0`@R0 000 LP☙0Pf 00 p p-`PL@l0lq@M VPP8` r  phs.plW - L@ٚ P   њP -LPpZ 0#S@P@ *`P -@QL  +Pp``V 0S  f+@P@Pf 2p`V:00@j -LM\p8 < @0 @,14 8 yjPPPHsjTX` UU0PP``ї `cjPUp0 ,p W4 80<@ |0,  0S `0 \0 @pT Z p@04(KonlW,h p , -L 0  P`@p!0 Sm'S ePUpPH0S CTTCH  T@0 @0@0TSU mWUu $)LHU -L@p`P0S)QPU:|Q00V0S U ?qPP@T: -pLMP`, G0SC@*T< ?T: [TV:0S 0!RP0S.0 ]S `P) ']TV% X/`! qP Vp|T0V0X0S )T V X*WpG  `P,0U:V P w3 -LM@Q` 010PU40!0R-P00-S Q  0 0, 0 R -P 000#0+P0SPU , e0 -P0 0:U?Upp ,U;U #U ,P pP0:S0?, 0Pz 01  1PT 0k h:P ;P- 00 0R0! R0 0;P :P,000, H 0,1  $1,P& 0= i?, :007,P0100+#P- 00`pV 0 0P"pPPpPU 0h 00TpP0`P000? , ,(Kjx , Wo p-<`LP@1S oP @%T@p0 0 -PLM8 pR  R< l8< 0Q858 5#4 %4 5 S8 \0S8 ?S *SR[S SMSJ:S0CSE4QM 0SM0!SI , 000 0S0[S0 D[SB0:S?0:S@@`|oP 0S *Tf oP  0S4P P@T  0S  r R0  r 0S0[S0:S 0S0]S= 0S Q  Q Q4[\1 (0S0-S R0]S R  R Q 40Q 400\00S 0 0Sw0]St0 ,0R pW4\ W 8@A< 0P< T@*  P 0W8S`L< 0PGP@   r@p@P < 0P<@  0qV Pl@< T 0WP_   K`PX 0W8SA< 0PNP  8<@ Vp@@ P < 0P9@< T 0WP,   P% 8`AP  @ 0DPPT `< V 0W4\ W:8< Q  0,0 < 0nP (K- -pP00`Q0L@MS@%nP|nT@P0f@@T\PKT0P ܾnp3 05KlW 0-LM@P K^0S  P00 R0Sp008 0-L@PP 0 p-`PPLP 'n@ʔ P\p -\L(MT2K R 0S %Q$02K00 KVlW p-LMD`@4 P0^0 ~KpV/  -PLM`U0p`QR: UU UR0000` USQ R<@K$ /Ol0 |U00R0S80   U 0GS 0 00R0$`VVxWV -LMhT0Sp! P( )\mK=0S QP%Ut- P@Ÿ0U% 10<<}WsP00x   0P0  %Q  DK|!p40D !R 0-S+S00S 0SQ ,!0S#0D0 !R t1S0P0D010S00tQ 0S l0S x!R D  0Sb ]t1S D  !lD0 D0!0RD(K^343 V HU  ,   0-@QLP0 00h0@-0PSH /S``V@@ /p/\ \R.00.\!/\\ .\0/SS0&R00S Rp0 R  BR0/SRp0L0 S/S -Q4LM0 /Qp@0`0g.Q0.S0S/S00#0 `V Y ,  0S:S00SQ000 f0, , RY 0/S Z 0S k 0 bRP@  h 00S@/S/00,0YQ 0c0` , 0 bR@, h, 00S@/S/00`k P0 bR@ hY00(K, -LM00lSp@ upPUP@/T TQ /kP `eQk`V.T@V .T 0.S  0w/S4 W1@/000 0 bRB@ 7h  BKA| ;P@0Spp( K0 $C(4[/S0jB.K BpP PU(K -LM@j0 0 0  0 嚑00 K 0  yP 0Q/0000 `KlW -pPLP0PPPjp`0V`@X `}D0 gU 0U $0h+,|V4WVlW 0-0L @ 0  # 0SK0[ $0 0 :Q0a/0 0 0 P  0h 0p  -0L Pp 0S0+ ζ$00j  d0:00  X = SU, @0  d0d0 0 8 @0`d!. =P0S0 0;0制 0T$000  *000``@ V 0 90 0 0 090  -P Ll X`  R 0PXX@@ f0 0 d@d0 @T8Np4 T$Qp ap`` ǠP0S0 0;0 00$ `` V @gT  f 0 0d0    0-@PLP i 0h0 p-LM @P% u8 0& 0PKS0 `K ˵$0P0&Pĵ0S0 0P;0幵0$0 ZP0SpP 0 0C0P x   -QL0MP T H H D P %PP0pL0 q  R 0 B 0H@PP @H@ .X *X  X #X7 +X -X2 hX- lX# 0X+pGpEpCpA p>|;TT0  D T 2D@TDpaT L@ T L (0lSP @p  pP  pDF00! 0H 00L 0 RF00 <SL0  AD L P @PPPP XP cA0H0S 0c0HT|ΟS񟗦7 5 @7 @7 @7 @7 5 @7 @7 @7 @7 @7 5 4 @7 @7 6 @7 5 @7 @7 5 pp{@T  T `T0 T P`oX: dX iXuX xXA pX? (KVV@D@ (KPu`D  0X X0l 0X  P`XuX5 D0S-0+0, 00l)(K1A> `0 @P l 0R0l# (K%2> &B P0` l P Lx0X00@0L@BB(K l YрpL T 43\ X T gX T@0@|?KT@ ?0K?K?K'40#0 P0SL Q`qL `i l= S`fH-P+P P0S X PX0C0 0 0H00IH0 20P00S X :X0C0 0 0H@I@YH@  0xS0S X !X0C0 0 0HIH  00V 0pP0S C X X0 0PUH  fH `Y P0S C X X 0 0PU*H0 0H0 VP0S C 0 0PUH@@H@ PP0H   H H(KW T   --LM0 0 K 0- L@P u  50 + 0R 0S$  p  0R00 0  0QS 0*A0 0  : A0 PA 00 0P0  -0L @; 0S0   3 =$00/  Tp' 0 :0  'P %0S0 0S0:0 ;00 00$ 0(  - L@LG 0Sp 0S 0 0C 0 <  -P L@( T0pD ` 0S p' 0S V0`!  P0 00c0S@@ ccpW0 X0 dP0 ``T  -P Lp W`  0S?p 0S @V@@ )c0 `d0 dV0 W0;fh |  0-0L@P  Pw0  00 ,g0 0- 0LS@P 6P f 0P 0P 0 0- 0LS@PP OPP0 ,  ,60 -L^\Pp`@ZT00\I@|0W0,B0BSV@`;[p0 F 00p $0(`pp ``` lW --L4MD@K0B 0 0 7dK -p-`P00PQ0 L4MSP 0 L@K0 0 0 PCKp  -l`L@pP  iPP@ P P@@ U 0S (0S`0< `0``0$ p   9   -l`LPp@  'PPP P PPP T V` 0[⃋00\{00@0d00 0,0$ (` p ` P  lW -@`lL0pM00 0,0< (`0P t@P T00ӧ2  㿌`V@,0 Q00 o0lW -<0@L   @     lW p-LP`@@P`p p- @0`SL0@0? P p 00P@0T:h0 @`DA  A000 000 0 00 p33lWhW, -H"p0LS82@Q00@A2 P 20 S T1 T1P``BTR5 1c6T(P``2T)P``,0DSTEP`100LS P1\H1H5 `R`>  b`P0  R`0rc`p`3V( 0 T # X00 P@0T:t0 @`DA Q A000 000 0033UhWlW -1LM0 PPP0@  Q EQ Q P0PZ0 0 0 0K 0R S P0AS@KKK0@  053( 33V4 @ hWP` d  -0Q0L0 80 00  0 0bC1!0 33hW 0-< <@0PS0L0P033 p- L0@S 0ES00EPPP `0P@ @T@@T000 0H 0D00S000 ,0RP4 5 %+p33hW`WUtV|  -L(@P) P㤀p` P/ U0B@0<PP 0`|S00|P00S 0 33 -LM`ءp, PP  P 1T0 PP1@Zl1@\1T 0T P<100H$1 P,0S1  $0 < R 0S UU* &P00FP  R S0P;P@ @V` W0 `p 0pT 0  33V 0- LPsP @0S00,t0P 0P\@P dg@T0 @@033 0-l l@0LS00 D0P {P}P :^, @033 -\0\@00Lp`0 P 0m,V3 -LPM@NP)t @$0@ @, 00 40 -0S@0h P0,^P=U0CUAU {U  U. (U=U 0UREU! \=U 0UD=U 0U) M= t⮇0⪇ ⦇x /\@@ ,R  0Sb@, @P0 SP@0 R,0  0Sb@~,@P0 SP@0 X/ @Th@~~ P000S z 0S t 0S @T @ , p, k,00, -L M`p, 9,%P, 0TP, RP# @;P NP"dP cPsP uP@=0S@@0P Sxx x x x y Ly `y ty y y y y  Z@ `T"T $T\P$ ( 0S<$((0S))""${P @l0TPS@}P (|) ?dPPPUb,U@-00d0S@PU} 8C80CS!z p{ { { { { { { T| @| | `} $~ $~ `}  ~ ~ ~ ~ h{ ~ @T0\t%@`%@T0\0%@(%P%0%0$v4R0 0 $h$cP$]@Z00\x$@p$d$0K0 SL$0D 0S 0$=@:0\#@$1$0 f#0'p#!@\)|0\#0 #pW#nl#0@pP0S(#  00#@T" 0S"0" "0"= R20"""0 "& x"0p"d"X" 0D0R<20 0 "0 " @TL0 S@ P00S0S dS M!0v @PTR'  O#0  ;PH  C@@@DT 9T @D W+ p,0P(K$ $(,<HLT`hp| 4$) -- LP4MD@KB  0 0 x]K -- LM 0  j K -pL@TTP` T TT  T30# 0R 0 P00DS0d Ԃ t !   !  @     T 0S d  \ 0H  <0  0i~   -@LP]00D. -@pLPP00`P P囁@P@@!S PPPPP@xhC  |L0PSD 4W0 U hD.]X<\]0S0 00 R000QR0[S 0S0 [S ]SQW -L@P0s3 -L@P 0S0=S0 [P 0P]P Ra -@PL 0T 00  R0 0Q [RP@W -PL pT0W:0000`$`V 0S0P@  z@  B0 A?V0@0 p`P -[L@SP 0 d hblW -L@ $P 0 3 -L@@P> L x 4 @ L L x x x x x x L  L @P z0[h茮(0 x@P Xy00h!h@U ,P hWUVV0 ,V3 -0LPp y 0w03&@  0` yy@T@ $0W<0 0 h! -@`L 'SP $S0p0y @%P=00 0@@0c0  PZ  oy -L M`@R0P  0SP2y p A 1 00"@P0Ps 0d^0a@ 0t!00h!d!d0n@V@0s 0@00S  0 @? O7 r 000 R00ӑ R \t r 000 R00ӑ R KlWBW,AA -LM@ p0 0P`+ 0[S(P% PP @  @x g p0 ,Kⷹ,  R(R00 x(KlW -LM4Q0( K!Kp@`0 !00 0P02 WP 0T@T  5P\ 0 0 0 0000!0[S (P000P0<0 KlWW3 -LMHR0!K( Kp^`(2 00@Y!@[T Q 00 @ @ @0S0T0 -ې!0p;2100Sp1$Q0 !Q #Q!-Q ?Q 81p =P  p=0p?08p100p 000p0M * 0p0%P pP !0[S (GpT R@ !0[pS (7p000P0<0 KlWWX3VU p-LlM`h@P񟗪긒  0 @ P l ܓ  , Ȕ @ hBP`w-P%@ $2 0<0xy wQP hw000@/SiPeK P`0: S\tW0<0볺M~LD0GݐC! P 0,;b730<0)0<0"0<0@P}T/@ 00  0d ?0 0<0iD00c<0@0<0KpUV,V|U,3UHV4 -"1L0#0,uP`@  4TG$x / @Q:SPV 0 v V0000   6@`@0  0 00 0|P @00 0T(0v,lW -LP`@50pHU@P P0S -0L@  T0T ?@  h00 0 hlW3 -L@@P>< h Ș 0<0 00c0<0 0<0l00<0X00<00<0,0 (00<03tW|W4HV -LM0@ `Pg   Ra 000p1U 00S0 S XSxS   00S  p p00 0@  ,0 *-R& #R \00S&$\$ pP00 00B S r ,P0W B 7 BR00?,, R^l,BW 0-LM@ K|pP@ L00S00 iu 0S0P 00? 08 -L(M0P  0I    0D !1 `o oF@T @ T$T @0!0K!pKF00gF`P T #00G F 0G T CpC F00g0 0S-00g0   0[ K,lW -L MA #u0pPA040 000 740`V0 0 0 S, M, T@P000T@T , 0  q0<0 U :0@g DA tAPp 0040040 000S00 ZTX U :H0@g DA tpQ 0 g (KotlW -LMK @p-( -LM`p, 00 P@ 0[SP  ß @000  R@0=S3g  zPP`30S PMP @MP 0MP$  &0e k 0  , RZ0S ἼZ|2t,00u ,p 4@ ,0D0 )< @4 80 < ` ! 0T0Z0S 40S  <\80S   P 0 PP000P0,8\0 0D 0\  R@ 000 0T0Z0S 000Q  P0|0p0 s0p00pUs@TW= Z 0   \  ?S 0S<  (KWlWVp,, p-LLH @P` 0`0@PTp3V p-0L @T0`0PP 0  0 `PUZ 0 40Ps0ph)slW|W 0-@LXLs0 0Ps00S0000L00@0 0L@P@u q 00T00P0lWP0 0 .PP 0@-0P0 0@$ R& q 000  RJ0q00  R J\L00q 0  RP*0X4WBG-PW\@ B\D ,\ $\ \ \ %\0\ ;\F\ T\ E\h\ e\M ^\ b\f\t\ l\w\ |\77 0 BqR700S GzRt700S `7\70P: 0s 0 PJ0 Bs 0 P@T*R6 0 0S6f6 0pL'P$ r 000   P000  P  00r 0 @ P.@T*+R5 0 0Sj55 0`LP 0s 0  P0 s 0 @P@T*UI PG>$5 5 5 ^9 4a^  ,\ 4 "\` +R  P%P#J00S@T*F^f^ R@PU00S UD400S 04000dU4 0 0S30 P 00SR3 0 0S3s`30 P4 00  0 00 Pr0  00r 0P 0 s 0 PP@T*R2 0 0St2p20 P0 s 0P 0 s 0 PP|@Tz: Pt00sp 010 0PPe @10 |1 P00[S (S )S {S }SG ]S     P5 p`@bRP(P&J00[S0 (S0 )S {S 0 }S 0 ]S 000S SAQUR X4BWh.tD (0 0S00PP0V P-L@0 p-@`L0@ PR aB  e 00b 0pX4 p-PQL`pR@ 0 Q" 0Q   0S0 a  00 08@ 0  000ppX4 p-p`pPL@ R  P pT8@D00 0S0C0 0 ph<D`4X4 0000  X4LD 0-4@4P0L  0 00 0 0X4DL `$0R 00 pDX4p< 0P000 0HWDD -`L PP@ `0S@ ؉0p00Tω0@S00lj0S0C0 <000c@T幉0@S000PDD -PL3M8 0880 3`@Yt3@0P?0p40 ,@ 0@ T(30P4 S,P,p 0p@ W0h0P40j S P2 0b2!p20 @2 PG -< 708P00\0S00 S Q   U MQQ0SS0… Q^@0# 0´08P\<Q 0P0PQ 0 0S0a 0C ,a 0P00 0R 0S 000pP@T*000S00 ,@S<@Z @>@P0S x0`00ЈX @000D00 S  00c0(KDX4DDDDVDD -`0@ X0LP0  @GT 㦈 㤈$0 0 0 DDDDDD -0@L0S Rn hGDV -L|h 0- P@L:n0h6nV -H0L 0@S  ,H@TT^[@@$hWV 0-@P LD 0 00h p-X`@L0nP,n D0 0 pV -LM@Pq0S aQ 1P@@]QP 00hA 0K 0$0K0p(0K0 p0 `PwPB1 $W 0P0(0AP3G ἃP U VPUPP|00  $0c0u03Q0SP0 000H0 @0 <08040K\.<4X4 ,DDDD|D -L M K0 KK K 寃@P 囇uK -L M@PPr0S 2P 00S hbQ \2@@LP MPD H DΟD>8> 0>P (>(N$>$n > > k.>Ο >HD0 ^#PP@ P PPP,K⌽= ,0 LP0b-Pմ]0 a0bM 0R 0LR |M0Lt-0g\-g@MD]  T@ P@ = =0  c= B = <唬<匜<̟Q  P 0 S<  pP Ro L 0P 0P  U0P  Rl ;0 0SP Rtd $ 0 l \ ˟^ P+000^PP``0^HKH; 0Q0AS0C0 0Q0 0 0ӷ0C 00· R 0S0C0 0BL c0  0P|J0Q `  a0 ` a |:`0P @0S 0 p a 0 g0b 00S0b`0pt0 S P00Sl9` P7 P/ P6 Pl 7 P.  P2*P P-|9R` `P800O T)a0Pɟ000<)0cSsS CS@9@<B8=8!0S 5H0 0CR,8` ^` 0  c< 00 0ȟ0 `0S 0P0 0 8 "P P pr0S7 00C0t'P P P@@ 10@'S7@@ǟ00@007`` P#7/U0 X P @@P}0 S56@0 @@o? &00xF  0y0 PX]0000@ Sl6hƟ 000C00D&00<6P>10@<&S0000@000?&0 0P0R %00( $00@ S 0 00C005 5R00tşp%000d% 0P0, Xş00 y0#P0%005 P P``s4@T0S  @ğ0 ( 0z-00h$0PP@T |4 D3 @ 00`0 0E@s0U3 4 0UxCp@0KS`0$ R0 0 0r|. ^ -|0LRM~Kl dipX `@P@  0@g Kl.td@A -PL M|,S 0,SS0 afS nS 0@K *  |0PS K$8 -FML MP KHp H@`㔐K1,,,Sp* 0,SS& g * 0CpP  upy@p0 epx01` Vڀ@|@0TS1!S00Q0S<QP (KH\p p-L M`Ph| 0(0PX0,P04@000000800$0(00 Kpt. -0LSd0@``PpH  9fP U0SR{ 4 -LMMOKMH@/pK:` ^K: : K: K*00 8 42 0r FhPP,04  0K 0 ~0 082 042 80Kt02 ?K00 8 4` ,` &h@ : :K :T (Kl.(B 0-LMOKP/r:H00 2 )00 (gPK\K0X_l.'B -PQLM Hp '1P  CTP TcT0-{0UCTUtJKH/%:X2CT H2$K@2W`` 0 @V0 ! 1 2 nK G_Kp: :1!01  01 Q q g@PX1S 0! 9>K1 01 01 0W00 S+  0ApP  K߄p@o0 ^dn@t0^K 1 90 1 0! Q A 1 ! A t0J^KPEh 1g@ K9tT -$K0Tlp.X_4l.&Bœ\p -VML MPp gp`  OK/m9 $P f@P t0Yz]K PE-KZ/Z9\0 KT0P ᳀ r fP4pEn KH[BX_F$B -LMM/NKp/`090 2 f@PK ^^KPEPE2~K`,90x 5 @C fP `1X y9P @00T(KX_l. B"B -LM@/K8 0 d0C" S             0 0 000 dy0 \0\/KMfPHK0gS ,0R((cKX_ l.#B(4 -LM;NKe /U80 3 !f@P 0S T`(K'KjKAJAJ ?I  I ) 9 =, r8ğe06 9(K4 0)P0K_Le@P  VQ >K8P)Rğ4$c09 (K02PK8C8sf@K2K T$7K?QSfK<$73S d ddddccQs #3QppK2KKfK0K c >K2K fKK0K pcp/ 78"8Ÿ09 9  7 FePU' K@ 7S a a aa$babbK "77 3CS '7 K@!171 K0GWS y;0@l!P6!(K1 0|!BK66[ SXRK&6[ S@K&BK0K RK KPb10S K 0b3Yt) ) 0\(KX_l. B,"B|tLdlT_@!Bdpx P_ p-L\Ml@KP PW&:`7P) @@.`X7P @K< /\@K< @ \`p0S.S0 C.SP @0S0 C R000C 㓕)+ TP R0@S0 CX0W0Y0 4K4p 0 , ~P (K AMЍ 0-,@,PL(  u\Ch -LM  ZP A!1壟 K .p" 0$#4 'ZP @ 0償]s K p\d 0 DHv#4 ,$vK $) -L M`P H _PH-_Pp= PD  Y0D0 0r ^0ST00`)2P@ @uiP  q1 z@P HzPtEg CgT@gD0S 0  H ᓜ0;0010S $  ]P Q00X kP ~0-SX0S ?( 0@0 <@ *,08 440 0@ *@K, ὗPp( fP ,H存P H(K$)`_\_$0d_`t -rMLMpCKP 2Qb`P^20S  WP %20SL IPG KjPB3`K?^* [P2 RDB@PƘ 0Pp20S 00CS00@Ӥ0иI~@aQ0S 00CS00Ӥ0Ἰ4~ PpyTYTN fPI D~0S  @1 1: SsNK@D @D 6P t! KⳣPKz1PtK~P0: S\PP X 1: S C/K %$K$)d_l_\Ch_ipBB -qLGM@`PfP`P iP`P!Gp10cQZ1pI aK⛖P 0: S ZJMK@D @D+ !P q>1p0W`/S/00p`.P/&P@ 0S @P :0/S @P:0/S@1l 0S\t  wIKAPZl_d_ Ah_MЍ! -0L \C-0 CR 0R0 S00 -@pL8M`PpNPP sP p MP@$"嗠pp5W&R@K0KP< , K 00 @P g`P,00,0 &@Pp W0S< , 0 0 ``LP \XK -pL0T PR0T0 T0@`5K,0T@X >\P <\00S \ 0   \PPe40[S  5[0Se|st Z`@L0VU D00S8 P $](Kx(@H`BC$)MЍ -0L  \C -LMP`p@sPp p0@0dSAT 0AP\G_Kǧ@P <\W ./P@GKZPA -@LM `P/ /00 Q03*,  0,, pW00P0 U 00 @ep 0 QP02@0P5 :0HP *0@@,0 PdW p. 0-LOM@P& @\@0P00 K.{D10@1P0  :#K0t&p__ -LOM@&/\@0P00 SK~.{@10<1P0  :n"Kt&p__ -Lp`-P*+@P04`0K*K0C8M4>K0C4A=K(0C4$QK 0B*K44(I C:K$$P0B*Kp(I4 0 SK  " \ " " " " " " " "  ! ! 40S 0000 0 0;0S000S00 01 )p 0+  (00?0bS fS)0S00 R< 4<̠Č8#Č:K"̌,K$D4, -*K 0%880Sz0 0000 0 0:K P$ Z0`<`:KdK 2)pz0`06PZ@`G0  0KpP T d KP @T`P d p@ d0Kp @T ` y!`Kz*K@FzV@8aAz0SD h8,P 080(x0 0S$o $`@PO dK -dK<K./3[0C3K:K3[dKS3dK -/ R)0S S S"Z  wZ:Kp0S   p ,<4("4!< 03[0C3Ka3[S!@$!Ty0 0000*0S<0 00S 0S 0S8A 000 00 000 00S081 0-0 000 000 0(KS p-PPLy@00+`)@P L00040P0 ((@+pD -L@M` PH, D,0 \13000 55:W00000 0 S,0 ,, pW0000P U>*0  0 @ep 0 nP02@0P5 :*0 eP $*0 @@00 PdW p0@ TP3 : 0S 00@ 0@,0qU dP"(K. p-LOMP@`#0 >|P0P00 UK+xH10 D1P0 @@ :f@  T  00x@Kpt&oo 0-LOMP@#uO Px@Kn+xD10@!\0P PP :1@T (0 x@00SK0t&oo -L@y#000  Phx&G-M T 0 $0@(@ P,P`0`p 4p@0Tp  <0P<` 0Ԣ($ 0,($0P00P4@ h ! @(`$, <@0g\ P. 0@!g.,P(@T<@`0$ 04@, p$0( 04$(0Dp4pHXLP @ @0 ! 0@!0@ Q18 P!@`!@08P! LPpHI$PDHpf.. 0 p 8D0#Hpj!E$ 0#j 0P%@@X@ 0H @^LP@D PpX  `DHL@PPT@00P0 00 pD0 00H000000000 L@000 PP`000Ѝ G-M0@ P0@0@0@0@0@0@0@0@0@0@|0@t0x@l0p@408@,00@$0(@`@p@P `(p08!AQ aq$(\,00P 4!81@0  0p^P0Qp nt ^Q nt 'tP@ t ~ 'tPp t 't0P0L0#,0 #(8 , 4 #@ H0 < D H #",#,L P H .(#T X H "D0\ #<`0 D d "(h D0l #4p0 @Dp.\..40[8[T@[?  08^P0Q8 n< ?^Q@ n< &<P@ < u8 &<P8 < &<0P0D0#<00 , D04 #880 @0D#\#.pT.l0[#4<8[0@0 @P劐pP0(KoA 0-PL@ 0#<00#800#400 R00h<$ -pRLPw D@A1>0O `cWP: 4$@1@ T@D SH0 0@H0L@pf.$@1 0S@DBR@H0 0@H0L@@00 @TpG†@0D@ S H00 @H0L@`W W  P#@1 0S@D RH0 0@H0L@ \00-PLP %@0@0D@H0L@0d  -RL`? D@A1>?0( @PcXPp: #@0!0@@0D@eh#@0!0@@0D@\@00 @@0D@@H@?X X  Pm#@0!0@@0D@ D00-PLP %@0@0D@0! -LOMP`@rp 0+Pr0 S 0r 0p WKI%H1 s000rP10H1 KQ`0 S0$00DS$0 0!$0D -MLM`p$!PP) 0V0 BNK@D@D 0 PP0 Z ᭺P4 W\  C %@0`p\0~!{!P$$KB  -L0M`PpP) K.0 PB 0S r0"S UD@K $00 KrMP(@Su("(04"48#K -鈑LM`, W0RSd0 S SMZK hP0U UP SBU U8p UpK0C*KK*K0C M8>K0C8a=K(0C8Q=K(0C8(P 0B*K88 C:K((40B*K88( C:K( 0 Sj q k q q q q q q q q Ln lq q 40P0 P 0000 SL0SRL0S 000 00S00S00  0 .V S:V` 00FV08 K2+Py40p@P  Zp 8K p4Ah;g0 00lsp 0y (00?0bS fS0S4 0R  0 :K(45<*K 0F880S 0SP\:K P(n 0S<`:K(0 5Z`P0`0*K84pL*KpK pf0`0?P:K8S@p KP@pH K*P T pH K*PHK P|`P l p@p0Kp @ T HK -p `f*K@fV@4af0S 8>P 080(pw0 0S$ 0P04 $`:@P  pK_pKHKnK`F4[0C4K4[pKS:K"r_*KpK{:K8"`VR0S SL- S SG6Z:K <*KuP8*K$"z2Z0*KgP**K @p#:K ZY:K /*K Z Y :K !*K p 4[0C4K4[S* @$' Te0 000090S <L mp` e0 0+0S00S 0S4A 000 00 0P0S00 00S041 0 -0 000 000 0 `(KS -L@`pP 0A@ -`PL@eP00pPP d0T04@0 T0L0P0 Pi   -LMB^KM`PE@p x0P 0 @@P <00宭PP<4p8@ Ks -L@'P 0@0B -LMBKMH@`H p 0 S񟗹pt t w w w w w w w w w Xv v ht <00S00D00 pS:fRxR:0PI0 J"00003 J000S03 03 S  :J   60K0UI0 0 0CS0000վPU  ?K0CUUUXPxPPE ;-0 80#b=80#I@   0p@  0p 0p @pp4# 4# 8 0`_ H?K8RPPJ,0 9R 0RJ#*-R .R +R!ER eR  J  J9S:J0 0CS0000YPX   _K@PEtpT-xePEP fxc;0 8@d0p@ 8[d0p8P;0p4# 4# 8S 0e4P4 4(KB" -DpL0`S@P5K 0@S3KB -L M0`ჀpX 0S 0@P0 'p Ҁ@ d0P0&p@  廹@  b~$K -Ll'l7 l  @0S1&*l@ @0S 18#X `!0 8#X`l @ PQ`P`  P 1P` 0 P` @0S10P`P`x0   H *0K@P㊡ D D' Dw  28Wp\Dw  PD8WPaD P"P0L7 )0Kl' l' l7 l  @0S1 `B `>ll l  @0S1&*l'@ @0S 18#X `!0 8#X`l7@  PQ`P`  P 1P` 0 P` ZH l l  @0S1 `B `>l'l7 l  @0S1&*l@ @0S 18#X `!0 8#X`l@  PQ`P`  P 1P` 0 P`lw 0  *K 0)0K88Yl0̣l 0Q0O/KD' I R OK2D 5 :R3 58wPD7 Lw NOOK!1 D>A0  `P`D l+ 0R000`D & 0㴡0 0d夡P`V U00 DD' 0DO?KD7 Hw %2 D>&B lP`D DO?KP`dU8L Q Y 0.K⠑K)0KL7 D' P)0[LYS*0[Sl70t7 1K000` \0 R0\0 ` PxdKPPKDT'0B0` \0 0R\0 ` PxdKPPKTw87@gTr`2H` \0 R0\0 ` PxdKPPK@DT0p@` \0 0R\0 ` P pD0 `  \0R0\0 ` PxdKPiPKXK\' ` \0 \wR0P\0 ` pW xdKtPTKp l. <@iTaP'p'(` \0 0R\0 p7` 0p7 xdKVP6pKpw @DT0p`@` \0 0R\0 ` xdK@P <'h1 R 0`R\0Sh  xdK.PK0p `0 \0S xdK!P0`0 x'0@0h7 NUp 00hw PY #@P 0KP DVh(K.. -DpL0`S@P|? 0@Sz?BQRP000S0 -LS`Pm @ 0S\00R001S @ 7 T0p@ 0\ T0Wp@d 000XJT00S <0@@ \ 0 0l<x&$B -LMGPPX 00z`10>CNKTa@D @D 0P3KHH h p* T0S \PT3 4`K XpxHK0D@K0@3[<3K03K\ Ti  (0!"(80S yT00 @3[P3<8ӜP@<0X0P(K輹  0- L@ ?pP  0p  0p  j>p DT0$S @T@^<S-!@ T @!  8 8 d, X100,0 00`VZY`w 0S0%5,0 r<040R(0 0ZY (K`$p$ -LMkP"{`@p{xb"Kq 0Sn"[0hS*1 0Q Q Q QD1Q Q6 Q=  O4!Y;   !O! J&" 00S   0S   [`0 $000 0S 0"[0hS,0 0 0ST$ $ 0-< LP@ P0 -0L.S@P#P*QR00)uP00X0`dS F>R`V@1@! WP P0@0S.pJU000U -h3LM00< 00 0s 00 S P R P u@0+S  -S00  ` Pp8 4 !R ZZZ Z5@ I$`VI"0I845@A$  8 4  0L.\  0 S00S@ P 8 0O4S "8S 8P 4` `4` \<@8 K  V d1d0@0\ 0 R \Ap 0P0 eI00<110 0`pJ W  0Vd9#Zp `p X 04085# <0 @T'I00 (KBA$$ -?@p##pWL$MX< 0O?   BE!5;t l@H"0 01`V#U!42T100  8 4   0S8 4  0$T 18K1 8 4 @T0 8 40 000 8 24|A$p0OT?@ 00@@#U[ UDe VZ00@@P` @ < 30 0r03Z cY 0zdyVUZ00@@l 0@ 0<X  D 0 0<4 ` (K$$$$$$ p-H<`LMP@1Px0Sx -LMP@ R@00 00a -LM@J0pMЍL- 800Ms00Ѝ p-(LM"X`  p@xx -LM   PG@"00S0  @0 $ !K00 @P $K p@K$ -LMP p@ 0^ Ƞ,Ƞ0@P` ("(p V`00 K p-LM ` Ƞ,H@PP  p 00jKp -1LM`PV@7 0pA("S*pG"0 0(Q% 00{P  000 `0 P*@` Q$0@0    ? - 2L F0S F0#S 50 !S0S0` 0C# @U  000PP P.@` T0L 00P00 R p LX0 Q dp  PpWU ,0 dS(K .  % 0-@LMP$0 (0P0CP<0@008 $0 R0MЍMЍ0McЍ 0M 0 Ѝ000M00000ЍMЍ -LM@h 0-LM R00 0P0@pm.00C08h -LM@0S -LM `@p 0QP@150` !!@c + RT -LM0MJK1@D00@D`* 0 LK P Q  0000 0b00@sPU:K0C00CUD0 @ 0s 00K<0 0 ,0 00 (0 8 0$0 LpK  `p@ E0S E07SE#00PE@ U p -00 0 SK% -LJKM@DM@D`*p  W@  0p000 0b0QZKPEPE EEp@ E0S E07S {E#0 0 PtE @3 K 0-LM 0PQ@^E"0 0P0 0 0 8 0-LM0 0S@Pp80  8 p-LM0P 0S@`p 0 000x p-LM` 0PP P&P@6P0 `0`x -QLM@*P T@ -L$M`p@0 D 1! /< +P +L%@,ZP@& + =%p@ 8PK  00 000 Z00000 ,1080 4@ "%pP,D@Yt2D0S. a< 0p P*%@D?00tD0S<`l d0p P*8$@tD?00@ R00(KH,(%wd 8%,D% -LpM`10@W,0   @KS@PK ὚"p@K@ % Zd`P060#0P@U@K5 ᠚  ᜚   4 WgPP8 $ P@ Lg@P8 00S4 KP 4 R ;;S 7g@P"0 孋<P 4l !gQ@  0 8K̜@PVR m$@(K%H0 ,%%"RMA Q:0S Ѝ -LŸMS 04 < `0 80 @ D Y00K00@厜PPU 004SQ@04 S  P<0eS\00 @000T:0 R 00S S0B00 08 QR 0E 80R P000C00 0<pqp3\pW  @P<<@ Q 0 B00<@  pX00V00S< < R9 P4 0<pP@"0B 0S S 0S 4S8  S4 S S 8S S R`00 0S 00<D R<(K% -aMLM20$0 pP" !p` ]KPE[NK@D +h 0K 0 E 5 U\e !pT9)cKYPXGk06: S  S [NK@D+A K@@P[NK@Dp1l!T 0K@@X@9@UTSaD[NK@DP!`P@0S m K0UCB!`PX% !n/K2!PX[KA(( K2SPX [KhA77\00S $0 S4ޞ K(%wd ,l&t&$)edA&&&& -LM  K K0K עP K 0-LM@P PP0.S 0a C00C0  SRQ88 -LM  K K0K 埢P K -0LM0`p  $0 PPK&>PUOK ` SK`,KK`J✉.*P_KY52( $0 SM K&& -LM@Pp@ 000C S 00 B00C S 0.S 0  00B S00EP@000C S0*S@0@SU T0 0B8 S8< 74`@T@DP(&R( -PLMb2 pP@0 %Sp{0BS| 2S- +SI .SI %Sm3S >S7iSb DSp dS nS rS 0 &`*`( UcU V*dOd0000P V* D0 V* #0000c00 0 RPE PC0 U0ppP;0PUU U00S!0S 00S Q0 PP U V{*PP Vs*0  BP>10CB>A#>A0BPE0Sj<@@f  KPW*(K'6,X(T(v p-L M`0`@K$ KKK`KMsPP$+(0$000Kpx - 0LM: rPx -(0LM KrP Kx p-ML Mh20@0 \2`(PPDPPAK@0@$0/S PAK@@ P 0S AK@0@! P :AK@@AK@@+A.KI>K B0C B0C$ :S S S:S0S QA"*0S0U0 0S /S ksP+AKIK@A @`A d HvPPT00S +:ϞP 0S` T00S <0P[u 0 S(hKpx''0'|<'0' -,"L$Ÿ M RP`@ 0 0 Q 10m Q 0 0P`bN Aʠ^   0b< 0BcA4H6&? `? 0S_ c`\ Q @ p^00P00S P@T00Q n B2`p? W P  |0 ` 0:5 6!ƠP `* -LDM\p, 0 \0QD0XSxS@ P<r: 000D4 W @`  Q#00ӑ iPdd#d3e/0T02@0 pW: @Q q "000DTpG. v00A SsԢ` P@ lj Pv"2$TaQ 00A SpWa:/QQ@ .QQN00A SK/Q!D00A S00V0S< @ 7j P$ T9Q *00A SP&Q@"V t0S SS0h1P@@0h!0Q  0T2<@0(^PK2 1P<@(0/@P00 }PT@ dK0 wd0S@ <@00</00@ ,0 S,(KB'A'p''''`' -L M 0噓['\C -LM0 卓O\C0( -0LMP`0pK00KP i 0 ##SVPU`0.T00S` U @ TU 0K (Kh( -h2L M0P,0 PD  PD<@K 0:S0:Sr ` p@ H >@PP19P 1@ RY0cr1WT @ %:TXZ I0SF H 0SB'$0 p`p@ .T5`,0KV1 hP,@TX  ,0KR!0'$ p`Z<K 0Vj  0\0 l^A0VD<K 7;/00 ,0 Sę(K(t(\( -QLM@< P@0 Rn;0 0~P8 < e yꕘ$*`@ P@&@0P  0Q0p <净XJZ p< e║!0 4 4 080 R4  0 R0<`A< ꕗ$*@ Pp@! 0 R0`<0pWV㕖' `ᕖ$8@ P 800 R  0 R04 <00Q 4 8 (K%%?* M0ЍU --LM0 0 K..(* - LM0 K  p K -L M@P4K0`px $@ PPP00P0#S :00  $0 S̘ K(( -L`M\,  0  \ |K M! BB/A?/A0(K B 0bT 1#QT ` |K1Sr @@r v T` Qr v T`v Z`ZK p. ;v W 0WW10SG*:*W @T>*: W VZ Zh0L S   dNP@ @|KPd!1[PPpW00P0#Sv 0S ,0KR*:00ZK .0R:90a @S@900 9/00 ,0 S(K( 0-LM 0@0 @PK0 `(MЍMЍMЍ p-L M@P`꺁P0fC @\000C S 0 tKp -4L,M TK@KT0 P@ ]qPle/>d4@D0 D D R*0S0 |S :S00$m  $@m: @lP#X0@0X0H K%mpH0C<HPK (0@mH0 00@mH0 ,0@mH0@D K40smPDl  @PlpH0 8#(3 H K0@lp2B, 00H0 800H K7@lp8 40H 2ad.d>`.`>n@PL.L> 0b@P=l 0FP l 0?PlAl l R0h0 l=K1 -PlࠣA h l h 00l0fS0SaBC` U|0 U| E` E^` ` \ x |0l0ll|0 x \  R @R0@0C0 Ő@\ (, (, L, t, , , t p d # d 0  `t  p d 0d0 \ ` t p d l 0`V0Ft` p0 `t` JPH  t\00S2 l^+; NB1`p;K @@ P`tT p  0"l @bT ; 1 KDbP@p` @PV ph0S :  dtP00\00S@ P p^  P:lp A< 8 t0l80 <  0 :O8`^ p@ UA 9 0 0p`1P8 L p 1!Pd8Qd)1A 0 dI 0HD @b 00@ 0@`PDPD  0< l  0P 8 D8\S' p8 `p0 0  H@$ 0 0`Pe>8P 8 80@ Z 7@ 7K 0ᬶPlʄ K  0ᚷP 0x0S <l O`pꌀK4 l0?Q0Sl t R00Ӭ61 R 6 0!PlpL < @H P 0N 0 0S000 0@P=P ,6 t Y' 0R 0@P@P<l  0P HXl 00 l 00x9S 000`@Pd0S|PL0  X\00CN@6@cxPL  `|` P| `0RS``0|` S 0c` Pc `cxQd R L嗹0PL0  T@P TԷT@ Tx剹PT  FpP \\ }pP d@^00S X 46S 40 S `P` \ R0 016 0`` 00 0cS0C` S`0` P`UTwPT ^ `QopPW h R T&PT  PT H T L  PL ? l0p0Cl0 t t^&ʐQQ" ߸pP- t R TPl0<0 L pHl P H100<00l0 T VLPL  ZLLH@ P L L ?@P L0  ! PTPT巶L`᣷@P 0SPT᪶P0@ \ U00S Y9T* V1@ V00S YT0S0SUTķPT ~P @:T @U9T0{900t'()Q?aCoc?`(?yPD?ndn?$@@@?@ t0@RC T  *PT w PL\  PL l P P  PP c L  PL \ @@ nHPTu0@T@T0  \0SP ,t UPPT = P TMPT 4 P  H X100l00l0 0x9S 000x0S >L\ P^ ^6L4T2 0lS00 H H(K -LMp3DD*MA Q00  A0S 00Ѝ -LM4 0 -[à`8  @4pKP4t< < < < < < < D< < < < < < < < 0< 0#2>;?C0C,  4K2 #4 0 0#2>;3Sa SC S- Sy'S- St4So S Sj Sj:SL Sb Sa^S\ S\: SW "SVH&S SQ 0 P!P1WWIXF4!W,1W? W< W8>32 0 00 0->400 2&0aPC E 00>  >3 0>3 S0 >01 >3 S00P@ UsЍ -LMp8 Q04 Q@0 0Aό  D0Zl` X00 X00LR,@P@ V00  V 00"U00P@T T 0  @Dʰ1U  XD x 00 000s03_X0S  V vd 0  0 _V00R08!SP X" x 0  0 _X00R0S U  V v 00  000s03_V0S PA?E0CS 0  0<04 80 Z\0 04  @\0(KB -L MPp0 0A>#R R R >3>3>3 SR8  R R R R RR RWp0 0@0  000 DPP`I 0`P 0 `pw0 0`0  000 FP@IpP 0P  P00S0@P R@ 0rpE0 00  000 JP0 E0`0>3@ 0` 1>3@1>3"S@D0 @~ PP0 @<p 0 >0c"O 0 >0c"O0 @ P U/(KG- M,0@H`pIP>3Sg SD S. S'S. S5S S S} S=SW Su SvqSo Sq@ Sj "SkV&S Sf0X !1XX]YZX!XSXP XL>32 00 C 0 > 0>0 0 `0 S004S0``C/ 0>0 0 0 00$ P >3 0>3 S 000 0>0 0 01>3 S 0     0 0 0` V] Ѝ -LM8  0p 1>#R# R/ RR4 R R~ R&R8 RT |8WW 0RS8 WO 8WJ >32 0 0A pa0W0[ 0W6*0W0W0P -,*0 S)0H% W0 0W*0W S0 W Wr 0_R  0W * 0W0 * R0r 0_R 0W Wr 0 _R  !>3 !>3 S .Z00S\R 8W 0J000 Q>3S9 SF SM SS Sd S0>S4P "0st `@S dR 8 0dW  ᢡP040 !0S   8  0P>3 $0 1p 1WA  >3 q 0c 8 P\ @>30 @C1>3@1 >3"S@D0 8 @P<0 1>3 S5 @>3@d_8 0 0 P0 0 @>3@d_8 `@ P 0 ~P0 0` p(KB -LM8  0p 1>#R# R/ RR4 R R~ R&R8 RT |8WW 0RS8 WO 8WJ >32 0 0A pa0W0[ 0W6*0W0W0P -,*0 S)0H% W0 0W*0W S0 W Wr 0_R  0W * 0W0 * R0r 0_R 0W Wr 0 _R  !>3 !>3 S .Z00S\R 8W 0J000 Q>3S9 SF SM SS Sd S0>S4P "0st `@S dR 8 0dW  P040 !0S   8  0P>3 $0 1p 1WA  >3 q 0c 8 P\ @>30 @C1>3@1 >3"S@D0 8 @P<0 1>3 S5 @>3@d_8 0 0 P0 0 @>3@d_8 `@ P 0 ~P0 0` p(KB -L MP< @0 Q`40(@08 4  VI@ 000 0Aό@ @0Y|p Z00 Z00b,@`@ W00  W 008"88V00`@T @T0@ @D1V  ZD z 00 000s03_Z0S  W w 0  0 _W00R0S` Z" zP! 0  0 _Z00R0S 1V  W w 00 000s03_W0S `A?F0CS0@ @0@\00 08 00 帞< YP  4^0 8Y@ 40aO0(KB -L MPp0 0A>#R R R >3>3>3 SR8  R R R R RR RWp0 0@0  000 DPP`I 0`P 0 `pw0 0`0  000 FP@IpP 0P  P00S0@P R@ 0rpE0 00  000 JP0 E0`0>3@ 0` 1>3@1>3"S@D0 @h PP0 @<p 0 >0c"O 0 >0c"O0 @ P U/(K -L|Mp 0 \  >R(00  p S$0 0    0 /Y:<`V Ph@ 0R0@ UxP @PE Tʠp0 ` Xp 40 d \0 H0 T P @0 <0 80 T0AϠX0d  `Xl0l t P0tXpl|\ Vl d00 V`0d0 ],@P@ Wd00  W `0<U, d0P00@T d T 0  @Dp U  VD vd 00 000s03_V0S  W w$, 0  0 _W00R0SP V" v  0  0 _V00R0S U  W w+00  000s03_W0S `[A?E0CS 0d   6<>  X00S  0td  &`ZlRL  x\HPH0S dPKL 0@PL00L0  ^H0Sf \Pd0 D\ \0S  \02  d0D0RH0S `0 dKL 0>LQHP ׃H L0SH0S\ dKL 0>P`dPKL D T 0 2J@P 0 * L``%PP" XL0`0`O/\ @P` d0D0T\02P`P`@T\P,HP      0    ^*<`V @Pi 0R0@ UɛP @PE Tp@ d ` Xp \@ H@ T P  5P@ P d0D0 < 0 0D 80 0 0D 40 0 0D0 0  T04Y80<@x0 d0|  |pYs00AϠ0 d@;d0 x'h P0d`Yx nhP  Wh 0 W`0,@UP@ Z0  Z `0``ş`%U00 P@T d T0 @D U  WD w 00 000s03_W0S  Z z$ 0  0ğ _Z00R0S P W" wx 0  0 _W00R0S <U  Z z( 00 000s03_Z0S SA?E0CS0d  0 Y00R0Sd0 |d0 xd |0 pNhL 0S y\H@Q H0S dKL 01@PL00L0  ^H0Sj \Pd0 D\ \0S0  \02  d0D0RH0S `0 dKL 0!LQHP H L0SH0S\@ adKL 0PPL D T0dK H@P0 dK@ LPPPP" XL0`0`O/\ @P` d0D0T\02P`P`@T\P>HP;@9 L0 SL0S(KeEBR* M0-LM0 0 0@ P~K0 -LMp`@ P@D`@0c%T -L M K** 0-LM 0KK Ɯ0PS8r @r \r pr xr @r 8r dr @  0$0%K@%"00@@ AK0d/1 xB 02 #4xB 024=> 0&]@-1@d4xB 02d @-M+Ѝ@4=> 08M Ѝ) -LM K> K -L MK  K6P K -L MK  K)P K -QLM@ 0K00#0  60p03T0S00#0K MЍC BBM*A 0-LM 0@P᪦P d0圦P8p8 (0EP88C -LM 0P`Pp h0(P X0ᶿ@ <0尿 0wpC= -LMp `P~P@P 0S@W P }P @TP ~@ -LM 0 0P)P4M<P81#8181:P02410!0 < 8#" Ѝ*\\* -R00LM?@ D $R D R@00$0 < 80 00P2@p0 @t 0-T0@40  +T @4 4  z 3Z00S 0T0XSxS@p R 0T  Po 0m 0m 0< 80 0 00D S t8 @!0002 W070c P,\(80 S<@T <0\8  R00@P00S #0 < 80 "00 <0<@8<# 0O<0 8@ @40\00S < K r0< 80 D0S \pG@p @D@<K(KB -RQ3LM@`P :Q :P*n#W000@@00'@$ 0,` 0(p S,0K80 040 0p  0 R r 1S018K80`0S V 0` @ KB p-0L$M0PQ`0 AEP P<@Kih 0#20000 Q0 0@0 0 SQKp@)) -LMT0@K`P$0 p> $ 0R 3 K$) -MLM@lK, l p`PP@ VKA p ;$U eXW 0ZlQ )K ᱯV U PUo0 ONK@D@DV  U zpPʜ"@ "W@lKV ,0 S ΀(K0) 0-@ MPL 00K0 -- LM 0  -PLM\ p` PP@yU  0(0$  y\CPjPMЍ  -LM@P4$    0 0 0       T 0    0 0 0       0 H ` 0 d R0 0D<4N  "0 0 )T)l)]*Y*AS*- 0-Y+ ̌!0M0@  0ЍWW9*QQ5* --LM0  0 KCZZ#* -PLM `h!00 0-LMPK@RlP@  R 0S0U Q@P P4l!PK0 -L M0 y K* -L M@0 0 S00@ (0 0$0 00K 0 00 , h d0 R r 1S018 K $0@0S T KBCB||* -R00L MH /@ D H$Q D R@002! 0< 8 0(3@0 pw 0-W p4  +W0@p40 4@ H | 3\00S 0W0XSxSpH  R 0W  H 40HSQQ ȟ@@ 0a]0   03`4PQ 0 R0PH0@ c`0 0@@d0@  < 8 00G S w` !000Z W070cH0PS\O4@T# 8 V<U < 0R8@T00 P00S !"<0<@8<# 0QO&8@T<\ <0Q8 R00@P00S !< 8 " <0<@8<# 0O<0 8@ pD@T \J@ @D<K(KB=*=*<<*UU*::*: SMb0  Sc0  Sd0  S  Sl0  Ss0  S-0p0?0 0r0-00w0-0 00!=@S S-0  S ! Sx0S0s00 r0-00w0-0 00 \ \-0  \ 0\x0S0s00r0-00w0-0 00t \ \-0  \ @0\x0T0t0000 00Ѝ 0-LM@Pp Pp6Ep Tl = U` p@ T888|S66***0@-RM@P \4, 0L 0lRQ@PЍ0M3P3܋   0 0 0 0 0 0 0 @ @ @ @ @ @ @ T T T T T T T T T T T T h h h h h h h h h h h h | Č ԋ ̌ A 10=009005001001,0010014#001001Hp0h00\00L00 <00 ,0(00L 0PЍBpDx/L< 0-LM@P87P(008/P008*P<*X<QM R P000SЍMЍ 0-PLMP@   01S S  R 0^0T0 0 ^  RR11:008-PM Ѝf.0S1 P P10:00Ѝ -PLM QoT0 0 PM 0s3Ѝ -LM0S U 0P ( 0 $ >0S@ !88S@ ::S : T00@ 0lA?0 B<R<00  -LM@\`0+Q`L RL \P %VP?0  P 0S 0S0 [ 0S0 X T00&0 P|3Rp1p!0S?0\:\0l) P6;@ S:0VP0 -LMPP`&RZ 0S00S)0 R  d 0ypD pB P@ @@pT:6SR 0S00Sp@"~T00#  00S d 0Fp00 p00 P @pT X1:00 -LM`P4 80  GP00LXP=@Pp0K0QQ=  pP6 P@4 T/00SS0&Y p@  0K@t0K 0P0 T P804 q ZU1e@:0 10(K 0-LM@PPU@8//@* -2LIM0TK(0 `@P:KPP50z WeV? j 0Pұ@P 0lp h0 l0Kd0 0`0 dK0\ K PPX 0FR\I/3@P*1 0R& 0R" R]3"" ( Y5PP @1R <1R  81RD3 pFQK`-5P93 (0 Sz$K,$** 0-LM@HHA/0PP PA/c@P AP@8$ M ЍWM 0LS\\ 񟗕( P ș 4 \Q0000aQ@ 7Q 0Q'*$QH -Q00 QK@MQ EQE7\Q =rQ fQ, nQ bQ8tQ" 3 03:vQ0G00A00000 0 00600 0 0 00"-Q0 ^Q0 0000?Q0000 0A0S010000A0S0001000 Ѝ -LM0p`@(K(0  0DP ؚ @@00 PU( K0-P@Pg K -0LR M p`C@-K4K4  C  0P T-0[505@ T-0[505@T00ĕPU-K4 K0PT-0[505@T00ĕg(K@-AM@0gS -S0 XS1 +S50oS uS0=#80  0 30100  0301000T 0ЍI@@-gQM@  =Q +Q -QXQ1 oQ uQ, 0R0- 0+\ 00\00  00  00000+T00 -T00 =T000Ѝ -L(M@T l8@K04K 40 %`# /P 00 00C S`L  <` P`@ * 0K |00`0S>0S T "00hL0U@1:  u@PP <0p%=f0 0Qp0gS aSoS uS ~p'}C~pp+Y -Y=Y E 0D0=Y0D0 H | 0sS gS# XSoS rSuS :wS xSyIW  W 0 |ꒀIX L U:@  @  Su@P 0f0P@0 D!L `<0  PH +Y00R0D=YSD  L U:@00 @0 *u@Pc @0f D0!PL `< H0X PH L0U:@  @ u@PE 0f0P@0 D!L `< 0PKXD =YRLD0=Y0 UD0 :@  @  t@P 0f0P@0 D!L `< 0 PH R$ L0U:@  @ t@Pq [0f0P@0 D!L `<H0X ]PI H !0S ,SpX+-0S2 `0+S -SXS@0-S0 @ +S0 @XS0 0`T@p\p^p (K -R00LM?`p$RW00`1P0 @t 0-T@ +T@ v 3V00S 0T0XSxS@`P R 0T ``n0 Z 00D S t 000 W070 cRQ00\00 R00S,, }"  @Q00 SlW QE (KBG-1M0 `p00B Sn0R  XRxR   P00B@@ S<, Е^ Q r 0D A0a00c ƒ.R`VC  R Q;r9 06 0mC10S% Ȩ D ` \)*0Š$\"*0S R<8\0SP R<84 Z ,< $8 #$,, ЍB -LMKyP K:*6* -QLMP`pPp`p00 Բ략@ᴱW1A* -L M& K$$* *@-\QM@  @Q*Q?Q [Q#Q p 3000#"10# Q00S10# Q00S"20# Q00S  0A QSp 2000 \Q@S Q Q# Q> JQ QF& Q*  Q Q>*0\  n00\  r00m0\  b00\  a00\  v00\  t00\  f00\  s0\00 L0 R00000Ε< P   ?Q*Q #Q[Q \0010"#0 000 0@\00M00| `0000  0^  Q?0@00-  00ЍB p-LMP`@00 S  e0x -LM@pP`T0PEU0 @U 00g0 -LMp@` qPP@  @x`PPo` -LM8 `8#1!0#  "@0 1K @p<0 @ D V\Q  @Q*Q?Q [Q#Q q |000 <0 Q00S@0 Q00S&20# Q00S   0A QSq 000 \Q@ T4@D"p#*p01K gD0pcP U1K @ HX HQ T:8\000 SP1pK0Gg@0S i(KB<*bb8*4* M0-LM0 0 0@ PnK0$MЍ -LM K&P Kwt@MЍMЍMЍ -LM K  Kvt -0-L MP0U0 @0 0 0Q a0)0 |P@T( ,K K$0K$ @, @wP 000(   K0(P$)(<**==*aa**pM L0000 P40 P000ЍBAA0 S0M00Ѝ, -@LM $$ R*00 C R00T0SQ00T0S  @-0P`p @M 00000l0P20C^  00C 0Ѝ0S M1>3 01Ѝ p-LM0@S`x  >pPP x` Px p-LM0@S`P 0S0?0 P  0 1 x -LM` R*P*0S0]SY`pPhP0Sp@T U?(= 0-LM @R#3+ R!*0S*0[S.Q00 PR *0S*0.S0]S00 8 8 -LM@ 0SP* P &  P ^000 `0 00Vp(@@ oP> 0A0 uoP00Q0 1#"0"Q00g 0Q P V001LB"A2A` B,0V 0000@0@00 @o R*0^S00 R*0]S 00 ]00]00]0 -S00 -00-00-00-S [SR: {0:S =Sw 0S0!#L+00-S]SE R*q Ɵ000ujP0S p@ T #0 000000Pp 勽@P@ PW @  @  g`00S R!#+ R*0S*0:S0]S. ] 0S0!#+00-S]S =X 0000 R!#+ R *0S*0=S0]S00/k pR*0-SQ*0]S -P00W@ @ 0000000SQ*0]S  R*-S0]S  -00-00-00 R*0]S  [0Sb 0 0h@Cp0 t 000 &P 000000@DT Y 00C  0N@@000`00^00  00 00 0C0p 0 0P\ 0 0PWo 0@0S00T0S 0 0 00Q\ \ @T:`0  bB"o-}$4*<*B< p-L KM0P0^0 0K 00KS0`0K 0@0KP`Kp -LM0` @8P pw 0000 kP #0KP 0]0@ "0K0#pK!0Km@P 0S04  4KB -LM`RP@p P 0!"000 -LMP\`@ 0 q$0S0$0L0S0L0 Q   fA! BV 0p -LMP`@p0 ST TW0 W000St4 < < < X `  f00   fT  f+" K B a"  .@0 f|  f7  f" . B a  % HpG`@  f0W  fi5@DpG/@D`vi -LM0 \@0 :P(0^S00  (00(0 ,00,0\Qp0P!#c+0 0|4W$Wk[W! *W .WJW' 4W $W OWwt4W l$WpL00   i(f& a  70D  D 0DP U 1  R *0S*0\S0)S \) x U 1H  q R *0S*0\S0)S00% !<0`CQH0S  T H v K0 H U  - R*0*Q 0 0 hl  h'   h0`  hPSv*\Qt0{Sq00 `R*0,S0S0 *000C SVP \P 0V R *0S *0\S0}S00  R*Q*0\S0}S [ XP R*P*0 S0 SQ 0 0C0 (00(0 0000000 S(Ko0$W (K91)>{} - LM@0 8 R ?U pe +U*U`*$UM (U.U\^U7 [Ud \Ud{Uv |U|HR!#+0D  D 0DP U 1  Y R*0)S ) U 1H  H R*0)S T   : (00(0 ,00,0D , (00(0 000006 .00P '  "R!#+0<Q0 >Q&  R*000C S ~ R*P*0E0?US{U0S*000C S0Q0 a+U *U?U' {UzB 0  g  g   g0  g    g0  gT 0  g  g  gm " B ad   `R*0,S00000C S\  VP P 0 R*0}S00  R*0}S  Q* *0B0?RS{R 0S*000C S 0S*P|U 8 U0 S R/*0|S,00 0R    j 0V 4 0   i04 aC0" 40 t4  a  i (Ko0 R (K -0LxMS` 倀0  PPa *).P㧷@P % 00 0 iP  ᪴ 0K0 @ `   P(0 PHPP0|P40 pPP P(P,P0P3S S SS S SP`B B>3!>3S S "S (00(0@0P@P >3S@P öP<@@  >3S BR000S   0>3S SPASQ(00(0d0L0D 0 L0 @0(0KJ0S p(KEe -LM l0R @T T0R000P{PxPu<PrhoeE -PLM 0@ 0 @ K0,K0 T P0@,0 (@ ,K --LM0 0 -H0LM@`P4 0EcT Զ l\CP33_* -(LM"x H!X` P  h᩷ HU -LM,K>2 2R (0 Sa ,0S]n|2t" 890h2 \ (084"#H<208#Xe@ 2@K r X`iV@ T S XZ!A 0S1h1 " 㘵P"ۻ8K8Kd0@0   S9001Q1 0@ !0.00 !@Q0 \ ( <@ 30B320 0 R0#@$@T0@@K8(@/uHy<>@BDH/,@F*@ -L8M\$ p`<@ ^P @ PU@V@K 02R R @ RV@K 2 )` 2J}WP  $0 S i K0@<@Q\/P/)*PP%*;;!**(MЍ -L M0 b K p-0LDM0PQ`0 㷴P P\@KUh 0#20000@Q0 00" 0 ShKp21 -LMT0@K`P$0 pM Ȗ$ 0R h K1 -MLM@lK, l p`.P@ VKA?p c;$U eXW 0SQ Q)K ᇖV U PUo0 ONK@D@DV  U WbpP @ , W@lKV ,0 S @h(K1 0-@ MPL 00K0jjJ*F*A*=* -L MhpPA 0S> ,K wgP6,0 R% 0SMR GR KR R kR mR gR`PA`VK 5` @ `[F`Q@Pڌ% TpLX`0XX `P0P00(@$K2Xh(2P@2\2P|2 --LM00  K 0-@0LM@P ,,`T   8h\CP-p0M0S 0 CR 0R0 SЍЍ00ЍB -@QL@Mp `żPP @xqP 0(K ;D(0S 0 0 0  K22l -0LM0 Q0  0S0S $S02SP  K0 00 0 S g K2p@-PM@0#!P0 "0'0%"*0V#" 0 !0'0%" *0##?0 0 0Q` :Ѝp3 -BML,M$ğ@ PK,@ TK @<T0$S0@2SaY bY0*K0 HPH#K 0$S000C S000C S0$S@0J0S0ʠ*K0?S<0KsK@ 'K` @300S  P 0 1"2*K DQ0D* |PUy 0< 2"10DK0#Tp 0h @R`c 030DKT`  @*K T05K@TpKV`KpPK @TB]K(PEPE@p`K@ r@TTKpP `0# #$# 0PUK 0!1:K0<@K K B K(@@TQNK00BMK(@D@DdKPK`p  @P 0 @P㴷 0 S SeK2 -0LM0K0 % K0K0  c0`t0ʲl 00PS?@08 PS 0 SeK4@B`3 p-0LDMY`K =0P &PZ@WT @P  00=G 0 S dKp3:G-0PP%%8%L01%@4a0@,@$ @$$8$Ġ$ 0 q1ß` 00#0 P%P%%8%Ġ% 0 q1ß` 00#0 @$@$$8$Ġ$ 0 q1xß` 00#0 P%P%%8%Ġ% 0 q18ß` 00#0 @$@$$8$Ġ$ 0 q1Ÿ` 00#0 P%P%%8%Ġ% 0 q1Ÿ` 00#0 @$@$$8$Ġ$ 0 q1xŸ` 00#0 P%P%%8%Ġ% 0 q18Ÿ` 00#0 @$@$$8$Ġ$ 0 q1` 00#0 P%P%%8%Ġ% 0 q1` 00#0 @$@$$8$Ġ$ 0 q1x` 00#0 P%P%%8%Ġ% 0 q18` 00#0 @$@$$8$Ġ$ 0 q1` 00#0 P%P%%8%Ġ% 0 q1` 00#0 @$@$$80$l$Ġa0 qA=00. P%P%@$M@PЍ  $(,048<|4G-0PP%%8%L0%1aA=0@,@$ @$$8$Ġ$ 0 q1ß` 00#0 P%P%%8%Ġ% 0 q1ß` 00#0 @$@$$8$Ġ$ 0 q1xß` 00#0 P%P%%8%Ġ% 0 q18ß` 00#0 @$@$$8$Ġ$ 0 q1Ÿ` 00#0 P%P%%8%Ġ% 0 q1Ÿ` 00#0 @$@$$8$Ġ$ 0 q1xŸ` 00#0 P%P%%8%Ġ% 0 q18Ÿ` 00#0 @$@$$8$Ġ$ 0 q1` 00#0 P%P%%8%Ġ% 0 q1` 00#0 @$@$$8$Ġ$ 0 q1x` 00#0 P%P%%8%Ġ% 0 q18` 00#0 @$@$$8$Ġ$ 0 q1` 00#0 P%P%%8%Ġ% 0 q1` 00#0 @$@$$80$l0$Ġa t0 q:0. P%P%@$M@PЍD<840,($   -LM 4H0@-@MP!\#0  0(^D"ȠЍ0 -(LMZ0p"2K@`.K 0 8#h "V 0AM80 2K40 @4`K8K W8 40 0PU   K4 0 8#H80 T0P`V  `U @(K -LM(j<0 0" x2K@P. K<0 8#X "U 0A]80 2K40 .pKP  4@w 0  40 8@p8 K0 4K80 8 40 0`V . K 4@] 0 . K 40 8@V8 K0 4K80 4 0 8#h80 V0PpW pU`(K -(LMp"h@P08#XU @ -(LMp"h@P08#XU @ -L Mp#0@P`8 Ƞ<̌@04Č00 4 004 ###Ġ""H"T0@P p0h S 0K4 K:(K -L Mp#0@P`8 Ƞ<̌@04Č00 4 004 ###Ġ""H"T0@P p0h S 0K4 K:(K -L Mp`4K/0 0#0P0 8 Ƞ<̌ 04Č 0K 00 4 4 0P-[B["%4""Ġ@0P `0gS:(K - LM@BPC0K4K8 -8<0 400 0 8< 04 40 -0[02[ 000#4 000 010[ 03[ 040#404000 0#0Q@DPEUp  `<8 400 0 8< 04  40 -0[02[ 000#4 000 010[ 03[ 040#4040080 0#0Q(K p-LM`H  P̲$H xh4HM Ѝ_@-@M0 0#@\LTЍ55b* 0-LMP@ $Kڴ E0R$@ 0 0 004003200 $K0 KP0K0\(889*[[5*QM  ;ЍKii**99&*RM 0S0S0  R00ЍEE*M&"R!" Q\R0"S0Q0 #Rt0 00 R R R L0 000 S S S  R00LЍᤜ -LM(@P[00訜 -LM0@P \k\P訜S\D -LMC0SP S <P  ㋴P0t00CS00 Ӥ0; R r  r 0R#R S3 k0@S0 d0@S0\@2b P  㣴P  r 000 00T 㓴P  r 000 00 0] ぴP  r 000 00 qP  r 000 00 aP  r 000 00\ QP  r 000 00  AP  r 000 0 0 1P =Q ѳP@pWyx00#S #W0 S SHP@0 S0P0  0 訜Bě/hD0pDxDl+D 0-LMP塳P @P8yy*H0M0S 00CS0Ѝ:Ѝ00ЍB0M0CS 0Ѝ:00Ѝ 0-\0LM0@Sb00CS00PӤ0q:P00SY8BMЍ`(@-0@0@$0M00 00000Ѝ#EgvT2ܺ -LDM@ lKⅰ pl( 0 @ 00# h ,0*0 0#da0"00# `@dȟ0! 00#\@Dlŀ0 0 0#X@$(0, 00# T@ b* 0.0 0#P@0"00# L@ǟ`0! 00#H@̀0 0 0#D0n)+C0,0O B0#  @`G' 0.@0 0#@<@@dE0"00# 8 0$00#4`ǟ` 0! 00#0 ǀ0 0 0#nh@& 0. 0 0#  -T@0" 00#@@|0!00# ` l@\Ɵ0 00#lƀX@<0,00#D@& 0. 0 0#  +0@0" 00#a\@0!00# `H@ş0 00#̀0,00#`@% 0. 0 0#  b)L`E0"@ 00#@@dF8@0$00# d ş0! 00#ˁP0,00#n$ P.0 0#  X0b&P%L@`0"0# ğ@0 0 0#lȁ0! 0#h@d$0, 0#  H\0b. 0.0#P@, 0"0# ğD0a 0 0#8@ā0! 0##l0n 0,0#`@  * 0.0#T0`0"0#H@ ß0 0#ll΁0! 0#P#00 0,0#d@ 4 b( 0.0#l@000# P@Ÿa0 00#lˁ000#X@"0 0 0#  % 000#`@|` 000# D@\Ÿa0 00#h@<ȁ000#L@"0 0 0#  0Ab- 0@00#@@TQdK0P00# PP8aX0`00#``\e000#@|` 0 00#d \lˀ000#H@<1  0p0  "0u 0 0(KxjVp $ν|*ƇGF0FؘiD\"kqCy!Ib%@@QZ^&Ƕ]/SD!7Ç ZEogL*B9q"am 8D꾤K`Kp~('09|eVD")*C#9Y[e }]O~o,CN~S5:*ӆ -LMP`1>?0@@N10@j@Rp0@P:Z @  `phP[@P@pG?W W   oۭ -L(M< 1>?0@0c@ S80 D ,T`p@P  @00#:k0cS:UV@ 0—`p -LpMoP0p U<0  }P3⭦P@ + ̞P$>0@H0 D@ 8p 8 0 S S*S? +S -S S x 0x0 080 0S,080 @x@ 8 00S| 00XS xS!x@<0K8K@ K@y0S@ Ss SV x < R =PK{<~0HKPK@ QC8 080 00S S; | 8 T  t Qt@Ւ4$t@ 00@Q:*080 8/P00@9P0P M0SI RQ 080   @@ 68 @080 0P 10@S 28 T @0P@ 0 PPt0t R  \BSt  0ӓ"t R 0ӓ*@8 080 00@ S00 ᄐ @EPeP:|0 y 8p 8 0+S -S```080 00@ S8 080 0P 10@S8P0@ <,808 /P00@9Pڨ*0e\S 00V0c08p 0XC| R9NP IP4iP nP/8@K$zP( 800C 80 zP80080 H:D0 08@KzP 800(S P K0|PL046D0 P0H0 L0H0 D0 H0x0 8p DX``Q0it X0 j VH D 891H C 3@ P] 0H D X,ʁxP)X@T T8HK؄1 PhX0\ʤHHK1 X 0eA H D X0s`(X@0##HK X0f @TW  8HK1 H D 0 MSl p h d (8D0 0H0 lQ <}p}h}l~}d|}꘧CbpH@K0p` Õ@PV!H@ DP D056CD0 87HK1 豕H D D\'7 R6CR7 D0 560@ H0 @ D0 RO@d  6HK1 联H D DbB V60␦j0p0 H@K0` @PV pʈH@ DP \ Dh60#:kcQQ04QH0 A0276D0 H0 1H0 HK 0P l p h d 0@H0 D@ m `5T t0/zPl Y d h l0}Pp S l@  ! ƪHK0 K40K-}P< D L~Ph ? X00\X `4 ࠣSc00CD0aS6b ` $ cRb0 B"00`0 ` @0` @T00 S 0S p pc@c`c^ hL~Ph  <}PP <| 0VS+검VX7 0 pSY@0U 0@ S 1Pp0 SU0Sp#@UpPh0U W 0VS ` TPF:0Vs3(K?*!:xA-]M0P P0ЍM00P  R*Ѝ p-LM @R 0`Q0PSe`V*a000SP 01PSU0UP00x -LMPq0  |   x00  x%`pHAP P, 0  0S 0S0!@V`P 00P 0 0 \PP  pR 0S '0SpZ 0p =  DPP  `R 0S &0S`ZZ`0 0 0l 0  R:0 0F@0l@ഞAP<  0 0l : 001  0 0S00 c0@00ᗞ`P 0 #P ᣛ0 0a0 @0A 0  01Sc @V  (K -MLMğ  ` ,  P8 @T g@ 0  (0 S00:5p/0@@0BNK@D@D+P 0K@A (}P 0* 0U/S' 8: S S!BNK@D@D+P 0K@A , P 8: S0 S/ 000>K(0Cp   R0B0S/S@@Q P PU0E0/S |(U@@K0@S@L++VP  0K@@@ $ P0Sm B^KPEPE+=Pb@0PY 0VW 0p@ ! ( = 0  d0S00sp0/ 00 10.S0.S%@ 8T*0 S0 T:p @0vP  D8` pP (P 0@   ppp ,0 SfQ(Kpk?D -LM:K M00 K~S4 G 0 D K@K@0^@`P.K0A@ Q p 0S /S000S P$P  9K@@ևP 0FV 0`SR*0S0>K0C0C K00nK`F`FKP8`?WPu [W *W0u@!TP0S ]HP!TpPEr!T#3@ 0p@[W:0:S7P:1P1 0]S.0e4c 0^^  R*0S `PU  Ÿ0l10 0p[W@0 0 ]W 000-S 0]S dŸ 00@0]Sp 08< 0P` 0< 0 *K 08 <V 0 V1R 10pWp1p(K0S KLL K.KK(@AK@A4 0 PO 0 P < SEK:K4 00 > P;Ipi - @൛`P0 AP 000000P  0  00 00@QP 0 D0m (K|[!xA:-]?**EE -MLM0@{S0}S0Sv {>Pn >K0C0C@@C@Tp0 @P` [S   0]SSSP {S` }SVゞKIIB `FP0SK@@>0[S ,S2{S }S-   0]SSS@ `V`FV0 CQ 0:0S0 P  00 @T (K -LMt`,KPp@ PN 0 000 <Q 0p> R;q9 r7 10aR3 K @ 0\`.KS   0R\S0@0Q09 B0LP*0 S L00K, K @ KDMЍMЍp 0 M00ЍBp 0 M00ЍB P PMЍp 0 M00 ЍBp 0 M00ЍBp 0 M00ЍBp 0 M00ЍBp 0 M00ЍBp 0 M00ЍBp 0 M00ЍBp 0 M00ЍBp 0 M00DЍBMPЍMЍM @ЍM ЍM QA 0SbЍG- Mp,0`SPP0`00b@070 S:!^ ^5*.000S0*.\ \\00S$*\00Q*0`0SZ0Y0? 04030#Q0#S 0Z RYh ЍM  R P*0SPlЍ0M p 0 0 00 P000ӑЍBA -SL,M D H0 8 <0 @0  H\H H @ < @ @00@0 @0S<  Dp BP \e H0J00 =0P04 / QN%0C0L0 .S+ \ST P@PTPL `0aS0S0S40l.SP0? 4`0 R0S4 l <0Y:Q8 PL*8!A4 =R#= B0,D",0 a = R @0PS 3p5 5@0 5 .X \XX 80R*X0gSXpB 0A>S\ < 00pXs80W:\ <0000D b(KM. ".Q  .RA Aa0A \.\A Aa0ARS 00A S  RS 00A-Q S _Q  QЍ0M*S0.S S ЍЍ-0MS]S.R00 S Q\R !R!0B.RЍЍM]R0S! CЍ0MЍ0 <8MЍ <M 0Ѝ <0 Ġ 8M0Ѝ -RLM$ 00 0 -LM@@OT p-LM PR @T@? <0S9$0``PP/-+vP RP@@x -LM$0`pPPᡗP@ 0(P004$0@L0000H0 Lw 0-LM @<Q *P00?0 0 PPP Pܔ P8 -LpM$s`Pc`LP0pKHp @  0 P  0 PP 0PC  0 P }00l Y 010  P%L 4,00.R80M0S L040. S  ,0S00S40\0   <0S0 P 0  P000 K -LpM$@pP(R``PP K#PP4 0R, 0R0 0R P00lPW@/ @K -LM0@R`p ( wHPPPP PP0P0 0p 0^10 -L4M\ P"P \ Rt0400 0x\ R0@0  $ 0S 0@ <0  8 00 c@  < @0\ @S@R  0X H0 L0  0 WP0L H0  X  00404L ZH $000S/S$0L 0/  4 <0sD0 D 0 D Z0 P  pi0 8 T P $0  0.S0S 040. S  ]@P Q&: pvP BT`j0 04$0 :0 $02` W $0 04  80 8 0piD0<00000 S$0*D0  $$0 :0 $0 ?00L0S @ R 04 0L 40 04@ R <0S P P $0 0L00$!$0L  0( 0 4_ 0 0%@0Sڰ$0B8RS@  B@ 00  ST00@ @P T@  P `PUfQ00c00 RL00  Q00c000S0 <0LS$0 0P RY400C40 4 00H0S# \ P0SR<0S $0P 01PP  $$0 :0 $0P0SX R00 04 0P SR0(KoH000  #8 R 0(K~ -pQ00 W@@LMTP 50 0:`/@$0 3D T 0 T-P W$0p:$0<0pS00/S $0` 9 X~@P.YP   p 0-LM@PꅞUP10@S8 -LM`pV $0*0Q40#Q4 0C8S 0P$0/P4֡ 04ơ0 $04SFQ $@ 4 0R 4 P n0004P   :$0a000S  0BP 4 04  000 R P$0  `00Q0`V] <0S($0@P$0`( L$  P^/JP P0S @؝P >^(P04 00 :4S S 0{P$0 P4֡ 04ơ0 $0040$  0R/S@/00(  L^ P*<0s%``60$ `<0S$0$B4 $0  9P @ @   L0P $0P:$00`S004P`p~ -0L M@p 04 0|(ePP4P v 4P p40$@4 0$0  P @P_ PW 0`<0(P00F @P@ L000<0$  0P $W``Vp00`@0` 0@  ATWY J` ]P `0 $$0dP$00$0Y e  `^\040 4(Kp p-LMXP0@S$0` 0F0S$0S$<xh.BMЍ -LpMKp`P'0: S P00( P P0K80@000P P 0@p$`0 @``0@PK 0-LM@pP  00R00S P 00PP 0K2  u8 0-LMp@P PP 8-SM " 0\0  0\0 Ѝ -LM`Pp@P PP@@ PP@@ -L` M <0 0f8 D H0 D R0V000  0 80S'# f f40 @ 00S 00  00@ @p@0TP< P40Z* @ p8 0R㖃' (R0B▃*8 1<0P  <0d{ d p<0 eu <0op00S 00  00L8 @0B▃*p P 00S 00  009p@T/< Pf 00S 00   00  fH  0TP<0P4 00  00Pf0hpgS08S㖉) c00 0j PefQ!Q 00 aWL <0$U B e8 (0 R (K -0LM`P0p R p  SP   @!R  000lRJ0 0  0  00@ 0-LM8P0@S$'K0S$#K0B&&*LL|*oow*G-HM@pP0 #2b P"3 UpG1?7 (1 L0LLLWW& 0 00000 R0 S` h.22 1 W00&#!0=00=00P U03107:ЍD -`LM@pPUq ("000L=QN P| UC0n\nnoT P< Vp*1 P0c104T Vf*!0 bB2 Q05:PX` PT VQ*P!0 bB1 Q05:PC`P T V<*0 0c  `PQ/ U-pptodo0000r 0  PR=R  r 0  PRTV*0SU `BD * p-LM`PPp@0S@ PT  0RxxddX* 0-LM@P PU0. @ ꃙ@P0/S P /U l0@P  Q0r/S0Pa U:@?00@ j008* * -?0$ LM0@S`0Slp0S3w00yxPZ 040 $@ ʇh\ -?0$ LM0@S`0Slp0Sx00yPZ 040 Ɨ$@ ♇h\(MЍ))﫫*0 M!Ѝᠷ -LM@R$  ,  `70A XK00C 1 儠K─K0 h!0!S @PpP P "  ! 00P RP L00L0 60[S0 60K Q Q , ՗L0 0, L0 Ηx00x0 00 0 \3 K0  K K ,K  K K K K KTV `A p ! # T *!R00K [r d000 1S R@00 ӑ KW [R 00 ӑ K0[0K <P  0[ S S00~L0   , kXP  }pi0ST!X0S K 㑩K ㍩K ㉩K ㅩK どK }K yK uK q1S Z1S QMT4P@!TU!R #10 qQ P@p ,0 S(TB(KX|sBAA0EM 0ЍP0M00ӑЍAP0M00ӑЍA 0-0L0M0P0 @ DK<00<0 D KQ Q QT L;@00 0 SAK0t,t,t,DI* -LM`P @0S 3pP PUP =P -LM 0P$d( 0-LMPP =00@夊@@堊 @@8MЍd( -L M0`SPPo>P 0K4K=@P 4 R 0#S S 00S# S0B40 4 P0d40 4◍PPk 4 40@P@@0 S SPP h@pPP  @00S ?R0Sp 0SȌP PW@Pp)+ S S@" 0@1U r>P@h @00000c0P@Lx@P p@T 0S0 0 (KLSS -LMV0Pd(0 0-LM0@SP$$=B> 00 08LSMЍd( *((*****##*''* *$MЍ --LM0 0  K p-`0LM@`PL H9T  ,,, L xh9\CPjPﰨ*MMﬨ* p-0LM0PS:0@0S @T00S-Qx0 d0 0SX!m< `K pP0S Bu KpBA< -L M@ 0< rSwS 0 S8 eS0S 00 , ,P 4K㬕P 20SܕpP P A10Sӕ40,m1Q@0S01@T@ P0rS$0KAP p zp    qpb<0  ! }p0S@ $0K@wT@@aT@@$ K0,0,0P0Slqh, 000, S Dj8 0eS 2p  , $KBA<\U -0LM ! -BML M20PP ,0 T$ 0S /㉔PP0 L4 04 J\oX2@P@˔00 c]0  ) 0| cBKJJLT `0SPa P ᰔ0 Sp1KH4 0D4 1A84  0@d 0@S/ L$ P$1!S 0 c@] P40T$BNK@D@D`PL$R 00S00 ,0 S,>(KppMNUM 0M ЍA! --0LM00  00  0  0S10 c]u 00 00 0  0S0 0 S > KM --0LM00  00  0  0S10 c]> 0000 0  0S0 00 d 0 S d> KM --0LM00  00  0  0S10 c] 0000 0  0S000 + 0 S+> K!M! !S - PLMP@0$K;pP3  㖻`P- R $00R @00"@@P 8#$0 <0$0 v q 40P$0,0@,0$0(0 0 0@KH 0-LM,@0PS0@S@8B -LMPQ`PPdp0S0 R r A0t03U0SQ0@S @BRM 0S0 0A R RЍ!!殮*;*;""* -LaM ``0 pP@P@T iA \00 c 1   ^@P(K -L MDCDß`8 < 4 =@ D0 BPpfዒp0@P0H0 0 * ሒP"zP " 0Q0W0Sz  H R @0 0R 0R 0S 0 P@T00P00S 20Sm <0:Si  4dzO @ X B R00S 10S <0:S 0|!S 00<00-0BS QP1 R408!,1 10S410S000S <0:S0 S 0000  B < 0:S:?0S 4p0 L d00S <0:S\H0? D R0 S(KABAPNlNAx(NN -LMR0 4 80 m E0S5  0 s 50S GP -R d50S+RL-R+R0S858%00,% u0< 0S %00S`04V4$P4u0D @40 0@d0d0@t@0|$`0[40lA@-QPU+P'<44,$Q0 4 `@  Pu` @t  40[0 e0b#0000003pw #0s`U l-U0SL0S@H3 t0  4010 g0b00`0"8Q# 204 1R -Q 00:Q ᘐP48 08p`N\rP@`:V@ -V0S{P-V0Sw 0S!00010S 0:S1`?`e8 0R0WV0S" 0;S0Sh!000S4010d1 X1R0248 0`$!1 ;0:S 0S4 000/000S@0:S 000S04 100 0S0  0:SMp0`0:S:`?`(D 80  `(KAB|(Dx(AABANA,N -L Mm K -L Mb K -L M 0W K -LM@P 600@ p-LpM`@T 7 lK>PP D @0  0: S WO0 0 _7 P Kp@@S -AMLMt3B~KpG0`c,0 pGIJP3P @P <9PPC, P 0#S    P@ iP  @c2PŸ P 1 (0DT` P 1 04S|0 P 0#S    P @ @@P 1 0DT| P 1 04St + } 4 Q@08P'P0  P0  ߎP0  ՎPh0 ͎PP< d ^@T4 ,0 SD9(KD@@ScNNxR0 , xN 0-LM@P 垎P8PP8D 0-LM@P 凎P8PP8D -80LM0SP P @D0@-PM@P0 0 ^ 0\^0 P0SS00@0ASЍ0 MЍ`__<*vv8* p- 1L MP8K8 7 K$ K0 0 Ջѵp` P $K ʋ$ $Kŋ0 8KmP(K@  `$K㭋v(KpN!UM0Ѝ7*7*TTݠ*kk٠*ՠ*??Ѡ*͠* -Q0L M4 0R004 000 040`0S+ Pp @⧍P 㕒"0S ꜍P pt0 2"0S Z0 00 X0 00PU0K3`P(KNO -LMP ׃@P` |` ᨀ,pP 0Rp„S0C \0 ^00N@-@MP 0SS 00B SЍ -QLM ,0 (@ 0 0 @ 0$0 0 ,KK -LMP0A Q@"` p0 0 B0&&P00R00S 0/S9SV00 V0S` 0-LMPPhdEAd`88 -LM`Ap  !PPP0U`VP -SLMp8  +; ; ; ě7q 0000 00 r ˟00088 ]8 %Q 8 P  ]P8080 %0AUSdl|ȥ8,LX(lتl(h$Dĩ@T00 Q00  dUPaU ]0[ɟ (UU0p0#UO0\0UI0H0UC040U=0 0 07 01 0 -P0 U&4P (1@0` P A P0 40 4PUU P 00 0'U4P ȟ0h@0` P 8@ P0 40 4P U U P 00 000 ` 0K4Kc0jP 40d 00R0K  0[P 00U 0K0U0K 0U0K 6>P 00C0000% 0K;00K 0(P 00C000U$`@~0 ( P0 SrP@n  Pf0 Sc S 0000 0 [0K=0E U0K4K' P0K0PJ G0K4K 0P@ 4c000K4K "0 000 000C S0K4K 50 &0K4K4P  40ğv>C 0C 000z `0Kc0P i0@h P P P0 U4K($0P 400 0{0 0 q ß000 GQ0 +Q7 -Q4UQ ZQ  0 MS0 00 TR00  SB @4KT#00 @P 04K00#@P 0 00 <00L CA0C0  RS000 0 P4 000L Q 0 4@ R:\ 0 4 R@R Rd㮂;P4  U 0 00 r 0008Q1 r 11QDRd0 0v>C 0C0!000x1@S 0vn ` drPlp3 0SX10 2) 00C0040 0!4 004 0R0 0% PF@{F@@@@e;P0000 c 0 S 1X0 00(KllhdBBPPPPPn'B BDDPXPlPM0Ѝ隆* --LM0 0  K -WMLMp0@P  C/$0 KN?K`5 8 4 0  PKⳀ0YnKⳀSKl0NFK|E E t d5 w@PAP@$ 0RF4 KRMЍP 0MЍBMЍ -LM$0!  0-LM$@P}P}$}P}8h| p-LM$`4PK@.0(<;P ;P800000S4KKp S -L@M$@ 0PR/ 0`00dpKH` 8` 0LK; P 4Kc#40L0 d` `0 Pd@K0LKd0 `00S$K -LM`Z$P@K 0;P |00 @;pP@ y;pu$K -LwM 2 0(, 2 KP||?`QBPP`XP?P|`E@1@! 0$P@ 0@rK"~K 0 oK . ء ԑ g;KP 100@ Px|?oK ᓅ 10S~K | |` ,0 S3(KHS\CB,R -0LbM0K 0 0p" @!@KLp^K`pP|00 PNK0 0 ^0 K@Z 0 S2KBS -LM   K 0K 6p K 0-L MP@<P  r>P 6<P  1<P , 0PK0ا -LMp`@P P U@P -LMP`@<P< pWW0S1T0S S+W) P-~P@>P `P0P0UV @#3`:0S!{PPhS\CGϠH*MPXйȹxph|xtplhd`\ X TPLHD@ЍSSSSST(TTTtTTTTT[U,U++* -LpMK@P`  : SH  l0S4   KUUVV -LMP: P -LM@P PzPzPzhz -L$M@ Q< D0 R 0 @݆0 @0pB@@0iPI40 L >0\S+ $S7 ^S! ~S2Z0 D @0RT 0T:S(0`/SSP"  ὆P 0/SSL @ PZP0SPE0S  E@P@ 0/S7SP@4 T: }PH 8 @@pP\U8 $U%^U, ~UZ D0@S T 0T:Sy0`/SS  rPn 0/SSj @  u0 bpcZ_  ti pZ0 SPRR0 SN RSG CS( 0SD:7SP#BS=-FS4 NS/ ES6eS bS! cS TSnS! fS' rS! tS"@P @:P0QQ00C Q 0/S7S@P @ P @ P@ P@ PP@PH@40Tj:HP00@P8 8 <@uy(K -L,MD @0 D0`@@  0000PpDp @ PV DX@YDP @`  0"0S@00T TpN )0 @Tp  pG DKP (0 @Pp T0I0 S D @ @e0DK as#. 0| t0p h0d @P00p40 40Snv@P(K4VTV|VVQ: 3 -LMpQ@ 倂1PpP Ov00T  0`P 0 <0{`P0Q. ,T@0TxPP f$v  0S,S00SQ000S0S 1`Wp@TP +P7P88 XuVuVVV0BVVW -QL M@P$ 0 (P (0 xPPhh!_0pQ0Tp00 0S4AP@!j0up8(0S5 (KP/ 0 0R , 8(`P⑶@?P00Sh \TL uupK WW0WTWhWWWWW -L`PM ,  Qv`P ` Z60 S P LKd&0ჀPTlK H&0zP8|KP= @P LK= TLK5lK= TlK5U* UO U~@K0 00@K0   00@K0   0LK0@K0 |  0lK0L@K0 00@K0   00@K0   0LK0@K0 |  0lK0%@K0 00;@K0   001@K0   0LK0'@K0 |  0lK0x t K$P0 0 00 pW> @P 00 HPd   @P 0@0  YP  0 7P 0  P @  ᑏP x0 : P3 Tp K,P2p@p0P#0,S \S S 0 ,S@Up ==Pp 0PP ptu P@T:p tE> 0p0 P= dp KP8vPPHp: R \R R 0 S S S0 S S  00 R  0L@psst-)pP ,0 S`*(KdUWW$X,XPXlXlXXXXXXYYpKKN0CBK 0CL|8 LN B;` Tx ( X8 d\  'P U%|PD%0S@ d  0t_P7 h< }8 ( 0 p P D8 R@ <8 @80C88 Rppfq}PJt`P1  zP.`(\8`%T0%Pd p P |xHx PPH(W:|+d8:Plğ0Sd02@ d @P(RdF$T+%q|8H p0 SU!0U@E\S 0X@ U:;Pf8tPVqP^ d$0fP@`XX d @T0#SS hPl(R PP0:S@l}P@T80T8 T0S*.K B0 B0CL p( t8 x = =pPn @0S :S@DxptT(d8PPP uP(Rd#ppvU u0:DL8 DLX 4 0S :S08 i b0( 4 00SPG:S:08008 0(0ecX(0hZX;0f psPVmpP^d# )f0f fpPXx `0H a@2=40(.= Sp DP(Rdi#X8f`S0A0 osP`V 0@S@8B 0-LM,@0PS,0@S.$8B -RQ3LMP@ :Q sP*W000@00R O @10S0 R r 1S010pS000 P$PU  $Ppʸ00S e4x000$Pp`e t00Sֱ f Es `(V  x 0f0 0 0SB p-LM(0`S[@0P0-00S㢱20 P@0  0(p@Pq 0 00 0@T_S <0@T_ R 00c@_00SzxB -LMQpW0 0 -M 0 S S@nЍ -LHMX@K 0K Y'PK -LMP0P :4 80 @+zP> `P0K0 00pZS00@ % *,zPP 000S8   41S  RRR4080@T 0S(K -MLM8 0( t8 t3\0(P,0 x | 0X 4X @P|8@0H #X낎KH H/48S  4 (|(`V 0X  1 S0q03R0SQ p@ xyP@t(U@࣡0a08 PSYP4\X00 S KB.KA BxA B;8 Z`P@B0SPwK@@0h(<Zm h'!PP@ @nK`FH`Fp) VyP p Py0PY00CS00Ӥ0b PN pL p @EyPDt (0@P P% t T@<$PzPKt0C(0C8hp@ @<l8l@!W08(0@ ,0 S #(KYZS ZY -LM0 @R r 1S01"P0 0C0  -p-1L]M0PC/0 `>KJK\1 0Q ,Q @Lx 0K 0 KvoP |  0 cKx1 1 4 *gp@ 1P|oP |P pl0|1 00? 00@ 0 Sw#KpBZ -LM@QP&00J,10Sm0 R r 1S01D p00S0"P W)0P+ X'0`X@1@!   20P d  @f 0d  u00 0 d0upX0000S. B M-L(M\PK0p@0L0 0 X0 WP`'0K <00PT` 0SPQ0"S XWuv0"S V U@@@@ R( K1(0 0( K1T$0P`0(K(Z -R00L MH /@ D H$Q D R@00a 0< 8 0$3@0 pw 0-W p4  +W0@p40 4@ H | 3\00S 0W0XSxSpH  R 0W  H 40HSQQ ȟ@@ 00   0bV`4PQ 0 R0PH0@ c`0 0@@d0@  < 8 00G S w_ !000Y W070cH0PR\N4@T" 8 V<U < 0R8@T00 P00S !!<0<@8<# 0QO&8@T<\ <0Q8 R00@P00S !< 8 " <0<@8<# 0O<0 8@ pD@T \J@ @D<K(KB p-QLM@P`p`S@rP$K 0UV $0K0s@$0 @ $KKp p-`LMD@`0PS P@0S x x( -LM   K0K %p K -LTMP`h  0S v0v03@P0S0S v0x03@P0Sx Xv P0 d0 0u0`X0K@p P \ R00`00h<@P8Ol P@ 04 r 0@ )0@(KK\@0C\\4H $P`|h@\ Ppt X\ 00`Z `  ,0 SX(KZ@B(ZZZx.Pj,@K  kP ,0 `@,  ,0!0S0  kP 00pW0bdCQ <@P <`0S!]i1@@ 0p $K! -0LM`P@00 <  0S 0 S =S00SR 0 0[<f!l 8 0 KkP T00K @Q04@K40  40!0S0  ykP0 00Y0bpCQ @P) 0S!h1@@0P 8p 0P@]bP 00! 0S0 =S=00<0S< 0 (K! -LM@$~!l@P0 @~蔽B -LMp`s~@T xP  lP00 @ťPh~@k V*(^~"h W~B 0-LMX! 0PL~P߷!@PP@Tӷ00P8蘽0@-LMP@P 0 0S 0Q0cЍ0,_p@-`RMP@ L 00S0\0cR ^Ѝp,_ 0-LMP-k@a0P@ @1h8 -R00LM?@ D $R D R@00u0 < 80 00P2@p0 @t 0-T0@40  +T @4 4  z 3Z00S 0T0XSxS@p R 0T  Po 0e 0g 0< 80 0 00D S t8 @!0002 W070c P,\(80 S<@T <0\8  R00@P00S 0 < 80 "00 <0<@8<# 0O<0 8@ @40\00S < K r0< 80 D0S \pG@p @D@<K(KB -LMNI K -LMKEIK K0P M 0ЍMЍgB0MЍgB -LM0  g KB. p-L M$@K`PH0 XKp,` --LM0 0 K 0P M 0ЍB 0-LMP$KOPU$0K$KK0KK|* -LM0 0 K -0L4M`p8KP K@P8@ 4P ,` (p 00 $0 唴P <0S D0K 0@D0 @@ DKM 0ЍQ0M  Ѝ -RL MP` ?R0Spb10Sd!00P @0P7]0 000 R r0 11@ppp&]NZ@ ,K0 KL"V@,` X`Pp,0Vp `_pX@ 000C 00 0 t00Sq ,0VKZ@0@`0  f00 `00S $KB, --LM00  K p-LM@P឵P0` HH T  ,[`,  +h xh \CPjP -LMp$K!P$`@@  PU 0ShP@ @TTb00KMЍ\ -0L@MH0 0 D0 0X 80 ` @ < 4 HK0pK` 0``p@z 0Q X_PP}  0``p@+0XP S !XP X00Pp`N0SI0 S SD 00`@ 0` R000 0 Pp0V. @T 0夀' 0 X2 0S000R`  R ` X< R000\RP P \p`0 Q:00S`@@X0^ P\ X[ g\0Xp`PPP T 0S0 S3 S 00 PPᶠ0@0 P8e0P  ` .e0S0@@@@P 0 B 0R #P0 e`00T QZP RL _e 0LG T0 0 0  \0 0S0  P  PP 00S5 0S0@@U U U ` `Q g ``  d`P U00L0p00X 0Wk:>[\0HS:00\ ` `0@@\.[(K[z* -2MLMD4@0TP,0 ``0V  ,  ]P 0`< 0/S0000S BK@@+ Vp@P ,R Z`d+UlPgBK@@+Up,#XW00< >K0C< >K,BK0C0CI B< I0F, < /fP PP"@iT  0d( K0Z (Cpd  ',0 /S \2Xm/00  ,8[Sr (fPm f@P Xf<@/0f@]+f!PIKA@P K0STZRE<0U<: SA, R:>01L!PP>( K0LC,<[/S@ X<@/0@fZ ( KP6 P1 PP) P="P+ P P "# PPP P2P /P 0P  1P 8P5P 3P  4P9P+\P+[PIP CP @P APFP DP EPBPP  NPMPKP LPXPRPYP ZPqPoPfP dPr. mPlPgP kPx|PvPtPsP 3P }Pj2P 0P 04 040 0DKXPDKpq QpDKGPDKpq} Qp W0dQo Pm: "|040 0[040 0W4 4K# K0K0 pW PT Qi @ b@ P U}J,QA/O4 0 4K( K0K p0 (@K0 ?B%@f/K0 UϠ4K0K 4@ p!&040 0( 0000 K4K0Kvp   H <  +!+K0i @-0@0@,0M0$00 00000 0Ѝ#EgÉܺvT2 -/LM0 @ lK,0 `1Ahp PaA ad`lnDi4 i80/0%1  d0 ac 00#l1 p `0(p0 $nd-c Hc1@l ` 0(T` 0\,@1 P\0P Q\clD0%X0H@aqbacT`Οc< Ȑ X0' &@0 P01 T0Q T "aDc, 0% P0H͌@`lcTc< 0* (0X A1 L0 PL|  "d Qc,lDnad@͟H0% &@ H0  "aq@cTc?1 0 @?Rp0@`P@Pl@  Z@@P?0S@@:  eoZ -0L M0P@ 0 (`K  !>@Tx ~op` 0 P Qn/B(K 0 SoKt`h`l` 0-LMP@!1 1 !320QH8hY0@-RM@P \4, 0L 0l51@PЍ077Xo* --LM0 0 -LM@PpT0` LLT  0S0$cs[  j \CPjP --LM0 0 S Khho*o*0MS  0S0 0S Ѝ PM Q 10C0 Ѝ -LMQp' %R`@@PU@ UP@  P 0Pg0 B T:00 -LMQPp R`@@ P 0S0B e0@T:00 0-LMP @X8 0-PLM @X8 -LR0L0M@@P T@ lR0  0 R B0 0 Z -0LMS00 P@0Y.0D0TST' T%0 `SPpp``UVZ W@@ W G00 Z@0 0  00`(Kn*n*n* -LM@0Sp [P.0Q 0 [P"PN000QP0 0[P 4`4P4协  @R00Խнؽ{{m*RRm* 02 MЍmNA900 M Ѝܽ 000MЍܽB -@0LM0StW  0 :900ܽBmNAG-$1M0 ` p00S0 XSxS  R!! \s  D A0a00c0PP@S @0 C .S^ s 0 0m C Q171Q ЍBIICm*6?m*6 -LM` P@0SV !ZP 3pP @TP @ -LM 0 0P) 0-LMPP 00@M@@M @@8MЍ) -L M0`SpP 0K4K@P 4 R 0#S S 00S# S0B40 4 P0d40 4PPPz 4 W40P@@0 S SPP P P  00S ?R0S`1P8#8 $#$(@"( @0S OP PPP/ 00@% S S@! 0@1U P@X @00000c0P@H@P T 0S0 0 (Kx`SS` -LME0P) 0-LM0@SP$$W 00 08x`SMЍ) 0-LM0@SP 00400S0 R r0 110D 0PS PP೼0L00P @0PL0 00DP L0D0000000Sˏ8B 0-LMH0@SP:8DOPDHP8 -1LM0S@ᤏ0 R r 1S010SjPH  UP Pe0 :0 a100P`PP f-DUGP `2P 0`cpPD U0P0f00PD0P0DPS S 00SM00PB p-LMP K2`P@' @P$   S0P00ı@ S00Ӥ@000L0`$0D0@,0<0(080 0 0 0yKpH 0-LM0PrS wS aS<? 0@Ꙥ00eR8 xR +R ; R 008 p-RQ3LMP@`:Q =PP:xhNm 00x -LM @(00S0`00X00B 0-LM4P0@S㛎0`000S 8h虎8B -L|M@T P ( R / 0Nu0SwZ ZG ZE :0 PP` 0  pP`q0S  ^ 0 00 0PUoS <0PUo R 00cPo K  0 0 40S7ߣ 00P`0S\ 30S 3\ 08CJK⼡P0: S 0;00D ;L 0ZpK K⦡PTpK K pY0 P  0 pqz 00 0PPoS <0PUo000 S 80<0b q/ 00bU 0R60#0Q  P`VU0 ab00 0P @0P~J0 000 00+L00cPo 0 pq# 00  P @0P^J000PW 00 MP R :0 e00 00S0 p-P K 0 pq00S Z00P @0P'J0 000 0P080$0S C  (K,B0M/Ѝ 0-1LM0@Sv 0 P0XȢ 000@0D hPG0P00P00000P @0PI00P<0S0 80080S& 0 90088  R09  $0X P  8 0080@000088,~0M 0 SЍ6ЍM SB0SPЍ -R00LM?`$RZD00~2p0 Pu 0-UP  +U000 P 0  v 3V00S 0U0XSxSP`p R 0U ``00SAAMM0 @R Xf@h 00E S u4 000. W070 cR(Q$00S \ 00R00S b ݡ"  \00R00S,, ̡"00PZ QG (KB p-0LDM \@K:PK`  SR 0@K @0 R0 L@KR ~T0 H0 D0 L0 f뱗fNaa -LM@LPpA 0 /T #R 0 1 C P@36:/0 C P`$*?XQPdP0@ M0P@X P*0`@@ L0f MPP@D"@X-00@ :a -LM0@!  0 Kla -LM`p@P0PP@0  pv@TPPKBba -pLM@ 0 0P  H  -pLMPؠ 0 0^p@,<4("4!<C `J,<4("4!<0cS= @ @,< (l<4",(.̀%"4$<PA `@,<4("4!< 0cS<,$ 00凛0SL`KY`PK`T0KXL PU`QZ0=@P`  L2K P0= @@ @Q R@P00Y0X00Sz0<K@ K@  d 0{P>0SPPf6 08 40J`0h 0RYx@K h0`K-P* 440S@0 @ 0P0400800S 0@0 1\ 0 0 P  B xP@x@ xP 4@40#S  ,0 S!(K,?Bm -80LMQ< 0( MЍMЍMЍMЍ p-LM@PU@jDP" P<\04`Kx0 @ 0 0(00<000SKp,C0MS S. R > R0 0 0 0 00 000 R0 R000000 00000S00 S S000 00 00Ѝ 0-0LM0000PS@{P YP qP  lP 8hf8 0-LMP@@P 0S S RP 8hL8h+8 0-LMP@?P P 0S 0HK0CM Ѝ  0-LMP@P  >K0h 8 0-LMP@P  P 0S S 88P 8h8-$$ M @ ЍD8DMЍ-0MSࠓ 0C0,<4("4!<0 00 0Ѝ0SM0C0 ,<4("4!<0 00 0Ѝ0 McЍ0 Q0aM0 Ѝ MR %3 a 0 0% % ЍMЍ 0-LM0@SP*80b0 I 00 08 0-LM0@SP*80b0 I 00 08 -LM0@S0C0 ,<4("4!< K0 I 00 0K 0-LM0@SP0C0  KI,<4("4!<0 00 0K0 -1LFM0PQ,0 p@ K_K<N/K81 7pR 8!+A[KT081 4A `T041 081 `)꥘.005@81V0OK@  >KK娖K?KU N/KPl@ ,0 S (KLmMЍ 0-LM@PuP pP kP  8he8 -0LM (0 (K KMЍ 0-LM@PT :T 0 K0  0KP00K0 0-LM@PT :T 0 K0  0KP00K0 -LM R :R00 -LM R :R00 0-LM@PT :T 0 K0  0KP00K0 0-LM@PT :T 0 K0  0KP00K0 0-LM@PT :T 0 K0  0KP1[0K0 0-LM@PT :T 0 K0  0KP1[0K0 0-LM@PT :T 0 K0  0KP1[0K0 0-LM@PT :T 0 K0  0KP1[0K0 -LM0@K0 P00K -LM0@K0 P00K 0-LM@PT :T 0 0S00 K 0KP 00S00K0MЍ 0-0RLM@& P0PeS 0P U  0h8S 0 P U  0, 8S888\D -LMP@p`P 0@S RV -L MP@U` :U) '0(PK( $0 0P 0(pK0P 0P (0$ @@00K -L MP@U` :U) '0(PK( $0 0P 0(pK0P 0P (0$ @@00K -LM0PS`p@ ST- I$ $KP' $0S$ R :R T ?P@XX\$0  $ <00K\m\CM Ѝ -LMPp`@P( PU0S"0S :SU T ?P@PP iT <00xm\C M;Ѝ 0-LM @Ix0 0$ S 0K,0 0(0 0 R r 1S01,K 0P0SK0B -L M0S@ 0 0SWP 8 0 0 0p Wp  W 1+#,Pp`00`S0 040 00 dWp 0B<B S0S*0P`` 0PU:S?P 0 0b00P0P  UP! E0 0e P0 #0PW  }E000{P o W:,PP e hE0 0g 0 P00eS0[ pe0p40 W 40S   P00h000 040  0`0V`!PP00V0S  2E0000P $V ,PP  E0 0f 0 P000S00 P4 00eS0 pe0 @00 (K p-LM0@ `V  00Pf`0 ,Pʼ0@00x`P` Ux p-LM0`0PSx~0@Sx~xB 0-LM@P\8hT00Sa~0 P 00P00SX~8B -LML`p@P0X@SpPUZ`VC 0-0LM0@S~ 0P,  00P @0P:00P0 $000 0000S0B< S @0  0 0c0 800088, p-LpM0@8CP`JK⑑P00 ; 04  Q00R0 ;0  Q L ( 0R   Kp蜻 p-L M0@ C 00  K$ K` y=P0C0  0$0 S P IPP000KpMЍd{ -LM@pq0:00PT:0 p-LM0@ `P 00: 0xh} 0-LMPWPP00OP0T@80:08 -L0M0@0@K0  0R 6Km MЍ\st,@RM 0S@  RЍ0@-RM@P \, 0L 0l4 @PЍ0 -LM@ ,0( P00 -LM(0 :1PX(0  XaA<pP+   d}E9q`AP<P 1!0 1!(u 0  P1D 1D , Z00  ,0oN -PLM@ 0Ath00 -L~M41Sm 5 000  @0 P P `Q `Kla `pH 0@L1 T 0X1  0\! Pd h 4 p P0aK/qK.K-KLQH+QK,KPaTqX\Q*aK)qK(KP`a `dqh$qKl10QpaDQ `p4|q ⌑  ! 001 P4qtQ 4x `a pq 刑  !  0p1 @0A PR `8 a a$`p8q(@taxq aKp|,P1a1K`qp向!K 10a堑8qaK!( 11K`a pq Б  ! 嬁 01 `a ,` $pq 0pȁ @崁A ( P4Q , 8@" 0$ 1 P 0?P0S0@T0d p pGW0WXS 0gS80S @00P ! `K :P@ 00C>N6( K 8C0SP0@ U T00SR`1S S S KܧP w0S@@ -jp@j0S khP@ _0S  R W00@ ,0 S(KD*m -LM 0@jPM 0Ѝa0M Ѝ[M 0ЍU0M ЍP -LM 0@GpMЍ0 10M0S0C0R:Ѝ 0-LM0 RR@  P  100P:R0 b320 8 0-LM0@10 0s00R: 0R PP@  ! d:v @0 1 8 -LM8 <0 P4 K00K@ `P? 00 i40R040 0  R5Y0S @TT T  BR \ 0210 32@@0Q&0 0Ppp T( `P 0@0y0@1 @d P p X0 40 p040 a `P 0@0[ p40Q8a Z40 0S 00 pP008PJU00X0S XQ4 21@0PC L 0T0 ,`P`p 0@0XPp  Q 00040 "00p <K 0  @000@ (K -LMoPpU 0 X Pl<2P@ d< +P]<8?0@T0 P@ 0H0 80 Dp D 0 S S*S +S -S S  00 0D0 0S 0D0 D 00S0XS xS DKH0K P8  P  D 0D0 00S S     D0  X0 QՒ<,Є 00@Q9)0D0 D/P00@9P0P M0SI RQ 0D0  @@ 6D @0D0 0P 10@Sࠃ 2D X @0P@  0 PP0Є R  \BS  0ӓ"Є R 0ӓ)@D 0D0 00@ S00 ᴀ @EPeP90 y Dp D 0+S -S```0D0 00@ SD 0D0 0P 10@SDP0@ <,D0D /P00@9P`+0e\SVlDp ZDQ:NP IP5iP nP0D@K<P) D00CD0 4PD0 0D0 0 80 D@K'P 0 D0 80 0(S  i 8 080 Dp   h 0`  R080 00c0  R   r 3 Z ``Q  E VT P ڤ91H C c"@ PE 0&!T P 5^Z[`P 0TKF4`^ T  9RQL LK Z 5@`P06L0 T @`` 8TK1 1"T P 05\TK!Pj`0^(ʈHTK1 "` 0eA " `~L8 2#TK T P 0TK8K<P 80S?Q`  0f@T=  7TK1 !T P 0y GCb46 56,ʠP0 LLTK !T P `FVHǟPp4656P0 T@K0` !@PV >F@d  6TK1 T P 09 FCb46 56,ʠP0 LLTK !T P `FVHƟPp4656P0 T@K0` }!@PV 5T@ PP 0#:?C0C PPTK@ K<0Ki PH  <0@a@0T0@0 @0 0< @0 @<0 Pn0Ug U0 P 0 4@lT H P<0H 0<0  R< r H0  H0 P080 RH 0<0 00dHB Q@  0S00 $4X 0Pt [ ``  t Px L t0 ! 6H0P| ? H  ! w6"00SC S40X b040 8 <0R<0F0ZCP0f0CI X 0 S S R0S zPP000'S S SQ  R0pbPP@@[D0P 0P @T0U 0g R#1 0@00S>PP  0 0CP00@  q0Rh ^000Q@ @dDA@`Q@hP D21 03pQPppW40040 @aPP 4 d4 0 p04Q룠/4 RE40`cV) 0S S SVX HPQ  R 0000D bP0@0ڀրP"00`W@FpTp0 20 2p0f40 W? 0S S S70 2 000, 0bS( `PP* Z 00CX21 030S@ 1 0dP40Q4 p D P4@0 (K,0M 0@RZR R\00Ѝ0A10M 00 R0: S:Ѝ0 \M 1 21R  10 02SRЍ -L M@,KP0K0p0 c,0`0b2SzG  0$K -LMp` @+ 00RP! 0 V0 0@ P @@ P 0 B PP@ U @ @0 BP U P p@-0"RM"1@ 0`  00 3$ Pd05003$Q:R 00Q :0 0cC1S00Ѝp -LM0 10@ @R*0 S K0 @KM0S. 10          $  (  )  *  + , ! - " . # / $ 0 % 1 & 2 ' 3 ( 4 ) 005 L0S @04 0000 00 ЍdDlDhDpD0@-@PM 0Ѝ0@0@- bM@ l 3. P:Ѝ -2LM00< S@ 0 2140 040 8 4 00<0BP0 S SP00S p @ 0p W0 XSxS0 SP"`V< S$00S T0#03P0S  T7`$0p P0 S0S+0 XSxS&0 SP")S00W0S< 00 )Q<0B 0 S= PpT  $ 0200SW* T0#03P0S  `T  0 T000 R 80S 8 0 b 21040ASQ00(K,- M 0SЍ -8@LM,    h,x*,\n -LM` -LM<` -LM0 PR0P``@PH 00010p 8!#800"( (!( 0( \"x:0 0b 0("( #8!80#x \:W  0RPP@  ! .@0 1  M 0"108#8S"("$"""!   Ѝ 88S00000PM 00Ѝ-0 MS10 0LRA 3#\Ѝ -LM0p100`@PC 0` P0 `6>03U<U@@5 P 256 b42Uࠓ> M0S0Ѝ 0-LM@P 0 S8he$D0C05 `0 C>@0C01B@`@ K -LM@P`PwP00`?0P@``kP6 p0!1  0 ``0 @P0Q Q @ ^ P@:0t @  P@0  0V: pG02S p(K -LM0@0 P` VpP 0!R 0010P n0>00R3:Q`0R0:0F0 -LM0 @R0@PP` pWP9 10080 0 8S:1 ! 00 `P00 4 Z 0 @:4 0@^0:@P`00U:8 pGW02S p(K -LM@ P00@ -LMpPoȟ0@)"0@ \0P`0 0Zv@Pp  ! :,Lp 1P  -LM@` 1 1`P@ Dq> APU0Sh/PUPP+ 000S\/ ?@P `p @T0S\D/@T+P@ 0S 8/P`loB|Dq0 SM0 RЍp@-0MSP`P` D4%LP`\ЍpM0S0 C ,S R-S+SЍM0S SЍ0@-PPM  00L S @#0C^00L S^Ѝ0 0-LMPK@ 0P  >00:S 0P 0<##00:S  0 P0 00K0 0-LM0P-S@ +S@P T00c08 -LM0@JS000 #MS00  0P& 0.S" 0P 0.S 000C S00 [?mP 0/Sh00m  -L MPp@0  d&P000 %p30 0S# S Sf 100 2" `0F40  1:C=C00SO ;RMX1@H0@!B0ß40 QV@@Gd%dP% @ %0 @%T  U0B0C@%0P S04 0 \@ B1Q \000 O0O(KoQ 0-LMPP%dEA%`88 MR10bQ1bQP00Ѝ -L(MRP0 L PP 09H0D LR L=Q:S0T.U50S8 ( 0 5  00S9P0 8 80080 U0L SPE 0S 0<0R 8 0"4 < PUZ8 < DğP 00 ~ H` D @ !@ 9$0 p Po0@0S@T SUQPRZ 004K40 \P04pß0Os/< PL$ `GPU`9@H6@`Uį0p Z0@ d$P$p3`1 Qʭ P,C! ,3 `$HD 0n00a<L lpz}HWzG}G2WPd00@h$P0b$0p031T0K`PX U 0 dN$P0H$0p030KAPndؑ`0@P  d4$P.$p31XP@PPPp0@`DP{D@$PfP$PP00"$P $<@$P0<#8P 0@  d#P#p3 00 P00bP 0P0!0X0 00 0L$P P(KP@D@Qnmo?Qo MR10bQ1bQP00Ѝ -LMP`Up@##0c0h% 0RM 0R  0R  0R 0R 0cЍ -LM0 00  lK0S lK< PlPK`< P  P\PXpU `# \# 00`K0c\0 0p wPsrP mnPdh\ 00``RPP!#P#p3 10`0 XEp`0 S\ 00RPP#P"p3 10c`0 3P/DĔp0K``dV ʨp` @0K0Pd "P " p 3\0`2"1Q c P` \ \` P 0K Pl00;Q X0 v># 0Sl lK:>Pl ;0 l0 0 0 ?S p 0O /?0@ @  `cP@a0P`Z@P <` Y@ < VU@p < @K K0P <0S@0SKlKP- @ K R  S ZʐY@ < R S ppSʀR~@p < ZzYwP@ K pіL RKx0SH 1\11`Va  A=0K4 L0R. 0pB=0P L0\ @0K 0O0SO80 4@ 0PlK fPx L0R80K@0 <@  PEW 8KpGJHZ @ K PoSR ?!0 @K8P 4` @P <` P00@K(KlonoG8< -LMp@P`10S 0'K@-p0M@ 09H00 NS N0S: 0C"0\ZЍ8P@ -MLM`P8 <( u0 0 0S0 000K 0Pz 0S 18P11Zm B.K0 B B0S =0 B@4 P(0K 4@SD4xp4x 4(KR B.K B BD( ?Dx 1員! 0S@ , 2DP圥% p\! @ H @H L w3Lx dP00 S@x 0 0` cq3 4xX8<(00K4 Y (KG8<L*H*P 0M 0ЍYF P0 0M ЍPF -P?0LMS+? Q0S% R#0.,0 0St0 0Sd0 0ST0 0S D =04(p3H*L*T*X*P* -FMLM90@,0 9Kp&PT 0T00 ^P 0:S /'P 4-(P/S .'P I0:S@0/S 5( P)*B^KPEPE++'+'.'P@ @4PTp@ H(P\PUIK966,`fV @FFH`fg0`j6fK $ ( @ 2TQ Q\K\P2P)K6SSYY 0##iKf0 2"K0#"F0aS)KV`@v KPK`P@0V0 SH&00@P9KV`0S0o 0PRi@`0V 0e 0 0`R K&F)K0%P09K6Sz K` @P0X9K' IKFT@ 0S0(` 0QK' Y 0S0` 0Q @0 UT00CP0S )K&0j@c)KF 0 0 9K6RIKFTiKf PiK&9KF6TS0 SIKFD0 S}00 SyFLK(@D @D Po0Sl 002Sg,#qK0(A 000 00 0  0  0 P ``V FP*Y`xo -RLLM`@ %,6p@ P01h0 @000 0<S @>>0>Sv dp@ h &p@ @d h@ 0Si 0K~@Pd  RpP00PU& <U @>0 >SP dl@ d l@ @dd@ 0S,S ;S 4KVP;00>C40 0 s 3W4 R0;S,SHK VP& 0,S#\KMP PU|ğ @M00@H04 ` h0004 b 0a 0004}0Pp0(PPG0` H0K V4P@ ` \0KMU T  G0  G0@ P 0G G0`00 `dBP`<p3"1p QʍP`  ` 00KSځSB0`"0Sh20c Q0TBD  0c#0S ,rR( R0 0h!00 0S0 0 n0O0@0 Sb0 \| @M00@00 4h081 b 0a 0 0 00C00͆@00 00 blP  000P0PlPd h0d R d00 0 0 S pdQ h d0 l (KppH*L*oQ%X* -LM@ P  hNo p-LM@P`7 0S00lOh0PL6P0@0 V40T(0(0x=0(0xLDB<Do MЍP -LM@  -3L(M\4p 0 H L 0S 0S0S 0S~ 0!0Sx0Su*,ptp -lLM0SX@0 0R@P (@ 9PRh@8B -@LMa5h`5H p-LM,*"@PxhQ0S <"P< |"PP,P0SP% PQ0  B B,p P` 0:S  UP xh.xp@@8BP*o p-@`LM@4  @P4xHG P0M 0Ѝ p-<`LMP@4 @4xH -@LM4oh4H -LM< 8 <@K0<Kx4`K@_4@ 0P q<KpTR0@ Qp`4@K0@P4@ 0P [<KT R 0 @ QQR* 4KP'T"S `p4K4@K0@P4@ 0P 7<KTZ 0 @YQR 04K@4K(K 0-L M  @K0 K T?K0 -L0M@@KaM K -LM(@, 0B4P hcP0 -LM(@, 004P h<P4 -LMh p-QLM@P`p`S@rP`& 0V pKpp@-`M@Pb0 <250^@ 0<0Ѝp -LPM@P`p 4<`^0p(S RP 0p#83K`#[ &8R! X.(,Ƞ3K0#KKKsK3KᾂKSK@PK@\ ;3[S @0K@P\ 23[S*[ 3[H3[ Q  H $HxH $Hh@0K@P0\0 \6Kll PIl l0 SP i00CJ K 00S BZ J0Kh X X X RX R\0l<\LX 7\0x @l d@ T P0`P p0 t l0d P0 RᴠX Hd~dPjd!PPE` 8Rp0t@\x 0  c a"88c !^@NLl00a#0\0 000#Q@DAJlPE000T h0 RT P\ X^ \l 0Bn0X 3><A0 Q@l0#[[[2[x h[$[[4[xh(KD -QLM`p`ppl* <0;@Pe*0 X0AAQM Q0!0a0PЍ-RM \1,0l00 ?\0 00Ѝ-RM 0bR12<0 RQ ?R0̑030Ѝ@-SM@ 0l\4<0̠ \ ?\ 0 0@\ P R  0 0 0Ѝ-MR ,0l0>ЍàS-0c02Ì.1M0 00Ѝ0M S 200 ЍM0 3# R02 R02 0ЍM bQ B2c00 Ѝ@-M @0cR#3n P0C2Q0C2 d  l 0Ѝ0@- H. !Q, H@ ,P2\Ƞ3# MЍ0 -LM@,pK` 00K(PK 40K(4 ,000 ,( 0 K -L(M8pK4`K@H0  <0KDK 00PK@@K4D 80e  00@ 40`Z H 0@D 80O04 @0`I0< 840 000(K -RLM@`P&"xZ᐀q4 K80Kf,@K0PK4 800<h0H0, Q02[ZR$KP1#3P1 <2MЍpPQMЍPM3:00QЍPM3:00Q#2ЍQPMЍ ;; ;SMЍp@-9`\@T0 QMP R ,@00@0000#Ѝp p-LM`P@@@`@x -LMPP`p P0`B53A0Q B"A0E0U00` EU0 u @@ 0@dpQ@$K0@-@_Z@@P  @PMЍ0 p-PLM 0 o@a@I PP5Q 0 U0S$0 UZ$K e 0KAe $0Kp0 000M ЍЍDD -LM, T"`@pt3Z00 P T  W TTV1("SU*0U,!00QsKPI T 0W0T0SWT  !0Vt0RU/u P ,08!0P,K0K 0e,0|X 0SZ0P W T T0SP0S 000P ,K 0,0K00000  000 00, 0P, 00$KDD -,1LM0( s3Xp@` S P SS``(8?S@!Q vZ)?45VC"QqP0P_a( K(0@Q T< 000(0@T  030? KDD p-LM`P@'@!axh -LMP`pZ00 T0 G  0sRq0P00 0G (K -L :@KDK T0Z@ D0 J)@0 6 `H @0 0@K<0DK48 0 @0`DS :`@KDK@HKDH 0IH@ D0e (K -LM@p`U@0S0S00SU -;LPp45gc M3^@(` ,0 0U0/@@UPpS3:V:00S00O2WS0"?DE)U1(0 n(( K,01,0 , (0( cUV W1,0 N,, K~(01(0 ( ,0 cA@ KD -;LP`45f M3 à^@p$0 ( US8 V2N(0 (( KM!V\?DE% U2$0 n$$ K:U GU 1?"C   $0( 2 N$0 A A4@K -顏OLMX`p P$K -顏OLMX`p Pp$K/RMЍЍ|/RMЍvЍ -LpM| x x 0 ,JPJt@ %Jt優Cʠt \oOp&tP|@㪪<@ 8 0P D @ 4  @ tPZ t   lCZ  !  0$Z @tP0P 0DK4 K@0K00S 8<0 hT@KlXPK\`K8< d0@ P` HXLH @\ D@ P`T 0RX\@ ;#;SL 1lK D@h0KpK lX@Kp\PK``KX\ h0@ P` @\D` L @ P`X0LQL`0\ 00 00L0 HKLKHL 0PK-PH L0I(K -LPM` \ \h d0 (JJX@ Xd@ʠP`X $Jㄪ\X@p8RToOP&`@X<@ h@㪪0 8 D@ @ 4 `` XZ 0 0  AZ c0XZ  0X R  0 `MbЍ -@LM%   H900D9 -LMD9@SD9 H 0D9 -1LdM0`P 0 y]1p4@K x@ | S0 0t H@Kp 0l h0 0d0 `P V\ X@ T`  0| T h0K P0 0L0 ]E]H0p0S8 0 S(|KvP`v -L LMQ080 000 0 BS ] 00vB 0-LMP 0@Sl000C L{8:#:3 201 32 l8vvv -LM0PC@[ 0 0 b 00刡 0@ 0 `0D @1p0W00  P # 3TX0#0300 0 p (Kw p-LM0P,  0%R@`@l90\ lN@1A.S R00SRPx(w -LM 0`^0 4 ;~PrP 01@0鎐"pPI@  ?p 1@T  0A !0S0@0pW:XP 0 P0 000@C0  BP0!004  00C 0(K@w -t4LPMl$@0, 000(@pPlKX X X` ? ;P( K0 `DCFP(`3`<0C<Sw 4DTdtؚ,<L\lК(00 S,(0( 7(00 P2p0P"p"$P*$(P&p$P"00PpPpP P$P@0(000 p$(P P p P p1 F`V 0SyXZA P, pP` 1p`!P@?    i:B< 00 1p`!P 00 0 0R@\,0Z0$%Z Ul)0@  p00SD0 0SX[ 00 ,0 S0=(KHw\w-xvlwBlv -LM2@, 0$PPl90\ V>0>0U |M1%vW\b0ST"00C0@2 @P0!0v"1`(L$X! 1AS1a0g1 0 S K0S (Y  *0S 0, Q` 0 ^ V' $0 0gR &0S 0Y0g010g1  E )0S& 0S 1 S|p0St 00C0(`0 @P0 0S $ 000(K(wwBw ->0>0LMRP8 n1"( Y 80P8ce10cY czp`0 1S PTy01Xa140a1!010`0 X 00( 0B0P40 A:Z0( BaVp0S8  c 0S  8z 8011 010XAp@@(0X@2 !(0R((Ko)(Kw@wwww - 3LMp@Pk *"*RP R B0RP Ub;$ 0b S:XWR U53;2 @T $a ! PXD R 0S R>0>$ 0+ b< . . $ mc0SU * 0S  ,pd !9T I@TW PP\m @pG !0 1!08#(R!1 S1@10S00@@1S$ R00 1Sl0 0S  *1S1100S00@@x(x4x@xw -LM`XVp# P0S 0 @|0T 0S dh4X@00S0 h0 0CR0 XpBLxTx -L MD P8 < `Y$8 0:CR*80< p>0N@pPXP 00p0 P  BpXP$Q a  Ppde0S $ 0b S*0S b7 $0< c:b0PPA 0S>:$0S9<0S$0$ c g b-, 0&Rl90Q 80@S08 R 800C10 @0P0U40  p Y:3), 1 ""p  0 W0 3 @P0;p0#  0@ 00S0@@00@P 1P R0000  0U 0 *\Y# ᰑ01 R1J438#811  ] P  w0S00PP`6:39 )8#8!1Ბ1 !2R0 B101!2 Q 4 @0S00P40P0  0PO 0Rt1Sd1@@T0@@$20!0Rp@ >8#Ƞ@T@ 00001!0C8#8 ,S!1 R00 00t 00c0!2QB!R 0P<PU 8 R  (K4x(wtxvh -LM`4 pV0F80 V@@T0 P|20S pRp"0Sh2 PT"00S0  V W!1-@X$0:CW-*>0~ Vp:X 6h0Ve pP^ 80 0f@T `࿯P|ePaᶯPTTV 0PP   \V@ 000$Q a / P 0S$  bT 0 0 BS G T p0 0S x`V 00\V00P040@UVPSV000@(KBxx@w4x -LMP`;V(1p0S 1!@1T PP9VU3:U P *00S 0 0SVP@0Q P h\ 0 0CRP0 U 80 0S 4sU 00UpBx p-LMPU0`0S 0 @0T PP#@00S0 P &\ 0 0CRP0 U 80 0S 81U 00U`xBx -L(Mp`U40@ St 4$@4T wP'$0@T@ Y@TW8  @8P< L<@$ 0:CV:kU@ 000@0. N^@PUX$0Sd@D@ DP8@ 40 DP:P8P !8P!10b1@"4P(0UP4P :@PD  20DPP@@  p2P0@@DPT ,20S  <@`et6 P1 X-*$Q a P K$a {P B e800< @0< V0S$  b f0ZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0  -'QLM`$rP@ 2P0^p@  "p 1 @0 84 0<00 84 0<0 0 84 0<00 84 0<0 0840< 00840<$0 0 84 0<(00  8 40<,00 00 00 0040000 840<8008 40<<0K H expate knd 32-by -9LrM 9, 0 @,! 0x0 @@ PP `` pp Ā    $00 (@A ,P Q 4`a 8pq <,$ P T H 0 L L?P  HA00 LQlKRH 1`pD1 $14a 8q < @ xP `p0A1 04100 81 (00 <1 00 0,@#1n, 1lȠp `p D@qc8` dH`1 p0P# ,&0b*a0 0 'eZ0` 0 (0 0#@,0n 0#1 1dLc̠1`c<1 0&00 000 1p0'P#0  #0\00 0,00 000 10(1 0 #0lȠ#0n@#1dHc8`1 0p00 0'00 0a#0` P#0eZ041 0 &081 0b*0<1 10(1 41 #81l̠#<1p@#1Dq c<`p1 0@a ndL`p@1& #D1P'#p0, \0Cp0 p0SF01( x0 01 t 41匀80|0 0< 0 ऀ ̀P P  P  `p1 ` p aq@!DQ P! Q  $t| @p !",q A X \ `! 0@P`p؀(!#<$L%\&l'|(,̠. !",d1 hA pQ |a q 唁   ! 1 A#p?$(,(0!4 180 A<@,QPaq0V4p00L@@HL Tp(\(#0P!0@  "@ PT@(@( @00 ?00, 0RX(K  x p-L,M`0 0R0 P 0SD@K(p  0S((bp@DK(0\0+@ H0040 0S00e0 0 SKp  jx p-LM`0SP00S.`0 @0M@c KY  00C00S KpB   -0LM0@S`}뤀夠p00S @VP1P!M@c * a p0`e0e00P V00S mUB  MЍ 0-@LM P>8h p-R00P0LMS P?P*0SR *0S0,K  q00 0!00^0S0c 00 R L0Pl .a @0Q010C  P 0Q0Kpyy -LM@K 0 0 L  B100G*2 -LM@h+7*+PRM  Ѝ0M0Ѝ -- LM 0   K -LMğPP,  P, T, P#\3#0#P[%[ 0 S2 NL 0NK@DP@D0|#p3 PP ` ^H, [`  PEP``0 00RD< 300\ "0PEP``0 xD0"PEP``0S UPEU:00 00PEBKHH{-%T'0mS@ P^ L "0 "L<PGp` %S00W0S 0@pG@@W@pG@TB.K@ B BT<P~KEpG0pG @gb@DT0R S 0  D,K0gT00c8< 1AD4< A0 < 0< MK@@p0  F.PPHKgT0`0H8< At0A < 4< 0 zM5 ,0 S@(K0y4y\y|dy$)ly4mP\$y -LM00 K --0 L^M0`QP 0 paM_KPE`@M?KC/KKd1 4A 0A cl0F`KppX0 peKQ Q < F1@0 0RKxy -@LM ?  -L]M@ PMKpKKC/` `4 0 $TAM_KPE@h0D@KX0 KQ | Q 1 0 0ReKy-R0 0c BSR48 R p-@P`x BRpR0 BRRR@-pPM`P 0@T00 S R B \0dC10 P  =\Ѝ! -0LM0 0S=S` K KM0P P0Ѝ 0RR! B -@LM\:0S@d0d S0!*'R0 B\0` -LMp@W P`@P P P@DM 0SbЍR B 0\R#R! BJJ*SS*OO*xx*ee* 0-LM 0@0 @PfK0MЍMЍMЍMЍMЍMЍ``o*k*ccg*MЍMЍMЍ22Z*11V*R*Π0N*>>J*F* 0 0C0S2M-S0!1!Ѝ0 00M100 00 Ѝ -LMAPTpm%& R0 W 0 0PX@ P  } 00 AT$K -L$MR` X 0SR D @ 0 13 B1 80 0D0 @ 010s03@0 < XQ 1U   01 0Q0PQ!0Z000 R00S 0S S0101S 1UK0P  P CPT 1S0C1\0   P0R 0S00S40 0 0Ps 00<3 Q B  1 001% p # 40S0S00S40  0pPC p00 p 10!00@0@@T00Q00001P0Q =U0 P @ 0 Z00 IPZD< 081  01 0ā0P(K -LMPp Q0`@\ Q QVPP P0S -L M@pQ 4  P n0 %`P{cP> Z) 0(10S$1 0 ! 0S 0P * 0P$1 0$10 0S0P  0 `P0 8#R J`00 4 0 `(K -LMP@`QiPPq  Q0 Q000a0UP^ 0 8ᲀ#xP`=0 R  0S0 ` p=P(E000Y0n0@ 0S$10 (!$1 50S 0!P ) 0(10P%$10$1  0h8(#h"x 0 /p 0S I00  勽10 -LM@pAQ 4  n`0 PPxP- 0 PP #0 0S0P  0PP0 8#R >IP00 4 0 7P(K 0-LMP @p10K0 -L M@0 D <0K4 K `@P^40 <@KPtP 0@ kPJ 0D pUpW 000ᴠ08#8 P(@"(0ᱠ00 @0@0@ D0@00Q@0A 8#8 P0 00@6PP W000(K -L M`H0 00C< H8 H 8 4 D g< S0@8@#8@cH$H 00 冼   8#8 @@0 0@ 0@00 DP <0P< 0+p@4T # TH0X @ T@PH$HPdX%X N0PC4 4 0d0d00@ 0P00B0`008008 000C8< @ P#88 00;R008R#XH 0X0E8#X0 0@@eH$H X 8#8 B @0 00@ 00 DmP `04 0 4 00000C8X#(p4(K -LMP `  a("Hpd෻0P pP(`PP  0 0b8#H0T ʲ0S T0 ᔻP P -LMpP`@LQ\QQW@pT0X  Q00SP ô 0@00!0 0 0C2#00 0 0T00WW800C80 -LM` GpP@H1B@A01  P d 0200 0 0崜8q -AMLMŸP, p p8$ .$1P\2PPBnK`F`F08"S P:F?0xBNK@DBK @DA0A 04 㣼p` 1sa 1 <4 1R& Y 0CA 004 -4[.$[/[0[0L LLL^0H 0Q( K0/4[0$[0A A PZ<` W ∺@00%BT  z@ F : : ᢳ8$P0@<P0p 8$P qFO00 ,0 S (Kp|uyy -LM`pyQ 0P40 00 0 ? Q< R .@00%BT  @ H : : H4 P0@ P+ p G P 40P FO0 0<Z 0S 0 0C0pp/ 0R* Z 0CA 000 -0[. [/[0[0L LLL^03K/0[0 [0 003K/0[0 [0  P (K p-L M1@QP aP8 0,0ZP8 8Kp p-LM 0P8-`#1@::0C0$ 0\\1 8!$ BP@  T00~AB2AA 0B 1 0xh -L M404  SP0 00S400404 000 `0$0!QD AQ! 1 BN?p @%PP T 01C T 0 ! 0$ 10C0S  "0|X 0S@p T!D0V$0@00@c TD `Vu F!D1DD0 `0CD0@ 010CX$0Sc pPi!D0@0 TD0"`V1 /DR F!D1DD0@0CD0 ` 0 B Q~AB"AA 0B 1 05:    RQ00~LB2A0AB <0 0$ 10Q0A $0PD0 QP1@0c0Q51 N/D008#8#H! 04 40P 00P00 00000P0C0@P0 40(Ky -LMP0@0P@cH$HX`p %Xc0@@bH$H[PX%X0 0C@0P0@ -L M`PD OXX 0S0?pQH NR7 0< 00Q8 -:@0@0F@bH$H0 @0H @cH$H4 @000<0H0@ 00 0c80b0C 0< 00@ 0@G0 SD0dPU `尀X 0R@0 00S0S 00 0S `4 DPP1 0S 0 0 0S H 4  0D  P040 0400D Q808(|D40P4D(Ko(K -LtM@ 0  PP` > 0Ph 6 `(0P 00h"0  0@ `p| 00S`@d 0h 0C 8xp hp#X`p 00C8Sl   0\K)PXX \p0W T`V @p d` (^#x0`0C8#8 I 00l0ἐ 0`P~ dPP @a8 @#d` x  0P8#8t0 Ut0D  b@ 00L0 00 0lH t "P0S H @00 0S DKZP; 0DKL K\000p 0S @0H 0 0SpDK<pP 0DKp0 L K>00008#X0S0S UH:dP dDB4 00c 00 į 0f P4K< K8|#8  08# l  0 0b00屐 00<0 00l80 08#x`0X0g8#8 I! 000ഐ`000h 000(K -LM@0pP\oR 0080S#80l G8U#h 0  b)000 R C CCC0^(1U0E(10 00G000 000B800C80000 -L@P/ 0`p( 0A 0P-L 0- L@0@PKP $00}0A -@LT 0A -OL@ POtp -0LM"@ -L5Usage: %s ..., where is one of: instbin%s: %s not compiled in mount_cd9660md5sha256sha512dfmountmount_ext2fsarchsyncnewfs_msdossttylndisklabelpaxtarfsck_ext2fscatifconfigsysctlping6datelessmoremount_nfsfdiskgrepfgrepegrepumountmount_msdosfscksignifymknodreboothaltmount_ffsdhclientcpgzipgunzipgzcatchmodchgrpchownfsck_ffsnewfsrmmtejectmkdirksh-shbioctlencryptsleepmvdmesghostname.t HY(@@    ̆ Lf@@ Ȍ  ( 0 unknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs cannot be zerocbs meaningless if not doing record operationsbuffer sizes cannot be zerobuffer sizes cannot be greater than %zdseek offsets cannot be larger than %qdnonenoxferunknown status %s%s: illegal numeric valueunknown conversion %s%s: illegal conversion combinationcbsconvibsifobsofskipstatusnoerrornotrunc%s: end of device%s: short write on character device%s: short write on tape devicefiles is not supported for non-tape devicesstdoutinput bufferoutput buffercase conv and -DNO_CONV%zu+%zu records in %zu+%zu records out blockblocks%zu odd length swab %s %zu truncated %s %qd bytes transferred in %lld.%03ld secs (%0.0f bytes/sec) skip reached end of input  , 0 4 < H P X ` h usage: mount_cd9660 [-egjR] [-o options] [-s offset] special node session number is %s: %segjo:Rs:realpath %scd9660%s: Filesystem not supported by kernel%s on %suserquotagroupquotarwnetautoaccesstimeatimeexecsuidrdonlyupdateneedsdoes not need-o %s: option %s a value-o %s: option not supported%s: illegal value '%s'%s (%s) = %s usage: %s [-bcpqrtx] [-C checklist] [-h hashfile] [-s string] [file ...] error encoding base64cannot open %sstdout: write error%s: read errorbC:ch:pqrs:txbase64hex%s doesn't support %s ,unknown algorithm "%s"SHA256SHA512usage: %s [-hiklnP] [-t type] [[file | file_system] ...] df: %qd: %s 1024-blocks 512-blocks%-*.*s %s Used Available Capacity Mounted on Filesystem%-*.*s %*lld %10lld %11lld %5.0f%% %s %7s%-*.*s %*llu %9llu %9lld %5.0f%% %7llu %7llu %5.0f%% %s %-*.*s %s Used Avail Capacity Size1K-blocks%-*.*s %s Used Avail Capacity iused ifree %%iused Mounted onempty type listonly one -t option may be specified.hiklnPt:-h and -i are incompatible with -Pretrieving information on mounted file systems%s is not a local file system%s mounted as a %s file systemffsext2fsnfs:@ufs%s: fstab uses outdated type 'ufs' -- fix pleasemfs%s: fstab type %s != disklabel type %susage: mount [-AadfNruvw] [-t type] mount [-dfrsuvw] special | node mount [-dfruvw] [-o options] [-t type] special node -o%s,%s on %s type %.*s (%sunknown flag%s %#x, ctime=%sv3v2udptcpsofthardintrnoconnrdirplus%s%s=%dwsizersizerdirsizetimeoretransmaxgrouplistreadaheadacregmin, %s=%dacregmaxacdirminacdirmax%s%s=%lu %smsdos%s%s=%u, %s=%uuidgid%s%s=0%onowin95direxecnorripgensextattstatfs %s on %s type %.*s: %s already mountedexec: mount_%sfork%s/mount_%sexec %s for %sno mount helper program found for %sforceAadfNo:rswt:uvrqnoautogetmntinfounknown special file or file system %s.root_devicecan't find fstab entry for %s.%s has unknown file system type./var/run/mountd.pidsignal mountdasynchronousasyncexported to the worldkerberos uid mappingNFS exportedanon uid mappingexported read-onlynoatimenodevnoexecnosuidwith quotasread-onlyroot file systemsynchronoussoftdep/usr/sbin  , 0 4 < H P X ` h usage: mount_ext2fs [-o options] special node o:specified device does not match mounted devicefilesystem not supported by kernelmount table full%s on %s: %susage: machine [-a] usage: arch [-ks] machinearmisharmOpenBSDd @@h @h l pp p t p x `  @   $%s: no default %s%s: illegal %s%s: bad %susage: %s [-N] [-a FAT-size] [-B boot] [-b block-size] [-c cluster-size] [-e dirents] [-F FAT-type] [-f format] [-h heads] [-I volid] [-i info] [-k backup] [-L label] [-m media] [-n FATs] [-O OEM] [-o hidden] [-r reserved] [-S sector-size] [-s total] [-u track-size] special [disktype] %s: bad FAT typevolume ID"*+,./:;<=>?[\]|%s: bad volume label%s: bad OEM stringbytes/sectorsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsfile system sizesectors/track/dev/%s is mounted on %s%s: block devicewarning: %s is not a character device%s: unknown standard format%s: can't figure out partition infoioctl (GDINFO)%s: can't read disk label; disk type must be specified%s: unknown disk type%s: partition is unavailablebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %u-%c is not a legal FAT%s optionblock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectorstoo many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs=%#x bkbs=%s: can't read sector %uNO NAMEFAT%uBSD 4.4%s: can't write sector %u160180320360720120014402880(( ((,,((( ((  ( ( (-+():*********** * *#*3+#+3+2+3 +3(+#0+@8+@H@@+@H+P+X+`+l+t+|+++++++++++ + +@+@+++, ,,,$,p,,4,<,D,L,T,\,d,l,x, , X-,,,,,,,,,,,,,- -- -(-0-8-@@-@L-@T-@`- h- t- - -------@-@--- - .C$-C-C$-C...(.4.<.D.L.T.\.d.l.t. |. .....@.@......option requires an argument -- %sundefmaximum option value is %d -- %soption requires a numeric argument -- %sdiscarddsuspeofeol2lnextminquitreprintstartstopsusptimeflushrprntillegal gfmt1 option -- %sillegal gfmt1 option%lxcflagiflagispeedlflagoflagospeedgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d TIOCSTOPTIOCSTARTTIOCSETD%d %d rows %scols %sospeed %sispeed %sillegal option -- -%scbreakcolscookeddecekeverythingextproclcasenewoldostartostoprawrowssanespeedttycs5cs6cs7cs8cstopb-cstopbcread-creadparenb-parenbparodd-paroddparity-parityevenp-evenpoddp-oddppass8-pass8hupcl-hupcl-hupclocal-clocalcrtscts-crtsctsmdmbuf-mdmbufignbrk-ignbrkbrkint-brkintignpar-ignparparmrk-parmrkinpck-inpckistrip-istripinlcr-inlcrigncr-igncricrnl-icrnliuclc-iuclcixon-ixon-flowixoff-ixofftandem-tandemixany-ixanydecctlq-decctlqimaxbel-imaxbel-echoechoe-echoecrterase-crterasecrtbs-crtbsechok-echokechoke-echokecrtkill-crtkillaltwerase-altweraseiexten-iextenechonl-echonlechoctl-echoctlctlecho-ctlechoechoprt-echoprtprterase-prteraseisig-isigicanon-icanonnoflsh-noflshtostop-tostopflusho-flushopendin-pendin-crtnewcrt-newcrtnokerninfo-nokerninfokerninfo-kerninfoxcase-xcaseopost-opostlitout-litoutocrnl-ocrnlolcuc-olcuconlcr-onlcronlret-onlretonocr-onocrtabs-tabsoxtabs-oxtabsonoeot-onoeot tablet disc; slip disc; ppp disc; strip disc; nmea disc; #%d disc; ispeed %d baud; ospeed %d baud;speed %d baud; %d rows; %d columns;lflags-extprociflagsoflagscflagscchars%s = %s;%-8susage: %s [-a | -e | -g] [-f file] [operands] -aefgaef:gnot a terminalTIOCGETDTIOCGWINSZgfmt1illegal option -- %stcsetattrTIOCSWINSZusage: %s [-fhLnPs] source [target] %s [-fLPs] source ... [directory] %s/%s%s: disappeared%s and %s are identical (nothing done).fhLnPs\ | R|u u @u u@@ u @u(@u %(u@| R `Nu@u_|R@d|1 2`22p\Rx\\\\\\\\8S\\\\\hX\h\\\d|u uhuu8S\\ \(\DS0\8\@\H\P\X\\\`\h\u(\V@S8 uu\4^\u8\\\uuu\s6㿂;{v&c'9O8'm:="!5Ei[HZqv8E>}N.{ɋFsUw-kUٻ4.yw'篒W;}ER$7eRD͒N4OZ^%7}UIE0UJWNU7pKˣ}%اqJxuó0cSbQ} y/`l(ψ S>CcGueScT}ƻdT$9i:^L>qt^ǥ޺)ʢ٤ҙN[1iQF4jUTz:]of6ٖTbŭ< 13U0zR*kt]ئl:0zY_dO`)H6@e:gjpqft֤Eh!YfR-RfoMaav-Mk\WM8GmkS76=|V2Xj֦],.IV9̙v.JmV3miJ0ˍ-2>8)pi1#M xtJ, @N*Ӡ4plxK|v0՗\-TSH.ީcH;fjIaᩁ;g#(@R ,5@zm"׹$gtK`)Ksg;q08@[0+k]2h_ju'e:;ڝj5o]j]ʠMzvJB>@VtJOĸѕʧ/&Q8SHAS[LsW U7d?@7 K8TyAx ^DDMOD׬BpNz조X?1Ts"˜[KAV:), =VqIF $kGr(6wr S85.+)sAgp ;lFa4t|qJz`^Z!jA8 hL)mp,xfn4U>nrY q6!p,Z)l";.A+bGlH*ik118ƫ.r`MTC%o psXjD*%# a^vCr^6-Mij-[~k y9$Qpr8D!VQHp_! =J~d@9ciE0"ks ˶XɈj9%ʂe9А eI6FauqñڈKD"lF+`u#ǤjjD9Q+],̤F$Gdn<hS y(@ ]ER 6h yA+4g*49ZH9%!Yl]: uftWq|nuCÝ8ΣSaԒոs(w$&')OW ﻲ< M "Mh1ņkR)ޯsM ySȃ0ݨtpY&U/f$HH}d|*`5fԃ0QI 1̚J ;Օ-P3x$0cel3 #rZ3ڇqJTW^ sӺLIКD 7V~[_M1Yx09&D]m貴Jp> c:|c 7چeAZB$s <WƧRɩE68G),G'm'r}} aP]pc\O0۱yAnswIkUKu\vI E|b2vuݮ u2FF m%[UdC<FƄ\%W=!,vP9j<+!v 8򀖸A@O^oh L'cnp kh\JSP VYDQ򾏒c-=+vř]S0*Dwa 9: -M~oրDh͞H 4]aBNj<9|$9 >&o_2ԗ+KwIPwjŠ.$U˸ҏYH) ]^"N Cv%{|/>DMdJOzYHƍRtŢvCN"3 \aK=o?R2nJUɍ0Q0)5EQ=dQr[嚴C@1]mL={88O7t3O#gؕ^::YT^TѸO/_Z%jim=`"oO<7r!ѐAA8Q O u/E/|W#O,1cҽ~6ru)rb}hm j+_GϾnնa=8ż6߮sN^oo?ӝQmfEy4ƤXN)ͰFVFnGE}٪ϐ#$J )@`l;Ot16ܣC.дk\T0|쌔 X=se0,Pxf'ٍh&[,2 0Uz;5#yͲ"wt4 'Fwˋ]7b<; RE#=b'K͜ru]R%#M%n;LVO 咯' c/p >%&AhLUWsb'~H~*uKFx-/ҕi`F7_OeݥLDv53mϞ< 2^Y"f?z1M]:MRusage: disklabel [-Acdtv] [-h | -p unit] disk (read) disklabel -w [-Acdnv] disk disktype [packid] (write) disklabel -e [-Acdnv] disk (edit) disklabel -E [-Acdnv] [-F|-f file] disk (simple editor) disklabel -R [-nv] [-F|-f file] disk protofile (restore) `disk' may be of the form: sd0 or /dev/rsd0%c. `disktype' is an entry from %s, see disktab(5) for more info. /etc/disktab`packid' is an identification string for the device. `protofile' is the output from the read cmd form; -R is powerful. For procedures specific to this architecture see: %s fdisk(8)sector size %dsectors/track %dtracks/cylinder %dcylinders/unit %dboot block size %dwarning, boot block size %% sector-size != 0super block size %dwarning, super block size %% sector-size != 0warning, number of partitions (%d) > MAXPARTITIONS (%d)warning, partition %c: size 0, but offset %llupartition %c: offset past end of unitpartition %c: partition extends past end of unitwarning, unused partition %c: size %llu offset %lluBootstrap doesn't leave room for disk label line %d: syntax errorunknownIDEESDIline %d: warning, unknown disk type: %sbadsectvendorline %d: bad flag: %sdrivedataline %d: bad drivedata %s%d partitionsline %d: bad # of partitionsduidline %d: bad %s: %ssectors/cylindertracks/cylindercylindersrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seektotal sectorsboundstartboundendline %d: bad partition name: %sline %d: too few fieldsline %d: bad partition size: %sline %d: bad partition offset: %sline %d: warning, unknown filesystem type: %sline %d: unknown field: %sVISUALEDITOR/usr/bin/vi%s %s/bin/sh%s: No disk label on disk%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of disk %c: %16llu %16llu %c: %15.*f%c %16llu %7.7s%7d %5u %5u %4hu %19.19s# %s# %s: type: %s type: %d disk: %.*s label: %.*s duid: %02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx flags: badsect vendorbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %llu # total bytes: %.*f%cboundstart: %llu boundend: %llu drivedata: %d %hu partitions: # %16.16s %16.16s fstype [fsize bsize cpg] offset%.*s|Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:nc#%u:sc#%u:su#%llu:d%d#%u\ :p%c#%llu:o%c#%llu:t%c=%s:t%c=unknown%d:b%c#%u:f%c#%u:ioctl DIOCRLDINFOioctl DIOCGPDINFOioctl DIOCGDINFO/dev/%s%c%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx.aioctl DIOCWDINFO # Notes: # Up to 16 partitions are valid, named from 'a' to 'p'. Partition 'a' is # your root filesystem, 'b' is your swap, and 'c' should cover your whole # disk. Any other partition is free for any use. 'size' and 'offset' are # in 512-byte blocks. fstype should be '4.2BSD', 'swap', or 'none' or some # other values. fsize/bsize/cpg should typically be '2048 16384 16' for a # 4.2BSD filesystem (or '512 4096 16' except on alpha, sun4, ...) No changes.re-edit the label? [y]: unknown disk type: %sbckmgtBCKMGTValid units are bckmgt ABEf:F:hRb:cdenp:tvwSMDMSCPold DECSCSIST506HP-IBHP-FLtype 9floppyccdvndATAPIRAIDunusedVersion6Version7SystemV4.1BSDEighth-Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSHFSADFSNTFSUDF-cTreating sectors %llu-%llu as the OpenBSD portion of the disk. You can use the 'b' command to change this. OpenBSD area: ; size: ; free: # %16.16s %16.16s fstype [fsize bsize cpg] Can't stat deviceAvailable commands: ? | h - show help n [part] - set mount point A - auto partition all space p [unit] - print partitions a [part] - add partition q - quit & save changes b - set OpenBSD boundaries R [part] - resize auto allocated partition c [part] - change partition size r - display free space D - reset label to default s [path] - save label to file d [part] - delete partition U - undo all changes e - edit drive parameters u - undo last change g [d|u] - [d]isk or [u]ser geometry w - write label to disk i - modify disklabel UID X - toggle expert mode l [unit] - print disk label header x - exit & lose changes M - disklabel(8) man page z - delete all partitions m [part] - modify partition Suffixes can be used to indicate units other than sectors: 'b' (bytes), 'k' (kilobytes), 'm' (megabytes), 'g' (gigabytes) 't' (terabytes) 'c' (cylinders), '%' (% of total disk), '&' (% of free space). Values in non-sector units are truncated to the nearest cylinder boundary.%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx.%c%s%c none swap sw %s%c %s %s rw 1 %d failed to sort partition table Error, partitions %c and %c overlap: Disable which one? (^D to abort) [%c %c] %s: [%llu] %lldRounding size to cylinder (%d sectors): %llu fragment sizeSize of ffs block fragments. A multiple of the disk sector-size.Command aborted Invalid entry Error: fragment size must be a multiple of the disk sector size (%d) Zero fragment size implies zero block sizeSize of the partition. You may also say +/- amount for a relative change.The size must be > 0 sectors The size can't be more than %llu sectors, or the partition would extend beyond the last sector (%llu) of the OpenBSD portion of the disk. The 'b' command can change this limit. Sorry, there are only %llu sectors left Starting sector for this partition.The offset must be >= %llu and < %llu, the limits of the OpenBSD portion of the disk. The 'b' command can change these limits. The offset must be in a free area. Starting sectorThe start of the OpenBSD portion of the disk.Size ('*' for entire disk)The size of the OpenBSD portion of the disk ('*' for the entire disk).%s: [%s] [d]isk or [u]ser geometryEnter 'd' to use the geometry based on what the disk itself thinks it is, or 'u' to use the geometry that was found in the label.BIOS geometry not defined. Note: user geometry is the same as disk geometry. You must enter either 'd' or 'u'. Where to mount this filesystem (ie: / /var /usr)'%c' already being mounted at '%s' Mount points must start with '/' FS typeFilesystem type (usually 4.2BSD or swap)FS type (decimal)Filesystem type as a decimal number; usually 7 (4.2BSD) or 1 (swap).Unrecognized filesystem type '%s', treating as 'unknown' Size of ffs blocks. 1, 2, 4 or 8 times ffs fragment size.Error: block size must be at least as big as page size (%d). Error: block size must be 1, 2, 4 or 8 times fragment size (%llu). Align partition to block sizeRound the partition offset and size to multiples of bsize?Rounding offset to bsize (%llu sectors): %llu Rounding size to bsize (%llu sectors): %llu The disklabel UID is currently: %02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx The disklabel UID, given as a 16 character hexadecimal string.Invalid UID entered. Possible values are:"IDE", "%s"Disk typeWhat kind of disk is this? Usually SCSI, IDE, ESDI, ST506, or floppy."%s" is not a valid disk type. Valid types are: Changing device parameters for %s: What kind of disk is this? Usually SCSI, ESDI, ST506, or floppy (use ESDI for IDE).label name15 char string that describes this label, usually the disk name.The Number of sectors per track.The number of tracks per cylinder.The number of sectors per cylinder (Usually sectors/track * tracks/cylinder).number of cylindersThe total number of cylinders on the disk.The total number of sectors on the disk.You may want to increase the size of the 'c' partition.Not enough free space to shrink by %llu sectors (only %llu sectors left) partition to change sizeThe letter of the partition to change size, a - p.Partition must be between 'a' and '%c' (excluding 'c'). Partition '%c' is not in use. Partition %c is currently %llu sectors in size, and can have a maximum size of %llu sectors. partition to deleteThe letter of the partition to delete, a - p, or '*'.partition to modifyThe letter of the partition to modify, a - p.partition to nameThe letter of the partition to name, a - p.You cannot name a filesystem of type %s. No space left, you need to shrink a partition The letter of the new partition, a - p.Partition '%c' exists. Delete it first. partition to resizeNo such partition Cannot resize spoofed partition [+|-]new size (with unit)new size or amount to grow (+) or shrink (-) partition including unitAmount too big Partition %c shrunk to make room No room left for all partitions can't get mem sizeYou need to specify a type for this disk.can't run when there is partition overlap.No 'c' partition found, adding one that spans the disk.Label editor (enter '?' for help at any prompt) unable to get default partition tableThis option is not valid when run without the -f flag. PAGER/usr/bin/lessgunzip -qc|%sunable to execute %sIn no change mode, not writing label.No label changes.Write new label?Write the modified label to disk?unable to write labelResize only implemented for auto allocated labels Free sectors: %16llu - %16llu (%16llu) Total free sectors: %llu. FilenameName of the file to save label into.Original label and mount points restored.Last change undone.EnteringExiting%s expert mode Unknown option: %c ('?' for help) /tmp/var/usr/usr/X11R6/usr/local/usr/src/usr/obj/homelfsadosntfsudfsdFLOPPYxdhdVNDsvndabcdfiklnoprstuvwxBDEGHLPTUXYZ0Cannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specForward positioning operation on archive failedCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Reverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %d pad blocksUnable to backspace tape %d blocks.Failed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDUnable to truncate archive file%s%s: Waiting for tape drive close to complete...done. %s: unknown format, %llu bytes skipped. %s: %s vol %d, %lu files, %llu bytes read, %llu bytes written. could not pipecould not fork-dccould not exec %sFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed chdir to %sFailed stat on %sCannot write an archive on top of a directory %sUnable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Ready for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again ..Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sUnable to open %s to readCannot identify format. Searching...Sorry, unable to determine archive format.Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot mix current archive format %s with %s%s: Reading archive to position at the end...Cannot chdir to %sCan't fchdir to starting directoryUser specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUnable to append when there are archive read errors.Archive read error limit (%d) reachedCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Write block size %d too large, maximium is: %dWrite block size %d is not a %d byte multipleWrite block size of %d too large, maximium is: %dWrite block size of %d is not a %d byte multipleWrite block size of %d larger than POSIX max %d, archive may not be portableUnable to allocate memory for group name cache tableUnable to allocate memory for user name cache tableUnable to allocate memory for group id cache tableUnable to allocate memory for user id cache tableFile changed size %sFile %s was modified during readFile rewind failed on: %sFailed seek on file %sFailed write to file %sFile seek on %sWARNING! Major Internal Error! GNU hack Failing!Out of memoryCould not set permissions on %sUnable to set file uid/gid of %sAccess/modification time set failed on: %sUnable to close file descriptor on %sUnable to copy %s, file would overwrite itselfUnable to remove directory %sCould not unlink %scannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCould not create: %scpioCould not access %s (stat)Unable to link file %s to itselfUnable to remove %sCould not link to %s from %sUnable to link to %s from %sA hard link to the directory %s is not allowedUnable to create %sIgnoring unterminated pathname at EOFIgnoring too-long pathname: %sCan't chdir to %snext_fileFile system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %sWARNING! These file names were not selected:Invalid file name argumentUnable to allocate memory for filenameUnable to allocate memory for file name buffer%b %e %H:%M%b %e %Y%s%s %s %s%2u %-*.*s %-*.*s %4lu, %4lu %9llu == -> %s: unknown option %c %s: %c argument missing Invalid option nameUnable to allocate space for option listInvalid options formatusage: tar {crtux}[014578befHhjLmNOoPpqsvwXZz] [blocking-factor | archive | replstr] [-C directory] [-I file] [file ...] tar {-crtux} [-014578eHhjLmNOoPpqvwXZz] [-b blocking-factor] [-C directory] [-f archive] [-I file] [-s replstr] [file ...] usage: pax [-0cdjnOvz] [-E limit] [-f archive] [-G group] [-s replstr] [-T range] [-U user] [pattern ...] pax -r [-0cDdijknOuvYZz] [-E limit] [-f archive] [-G group] [-o options] [-p string] [-s replstr] [-T range] [-U user] [pattern ...] pax -w [-0adHijLOPtuvXz] [-B bytes] [-b blocksize] [-f archive] [-G group] [-o options] [-s replstr] [-T range] [-U user] [-x format] [file ...] pax -rw [-0DdHikLlnOPtuvXYZ] [-G group] [-p string] [-s replstr] [-T range] [-U user] [file ...] directory Invalid block size %sbzip2compress/dev/rst0/dev/rst1/dev/rst4/dev/rst5/dev/rst7/dev/rst8b:cef:hjmopqruts:vwxzBC:HI:LNOPXZ014578-IUnable to open file '%s' for readProblem with file '%s'-Cwrite_opt=nodirTAPEInvalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multipleError count value must be positiveab:cdf:ijklno:p:rs:tuvwx:zB:DE:G:HLOPT:U:XYZ0%s: Invalid combination of options: -%cDestination directory was not suppliedThese format options are not supported %s = %s ustarFile name %s/%s, too longWARNING! These patterns were not matched:Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Removing leading / from absolute path names in the archive ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Pattern select out of memoryPattern list inconsistentEmpty pattern stringUnable to allocate memory for pattern stringEmpty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %s CPU time limit reached, cleaning up. Signal caught, cleaning up. Can't open current working directory.TMPDIR/tmp/Cannot allocate memory for temp file name.Unable to set up signal handlercan not gzip while appendingEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [[[[[cc]yy]mm]dd]HH]MM[.SS][/[c][m]]Unable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory for directory timesCannot canonicalize %sUnable to store mode and times for created directory: %sDirectory access time reset table ran out of memoryDevice map table out of memoryUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableCannot allocate memory for device mapping tableCannot allocate memory for interactive rename tableCannot allocate memory for hard link tableNo interactive rename table, links may failCannot update rename tableInteractive rename table out of memoryHard link table out of memoryFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sUstar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sFile is too long for ustar %snobodyUstar header field is too small for uid %lu, using nobodyUstar header field is too small for gid %lu, using nobodyUstar header field is too small for %sTar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sInvalid extended header lengthInvalid extended header recordInvalid extended header record lengthExtended header record length %lld is out of rangeMalformed extended header recordlinkpathwrite_optnodirUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.%s: /dev/ttyFatal error, cannot open %susage: ping [-DdEefLnqRv] [-c count] [-I ifaddr] [-i wait] [-l preload] [-p pattern] [-s packetsize] [-t ttl] [-V rtable] [-w maxwait] host patterns must be specified as hex digits%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0x%02xVr HL TOS Len ID Flg off TTL Pro cks Src Dst Data %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %s TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Echo ReplyDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set (MTU %d) frag needed and DF setSource Route FailedNetwork UnknownHost UnknownSource IsolatedDest. Net Administratively ProhibitedDest. Host Administratively ProhibitedDestination Net Unreachable for TOSDestination Host Unreachable for TOSRoute administratively prohibitedHost Precedence ViolationPrecedence CutoffDest Unreachable, Unknown Code: %d Source QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect, Unknown Code: %d(New addr: %s) Echo RequestRouter Discovery Advertisement(%d entries, lifetime %d seconds) Router Discovery SolicitationTime to live exceededFrag reassembly time exceededTime exceeded, Unknown Code: %d Parameter problem, required option absent: pointer = 0x%02x Parameter problem: pointer = 0x%02x TimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask Reply (Mask 0x%08x) Unknown ICMP type: %d --- %s ping statistics --- %ld packets transmitted, %ld packets received, %ld duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/std-dev = %d.%03d/%d.%03d/%d.%03d/%d.%03d ms packet too short (%d bytes) from %s%d bytes from %s: icmp_seq=%u ttl=%d time=%d.%03d ms (DUP!) (TRUNC!) wrong data byte #%d should be 0x%x but was 0x%x%x %d bytes from %s: LSRR: 0.0.0.0 %s (truncated route) (same route) RR: NOP unknown option %xping: sendtoping: wrote %s %d chars, ret=%d setresuidnumber of packets to transmit is %s: %sbad interface address: %sbad timing interval: %s%s: only root may use interval < 1spreload value is %s: %spacket size is %s: %sttl value is %s: %srtable value is %s: %ssetsockopt SO_RTABLEmaxwait value is %s: %sDEI:LRS:c:defi:l:np:qs:T:t:V:vw:unknown host: %s-f and -i options are incompatibleNo audible output for flood pingsbind-R option and -D or -T, or -t to unicast destinations are incompatiblerecord route not valid to multicast destinationsping: record routesetsockopt IP_MULTICAST_LOOPsetsockopt IP_MULTICAST_TTLsetsockopt IP_MULTICAST_IFgetsockoptsetsockoptCannot set the receive buffer sizeCould only allocate a receive buffer of %d bytes (default %d)PING %s (%s): %d data bytes PING %s: %d data bytes ping: recvfromp\Rx\\\\\\\\8S\\\\\hX\h\\\NO SPACE LEFT IN %s (EXPANDED)EXPANDUNREFDIRLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTUNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORYlost+found IS NOT A DIRECTORYREALLOCATESORRY. CANNOT CREATE lost+found DIRECTORY SORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu NAME=%s %s=%s DIRECTORY CORRUPTEDwrong type to dirscan %d lost+found%d %s I=%lluBAD STATE %d TO BLKERR cannot find inode %llu bad inode number %llu to nextinode Cannot allocate space for inode buffer bad inode number %llu to ginode blk %d < cgdmin %d; blk + cnt %d > cgsbase %d blk %d >= cgdmin %d; blk + cnt %d > cgdmax %d LARGE FILES UNSUPPORTED ON REVISION 0 FILESYSTEMSSETTING LARGE FILE INDICATOR SET LARGE FILE INDICATORTRYING TO SET FILESIZE TO %llu ON MODE %x FILE I=%llu OWNER=%u MODE=%o SIZE=%llu MTIME=%12.12s %4.4s cannot increase directory list PARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDSCLEAR (CLEARED)-%c flag requires a %s usage: %s [-dfnpy] [-b block#] [-m mode] filesystem ... Alternate super block location: %d bad mode to -m: %o ** lost+found creation mode %o b:dfm:npystarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system** Phase 1 - Check Blocks and SizesINTERNAL ERROR: dups with -p** Phase 1b - Rescan For More DUPS** Phase 2 - Check Pathnames** Phase 3 - Check Connectivity** Phase 4 - Check Reference Counts** Phase 5 - Check Cyl groups%d files, %d used, %d free %d files missing %d blocks missing The following duplicate blocks remain: %d,The following zero link count inodes remain: %llu, ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW *****EXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEEXCESSIVE DUP BLKS I=%lluuDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%lluINODE I=%llu HAS DTIME=%12.12s %4.4s (CORRECTED)bad size %llu:HOLD BAD BLOCKbad size %llu ndb %d:bad direct addr: %d bad indirect addr: %d LINK COUNT TABLE OVERFLOWINCORRECT BLOCK COUNT I=%llu (%d should be %d)UNKNOWN FILE TYPE I=%lluROOT INODE UNALLOCATEDALLOCATECANNOT ALLOCATE ROOT INODE DUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYFIXBAD STATE %d FOR ROOT INODE DIRECTORY TOO SHORTDIRECTORY %s: LENGTH %lu NOT MULTIPLE OF %dMISSING '..'BAD INODE NUMBER FOR '..'BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' BAD TYPE VALUE FOR '..'CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '..' EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEUNALLOCATEDDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORY (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%llu ZERO LENGTHBAD/DUP%u: %2x summary info for cg %d is %d, %d, %d,should be %d, %d, %d SUMMARY INFORMATIONS WRONG FOR CG #%dblk_bitmap:bbmap:BLK(S) MISSING IN BIT MAPS #%dino_bitmap:ibmap:INODE(S) MISSING IN BIT MAPS #%dsummary info bad in superblock: %d, %d should be %d, %d SUPERBLK SUMMARY INFORMATION BADstrdup failedrealloc failedmalloc failed/r%s (%s): UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat rootCan't stat %s %s is not a character device ioctl (GCINFO): %s %s: can't read disk label %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A EXT2 FILE SYSTEM (%s) BAD SUPER BLOCK: %s MAGIC NUMBER WRONGBAD LOG_BSIZEBAD BLOCKS PER GROUPcompat 0x%08x, incompat 0x%08x, compat_ro 0x%08x INCOMPATIBLE FEATURE BITS IN SUPER BLOCKsuperblock mismatchesoffset %ld, original %ld, alternate %ld VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATECan't stat %s: %s %s is not a character deviceCan't open %s: %s ** %sNO WRITE ACCESS (NO WRITE)cannot allocate space for superblock LOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO FSCK_FFS TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ext2fs(8).USING ALTERNATE SUPERBLOCK AT %d state = %d ** F%sile system is clean; not checking ** File system is already clean IMPOSSIBLE RESERVED BLOCK COUNT=%d IN SUPERBLOCKSET TO DEFAULTWRONG FPG=%d (BPG=%d) IN SUPERBLOCKBAD SUMMARY INFORMATIONcannot alloc %u bytes for blockmap cannot alloc %u bytes for statemap cannot alloc %u bytes for typemap cannot alloc %u bytes for lncntp cannot alloc %u bytes for inphead returning to single-user after filesystem check bad file type 0%o cannot allocate buffer pool INTERNAL ERROR: GOT TO reply()%s? no %s? yes %s? [Fyn?] (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %d CANNOT %s: BLK %dProgram terminated WRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN: %lld (%lld), %lld,PARTIALLY WRITING %sZERO'ED BLOCK %d TO DISK UPDATE STANDARD SUPERBLOCKSPanic: lost %d buffers MARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEANcache missed %ld of %ld (%d%%) READTHE FOLLOWING DISK SECTORS COULD NOT BE READ:deadlocked buffer pool %6d usage: %s [-benstuv] [file ...] benstuvH5j55555DDD. @@PCPC D(D0t8t@ 5D 5L8\T$[`Xpp]|rr;;d;.,0\LSKqp@@,KJIL/L/L/(L/V|V4@w<3L3`L1lL1xL1,RL1L1L1L122L1L1L1L1|655 55@55WZ randommalformed link-level addressSIOCSIFLLADDRSIOCIFAFDETACHSIOCIFAFATTACHSIOCGIFXFLAGSSIOCSIFXFLAGS[#%d]SIOCG80211WPAPARMSSIOCS80211WPAPARMSSIOCGIFFLAGSSIOCSIFFLAGSSIOCIFDESTROYmedia mode %smediaopt instance %d"%.*s"0xSIOCGIFGROUPgetifgroups groups:usage: ifconfig [-AaC] [interface] [address_family] [address [dest_address]] [parameters] invalid channel %s: %sSIOCS80211CHANNELprefix %s: %sSIOCGIFMEDIA%s: no link type?only one `instance' command may be issuedmust specify `media' before `instance'media instance %s: %smtu %s: %sSIOCSIFMTUinet6autoconf not allowed for this AFbad hexadecimal digitshexadecimal digits too longstrings too longSIOCS80211NWIDmalformed BSSID: %sSIOCS80211BSSID%s: bad value%s=%o%s=%xInvalid trunk protocol: %sSIOCSTRUNKSIOCSTRUNKDELPORTSIOCSTRUNKPORTSIOCGETVLANSIOCSETVLANvlan tag %s: %s vlan: %d parent interface: %s SIOCG80211ALLCHANS %4s %-8s %s chanfreqproperties %4d %4d MHz passive scan%d: bad prefixlen trunk: trunkproto %s trunkdev %sstrdup trunk id: [(%04X,%s,%04X,%04X,%04X), (%04X,%s,%04X,%04X,%04X)] trunkport %s MASTERSTACKACTIVECOLLECTINGDISTRIBUTINGDISABLED supported trunk protocols: trunkproto %s trunk: trunkdev %s invalid vlan tag and device specificationinvalid %s %s: %s%s not allowed for the AFvltimepltimeunknown %s media mode: %sonly one `mode' command may be issuedinvalid media mode: %sunknown %s media subtype: %sonly one `media' command may be issuedmay not issue `media' after `mode' commandsmay not issue `media' after `mediaopt' commandswpagroupcipher: unknown cipher: %sunknown %s media option: %sonly one `-mediaopt' command may be issuedmay not issue both `media' and `-mediaopt'only one `mediaopt' command may be issuedmay not issue `mediaopt' after `instance'wpaciphers: unknown cipher: %spsk802.1xwpaakms: unknown akm: %swpa1wpa2wpaprotos: unknown protocol: %snwid chan %u bssid %s lladdr %s %u%% %ddBm powersave %uMESSIBSSCF_POLLABLECF_POLLREQPRIVACYSHORT_PREAMBLEPBCCCHNL_AGILITY SPECTRUM_MGMT QOS SHORT_SLOTTIME APSDDSSSOFDMDELAYED_B_ACKIMMEDIATE_B_ACK,wpa2,wpa1,wep,802.1xCACHEBSSAUTHASSOCCOLLECT no permission to scanSIOCG80211ALLNODES none restore ieee80211: nwid chan %u bssid %s %u%% %ddBm nwkey persist%d: wpakey wpaprotos %swpa2 wpaakms %s802.1x wpaciphers wpagroupcipher powersave on (%dms sleep) (auto) %ddBm%sHIDENWIDNOBRIDGEUPBROADCASTDEBUGLOOPBACKPOINTOPOINTNOTRAILERSRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTTXREADYNOINET6INET6_NOPRIVACYMPLSWOLAUTOCONF6 rdomain %d metric %lu mtu %lu lladdr %s status: %s %s: no media types? media: supported media: tunnel: inet%s %s -> %s:%u vnetid %d ttl %dunsetifgroup: group names may not end in a digitunsetifgroup: group name too longSIOCDIFGROUPsetifgroup: group names may not end in a digitsetifgroup: group name too long SIOCAIFGROUPSIOCG80211NWIDwpakey: invalid pre-shared keywpakey: passphrase must be between 8 and 63 characterswpakey: nwid not setwpakey: passphrase hashing failedSIOCS80211WPAPSKpersist:SIOCS80211NWKEY: too many keys.0x%sInvalid WEP key lengthSIOCS80211NWKEYinterface index is already filledgetifaddrscould not determine link local address inet6 %sSIOCGIFDSTADDR_IN6 -> %sSIOCGIFNETMASK_IN6 prefixlen %dSIOCGIFAFLAG_IN6 anycast tentative duplicated detached deprecated autoconf autoconfprivacy scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime inet %sSIOCGIFNETMASKSIOCGIFDSTADDR --> %s netmask 0x%xSIOCGIFBRDADDR broadcast %sSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesSIOCIFCREATEinvalid carp demotion: %scarpdemoteSIOCSIFGATTRSIOCGIFGATTR carp demote count %d%s: no such interface SIOCGIFGMEMBprintgroupinterface name '%s' too longdestroy'%s' requires argument'%s' requires 2 argumentsSIOCDIFADDRSIOCAIFADDRarp-arpdebug-debugalias-aliasdeletenetmaskmtunwid-nwidbssid-bssidnwkey-nwkeywpa-wpawpaakmswpacipherswpagroupcipherwpaprotoswpakey-wpakey-chanbroadcastvlanvlandev-vlandevgroup-groupautoconf-autoconftrunkport-trunkporttrunkprotoanycast-anycasttentative-tentativeeui64autoconfprivacy-autoconfprivacypowersavepriorityrtlabeltxpowernwflagrdomain-inet-inet6descriptiondescrwol-wollink0-link0link1-link1link2-link2mediamediaopt-mediaoptinstanceinstlladdrinetEthernetetherFDDIIEEE802.11TDMCARPautoselectmanual10baseT10baseT/UTP10UTP10base210base2/BNC10BNC10base510base5/AUI10AUI100baseTX100TX100baseFX100FX100baseT4100T4100baseVG100VG100baseT2100T21000baseSX1000SX10baseSTPSTP10STP10baseFLFL10FL1000baseLX1000LX1000baseCX1000CX1000baseT1000T1000baseTX1000TXHomePNA1HPNA110GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10GbaseCX410GCX410GBASE-CX42500baseSX2500SX10GbaseT10GT10GBASE-T10GSFP+Cu10GCuSingle-modeSMFMulti-modeMMFCDDIFH1FH2DS2DS5DS11DS1DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72t1t1-amie1e1-g.704e1-amie1-ami-g.704t3t3-m13e3e3-g.751e3-g.832e1-g.704-crc411a11b11gfhmasterfull-duplexfdxhalf-duplexhdxflag0flag1flag2loopbackhw-loopbacklooprxpausetxpausedual-attachdasadhochostapibssibss-mastermonitorturbohdlc-crc16pppframerelay-ansiframerelay-ciscoframerelay-ituno carrierno networkbackupactivekeepalive downroundrobinfailoverlacploadbalancedefaultusegroupwep40tkipccmpwep104 %s: %s: %s: directory causes a cyclefts_readCOLUMNS1ACFHLRSTacdfghiklmnopqrstux%*llu %*qd total %llu %b %e %H:%M:%S %Y%s %*u %-*s %-*s %3d, %3d %*s%*qd %*s ls: %s: %s usage: %s [-1AaCcdFfgHhikLlmnopqRrSsTtux] [file ...] usage: sysctl [-n] name %s=kern.osreleasehw.machinehw.modelhw.producthw.disknameshw.ncpufoundXHusage: ping6 [-dEefHmNnqtvWw] [-a addrtype] [-b bufsiz] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-V rtable] [hops ...] host ff02::2:0000:0000-%uVr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->IP6HBH DSTOPT FRAG RTHDR AH ICMP6: type = %d, code = %d ESPUnknown Header(%d) ...refusedunknown qtype truncated no address %s(TTL=infty)(TTL=%u)\%03oNo Route to DestinationDestination Administratively UnreachableDestination Unreachable Beyond ScopeDestination Unreachable, Bad Code: %d Packet too big mtu = %d Time exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option Bad code(%d) pointer = 0x%02x Listener QueryListener ReportListener DoneRouter SolicitationRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sNode Information QueryNOOPSupported qtypesDNS namenodeaddrIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subject, subject=%sDNS label(invalid), invalidNode Information Reply, %sBad ICMP type: %d --- %s ping6 statistics --- +%ld duplicates, %.1lf%% packet lossround-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms path MTU for %s is notified. (ignored) NodeInfo Supported Qtypes, compressed bitmap, raw bitmap???nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu HbH Options: Dst Options: Routing: invalid peernamefailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!)extra (%d bytes %s)refused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%lusendmsgping6: wrote %s %d chars, ret=%d invalid socket buffer sizeMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %stoo small interval, raised to 0.01Must be superuser to preloadillegal preload value -- %sinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %da:b:c:dEefHg:h:I:i:l:mnNp:qS:s:tvV:wWtoo many intermediate hopsgetaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface namecan't initialize rthdrbad addr family of an intermediate addrcan't add an intermediate nodeUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP setsockopt(IPV6_RTHDR)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> recvmsgnew path MTU (%d) is notified IPv6 addressIPv4 addressSuccessRefusedusage: %s [-aju] [-d dst] [-r seconds] [-t minutes_west] [-z output_zone] %-*s[+format] [[[[[[cc]yy]mm]dd]HH]MM[.SS]] illegal time formatUTCcannot unsetenv TZad:jr:ut:z:settimeofday%a %b %e %H:%M:%S %Z %Yspecified date is outside allowed rangeCould not get local time of dayadjtimedate set by %stoo many argumentsconversion error?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for data?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?m(%T %i of %m) .?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%tCannot allocate memoryLESSSECURE-G-L-XLESS--WARNING: terminal is not fully functionalLESS_TERMCAP_DEBUG<%s>LESS_TERMCAP_krklkukdkPkNkh@7kDLINESlicoTERMhcxndadbsgpcticdcmsomdmbvbbc|^srNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketseek error to 0ch_ungetchar overrunseek errorESC^%c*s<%X>less %s(P)+Non-match First-file EOF-ignore Keep-pos Regex-off &/Pattern not found& There is no %s optionCommand not available(N-th) No %snext fileNo %sprevious fileNo such filemark: goto mark: Brackets: Warning: some edit commands disabledWarning: some commands disabled@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETAESCAPELESSMETACHARS; *? '"()<>[]|&^`#\$%=~%c%s%c%s %s %sLESSCLOSEInvalid LESSCLOSE variableLESSOPENInvalid LESSOPEN variable...skipping... Cannot seek to that file positionDetermining length of fileDon't know length of fileCannot seek to end of fileCannot seek to beginning of fileCannot seek to line number %nLESSANSIENDCHARSLESSANSIMIDCHARS0123456789;[?!"'#%()*+ Line numbers turned offCalculating line numbersInvalid mark letterMark not setUse "h" for help-" must be followed by 1 or 2 charsquotes %sTab stops and then every %d spacesless POSIX regular expressions) Copyright (C) 1984-2012 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less #Invalid column fractionInvalid column numberHorizontal shift %d columns.%06dHorizontal shift %s of screen widthjInvalid line fractionInvalid line numberPosition target at screen line %dPosition target at screen position %sNumber is required after %sValue is required after %s--%s-%c (--%s)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric option-%sThere is no %s option ("less --help" for help)LESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numbersprompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linesDisplay underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersfakeInvalid patternNo previous regular expressionPlease re-enter search patternNothing to search  , 0 4 < H P X ` `h   @  (@08LXdusage: %s [-23bcdilsTU] [-a maxreadahead] [-g maxgroups] [-I readdirsize] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-w writesize] [-x retrans] rhost:path node hostname too longno : or @ speccan't resolve address for host %sNFS PortmapCannot MNT RPCbad MNT RPCcan't access %s-2 and -3 are mutually exclusiveillegal -a value %s: %sillegal -g value %s: %sillegal -I value %s: %sconflicting version optionsillegal -R value %s: %sillegal -r value %s: %sillegal -t value %s: %sillegal -w value %s: %sillegal -x value %s: %s23a:bcdD:g:I:iL:lo:PR:r:sTt:w:x:Ubgconndumbtimernfsv3mntudpresvportnfsv2acunused DOS FAT-12 XENIX / XENIX /usr DOS FAT-16 Extended DOSDOS > 32MB NTFS AIX fs AIX/Coherent OS/2 Bootmgr Win95 FAT-32 Win95 FAT32LDOS FAT-16 Extended LBAOPUS OS/2 hidden Compaq Diag.OS/2 hidden OS/2 hidden OS/2 hidden AST swap Willowtech ThinkPad Rec Willowsoft $NEC DOS 'Win Recovery8Theos 9Plan 9 @VENIX 286 ALin/Minux DRBLinuxSwap DRCLinux DR MQNX 4.2 Pri NQNX 4.2 Sec OQNX 4.2 Ter PDM QDM RCP/M or SysVSDM TOntrack UEZ-Drive VGolden Bow \Priam aSpeedStor cISC, HURD, *dNetWare 2.xxeNetWare 3.xxfNetWare 386 gNovell hNovell iNovell pDiskSecure uPCIX Minix (old) Minix (new) Linux swap Linux files*OS/2 hidden Linux ext. NT FAT VS NTFS VS Linux LVM Amoeba FS Amoeba BBT Mylex BSDI NotebookSaveFreeBSD OpenBSD NEXTSTEP MacOS X NetBSD MacOS X bootMacOS X HFS+BSDI filesy*BSDI swap Solaris CTOS DRDOSs FAT12DRDOSs < 32MDRDOSs >=32MHPFS DisbledCPM/C.DOS/C*Dell Maint SpeedStor SpeedStor SpeedStor BeOS/i386 EFI GPT EFI Sys SpeedStor DOS 3.3+ SecSpeedStor Xenix BBT [[s7~EWI)ڼH(=,ٱvmc)MR 5F(w/Л9=ۭJWZU=#8(B\_~7P0A_}kQ\(u@u.2tno77G^k|x^؊0`*SOE4TS" #1d)g_c@cÏ1?α^bO +;5XĒ  /ΕKqI|f;q Pt`o/'cPˤʂe /2m*d_s,Ms5\,ad,UarI3Gh`K4yd!Q'inY G8wRf@tq1pD%X`v-@ afѣy*gP`Y$F>$&8 i^vvHgwVƩ MbHaWUVzf[GaNL^DIEN*gN \msa p#qef ^9hupz%amA< ,A7aEs& Ev+4x,]\ XeLXA,`Rs6]}R.)$"+ 0xFJId?Cή}*Rqe閎*1]Kuk<2g~ԡ|xKpt$4'& Q!Qe['_ģ:ڽnj5B#{McLC܆5S E k%c ~ C SzbbrJ"x4/b"\lu!>ԏnڛCڰ}KJ[&k. &3O^s7tٚ[DTqfm7ym%DDi_mC=WEw`$xE\E}qLfEMHK]d(0Vl /-WoΌ@AJ`U\q{ڔrp@hi.-RmaM9 T2ka#220owT ^7Պ!diht8bF lmc<䚊˩s1J ^Mk迆v+/?pynjtz6.%LV$%URY[Vd|[B$A;퐶\I'~xW&р$bÁZ5(_Җn:yu{$K4`E QhP 5Yh܉G UL@ؕGEXWF+2kMs z\ J:V ׄJA>oU<1ؿ=yH E5- ,mB c8z\:ic/M ^#)1ϲx$TIeBuS9_ho.&<~I4;zj-6hRtw낑aƻWR) @gס:U#c#- Э5ևѹ?}Bb5黆R* ^&Xe |zI+CgE0ؚ Ud.T7A=8Q`&~WT`V4KCJm P4XQlw>>Yp|ؖ5؊siDJ@o%d݆0 I2+gѪ-؍wk GO"uAoet άQl`_L%B,C$|u "~m, ܒ !C6mCCLk\rJvl!RY޴c ukkPSykx ?tw_N&~(>^Kqy!.މw‹q,TPODCzhv0l?—rDPJvwO5;\qF<8xT7lmΥqj) A#$td+ ?K}.[y+_Hw#q|Mc?WJ ǃdpv2}5JF݋㡇6F_Auk@+g/nCvw,}9ݹM0r0:>韝M2u+~~uTa\o}7RIJYu.淺S?RrB'C&AZhzheje͡;|Q"c8s_*uSz^k/ C ,[ ɶv*\6԰9 VEfB:6{+\FB ]\pM᳁v"Q6Zsw]-a߱>2p0KwTqV-V)$ z;* 3* vwXQ1\cQArF0Lmflâ=28iB%iS3;d,*[b)/{o{G$9SGX[?~pxx׺.: \ L90Ͳv|Xh.zdjJf6oˊ[3*ڬ]HX*I҄c|K˰4QUERǕ(jFIL,3oE1]̋$im4qZ[lu)3 =쮗! &M>םf <^]w}qub3:I{Y0Fg;,P*.NP;D-+[$?BxeWL v`xx6 i?cu,V-65Pl]m2gmq^s2SXS%{z+Mפ\  =cUL\u םfJO+eT t.OrFIQVN'Gї OrO)Xi:QžmĄ^6Ӭ&P-m /jx$E{LBP K81Kmܢ3 6F5*uZmIdZ:/|k8 ^y¤jq/?2I`kQ`X%p HBb[vK7Q[`W2DY,2X*'O5h,pIi,ZP=X;M+b iEk?U:rO<&k-+%T"BDWWZ-9Ȁ04|"Jj+zݯAiNer^"QNSm%rEQZּ8jh^,ȱ斖4j ŐDže*q< "(P.$=I=U̇mCe_MH.YŔI;gȕkuŁ[U\_s3ΞPW>Dq.Wz%-"wȜpضpϔkitje^)RBI*-'}j&^>ΈRCWֺST@]&,>e(N#PN8Fw-$ jNۗ:p ɣ05E`йush͓6L`Y5Ca}` ,􁏕6-pSeWͫy뽴=@jYk@N[=_Ɖ7HG*ۡW[nǸ-I[(8s&b|ɖnQO=zO2#JtU:VcRն bR] {1jh"3+U•Ѽe>R{9QfXF'w}&tZ*Q1:.:e@*- MluWci vXz -[$S+V'#ۧS ͙Z+鮲)DuVLzHg#'#sO&ev~`>Ն''*g-w‰y;TK6})$(>e5R7͵~'ٿ/Yv_g~mɮ )GG]T ״-,{:_!!O/e|}jΙ80ŝ+7 nyyhq7f2Z,!:Xffhސu]s-DsSpRIdɷAxYTg:w 2>Lr lOSd2c|K'?M Invalid command '%s'. Try 'help'. Aborting changes to current MBR.Do you wish to write new MBR?Do you wish to write new MBR and partition table?Command help listShow entire OpenBSD man page for fdiskreinitRe-initialize loaded MBR (to defaults)setpidSet the identifier of a given table entryEdit current drive statseditEdit given table entryflagFlag given table entry as bootableUpdate machine code in loaded MBRSelect extended partition table entry MBRSwap two partition entriesPrint loaded MBR partition tablewriteWrite loaded MBR to diskexitExit edit of current MBR, without saving changesQuit edit of current MBR, saving current changesabortAbort program without saving current changes%s: [%u] %s is out of range: %c%s%c %s is invalid: %c%s%c %s [n] Partition id ('0' to disable) [%X - %X]: [%X] (? for help) '%s' is not a valid number. '%x' is out of range. %s [%d - %d]: [%d] %s is %s: %s. BytesSectorsKilobytesMegabytesGigabytesDisk: %s geometry: %d/%d/%d [%.0f %d-byte %s] geometry: %s is not a character device or a regular fileDIOCGPDINFOdisk too large (%llu sectors). size truncated.Signature: 0x%X Start of partition #%d after end! Starting Ending LBA Info: #: id C H S - C H S [ start: size ]-------------------------------------------------------------------------------%c%1d: %.2X %6u %3u %3u - %6u %3u %3u [%12u:%12.0f%s] %s Warning CHS values out of bounds only saving LBA valuesChoose from the following Partition id values:%02X %s %02X %s %02X %s %02X %s partition number is %s: %s. flag value is %s: %s. Partition %d marked active. Partition %d flag value set to 0x%x. %s %s Machine code updated.partition number is invalid:partition number is %s: %s %d same partition as %d, doing nothing. MBR contains more than one OpenBSD partition!Write MBR anyway?Writing MBR at offset %d. error writing MBROffset: %d Partition %d is not an extended partition. Loop to offset 0! Not selected.Selected extended partition %d New MBR at offset %d. Change disk geometry?BIOS CylindersBIOS HeadsBIOS SectorsPartition %d is disabled. Do you wish to edit in CHS mode?BIOS Starting cylinderBIOS Starting headBIOS Starting sectorBIOS Ending cylinderBIOS Ending headBIOS Ending sectorPartition offsetPartition sizeIn memory copy is initialized to:Use 'write' to update disk.0123456789A:B:CEFGHILRUVabce:f:hilnoqrsuvwxyL;h\;d;t;A;BC D;E;F;G;H:UV;a;bc;e#f;h;i<L<l(<n4<q<<qD<rP<s\<vl<wx<x<uinvalid file type(standard input)(fd %d)usage: %s [-abcEFGHhIiLlnoqRsUVvwx] [-A num] [-B num] [-C[num]] [-e pattern] [-f file] [--binary-files=value] [--context[=num]] [--line-buffered] [pattern] [file ...] ^\((%s[[:<:]]%s%.*s%s[[:>:]]%scontext out of rangegrep version %u.%u binarywithout-matchtextUnknown binary-files optionCan't use small fgrep with -wbinary-filesmmapline-bufferedafter-contextbefore-contextextended-regexpfixed-stringsbasic-regexpwith-filenamebyte-offsetregexpno-filenameignore-casefiles-without-matchfiles-with-matchesline-numberquietsilentrecursiveno-messagesrevert-matchword-regexpline-regexpunix-byte-offsetsreallocarrayreallocLine is too big to processBinary file %s matches usage: %s %s umount [-fv] special | nodeumount -a [-fv] [-h host] [-t type]%s: not currently mounted%s: not a directory or special device%s: unmount from %s afh:t:v  , 0 4 < H P X ` h <@usage: mount_msdos [-9lsx] [-g gid] [-m mask] [-o options] [-u uid] special node invalid file mode: %sunknown user id: %sunknown group id: %ssl9xu:g:m:o:stat %snot an MSDOS filesystemfsck_%snostart %s %swait %s%s/fsck_%sexec %sCan't get resource limit to max data sizeCan't get resource limit for data size-b %sInvalid option stringusage: %s [-dfNnpvy] [-b block#] [-l maxparallel] [-T fstype:fsoptions] [-t fstype] [special | node ...] b:dfl:nNpT:t:vy%s: unknown special file or file system.Can't open checklist file: %s/etc/fstabpass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s: Unknown pid %lddone %s: %s (%s) = %x %s: %s (%s): EXITED WITH SIGNAL %d THE FOLLOWING FILE SYSTEM%s HAD AN %s UNEXPECTED INCONSISTENCY:%s: %s (%s)%s, )c]!!\cX%`-V%`,i\1Sn6i!XfffffffffffffffffffffffffffffffmRQw }dNfev_gY&V0V$xYMuAAM pywy@so+lRJ'x/C/=M+ O$+malloc %zuuntrusted comment: invalid comment in %s; must start with '%s'comment too longmissing new line after base64 in %sinvalid base64 encoding in %sEdunsupported file %sverification failed: checked against wrong keysignature verification failedSignature Verifieddup failedcan't open %s for %snot a valid file: %smsg too large in %sread from %susage: %1$s -V [-eq] [-x sigfile] -p pubkey -m message verify with /etc/signify//../untrusted path %smust specify pubkeyCGSVc:em:np:qs:x:must specify sigfile with - message%s.sigpath too longmust specify messagewrite to %susage: %s [-m mode] fifo_name ... usage: %s [-m mode] name b|c major minor %s [-m mode] name p node must be type 'b' or 'c'.non-numeric major number.non-numeric minor number.major or minor number too largemkfifoinvalid file mode.m:G8S01j0123456789abcdefUGHRBD M@dmCXLS1@2 3cPT l@bconnectedstaticospfis-isbgpbad label: %s is %sinvalid table id: %slabel too longprefixlen is not supported with af %dprefixlen %s is %s%s: link %s; %s: inet %s; %s: inet6 %s; sockaddrs: locks: inits: set_metric mtu: %s is %sset_metric expire: %s is %sking bula sez: set_metric with invalid key route to: %s routing message version %d not understoodmessage length mismatch, in packet %d, returned %dRTM_GET: %s (errno %d)destination: %s mask: %s gateway: %s interface: %.*s if address: %s mpls label: %s %s priority: %u (%s) flags: label: %s use mtu expire%8llu %8u%c %8lld%c sockaddrs: [rtm_type %d out of range]: len %d, if# %d, name: %s, link: %s, flags:, metric %d, flags:, if# %d, name %s, what: arrivaldeparture, priority %d, table %u, pid: %ld, seq %d, errno %d flags: use: %8llu mtu: %8u%c expire: %8lld%cso_dstso_gateso_maskso_ifpso_ifaso_labelso_srcwriting to routing socketread from routing socketroute-sysctl-estimateactual retrieval of interface table128internal error%s: resolved to multiple valuesmpls labels require -in or -out switch%s: not a network%s: bad address%d: bad address familybotched keyword: %susage: %s [-dnqtv] [-T tableid] command [[modifiers] args] commands: add, change, delete, exec, flush, get, monitor, show setrtablesetsockopt(ROUTE_MSGFILTER)setsockopt(ROUTE_TABLEFILTER)got message of size %d on %smust be root to alter routing table-mplslabel requires -inet or -inet6-in requires -mpls-out requires -mpls-out requires -push, -pop, -swap-pop requires -mpls-push requires -mpls-swap requires -mplspriority is %s: %snetmask missing: gateway %sentry in userouting table overflownot in tableno such interface %sactual retrieval of routing tableExamining routing table from sysctl(address family %s) write to routing socketgot only %d for rlen %-20.20s donednqtT:vrouting table %d/dev/nulladdblackholechangecloningdstexpiregatewaygethopcountifaifpinterfacejumbolinkllinfolockrestmpathmplslabelnojumbonostaticpopproto1proto2pushrecvpiperejectrttrttvarsasendpipeshowssthreshxresolveRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics or flagsRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_RESOLVE: Route created by cloningRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_IFINFO: iface status changeRTM_IFANNOUNCE: iface arrival/departureRTM_DESYNC: route socket overflowPUSHLOCALPOPSWAPlink#%dillegal prefixlen%s/%d%u/%d%u.%u/%d%u.%u.%u/%d%u.%u.%u.%u/%daf %d: %s(%d) %s%-6s %-*.*s InternetInternet6Encap Protocol Family %d: MPLS%-18s %-5s %-18s %-5s %-5s %-22s SourcePortProtoSA(Address/Proto/Type/Direction)%-9s %-9s %-6s %-18s %-6.6s %5.5s %8.8s %5.5s %4.4s %s In labelOut labelOpGatewayFlagsRefsUseMtuPrioInterface%-*.*s %-*.*s %-6.6s %5.5s %8.8s %5.5s %4.4s %sIfaceLabel%-6.6s %5u %8llu %5u %5s %2d %-5.16ssysctl of routing tableRouting tablesExtra `@' characters in usernames and passwords should be encoded as %%40 KMGTPftp://http://file::/Can't allocate memory for URL decodingerror in base64 encoding <>"#{}|\^~[]`receivedCan't allocate memory to parse URLurl_get: Invalid URL '%s'No `/' after host (use -o): %sNo filename after host (use -o): %sNo filename after directory (use -o): %sCan't allocate memory for proxy host.Can't allocate memory for proxy URL.Malformed proxy URL: %sCan't open file %sCan't open %sCan't allocate memory for transfer bufferWriting %sReading from file(unknown)Trying %s... r+Requesting %sCan't allocate memory for URL encoding%%%02x (via %s) GET %s HTTP/1.0 Proxy-Authorization: Basic %s Host: %s %s%s GET %s HTTP/1.0 Host: %s %s%s GET /%s %s Host: HTTP/1.0Can't allocate memory.[%s]:%sWriting HTTP requestReceiving HTTP replyError retrieving file: %sToo many redirections requestedContent-Length: Location: Relative redirect not supportedCannot allocate memory for URLRedirected to %s Reading from socketRead short file. Auto-login using ftp URLs isn't supported when using $ftp_proxyImproper response from %sftp_proxyhttp_proxyCan't allocate memory for auto-fetch.Invalid URL: %sCan't connect or login to host `%s'*?[]{}NLSTRetrieving %s/%s mget file fetch aborted. http fetch aborted. Forced abort. The connection will be closed. local: %srunique: can't find unique file name. receive aborted waiting for remote to finish abort. acceptsetsockopt TOS (ignored)%c%c%c421 Service not available, remote server has closed connection. Lost control connection for abort.%cABOR No control connection for command.QUITRETRSTOUSTORPASVproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s use of scoped address can be troublesomeEPSVwrong server: return code must be 229 LPSVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uBad family! %c%c%c%d%cparse error! setsockopt (reuse address)setsockopt IP_PORTRANGE (ignored)setsockopt IPV6_PORTRANGE (ignored)listenEPRT |%d|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dlocal: %s remote: %s REST %lldnetin%s: short writeWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sftpgatehttp%s: bad port number `%s'connect to address %sfdopen failed.Connected to %s. usage: %1$s [-o output] ftp://[user:password@]host[:port]/file[/] ... %1$s [-o output] http://host[:port]/file ... %1$s [-o output] file:file ... %1$s [-o output] host:/file[/] ... FTPSERVERPORTFTPMODEpassivegateunknown FTPMODE: %s. Using defaultsgate-ftpFTPSERVERNeither $FTPSERVER nor $GATE_SERVER is defined; disabling gate-ftpdumbemacssukeep alive amount is %s: %sretry amount is %s: %s46AaCc:dD:Eegik:Mmno:pP:r:S:s:tU:vVUser-Agent: OpenBSD ftpnmap: unbalanced brackets. CWD %sCWD command not recognized, trying XCWD. XCWD %scan't get cwdSkipping non-relative filename `%s' a+winternal error: unknown type %d.TYPE %s %sTYPE %susage: %s [ | Using %s mode to transfer files. %s: unknown mode. asciiimage%lld byte%s %s in %.2f seconds (%.2f %sB/s) ETA: %02d:%02d:%02d %-*.*s%s %-*.*s%s %3d%% %3d%% |%.*s%*s|************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************* %5lld %c%c %2d:%02d:%02d --:-- ETA - stalled -%02d:%02d ETAUnable to determine real path of `%s'%s: not foundunable to create temporary file: %sftpXXXXXXXXXXLISTcan't find list of remote files, oops. can't find list of remote files, oops.anonymous%s@Name (%s:%s): Name (%s): USER %sPassword:PASS %sAccount:ACCT %sLogin %s failed.Already connected to %s, use close first. gateserver not defined (shouldn't happen)PASSERVE %sConnected via pass-through server %s non-printstreamSYSTRemote system type is %s. 215 UNIX Type: L8SIZE %sMDTM %s191Y2K warning! Fixed incorrect time-val received from server. %*s %04d%02d%02d%02d%02d%02dCan't convert %s to a time. usage: %s [-dn%sq] dlnpqhalted (with powerdown) by %shalted by %srebooted by %s~SIGTSTP init/etc/rc/dev/consolerevokesetsidopenSIGTERM processesWARNING: some process(es) wouldn't die(can't restart init):   , 0 4 < H P X ` <@h o`usage: mount_ffs [-o options] special node filesystem must be mounted read-only; you may need to run fsckreload.@'5,"4DLTSh`p|' ST & #ďhT$̏DLԏ܏  !lpd\|̔ؔ @,8@D@Pd\\@h@xH(H(Е<\V$H(8d\LH(dH(tH(d\H(̖VH(<\V H(8@DP\x<\@ȗؗd\V<\,<\@d\Xtx@VVȘ@@ 0@D@Tlx̙@ $0HT`l|ĚКܚ $0<HT`lx̛؛,0<HT`lx̜؜ ,8@LXdp|ȝԝ(4@LXdp|ĞОܞ $0<HT`lx̟؟ ,8DP\htȠԠ(4@LXdp|ġСܡ $0<,Xdp@XCouldn't open '%s': %sCouldn't write contents to '%s': %sShort contents write to '%s' (%zd vs %zu)fchmod(fd, 0x%x) of '%s' failed (%s)fchown(fd, %d, %d) of '%s' failed (%s)short IMSG_WRITE_OPTION_DBwarning: hostname %s contains an underscore which violates RFC 952short IMSG_WRITE_RESOLV_CONF/etc/resolv.confwrite_option_db: imsg_compose: %swrite_option_dbwrite_resolv_conf: imsg_compose: %swrite_resolv_confInvalid option name: '%s'Unable to clone leaseUnable to apply defaultssearch %s no memory for domainnamenameserver %s no memory for nameserver# Generated by %s dhclient no memory for courtesy lineno memory for resolv.conf contentsegresssocket errorno interface in group egress foundioctl SIOCGIFGMEMB: %sget_ifnametoo many interfaces in group egressInterface name too long: %sInterface name too longdaemoncannot forkchdir("/")%s [priv]no memory for priv_ibufpoll error: %simsg_read(priv_ibuf): %sUnable to truncate '%s': %s%s; restarting.RESTART FAILED: '%s': %s%s; exiting bootp; %s { %s interface "%s"; fixed-address %s; next-server %s; filename server-name option %s %s; renew %w %Y/%m/%d %T UTC; rebind %w %Y/%m/%d %T UTC; expire %w %Y/%m/%d %T UTC; } offeredcannot fit offered lease into option dbcannot make offered lease into stringeffectivecannot fit effective lease into option dbcannot make effective lease into stringlease file not opencannot make lease into stringoptions do not fit in DHCPDECLINE packet.options do not fit in DHCPREQUEST packet.options do not fit in DHCPDISCOVER packet.DHCPDECLINE on %sdhcpoffer: no memory to record lease.option-dhcpoffer: unknown option %dBogus data for option %sdhcpoffer: no memory for server name.Bogus server name %sdhcpoffer: no memory for filename.bound to %s -- renewal in %lld seconds.mtu size %u < 68: ignoredNo acceptable DHCPOFFERS received.Trying static lease %sTrying recorded lease %sNo working leases in persistent database - sleeping.DHCPDISCOVER on %s - interval %lldDHCPREQUEST on %s to %sUnsatisfactory %susage: %s [-d | -q] [-u] [-c file] [-i options] [-L file] [-l file] interface %s: no link .... got link sleeping No memory for rtmmsgroute socket buffer overflow%s, not %s, added to %s%s added to %sActive address (%s) deleted; exiting%s, not %s, deleted from %s%s deleted from %s%s downLLADDR changed; restarting%s departuredno memory for errmsg'%s' is not a regular filec:di:l:L:quifi calloc'%s' is not an interfacesetting routing table to %u: '%s'socketpair: %sno memory for unpriv_ibufconfig callocclient calloccannot open %s: %s_dhcpno such user: _dhcp%s.%s/var/db/dhclient.leasesasprintf/etc/resolv.conf.tailCannot open /etc/resolv.conf.tail: %sCannot stat /etc/resolv.conf.tail: %sno memory for resolv.conf.tail contents: %sCouldn't read resolv.conf.tail: %sGot no data from resolv.conf.tailShort read of resolv.conf.tailcan't open and lock %s: %scan't open %s: %ssocket(PF_ROUTE, SOCK_RAW): %ssetsockopt(ROUTE_MSGFILTER): %ssetsockopt(ROUTE_TABLEFILTER): %s/var/empty/chrootsetresgidsetgroups/etc/dhclient.confno memory for reject address!expecting option name.too many options.expecting hex octet.string constant too long.expecting string or hexadecimal dataexpecting ':'.expecting identifier after option keyword.unknown option name.expecting string.option data buffer overflowexpecting signed 32-bit integer.expecting unsigned 32-bit integer.expecting unsigned 16-bit integer.expecting unsigned 8-bit integer.expecting identifier.truefalseexpecting boolean.Bad format %c in parse_option_param.out of memory allocating option data.expecting interface name (in quotes).wrong interface name.expecting lease declaration.expecting left brace.no memory for lease.unterminated lease declaration.Obsolete client identifier (%s) in recorded leaseexpecting a statement.unterminated interface declaration.Corrupt lease file - possible data loss!getifaddrs failedget_rdomain socket: %sinterface %s already has the offered subnet!Can't create socketioctl(SIOCGIFFLAGS) on %s: %sinterface_link_forceup: SIOCGIFFLAGS failed (%s)interface_link_forceup: SIOCSIFFLAGS DOWN failed (%s)interface_link_forceup: SIOCSIFFLAGS UP failed (%s)%s receive_packet failed: %s%s too many receive_packet failures; exiting%s rdomain changed; exitingpoll: %sdispatch%s; restartingsend_packet: %ssocket(SOCK_RAW): %ssetsockopt(IP_HDRINCL): %ssetsockopt(SO_RTABLE): %s/dev/bpf%dCan't find free bpf: %sCan't attach interface %s to %s: %sCan't get BPF version: %sKernel BPF version out of range - recompile dhclient!Can't set immediate mode on bpf device: %sCan't set filter-drop mode on bpf device: %sCan't get bpf buffer length: %sCan't allocate %lu bytes for bpf input buffer.Can't install packet filter program: %sCan't install write filter program: %sCannot lock bpfcSc%s%s/%u %s"'$`\\%cpretty_print_option: bad code %d%s: Excess information in format string: %s%s: no size indicator before A in format string: %s%s: garbage in format string: %s%s: expecting at least %d bytes; got %d%s: expecting only %d bytes: got %d%s: expecting %d bytes: got %d%huUnexpected format code %coption %s (%d) larger than buffer.option %s has no length field.Can't allocate storage for option %s.Can't expand storage for option %s.DHCPACKDHCPOFFERDHCPNACKBOOTREPLY%s from %s (%s)no memory for info stringeof in string constantstring constant too longnumeric token larger than internal bufferappendbackoff-cutoffbootpdenyethernetfixed-addresshardwareignoreinitial-intervallink-timeoutmediumnext-serverprependrebindrenewrequireretryselect-timeoutsendserver-namesupersedetimeout%s line %d: %s%*c^ %s: msgbuf_write: %sRTM_DELETE write: %sshort RTM_DELETE write (%zd) DHCLIENT DHCLIENT %dcreating route label: %screating route label: label too long (%d vs %zu)default route socket: %sRTM_GET of default route: %sget default route read: %sno data from default route readdefault route read rtm: %ssendhup: imsg_compose: %ssendhupadd_address: imsg_compose: %sadd_addressset_interface_mtu: imsg_compose: %sset_interface_mtudelete_address: imsg_compose: %sdelete_addressadd_route: imsg_compose: %sadd_routeflush_routes: imsg_compose: %sflush_routessocket open failed: %sSIOCAIFADDR failed (%s): %sSIOCDIFADDR failed (%s): %sSIOCSIFMTU failed (%d): %sdelete_addresses getifaddrs: %sRouting Socket open failed: %sfailed to add default route: %ssysctl size of routes:routes buf realloc:sysctl retrieval of routes:route cleanup failed - %s %s (msize=%zu)opening socket to flush routes: %s%d bad IP checksums seen in %d packets%d udp packets in %d too long - dropped%d bad udp checksums in %d packetspadsubnet-masktime-offsetroutersIAtime-serversien116-name-serversdomain-name-serverslog-serverscookie-serverslpr-serversimpress-serversresource-location-servershost-nameboot-sizemerit-dumpdomain-nameswap-serverroot-pathextensions-pathip-forwardingnon-local-source-routingpolicy-filterIIAmax-dgram-reassemblydefault-ip-ttlpath-mtu-aging-timeoutpath-mtu-plateau-tableSAinterface-mtuall-subnets-localbroadcast-addressperform-mask-discoverymask-supplierrouter-discoveryrouter-solicitation-addressstatic-routestrailer-encapsulationarp-cache-timeoutieee802-3-encapsulationdefault-tcp-ttltcp-keepalive-intervaltcp-keepalive-garbagenis-domainnis-serversntp-serversvendor-encapsulated-optionsnetbios-name-serversnetbios-dd-servernetbios-node-typenetbios-scopefont-serversx-display-managerdhcp-requested-addressdhcp-lease-timedhcp-option-overloaddhcp-message-typedhcp-server-identifierdhcp-parameter-request-listBAdhcp-messagedhcp-max-message-sizedhcp-renewal-timedhcp-rebinding-timedhcp-class-identifierdhcp-client-identifieroption-62option-63nisplus-domainnisplus-serverstftp-server-namebootfile-namemobile-ip-home-agentsmtp-serverpop-servernntp-serverwww-serverfinger-serverirc-serverstreettalk-serverstreettalk-directory-assistance-serveruser-classoption-78option-79option-80option-81relay-agent-informationoption-83option-84nds-serversnds-tree-namends-contextoption-88option-89option-90option-91option-92option-93option-94option-95option-96option-97option-98option-99option-100option-101option-102option-103option-104option-105option-106option-107option-108option-109option-110option-111option-112option-113option-114option-115option-116option-117option-118option-119option-120classless-static-routesCIAoption-122option-123option-124option-125option-126option-127option-128option-129option-130option-131option-132option-133option-134option-135option-136option-137option-138option-139option-140option-141option-142option-143tftp-config-fileoption-145option-146option-147option-148option-149voip-configuration-serveroption-151option-152option-153option-154option-155option-156option-157option-158option-159option-160option-161option-162option-163option-164option-165option-166option-167option-168option-169option-170option-171option-172option-173option-174option-175option-176option-177option-178option-179option-180option-181option-182option-183option-184option-185option-186option-187option-188option-189option-190option-191option-192option-193option-194option-195option-196option-197option-198option-199option-200option-201option-202option-203option-204option-205option-206option-207option-208option-209option-210option-211option-212option-213option-214option-215option-216option-217option-218option-219option-220option-221option-222option-223option-224option-225option-226option-227option-228option-229option-230option-231option-232option-233option-234option-235option-236option-237option-238option-239option-240option-241option-242option-243option-244option-245option-246option-247option-248classless-ms-static-routesoption-250option-251autoproxy-scriptoption-253option-254option-endexpecting semicolon.time string too longinvalid time string%w %Y/%m/%d %T UTC%w %Y/%m/%d %T%u %Y/%m/%d %Tunparseable time stringtime could not be representedexpecting unsigned 32-bit decimal value.expecting CIDR subnet.expecting '/'.Expecting CIDR prefix length.expecting 'ethernet'.expecting '.'.expecting decimal octet.filename must be a stringno memory for string %s.dispatch_imsg: imsg_get failure: %sbad IMSG_DELETE_ADDRESSbad IMSG_ADD_ADDRESSbad IMSG_FLUSH_ROUTESbad IMSG_ADD_ROUTEbad IMSG_SET_INTERFACE_MTUbad IMSG_HUPreceived unknown message, code %uusage: %s [-] [-s] [-p string] [file] cannot close temp fileinvalid address/tmp/ed.XXXXXXXXXXw+cannot open temp fileline too longcannot seek temp filecannot write temp filecannot read temp fileunexpected end-of-file& no previous commandinvalid pattern delimiter\  \abfnrtv\cannot read stdincannot write filecannot open output filecannot close output filecannot read input filenewline inserted newline appended cannot open input filecannot close input fileinvalid mark charactered.hup/ed.hupno current filenameinvalid filenamefilename too longno matchnumber out of rangeinvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioncrypt unavailableHOMEcrypt unavailable ? p:sx ? interrupt? warning: file modifiedscript, line %d: %s unbalanced brackets ([])trailing backslash (\)no previous patterninfinite substitution loopnothing to undo%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).HLPRfiprthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too longusage: %s [-fip] [-R [-H | -L | -P]] source target %s [-fip] [-R [-H | -L | -P]] source ... directory lchown: %sutimes: %schown: %schmod: %schflags: %sunlink: %smknod: %smkfifo: %sreadlink: %ssymlink: %soverwrite %s? $48<<@D      A@!  @a`10  @`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O @@ !1Aa  0@` #+3;CScsP`lxVusage: %s [-123456789cdf%sh%slNnOqrt%sv] [-b bits] [-o filename] [-S suffix] %*s [file ...] usage: %s [-cfh%slNnqrt%sv] [-o filename] [file ...] usage: %s [-f%shqr] [file ...] OK %4.1f%% -- replaced with %s %lld bytes in, %lld bytes out method crc date time compressed uncompressed ratio uncompressed_name%-7.7s %08x %s %10lld %10lld %4.1f%% %s %10lld %10lld %4.1f%% (totals) .-_tgztazfchown: %sfchmod: %sfchflags: %sfutimes: %scompression not supported%s: won't read compressed data from terminal%s: unrecognized file formatcrc errorzcatzipunknown program nameGZIPoption -a is ignored on this systemillegal bit count -- %s-o argument is too long-o option may only be used with a single input filemay not mix -o, -c, or -t options%s is a directory: ignored: unchanged%s not a regular file%s%s already has %s suffix -- unchanged%s: unknown suffix: ignored%s%s: name too long%s: input: %sdeflate.gz123456789ab:cdfhLlNnOo:qrS:tVvcfhLlNno:qrtVvfhqrZgzz1.2.3need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionusage: %s [-R [-H | -L | -P]] %s file ... owner[:group]usage: %s [-h] [-R [-H | -L | -P]] %s file ... %s [-h] [-R [-H | -L | -P]] :group file ... group is %s: %suser is %s: %sHLPRXfghorstuwxthe -R and -h options may not be specified together.invalid flags: %sinvalid flag: %sp\Rx\\\\\\\\8S\\\\\hX\h\\\ @ ?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@%lld %s I=%llubad size: blk %lld, offset %lld, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock.fs_fpg %d cannot allocate memory for inode cache cannot increase directory listbad inode number %llu to nextinode %llu cannot alloc %zu bytes to extend inoinfo CG %d: BAD MAGIC NUMBER %lld files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %lld files missing %lld blocks missing conversion levelcannot do level %d conversion usage: %s [-fnpy] [-b block#] [-c level] [-m mode] filesystem ... dfpnNyYb:c:m:EXCESSIVE DUP BLKS I=%llucannot alloc %zu bytes for inoinfobad direct addr: %lld bad indirect addr: %lld INCORRECT BLOCK COUNT I=%llu (%lld should be %lld)too many inodes %llu, or out of memory phase 1, inode %llu/%lluphase 1b, inode %llu/%llu%s %s: LENGTH %zu NOT MULTIPLE of %d%s %s: LENGTH %zu NOT MULTIPLE OF %dphase 2, directory %d/%dphase 2, parent directory %d/%d (REMOVED)phase 3, directory %d/%ldphase 4, inode %llu/%lluDELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS UNKNOWN ROTATIONAL TABLE FORMAT %d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %lld MARKED FREE ALLOCATED FRAG %lld MARKED FREE BLK(S) MISSING IN BIT MAPSphase 5, cg %d/%d%s: NOT LABELED AS A BSD FILE SYSTEM (%s) NCG OUT OF RANGECPG OUT OF RANGENCYL LESS THAN NCG*CPGSBSIZE PREPOSTEROUSLY LARGEILLEGAL BLOCK SIZE IN SUPERBLOCKILLEGAL FRAGMENT SIZE IN SUPERBLOCKoffset %d, original %ld, alternate %ld VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN LAST ALTERNATEINFORMATION; SEE fsck_ffs(8).clean = %d UNDEFINED OPTIMIZATION IN SUPERBLOCKIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE NPSECT=%d IN SUPERBLOCK (FIXED)INCORRECT BMASK=%x IN SUPERBLOCKINCORRECT FMASK=%x IN SUPERBLOCKINCORRECT BSHIFT=%d IN SUPERBLOCKINCORRECT FSHIFT=%d IN SUPERBLOCKFormat of filesystem is too old. Must update to modern format using a version of fsck from before release 5.0 with the command ``fsck -c 2'' INCORRECT MAXFILESIZE=%llu IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%lx IN SUPERBLOCKINCORRECT QFMASK=%lx IN SUPERBLOCKINCONSISTENT CGSIZE=%d INCONSISTENT INOPB=%d INCONSISTENT NINDIR=%d cannot alloc %u bytes for cylinder group summary area cannot alloc %zu bytes for blockmap cannot alloc %zu bytes for inostathead cannot alloc %zu bytes for inpsort cannot alloc %zu bytes for inphead inoinfo: inumber %llu out of rangeCANNOT %s: BLK %lldWRITING %sZERO'ED BLOCK %lld TO DISK UPDATE STANDARD SUPERBLOCK   delete %d: %sinsert %d: %ssession database close: %ssession database open: %scannot get kernel security level: %scannot change kernel security level from %d to %d: %sfatal signal: %scan't parse getty for port %scan't allocate windowcan't parse window for port %sport %s changed utmp index from %d to %dcan't fork for window system on port %s: %msetsid failed (window) %mcan't exec window system '%s' for port %s: %mcan't fork for getty on port %s: %mgetty repeating too quickly on port %s, sleepingcan't exec getty '%s' for port %s: %msome processes would not die; ps axl advisedcan't open %s: %mcan't get %s for controlling terminal: %mcannot disable lid suspendcan't exec %s for %s %s: %mautobootcan't exec %s for %s: %mcan't fork for %s on %s: %mwait for %s on %s failed: %m; going to single user modeinit: %s on %s stopped, restarting %s on %s terminated abnormally, going to single user mode/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bincan't exec %s for single user: %mcan't fork single-user shell, trying againwait for single-user shell failed: %m; restartinginit: shell stopped, restarting single user shell terminated.single user shell terminated, restartinginit: %s init: already running initial setsid() failed: %msetlogin() failed: %munrecognized flag '-%c'sfignoring excess argumentsusage: %s [-b block-size] [-c fragments-per-cylinder-group] [-e maxbpg] [-f frag-size] [-i bytes] [-m free-space] [-o options] [-P file] [-s size] special node usage: %s [-Nq] [-b block-size] [-c fragments-per-cylinder-group] [-e maxbpg] [-f frag-size] [-g avgfilesize] [-h avgfpdir] [-i bytes] [-m free-space] [-O filesystem-format] [-o optimization] [-S sector-size] [-s size] [-T disktype] [-t fstype] special ioctl (WDINFO)%s: can't rewrite disk labelinsane maxpartitions value %dP:T:b:c:e:f:i:m:o:s:NO:S:T:b:c:e:f:g:h:i:m:o:qs:t:%s: invalid ffs versionsector size invalid: %sblock size is %s: %sfragments per cylinder group is %s: %sblocks per file in a cylinder group is %s: %sfragment size is %s: %saverage file size is %s: %saverage files per dir is %s: %sbytes per inode is %s: %sfree space %% is %s: %s%s: unknown optimization preference: use `space' or `time'.file system size invalid: %snewfs_%s%s/newfs_%s%s not found%s: getmntinfo: %s%s: not a character-special device%s: can't figure out file system partition%s: `%c' partition is unavailable%s: `%c' partition overlaps boot program%s: no default sector size%s: maximum file system size on the `%c' partition is %llu sectorswarning: changing optimization to space because minfree is less than %d%% setblock bad fs_frag %dclrblock bad fs_frag %disblock bad fs_frag %dwtfs: write error on block %lldrdfs: read error on block %lldcg 0: bad magic numberfirst cylinder group ran out of spaceinternal error: can't find block in cyl 0ilog2: %d is not a power of 2 fsinit: inode value %llu out of rangeinode table does not fit in cylinder grouppanic: cylinder group too big: %d > %dpreposterous size %lld, max is %dpreposterous size %lld, max is %lldblock size must be a power of 2, not %dfragment size must be a power of 2, not %dfragment size %d is too small, minimum is %lldblock size %d is too small, minimum is %dblock size %d is too large, maximum is %dblock size (%d) cannot be smaller than fragment size (%d)fragment size %d is too small, minimum with block size %d is %ddensity reduced from %d to %d bytes per inodecan't honour -c: minimum is %dfile system size %jd < minimum size of %d fragmentsreduced number of fragments per cylinder group from %d to %d to enlarge last cylinder groupcalloc failed%s: %.1fMB in %jd sectors of %lld bytes %d cylinder groups of %.2fMB, %d blocks, %d inodes each can't get physmemcan't get rlimitwarning: fsck_ffs will need %lluMB; min(ulimit -dH,physmem) is %lluMBsuper-block backups (for fsck -b #) at:cannot allocate I/O bufferfsinit1 failedfsinit2 failed%s: initializing cg %ld/%d usage: %s [-dfiPRr] file ... "." and ".." may not be removedremove %s? override %s%s%s/%s for %s? %s (inode %llu): not overwritten due to multiple links%s: malloc%s: is a directorydfiPRrusage: %s [-t] device usage: %s [-f device] command [count] %d: unknown tape drive type %s tape drive, residual=%d erblocksize: %d (%d) density: %d (%d) ioctl MTIOCGETf:no remote support%s: unknown command%s: illegal countbsfbsrdensityeomfsffsrofflinerewindrewofflretensionweofWriteProtectMounted76543210usage: %s [-p] [-m mode] directory ... m:p\ can not be used as a string delimiternewline can not be used as a string delimiterwhitespace after %sundefined label '%s'RE error: %sunterminated regular expressionexpected context addressunexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandfilename expectedw commandread commandbranchempty labelduplicate label '%s'substitute pattern can not be delimited by newline or backslashunterminated substitute pattern123456789\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expressionmore than one number or 'g' in substitute flagsnumber in substitute flags out of rangewfile too longno wfile specifiedbad flag in substitute command: '%c'transform pattern can not be delimited by newline or backslashunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthextra text at the end of a transform commandunused label '%s' ..."usage: sed [-aEnru] command [file ...] sed [-aEnru] [-e command] [-f command_file] [file ...] Eae:f:nrustdout: %ssed: %lu: %s: first RE may not be empty\ %03o\%d not defined in the RE\abfrtv~ t  X- t H Ts { $,v ,| k 0 4t @t L } X܊ `z dz ةhr hpHX L P T \ h t |         L      |P  -a-b-c-d -e-f-G-g-h -H -k-L -n-O-o-p -r-s-S -t-u-w-x-z===!=<>-eq-ne-gt-ge-lt -le!-ef"-nt#-ot$dd2:lXtlf|cdslmndmp $0$   ,X < H `8 x  0   .8  < h0 |  d  x   ( 0( < Lx ` p | X  \       $ 4 H P \ < l D  $ , 4 \  0++--==!== *= /= %= += -= <<= >>= &= ^= |= <<>><=>=<>&& || */%+-&^|? , ~!():,IFS= ${PS2=> } ${PS3=#? } ${PS4=+ }p a  c$ (f0 @ eH P \ ih kp lx X@m Cn f  b u   prds h v      x           t   lSD({}d2 $(,0 ]]<>!let||&&()h <pDp T U |U `lx,@(#)PD KSH v5.2.14 99/07/13.2 AAA  Q AA A QBafree: %p not present in area %punable to allocate memorylmmissing options argumentmissing name argument%s: is not an identifierc_getopts: no argvarguments changed since last callOPTARGbad signal `%s'usage: kill [-s signame | -signum | -signame] { job | pid | pgrp } ... kill -l [exit_status ...] %s: arguments must be jobs or process IDs%*d %*s %s%*d %*d %sjob control not enabled%%lpnzno argumentsadtdprtUxalias: -r flag can only be used with -t and without arguments alias %s alias not found L#R#UZ#fi#lprtuxonly -t, -u and -x options may be used with -ffunction %s %T %s() %T %s: not identifiertypeset -i -x -r -t -L%d -R%d -Z -l -u -U exportreadonly%s[%d]pvpvV is a reserved wordexported is an %salias for alias %s= is an exported traced undefined (autoload from %s) function special is a%s shell builtin is a tracked %salias for not found%s is *GOK*Rnprsu,-n-p: %s-u: %s: %sLPcan't get current directory - %srestricted shell - can't cdPWDOLDPWDno home directory (HOME not set)no OLDPWDdon't know current directoryCDPATH%s: bad directory+alias+cd+command*=export+fc+getopts+jobs+killletpwd*=readonly=typeset+unaliaswhence+bg+fgunalias-tacan't suspend a login shellinvalid file modeusage: mknod [-m mode] name b|c major minorusage: mknod [-m mode] name ptime: -%s unknown optiontime: -%s requires an argument:p%s%*lld.%02ld%s%s%*lldm%lld.%02lds%sreal real user sys user system fv%s is read only%s: cannot %s%s: can only %s %d level(s)%s: bad numberugorwx%#3.3o augo=+-rwxugoXsbad masktrap -- bad signal %sprsu,nothing to shift*=.*=:[*=break=builtin*=continue*=eval*=exec*=exit+false*=return*=set*=shift*=times*=trap+=wait+readtest+trueulimit+umask*=unsetsuspendmissing closing parenmissing argumentexpression expectedmissing second argumentmissing expression operatorunexpected operator/operandinternal error: unknown opmissing ]-t-aunlimited unlimitedinvalid limit: %s-%c exceeds allowable limitbad -%c limit: %susage: ulimit [-acdfHlmnpSst] [value]ulimit: %c%-20s time(cpu-seconds)file(blocks)coredump(blocks)data(kbytes)stack(kbytes)lockedmem(kbytes)memory(kbytes)nofiles(descriptors)IFS"#$&'()*:;<=>?[\]`{|};|&()`+@!fileglob: substitute errorFPATH nothing to yank yank something firstduplicate binding for %sPOSIX%s = %s %s = '%s' cannot bind, not a ttyauto-insert%s: no such functioninvalid return code I-search: beginning-of-historycomplete-commandcomplete-filecompletedelete-char-backwarddelete-word-backwarddelete-char-forwarddelete-word-forwardkill-lineredrawend-of-historyeot-or-deletegoto-historymacro-stringkill-to-eolkill-regionlist-commandlist-filequoteyank-popbackward-charbeginning-of-linebackward-wordend-of-lineforward-charforward-wordnewlinedown-historynewline-and-nextno-opup-historyprev-hist-wordsearch-character-forwardsearch-character-backwardsearch-historyset-mark-commandstuffstuff-resettranspose-charsexchange-point-and-markcomplete-listexpand-filecapitalize-worddowncase-wordupcase-wordset-argcomment*+?@! substituteexpand(NULL)%Rfunny $() command: %s%s: cannot open $(<) input%s: parameter not set%S%s: bad substitutionparameter null or not set%*d) %sdbteste_error: %s (offset %d)shcomexec: %shere document missingcan't %s temporary file %s: %sherein: yylexerror writing %s: %sPS4%s%s %s: restricteddupcannot %s %s: %scould not finish (dup) redirection %s: %scoprocess already existsPS3EXECSHELL%s: %s: %sbuiltin: %s: not a builtincommand -p: restricted%s: can't find function definition file - %s%s: can't find function definition file%s: can't open function definition file %s - %s%s: function not defined by %sCFUNC %d%s: cannot execute - %s-rend of expression%s: unexpected `%s'%s: bad number `%s'%s: expression recurses on parameter `%s'%s: %s requires lvalue%s: %s applied to read only variablemissing )zero divisormissing :HISTFILE%s.%dno history (yet)%s: not in history%s: invalid rangehistory functions not available-%c%se:glnrs0,1,2,3,4,5,6,7,8,9,can't use -e, -l, -n, -r with -s (-e -)substitution failedcan't use -l, -n with -e-16%.*s cannot create temp file %s - %serror writing temporary file - %s${FCEDIT:-/bin/ed} $_cannot open temp file %serror reading temp file %s - %sno coprocess%s/shXXXXXXXXbad file descriptorfd not open for readingfd not open for writingillegal file descriptor name%s[%d]: internal error: shl_stdout not validtoo many files open in shellcan't create pipe - try again RunningDoneDone (%d)[%d] %c %5d (core dumped)%s%s %-20s %s%s%s%s%5d %-20s %s%s %s%sremove_job: job not found (%s)notifyj_async: job not startedj_async: bad nzombie (%d)zombiejobsstopped and runningYou have %s%s%s jobs j_waitj: tcsetpgrp(%d, %d) failed: %sjob not job-controlled[%d] | 1st tcsetpgrp(%d, %d) failed: %sfg: 2nd tcsetpgrp(%d, %d) failed: %scannot continue job %s: %sjw:resumejw:waitforwaitlast: no last jobwaitlast: not startedjw:waitlastexchild: XPIPEI and no last_job - pid %dfork failedcannot fork - try againchildexchild: execute() returned[%d]jw:last procj_init: getpgrp() failed: %sj_init: tcgetpgrp() failed: %sj_init: setpgid() failed: %sj_init: tcsetpgrp() failed: %swarning: won't have full job controlj_suspend: tcsetpgrp() failed: %sj_suspend: setpgid() failed: %scheck_job: job started (flags 0x%x)checkjobno such jobambiguousargument must be %job or process id%a %b %d%l:%M:%S%r~/%sPS1\$PS2missing ] no closing quote here document `%s' unclosed MAILyou have mail in $_shell: %dUse `exit' to leave ksh include: %drshrkshrpdkshpdrkshSH_VERSIONPPIDUSER$ -c requires an argumentCannot determine current working directory/etc/profile$HOME/.profile/etc/suid_profileENVtypesetKSH_VERSION-xOPTIND=1evaltypeset -i RANDOM MAILCHECK="${MAILCHECK-600}" SECONDS="${SECONDS-0}" TMOUT="${TMOUT-0}"hash=alias -ttype=whence -vstop=kill -STOPautoload=typeset -fufunctions=typeset -fhistory=fc -linteger=typeset -inohup=nohup local=typesetr=fc -e -login=exec login-tUccmailmakeprviwho |&;<>()*@#!$-? =-+?#% "#$&'()*;<>?[\`|0123456789ABCDEF%-*s%*s'\'%s%s-%c: unknown option%s%s-`%c' requires argument%-*s %sA:o;sCurrent option settings -o %s%s: bad optionparse_args: `%c'allexportbraceexpandbgnicecsh-historyemacs-usemetaerrexitgmacsignoreeofinteractivekeywordloginmarkdirsnoclobbernoglobnohupnolognounsetphysicalposixprivilegedtrackallverbosevirawvi-show8vi-tabcompletevi-esccompletextracealnumalphablankcntrldigitgraphlowerpunctupperxdigitshf_flush: no fdshf_emptybuf: no fdshf_write: flags %xshf_write: nbytes %dshf_putchar: flags %xshf_putchar: no fd0123456789abcdef(null %s)shf_ungetc: flags %xshf_fillbuf: no fdshf_getchar: flags %xshf_getse: flags %xshf_read: flags %xshf_read: bsize %dshf_sopen: flags 0x%xshf_snprintf: buf %lx, bsize %dshf_reopen: missing read/writeshf_reopen: bad shf/buf/bsizeshf_fdopen: missing read/writeunexpectedunmatchedsyntax error: unexpected EOF ?%dsyntax error: `%s' %s too many <<'s too many redirections for%s: bad identifier %s: invalid function name thenelseelifficaseesacwhileuntildo{[[&&||;;((|&too many varssetexecsig: unset signal %d(%s)ERRError handlerEXITtimed out waiting for inputSIGwdscan: unknown char 0x%x (carrying on)%S #no-vars# #no-args# ( %T) %T| %T%;%T%s %T %S ]] select %s for %s in %;do%N%T%;done case %S in%N(%S%c%;%T%N;;%Nesac if %Tthen%N%Telif %Telse%;%T%;fi %s %T%;do{%;%T%;} %T|& %T& function %s %T%s() %Ttime %T< <<- << >> >| <> <&>&No controlling tty (open /dev/tty: %s)Can't find tty file descriptorj_ttyinit: dup of tty fd failed: %s%0*s%.*s%*s%.*s%s: subscript %ld out of range%s: is read onlysetstr: %s=%s: assigning to self0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789abcdefghijklmnopqrstuvwxyzOPTINDPOSIXLY_CORRECTHISTSIZEMAILCHECKMAILPATHRANDOMSECONDSTMOUTLINENOM-grabhist: bad history arrayy$%s %dfc -e ${VISUAL:-${EDITOR:-vi}} --Invalid keyInvalid saltToo few rounds: %dcan't specify passphrase file during initial creation of crypto volumeinvalid passphrase filecan't stat passphrase filepassphrase file must be owned by rootpassphrase file has the wrong permissionscan't read passphrase fileinvalid passphrase lengthunable to read passphraseRe-type passphrase: Passphrases did not matchpbkdf2 failedinvalid KDF infoinvalid KDF hintKDF hint has invalid sizeunknown KDF type %dnumber of KDF rounds too low: %dDIOCINQ%s: <%s, %s, %s>, serial %s invalid flags listinvalid flag %sinvalid device listcould not open %scould not stat %stoo many devices on device listduplicate device in listNew passphrase: unknown errorBIOCDISCIPLINEOld passphrase: BIOCDELETERAIDno devices specifiednot enough memory for dev_t listunsupported raid levelnot enough disksnot exactly one partitionioctlPassphrase: BIOCCREATERAID/dev/bioCan't locate %s device via %sBIOCBLINKBIOCINQBIOCVOLinvalid alarm function: %sBIOCALARMalarm is currently %s %-11s %-10s %14s %-8s VolumeStatusSizeDevice %d%% done %u secondsScrubbingInvalidOnlineOfflineDegradedBuildingRebuildWTWB%s %u%14llu%11s %-10s %14s %-7s CRYPTO%s%s %11s %-10s %14s %-7s CONCAT%s%s %11s %-10s %14s %-7s RAID%u%s%s %s BIOCDISKFailedHot spareUnused %3u%14skey disk%u:%u.%unoenclunknown serial%11s %-10s %14s %-7s %-6s <%s> %11s %-10s %14s %-7s %-6s '%s' target not specifiedTarget %s: %sDisk %s is not in an enclosureDisk %s does not existinvalid device %sBIOCSETSTATEusage: %s [-hiqv] [-a alarm-function] [-b channel:target[.lun]] [-H channel:target[.lun]] [-R device | channel:target[.lun]] [-u channel:target[.lun]] device %s [-dhiPqsv] [-C flag[,flag,...]] [-c raidlevel] [-k keydisk] [-l special[,special,...]] [-O device | channel:target[.lun]] [-p passfile] [-R device | channel:target[.lun]] [-r rounds] device Invalid RAID levelNumber of rounds is %s: %sa:b:C:c:dH:hik:l:O:Pp:qr:R:svu:need deviceneed -c parameterneed -l parametermust use bio deviceblowfish,%spref too longunable to get login class `%s'localciphercan't generate hashusage: %s [-b rounds] [-c class] [-p | string] rounds is %s: %spb:c:Enter string: getpassusage: %s seconds usage: %s [-fi] source target %s [-fi] source ... directory /bin/cp-PRp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status/bin/rm-rf%s: remove%s: set owner/group; not setting setuid/setgid%s: set owner/group%s: set mode%s: set flags%s: set timesrename %s to %scannot resolve %scannot rename a mount pointcan't remove %s%s: destination pathname too longusage: %s [-s] [-M core] [-N system] sM:N:sysctl: KERN_MSGBUFSIZEcouldn't allocate space for buffer datasysctl: KERN_MSGBUFusage: %s [-s] [name-of-host] sethostnamegethostname/etc/networks"(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDlɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~[/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxqg jgrn<:ORQhك[0.0.0.0127.0.0.1::::1/etc/group/etc/spwd.db/etc/pwd.db/etc/ethers%02x:%02x:%02x:%02x:%02x:%02x  0123456789ABCDEF0123456789abcdefnanNANinfINF(null)bug in vfprintf: bad base HOSTALIASES/etc/hosts;#nameserverlookupypsearchinet4ndots:RES_OPTIONSoptions LOCALDOMAINsearch lookup bind filenameserver 127.0.0.1ASR_CONFIGlookup file %d.%d.%d.%d.in-addr.arpa.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.ip6.arpa.no spacetoo shortbad domain namedomain name too longbad dlen@BKMGTPE0B%lld%c%lld.%1lld%cimsg_readmsgbuf_write/dev/diskmap%s%s%s%c%s%s%shmac_sha1pkcs5_pbkdf2logout/var/run/utmplogin_protect%s: %s: %m/etc/fbtab/*%s: chmod(%s): %m%s: chown(%s): %m%s: opendir(%s): %m%o%s: bad entry: %s\\#readlabelfsd|u uhuu%sr%s%s: not a device node%s: couldn't read disklabel%s: bad filesystem type in labellogwtmp/var/log/wtmp5MS7) OOPStgetentTERMCAP/usr/share/misc/termcapTERMPATH.termcap /usr/share/misc/termcapinet_net_ptoninet_net_pton_ipv401234567890123456789abcdef/usr/src/lib/libc/net/inet_net_pton.cn >= 0 && n <= 15n >= 0 && n <= 9assertion "%s" failed: file "%s", line %d, function "%s" assertion "%s" failed: file "%s", line %d inet_pton01234567890123456789ABCDEF0123456789abcdefinet_ntop4inet_ntop%u.%u.%u.%uTPb0b1ncdtscsbpxbxfxoxtxdxInfinityNaNlongjmp botch. SHA256EndSHA256DataSHA256FileChunk0123456789abcdefPOSIX_V6_ILP32_OFFBIGPOSIX_V7_ILP32_OFFBIG-lpthread))*$?^[Yy]^[Nn]yes646NONEUTF8ttyname_r/var/run/dev.db[:<:]][:>:]]ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ !"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789ABCDEFabcdefNULSOHSTXETXEOTENQBELalertBSbackspaceHTtabLFVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBIS4IS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stopzeroonetwothreefourfivesixseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDEL regerrorREG_0x%xREG_NOMATCHregexec() failed to matchREG_BADPATinvalid regular expressionREG_ECOLLATEinvalid collating elementREG_ECTYPEinvalid character classREG_EESCAPEREG_ESUBREGinvalid backreference numberREG_EBRACKbrackets ([ ]) not balancedREG_EPARENparentheses not balancedREG_EBRACEbraces not balancedREG_BADBRinvalid repetition count(s)REG_ERANGEinvalid character rangeREG_ESPACEREG_BADRPTrepetition-operator operand invalidREG_EMPTYempty (sub)expressionREG_ASSERT"can't happen" -- you found a bugREG_INVARGinvalid argument to regex routine*** unknown regexp error code ***SHA512EndSHA512DataSHA512FileChunk0123456789abcdefBLOCKSIZE%s: unknown blocksizemaximum blocksize is %dG%s: minimum blocksize is 512%ld%s-blockscrypt_checkpassblowfish,8blowfish,bcrypt_hashpassOrpheanBeholderScryDoubtbcrypt_initsaltbcrypt_newhashbcrypt_autoroundsbcrypt_checkpass6789:;<=>?  !"#$%&'()*+,-./012345./ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789$2%c$%2.2u$$2b$%2.2u$testpassword 1Ѭߘr/Ḗ~&jE|,G$l iciNWqX~=t XrX͋qJT{YZ90`*#`(yA8۸y:`l>w'K1/x`\`U%U攫UbHW@cj9U*4\̴ATr|*oc]ũ+1t>\3֯\$lS2zw(H;Kkē!(f a!`|H2]]]u#&܈e>#Ŭom9BD . Ji^Bh!la gӫҠQjh/T(3Ql n;zP;*~ev9>YfCoEå}^;uos D@jVbNw?6r=B$7H ۛIrS{y%P;LylO`@ž\^c$johSl>9oR;Qm,0DE ^J3(fK.WtE9_ ӹyU 2`yr,@%g̣饎"2u<kaP/R=2`#H{1S>W\o.ViB~(2gsUO'[iXʻ]=!lJ[-ySeEIҐK3~ˤAb Lw6~д+MەqՓkю%ǯ/[{AI~-%^q h"W6d$ cUYCxSZ٢[} Źv&ϕbhAJsN-GJ{RQ)S?Wƛv`+t恵oWk *!ec.4dV]-SGjnpzKD). u#&İn}ߧI`fqilRdVឱ¥6)L u@Y>:䚘T?eB[k?ҡ08-M]% L&pc^?kh >\D}W7: P tAu8/;21>8TNmO Bo ,y|$ryVw.?rU$qk.P̈́GXzt}K:zfC cdG27;C$CMQe*P:qUN1w_V5kǣ;< $Y,n<pEㆱo ^*>Zw=Ne)։>%fRxL.jxS<- N=+6&9`y#RnfE{7(2åZl!Xeh;/ۭ}*/n[(!pa)uGa0a4c\s9pL ު˼,b`\ndi#PZe2Zh@*<1! T_~}=b7w-_h)5ǡޖXxWcr"ÃF T0.SHُ(1mX4a(s<|J]d]B> EꫪOlOBBǵj;Oe!AyMjGKPb=bF&[$ti GV[ Htb#*BXU >ap?#r3A~_;"lY7|`t˧@n2w΄PU5ai Z .zD4Egɞs͈Uy_g@Cge48>q(= m!>J=+hZ=@&L4)i Av.khq$j 3ԷCaP.9FE$tO!@MpE/f m1'A9UG%ښ ʫ%xP()Sچ, mbhiHפh'?Oz|Ϊ_7әxB*k@5 ٫9N;VmK1f&tn:2C[Ah xN جV@E'H::SU kKмgUXc)3VJ*%1?~^|1)p/'\,(H"m?H܆AyG@n]Q_2Տd5A4x{%`*`lc´2Of#k>3b $;" r(-Exb}doITH}'>AcG t.no:7`L knU{7,gm;e' )̒9 i{f} ϑ^و/$[Qy{;v.97yY̗&-1.Bh;+jLu.x7BjQ满PcKkؽ%=YBD n *Ngd_ڈ鿾dW{x`M``FѰ8Ew63kBqA_^ !cT 0cT 0cT 0 cS!cTא1cTא1cTא1 2&!cTא1cTא1cTא1;Nl(!cTא1cTא1cTא1MR!cTא1cTא1cTא1(!cTא1cTא1dT~!cTא1cTא1cTא1}!cTא1cTא1cTא12]8acTא1cTא1dT5}b)!cTא1cTא1dT5}b acTא1cTא1dT5}b!cTא1cTא1dT5}b?acT 2cT 2dT5}bv!cT 2cT 2dT5}b\*acT2cT2dT5}b?!cT2cT2dT5}bgacT2cT2dT5}br!cT2cT2dT5}b@~acT2cT2dT5}b!cT2cT2dT5}b~%kacT2cT2dT5}b)Zyw!cT2cT2dT5}beacT2cT2dT5}b!cT2cT2dT5}bQ`acT2cT2dT5}b!cTP3cTP3dT5}b2acTP3cTP3dT5}b H:!cTP3cTP3dT5}b `hacTP3cTP3dT5}b 4!cTP3cTP3dT5}b acTP3cTP3dT5}b ,Ȑ!cTP3cTP3dT5}b  acTP3cTP3dT5}b oo!cTP3cTP3dT5}b 5 acTP3cTP3dT5}b Փ!cTP3cTP3dT5}b ݅acTi3cTi3dT5}bͶ!cTi3cTi3dT5}b17%,acTi3cTi3dT5}bG!cTi3cTi3dT5}b݅acTi3cTi3dT5}b=!cTi3cTi3dT5}bSacTi3cTi3dT5}b`S!cTi3cTi3dT5}bUacTi3cTi3dT5}b,$q!cTi3cTi3dT5}b acTi3cTi3dT5}bʱi!cTс4cTс4dT5}beacTс4cTс4dT5}b'!cTс4cTс4dT5}b\#acTс4cTс4dT5}b!cTс4cTс4dT5}bK_~acTс4cTс4dT5}b2!cTс4cTс4dT5}b$9acTс4cTс4dT5}bd!cTс4cTс4dT5}b acTс4cTс4dT5}b]2S!cT?5cT?5dT5}b03acT?5cT?5dT5}bFOЖ!cT?5cT?5dT5}b\acT?5cT?5dT5}b{ !cT?5cT?5dT5}b/jacT?5cT?5dT5}b.!cT?5cT?5dT5}bgBacT?5cT?5dT5}be0|!cT?5cT?5dT5}bJacT?5cT?5dT5}b!cT?5cT?5dT5}ba?oacT5cT5dT5}b^!cT5cT5dT5}b Y~acT5cT5dT5}b!cT5cT5dT5}bEacT5cT5dT5}b;!cT5cT5dT5}bacT5cT5dT5}b$!cT5cT5dT5}b |acT5cT5dT5}b[!cT5cT5dT5}b%IYacTV K6cTV K6dT5}b%=!cTV K6cTV K6dT5}b^*acTV K6cTV K6dT5}b3!cTV K6cTV K6dT5}bh'acTV K6cTV K6dT5}br:!cTV K6cTV K6dT5}bDi#AacTV K6cTV K6dT5}b%!cTV K6cTV K6dT5}b acTV K6cTV K6dT5}bFi!cTV K6cTV K6dT5}bÛacTV K6cTV K6dT5}by@!cT6cT6dT5}bC|/acT6cT6dT5}b t!cT6cT6dT5}b  acT6cT6dT5}b +O.!cT6cT6dT5}b acT6cT6dT5}b M!cT6cT6dT5}b |\acT6cT6dT5}b R!cT6cT6dT5}b 9%acT6cT6dT5}b 5!cT|7cT|7dT5}b fUVacT|7cT|7dT5}bǔ!cT|7cT|7dT5}bavZacT|7cT|7dT5}bQ!cT|7cT|7dT5}b"&!cT|7cT|7dTm YBu!cT|7cT|7dTP7 hoBuacT|7cT|7dT5}b.U!cT|7cT|7dT5}b*BacT|7cT|7dT5}bCl!cTp8cTp8dT5}b}@!cTp8cTp8cTp8?(`%!cTp8cTp8cTp8?acTp8cTp8dT5}b|!cTp8cTp8dT5}bacTp8cTp8dT5}b/4j!cTp8cTp8dT5}bacTp8cTp8dT5}bHv!cTp8cTp8dT5}b0lacTû8cTû8dT5}bЩq!cT@hE9cT@hE9dT5}bH!cT@hE9cT@hE9cT@hE9<dh!cT@hE9cT@hE9cT@hE9=!cT@hE9cT@hE9cT@hE9"\|!cT@hE9cT@hE9cT@hE9"CA!cT@hE9cT@hE9cT@hE94* E!cT@hE9cT@hE9dT5}bf0!cT9cT9cT9(Ŕ!cT9cT9cT9(;2!cT9cT9cT9(kV!cT9cT9cT9(';W>D_l%,m// OlþWj}7>ZkjXy377 d^v!o@ . ..GMAKEDEVHconsoleI ttyJ memKkmem|Lnull|Mzero|NstdinOstdoutPstderrQksymsRklog|Sbpf0|Twd0a|Urwd0aVwd0b|Wrwd0bXwd0cYrwd0cZwd0d|[rwd0d\wd0e|]rwd0e^wd0f|_rwd0f`wd0g|arwd0gbwd0h|crwd0hdwd0i|erwd0iA ...B ...C ...D . ..Ekeymapsmisc}E .D..F ...742cg`@79:7w«-Zg\B7O@'Ӿs~-{kE!nn6j/HWynvIeS}ލF sMLۻ9)PF&^Q-jc"‰.$CaMjP[d&(::KbU/Rio?Y w >;Z4ٷ,Q+:Ֆ}}>(-}|%rZLZq)GW;()f(.y_xU`uD^mm%adâW<'*:m?!cf&(3uU4V<wQ( gQ̫_QM08bX7 z{>d!Q2Ow~㶨F=)iSHd$m-if! FEdlX [@X̻k~jEY:D 5>ʹrdfGof,ҏ"W##v215VbuZ6ns҈bIPLVq z2E{Sb%ҽ5iq"|˶+v>S@`8G% 8vFšw``u N˅؍芰z~L\HjiԐ\-% ?2aN[wߏWr:j?$.Dsp"8 1).lN!(Ew8fTl 4)P|ɵՄ? Gy/etc/ttyssecurertsctssoftcarwindowMD5PadؗҜ<3#I9=D2[%Cod(hinityan0123456789abcdefglob2ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/readpassphrase  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~tcsetattrXJdJlJxJJJJJJJJJKKK(K4KLK`KlKxKKKKKKK L$L8LLLdL|LXJdJlJxJJJJJJJJJKKK(K4KLK`KlKxKKKKKKK L$L8LLLdL|LSignal 0HangupInterruptQuitIllegal instructionTrace/BPT trapAbort trapEMT trapFloating point exceptionKilledBus errorSegmentation faultBad system callBroken pipeAlarm clockTerminatedUrgent I/O conditionSuspended (signal)SuspendedContinuedChild exitedStopped (tty input)Stopped (tty output)I/O possibleCputime limit exceededFilesize limit exceededVirtual timer expiredProfiling timer expiredWindow size changesInformation requestUser defined signal 1User defined signal 2Thread AST/etc/protocolsXJM MT`$M(M0M8M?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~%h %e %T realpathinet6_rth_reverseSHA1TransformSHA1Pad/etc/services,/ ((((( AAAAAABBBBBB __stack_smash_handlerstack overflow in function %slibcUnknown signal: Unknown error: _catopenNLSPATH/usr/share/nls/%L/%N.cat:/usr/share/nls/%l.%c/%N.cat:/usr/share/nls/%l/%N.catLC_ALLLC_MESSAGESLANGcdd8dHd`dtdddddddee4e@eLe`eeeeeee ff,fDfTflfK|fffffg4gTghgggggg h[%ld]Error %dsnprintfvsnprintf__put_page%s/_hash.XXXXXXHASH: Out of overflow pages. Increase page size *lL|̬4ȜȜ4xx$D.L H $ ,84@p$Hp$Pp$X>`FlMt`e|thU؛frr4x`|K#\t$m% / / T6 l9 p p p |  $ , 0( 8` Lpunblock and -DNO_CONV?  = < 9 { @$< : 7 @,<D\t0 @ 1м|^t0 Non-system disk Press any key to reboot NB:F:I:L:O:S:a:b:c:e:f:h:i:k:m:n:o:qr:s:t:u: Kl,*4*@<*D*H*L*TX*T)`*h*,-Ll*l)tp*x*h*,*T*n<**/tmp/EdDk.aXXXXXXXXXX8S\\ \(\DS0\8\@\H\P\X\\\`\h\p\Rx\\\\\\\\8S\\\\\hX\h\\\ (oxpZLc> P30123456789.=:f/?/*?*n+n,N-N.&7m'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !+ Hh VqQ:q:QZZ    l h b  w  i x X      0  $  k  j  is not a regular file (use -f to see it) is a directoryaT<\bT@BTcTDDdTAleTfTFT$PgTthTiT4TljTJT!KTLT4TmTl|nT"pTHإPTؤqTDrT"X|sT!ST!(uT"8dVTwT"xT(4( 4 XTA@ h yT  zT  "Th ~T! , ?T0#T@L ` TAl | T  T  T P  ... (interrupt to abort) (press RETURN)8458 Ȏмظ11"t €u6Uu|agPtPS[X!Using drive X, partition YMBR on floppy or old BIOS Read error No O/S No active partition OxUhD-|, .4.#<.d.l./ ..P!...h /t$/RP/kl//L//$/(/$08,0}@1iH1hP1P\1X@h1 SSSSSP S( S S S j StVSD40SS\STZ T@T,R T 0  !,T"4T#i$@T%&l'DT(LT)TT*\T+hT,pT-tT.|T/T0T1T2`K3R4T5TTTUUDUpUUUUU VLV|VVV priorityrttvarrttssthreshsendpiperecvpipeexpirehopcountmtuUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CLONING XRESOLVE LLINFO STATIC BLACKHOLEPROTO3PROTO2PROTO1CLONEDMPATHMPLSLOCALBROADCASTUPBROADCASTDEBUGLOOPBACKPTPNOTRAILERSRUNNINGNOARP PPROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD SRC SRCMASK LABEL<NOOP |gj:d\gd\4( 0(EHC P E(  0(EHDHCD1Hx  ... ...-мммн  , 0 4 < H P X ` <@h `@@@......42( ,  $(\,D{}abcdDgGhHilnNpPqrs tw xy !:#= !!, Pp|4DTd|K(f@L  ,     E( E0 F8 8F@ hFH FP FkFX (GlXG` Gh GL _ xx:xx:xx:xx:xx:xx0000000000000000 8S\\ \(\DS0\8\@\H\P\X\\\`\h\p\Rx\\\\\\\\8S\\\\\hX\h\\\kh)RuneCT10NONEBBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~*P< ( 0 8 @ H P kX  l@` h |/`<t<h h Ȏ  0 X ( D*( *0 S8 *@ x*H *P @+k\+X +l+` +h ,, ,$,(,,,0,x4,8,@,D,P, T, X,  \, `, p, t, , , ,,,,,,,,,,,,,,\,,,,,,l ,!,"-#-$ -%0-&<-'H-(\-)p-*|-+-,-----.-.t././-0-1-2-3-4-5-6-7-8-9.:.; .<.=(.><.?L.@\.[p.\|.\.].^.^._._.`.{.{ /|/}(/}6Á.Z~tn&oo"رUŋ_#98GC\7/8޻EPYs;X* Xz : :I䩥nj$l }Zqs,px;V 6V@' Qpy;RƉ? p?SMpW˞·ٱ`^&#k: %}}Ϻ(I-gbYWEl?zϥ9E7nHū sLFA+B^@*s:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:l1=pf1:l2=pf2:l3=pf3:l4=pf4:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[0m:mr=\E[7m:nd=\E[C:pf=\E[4i:po=\E[5i:\ :ps=\E[0i:rc=\E8:rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :..sa=\E[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t\016%e\017%;$<2>:\ :sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: vt220|vt200|dec vt220:\ :5i:am:bs:mi:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :%0=\E[29~:%1=\E[28~:*6=\E[4~:@0=\E[1~:AL=\E[%dL:\ :DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:F1=\E[23~:F2=\E[24~:\ :F3=\E[25~:F4=\E[26~:F7=\E[31~:F8=\E[32~:F9=\E[33~:\ :FA=\E[34~:IC=\E[%d@:LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:\ :SA=\E[?7h:UP=\E[%dA:ae=\E(B:al=\E[L:as=\E(0:bl=^G:\ :cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:\ :cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:\ :eA=\E)0:ec=\E[%dX:ei=\E[4l:ho=\E[H:\ :if=/usr/share/tabset/vt100:im=\E[4h:\ :is=\E[?7h\E[>\E[?1l\E F\E[?4l:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k6=\E[17~:k7=\E[18~:k8=\E[19~:k9=\E[20~:\ :k;=\E[21~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=^H:\ :kd=\E[B:kl=\E[D:kr=\E[C:ku=\E[A:l1=pf1:l2=pf2:l3=pf3:\ :l4=pf4:le=^H:mb=\E[5m:md=\E[1m:me=\E[0m:mr=\E[7m:nd=\E[C:\ :nw=\EE:pf=\E[4i:po=\E[5i:ps=\E[i:r1=\E[?3l:rc=\E8:sc=\E7:\ :se=\E[27m:sf=\ED:so=\E[7m:sr=\EM:st=\EH:ta=^I:\ :u6=\E[%i%d;%dR:u7=\E[6n:u9=\E[c:ue=\E[24m:up=\E[A:\ :us=\E[4m:vb=\E[?5h\E[?5l: bin*Binaries Commands and Source//sbin/nologin1binrdrrootdaemonCharlie &/root/bin/ksh2rootdaemonCharlie &/root/bin/ksh3MHdaemon*The devil himself/root/sbin/nologin2daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user for NFS/nonexistent/sbin/nologin1nobody f]\W operator*System &/operator/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Boperator*System &/operator/sbin/nologin3operator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/ksh1rootA<bin*Binaries Commands and Source//sbin/nologin2bin*Binaries Commands and Source//sbin/nologin3uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucpD6Duucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2_dhcp*MMDHCP programs/var/empty/sbin/nologin1_dhcp^P^_dhcp*MMDHCP programs/var/empty/sbin/nologin2_dhcp*MMDHCP programs/var/empty/sbin/nologin3M@2@nobody*Unprivileged user for NFS/nonexistent/sbin/nologin2nobody*Unprivileged user for NFS/nonexistent/sbin/nologin3a  n}bin*Binaries Commands and Source//sbin/nologin1binpbprootdaemonCharlie &/root/bin/kshs2rootdaemonCharlie &/root/bin/kshs3MHdaemon*The devil himself/root/sbin/nologin2daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user for NFS/nonexistent/sbin/nologin1nobody e\[V  operator*System &/operator/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Boperator*System &/operator/sbin/nologin3operator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/ksh1rootA<bin*Binaries Commands and Source//sbin/nologin2bin*Binaries Commands and Source//sbin/nologin3uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucpD6Duucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2_dhcp*MMDHCP programs/var/empty/sbin/nologin1_dhcp^P^_dhcp*MMDHCP programs/var/empty/sbin/nologin2_dhcp*MMDHCP programs/var/empty/sbin/nologin3M@2@nobody*Unprivileged user for NFS/nonexistent/sbin/nologin2nobody*Unprivileged user for NFS/nonexistent/sbin/nologin3a  n}#!/bin/ksh MODE=install . install.sub DISK= DISKS_DONE= _DKDEVS=$(get_dkdevs) _fsent= rm -f /tmp/fstab* ask_yn "Use DUIDs rather than device names in fstab?" yes && FSTABFLAG=-F while :; do DISKS_DONE=$(addel "$DISK" $DISKS_DONE) _DKDEVS=$(rmel "$DISK" $_DKDEVS) if isin $ROOTDISK $_DKDEVS; then resp=$ROOTDISK rm -f /tmp/fstab else ask_which "disk" "do you wish to initialize" \ '$(l=$(get_dkdevs); for a in $DISKS_DONE; do l=$(rmel $a $l); done; bsort $l)' \ done [[ $resp == done ]] && break fi DISK=$resp makedev $DISK || continue rm -f /tmp/*.$DISK md_prep_disklabel $DISK || { DISK=; continue; } grep -qs " / ffs " /tmp/fstab.$ROOTDISK || { DISK=; echo "'/' must be configured!"; continue; } if [[ -f /tmp/fstab.$DISK ]]; then while read _pp _mp _rest; do if [[ $_mp == none ]]; then echo "$_pp $_mp $_rest" >>/tmp/fstab continue fi [[ /tmp/fstab.$DISK == $(grep -l " $_mp " /tmp/fstab.*) ]] || { _rest=$DISK; DISK=; break; } done /etc/fstab rm /tmp/fstab.$_rest set -- $(grep -h " $_mp " /tmp/fstab.*[0-9]) echo "$_pp and $1 can't both be mounted at $_mp." continue fi while read _pp _mp _fstype _rest; do [[ $_fstype == ffs ]] || continue _OPT= [[ $_mp == / ]] && _OPT=$MDROOTFSOPT newfs -q $_OPT ${_pp##/dev/} _fsent="$_fsent $_mp!$_pp" done >/tmp/fstab munge_fstab mount_fs "-o async" feed_random install_sets if [[ -z $TZ ]]; then (cd /mnt/usr/share/zoneinfo ls -1dF $(tar cvf /dev/null [A-Za-y]*) >/mnt/tmp/tzlist ) echo set_timezone /mnt/tmp/tzlist rm -f /mnt/tmp/tzlist fi if _time=$(http_time) && _now=$(date +%s) && (( _now - _time > 120 || _time - _now > 120 )); then _tz=/mnt/usr/share/zoneinfo/$TZ if ask_yn "Time appears wrong. Set to '$(TZ=$_tz date -r "$(http_time)")'?" yes; then date $(date -r "$(http_time)" "+%Y%m%d%H%M.%S") >/dev/null fi fi if [[ -s $HTTP_LIST ]]; then _i= [[ -n $INSTALL ]] && _i="install=$INSTALL" [[ -n $TZ ]] && _i="$_i&TZ=$TZ" [[ -n $METHOD ]] && _i="$_i&method=$METHOD" [[ -n $_i ]] && ftp -Vao - \ "http://129.128.5.191/cgi-bin/ftpinstall.cgi?$_i" >/dev/null 2>&1 & fi sed "/^console.*on.*secure.*$/s/std\.[0-9]*/std.$(stty speed /tmp/ttys mv /tmp/ttys /mnt/etc/ttys echo -n "Saving configuration files..." (cd /var/db; for _f in dhclient.leases.*; do [[ -f $_f ]] && mv $_f /mnt/var/db/. done) hostname >/tmp/myname echo "127.0.0.1\tlocalhost" >/mnt/etc/hosts echo "::1\t\tlocalhost" >>/mnt/etc/hosts if [[ -f /tmp/hosts ]]; then _dn=$(get_fqdn) while read _addr _hn _aliases; do if [[ -n $_aliases || $_hn != ${_hn%%.*} || -z $_dn ]]; then echo "$_addr\t$_hn $_aliases" else echo "$_addr\t$_hn.$_dn $_hn" fi done >/mnt/etc/hosts rm /tmp/hosts fi _f=dhclient.conf [[ -f /tmp/$_f ]] && { cat /tmp/$_f >>/mnt/etc/$_f; rm /tmp/$_f; } (cd /tmp; for _f in fstab hostname* kbdtype my* ttys *.conf *.tail; do [[ -f $_f && -s $_f ]] && mv $_f /mnt/etc/. done) echo "done." apply if [[ -n $user ]]; then _encr=$(encr_pwd "$userpass") _home=/home/$user uline="${user}:${_encr}:1000:1000:staff:0:0:${username}:$_home:/bin/ksh" echo "$uline" >> /mnt/etc/master.passwd echo "${user}:*:1000:" >> /mnt/etc/group echo ${user} > /mnt/root/.forward _home=/mnt$_home mkdir -p $_home (cd /mnt/etc/skel; cp -pR . $_home) (umask 077 && sed "s,^To: root\$,To: ${username} <${user}>," \ /mnt/var/mail/root > /mnt/var/mail/$user ) chown -R 1000:1000 $_home /mnt/var/mail/$user echo "1,s@wheel:.:0:root\$@wheel:\*:0:root,${user}@ w q" | ed /mnt/etc/group 2>/dev/null [[ -n "$userkey" ]] && print -r -- "$userkey" >> $_home/.ssh/authorized_keys fi if [[ -n "$_rootpass" ]]; then _encr=$(encr_pwd "$_rootpass") echo "1,s@^root::@root:${_encr}:@ w q" | ed /mnt/etc/master.passwd 2>/dev/null fi /mnt/usr/sbin/pwd_mkdb -p -d /mnt/etc /etc/master.passwd [[ -n "$rootkey" ]] && ( umask 077 mkdir /mnt/root/.ssh print -r -- "$rootkey" >> /mnt/root/.ssh/authorized_keys ) finish_up bytes: \(.*\)/{s//(\1)/;H;}' \ -e '$!d;x;s/\n/ /' rm -f /dev/{r,}$_d? done } while :; do echo "Available disks are: $(get_dkdevs | sed 's/^$/none/')." _ask "Which disk is the root disk? ('?' for details)" \ $(get_dkdevs | sed 's/ .*//') || continue case $resp in "?") diskinfo $(get_dkdevs);; '') ;; *) isin "$resp" $(get_dkdevs) && break echo "no such disk";; esac done makedev $resp || exit ROOTDISK=$resp ROOTDEV=${ROOTDISK}a SWAPDEV=${ROOTDISK}b usage() { echo "usage: ${0##*/} [-a] [-f filename]" >&2 exit 1 } AUTO=false RESPFILE= while getopts "af:" opt; do case $opt in a) AUTO=true;; f) RESPFILE=$OPTARG;; *) usage;; esac done shift $((OPTIND-1)) [ $# = 0 ] || usage . install.md set_term() { local _layouts export TERM=${TERM:-${MDTERM:-vt220}} if [[ -n $CONSOLE ]]; then ask "Terminal type?" $TERM export TERM=$resp else [[ -x /sbin/kbd ]] || return _layouts=$(bsort $(kbd -l | egrep -v "^(user|tables|encoding)")) while :; do ask "Choose your keyboard layout ('?' or 'L' for list)" "default" case $resp in "?"|L|l) echo "Available layouts: $_layouts";; default) return;; *) kbd $resp && { echo $resp >/tmp/kbdtype; return; };; esac done fi } stripcom () { local _l [[ -f $1 ]] || return set -o noglob while read _l; do [[ -n ${_l%%#*} ]] && echo $_l done <$1 set +o noglob } quote() ( for a; do alias Q=$a; a=$(alias Q); print -rn -- " ${a#Q=}" done | sed '1s/ //' echo ) tmpdir() { local _i=1 _dir until _dir="${1?}.$_i.$RANDOM" && mkdir -- "$_dir" 2>/dev/null; do ((++_i < 10000)) || return 1 done echo "$_dir" } scan_dmesg() { bsort $(sed -n "$1" /var/run/dmesg.boot) } scan_disknames() { local IFS=, bsort $(for _n in $(sysctl -n hw.disknames); do echo "${_n%%:*} "; done | sed -n "$1") } get_dkdevs () { echo $(scan_disknames "${MDDKDEVS:-/^[sw]d[0-9][0-9]* /s/ .*//p}") } get_cddevs () { echo $(scan_disknames "${MDCDDEVS:-/^cd[0-9][0-9]* /s/ .*//p}") } get_ifdevs() { local _if _iflist=$(rmel vlan $(ifconfig -C)) for _if in $(ifconfig "$@" 2>/dev/null | sed -n 's/^\([^[:space:]]*\):.*/\1/p'); do isin ${_if%%+([0-9])} $_iflist || echo $_if done } get_drive() { ask_which "$1" "contains the $MODE media" "$2" "$3" [[ $resp == done ]] && return 1 makedev $resp || return 1 return 0 } mount_mnt2() { local _dev=$1 _opts _file=/tmp/parts.$1 _parts disklabel $_dev 2>/dev/null | sed -En '/swap|unused/d;/^ [a-p]: /p' >$_file _parts=$(sed 's/^ \(.\): .*/\1/' $_file) set -- $_parts (($# == 0)) && { echo "No filesystems found on $_dev."; return 1; } if isin "c" $_parts; then resp=c elif (($# == 1)); then resp=$1 else cat $_file ask_which "$_dev partition" "has the $MODE sets" \ '$(disklabel '$_dev' 2>/dev/null | sed -En '\''/swap|unused/d;/^ ([a-p]): .*/s//\1/p'\'')' [[ $resp == done ]] && return 1 fi grep -q "^ $resp: .*MSDOS" $_file && _opts="-s" mount -o ro,$_opts /dev/$_dev$resp /mnt2 } askpass() { stty -echo IFS= read -r resp?"$1 " stty echo echo } rm -df /tmp/lock lock() { while ! mkdir /tmp/lock 2>/dev/null && sleep .1; do done } unlock() { rm -d /tmp/lock 2>/dev/null } retrap() { trap 'kill -KILL $cppid 2>/dev/null; echo; stty echo; exit 0' \ INT EXIT TERM } rm -f /tmp/update if ! $AUTO; then ( while :; do lock if test -e /tmp/update && [[ "`dmesg`" != "`cat /tmp/update`" ]]; then dmesg >/tmp/update kill -TERM 2>/dev/null $$ || exit 1 fi unlock sleep .5 done ) |& cppid=$! retrap fi _ask() { local _q=$1 _def=$2 _int _redo=0 _pid lock; dmesg >/tmp/update; unlock echo -n "${_q:+$_q }${_def:+[$_def] }" _autorespond "$_q" "$_def" && echo "$resp" && return trap "_int=1" INT trap "_redo=1" TERM read resp lock; rm /tmp/update; unlock if ((_redo)); then stty raw stty -raw else case $resp in !) echo "Type 'exit' to return to install." sh _redo=1 ;; !*) eval "${resp#?}" _redo=1 ;; esac fi retrap ((_int)) && kill -INT $$ : ${resp:=$_def} return $_redo } _autorespond() { typeset -l _q=$1 _key local _def=$2 _l _val [[ -f $RESPFILE ]] || return mv /ai.conf /ai.conf.tmp while IFS=' ' read -r _l; do [[ $_l == [!#=]*=?* ]] || continue _key=${_l%%*([[:blank:]])=*} _val=${_l##*([!=])=*([[:blank:]])} [[ $_q == @(|*[[:blank:]])"$_key"@([[:blank:]?]*|) ]] && resp=$_val && cat && return print -r " $_l" done /ai.conf [[ -n $_def ]] && resp=$_def && return echo "\nQuestion has no answer in response file." exit 1 } ask() { while ! _ask "$1" "$2"; do done } askpassword() { local _q=$1 if $AUTO; then echo -n "$_q " _autorespond "$_q" echo '' _password=$resp return fi while :; do askpass "$_q (will not echo)" _password=$resp askpass "$_q (again)" [[ $resp == "$_password" ]] && break echo "Passwords do not match, try again." done } encr_pwd() { local _p=$1 if [[ -z $_p ]]; then echo '*' elif [[ $_p == \$2?\$[0-9][0-9]\$* && ${#_p} > 40 || $_p == '*************' ]]; then echo "$_p" else encrypt -b a -- "$_p" fi } user_setup() { local _q="Setup a user? (enter a lower-case loginname, or 'no')" while :; do ask "$_q" no case $resp in n|no) return;; y|yes) _q="No really, what is the lower-case loginname, or 'no'?" continue;; root|daemon|operator|bin|smmsp|popa3d) ;; sshd|uucp|www|named|proxy|nobody|ftp) ;; [a-z]*([a-z0-9_])) ((${#resp} <= 31)) && break;; esac echo "$resp is not a useable loginname." done user=$resp while :; do ask "Full name for user $user?" $user case $resp in *[:\&,]*) echo "':', '&' or ',' are not allowed.";; *) ((${#resp} <= 100)) && break echo "Too long.";; esac done username=$resp askpassword "Password for user $user?" userpass=$_password userkey= $AUTO && ask "Public ssh key for user $user" none && [[ $resp != none ]] && userkey=$resp if [[ $sshd == y ]]; then ask_yn "Since you set up a user, disable sshd(8) logins to root?" yes sshd_disableroot=$resp fi } function ask_until { resp= while true; do ask "$1" "$2" [[ -n $resp ]] && break echo "A response is required." $AUTO && exit 1 done } ask_yn() { local _q=$1 _a=${2:-no} typeset -l _resp while :; do ask "$_q" "$_a" _resp=$resp case $_resp in y|yes) resp=y; return 0;; n|no) resp=n; return 1;; esac echo "'$resp' is not a valid choice." $AUTO && exit 1 done } ask_which() { local _name=$1 _query=$2 _list=$3 _def=$4 _dynlist _dyndef _key _q _key=$(echo "$_name" | sed 's/[^[:alnum:]]/_/g') while :; do eval "_dynlist=\"$_list\"" eval "_dyndef=\"$_def\"" set -o noglob set -- $_dyndef; _dyndef="$1" set -- $_dynlist; _dynlist="$*" set +o noglob (($# < 1)) && resp=done && return : ${_dyndef:=$1} echo "Available ${_name}s are: $_dynlist." _q="Which $_name $_query?" echo -n "$_q (or 'done') ${_dyndef:+[$_dyndef] }" _autorespond "$_q" "${_dyndef-done}" && echo "$resp" \ || _ask || continue [[ -z $resp ]] && resp="$_dyndef" isin "$resp" $_dynlist done && break echo "'$resp' is not a valid choice." $AUTO && [[ -n $RESPFILE ]] && exit 1 done } isin() { local _a=$1 _b shift for _b; do [[ $_a == $_b ]] && return 0 done return 1 } addel() { local _a=$1 shift echo -n "$*" isin "$_a" $* || echo -n " $_a" } rmel() { local _a=$1 _b shift for _b; do [[ $_a != $_b ]] && echo -n "$_b " done } bsort() { local _l _a=$1 _b (($# > 0)) || return shift for _b; do if [[ $_a != $_b ]]; then if [[ $_a > $_b ]]; then _l="$_a $_l"; _a=$_b else _l="$_b $_l" fi fi done echo -n "$_a " bsort $_l } showcols() { local _l _cdir=/tmp/cdir set -A _clist mkdir -p $_cdir rm -rf -- $_cdir/* while read _l; do [[ -n $_l ]] || continue mkdir -p /tmp/cdir/"$_l" _clist[${#_clist[*]}]="$_l" done (cd $_cdir; ls -Cdf "${_clist[@]}") rm -rf -- $_cdir } makedev() { [[ -z $(cd /dev && sh MAKEDEV "$@" 2>&1) ]] } addhostent() { local _addr=$1 _name=$2 _delim="." [[ -z $_addr || -z $_name ]] && return [[ $_addr == *:* ]] && _delim=":" sed "/^[0-9a-fA-F]*[$_delim].*[ ]$_name\$/d" /tmp/hosts \ >/tmp/hosts.new 2>/dev/null mv /tmp/hosts.new /tmp/hosts echo "$_addr $_name" >>/tmp/hosts } select_sets() { local _avail=$1 _selected=$2 _f _action _col=$COLUMNS let COLUMNS=_col-8 cat <<__EOT Select sets by entering a set name, a file name pattern or 'all'. De-select sets by prepending a '-' to the set name, file name pattern or 'all'. Selected sets are labelled '[X]'. __EOT while :; do for _f in $_avail; do isin $_f $_selected && echo "[X] $_f" || echo "[ ] $_f" done | showcols | sed 's/^/ /' ask "Set name(s)? (or 'abort' or 'done')" done set -o noglob for resp in $resp; do case $resp in abort) _selected=; break 2;; done) break 2;; -*) _action=rmel;; *) _action=addel;; esac resp=${resp#[+-]} [[ $resp = all ]] && resp=* for _f in $_avail; do [[ $_f = $resp ]] && _selected=$($_action $_f $_selected) done done done set +o noglob COLUMNS=$_col resp=$_selected } configure_ifs() { local _first _ifdevs _ifs _name _hn _vl=0 _vd _vi _p _tags while :; do _vd=$(ifconfig vlan$_vl 2>&1) [[ $_vd == @(*no such interface*) ]] && break [[ $_vd == @(*vlan: +([[:digit:]]) parent interface:*) ]] || break ((_vl++)) done _vd= ifconfig lo0 inet 127.0.0.1/8 rm -f /tmp/mygate while :; do ifconfig vlan$_vl create >/dev/null 2>&1 ask_which "network interface" "do you wish to configure" \ '$(get_ifdevs)' \ ${_p:-'$( (get_ifdevs netboot; get_ifdevs) | sed q )'} [[ $resp == done ]] && break _ifs=$resp _hn=/tmp/hostname.$_ifs rm -f $_hn if [[ $_ifs == vlan+([0-9]) ]]; then _vi=$(ifconfig $_ifs 2>/dev/null | sed -n 's/vlan: \([0-9]*\).*/\1/p') _tags=$(ifconfig vlan 2>/dev/null | sed -n 's/vlan: \([0-9]*\).*/\1/p') [[ -n $_tags ]] && _tags=$(rmel "$_vi" $_tags) if [[ -z $_vi ]]; then _vi=0 while ((++_vi < 4096)); do ! isin "$_vi" $_tags && break done fi _ifdevs=$(get_ifdevs) set -- $_ifdevs while [[ $1 == vlan+([0-9]) ]]; do shift done ask "Which interface:tag should $_ifs be on?" "${_vd:=$1}:$_vi" _vd=${resp%%:*} _vi=${resp##*:} if ! (isin "$_vd" $_ifdevs && [[ $_vd != vlan+([0-9]) ]]); then echo "Invalid interface choice '$_vd'" _vd= continue fi if ((_vi < 1 || _vi > 4095)) || isin "$_vi" $_tags; then echo "Invalid or in-use vlan tag '$_vi'" continue fi grep -qs "^up" /tmp/hostname.$_vd || echo "up" >>/tmp/hostname.$_vd chmod 640 /tmp/hostname.$_vd ifconfig $_vd up ifconfig $_ifs destroy >/dev/null 2>&1 ifconfig $_ifs vlan $_vi vlandev $_vd echo "vlan $_vi vlandev $_vd" >>$_hn [[ ${_ifs##vlan} == $_vl ]] && ((_vl++)) fi ifconfig $_ifs 2>/dev/null | grep -q "^[[:space:]]*ieee80211:" && ieee80211_config $_ifs $_hn resp=$(hostname -s) [[ -n $_first && $_first != $_ifs ]] && ask "Symbolic (host) name for $_ifs?" $resp _name=$resp v4_config $_ifs $_name $_hn v6_config $_ifs $_name $_hn if [[ -f $_hn ]]; then chmod 640 $_hn : ${_first:=$_ifs} fi NIFS=$(ls -1 /tmp/hostname.* 2>/dev/null | grep -c ^) _p=done done } v4_info() { ifconfig $1 inet | sed -n ' 1s/.*/dev/null /sbin/dhclient "$@" } dhcp_request() { local _ifs=$1 _hn=$2 echo "lookup file bind" >/etc/resolv.conf.tail echo "send host-name \"$_hn\";" >/etc/dhclient.conf ifconfig $_ifs group dhcp >/dev/null 2>&1 dhclient -c /dev/stdin $_ifs << __EOT initial-interval 1; backoff-cutoff 2; reboot 5; timeout 10; send host-name "$_hn"; __EOT mv /etc/dhclient.conf /tmp/dhclient.conf mv /etc/resolv.conf.tail /tmp/resolv.conf.tail } hextodec() { local _d _b for _b in $(echo ${1#0x} | sed 's/\(..\)/\1 /g'); do _d=$_d.$((0x$_b)) done echo ${_d#.} } ieee80211_scan() { [[ -f $WLANLIST ]] || ifconfig $1 scan | sed -n 's/^ nwid \([^"]\)/\1/p' >$WLANLIST cat $WLANLIST } ieee80211_config() { local _ifs=$1 _hn=$2 _prompt _nwid _haswpa=0 _err ifconfig $_ifs -nwid -nwkey ifconfig $_ifs -wpa 2>/dev/null && _haswpa=1 rm -f $WLANLIST while [[ -z $_nwid ]]; do ask_until "Access point? (ESSID, 'any', list# or '?')" "any" case "$resp" in +([0-9])) _nwid=$(ieee80211_scan $_ifs | sed -n "${resp}s/ .*//p") [[ -z $_nwid ]] && echo "There is no line $resp." ;; \?) ieee80211_scan $_ifs | sed -n 's/^\([^ ]*\) chan .* bssid \([^ ]*\) .*$/ \1 (\2)/p' | less -XEN ;; *) _nwid=$resp;; esac done if [[ $_nwid != any ]]; then ifconfig $_ifs nwid "$_nwid" quote nwid "$_nwid" >>$_hn _prompt="Security protocol? (O)pen, (W)EP" ((_haswpa == 1)) && _prompt="$_prompt, WPA-(P)SK" while :; do ask_until "$_prompt" "O" case "$_haswpa-$resp" in ?-[Oo]) break ;; ?-[Ww]) ask_until "WEP key? (will echo)" if _err=$(ifconfig $_ifs nwkey "$resp" 2>&1) && [[ -z $_err ]]; then quote nwkey "$resp" >>$_hn break fi echo "$_err" ;; 1-[Pp]) ask_until "WPA passphrase? (will echo)" if ifconfig $_ifs wpakey "$resp"; then quote wpakey "$resp" >>$_hn break fi ;; *) echo "'$resp' is not a valid choice." ;; esac done fi } v4_config() { local _ifs=$1 _name=$2 _hn=$3 _prompt _addr _mask if ifconfig $_ifs | grep -q 'groups:.* dhcp'; then _addr=dhcp else set -- $(v4_info $_ifs) if [[ -n $2 ]]; then _addr=$2; _mask=$(hextodec $3) ifconfig $_ifs inet $_addr delete fi fi if [[ -x /sbin/dhclient ]]; then _prompt="or 'dhcp' " ifconfig dhcp >/dev/null 2>&1 || _addr=dhcp fi _prompt="IPv4 address for $_ifs? (${_prompt}or 'none')" ask_until "$_prompt" "$_addr" case $resp in none) ;; dhcp) if [[ ! -x /sbin/dhclient ]]; then echo "DHCP not possible - no /sbin/dhclient." else dhcp_request $_ifs "$_name" echo "dhcp" >>$_hn fi ;; *) _addr=$resp ask_until "Netmask for $_ifs?" "${_mask:=255.255.255.0}" ifconfig $_ifs -group dhcp >/dev/null 2>&1 if ifconfig $_ifs inet $_addr netmask $resp up; then addhostent "$_addr" "$_name" echo "inet $_addr $resp" >>$_hn fi ;; esac } v6_config() { local _ifs=$1 _name=$2 _hn=$3 _addr _prefixlen _prompt ifconfig lo0 inet6 >/dev/null 2>&1 || return set -- $(v6_info $_ifs) [[ -n $2 ]] && { _addr=$2; _prefixlen=$3; } ifconfig $_ifs inet6 >/dev/null 2>&1 && _prompt="or 'rtsol' " _prompt="IPv6 address for $_ifs? (${_prompt}or 'none')" ask_until "$_prompt" "${_addr:-none}" case $resp in none) return ;; rtsol) ifconfig $_ifs inet6 >/dev/null 2>&1 || { echo "No INET6 support."; return; } ifconfig $_ifs up ifconfig $_ifs inet6 autoconf && echo "up\nrtsol" >>$_hn return ;; esac _addr=$resp ask_until "IPv6 prefix length for $_ifs?" "${_prefixlen:=64}" ifconfig $_ifs inet6 $_addr prefixlen $resp up || return echo "inet6 $_addr $resp" >>$_hn addhostent "$_addr" "$_name" v6_defroute $_ifs } v4_defroute() { local _dr _prompt=" or 'none'" [[ -n $(ifconfig | sed -n '/[ ]inet .* broadcast /p') ]] || return [[ -f /tmp/dhclient.conf && $NIFS == 1 ]] && return [[ -x /sbin/dhclient ]] && _prompt=", 'dhcp'$_prompt" _prompt="Default IPv4 route? (IPv4 address$_prompt)" _dr=$(route -n show -inet | sed -n '/^default */{s///; s/ .*//; p;}') [[ -f /tmp/dhclient.conf ]] && _dr=dhcp while :; do ask_until "$_prompt" "$_dr" [[ $resp == @(none|dhcp) ]] && break route delete -inet default >/dev/null 2>&1 route -n add -inet -host default "$resp" && { echo "$resp" >>/tmp/mygate; break; } route -n add -inet -host default $_dr >/dev/null 2>&1 done } v6_defroute() { local _if=$1 _prompt _resp _routers route -n show -inet6 | egrep -q '^default[[:space:]]' && return _routers=$(bsort $(ping6 -n -c 2 ff02::2%$_if 2>/dev/null | sed -n '/bytes from/{s/^.*from //;s/,.*$//;p;}' | sed -n 'G;s/\n/&&/;/^\(.*\n\).*\n\1/d;h;P')) _prompt="IPv6 default router?" if $AUTO; then _autorespond "$_prompt" && _resp=$resp && echo "$_prompt $_resp" else local PS3="$_prompt (${_routers:+list #, }IPv6 address or 'none'): " select _resp in $_routers; do [[ ${_resp:=$REPLY} == *:* ]] && break [[ $_resp == none ]] && return done fi route -n add -inet6 -host default "$_resp" && echo "$_resp" >>/tmp/mygate } ifstart () { local _hn=$1 if=${1#/mnt/etc/hostname.} ((NIFS++)) while :; do if [ "$cmd2" ]; then set -- $cmd2 af=$1 name=$2 mask=$3 bcaddr=$4 ext1=$5 cmd2= i=1 while [ i -lt 6 -a -n "$1" ]; do shift; let i=i+1; done ext2="$@" else read af name mask bcaddr ext1 ext2 || break fi case "$af" in "#"*|"!"*|"bridge"|"") continue ;; "dhcp") [ "$name" = "NONE" ] && name= [ "$mask" = "NONE" ] && mask= [ "$bcaddr" = "NONE" ] && bcaddr= dhcpif="$dhcpif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 down" if [[ -x /sbin/dhclient ]]; then cmd="$cmd; dhclient $if" else cmd="$cmd; echo /sbin/dhclient missing - skipping dhcp request." fi ;; "rtsol") if ifconfig $if inet6 >/dev/null 2>&1; then rtsolif="$rtsolif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" else cmd="$cmd; echo no INET6 support - skipping rtsol request." fi ;; *) read dt dtaddr if [ "$name" = "alias" ]; then alias=$name name=$mask mask=$bcaddr bcaddr=$ext1 ext1=$ext2 ext2= else alias= fi cmd="ifconfig $if $af $alias $name" case "$dt" in dest) cmd="$cmd $dtaddr" ;; *) cmd2="$dt $dtaddr" ;; esac case $af in inet) if [ ! -n "$name" ]; then echo "/etc/hostname.$if: inet alone is invalid" return fi [ "$mask" ] && cmd="$cmd netmask $mask" if [ "$bcaddr" -a X"$bcaddr" != "XNONE" ]; then cmd="$cmd broadcast $bcaddr" fi [ "$alias" ] && rtcmd=";route -qn add -host $name 127.0.0.1" ;; inet6) if [ ! -n "$name" ]; then echo "/etc/hostname.$if: inet6 alone is invalid" return fi [ "$mask" ] && cmd="$cmd prefixlen $mask" cmd="$cmd $bcaddr" ;; *) cmd="$cmd $mask $bcaddr" ;; esac cmd="$cmd $ext1 $ext2$rtcmd" rtcmd= ;; esac eval "$cmd" done <$_hn } enable_network() { local _f _gw _trunks _svlans _vlans for _f in dhclient.conf resolv.conf resolv.conf.tail; do if [ -f /mnt/etc/$_f ]; then cp /mnt/etc/$_f /etc/$_f fi done ifconfig lo0 inet 127.0.0.1/8 for hn in /mnt/etc/hostname.*; do if=${hn#/mnt/etc/hostname.} if isin ${if%%+([0-9])} $(ifconfig -C); then case ${if%%+([0-9])} in trunk) _trunks="$_trunks $hn" ;; svlan) _svlans="$_svlans $hn" ;; vlan) _vlans="$_vlans $hn" ;; esac else ifconfig $if >/dev/null 2>&1 && ifstart $hn fi done for hn in $_trunks $_svlans $_vlans; do ifstart $hn done [[ -n $rtsolif ]] && ifconfig $rtsolif inet6 autoconf [[ -z $dhcpif ]] && stripcom /mnt/etc/mygate | while read _gw; do [[ $_gw == @(*:*) ]] && continue route -qn delete default >/dev/null 2>&1 route -qn add -host default $_gw && break done [[ -z $rtsolif ]] && stripcom /mnt/etc/mygate | while read _gw; do [[ $_gw == !(*:*) ]] && continue route -qn delete -inet6 default >/dev/null 2>&1 route -qn add -host -inet6 default $_gw && break done route -qn add -net 127 127.0.0.1 -reject >/dev/null } install_files() { local _src=$1 _files=$2 _f _sets _get_sets _n _col=$COLUMNS \ _tmpfs _tmpsrc _cfile _fsrc _unver _t _issue _srclocal for _f in $THESETS; do isin $_f $_files || continue; _sets=$(addel $_f $_sets) [[ -z $DISPLAY && ! -d /mnt/etc/X11 ]] && isin ${_f%${VERSION}.tgz} xbase xshare xfont xserv && continue isin $_f $DEFAULTSETS "site$VERSION-$(hostname -s).tgz" && _get_sets=$(addel $_f $_get_sets) done if [[ -z $_sets ]]; then echo -n "Looked at $_src " echo "and found no $OBSD sets. The set names looked for were:" let COLUMNS=_col-8 for _n in $THESETS; do echo $_n; done | showcols | sed 's/^/ /' COLUMNS=$_col $AUTO && exit 1 echo return fi isin INSTALL.$ARCH $_files || ask_yn "INSTALL.$ARCH not found. Use sets found here anyway?" || return select_sets "$_sets" "$_get_sets" [[ -n $resp ]] || return _get_sets=$resp _get_sets=$(for s in $THESETS; do isin $s $_get_sets && echo $s; done) _unver=$_get_sets for _issue in ''; do ! isin SHA256.sig $_files && _issue="Directory does not contain SHA256.sig" && break _tmpfs=$( ( for fs in /mnt/{{,var/}tmp,home,usr{/local,}}; do df -k $fs 2>/dev/null | grep " $fs\$" done df -k ) | ( while read a a a a m m; do [[ $m == /mnt/@(@(|var/)tmp|home|usr/@(src,obj,xobj))@(|/*) ]] && ((a > 524288)) && echo $m && exit [[ $m == /mnt@(|/*) ]] && ((a > 524288 * 4)) && echo $m && exit done ) ) if [[ -d $_tmpfs ]]; then ! _tmpsrc=$(tmpdir "$_tmpfs/sets") && _issue="Cannot create prefetch area" && break else _issue="Cannot determine prefetch area" && break fi _cfile=$_tmpsrc/SHA256 _srclocal=false _t=Get/Verify [[ $_src == file://* ]] && _srclocal=true _t='Verifying ' ! ftp -D "$_t" -Vmo "$_cfile.sig" "$_src/SHA256.sig" && _issue="Cannot fetch SHA256.sig" && break ! signify -Vep /etc/signify/openbsd-${VERSION}-base.pub \ -x "$_cfile.sig" -m "$_cfile" && _issue="Signature check of SHA256.sig failed" && break for _f in $_get_sets; do rm -f "$_tmpsrc/h" "$_tmpsrc/fail" ( ftp -D "$_t" -Vmo - "$_src/$_f" || >"$_tmpsrc/fail" ) | ( $_srclocal && sha256 >$_tmpsrc/h || sha256 -ph "$_tmpsrc/h" >"$_tmpsrc/$_f" ) if [[ -f $_tmpsrc/fail ]]; then rm -f "$_tmpsrc/$_f" if ! ask_yn "Fetching of $_f failed. Continue anyway?"; then [[ -d $_tmpsrc ]] && rm -rf "$_tmpsrc" $AUTO && exit 1 return fi continue fi if fgrep -qx "SHA256 ($_f) = $(<$_tmpsrc/h)" "$_cfile"; then _unver=$(rmel $_f $_unver) else if ! ask_yn "Checksum test for $_f failed. Continue anyway?"; then [[ -d $_tmpsrc ]] && rm -rf "$_tmpsrc" $AUTO && exit 1 return fi fi done done [[ -n $_unver ]] && : ${_issue:="Unverified sets:" ${_unver% }} if [[ -n $_issue ]] && ! ask_yn "$_issue. Continue without verification?"; then [[ -d $_tmpsrc ]] && rm -rf "$_tmpsrc" $AUTO && exit 1 return fi [[ $MODE == upgrade ]] && rm -rf /mnt/var/tmp for _f in $_get_sets; do _fsrc="$_src/$_f" [[ -f $_tmpsrc/$_f ]] && _fsrc="file://$_tmpsrc/$_f" case $_fsrc in *.tgz) ftp -D Installing -Vmo - "$_fsrc" | tar -zxphf - -C /mnt if [[ $_f == ?(x)base*.tgz && $MODE == install ]]; then ftp -D Extracting -Vmo - \ file:///mnt/usr/share/sysmerge/${_f%%base*}etc.tgz | tar -zxphf - -C /mnt fi;; *) ftp -D Installing -Vmo "/mnt/$_f" "$_fsrc";; esac if (($?)); then if ! ask_yn "Installation of $_f failed. Continue anyway?"; then [[ -d $_tmpsrc ]] && rm -rf "$_tmpsrc" $AUTO && exit 1 return fi else DEFAULTSETS=$(rmel $_f $DEFAULTSETS) GOTSETS="$GOTSETS $_f" fi [[ -d $_tmpsrc ]] && rm -f "$_tmpsrc/$_f" done [[ -d $_tmpsrc ]] && rm -rf "$_tmpsrc" } startcgiinfo() { ((NIFS < 1)) && return set -m ( ftp -Vao - "http://129.128.5.191/cgi-bin/ftplist.cgi?path=$HTTP_SETDIR" \ 2>/dev/null >$CGI_INFO echo -n $SECONDS >$HTTP_SEC feed_random ) & CGIPID=$! set +m (sleep 12; kill -INT -$CGIPID >/dev/null 2>&1) & } waitcgiinfo() { wait "$CGIPID" 2>/dev/null [[ -s $CGI_INFO ]] || return sed -n "s,^http://"'\([[A-Za-z0-9\:_][]A-Za-z0-9:._-]*\),\1,p' \ $CGI_INFO >$HTTP_LIST 2>/dev/null set -- $(sed q $HTTP_LIST) : ${HTTP_SERVER:=${1%%/*}} CGI_METHOD=$(sed -n '/^method=/s///p' $CGI_INFO 2>/dev/null) CGI_TZ=$(sed -n '/^TZ=/s///p' $CGI_INFO 2>/dev/null) CGI_TIME=$(sed -n '/^TIME=/s///p' $CGI_INFO 2>/dev/null) } http_time() { local _sec=$(cat $HTTP_SEC 2>/dev/null) [[ -n $_sec && -n $CGI_TIME ]] && echo $((CGI_TIME + SECONDS - _sec)) } install_http() { local _file_list _prompt _mirror _url_base waitcgiinfo ask "HTTP proxy URL? (e.g. 'http://proxy:8080', or 'none')" \ "${http_proxy:-none}" unset http_proxy [[ $resp == none ]] || export http_proxy=$resp if [[ -s $HTTP_LIST ]]; then _prompt="HTTP Server? (hostname, list#, 'done' or '?')" else echo "(Unable to get list from ftp.openbsd.org, but that is OK)" _prompt="HTTP Server? (hostname or 'done')" fi while :; do ask_until "$_prompt" "$HTTP_SERVER" case $resp in done) return;; "?") [[ -s $HTTP_LIST ]] || continue less -XEN < $HTTP_LIST ;; +([0-9])) [[ -s $HTTP_LIST ]] || continue set -- $(sed -n "${resp}p" $HTTP_LIST) (($# < 1)) && { echo "There is no line $resp."; continue; } HTTP_SERVER=${1%%/*} ;; +([A-Za-z0-9\:.\[\]_-])) HTTP_SERVER=$resp break ;; *) echo "'$resp' is not a valid hostname." ;; esac done set -- $(sed "/^$HTTP_SERVER/x;\$!d;x" $HTTP_LIST 2>/dev/null) resp=${1#*/} [[ $resp == "$1" ]] && resp= if (($# > 1)); then resp=$resp/$HTTP_SETDIR _mirror=yes fi : ${HTTP_DIR:=pub/OpenBSD/$HTTP_SETDIR} ask_until "Server directory?" "${resp:-$HTTP_DIR}" HTTP_DIR=$resp _url_base="http://$HTTP_SERVER/$HTTP_DIR" _file_list=$(ftp -Vo - "$_url_base/index.txt" | sed 's/^.* //' | sed 's/ //') install_files "$_url_base" "$_file_list" INSTALL=$_url_base PACKAGE_PATH= if [[ -n $_mirror ]]; then PACKAGE_PATH=$(print -r -- "$_url_base" | sed -E "/\/(snapshots|[0-9]\.[0-9])\/($ARCH)\/*$/!d s!!/\1/packages/$(arch -s)/!;q") fi } install_mounted_fs() { local _dir while :; do ask_until "Pathname to the sets? (or 'done')" "$SETDIR" [[ $resp == done ]] && return [[ -d /mnt2/$resp ]] && { _dir=/mnt2/$resp; break; } [[ -d /mnt/$resp ]] && { _dir=/mnt/$resp; break; } [[ -d /$resp ]] && { _dir=/$resp; break; } echo "The directory '$resp' does not exist." $AUTO && exit 1 done install_files "file://$_dir" "$(ls $_dir/)" } install_cdrom() { get_drive "CD-ROM" '$(get_cddevs)' || return mount_mnt2 $resp || return install_mounted_fs } install_disk() { if ! ask_yn "Is the disk partition already mounted?"; then get_drive "disk" '$(bsort $(get_dkdevs))' \ '$(bsort $(rmel $ROOTDISK $(get_dkdevs)))' || return mount_mnt2 $resp || return fi install_mounted_fs } install_nfs() { local _tcp ask_until "Server IP address or hostname?" "$NFS_ADDR" NFS_ADDR=$resp ask_until "Filesystem on server to mount?" "$NFS_PATH" NFS_PATH=$resp ask_yn "Use TCP transport? (requires TCP-capable NFS server)" && _tcp=-T mount_nfs $_tcp -o ro -R 5 $NFS_ADDR:$NFS_PATH /mnt2 || return install_mounted_fs } set_timezone() { local _zonefile=$1 _zonepath _zsed _tz _zoneroot=/usr/share/zoneinfo [[ ! -f $_zonefile ]] && return [[ -n $TZ ]] && return if [[ -h /mnt/etc/localtime ]]; then TZ=$(ls -l /mnt/etc/localtime 2>/dev/null) TZ=${TZ#*${_zoneroot#/mnt}/} fi waitcgiinfo if [[ -n $CGI_TZ ]]; then _tz=$CGI_TZ [[ -n $_tz ]] && isin "$_tz" `cat $_zonefile` && TZ=$_tz fi [[ $_zonefile = /var/tzlist && -z $TZ ]] && return while :; do ask "What timezone are you in? ('?' for list)" "$TZ" _zonepath=${resp%%*(/)} case $_zonepath in "") continue;; "?") grep -v /. $_zonefile | showcols continue;; esac while isin "$_zonepath/" $(cat $_zonefile); do ask "What sub-timezone of '$_zonepath' are you in? ('?' for list)" _zsed=$(echo $_zonepath/ | sed 's,/,\\/,g') resp=${resp%%*(/)} case $resp in "") ;; "?") sed -n "/^$_zsed/{s/$_zsed//;/\/./!p;}" $_zonefile | showcols;; *) _zonepath=$_zonepath/$resp;; esac done if isin "$_zonepath" $(cat $_zonefile); then TZ=${_zonepath#$_zoneroot} return fi echo -n "'${_zonepath}'" echo " is not a valid timezone on this system." done } sane_install() { local _q=$1 _s for _s in $SANESETS; do isin $_s $DEFAULTSETS || continue [[ -n $_q ]] && return 1 if ! ask_yn "Are you *SURE* your $MODE is complete without '$_s'?"; then $AUTO && exit 1 || return 1 fi done } install_sets() { local _d _locs="disk http" echo _d=$CGI_METHOD ifconfig netboot >/dev/null 2>&1 && : ${_d:=http} [[ -n $(get_cddevs) ]] && { _locs="cd $_locs"; : ${_d:=cd}; } [[ -x /sbin/mount_nfs ]] && _locs="$_locs nfs" : ${_d:=http} if ! isin "$_d" $_locs; then for a in http cd nfs disk; do isin $a $_locs && _d=$a && break done fi echo "Let's $MODE the sets!" while :; do umount -f /mnt2 >/dev/null 2>&1 ask "Location of sets? ($_locs or 'done')" "$_d" case $resp in done) sane_install && return;; c*|C*) isin cd $_locs && install_cdrom && METHOD=cd;; d*|D*) install_disk && METHOD=disk;; h*|H*) isin http $_locs && install_http && METHOD=http;; n*|N*) isin nfs $_locs && install_nfs && METHOD=nfs;; *) $AUTO && echo "'$resp' is not a valid choice." && exit 1;; esac [[ -n $METHOD ]] && _d=$METHOD sane_install quiet || $AUTO && _d=done done } update_firmware() { echo "/usr/sbin/fw_update -v" >>/mnt/etc/rc.firsttime } munge_fstab() { local _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do [[ $_dev == @(/dev/vnd*|\#*) || $_fstype == nfs || ! -f /sbin/mount_$_fstype || $_opt == *noauto* || $_opt == *xx* ]] && continue _opt=$(echo $_opt | sed 's/softdep//') [[ $_fstype == ffs ]] && _opt=$(echo $_opt | sed 's/[[:<:]]ro[[:>:]]/rw/') [[ $_fstype == ffs ]] || _opt=$(echo $_opt | sed 's/[[:<:]]rw[[:>:]]/ro/') echo $_dev /mnt${_mp%/} $_fstype $_opt $_rest done /etc/fstab if [[ ! -s /etc/fstab ]]; then echo "Unable to create valid /etc/fstab." exit fi } mount_fs() { local _async=$1 _dev _mp _fstype _opt _rest _msg _fail while read _dev _mp _fstype _opt _rest; do [[ $_mp == /mnt ]] || mkdir -p $_mp _msg=$(mount -v -t $_fstype $_async -o $_opt $_dev $_mp) || _fail="$_fail\n$_mp ($_dev)" echo $_msg | sed 's/, ctime=[^,)]*//' done 0)) || continue echo -n "fsck -${_f}p $_dev..." if ! fsck -${_f}p $_dev >/dev/null 2>&1; then echo "FAILED. You must fsck $_dev manually." _fail=y else echo "OK." fi done /tmp/resolv.conf for _ns in $resp; do echo "nameserver $_ns" >>/tmp/resolv.conf done cp /tmp/resolv.conf /tmp/resolv.conf.shadow fi } apply() { [[ $sshd == n ]] && echo "sshd_flags=NO" >>/mnt/etc/rc.conf.local if [[ $sshd_disableroot == y ]]; then sed "/^#\(PermitRootLogin\) yes/s//\1 no/" \ < /mnt/etc/ssh/sshd_config >/tmp/sshd_config cp /tmp/sshd_config /mnt/etc/ssh/sshd_config fi if [[ $ntpd == y ]]; then echo "ntpd_flags=" >>/mnt/etc/rc.conf.local [[ $ntpd_server == default ]] && ntpd_server=pool.ntp.org echo "servers ${ntpd_server%% *}" >>/mnt/etc/ntpd.conf fi [[ -n $aperture ]] && echo "machdep.allowaperture=$aperture # See xf86(4)" \ >>/mnt/etc/sysctl.conf [[ $xdm == y && -x /mnt/usr/X11R6/bin/xdm ]] && echo "xdm_flags=" >>/mnt/etc/rc.conf.local if [[ $defcons == y ]]; then cp /mnt/etc/ttys /tmp/ttys sed -e "/^$CTTY/s/std.9600/std.${CSPEED}/" \ -e "/^$CTTY/s/unknown/vt220 /" \ -e "/$CTTY/s/off.*/on secure/" /tmp/ttys >/mnt/etc/ttys [[ -n $CPROM ]] && echo "stty $CPROM $CSPEED\nset tty $CPROM" >>/mnt/etc/boot.conf fi ln -sf /usr/share/zoneinfo/$TZ /mnt/etc/localtime } questions() { local _d _cdef=no ask_yn "Start sshd(8) by default?" yes sshd=$resp ask_yn "Start ntpd(8) by default?" ntpd=$resp if [[ $resp == y ]]; then ask "NTP server? (hostname or 'default')" default ntpd_server=$resp fi aperture= xdm= if [[ -n $DISPLAY ]]; then if [[ -n $(scan_dmesg '/^[a-z]*[01]: aperture needed/p') ]]; then ask_yn "Do you expect to run the X Window System?" yes && aperture=$MDXAPERTURE fi if [[ -n $MDXDM ]]; then ask_yn "Do you want the X Window System to be started by xdm(1)?" xdm=$resp fi fi if [[ -n $CDEV ]]; then _d=${CPROM:-$CDEV} [[ -n $CONSOLE ]] && _cdef=yes ask_yn "Change the default console to $_d?" $_cdef defcons=$resp if [[ $resp == y ]]; then ask_which "speed" "should $_d use" \ "9600 19200 38400 57600 115200" $CSPEED case $resp in done) defcons=n;; *) CSPEED=$resp;; esac fi fi } feed_random() { (dmesg; cat $CGI_INFO /*.conf; sysctl; route -n show; df; ifconfig -A; hostname) >/dev/random 2>&1 if [[ -e /mnt/var/db/host.random ]]; then dd if=/mnt/var/db/host.random of=/dev/random bs=65536 count=1 \ status=none fi } store_random() { dd if=/dev/random of=/mnt/var/db/host.random bs=65536 count=1 \ status=none dd if=/dev/random of=/mnt/etc/random.seed bs=512 count=1 status=none chmod 600 /mnt/var/db/host.random /mnt/etc/random.seed } finish_up() { local _dev _mp _fstype _rest if [[ -x /mnt/sbin/swapctl ]]; then /mnt/sbin/swapctl -a /dev/$SWAPDEV >/dev/null 2>&1 while read _dev _mp _fstype _rest; do [[ $_fstype == swap ]] && /mnt/sbin/swapctl -a $_dev >/dev/null 2>&1 done $/\1/p') md_installboot $ROOTDISK if [[ -f /mnt/bsd.mp ]] && ((NCPU > 1)); then echo "Multiprocessor machine; using bsd.mp instead of bsd." mv /mnt/bsd /mnt/bsd.sp 2>/dev/null mv /mnt/bsd.mp /mnt/bsd fi update_firmware store_random cat <<__EOT CONGRATULATIONS! Your OpenBSD $MODE has been successfully completed! To boot the new system, enter 'reboot' at the command prompt. __EOT [[ $MODE == install ]] && cat <<__EOT When you login to your new system the first time, please read your mail using the 'mail' command. __EOT md_congrats [[ $MODE == upgrade ]] && \ echo "After rebooting, run sysmerge(8) to update your system configuration." $AUTO && >/ai.done } ROOTDISK= ROOTDEV= PACKAGE_PATH= SETDIR="$VNAME/$ARCH" CGI_INFO=/tmp/cgiinfo CGI_TZ= CGI_TIME= CGI_METHOD= INSTALL= METHOD= HTTP_DIR= HTTP_SEC=/tmp/httpsec HTTP_LIST=/tmp/httplist WLANLIST=/tmp/wlanlist FSTABFLAG=-f for _opt in d f l m n p s; do ulimit -$_opt unlimited done dmesg | sed -n '/^OpenBSD /h;/^OpenBSD /!H;${g;p;}' >/var/run/dmesg.boot HTTP_SETDIR=$SETDIR set -- $(scan_dmesg "/^OpenBSD $VNAME\([^ ]*\).*$/s//\1/p") [[ $1 == -!(stable) ]] && HTTP_SETDIR=snapshots/$ARCH MTDEVS=$(scan_dmesg "${MDMTDEVS:-/^[cms]t[0-9][0-9]* /s/ .*//p}") NIFS=0 DISPLAY=$(scan_dmesg '/^wsdisplay[0-9]* /s/ .*//p') CONSOLE=$(scan_dmesg '/^\([^ ]*\).*: console$/s//\1/p') CONSOLE=${CONSOLE% } [[ -n $CONSOLE ]] && CSPEED=$(stty speed /dev/null 2>&1 for _ifs in $(get_ifdevs dhcp); do set -- $(v4_info $_ifs) [[ $1 == UP && -n $2 ]] && continue ifconfig $_ifs delete down -group dhcp 2>/dev/null done get_responsefile() { local _rf _ifdev _mac _mode _server _lf action= [[ -f /auto_upgrade.conf ]] && _rf=/auto_upgrade.conf _mode=upgrade [[ -f /auto_install.conf ]] && _rf=/auto_install.conf _mode=install [[ -f $_rf ]] && cp $_rf /ai.$_mode.conf && action=$_mode && return for _ifdev in ''; do [[ -x /sbin/dhclient ]] || break set -- $(get_ifdevs netboot) (($# == 0)) && set -- $(get_ifdevs) (($# == 1)) && _ifdev=$1 while (($# > 1)); do ask_which "network interface" \ "should be used for the initial DHCP request" "$*" isin "$resp" $* && _ifdev=$resp && break done [[ -n $_ifdev ]] && dhclient $_ifdev || break _lf=/var/db/dhclient.leases.$_ifdev _server=$(sed "/^ *next-server /!d;s///;s/;$//;q" $_lf) _mode=$(sed -E '/^ *filename "auto_(install|upgrade)";$/!d;s//\1/;q' $_lf) hostname "$(sed -E '/^ *option host-name "(.*)";$/!d;s//\1/;q' $_lf)" done if [[ -n $_server && -n $_mode ]]; then _mac=$(ifconfig $_ifdev | sed 's/.*lladdr \(.*\)/\1/p;d') for _rf in {$_mac-,}$_mode; do _url=http://$_server/$_rf.conf echo "Fetching $_url" if ftp -Vo "/ai.$_mode.conf" "$_url" 2>/dev/null; then action=$_mode ifconfig $_ifdev delete down 2>/dev/null return 0 fi done else [[ -z $_server ]] && echo "Could not determine next-server." [[ -z $_mode ]] && echo "Could not determine auto mode." fi while :; do ask "Response file location?" \ "${_server:+http://$_server/install.conf}" [[ -n $resp ]] && _rf=$resp && break done _mode=$(echo "$_rf" | sed -En 's/^.*(install|upgrade).conf$/\1/p') while [[ -z $_mode ]]; do ask "(I)nstall or (U)pgrade?" [[ $resp == [iI]* ]] && _mode=install [[ $resp == [uU]* ]] && _mode=upgrade done echo "Fetching $_rf" [[ -f $_rf ]] && _rf="file://$_rf" ftp -Vo "/ai.$_mode.conf" "$_rf" 2>/dev/null && action=$_mode ifconfig $_ifdev delete down 2>/dev/null [[ -n $action ]] } if ! $AUTO; then cat <<__EOT At any prompt except password prompts you can escape to a shell by typing '!'. Default answers are shown in []'s and are selected by pressing RETURN. You can exit this program at any time by pressing Control-C, but this can leave your system in an inconsistent state. __EOT elif [[ -z $RESPFILE ]]; then if ! get_responsefile; then echo "No response file found; non-interactive mode aborted." exit 1 fi rm -f /ai.done echo "Performing non-interactive $action..." /$action -af /ai.$action.conf 2>&1 >/mnt/etc/rc.firsttime ( /usr/bin/mail -s '$(hostname) $action log' root < $_lf && rm $_lf ) >/dev/null 2>&1 & __EOT exec reboot else echo "failed; check /ai.log" exit 1 fi else cp $RESPFILE /ai.conf || exit fi set_term if [[ $MODE == install ]]; then ask_until "System hostname? (short form, e.g. 'foo')" "$(hostname -s)" [[ ${resp%%.*} != $(hostname -s) ]] && hostname $resp THESETS="$THESETS site$VERSION-$(hostname -s).tgz" echo donetconfig ((NIFS != 0)) && startcgiinfo echo while :; do askpassword "Password for root account?" _rootpass="$_password" [[ -n "$_password" ]] && break echo "The root password must be set." done rootkey= $AUTO && ask "Public ssh key for root account?" none && [[ $resp != none ]] && rootkey=$resp questions user_setup set_timezone /var/tzlist echo fi diskinfo() { local _d for _d; do makedev $_d echo -n "$_d: " disklabel -dpg $_d 2>/dev/null | sed -e '/^label: /{s,,,;s/ *$//;s/^$//;H;d;}' \ -e '/.*# total =%HC%C%l@ $a%(a%$a%Ha% h%ERD%CEl%ST<%SL%RR%CEl%ST<%NM,%%CL%0PL%0RE$%@RR%CEl%ST<%PX@%%TF4%(%PN%RR%CEl%ST<% %%%`I)ܱ%'lp%I)%' 'Ԯ%}%%d%q%'%Щ%%%%,%%t}%''I)''Ш%Ԫ%8%' %%%T)ܱ%)H)I)h)T)*Ԯ%}%l)T)I)T)*))%*T)T)t}%T)T)I)T)T)Ш%)T)T*@)%i4D%inativef4Ki%`V4H%t%h4h4nativef4Ki\9&`V48&h4h4>>>&X&f& ( ( 4)&4l%f&$))Q&H)h) l)) )T1%&&) )x&8&L&& ( ((( ( @( `(,))))&x)&()&P)&t'& &&&&&&&d& 0(6')Կ) ) =&)8) )) ))Hf&'&' '4'X (1&$E1 D1 |B1)P) 8K10&& &&̎'|))&$'&' '&' &<(') `& l( ( )&p%( &e4 4(x(()&,( ((&&&&&&&X(&  ( (& Ȩ))&&&)&& %)((()l)&&'&&&&&&@&)&&&&&&&&&&&&)&&& 5&&&&&&&))&&&&&&&Ј&&&&&&&&&)& 1<&H&& PF1&\)))&@1\@1&&&& '&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&& D1& (`& )& \C1&&&&&&%( )&&) )4&&B1A1&&&&&&&& & & & @&& HN1&ȼ&&&&&&`)&&&&&&h&Y& l&)'&&&&(X(&)))&) ) )D)))) ) |)&&&&&&&&h&&d&!&$&&&6&&X0&<&@5&5&X&(i(i(i(i*i(i P)i@ 0 @&x&&*i$*i<>H>h*ih*i*i$'@B>h*i*i$+il+i+i+iD,i,i,i-i*i ̮> -iԮ> -id dd>>>-i''.i>ء'@''0'\'' J% >l?|>@>u@>t?>|@>t?Ƚ>@н>>H>?ؽ>?>t?>>>p:@>>>>dd>dd>P((P(X(8((,(((( (8*(*( ((t&((%(%(ttyclsttyopnttybgttyinttyout 2(Z(1(0(@h(H(`U(A(h(J(p*(xG(''''h(''F(''''h(''F(''''h(''F(''''h(''F(''''h(''F(''''h(''F(''''h(''F(''''h(''F(''''h(''F(  $0@>1i)1i)1i)++)+)+)+>(($1i1iL((L(((\(PI) I)2i6i6i6i^^3333> +` +#$%&'()*+ʚ;,-.ʚ;/ʚ;0ʚ;1@B2 T3 T4 T56 T7 Tcde@B@B@KLاO[@T6nQ%l7Jpp@@@@j j j @ 9i:i t`+e+)+\+\^+)+V+>`O+9i:id,Dp:iDi(>i#o#oH>i,>iT>id>ih>iX>i$?i?i?iP>p.`..T>(...\>8H|.t.T.h>L.D.,. t> H.P.@.>$..H..>$..H..>$> @X.P..`. > d>...> X@-.-> \@-.0.> \@8-Ē.@-> @..d.,.>00%.D.*.>@@ ,.$.P+. >4p...t. .>4p...t. .,>$4p...t. . <>X-.-@>\-.0.H>Z. .P>Z..<<<<+/TD11d11h111d~1Ii)$2HX2W2 2IiC--2x--IilL[-o-؍---Ii33T3̓3P3|3Ii:̎23T3̓3P32L|2h2Ii<4T2Ii+3Ii,Y2Ii)t-3̓3P3-Iit-3̓3P3Ii33̓3P33?GiIi+@22@  XdXlJiDLiHLiLLiPLipJi\LiJiJi`Li@ E8(@AAA==(A*JiJi Ji(Ji0Ji4Ji8Ji%=%=%'''''''''''''''''''''''''(555l5545'''''P555|5m5m5''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''M%L% I%|I% L%I%K%'I%tu( 't(dt(s( 'hs(',s(44h4h44'p'4&''''''p'''''''''p[('2(''''' '''''x''''Đ'' ''\'d%'''''x''''''''p''&''''''p''&''''''p''''''''p''hJ!xI!(!X(!lF!;!(!p[('2(''''''x''''''''p''''''''p''pP6O6R6R6M6'p''&''''''p''dB%A%\=%(=%>%'p''&''''''p''&''''''p''''''''p''*ر*<*`**'*'(*''''''p''(55@5 5l5'p''&''''''p''&P555`5|5'p''&''''''x''''''''x''''''''p''''''''p''''''''p''''''''p'''''''''''''''''x'''''''''p''''''''''''''''''''''''''''''''''p''`%`%l%h%ha%'p''`%''''''p''''''''p''''''''p''''''''p''''''''p''''''''x''''''''p''''''''p''''''''p''''''''x''''''''p''D%D%''G%'x''''''''p''''''''p''''''''p''''''''p'''''''''''''''''p''''''''p''''''''''''86d66'6'h6'''''''''6H66'ԟ6'ș6'66''6'x''> .?l@ >G,><Q5l5j5l5?D@5l5(55 .?\H5h5585>45T5А? /HNPWT,55?86D5ĕ?66?066? 6?ll'6&6?268.6?`?oiip?piv?pi2!(pidd>(?D?T?l?|????Ԣ?D?T?l?|????v666>?? ' ` ~ ^ "' ,AAA AA'CEEEEIIIINOOOOOUUUUYaaaa aa'ceeeeiiiinooooouuuuyy"A"E"I"O"U"a"e"i"o"u"yA^A`A*A~ACE^E`EI^I`I~NO^O`O~OU^U`UYa^a`a*a~ace^e`ei^i`i~no^o`o~ou^u`uy<66H66t>ȥ?̥?Х?ԥ?إ?ܥ?l?ȫ?X?777T77p&l??J7I7J7p&&=?g7h7j7g7|i7f7f7??*7ԉ7D7č7ر?h?|???# # ?<ooDi}i$7(\*< 9P,|)x95 5M Nil  $} .0 hF%8 @5 b! 8: p=` Pm=  Gi$ xb0 -i& 05 poB ,oS ll-Xi ^4t |b={ 7t T,X 6D ̛9  `:h v. Č- m ~6 )' *(41 lo < +Q (8X t6:k _9~ 43 ) m ,w'D " `Ni  & 8l Lm@ #$69d~1-35ȭm@bAKd1<bi&0k/i|Ta=I3 (*(<  3t7(4n$LD%XF*DH8 $m!1T06&@ԟ/V&Dfh&vD5x86T6D*i&'d9<W9` I=ATo e'H*T7X6/-HԤ90U5D^V, i[&|&PyiL=:8n?&'P 6d5o'vF$Z1Dd!W*Hp'`A5,()i0t@/ 86X":T 4g0G*TR}&<],Hf+l}|7`\(s=0 5,1(&@%d;Pt9lt32 \mܞ8|1$1 H,0P6$^ ) i\4io;Q,)Dm*%4<U, 5&@ ̘ L=n#pi-XK$D ,R1bX6@w0, 't$$M=Nh% Ay3 <@@i8$i+.&<$<:,P+Z5g5@q3i7"l h39@n|mPm '<X2iC94~845D!9.g7x;6: ,LF \)XP .4] mh f* u <:@ D* ' $4%L$$D[$&b$&L n$"@$HLi$,,$)($9($T4$(l$Юm$%$m,l$F$`%m(% $"%84%!%6%o%L&(%#%$)%-D &0#!&&)&'57&h0HH&6h&ov&@U4&o& C=&8&Mi&P/o&o&i2h&6&- '|:P't8"'b4/'lN8;')$E'H<^'(s=o'E4'10't-8'<&('i',x'&8'@4'tT4'p[-(" (̅/L0( 8:(B5K(V:[(* %4M*4^*f*o*̱4t*p.*8+*t6P*"X*|5)h*Mi*'*;!*(5,+XI0t+*#+B>2+}7E+9 S+"f+Jiu+&L~+$H+|i+)8`+m+p|4+#h+| +48\+6i+% ,G;x,,",t]12,$-@,'XS,p$0m,;,dm,0,80,x )d,i,A,d9\,38,~%,.#-s"-9|.(4 .5$.H)(.w(t.\&l.8&.tm.<0.8%p.4B6.\0/&/"$/*),/9D;/7H/P4Y/|.g/`8dz/N"( /\6/,d4/z(8/1p*tK1X$hZ1X*$i1@0xx1<6d1o 1|Ji1e.1D;1:1HGi1T<71t2  2{1,2(i&2%x72T O2. _2d%l2Hf&<v2`4 2mi2}1p24d*8\4PLi4&H4tq 4l(4#4D#44P"5 7L56%5o465@.A5\?1N58@Z5-7d5$0w5)5I)5'T5A5g5`5ԩ/5~i5@5@5%5&T5d1X6$+H6ni#6:6600 H6 mR6xiY6(\7g68p# x6.,6806(+6x6i6&6d5:D666LJi7m 7 7,m4$37n7I76@W744h7\1 ~7&7x)7x$!7Z*7Y)7;t7oi7H0<7;(8'8i'8T$ <8 D8)O8T 6`8Ԫ%0p8<>;w84'@8q&0868`/ 88Ni868+!8)8&8\"9<2,9l%)+9(989 .lG9,p(,N9 1e9~,|q9t4\9<<9:$9w849XB69ui9?i9hV1l96i:X):`. :0C$,:: 8lK:7T:V4g:+o:%{:p&:6:.:k::h$@:L# :404:m)L:i;o;/!;\#\+; >;$9K; l5`Y;4J7f;,)<s;4&~;p.@;8+8;|0;2;)0;Y&x;}+X;7;U4<y,L"<)5<43iB<8\S<+Tg<)+8r<|liz<(# <;4<2<C7<U4<$<J(< <<3P<-<@<8H=B= =x)d=`m =281=$0@=x8tM=8X=DGi_=E0p=l'T}=A=)(= 84=07=8Ei=H/H=(= "<=$>/>)$>@s=<8>h6hI>$=9 W>d7c><p>4)l>+#4>\ 5>ԗ'8>4e+>)T> >o>,d>p)t>h=:\?08 ?4/'/?">?T3LL?P;5_?M=g?%.Lr?,p7h?(?̙$?|o?6?Cn?6?P=n?#l?OA'?A?T8@xa0%@p<.4-@Ј&9@u4XU@ i@7|@ +<@8%,@-i@"@H2d@(@A1$@<0@#@ha% A4mA( )A, P2AL'`;AAEA[5WAU8DfA8,|A# A.Ax7PA3P A3pA!HA niA@24Ak(AL6( B+,(Bh+\2B)d'L7 L14M ,M8Mj3.M4viCMDiPM$8ZM8 eMX%tuM,1< MxoM &;M%9HM@77M,8MDp3dM2N%4 N;,|$NH'P4N'>N,,JN~)LWN "@hNH8|Nh7TN .N+dNl&N;N["NV*HN"O,!O,S)$,ODm5Owi >Ol,pIOD"dYOg= eOhuirO3wO`Z1DO'lO&O (O %O$8dOb!\Op:OmO +LP ='P71PLm8P#tLP\9lYPB7eP03(mPx/isP#P45PY&PB:DPxu$XP$)4PX'P@i$P*Q7iQ*(*QTm(/QQ'%LQXA9x]Q@o jQPx$<wQ; QD6Q$4QX 1`Q(Q(xQ)(Qx$Q&\Q=$R*R\j(`RA,R 68R|!HLR+4fR(%lpRk/XzR<6RD5R 7RDV4B3DKV@#HUV^8aV/HnVl$V#xV$8VoVt)VR'`VԏmV%WT8 W5Wn=l0W`0PAW:TW(bW:pWp8zW̦mW`!<W2HW(iW0)%W')Wv*WAW/iW5LWv3 Xv3XX$;(X`u5l7X@n@Xb0YX78dXT4 rX|()X9 X@G'XoX(<X8Xx2tX LX&=X,O8Xd!@Y46Y`Gi1YX/x>Y4J,(QY4ni_Y|)iY<ipY%Y0g!Yp7Y|k7Y$2YL%2t Yܷ1Y\<YL&p Z(&LZ,%'Z/:h8ZI$OZ8.`Z9)X|Z&Z3iZ4Z +ZF6ZdoZ<.LZX&xZ`0Z'p[& [`),[ '[E5p6["1HJ[-xZ[8dm[H,6l[8[i[5+[@$[c0H[D{+[p'$[7l[o8[0o4\<o\K%<\8ni\))\h42\9@\oO\hb4a\T8o\#}\0!\;\+l\Ԡ& \6\\# \tm\58\(]h&&t]5#]$X9]pP7pB]/XM]03V]"3b]ȩ%n]<,3]$]Y*]%]8T]@5)<]x2']#0 ^o^|#0^D8(;^(F^#Q^*_^8i^T4{^!`^%^$^5(^_t(`H_P$U_E/tb_\w"|n_;!<v_l(9_7T_F/_p-_pq&<_`0d_#0_,k!_3l`b0`P)i `Ȯ3%` #03`\'DA`$HK`3X`=(g`hmn`%`.\``-8`$9(` >i``O+`@o`*` '`. a,P+a &axo7aT"@Ka"(|Wa8:naHao=Ha )a#a*xax% b$ b858h/b*.H;b(0Fb$b4Vb$n& ]b|w0lb|Bi(b:bċ,b(b!tb &`bP$b# b<c9 coc5'c!.c<>i ;c!&LGct<8RcH%8fc#HxcД9xc')DcF%xc|<c)c&c( c(cܤ.c) cf$d9 dtU7$&d)@/d]= 9d,DdviMdT)TdLGihdH,td<0dAd2dpmd@i$d\+pd"@d&Dd0F%8d8e6\el6(eo4e<7Fe&,Seh)ice#8we?6 e8"e*eY4eXw&XeT%@e(Ae,,xeT:7et6xeAi$f# f9D fhb,4+f/T6f,%XEf)Tf9`f)(mf#yfY<fh5f&fH Lf-pf,6$f(4f*-foifi:g+:$go/g1$t Dg`u!Pgs&,^g5hg|F$0g0ge+`gn,PgY&PgL&g$i;gxjx(HFj0@;L`j+;kjA.xjmj5'PjDM<j\7\j\'hj2Dj'tj&j2jMijx 6kt%k!*k*D6kD/ Lk`& Zk%ekl"(sk%k*Pk7k6kxo6Dk83|kdr(kmkx8kp(k<}1k5Hlp*t l\m,l86lDc4Ml$e5T\l7fl5plHs)~l(-6Plolx.+Hl)*lبil0*lDl(l4'l)DldAlE,8m(#m\U <,mtJi@m`+Sm9``m%dsm!mЄmm}imh}im+(Xm0"<mG9m,m|+m4n .in\k1no,(n.9nԮmCnI$ZnAi(pn mn/(nT%Xnl5n|'n"n.<nȼ&noin4:Lo,9o(<%o?' 4oP9.$Go&Xo ho.uo@oomooo}ioX :o`6\oJ+po5Dop1oxG(o$DoX&60plK=p0mp`)'pvmiEvXiRv8d^v@2dqv1dv)0v,N><v`%ovh(hv2#<v"dvO3dvX2#hvlc0 w(9w&`"w#5w8|Ewp xRw 9(^w4pjw*Pvwx"wU7wL|2w1wJ0w%6wt*wJ$\w,"lx xt%)xܢ*2xmCxiQx$9\hx s14xx܍"$x$mxox=0LxP4x9.x#x`7dx`0lx  yY:,yR4,yo47y`%4Hyo4Yy)4jy$,vy9ly07dy*y+Hy*iy9 ym5yV4y6yP-tz1(zĬ#Pzx 9p-zH6:zPF1CzATz\$5Yz+3nz<=.~zmzخmzLT'tz:Xz:pzi= zk;zx;{c8 {("6T{/&{1oT-{o;{@i$I{%S{$d{O$Dp{`&d~{/{8.`{d$*0{$ &L{!{&{9D{0,{9 {94|7` | . |'+|'5|]7C|( I1<f1s K>x8;08"X9\%0Ȗ%Ж(9(ۖx0AP5-70x-6"mi*1P4xi;i7<S0|c w&8l"la7 d46*0Dl$\=˗oԗ0J+D6dT,hs7t c4&l~i0Ȣ-,;#4M#b&l< {3Dd&1d0lĘ*Θ8٘Tu88*'t;$*,1i8T;\M4DiDCi(w|3<*D<(4"H7™(o͙%Tٙ(=%4"mh+,,(' 6&8`H9FLw6$S4hgt%@xT*H#H7l4,mŚ<#ٚ,,"L'!m5 4#`7<P7 *5P?P"V`&]0 f<'<r(ziX{,:D."`6$>i<.i ț<+ қX T'4i&L"41+8l1#$o/lGi$<2iDH"<X6pd0)Dm*!wm#L"tf 4P6d֜/5p~i&730hc.%|;,4>|mN0p&|Z$9(g9t|8/dB%g3pG*0m**|9̝0D4\ݝ3D4%h9 ;x/+/7,f3N`m`W%he4mmA,>64&D"'͞Ȥ/@۞e3J$4B>LQ4A*h4/C/< <G>6e8ui*&%%$;<\O,<)iɟ$Tޟ;`D T'*ALo #@b=-::X'xH(B'[8 #@i=i~,"%$t4 L/L)dȠ/H֠Xk.x,`" 'm 4*34loDx%MZ<]&mx!$(xLAi$( R!6͡?5ޡ/) 0L<$ 2i= -ش6$HoX30`ܑ)iԅ(q:4~3y0,20*tt&4o0ʢq.آ$%< AT'x[5$S  l's&%xe7L0H889)4Fd-i T *c+0y:wiG/<n)*Po  )T<(ƣ<:0ۣ6̶4>/t!/ Ȩ)T)9,6wi E3RD. cy)\nx9{s50lĴ3<@<*T+̎2 Ƥ|mѤ'tޤAA0I* (a% P8(t"8Ԩ+ V\($`)8M9^`6wT1<F0.+H8('LŦܨ;֦oQ6(,3)< 94 2X!&<'H%50O9=<9Q@)k6lQ44m )i:;*ǧHa% اt$@i$<+P i8>$((4|A;0G@5<O4@^6yv3$1< 5i\Qa,Z%@gl>iw$( &&@%XppiD524*PǬ%ܬ:D^=-'D/$|"\$t0,4(>9(Kf8T6<^`j9`i0$4Pv)@%x6+V6f*.:0ϭ s8`٭s!,Gi#*4)4 $$& 4m= A6lSIi4_A9ttHv4x*dy&9H4'oEЎ+W+4p$0;~<.+$@) Z$p,e4t)io6ʰHJiٰ<(X^" _91  4m$5LNi8`2J=+Ut6Had. r$D-,>i,#$.<@`!;,*4Ʊ5Pұx5ޱx2i0D`;2$@h=518H#pc48L 1J++|Tt}%XcPL"o28y'X.'!32i)d (,̲}%LܲD/n*}*H(  A` (48*|3H.X8=t/pKH.(Y;o4p3LLN%D(Pt63@<.Lɳ )lγl7@ֳoX40Ш%"p)6T9,o J/YZ&|b(iqp9D@6b4;|7ƴtc4۴,),&98 ) 8m=P*)0-P9',EY*TmZ(Hd\1tq66.8dW*<KL9Wț*fh"hs|(d}x1@(p0y;H#Hͺ#h׺9i0j.(h.8o83iA(#'2/9;xI;tGm)X\LmhK$\v!6',m0 hyi X.ͻ0+ *DZ<  /LXm #P"<.j(5h"KoO9[)Dfܣ&sh". ;8TD" 8 LiѼo|,X#0P:,*D)(6D.;$S<Z Xl?9w7)<.$8&@",D9;ɽ`)XԽD$h#h8 :(8&Ho>@t1XT+\jH"Tz $<5 ,o¾0>i׾++l a74.+*9'CP)O!e5t#x} XL XPy6r=lƿ0׿k#89 ,vi:7&)L2)0:!@I!W86ja;zQ5@3)Й#x8/x!Pwi|(82|#$1:x4JiFČ# OG.\4#f io'y,#$Do ,<o{8z1 8 tH8l-8 h*%'.3)0tN>  g1\"x,:;l o,2&\@123>؂0ILAZHF+e (q-}U4)s&(h+d h'86ti8#o)l#x_4h0s(:()(D,b(#4t#Dر+DH%,s(<tu(44Ki'",t2<*im*dC=7XNi>T-Kb*HYm= eX.v"((0K%`0XO1"XJ><x5I/` )- )8T4'< 0p6=8Th.ie)DsJ"8 "`)iB= 6:_8`0o)i& 0mH"'<*5T9/(A@ 1O`>ib,As 0Pm0|U;,@*$830#989 o Ci+x)&T8x)5$MmiW8(X`7qpm{ 8847-$(!@`D9LR4`2i0650 0h$To%27Xn%`II%P(oYD,<u&(~4;TA>|tG6X!))4"pD\!4/D 5P@T4 )4$,8c45Ľ3 ;i%97|o,d4m0'r-t1*D#X.!hX3:H|x5p.Ĕ!d95 7\54,!\]!p)$\C$0yi0(H67(hB(%`H`O)S#%8a(j\:}p64)4p.:,pB6t 5 2xk*p-Ci$*+4.i&'4&AmiO4;eQ&ohJi~n0Xt)8]7mi(oL(l$&& U,  ?'`6-P"<p0`NBi(e1Tt0pk/\i6t6%hMi*D4$,+l-n47` ,HM*U1det7'ox$ }9p"9  &H#0Xvi4x6D'@"# :`?:4Į X<(H 4@XM+dcl(8m3"oAnl9L.D,"51(t-x A0511=iT?7'dM_!a'j["z88703<+#m6&p?'$oDu2g)8"q&L+7D846LAW8(b6Hz7 7lH0L!&6LW$4b;*0 .i0R x)83B2=x6!Gh:ZP3Db,ok`.xؓ)4(H ,H1#|HV4h84-*dLi@t0(0 :'xD%,41i4?:#N,"<^AHbl5,pxiyT8o,3 , 6@o+m9666i(I>\1t&(:0JmV*ib$&8t$0viH586<"!LxM;`/iL8iTXm`Q:r+($ (! $H2i $3d@54 (d/*8x!p6,n)X7$`J7TR/c%4qh<%$&<mE%8 6`*l,*im<(0+P 4x&=!̸3'm62C-LQ@*^&tl$Ly*t6PYA 0.xi 5(2To#|1:o t(%!.:45t.iC0\9M("[؈9Dh8'Ts*|L'L\#(8"lл!dи9D\e'6P`7,6(#i/4Gi@#U6\gH)t 7pLY'l'V5,M Lb4$p)X(  !p !/8|E7Ho2T70=%OXmK<AR7`].$l,w@v)C,d&0ATl9`j7+0*mx:pm@t.ح"(,<8\Ga4]8liizԶ$$'@b4 9X984N4m*p'q=`p*\(:5D/2|(4?+VԲ _)j$'~4)04R4pg&ph%R64Pm ;&zi|-4o',m-m= 96pDm)<Z+Df`:ivA:T6X'!492*lh)00mT6 8oW:h0$]8;dg.Kt8)Z\&b<1do)x|84x,Xx'<T43 &|r70#P78`57&6+z-8*lE<",^45Ho$ yhJ!:$6\Bi(|+<m:3T5p8 ) 8+6p4dr4XET#&dSL2cb0t1-~)+0C+|9i;!  . $$r.H.\R47,3,+H2L: AFiQC3Pb1|mT6t~dR8dA/ IPoYP+u(dk4<),؝;P`8`p+D>.&L[9pO6o@)tN9T$&026',=1R(Fib|i7dpdmxM&p 0<hx4&8@5b0H dAC=:XU 1ie4ois65HpB5x4ܱ%P($li#Pm`0l;J#8T7b7$oB90i#t*l3d$ m7x&`3DT5,h= 8P6$|.&X#`$8,+8 '\9T  %88   H. )< h=  \C1 .  8m 6| d( p'0 `ni$ :1 D/H 'S D$0j C>t 88 <3 q. (p  L$:tR (A90f ,o + !84 `"!t   h1 Ȟ4 d: 6` 8,H ui U4 m8$ 1(5 `.A (iK v",\ 07|p  q)v T%$ Ȭ:| 8 .  /+ 8$ (5  P. L&= W! l4:&P8`2z(88i$$C3W<0 b<:\sԭ4'@'ml)lc!,##~0%Xo"/i/4?K00L/\V)al&lj8l}X1$&@oD1$3&X U41A85 d'H> 1x/<>t3'Ldt(Vp4i..Dtd-$p8 `26H5<86|4L8(Dmd498/ 8L=(o $ȝ"+_870LK8d$``6tx c+8*(8^# (80N>t9Xh/)486&(,l"?T6tD"Vh!<f90siث7@ G9.$4(H+$'\=4JiN& [d4rU2}0 })xDoh1X`>6x( x0D'' \=%4&d!5,*30'?#HPp4a5|j5tL0#hHo0)k9T}iL68q&80<<  &8"$67.0Dl(#<W!mp+D~Dm !c3\e40614it!p "h6t1|9`4Lh"TPT48t7 [$ =7,D,9_<4H%O7`_m5g.(tx!/:280XK=oȑm$840'tR+L5^6tK A2Xo_1<o7}4,جm؋'A%t*Dm.2 )X8(M= V4( d;pJi'8B/7h6J&$[,0\p% udwi}9(:.T4t *l.:( i4@<* @ t(D1(ȱ,5X+4IxD5HV\D0de@I> z$/D 3 0&` %8\+)4ui8Q42  $8l+/5|&@9T$A^ofЬ"Tu 9lD80=8TH{/<Li8.6oP-+DH.\8 8*#P6$51C/[mj@&8y!T5D)D"H/h:iPm6hD0h)4%t1";H=P0PT(xa|J%8hJ$ltd:'Lȕm\(xX(;LP'\wiXq( Li =:|e< $)| 5" &P2 4 5; DviE %4S DNin ;'w 4+6l # |!t p9 ( _7x TN h K>!vi!D/1!`,"0>5I"T2]"6m"*<"Z("&"@#t"@:!"(1p"L:)0"07">%"#":#-#"(# X1>#D'H#8S#0U4f#7|z#-#P5#+#3#L#8 #7#TNi#(#9X$&=@$u$#$\7d6$'B$18U$,6ti$'u$)$6X$Ei$xI!$oi$49$ &$P $H8`$($6 %%30E%)R%I7X_%$j$o%h+X%Lk-l% 3 %90% 2%tm%D~i%wi%1%&4%g=  &*h&d?/&&$ 7&86 C&6S&1$g&0ou&'&xi&e= &8(&2 &@&x&0P&%'&88x&6T&o& M+'0<'q6%'Du9t:'H+-H' mO'>(,V'+<i'H)~'K"',o'('4A'+#'XS:'Ĵ40'/4'9' ,(Lo"(b46(3 :($4O(#f($2do(F'x(m(\::(@8(_7\(`<((To(P "(l6(0)t9.\)P7\')-'d8)4?iC)(L)H18]) /ln)@6T~)@&1)(@)D;t)-+@)Tm)\m) H8<),l)l)#8*PA */,*& $*)4/*,5>*,)4F*L9W*24b*p24q*0+d*~i*<*5*خ3*m*)(*pi*92p*!&$* 6<*t:*5*ر2X +x'+u+++5d<+(5M+e$ _+-!Lt+n4+$)D+6T+1`+i,08X,~(,l18,|E/4,,8,d-,,# X-83i-7T'-2p4-|B1@-f88N-Ag- Z!$z-j5(-i'l-6- 5D-2-i-X,|-h8d-7@-)<-PQ!.l+.ص7p%.(@96.T4H. * S.m\.T9Pj.9 x.Pe=x.$(."d.W6(.d ".'<.d6.m.h4/:/-/H4(/|?,|B/(!I/ )U/h&0d/$r/|6T/tc4/1(/u0d/.i /.</ 5/Hm/\d!T0H4.0D%D&0p,00tq9B0oa06)k0-Hs0;||0@60d%o0u4\0<40j&\04 0,0HX2l1<110D$14o11\!H1,Ni d1(r*r1g&1,#1 +<1|97H1831%1tT5$1lm1 !P1l5 2$,32*!"2t9d,2D%42X"J29 X2=dd250m2T$2529521L2(+L285(24,2DB927 3pU43m"3(1$H,3:,63T:iC3l6\^35Hm3,xw3p &|3!349#p>3H$>H2,>"l:>@mF>p( pd>i1xw>#:>\/>؍->4" >!$>|z9>\+>->'>+?(5 ?T0'? 2;/?F%T:?4F?(1PV?P$8q?w3?/0?h;t?d'?\&0?m ?%?le4? )L?7?w6, @Y2 @,#,@L4:@ToJ@t2iZ@$/i@xwiq@ ,@@(%t@1@@i-8@7(@@(o@'o@ :T@ t9@D7: Ab4A1`,A )<6AL%>Ao=0RA|(D_Ay8lpAJiTAl"A6(AH5Ad%%A I)@A'Axi Ap)ATz,A6BpBnB#L,B=#lAB`;|VB#0mB8{B 8BD7B.HB@g$B(wiBP5B.Ba DBZ#Cl:iC& "CT"5CA=CLmECXiLC$8 WC,c4kC|8 }CB1hCd6Cd71Cx 7C3@CiJ=iJ|,J Kxy9K2 K<+Km2Km9K8MK6 ^K{1@nK8$zK*K )0(Kmi8Kp&HKl;%K%Kd3K=iK,(Kx+LP&=Lv,<"L)o5L+HL7+PLD1]L0#lL`<La%L0hLL!$LM=L3iL8)iL8~(L%LAM<*#M&t-M4q:LBM)PTMH&LbM&qM8#M@$"M +MTN%M@c;DMoM0Mй1MiiPq)oPP.i}P%\PPo=<P+P)"P8\P(<P5$PMiP\A QZ:Q$x5$Qd44Q1DQ\$NQ`4\Q ,rQf.PQ-Qh(Q1 Ql,QR5QoQe7 Qc4QE,RXo9 R8`-Rm6RPh.HRDQ4]RpAi$oRк(wRe$TRf5Rj40R&R(R)R&R3@Rh= Rp+R %0S#0(SLKi5S3 BST4TSL5bS(qS I%pxS@:dSPpiS4<6S)xSP1SmSDm7dSoS8>iSoT8m$T*(8'T : ?T&KT%XTT.ihT ;hvTx8TT1TD)i Ts:|T؜9(T6,Tf$xTAT oU,UiZ%ZhT4Z4[@&8[*'@.[\C%7[بi>[<<Q[p8T\[P.p[2({[\6[([z%$["`[ĩ&t[0,[X&[6[)[0.\<&l\Ȭm.\'x>\̎'M\o0\\<4i\'q\`@'`~\.\ 9<\A5x\,18\M4\\m\Pm\4!\L0],m]o(]X1,]X"=]50J]ܬmZ]L!f]\58v]0]&<]0 ]8$]o],:]?i]H\+]l(T]87^1x^ =%^ni$^\6X2^D$V^'_^y($j^:^<a}i'aT}i0a`<Ja|',Sao\a&ga8-Xraic)(*c $%8coEcLoRc\Ji_cS>4jc9Twc9Pch_:ctc4cXk5lc0 c/Lcmce4c 2#d$(8dD$0(d(95l8d)e<6e`hmh7h'i=& i:`in:@0i$ &8iw&d?i(w"Ri!$gi*5$qi "i *Pi&i '4iP!ip'<i#i04$id>ij4m j(!Dj\p1"j|"$9j\/Lj܆. Xj8%hj 2tj'j,j R&j"Dj0&j&@jvijj&8jP6j8(Dj#j0k* !k),k60x^na4iñ30{n("nЏ8<n)4xn-\nAn,+nn.n(1<n8n6dn)< o h5oD%2o2@o*)LooH',o$`ph/lpt,4&p:7ppo@p1tIp,Spr)d\p+4spxApp+<p@: pp8 pZ+pAp*(p09q\,tq $ qP48.qi8q 4#Eq8Rq48&(cq'xtq5lI0,V+Dbi&@m6`wܟ/u#%\~)x*ƃ #ۃ$780$o0| $$ / e; d0<(8*1 AР.QTb \&X>(l(6Lzx)(0!\^7t,lD,(/i@Ȅ,m*,؄Կ) h2'$o(O'|j;/lvi@6(c&m$\y0D@F9x1',"&(mPY"ʅ|+('0*N3hh2#h1<3|H+VЏm_P!l, y$AwiW1X|h1hp2,Ћm,'Pʆ<~4߆i/t,ix8q& 1 &-|$DXCnH0'Xh+gk*Pxi@,'dK;He9H#!tЇp+`\*@)lY#0 nip]1 "26T:0,F%(Ow6\]0%8h 0Txm h'`34h0'[<4yi $Ljoֈ(i:410X.!h* yi41QCi(h<@iwh&\D3i@p>i48)FA Tyi0Q,|ۉl8$#|"lJi/P@i$=(Lj%[q=`rd$}`$8Fi$1\Q4- Ċ3ϊpS4H;xh9 m$"#(6-\H,SX**4\AiB>v +@5&AR=(Ai$͋}(TՋ"&"L6<DN:$1t#U889(CPoMdQ4\3tg$9+th)`$ \t6lt'%9ˌls8Ԍ,(*x)@4LL&D!H$6-EiWl,Tm02{6ip;%$)#č0ԍ iݍLm3:L,\8'; 1@.:0E`)@N )TXy"jormizX~i>7' l2`0ɎNiюx #܎ Lt)D"08ܝ,x!\13(8H@&KH<_iJ,:1Tx8`tE7dpxo4>iA 2:H$ɑ AӑD&3ޑy,l<:il75P8"iH)p0˔`.iؔ4i(A yi x/p45$Mi<mGDJiT0ej:8{ 60(5DP4,3$ɕ &.ԕ4' `=-xG5-p%Q,Y+\bP'@jTLivؗ+8H,x4 -0 h`3 țԼ7L؛f6l9X6\34-)Q8;P'XMHn=$f4,o\[)Tz TH9TNir2d2i˜4l&ԜS384~(@?'8J$HQ/`!A(/1\>̄mS L%[H!h8/0rf&~X\$\L"'T5p\(|īmȝ'xНP"  +X3 %p mt* 0p!t-l8>}5PTs&0_m(o<9. (@$(`3d&:ɞ:4՞G"@|44 0/70Q+!4*1TJiET(xN8&5]x|,\ij*wo@;,892%D#l՟Ā9(o8D4&}& +9.T*0 > *I`'YL9hg6|opiX6L ((1D,\Šdm Π9<ܠx7p6m9 .*H99j,E(<O#^''`h x+( '$x6hG/H7:ɡt.աĄiܡe' #"$p%HX(,"/p.(&$=< Il;De(58r@4|c$@! 54#@Ģ@Niߢ'4&`" 1l%h*b=2B> G.f@Jiy$P$08P''l)$ã"գT4D80|%x#,S7$" 4$/>hN> Ul(a܅,,r$&txPW)u(D9h6D,m&36¤@5ҤФ)ݤ dA.01 'XpK$&T#4`50Ah4)l\As0i } &8d8ph`75(¥x/ϥ`!h|S8dR7S4v("\qi.\M8<l1J\o<V (a.tli|U2,k4p$1$֦m%-)4X:1,_:=,}iswap_onwi_set_nwkeyucom_unlockpfslowtimonanouptimebuf_rb_bufs_RB_REMOVErandomreadehci_device_ctrl_closeem_set_mac_typeaxe_tickre_disable_hw_imlongjmpwi_usb_rx_list_initproc_freesr_crypto_discipline_initvfs_allocate_syncvnodetc_setclockuhci_pci_attacharpresolvechrtoblktblsw_reg_strategysys_minheritieee80211_tree_RB_NFINDputcharural_update_promiscuvmfault_unlockmapschild_returnsmsc_cartlabel_unrefHMAC_SHA1_Updatesmsc_startuvm_map_inituvscom_attachipsec_soft_first_usenkmempagesuhci_device_isoc_donecopyinstraue_miibus_readregsys_getgidieee80211_tkip_micdofilewritevwi_inquire_usbuftdi_matchdumpmagieee80211_derive_ptkttyflushsys_setsockoptsys_ppollcomdefaultrateclock_gettimeieee80211_watchdogdefrouter_lookupinetswbwi_rate2modtypewi_get_fid_usbcdce_rxeofip_reassrt_maskedcopyin6addr_anyVOP_ACCESSusbd_get_quirksem_k1_gig_workaround_hvip6_get_prevhdrscheduler_startpciide_triones_productspmap_alias_bitsuvm_maxkaddrehci_pci_cansphy_cdumass_io_putral_pci_detachicsphy_resetieee80211_getmgmtrlphyattachipmforwardingmainbusprintohci_waitintrumsm_attachfilt_msdosfswritesys_closeusbd_do_request_flagsbwi_mac_attachrt2560_set_rxantennartflushclone1sys_pipe2ffs_inode_allocdes_encrypt2sys_setsidbwi_rf_calc_nrssi_slope_11gieee80211_encap__ashldi3artisea_chip_mapvn_statunp_detachsiop_scriptnd6_nud_hintether_ip6multicast_minumodem_breaktcp_secretrti_find__mainbwi_rf_lo_writeaue_stopufs_quota_deletehardclocksd_vpd_thinenc_xform_aes_ctrsr_raid5_discipline_initsr_rebuild_threadrt2560_wakeup_expirewi_read_data_iowdc_reset_channelrt2661_get_rssiumodem_set_comm_featurein6_domifdetachieee80211_get_authsiop_pci_attachmtx_enter_trysmsc_sethwcsumwskbd_cndetachcd9660_vgetpcaled_caieee80211_inputcrypto_dispatchsr_discipline_shutdowngeneric_armv4_bs_wm_2if_group_routechangesys_fstatatnd6_timer_workohci_device_intr_closebrgphy_disable_early_dacurl_csr_read_2dest6_inputgsignalacphy_cart2560_suspendehci_pci_matchipport_firstautobwi_mac_set_tpctl_11bgmii_mediachgwi_txeofaue_devsipsendredirectsbpf_setifem_encapunp_internalizetk_rawcc__wdstartscsi_xs_sync_doneaxen_initfc_lfcemptyvfs_export_lookuprt2860_set_ledsrt2661_wakeupifnetif_cloners_countyieldohci_endpdm_freemwsmuxattachuhid_seltrue_filtopsfilt_seltruesc_print_addrlogcomspeedsmsc_tick_taskvn_writechkin_ifscrubral_pci_caarmv4_tlb_flushIuvm_pmr_freepageqpdevnames_sizemichael_updateumsm_umass_changemodescsi_mode_select_bigroute_dstsingle_thread_clearinit_execsr_schedule_wuuvm_pmr_size_RB_NEXTuvm_addr_alignieee80211_send_4way_msg4wskbd_cdnamecache_rb_cache_RB_FINDbcmpgeneric_bs_r_1ieee80211_node_detachnd6_dad_startexec_maxhdrszuhci_device_ctrl_doneSHA512Initieee80211_ifattachmmmmapieee80211_clean_nodesbwi_memobj_write_2setjmpsd_read_cap_16prefetch_abort_handler_addresswdc_disable_intraes_ctr_reinitbio_inforicohrtc_clock_readrt2560_get_rfpdc203xx_dma_finishpci_subclass_communicationsurlphy_funcsuvm_deviceopsuvm_addr_align_backlogread_filtopsre_ifmedia_stsvndxfer_poolcpu_info_primarytcp6_mtudisc_callbackcopyoutstratu_caaxen_tick_taskieee80211_countrycode2regdomainusb_transfer_completelxtphy_servicepciide_unmapregs_compatswcr_newsessiontcp_attachla_hold_totalwskbd_cngetcbuf_dirtysoo_writesystempageieee80211_align_mbufm_zeropdc20262_dma_startural_alloc_tx_listnd6_llinfo_timervn_fsizechkunp_gcingreaddoslabelbwi_rf_init_hw_nrssi_tablebdevswcalctsruumodem_matchbaddynamicportsohci_root_ctrl_closeural_ack_rateuvm_mk_pclusterbswap16domainnameehci_endpduvm_pmr_addr_RB_REMOVElockinitttywrite_filtopswi_usb_devsnd6_ns_outputbpfkqfiltersorwakeupre_ifmedia_updinflateCopyttyunblocksr_meta_opt_loadbiocloseremovedeudav_miibus_statchgigmp_timers_are_runninguvm_deallocatefilt_procattachufs_quota_free_inode2filt_procdetachsys___thrwakeup__divdi3pciaddr_resource_reserve_disabledi80321_io_bs_allocallowpowerdownsys_clock_settimesiop_led_offural_txeofwdc_floating_busuvisor_calocnameshidkbd_bell_fndisk_busyhidkbd_belltcp_pulloutofbandsqphy_statussddetacharprequesttfork_child_returnsiginituipaq_cdaxen_capci_mapreg_mapsr_wu_enqueue_ccbuhci_device_isoc_abortpool_set_constraintsusb_task_thread_procip_sysctluhidev_closemsdosfs_vptofhscsi_mode_sense_bigusbd_clear_endpoint_stallsetdisklabelbio_registerdeflateknote_removesii3112_drv_probepmap_bootstrap_pv_page_allocbufq_nscan_createsr_hotspare_rebuilduvm_mapent_addr_insertext4_ext_in_cacheroutedomainhid_locateicmp6_errorVOP_MKDIRpool_large_freeip_protoxsys_settimeofdayi80321_sdram_boundssdstrategyaddlogehci_sync_hcuvm_page_physgetrt2560_bbp_readmsdosfs_synccheckdisklabelscsi_mode_senseip_savecontrolstackgap_randomvm_map_unlock_lnffs_clrblockusbd_set_hub_featurepdc202xx_chip_mapuvm_addr_linsearchbpf_filterchgproccntip_drainieee80211_tree_RB_PREVumass_init_shuttlesoqremquepci_class__adddi3uvm_map_inheritsys_getthridcd9660_syncem_enable_hw_vlansbrgphy_reset_bnxin6_ifawithscopebuf_page_offsetumodem_set_line_stateuvm_pmemrange_addr_cmpkm_freeusbd_is_dyingsync_printvnopsem_lv_phy_workarounds_ich8lanieee80211_rssadapt_inputsys_lchownmsdosfs_removecd9660_readem_attach_miibusieee80211_regdomain_compare_rnfilt_timerdetachwi_get_idzeroin_addrbmtphy_cdehci_device_bulk_closewdc_set_driveuvm_map_protectusbd_get_xfer_statusuvm_map_setup_mdre_encapprintfehci_alloc_sqtd_chaincdce_devsrandomwriteuhci_device_intr_methodsprelist_updatehmac_ipad_buffercrypto_drivers_numsmsc_miibus_readregip6_protoxsys_recvfromswcr_freesessionttrstrtwskbd_mux_openrandombwi_txeof_statusif_getkcopysiop_modechangeext2fs_initext4_ext_put_cachertfreesingle_thread_checkre_pci_detachrt2661_node_freecuio_getptrcd9660_linkhostnamelenupl_cdusb_needs_reattachdeflateTuneusbd_get_hub_ss_descriptoruaddr_hint_selectem_flowstatusxscale_cache_purgeID_rngttyopenuplcom_rtsraw_ctlinputwi_usb_ctl_unlockbwi_rxeof32nd6_ioctlsched_chooseprocphyslockspec_setattraxe_miibus_statchgpte_l1_s_protousbd_get_stringfill_prlistipsec_exp_allocationsHMAC_SHA256_Finalbpfcloseusbd_probe_and_attachdirtyqueuesys_writevsys_setpriorityumodem_set_line_codingm_tag_prependE_abs_script_sched_slot0_Usedaxe_cmdurl_unlock_miiumass_detachusbd_free_iface_dataip_defttlif_inputwi_usb_attachurl_rx_list_initdopipeusb_schedsoftintrarpintrkqueue_registerpciaddr_resource_managein_delmultirt3090_rf_setupdisk_lookupuhci_device_intr_abortuid_findnd6_rtrequestuplcom_cduvm_km_suballocusb_delay_msucomparamif_getgroupattribsbpfdetachsys_closefromumodem_closeehci_devdttydefcharssigexitscsi_link_openhidirtypagesrt2560_reset_tx_ringin6mask128rt3090_rf_wakeupbus_space_read_raw_multi_4uvm_amap_poolin_pcballocVOP_LOOKUPsr_raid5_regeneratesr_meta_readbrgphy_loopphysical_startbs_notimpl_bs_c_8ifa_delenqueue_randomnessexphyattachusbd_set_idleserverworks_pci_intrieee80211_find_node_for_beaconemul_nativeaxe_txeofwskbd_inputre_miibus_statchgobio_matchacphy_cdbwi_memobj_write_4bwi_phy_config_agcwsmux_attach_sccpu_do_powersavebwi_free_rx_ring32aue_rx_list_initi80321_bs_vaddruvm_km_pagesufs_quota_alloc_inode2ieee80211_name2countrycodemicrouptimesr_validate_ioaes_xts_decryptsocket_poolsr_raid_recreate_wupgrphashsys_setpgidpciide_jmb_caprofhzAES_GMAC_Updatesr_meta_init_completeohci_setaddrntp_update_secondcache_enteri80321intc_attachedexec_elf32_makecmdsusb_rem_wait_taskext2fs_bufatoffsys_setlogininitarmamap_listip6_maxifprefixesthecustcp_do_rfc3390ieee80211_req2nodesys_setresuidsvwsata_dmactl_readrn_deletesd_get_parmsiskmemdevstat_rush_requestsrt3090_filter_calibwi_watchdogatu_start_scanipsec_def_compfc_lmdistancench_poolphtree_RB_REMOVEsomaxconnural_readugl_initscsi_xs_get_doneatu_external_firmwareuslhcom_openipsec_exp_timeoutip_directedbcasti80321_pci_decompose_tag_bus_dmamap_loaduvm_pmr_pg_to_memtypeuihashtblieee80211_node_getrssitaskq_systicks_per_secondsd_buf_doneieee80211_get_rtsamap_initffs_flushfilesubsa_baudrateiq80321_pci_intr_establishicmp_sysctlsys_lseekdes3_decryptllinfo_arpmsdosfs_pollpci_lookup_quirkdatamsdosfs_accessaddupc_intrdvd_read_bcaamphy_servicevm_map_lock_read_lnwsevent_finiip6statuplcom_set_line_statewsmux_set_layoutuvm_pageboot_allocconfig_pendingmii_phy_updatesys___thrsleepi80321_i2c_matchsys_accept4bwi_mac_dummy_xmitether_crc32_lepiix3_4_setup_channeluvscom_set_crtsctsaue_csr_write_1ugenread_isoc_filtopsipipstatsecureleveluftdi_caurl_matcharpt_keepsavectxpte_l2_l_cache_mode_ptbinuptimedogetrusagesys_seteuiduao_shrink_hashugl_rx_list_initwskbdpolluvm_map_checkprotmax_protohdratu_tx_list_initdes_is_weak_keyohci_pci_matchural_rf_writeuslhcom_set_configieee80211_add_qos_capabilityieee80211_cipher_keylenumass_scsi_attachsr_raid1_discipline_initrandomkqfilterbufpagesuipaq_attachusbrev_strpciaddr_resource_allocateiic_execsleep_setup_signalrlphy_cdpool_countprocess_newsys_keventcopyargsarc4_reinitsr_chunk_in_useuhci_device_bulk_methodsrt2560_attachwd_standbymi_switchcd9660_statfssr_scsi_wu_puttsleepkern_sysctlbwi_dma_mbuf_creatend6_delayin_pcbinitsys_fchmodatsqphymatchbs_notimpl_bs_rm_4nmbclust_updatehw_prodfdremoveigmp_fasttimoehci_device_ctrl_startuserconf_cmdbufwi_get_pmumass_bbb_stateohci_device_ctrl_abortsvwsata_dmacmd_readrt2560_updateslotpiix_setup_idetim_timingsubsa_stopbitscdce_startrt2661_reset_rx_ringusbd_port_disown_to_1_1uvm_map_entry_poolcrgetuhci_activateunp_bindtcp_delackuhci_device_isoc_closecsignalreaddisklabelvm_map_unbusy_lnusbd_clear_endpoint_stall_asyncvirtual_availbs_notimpl_bs_rr_2tcpstatuslhcom_cauvscom_readstatdma_constraintuvm_anon_pooli80321_softcicmp6_mtudisc_timeoutfillmapentrytcp_timer_persistsata_chip_mapugl_intrcpufunc_ifarudav_newbufsys_umaskuhci_pci_attach_deferredpci_subclass_i2o_tr_flush_blockpow2dividesyn_cache_reaperfilt_fileattachsysentieee80211_find_rxnodecpuset_addpmap_alloc_specialsbs_notimpl_bs_r_8tcp_setpersistrt2860_drain_stats_fifoufs_ihashlookupubsa_intrscsi_inquire_vpdsii3114_mapchanicmp_rediracceptmemmoveugen_set_interfaceusbd_get_hub_statusural_attachip_outputbwi_bbp_attachbpf_mtapnkmempages_maxfindblknamekue_rx_list_initpool_inituvn_referencebwi_pci_detachuvm_pmr_addr_RB_PREVrt_sendaddrmsgbpfreadbio_errorpool_putm_copym2sr_raid5_addiobuf_alloc_pagessysctl_structbufqs_stopuhci_poll_hubaxe_ifmedia_stssysctl_rdstringuvn_attachlasttimesr_wu_putehci_freexsysctl_disklockcnkqfilterrt2860_alloc_tx_poolbs_notimpl_bs_r_2ufs_pollsr_raid5_writepmap_map_sectionmsdosfs_readlinkpmap_devmap_bootstrapdes1_encryptieee80211_decryptusbd_get_device_statusbwi_rf_init_sw_nrssi_tablenchinitexec_mapsnprintfcomcngetciicbus_printext2fs_readlinkether_ioctlrdcide_udmatimumass_bbb_transfertqphy_servicebwi_free_txstats32ip6_forwardingsys_dup3sr_shutdownural_cdkue_resetarp_allocated_bus_dmamap_load_mbufbwi_plcp_headerwdc_print_capswi_watchdog_usbifindex2ifnetcd9660_ioctlem_initin_pcbnotifyalluvm_pglistallocsyn_cache_addpool_large_free_niohci_device_ctrl_transferem_k1_workaround_lpt_lpbuf_kva_enduvm_map_splitentryvm_map_lock_lnincoreurlphy_cdhzdcphy_mii_phy_autodefrouter_resetcd9660_ihashinsbwi_dma_allocrt2860_newassocrt2560_bbp_initsiop_script_writesched_exitcheckaliasttyretypestartuphook_listrt2860_detachre_tx_list_initpte_l1_s_cache_modeuvm_pmr_remove_addruaddr_pivot_poolkue_detachrt_timer_queue_changepool_p_alloclf_initwi_ioctl_usbcpu_attachuslhcom_get_versionbwi_set_addr_filterwdc_preata_drivemii_phy_matchrt2560_eeprom_readural_amrr_timeoutzlibVersionsdclosevop_generic_kqfilterpffasttimoinitsiginfosys_getuidcomconsunitcpuidsexec_setup_stackobio_bs_vaddruao_createsensor_detachbwi_led_blink_endbuf_mapbrgphy_adc_bugaue_lock_miiidentify_arm_cpuffs_realloccguplcom_set_crtsctsrt2860_initwskbd_load_keymapxscale_cache_cleanD_rngm_clpoolcd9660_bufatoffugenintrgroupmemberuvmspace_initrt2661_ioctlscsi_plug_detachether_sprintfatu_calculate_paddingmsdosfs_unlockselwaitpmap_init_l1icmp6_mtudisc_callbacksnd6_slowtimosys_forkbufq_implsip_setmoptionsuvscom_reset__qdivrempmap_deadproc_cache_statepiix_setup_sidetim_timingsumct_matchspec_openi80321_io_bs_vaddrpmap_vac_me_kpmapmld6_checktimerswcr_sessionsfilt_bpfreadsr_disk_attachehci_alloc_sqhuvm_fault_wireusbd_abort_pipekernelstackicmp6_mtudisc_timeout_qcrypto_initem_k1_workaround_lvpci_resumevm_nphysseguhidev_get_report_async_cbip6_randomiduvm_pseg_initproc_filtopself32_os_pt_notewdc_print_current_modesSHA512Transformfiledescopensys_vforkpmap_vac_me_usercomcnspeeduvm_pager_initcpufuncswinChkNamebwi_regwin_is_enableddvd_read_copyrightieee80211_recv_4way_msg1bio_delegate_ioctlrt3090_set_rx_antennauvm_pmr_addr_RB_MINMAXem_read_pcie_cap_regbwi_rf_clear_stateem_setup_receive_structuresuvm_uarea_freesys_mkdiraxen_watchdoguao_reference_lockedcom_resumepmap_devmap_tableufs_fhtovpcrypto_donewskbd_translatedumppcbbwi_rf_set_nrssi_ofs_11grttrashtargetpagesohci_root_ctrl_abortmblowatgetnewvnodert2661_amrr_node_free_allufs_inactivepciide_natsemi_productskue_load_fwnd6_mmaxtriessingle_thread_waitsiop_intrsys_socketuhci_detachuhci_abort_xferbwi_mac_fw_loadugenopenusbd_request_async_cbi80321intc_imaskffs_cgreaduvm_mmapanonwi_init_usbugenioctlvm_map_lock_try_lnspec_close_clonevop_generic_bwritenanotimere_cdscsi_detachufsspec_writelxtphy_casd_read_cap_10iso_disklabelspooffdfreeuvn_detachieee80211_ccmp_set_keyfintek_capci_set_powerstateuvm_km_valloc_trytty_countugl_cdhidkbd_detachbwi_phy_init_11gdeflate_globaluftdi_detachraw_disconnectmsdosfswrite_filtopssensor_task_registersis_south_matchusb_attach_roothubip6_neighborgcthreshbufkvmKERNEL_BASE_virtremove_coproc_handlerumass_polled_transferucom_to_tiocmdeflateSetHeaderuvm_pmr_extract_rangesensor_attachbrelvpre_intrmsdosfs_mountfsvfs_relookupem_oem_bits_config_pchlanpcibr_flagsuvm_map_addr_augment_getem_82547_update_fifo_headsys_utracencpusfoundehci_root_intr_startwi_stopsync_fsyncsetstatclockratecd9660_strategyem_iffuserconf_parserrw_inittiocm_to_ucomext2fs_allocpmap_cachevivtwskbd_deliver_eventcom_fifo_probebread_cluster_callbackfdcopy_bwi_txeofin6_proto_cksum_outbuf_acquire_nomapatu_send_mibAES_GMAC_Finalb_to_quvm_pmr_size_RB_INSERTin_len2maskbus_space_read_raw_multi_2uhci_pci_matchcmd0643_9_chip_mapugl_startobio_bs_allocusb_blk_freelistudp_sendspaceuvm_objtree_RB_PREVifg_headvfs_rootmountallocSHA1Updateehci_device_isoc_transfercue_tx_list_initaxen_iffbs_notimpl_bs_sr_2netintrcd9660_openrw_initi80321_bs_mmapAES_GMAC_Reinitixp_setup_channelsr_uuid_generateohci_root_ctrl_startvm_map_busy_lnbuf_rb_bufs_RB_FINDbrgphy_cd_bss_end__ext2fs_blkprefbwi_encapwi_alloc_nicmem_ioicsphyattachscsi_activateuhidkqfilterVOP_ISLOCKEDsys_kqueueAES_GMAC_Initieee80211_tree_RB_REMOVE_COLORuao_referencein6_addrscopebuf_getsys___threxitieee80211_ifdetachuvisor_attachbs_notimpl_bs_wm_4in_remove_prefixvfs_getcwd_scandirmaxlockdepthwi_usb_tx_unlockieee80211_free_noderaw_usrreqnblkdevuhci_find_prev_qhpciide_detachinitiduhidev_detachbs_notimpl_bs_wm_2sr_crypto_hotplugttyinputscancbwi_pci_conf_writeumsm_matchukbd_consopsbiodonedehashkeyicmp6_rip6_inputehci_free_sqtdwi_usb_txfrmsmsc_encapmaxslpext2fs_makeinodepool_requestehci_device_intr_methodssys_chflagsatcue_startaue_csr_read_2ufsread_filtopsufs_symlinkm_dup_pkthdrbwi_bitswap4sr_crypto_assembleufs_mkdirvfs_getcwd_getcachepci_subclass_satcomusbd_get_no_altsural_newassocaxen_attach_length_codenamecache_rb_cache_RB_PREVbwi_mac_fw_free__anddi3phtree_RB_REMOVE_COLORrt_missmsgVOP_BMAPre_txeofignore_addrsip_dooptionsvn_locksvwsata_lba48_write_regcue_tick_tasktimeout_add_tsbwi_phy_attachrip6_ctlinputscsi_link_shutdowncdce_caSHA384Initumass_cbi_adscsbdropsr_meta_native_attachmsgbufphysusbd_desc_iter_nexttcp_debugusbd_transferinpcb_poolohci_pollohci_hubdnextralocsmsc_miibus_writereguvm_addr_fitspaceblf_keysys_setegidbus_space_write_raw_multi_4wdc_wait_for_statusucom_status_changern_matchcd9660_symlinkautoconf_verbosebwi_memobj_read_4in6_setpeeraddrunp_externalizesys_munlockalluvm_faultuhci_waitintrrandomioctlsoftraid_disk_attachsoreceivesiop_iwrpool_getuextralocscsibus_printlinkudav_csr_read1ieee80211_eapol_key_inputohci_root_intr_startffs_dirprefucom_shutdownrip6_outputinflatert2661_setup_tx_descscsibus_cdin6_get_rand_ifidndflushcompose_tab_cmpieee80211_parse_wmm_paramsrn_insertspec_pollbpf_wakeupfilt_kqdetachif_rxr_getaue_unlock_miiwsmux_getmuxipsec_exp_bytesconfig_defersys_faccessatgf_mulbwi_mac_setup_tpctlem_check_for_link_bus_dmamem_allocm_tag_initbsearchif_attachsr_crypto_free_resourcesugl_capciaddr_ioaddrsys_setrtablesr_raid_read_capuvm_map_addr_RB_REMOVE_COLORnameibwi_disable_intrsem_read_pci_cfgbs_notimpl_bs_sr_4uvm_map_setup_entriesext2fs_readdirip6_ctloutputdead_pollpte_l2_l_coherenttqphy_funcswihap_initversionbwi_mac_opmode_init_bus_dmamap_syncuvm_pmr_remove_sizelzs_dummybuf_needvakqueue_initieee80211_wep_delete_keyrt2661_read_eepromuplcom_set_line_codingaxe_rx_list_initata_dmaerrieee80211_bip_set_keybwi_mac_set_retry_limuvm_pagezeroin6_setsockaddrigmp_leavegroupcom_common_getcaxen_cmdiic_probe_sensorre_pci_cabs_notimpl_bs_rr_8mountlistuserconf_histbufsys_getdentscomsoftwihap_mgmt_inputpdc203xx_read_regudav_initconfig_deactivateVOP_REVOKESHA256Finalclallocbiowaitbwi_led_blink_nextpdc268_config_readpci_subclass_inputprobe_addrs_sensorfilt_ufsreadrt2560_rx_intrunixswuvm_objtree_RB_INSERT_COLORsccstqphy_caehci_check_intrral_pci_activatepmap_updateccpuehci_device_setintrobio_cdem_setup_linkpci_vpd_readgeneric_bs_sr_1re_pci_activateacard_chip_maphidkbd_inputprocess_zapsr_raid6_wu_donenexttickeventfdinitboothowtoarc4randomnsphy_funcstcp_delack_ticksbwi_get_rf_loupl_stoprt2860_intr_coherentttopenata_get_paramsukbd_apple_iso_mungeip6_randomid_initether_ipmulticast_minconfig_rootsearchrt2860_bbp_initrip6_sendspaceieee80211_countrycode2nameuao_dropswapin_addprefixenxiosys___getcwdcd9660_specvopsusb_cdpmap_enterrt2560_iter_funcamphy_funcsundefined_handler_addressRMD160Transformsys_setreuidSHA1Initusbd_ratecheckbwi_phy_init_11b_rev6wi_usb_open_pipesudav_tick_taskuvm_map_findspacepdc203xx_pci_intrwsevent_initcomcnattachwdc_xfer_putrt2560_set_bssidsdsizeuao_dropswap_rangesys_pwritevudav_lock_miikqueue_scanieee80211_pmksa_findnet_livelockedbwi_rf_off_11g_rev5uplcom_breakusbd_iface_claimedtcp_closeohci_free_stdsd_patternsscsi_initmsdosfs_advlockswcr_idkue_attachpdcsata_chip_mapusbd_free_xfersys_utimensatfalloclxtphy_cdatu_joinisohashkeydeadproc_mutexumsm_methodsml_initpfctlinputcomcnprobephys_mapext2fs_pathconfumass_bbb_methodssoft_intrqdeflateSetDictionaryufs_lockcomintrboot_eaddr_validsys_accessem_read_mac_addrnsphy_statusuvm_swap_iouserconf_initbwi_phy_init_11art2560_ioctlkillpg1url_tx_list_initi80321intc_attacharpproxyvputonfreelistuhci_device_ctrl_transferwdioctlext2fs_mountrootobio_printpciide_mapregs_compatumodem_methodsieee80211_findrateregyearurl_ioctlpage0setrunnableaxen_miibus_statchguvm_pmr_getpageswi_set_ssidcue_ioctlnd6_prefix_onlinkugen_seltrue_filtopsffs_specvopsumct_intrcue_attachelf32_read_fromosversionticks_per_intrem_free_receive_structuresatu_get_mibhid_is_collectionwi_usb_tx_list_initfind_pfxlist_reachable_routerip6_pcboptstvtohzieee80211_get_eapol_keyphtree_RB_NFINDratecheckin_rtchangevfs_syncwaitrt2860_tbtt_intrudav_ifmedia_statusaue_crcffs1_reallocblksieee80211_node_lateattachcansignalem_link_stall_workaround_hvrt2860_suspendmsdosfs_check_exportbwi_fwimage_is_validieee80211_up_to_aclf_setlocknbigpipecue_devsin_controlbwi_regwin_inforlphy_funcswsmux_srcopslmaxuvm_pagecopyphtree_RB_NEXTsysctl_quadsys_readexec_process_vmcmdskue_tx_list_initrt2560_update_promisccmd_chip_mapehcixferieee80211_tree_RB_FINDi80321_bs_tag_templateucomioctlmbstatuhci_remove_ls_ctrldcphy_statusuhidev_intrttyinfottyinohci_root_ctrl_donegetnulldevispidtakenpciide_dma_initsr_meta_save_callbackbufcache_getcleanbufextent_destroyenc_xform_rijndael128if_group_egress_buildloop_clonerttsetwatergetcrt2860_gp_intrsr_raid6_intrural_update_slotuvm_pseg_lcksr_ioctl_volem_clear_hw_cntrscom_obio_matchpmap_enter_pvuvm_mapent_mkfreeunp_disconnectsys_listensys_mountehci_root_ctrl_donepgsignalehci_waitintrbpf_mtap_etherfirstcbwi_constraintuhub_detachrt2560_media_changeieee80211_ccmp_delete_keysr_failioffs_fsyncwsmux_mux_openfintek_attachucom_do_openinetdomainehci_abort_xferscsi_devid_wwnmemcpywdc_enable_intrkthread_exitscsi_req_detachbwi_nrssi_writecue_newbufdisk_constructvfs_unbusyrip_usrrequhci_setup_isocvm_map_upgrade_lnspec_writesiop_wdtr_msgpciide_unmapregs_nativecom_obio_cdkq_timeoutmaxin_broadcastfd_getfilehidkbd_set_ledsmsgbufaddrucomclosesdioctlutsnameip6_setmoptionsexit2dosigsuspendaue_resetkue_open_pipesacer_setup_channelip6_mloopbackext2fs_cgupdateuhci_add_hs_ctrlsiop_scsifreeieee80211_send_4way_msg2tcp_update_rcvspacerddumpem_enable_intrcpu_setperfuaddr_rnd_poolufs_lookupsiop_pci_resetugen_attachufs_bmapdoasyncfreeudav_miibus_readregcpufunc_dfarip6_randomflowlabelttpolldegetlogpollkthread_createbwi_mac_set_promiscugen_set_configin_pcbresizewdc_default_read_raw_multi_2axen_rx_list_initcurrent_ipl_levellogclosesd_vpd_block_limitsieee80211_kdfgeneric_bs_wr_4install_coproc_handlernd6_dad_findohci_rhscudav_detachufs_strategysr_crypto_create_key_diskohci_device_requestkue_watchdogphysical_freeendcopy_statfs_infobounds_check_with_labelarc4_timeoutsr_raid1_assembleumct_opensd_ioctl_cachepci_subclass_networkext2fs_checkpathns_scx200_chip_mapsocantrcvmorepci_vpd_writeuipaq_rtsprocess_poolrt2560_update_ledip6_setpktoptfile_filtopssr_raid6_rwbuf_unmapmsdosfs_renamesiop_adapterpipe_wfiltops__lshldi3purge_detachedpfxrtr_addem_disable_aspmcd_load_unloadipq_pooluaddr_kbootstrap_destroyaxen_encappmap_activatebuf_dealloc_membmtphy_resetconfig_make_softcpte_l2_s_prot_krunp_discardcue_csr_write_1ip6_outputwi_read_record_iouhid_caudav_rxeofrt2661_bbp_readwsmux_get_layoutswap_syscall_lockufs_kqfilterieee80211_newstatescsi_autoconfcheckdirsexecswsr_raid0_creatert2560_set_txantennaumass_atapi_attachuslhcom_attachin6_are_prefix_equalin6_controluvm_pmr_rootupdateleapyearsleep_finish_timeoutsys_sigsuspendcd9660_unmountpciide_dma_startehci_device_bulk_abortswcr_authcomputenamecache_rb_cache_RB_NFINDtrapsignalrushjobpmap_devmap_registerrn_inithead0wd_flushcachend_defrouterblf_decfdcloseexecuvm_map_sel_limitsevcount_attachlimcopybio_doreadwi_do_hostencryptscsi_req_probeuvm_mapent_forkcopytcp_timer_rexmturl_ifmedia_changei80321_gpio_pin_writeuftdi_attachsiop_pci_cart_timer_initsr_crypto_rwuaddr_rnd_createieee80211_next_modeputsaxe_tx_list_initrip6statip6_id_ctxtcp_debxcnpollcd_casys_truncateesigcodeacphy_servicescsi_xfer_poolarmv4_tlb_flushIDudav_csr_readohci_add_donert2661_ack_rateem_read_phy_regieee80211_tree_RB_NEXTsched_choosecpu_forki80321_pci_initohci_add_edwdc_xfer_poolcdce_newbufsoacceptkqueue_pollcdgetdisklabelehci_device_isoc_doneuhidreadufs_creatend6_freend6_optionscd9660_seeknd6_llinfo_settimersr_roam_chunksmsdosfs_unmountelf32_load_psectionuftdi_writenamecache_rb_cache_RB_MINMAXtaskq_create_threaduhci_device_bulk_transferarm_pcache_unifieduhci_remove_intruplcom_setm_tag_nextohci_intr1msdosfs_writecue_resetbs_notimpl_bs_w_1rt2661_amrr_node_free_unusedexec_script_makecmdsehci_rem_free_itd_chainiic_matchieee80211_reset_erpfilt_pipedetachcd9660_rootentropy_add_ptrrgephy_statusiophyattachdisk_attach_callbackselrecordehci_setaddrffs_validatert2860_intrcomstopatu_wait_completionaxe_ax88772_initffs1_compat_readrip_outputrrw_exitext2fs_accessbwi_ofdm_plcp_headerrt2560_read_eeprommld6_fasttimeouaddr_rnd_insertkthread_qimaxohci_free_seduserconf_pdevsr_detachinflate_fastiq80321_devmapmbpoolclock_secs_to_ymdhmsaes_xts_setkeytcp_canceltimerstqphymatchrip_recvspaceroute_initswap_prioritylink_rtrequesttc_setrealtimeclockffs2_reallocblksrt_ifa_addlocalwdc_get_xferuvm_vmspace_poolbwi_setup_rx_desc32pipe_createpdc202xx_setup_channeliodatand6_sysctlsyn_cache_putnd6_rs_output_timerdoopenatpciide_amd_productspci_subclass_multimediavn_openuhci_freexif_clone_createbufq_fifo_requeuesr_boot_assemblycdce_tx_list_initSHA384Finaluao_detachcpufunc_controlmallocamap_pp_adjrefauth_hash_hmac_sha2_384_192apollo_chip_mapin_pcbrtentryrt2560_get_macaddrknote_dequeuesr_discipline_inituhci_root_ctrl_startuhci_pci_activatewi_cmd_usbpte_l1_s_prot_kw__udivsi3re_ifftcp_outflagskqueue_statcdce_ioctlcd9660_rrip_analyzeohci_hash_find_tdexphymatchbuf_fix_mappingbio_unregisterip6_v6onlysys_preadvuserretsys_recvmsgpipe_statHMAC_MD5_Finalvn_writesr_hotplug_unregistermtdphy_servicehidkbd_hookup_bellVOP_LINKubsa_devsicmp_inputumass_cdvcountvm_page_zero_enableieee80211_get_sa_queryuvm_vsunlock_devicerd_root_sizein6_delmultistathzenc_xform_cast5route_ctloutputbwi_nrssi_readsched_idlebio_warnuftdi_get_statuswskbd_cnattachwdc_ata_bio_intrvirtual_enduhidev_get_reportsys_getloginbuckstring_inituhci_free_std_chainiq80321_pci_init2bwi_set_gainsdetrunccopyoutpfindbufq_peekcomconsaddrip_ctloutputuhidev_set_report_asyncwsevent_readenc_xform_arc4bwi_stopbrgphy_5704_a0_bugarp_ifinitufs_dirbadcd9660_readdirvfs_unmountallrgephy_loopsys_renameatohci_allocxcopyrightsdattachsched_peg_curprocwdc_default_lba48_write_regtcp_timer_keepusbd_devinfo_vpsbsynctcp_mss_updateiopiic_cdphison_setup_channelpciide_lookup_productfree_pagesehci_root_ctrl_startrt2560_initrw_enter_readvunmapbufehci_device_ctrl_transferuvm_map_pageable_wireroute_outputrti_deletefreepidsys_geteuidem_clear_vfta_i350icmpmaskreplin6_pcblookup_listenmsdosfs_mknodttkqfluship6_defmcasthlimsys_munmapsii3114_dmactl_writeaxen_stopkp_nonefilt_solistenvsnprintfpte_l2_s_prot_urarplookupuvm_map_pageablechainallocuplcom_methodssw_reg_startpmap_copy_page_xscalesr_ioctl_deleteraidifmedia_baudratei80321_calibrate_delayem_82547_tx_fifo_resetusbd_setup_default_xferuvm_pagelookupsoshutdownuserconf_hist_cmduftdi_cduserconf_listproc_cansugidcd9660_rrip_getsymnameip_mloopbackbwi_rf_get_tp_ctrl2bpf_iflistKQREFwdc_downgrade_modeip6intrqaxe_newbuftodr_handlend6_rs_inputscsi_activate_buspciide_mapreg_dmasoabortem_82547_move_tail_lockedem_get_bufcast_encryptunp_inotaskq_threadbwi_default_led_acthidkbd_attach_wskbdlogkqfilterip6_init2uprintfsensordev_installrandomidmainbus_cai80321_local_dma_initcoredump_elf32rt2560_intrif_rxr_initsoftdep_flushworklistsys_issetugidinitclocksbwi_rf_attachcd9660_mmapif_detachaue_watchdogwsmuxopenwdc_ata_bio_startnd6_cache_lladdrcatqsession_poolugl_txeofunp_connectuvm_pagermapiniic_smbus_read_byteif_detached_startpool_serialugl_ioctlxscale_cache_flushD_SEscsi_probe_lunaue_ioctlirq_entryvfs_mountedonboard_powerdowncputypert_lookupfc_lookup__bss_start__if_downndqbtaskq_sleepVOP_GETATTRuhci_root_ctrl_methodsieee80211_fix_ratebwi_get_pwron_delaysiop_add_reselswip6_mtudisc_timeoutieee80211_node2reqwi_usb_matchelf32_check_headerrt2661_bbp_initgf_logeephy_cdinphy_cdttytstamprt2860_mcu_bbp_readural_set_txantennaieee80211_node_allocieee80211_crypto_detachpmap_unwirepool_lockuvm_pageunwirerti_fillHMAC_SHA256_Inithw_serialehci_device_intr_abortauth_hash_hmac_md5_96autoconf_attdetufs_chmodbufq_nscan_resortcdattachuserconf_devicebwi_rf_off_11abwi_pci_wakeupsys_sigaltstacki80321_i2c_casii3114_dmatbl_writebrgphy_resetsoisdisconnectingdevice_mainbusBlowfish_initstatesched_steal_procwi_media_changenull_decryptsyn_hash2rttimer_queue_headarm_pdcache_sizeexphy_capcidetachucom_dtrrtredirectsoftintr_inituvm_pmr_pnaddrttymodemehci_free_itdmtx_enteraxe_devskqueue_poolvntblinitbuf_rb_bufs_RB_INSERTcpuset_intersectionem_lookup_gcubwi_rf_tssi2dbmAES_GMAC_Setkeysleep_queue_initpmap_preferin6_ifattach_linklocalVOP_REALLOCBLKSuhci_globalresetE_abs_tag0_Usedtcr1_get_timecountugenwritesys_setresgidsr_crypto_encryptuvm_pmr_freepagesmsdosfs_sync_vnodesplassert_failarm_picache_waystty_initaxe_ioctluvm_km_freesys_killuserconf_numberperflevelcomconsiohpmap_set_pcb_pagedirem_watchdoguvm_pmr_addr_RB_NFINDrt_setmetricssys_getegiduvm_objtree_RB_FINDsw_reg_iodone_internalem_check_mng_modeserverworks_setup_channelumass_init_insystemfrag6_deletefraghdruaddr_destroyem_validate_eeprom_checksumdirchkexphy_resetuslhcom_set_breakipip_outputpipecloseVOP_REMOVEpci_mapreg_typeconsiniturlphy_statusext2fs_dirremoveuvm_vnp_uncachesysctl__stringffs_clusteracctconfig_detachmtdphyattachifaof_ifpforaddrcryptop_poolsensordev_listsr_checksum_printsc_pld_shminidatacleanrt_timer_queue_destroysr_meta_probewi_cdsd_cduvm_pseg_geticmp_mtudiscipport_hifirstautoieee80211_tkip_delete_keysys_fstatem_read_eepromufs_itimesenc_xform_3desrgephyattachuserconf_enablepte_l2_s_prot_uwext2fs_vinituplcom_intrumass_bbb_resetffs_alloccgbuf_object_storesmsc_wait_for_bitsobio_foundgeneric_bs_w_1sa6_anysys_getpriorityatu_radfirmpci_subclass_cryptosysctl_diskinitsr_concat_discipline_initE_ldsa_abs_reselect_Useduvm_km_vallocieee80211_send_mgmtcue_getmacnatsemi_chip_mapbrgphy_bcm5421_dspcodescsi_xsh_delscsi_plug_probesys_unmountsr_meta_native_probeuvscom_dtruipaq_detachbootdvelf32_probesumct_detachin6ifa_ifpwithaddruvm_pagezero_threadvgonelpciide_jmicron_productscrypto_taskqsofreebwi_amrr_timeoutbwi_rf_lo_findnd6_dad_timerbwi_led_newstateuaddr_rnd_destroyinphyattachcpuset_unionbwi_init_tx_ring32uvscom_shutdownsiop_timeouteephy_matchpmap_removebpf_mtap_afrt2860_set_basicrateshidkbd_parse_descicmp6_fasttimouvm_pmr_addr_RB_INSERText2fs_removemtx_initif_clone_destroyehci_close_pipebwi_regwin_enablewdccommandvmcmd_randomizebpf_setfuserconf_historypciide_pci_capci_disable_legacy_vgauvm_page_unbusybwi_rf_lo_isusedtk_noutusbpalockext2fs_mountpmap_collectBlowfish_expand0stateuhci_check_intrukbd_enableuvm_map_addr_RB_PREVwdc_xfer_getpciide_compat_intrgeneric_bs_rr_4cpu_sysctlcd9660_deftstampi80321intc_smaskzlibCompileFlagsip_randomidbrgphy_eth_wirespeedaue_tx_list_initnettxintrieee80211_recv_disassocnosuidcoredumpukphyattachcddumpastusbd_claim_ifacetcp_disconnectuvmspace_execuhci_timeoutwi_usb_detachwsmux_createsys_mmapehci_bus_methodsbootnd6_is_addr_neighborblf_ecb_encryptunp_rightshostnamedisk_closepartcmd680_setup_channelpci_enumerate_busbrgphy_fiber_funcsem_set_eee_i350em_disable_pciex_masterupl_outputi80321_intrext2fs_bmapuvmexpnextstateventenc_xform_blfbufq_donesr_crypto_dev_rwehci_detachsensordev_getufs_diremptySipHashreinsertfinishduprt2661_newassocsleep_setup_timeoutbrgphy_crc_buguao_grow_hashukphy_serviceqsphy_resetsmsc_stopdeflate_decompresspool_destroylogwakeuphidkbd_attachip_dosourceroutesoread_filtopsgcu_miibus_readregieee80211_media2ratedmapoolsbdevsw_lookupperfpolicydisk_changebwi_mac_resetuplcom_matchamap_lookupsdoreallocblkscache_revlookupamd756_setup_channelbpfread_filtopssoinituhidev_get_report_asyncuvm_mapent_isjoinableem_get_speed_and_duplexuvmVOP_MKNODnd6_ifdetachin6_ifaddrroute_protofilt_ugenread_isocsync_vopshw_uuidext2fs_truncatere_newbufcd_play_tracksscsi_do_mode_senseuvm_pmr_allocpmrip6_maxfragpacketsehci_confdprefetch_abort_handleruvm_km_threadsr_checksumem_rxeofuhci_root_intr_methodsscsi_probe_buslminm_leadingspacesys_fpathconfwsmuxpollarpt_pruneohci_device_bulk_methodsem_copper_link_postconfigkp_zerosoconnect2knote_poolcnopensiop_scsiprobenatsemi_setup_channelscsi_test_unit_readyural_set_bssidricohrtc_reg_writenmbclustural_get_rfsominconndma_freert2661_mcu_wakeupuhci_device_clear_togglesoftraid_cduslhcom_paramuvm_vnp_syncem_transmit_checksum_setuppool_allocator_large_niieee80211_get_disassociopxs_cdarpt_downrdgetdisklabelarm_pdcache_line_sizebpf_tapnthreadsuvm_pmr_addr_RB_NEXTrt2860_tx_intrnumnegpciactivatemii_phy_autouvm_pmr_addr_RB_FINDuvm_mapent_free_removemsdosfs_initohci_device_ctrl_startwi_write_record_ioext2fs_writelf_clearlockbwi_rf_set_ant_modegeneric_armv4_bs_wr_2uvmpd_scan_inactivesiop_resetbusurl_memip_srcrouteuhidioctlpte_l1_s_cache_masksys_setregidusbd_device2interface_handleurl_csr_read_1cpuset_infosusbd_dopollvinvalbufsys_ftruncateuhci_device_isoc_startbwi_rf_map_txpowerubsa_dtraes_ctr_cryptm_splituhci_remove_hs_ctrlsoftintr_disestablishentropylockbufcache_getdirtybufumodem_ioctlurl_stoptcp_timer_inittuagg_unlockedsii3114_dmactl_readnd6_maxnudhinttcp6_inputsosetoptkp_dirtyehci_set_qh_qtdtcp_mssrt_sendmsgifa_addcache_purgeudav_stop_taskusb_detach_roothubbpf_mcopycomconsrateauth_hash_hmac_sha1_96fork1vfs_hang_addrlistpci_primary_vgacue_tickdead_writeufs_dirrewriteinsmntquettreadtk_canccrt2860_media_changeext2fs_blkfreeudp_outputfind_last_setsoftraid0rt2661_set_chansys_chmoducomreadprelist_removeuvm_objtree_RB_NFINDuao_shrink_arrayffs_vgetrt2661_tx_intraxe_encapsr_bootuuidip6_getpmtu__umoddi3bcstatsbrgphy_fiber_statusin_pcblhasharm_dcache_alignvm_map_downgrade_lnugenclosert2661_media_changeip6_log_intervalnull_encryptdevice_mpathsched_idle_cpusugl_newbufscsi_activate_lunuvm_atopgmaxprocesssyn_cache_timerieee80211_auth_opensolisten_filtopshfsc_dequeueatu_internal_firmwareprocess_kernel_argsin6_update_ifa__wdcerrorSHA384Updatecdce_detachrt2560_tx_intrehci_alloc_itdrt_msg2suser_ucredmem_noext2fs_buf_allocbufbackpagesral_pci_matchatu_xfer_list_freeuhci_free_stdpciaddr_resource_reserveuaddr_kernel_functionspmap_free_l2_bucketRMD160Update_intrevarprequestrrw_enterkernel_mapuhci_device_isoc_enterwi_init_iodumpdevcd9660_lockusbd_ref_incruvm_mapent_forkzeroieee80211_mgt_subtype_namegf_powbwi_led_eventugen_do_readpciide_unmapreg_dmauvm_pmr_splitvfs_mount_foreach_vnodekqueue_kqfiltertimeout_add_usecsr_raid5_set_chunk_statewi_mgmt_xmituslhcom_intruhid_do_ioctlzeroin6_addrstrncasecmptimer_filtopsatu_tx_startrt2560_encryption_introhci_device_bulk_starttcp_mss_advSHA512Update_intnd6_optionwin2unixfnmax_hdrffs_readm_freephtree_RB_FINDbwi_mac_hostflags_initaes_key_wrapurlphy_attachieee80211_get_assoc_reqsr_meta_attachsr_meta_native_bootprobescsi_inqmatchfdesc_poolcmd_pci_intrpool_page_allocsr_switchin_pcblookupm_tag_delete_chainfilt_pipewritecd9660_polliicprobencugl_detachbadaddr_read_4bzerouslhcom_create_configumass_scsi_probearmv4_drain_writebufswapdrum_addufs_closedefrouter_delreqfixjobcuvm_pmr_size_RB_REMOVEpci_subclass_daspscsi_devidin6_addmultirn_newpairbios__udivdi3sys_obreakblf_setkeyusbd_set_config_norgephy_cdieee80211_pmksa_addpciide_cdlastddateucom_do_ioctluvmfault_unlockallsr_meta_getdevnamem_inithdrpmap_curmaxkvaddruvm_pmemrange_addr_RB_NFINDin6mask0bpf_validateusbd_get_string_descvaccessuao_set_swslotsys___thrsigdivertsys_getdtablecountmbinitsr_errortcp_secret_ctxabortwskbd_default_bell_datascsi_readsafe_cmdieee80211_set_link_stateamap_allocVOP_LOCKbuf_rb_bufs_RB_INSERT_COLORMD5Finalwskbd_matchaxe_rxeofcd9660_vget_internalrt2560_decryption_intrwi_intrvgetrd_attachkd_nowaitugenpollbrgphy_jumbo_settingswinChksumbufq_requeueserverworks_chip_mapfreeclusterchainmld6_initswapmapscsi_get_linkdisk_initrt2560_wakeupSHA256Updateohci_bus_methodsohci_hash_rem_itdatu_cdrip6_ctloutputdisk_readlabelpciide_pci_writeaue_sendusbd_getnewaddrnd6_na_outputext2fs_fhtovpsr_validate_stripsizeumass_cbi_transferext2fs_createem_local_timerwi_sync_mediauvm_map_teardownpipe_pollpool_reclaim_allnsphy_cabmtphyattachucomopensysctl_dopooluhub_matchuvm_mapent_clonetcp_respondsys_readvcrypto_getreqamap_cow_nowroundrobinusbd_get_hub_descriptorbadaddr_readuvm_map_createissignalwdprintsr_attachfilt_uhidrdetachin6_selectrouteieee80211_recv_rsn_group_msg1cdevvprt2560_bbp_writescsi_pending_startuhci_intrbwi_mac_balance_atten_setsoftintrmsdosfs_kqfilterigmp_joingroupuiomoveohci_device_isoc_donewi_usb_wridrespmsdosfs_startlf_alloccpu_idle_leavewi_intr_ackpciide_dma_table_setupscsi_iopool_getbpf_reset_dem_hv_phy_workarounds_ich8lannd6_dad_stopdiskmapioctlhid_start_parseinflateSyncPointuvm_waitnexecsbwi_init_rxdesc_ring32mclpoolsi80321_mem_bs_mapieee80211_regdomain2namepmap_referencesys_bindrt2661_watchdogloioctlrw_exit_writebs_notimpl_bs_wr_8ieee80211_eapol_key_micrt_ifa_addrt2560_free_tx_ringumct_initusb_abort_taskspmap_bootstrapbs_notimpl_bs_wr_2blf_cbc_encryptsys_mqueryarm_picache_line_sizekmeminit_nkmempagesbwi_rxeofusbd_new_deviceuvm_pmr_size_RB_REMOVE_COLORscsi_iopool_initscsi_io_putuvm_pmemrange_findfillinusemaprecvitbmtphy_funcsfilt_sowriteuvm_kernacccnpollcsys_linkucomsubmatchuvm_addr_initlog_opensr_rebuild_initfilt_randomdetachuvm_pmr_size_cmpfragtbl124userconf_totdevi80321_bs_tagrt2661_tx_cmdxscale_cache_flushIDrt_tablesrt_ifmsgrandomread_filtopsieee80211_plcp2rateumsm_setobio_bs_maprealitexpireipstatunix2dostimert2860_delete_keydounlinkatscsibus_caubsa_attachiic_probe_eepromuvscom_openurl_newbufusbd_delay_msffs_dinode2_poolcrfreecnputcuhid_do_writeip6_lasthdrohci_device_isoc_abortuhub_uhub_caugen_matchtcp_reaperlastnowpool_sethiwatrt2661_tx_datasvwsata_mapreg_dmawi_read_record_usbuftdi_methodswdgetdefaultlabelmicrotimeuvm_pmr_addr_cmprt2560_tx_datapipeunlockuvm_pmemrange_addr_RB_MINMAXuvm_swap_getpciide_serverworks_productsext2fs_reloadrt3090_rf_initurlphy_matchelf32_copyargsisochariophymatchuvm_km_alloc1siop_cdcdopentcp_usrclosedaue_ifmedia_stsboard_resetphysmemuvn_flushurl_cduslhcom_get_uart_statusuvmfault_relockinferiorbwi_rf_calc_rssi_bcm2050ukbd_attachxscale_cache_purgeD_Eclusterallocsr_raid_syncuplcom_capci_dopmrt_if_remove_rtdeletewskbd_attachin_pcbbindumass_cbi_statexscale_cache_flushImtdphy_caudp_notifyuhci_timeout_taskuhci_root_ctrl_closeendtsleepwihap_check_txstrnlensigactsshareuvm_map_freelist_update_refilluvm_map_addr_RB_NEXTbpfattachuftdi_openugl_openpipesif_detach_queuesitimerdecrem_valid_nvm_bank_detect_ich8lanether_outputpci_cdem_phy_setup_autonegpmap_bootstrap_pv_page_freeauth_hash_md5inflateGetHeaderbpfilter_lookupm_copym0bwi_led_onoffaxe_miibus_readregvm_physmemiso_shipdirrdwritebwi_txeof_status32rnd_timeoutieee80211_parse_edca_paramspipe_ioctlfilt_timerexpireural_set_chanwskbd_enablepmap_devmap_find_vacd9660_mountrootbpf_allocbufsbwi_init_txstats32axen_tx_list_initset_stackptrmsgbufmappedohci_device_setintrrt3090_set_chancomprobe1cdsizeuhci_device_ctrl_startumass_lookupsmsc_attachiic_smbus_write_bytebwi_rf_get_latest_tssiwakeupuao_growgetnanotimeatu_devspciide_matchrt2860_rf_writei80321_mem_bs_mmaptcprexmtthreshkprintf_mutexrt_getifawi_get_fid_ioenosyslockmgrbwi_bus_attachrtlabel_name2idbwi_node_allochidkbd_is_consoleuvm_vnodeopsvfsconfrt2860_free_tx_ringusbd_detachVOP_OPENcompwroffbuckstringuhci_device_bulk_startrt2860_enable_tsf_syncsiop_scsicmd_endusbd_fill_deviceinfoscsi_interpret_sensesqphy_cdugen_do_ioctlext2fs_flushfilesdes_ecb3_encryptieee80211_send_eapol_keycomconsattachedmallocarraybrgphy_probelxtphyattachwi_usb_txeof_frmufs_readlinkrdopenin6_ifadddoscheckpathsyslogfpcbmapatu_newstate_tr_stored_blocknd6_option_initbufq_quiescebrgphy_servicepiix_setup_channelext2fs_setsizeffs2_ballocin6_init_prefix_ltimesnchstatscd9660_fhtovpmsgbufpE_ldsa_abs_selected_Usediq80321_pci_intr_stringsys_setgidrt2860_set_keyuserconf_common_attrfilt_ufswritert6_flushehci_timeout_taskrdcide_udmaclkgeneric_bs_r_4E_ldsa_abs_slot_Usedmmrwffs_bufatoffem_init_hwiq80321_pci_intr_disestablishwi_usb_rridrespfilt_msdosfsreaddohooksgf_invem_pci_set_mwiieee80211_rssadapt_choosenprocessesehci_free_sqtd_chainem_disable_intrsiop_sdppool_p_freeif_detached_ioctllocnamppsegswi_usb_casch_chip_mapuserconf_showconfig_suspend_allbwi_next_scanip_mtudisc_timeout_qsr_raid5_assemblesr_scsi_cmdaddress_exception_entryffs_fhtovpgetvnodefilt_ufsvnodecrypto_get_driveridin6_pcbhashbwi_mac_updateslotpool_setlowatkmembaseswi_entryrip6_inituvm_aiobuf_poolisofncmpseltrue_filtopssys_sigprocmaskrt2661_select_bandfilt_pipereadenc_xform_aes_gmacsoreservert2560_reset_rx_ringusb_activatescsi_report_lunsufs_quotactldosymlinkatuvm_map_uaddraroundin6_pcbnotifybrgphy_5708s_funcsusbd_clear_endpoint_toggleexplore_pendingstrrchrgetdevvpm_clgetpci_mem_finddefrouter_selectamap_unrefext2fs_statfsbpf_mtap_hdrcrdupamap_wiperangecuio_copybackisodirinocfrootschrtoblkscsiprintsiop_get_lunswuserconf_pdevnamminphysukbd_matchurl_ticksys_fchownattimeout_mutexether_addmultiieee80211_recv_actionpci_powerdowncdce_cdffs_vptofhvfs_isbusyifunitirqstackbawritetputcharsvwsata_dmatbl_writewskbd_detachpmap_postinitffs_fragacctrt2661_rx_tuneffs1_ballocsys_fchowndcphy_attachuvisor_methodsinflateInit_SHA384Update_intvwaitforiomii_phy_tickcd_read_subchanneluao_shrink_flushflsextendfilelortrequesticmp6_inputbuf_valistuserconf_addohci_device_intr_methodswi_func_iocreatedefilt_randomreaduvscom_closebwi_regwin_nameieee80211_michael_mic_failuresbreleasein6_selectifmsdosfs_islockedmax_linkhdrem_dma_freeumass_attachwdc_xfer_iopooludav_resetget_stackptrsysctl_rtablemsdosfs_reclaimbwi_set_chanbwi_rf_calc_rssi_bcm2060wdc_free_queuesqphy_serviceuserconf_hist_eocsys_readlinkatbrgphy_reset_bgei80321_intr_disestablishuvm_objtree_RB_REMOVEext2fs_getattrrtlabel_id2namesbdroprecordinitconsbufem_write_phy_regi80321_handlerwdsizenamecache_rb_cache_RB_REMOVEacphy_statusip6_sysctlsuserdiskconfural_tx_dataatu_get_card_configvn_syncer_add_to_worklistusbd_get_interface_descriptorgeneric_bs_rm_1tk_ninsysfilt_opspciide_mapchanclusterfreefilt_randomwritesr_warnsr_raid_intrieee80211_alloc_node_helperrootdevehci_device_isoc_startm_tag_firstem_82547_move_tailcdmatchpmap_map_entryusbd_get_config_descriptorpfxrtr_delpciide_machdep_compat_intr_establishdumpsysicmptstampreplcy693_setup_channelrip6_sysctlext2fs_fsyncdoforceuhci_root_intr_startsys_fsyncwi_usb_stopuserconf_add_readsr_crypto_writere_pci_probeusbd_reset_portrt2661_set_macaddrifconfsiop_led_onpciide_pci_intramap_wipeoutuser_configcast_setkeyuslhcom_uart_endistcp_outputnsphyattach_bus_dmamem_mmapi80321_attachupdate_ledsext2fs_updatert_ifa_dellocaltcp_timer_2mslaue_openpipesi80321_gpio_initffs_reload_vnodebuf_putmsdosfs_setattrVOP_RMDIRsr_ioctl_installbootif_addgroupciphy_cdieee80211_setmodeuhid_matchpool_allocator_freefilt_proceopnotsuppumodem_paramem_rxfillffs_reallocblksphtree_RB_INSERT_COLORrandomcloserootvpaxe_miibus_writereguvm_pmemrange_addr_RB_NEXTugen_do_writeieee80211_eapol_key_decryptuserconf_maxlocnamespool_reclaiminitdisklabelpci_subclass_serialbususb_quirksbpf_sysctlvflushehci_openieee80211_bip_encapcddetachpmap_clear_modifytcpctl_varsarptimerbufq_dequeuetcp_reass_limitm_copymruaddsys___set_tcbrdstrategysystemsbcopy_pageip6_freepcboptsif_upcoredump_notes_elf32piixsata_chip_mapumsm_catimeout_add_nsecehci_intr1rt2860_enable_mrruvmfault_lookupm_extfreergephy_resetupl_intrucomprintural_matchdeflateBoundVOP_BWRITEbufq_fifo_peekrt_timer_queue_createwddonemsdosfs_ioctlpciide_dmatbl_writeupl_matchrt2560_stopno_constraintmsdosfs_dehashsys_opensr_crypto_change_maskkeywdc_alloc_queuergephy_funcsusbd_match_deviceinet6domainural_enable_tsf_sync_bus_dmamem_alloc_rangeether_crc32_be_updatepgdeletert2560_next_scanbwi_enable_intrswskbd_do_ioctl_scdead_vopsi80321_irq_handlerieee80211_media_changeucom_detachuaddr_hint_createraw_attachural_set_rxantennahidkbd_cngetcscsi_ioc_cmdastpendingifnewlladdrphison_chip_mapether_ip6multicast_maxpipe_pooluao_initudav_iffrdc_chip_mapifa_ifwithroutespec_kqfiltertcp_notifyieee80211_match_bsscd9660_tstamp_conv7ural_free_tx_listffs_dinode1_poolieee80211_set_keyieee80211_bip_delete_keyem_smartspeedrtflushclonegetblksr_raid_turxscale_cache_flushD_rngmaxsmapwdc_ata_bioip6_mcast_pmtusoconnectrt2860_txural_inituvm_map_fix_spacenobuffers__lshrdi3data_abort_handler_addressin6_delayed_cksumrtrequest1usbd_errstrSHA256Update_intsr_scsi_ioctltcp_identtcp_rst_ppslimuhci_openbwi_pci_activateem_realignifinitsd_cmd_rw10cd_load_tocunpst_recvspaceuvm_map_mqueryget_ifidsr_infoscsi_io_getkue_initxscale_cache_purgeIDuvm_map_kmem_growraw_inputcd9660_reclaimrt2860_stopkue_ioctlfilt_logrdetachtimeout_add_btnd6_ifattachunpdg_recvspacedofaccessatpipe_closecd9660_inactivesoftdep_mountmsdosfs_rmdirmsdosfs_fsyncre_setup_sim_imcfdatadeflateInit_ffswi_usb_tx_lockufs_checkpathSipHash_Finalem_init_eeprom_paramspmap_pte_init_xscalepfxlist_onlink_checkdiskmapreadm_tag_findinittodradler32blf_encvputaue_iffpte_l1_s_cache_mode_ptvector_page_setprotcd9660_setattrbwi_rf_set_nrssi_thr_11busbd_get_configuaddr_kbootstrapufs_quota_initallocpidkqread_filtopsbrgphy_bcm54k2_dspcodeusbd_setup_pipexscale_setttbem_read_part_numaue_csr_read_1xscale_cache_cleanIDbuf_acquireatu_attachubsa_get_statusdolinkatbioopscpu_classesbpf_setdlttcp_flush_queuepool_setiplmsdosfs_statfslboltpipe_inituvm_wait_plausbd_open_pipe_intrusbd_request_asyncaes_gcm_reinitsyncerprocrt2560_set_macaddrufs_ihashinszcfreein_setpeeraddrinphymatchatu_taskwindow_inflatert2661_enable_tsf_syncether_ifdetachsr_meta_native_readuhidev_get_report_descuserconf_histcurrndstatscy82c693_writemsdosfs_inactivepciaddr_do_resource_reserve_disabledpanicstrbwi_set_clock_delaypdc20265_pci_intrupl_newbufumass_scsi_cbscsi_delayext2fs_sync_vnodeif_startunpdg_sendspacesession0bwi_power_offviscpyE_abs_lunsw_return_Usedehci_abort_isoc_xferhw_ver__umodsi3copyincomparamsiop_common_resetural_stopudav_sendcd9660_defattrohci_device_bulk_closeehci_reverse_bitsbs_notimpl_bs_sm_8uao_swhash_elt_poolufs_ihashgetdes_set_odd_paritydovchflagssigacts0findblkmajormsdosfsvnode_filtopsntohlsorflushugen_caiophy_funcsuvm_mapent_tryjoinbwi_phy_config_11gttioctlarpintrqvprintfslpquesr_raid1_wu_doneohci_root_ctrl_methodsttycharssyncdelayuvm_vslock_devicewi_usb_infofrmaxen_ioctlugenreaduvm_pagealloc_multihidkbd_enableffs_mountwsmux_mux_closeicmp6errppslimbadaddr_read_2msdosfs_vopsuhci_add_intrconfig_process_deferred_childrenbufq_waitohci_ifcdluphymatchxscale_cache_purgeID_Ebs_notimpl_bs_sm_2em_camsdosfs_roottqphyattachbpf_getdltlistrt2860_startm_tag_getuvm_map_freelist_updatesb_lockem_enable_tx_pkt_filteringohci_root_intr_abortuhci_pollrt_labelscrypto_unregisterHMAC_SHA1_Finalupl_watchdogsuid_clearttwritedma_alloc_initatu_initem_activatebuf_rb_bufs_RB_NFINDbuflowpagesehci_activatert2661_set_basicratesrebootswapdev_vpre_miibus_writereguipaq_methodsaes_xts_cryptieee80211_deliver_datadead_readkv_execufs_pathconffile_poolohci_timeoutbwi_setup_tx_desc32unputcbwi_rf_lo_measure_11gendluphyattachVOP_CREATEcpuset_firstSHA512Updatecdce_stopbwi_rf_set_nrssi_thr_11guvscom_get_statusnd6_recalc_reachtm_intervalpagetables_startin_ifinitohci_device_ctrl_closepciide_mapregs_nativein_pcbhashlookupsys_mknodatem_setup_transmit_structureskp_dmare_eeprom_putbyteural_writeucom_cleanupVOP_ABORTOPehci_pcdcoredump_tradbwi_power_onem_identify_hardwaredofchownatsr_wu_done_callbackuhci_idoneuvscom_set_line_codingdefault_chip_mapsys_acceptuvm_map_entry_kmem_pooluvm_pagerealloc_multiieee80211_wep_decryptbwi_rf_calibvalwi_inquireehci_pci_takecontrolleradm1032cloneprobeuaddr_bestfit_pooltcp_rst_ppslim_countieee80211_recv_assoc_respieee80211_parse_rsn_bodyukbd_detachaes_key_wrap_set_keyif_clone_listtc_windupsys_futimesrt2661_update_promiscsdgetdisklabelbwi_intrwi_do_hostdecryptsiop_table_syncinternal_commandpci_subclass_wirelessuvm_map_boundarybwi_phy_init_11b_rev5ciphyattachin_losinguslhcom_cdsis_chip_mapaxen_rxeofVOP_SYMLINKgeteblkrt2661_suspendrt2661_detachusbd_set_interfaceem_force_mac_fcscsibusmatchinflateBackInit_vn_ioctluhci_remove_bulkwi_usb_ctl_lockufsspec_readrt2661_set_txpreambleaxe_cdpipespacefiqvectorget_last_resort_ifidohci_alloc_stdcmd646_9_irqackip6_sendredirectsbwi_initcast_decryptbwi_startukphy_caitimerfixip_stripoptionsbwi_init_statechgsyn_cache_countieee80211_add_xratesnd6_timer_chugl_rxeofuvm_pseg_releasecpu_resetudav_ticktcp_ctlinputether_multiaddrstart_cleanerffs_blkfreeexit1ohci_detachbwi_mac_adjust_tpctlihashkeybdevvpifa_ifwithdstaddrehci_cdi80321_bs_mapuvmspace_dusedudav_ifmedia_changeselectroutein6_nigroupscsi_mode_sense_big_pageauth_hash_sha1sys_mkfifoatpool_get_doneuihashrijndaelEncryptscsi_ioh_deltcp_keepintvluvisor_detachcdwriteufswrite_filtopsttybgconfig_searchphtree_RB_PREVusbd_printuvm_km_valloc_prefer_waitsyn_cache_poolpci_subclass_mass_storageffs_allocaue_tick_taskeephy_funcsinphy_funcsucom_hwiflowrgephymatchbswap32ipsec_exp_first_userlphy_servicenet_livelocksplimit_poolip6_defhlimumass_setup_ctrl_transferunp_connect2usbd_set_pollingrn_walktreepciide_ite_productssys_chownpciide_rdc_productsuvm_pagewirebwi_calibrateem_stoppci_vga_pciin6_joingroupsys_munlockinflateBackuvm_anfreeuhci_bus_methodsrt_ifa_deldofilereadvipip_sysctlbs_notimpl_bs_sr_1vn_statfilerw_exit_readieee80211_iterate_nodeswi_intr_enabletablefullumct_set_line_stateuhub_exploreupl_txeoftcp_maxidlevfs_getcwd_commonset_cpufuncscttyioctlsys_lstatieee80211_recv_wpa_group_msg1ohci_timeout_taskohci_hash_add_tdieee80211_tkip_set_keyiso_uiodircttykqfiltercttyopenpmap_link_l2ptinet6ctlerrmappool_runqueuebwi_bbp_power_onicmp6_redirect_diagdisknamessched_queued_cpusumass_quirksdumploRMD160Updatemsdosfs_mountacphy_funcsffs_clusterallocbwi_calc_rssimq_dequeuenullcnpollcuvm_km_inituvm_objinitbwi_hostflags_readpciide_acard_productsbzero_pageffs_sbupdatechillbufsudp_sysctlsys_openatbs_notimpl_bs_wm_1vmmapbsyusb_add_taskurl_int_miibus_readreguserconf_histlenbufcache_initrt2860_alloc_tx_ringrt2860_updateedcankmempages_minukbd_accessopsusbclosesis96x_setup_channeludav_matchvector_pagekq_ntimeoutssys_sched_yieldvmspace0bwi_phy_clear_statescsi_decode_sensettywaituvm_map_setuptcp_syn_cache_sizewdc_default_vtbluao_grow_arraycoldqueueuvm_uarea_allocem_defer_attachetextifa_ifwithnetmemchrohci_device_ctrl_doneqsphy_statussqphyattachpte_l2_s_cache_maskcomp_algo_lzsrn_link_dupedkeysysctl_cptime2scsi_mode_sense_pageboot_argspipelockumass_scsi_setupproc_pooluplcom_dtraue_intrudp6_inputsys_writert2661_next_scanural_set_txpreamblegeneric_armv4_bs_rr_2sb_maxusbd_fill_iface_datacd_set_pa_immedsr_uuid_print__bss_end__ip6_insertfraghdrresume_randomnesscnstopihashtblieee80211_set_shortslottimesys_dup2em_phy_resetsiop_productswd_get_paramsbread_clustersys_readlinkbwi_rf_writert2560_setup_tx_descext2fs_size__ashrdi3bs_notimpl_bs_mmapzErrorohci_intrxscale_cache_flushI_SEcrc32ip6_auto_flowlabelsvwsata_mapchanuipaq_cadevid_copylf_splitifafreeVOP_STRATEGYtimeout_add_sectzucom_rtsxscale_cache_syncIrip_sendspacecoredump_writenote_elf32uhidev_writeusb_generic_tasksxscale_cache_cleanID_rngamap_addtcp_freeqif_setgroupattribsuhci_device_requestcom_attach_subrsii3114_dmacmd_readdvd_authSipHash_Updatert2560_node_allocexphy_servicesiop_maumass_scsi_cmdcdreadrt2661_get_rfrt2560_enable_tsf_syncspec_inactiveehci_device_intr_startwi_func_usbwsmux_do_ioctlsys_sendtoicmperrppslimgeneric_filtopsknote_dropuftdi_setcue_watchdogin6_selectsrcuvm_mmaplockrd_casoftclock_siem_82547_fifo_workaroundwi_usb_threadugl_watchdogsr_ccb_putin6_pcbsetportnd6_rs_output_timeoutalldevsbwi_vendor_led_actrt2661_iter_funcwddumpicmp_do_errorvmcmd_map_readvnsmsc_initrandom_startcomconsfrequsbd_get_interface_altindexamap_extendsigpropvmapbufumass_scsi_switchi80321intc_intr_initdehashtblsocketopssiop_pci_matchscsibus_bioctlnd6_maxndoptuvm_map_clip_startffs_fragextendtcp_always_keepaliverawcbtablespec_readumodem_cdunp_markacphyattachdes_key_schedicmp_mtudisc_timeoutnwsmuxpmap_zero_page_xscalettyread_filtopsuvm_maprdc_setup_channeliic_printgetinoquotabrgphy_5708s_statusscsi_do_ioctlrtable_existsdisk_lock_nointrehci_free_sqhcd_resetuhci_pci_cascsi_ioh_addext4_ext_find_extentbwi_mac_reset_hwkeysscsi_detach_busudpstatroute_inputsetrootcd_read_tocural_amrr_updatecdioctlieee80211_defrag_timeoutbufq_switchcue_stopuvscom_detachifmedia_addatu_usb_requestfrag6_queuelxtphy_funcssr_matchusbd_set_config_indexlogopenluphy_serviceieee80211_add_rsn_bodyrt2560_txtimern_del_radix_masksr_raid6_initrt2661_rxratecd_buf_donescsi_devid_pg80breadntcp_hdrszscsi_devid_pg83tcbtablei80321_mem_bs_init__xordi3frag6_drainuvm_objtree_RB_REMOVE_COLORdosdiremptyigmp_slowtimoifpromiscre_disable_sim_imip6_setpktoptsfork_returnsys_getsocknamecd9660_lookupsr_concat_initricohrtc_cawi_usb_intrusbd_alloc_bufferinflatePrimemask_rnheadsw_reg_iodonepte_l2_s_protoufs_roottcp_sysctlVOP_SETATTRsmsc_chip_initpmap_kremovesigactsinitohci_pci_caffs2_blkprefdomknodatcpu_kcore_hdrexec_elf32_fixupvop_generic_lockcomconsiotuvmfault_anongetconsttybwi_detachural_bbp_readsr_ioctl_diskusermountext2fs_dirrewrite__ucmpdi2vn_closefilepci_findvendorumass_discoip_mtudiscvfs_free_netcredem_power_up_serdes_link_82575mld6_start_listeningcpu_mainbus_cakue_matchpmap_kenter_papidhashtblaue_match_nrssi_thresholduvm_mapent_forksharedm_pullupenterpgrpxscale_tlb_flushID_SEcrypto_freesessioncnbellm_copydatabufq_nscan_requeueuvmfault_initatu_stopcd_setchanieee80211_get_probe_reqpool_p_removemtx_leavefilt_signalsigactsfreert2560_free_rx_ringwdc_default_write_raw_multi_4ttymallocupl_attachicmp6_notify_errorieee80211_recv_probe_respbs_notimpl_bs_sm_4pcisubmatchkue_setmultimmioctlumass_matchsched_choosesendsigohci_device_ctrl_methodsbpf_ifnameohci_cdural_ioctlsmsc_iffvfs_busytimecounterfilt_ufsdetachbufq_initlf_getlocksr_raid6_xorpsolistenpdc205xx_drv_probewskbd_compose_valuespec_getattrpciide_dmactl_readobio_bs_unmapiic_scanip_ecn_ingressmsdosfs_bmaprip_ctloutputffs_vtblif_getgroupieee80211_parse_rsnpool_debuguserconf_morekqueue_ioctlmax_processesem_free_pci_resourcessys_wait4rip6_recvspaceamap_share_protectfs_sysctlukbd_cnattachboot_filepte_l1_s_prot_uwfilt_sordetachknote_activatepsignalieee80211_regdomain_compare_cnconfig_pending_incrusb_task_threadbwi_mac_unlockamap_pp_establishauth_hash_gmac_aes_192uvm_pmr_nextszuvm_anon_initffs_reclaimbmtphy_causb_free_deviceusb_explorebufq_nscan_queuexscale_cpufuncsif_link_state_changepmap_virtual_spaceieee80211_add_wpaieee80211_eapol_key_check_micpage0_endieee80211_add_capinfobpfpolluvm_pmr_nfindszupdatepriohci_activateciphy_fixupbwi_mac_lockbmtphy_servicesched_kthreads_createuhci_device_bulk_closeuhid_cdwskbd_cnbellbintimebwi_set_clock_modeuhci_intr1jmicron_chip_mappciide_print_channelswi_seekfilt_soreadpmap_remove_allrtable_addmq_delistrt2860_mcu_bbp_writezeropageipsec_def_encbrgphy_bcm5401_dspcodeffs_nodealloccgbwi_mac_calibrate_txpowersoftintr_establishuvm_pmr_removeip4_input6pdevinit__iordi3uvm_pmr_findnextsegmentinetctlerrmapresetpriorityrt2560_set_slottimeenoioctlrt2860_watchdogwi_usb_start_threadaxen_ifmedia_stsflslbwi_dma_txstats_allocsigacts_poolpcaled_matchexecsigsconfig_initskip_fcicmp6_redirect_inputbuf_rb_bufs_RB_REMOVE_COLORrw_enteraue_read_macpciaddr_print_deviduvm_addr_destroysr_raid0_inituvm_pmr_size_RB_MINMAXnd6_ra_inputffs1_blkprefin6addr_loopbackuvm_objtree_RB_MINMAXttypendin6addr_linklocal_allroutersuvm_swap_freepagesqsphymatchnd6_dad_starttimerin_revarpinputstrlcpyiopiic_attachehci_device_isoc_methodsumodem_setusbd_reload_device_descsmsc_read_regaxen_newbufext2fs_advlockknote_fdcloseusbd_get_devcntehci_device_intr_doneem_get_pcs_speed_and_duplex_82575if_clone_detachpipe_rfiltopssiop_dmamem_allocubsa_openin6_cksumcomcninitpciide_print_modesstrncmpcsrc_ptedes1_decryptvfs_shutdowngetsockieee80211_get_deauthbwi_newassocbs_notimpl_bs_c_4upl_startsyn_cache_respondif_creategroupllinfo_nd6uvm_iosbcheckreservepreemptbioattachieee80211_begin_scanunixdomainbwi_led_attachbwi_tbl_write_2smdscsibusattachugl_devsumct_rtssyn_hash1ulminwihap_data_inputi80321intc_do_pendingproc0paddrrn_addmaskuvm_vnode_poolpciaddr_do_resource_reserveusb_attachbpf_bufsizeselscanpciide_promise_productssoo_polluvm_map_uaddr_ertafidx_maxsig_filtopsknote_processexitohci_device_bulk_transferukbd_cdricohrtc_getcalwskbdopenrt2860_reset_rx_ringrt2661_eeprom_readem_startttclosurl_rxeofipsec_soft_allocationssleep_setup_bus_dmamem_mapip6_fragmentnet_sysctlcom_cdbwi_mac_init_tpctl_11bgwskbd_do_ioctlxscale_cache_cleanD_Euvm_pmr_size_RB_FINDudv_listdead_ioctlaue_initusb_matchbwi_txeof__wdccommand_startsysctl_iflistvwakeupcmd680_channel_mappci_subclass_bridgeif_clonersrt2860_set_txpreamblewdcbit_bucketvgonewdc_probe_capspmap_initializedtcp6_ctlinputsched_init_runqueuesusb_allocmemsd_sizeufsspec_closend6_prefix_offlinkuvm_anon_dropswapwi_detachucom_lockigmp_inputkmemusageswcr_sesnumlf_getblockpciide_irqackautoconf_attdet_mtxumodem_attachtcp_rttdfltcleanerprocpdc202xx_pci_intrieee80211_parse_edca_params_bodysbappendstreamm_tag_copy_chainrt2661_bbp_writeohci_handoversowrite_filtopssr_chunks_unwindstrncpysdreadsys_pselectupdatefatscue_memata_perrorvfs_getvfssr_alloc_resourcesaue_txeofffs_sync_vnodedeflateInit2_sr_raid6_discipline_initproc_stoprrticks_initbio_status_initusbd_set_port_featurebpfilter_createsysctl_locklockfpoolmq_dechainieee80211_find_nodecpu_switchtoucom_cahtonlsched_all_cpusin6_mask2lentcp_dooptionsdos2unixtimesys_sigactionsr_scsi_donedeupdatusb_fill_di_taskehci_ifcdSHA256Transformrndlock__negdi2in6_purgeaddrcpu_modeluhci_softintrsii3114_read_regarm_dcache_align_maskcttyreadcd9660_unlockpciide_dmactl_writeuserconf_cmdsural_taskbwi_set_bssidiophy_statusschedclockbpfioctlconfig_attachohci_alloc_sitdcue_rx_list_initbwi_hostflags_writert2661_attachhookbmtphy_statusdisk_unbusyusb_syncmemugen_detachi80321_io_bs_freesoisconnectedurlphydebugamap_clean_worksuhci_alloc_std_chainusb_block_freememVOP_PATHCONFumass_fixup_sonydk_mountrootassertwaitokscsi_minphyssiop_script_syncxscale_cpwaitvattr_nullsys_getsockoptrt2661_tx_mgtre_rxeofufs_ihashumct_paramuhidev_attachfrag6_nfragpacketsaxen_startsr_raid0_assemblert2860_wakeupbwi_cdpool_allocator_largeuvm_anon_lockloanpgvfs_sysctlite_chip_mapcpu_get_controlVOP_READLINKbuf_mem_initumass_cbi_methodsmii_submatchohci_root_intr_transfermsdosfs_pathconfoldpidstimeout_wheelbwi_pci_conf_readbpf_m_xhalfumass_io_getaverunnablecd9660_getattrttyfreettysleepuvm_pauseehci_root_intr_donert2860_rx_intratu_get_opmodeunp_disposescsi_inquireufs_getattrBlowfish_encipherieee80211_mhz2ieeevfs_exportuplcom_closesr_hotspareuvm_km_pgremoveex_region_plfscalesmsc_matchffs_alloccgblkip_optcopyvfs_registerieee80211_proto_attachsys_dupmcllowatmii_printuslhcom_setupieee80211_setup_ratesbpfilterattachproc_stop_topci_find_devicetimeout_todoswcr_initbwi_updateslotumsm_truinstall_changemodecpu_read_cache_configumsm_detachwdc_sii3114_vtblsr_ioctl_createraidpanicget_pc_str_offsetciphy_resetural_rxeofcue_rxeofL_cksumdatamsdosfs_lockseltruepci_subclass_systembpf_m_xwordmq_enlistscsi_xs_syncsoftdep_initializeunp_shutdownieee80211_tkip_encryptwi_resetdovutimensdummy_get_timecountext2fs_sysctlgeneric_bs_wm_4kthread_run_deferred_queuearc4_initwdreadlastdaycheck_execwi_usb_cdtcp_initpte_l2_s_cache_mode_ptpool_request_initdeferred_config_queueciphy_funcsucomreadcbbuf_rb_bufs_RB_MINMAXnetisr_initipport_lastautouhci_endpdsis_setup_channelwsmux_detach_sccom_raisedtricsphy_statusip6_pcboptwinSlotCntvn_kqfilterext2fs_syncsched_stoleni80321_io_bs_unmappte_l2_s_prot_maskpciide_intr_flagudav_ioctlcrypto_registercache_purgevfspostsiguvm_mmapfilesys_pathconfcue_open_pipesin_addmultigetmicrotimebs_notimpl_bs_rm_8maxthrsleepumass_clear_endpoint_stallohci_setup_isocaue_newbufscsi_probedevaxe_ax88178_initi80321_i2c_attachtcp_templatemsdosfs_readrt2860_select_chan_groupfintek_write_regohci_initcomopensata_setup_channelusbd_setup_xferauth_hash_hmac_sha2_512_256ieee80211_tree_RB_MINMAXmtagpoolpiix_chip_mapbcopyiic_attachurl_tick_taskbufcache_releasecue_detachusbioctl_bus_dma_inrangekqueue_wakeupip6_unknown_optuaddr_rnd_removetcp_reasssys_getfhext2fs_vgetrt_timer_timerrtbl_id_maxcomcnputcKERNEL_BASE_physSHA1Update_intehci_alloc_sqtdcuio_applySipHash_Endgeneric_bs_rr_1axe_resetdefrouter_addreqin6_clearscopebwi_pa_modebwi_pci_cand6_dad_ns_inputuvmpd_tuneusbd_set_addressudav_openpipesffs_setblockipsec_expire_acquirepci_suspendkue_stopicmp6_mtudisc_clonehotbufpagesatu_send_commandinflateResetmemcmpwskbd_init_keymapobio_bs_subregionnamecache_rb_cache_RB_REMOVE_COLORumct_dtrip6_dad_pendingieee80211_rate2plcpmsdosfs_createcd9660_startbwi_get_card_flagsbwi_rf_get_gainscomstartuslhcom_setaes_xts_reinitcfroots_sizebwi_mac_gpio_finitickadjiq80321_irq_mapip6_splithdruvm_map_addr_augmentsiop_clearfifotcp_secret_initieee80211_recv_sa_query_reqsbreserveundefined_initvrecycleem_phy_hw_resetubsa_matchieee80211_alloc_nodeblf_ecb_decryptcrcopyural_newstatewdcloseundefined_handlerssys_revokeural_free_rx_listsysctl_stringsys_rebootuvm_unmap_kill_entryext2fs_specvopsuslhcom_closebufpoolproc_finish_waitwdccommandext_dist_code_bus_dmamap_load_buffersigonstackcpu_forkuaddr_kbootstrap_selectwi_write_data_iottylistwdopenuvm_vslockre_initdeflateResetuvmfault_update_statscast5_setkeypci_ndomainsttyoutputsr_raid5_wu_donekue_caexplicit_bzerocd9660_tstamp_conv17wskbd_calxtphy_statusuftdi_8u232am_getratetqphy_cdcopyaddroutumodem_detachcpuset_add_alluhci_root_intr_abortsystqmpVOP_READbwi_phy_calibrateufs_ioctlffs_freefilein6ifa_ifpforlinklocallastdtimegetdisksys_setuidiq80321_pci_init_wdc_ata_bio_startstart_updatesiop_common_attachudav_cdusbd_clear_port_featureusb_abort_task_threadufs_quota_free_blocks2re_stopsenditsr_crypto_decryptudp_detachbufq_fifo_destroyacer_dma_initcluster_writesr_raid5_createhidkbd_decodeuvm_setpagesizeehci_root_intr_closetcp_xmit_timerrn_add_radix_masksr_raid1_rwucomwritein6_recoverscopensphy_servicebwi_dma_mbuf_create30aue_ticki80321intc_cdtimeout_add_tvticksvwsata_write_regmclpool_warnmsgi80321intc_cascsi_pending_finishscsi_preventmmclosecd9660_accesssr_wu_getffs_statfscpuset_complementrijndael_set_keywdcprobeiophy_cdudp_recvspacefdropsr_block_putkm_alloci80321_mainbus_matchgf_initsyn_cache_unreachuserconf_histszsys_getrlimitrt2860_attachhooki80321_mainbus_foundicmp6_errcountbpf_attachdfintek_cdicmp6_ctloutputcpuset_issetsvwsata_dmactl_writeufs_dirremoveumct_setaxen_devsrgephy_serviceif_attachsetuppipe_writesr_set_chunk_stateuvm_map_addr_RB_FINDin_pcblookup_listensbappendm_copybackscsi_remove_linkuvm_swap_puticmpbmcastechoHMAC_SHA1_Initehci_timeoutbufheadconfig_scanwi_get_nwkeykp_pageablesr_raid6_addiopmap_copy_page_funcripsrciso_nchstatsem_update_eeprom_checksumkue_txeofaxen_lock_miiugenkqfilterural_amrr_startnlineswohci_rem_edether_ifattachinflateSync__wdccommand_doneumass_adjust_transfersignal_initfill_drlistffs_updatewsmuxcloseunix2dosfnspec_advlockmtdphy_cdfragtblraw_sendspaceubsa_cauvscom_breaknullopre_attachuftdi_2232h_getrateAES_CMAC_SetKeycomdiagextralocunsleepvop_generic_bmapwdprobescsi_xs_getmtdphy_funcsuipaq_seti80321intc_matchblf_encryptsched_proc_to_cpu_costohci_alloc_std_chainipintrgetnanouptimeohci_pci_detachuhci_pci_detachi80321_pci_attach_hookdes3_encryptmaxdmaprt2661_tx_dma_intrural_alloc_rx_listusb_block_allocmemext2fs_symlinkip6_savecontroldevice_registerpciide_chan_candisablesr_raid6_set_chunk_statend6_dad_stoptimertaskq_sys_mpq_to_bmountrootsyn_cache_resetuhci_device_intr_doneuhidev_openundefined_entryprocess_read_fpregsip_initreaddeohci_freexural_txtimecd9660_rrip_getnameufs_check_exportdes_encryptsysctl_rdintpdc20268_setup_channelcd_interpret_sensein_mask2lenbwi_ack_rateural_eeprom_readscsi_iopool_destroylodirtypagessr_ioctl_disciplineem_probeumct_get_statusfindwin95VOP_WRITEsys_nanosleepre_rx_list_initstart_init_execifa_update_broadaddratu_detachnd6_addr_addifa_ifwithaddrclock_ymdhms_to_secssiop_add_devuhci_root_intr_transferbwi_dma_freebwi_phy_init_11b_rev2rootduidif_clone_attachuplcom_get_statussys_getfsstatohci_abort_xferbpfopencdstrategynetisr_intrem_config_collision_distnatsemi_irqackdeflatePrimerandomwrite_filtopsnd6_slowtimo_chuvm_km_valloc_alignenc_xform_nulluslhcom_writem_extfree_poolip6_pullexthdrcpu_idle_enterbwi_regwin_disable_bitscomwriteuvscom_intrbuf_kva_starttuagg_subVOP_RENAMEauth_hash_gmac_aes_128cdclosesys_fchdirsr_crypto_readsysctl_ifqprocess0ieee80211_send_eapol_key_reqrandompidwd_cdurl_initfilt_ttyrdetachrt2560_update_plcparp_inuseuhidwrite_bus_dmamap_destroyvn_polluhci_device_isoc_methodsinet6swrouteswdosdirtemplatemainbus_cdre_ioctlsys_mincorepdc203xx_setup_channelieee80211_tree_RB_REMOVElastsecondspci_probe_devicewi_get_txpowerural_plcp_signaludav_stopusbd_error_strslun_switchamphymatchtcp_maxpersistidleudav_tx_list_initspec_ioctlufs_initproc_reparentrt2661_select_antennauvm_exitfc_bmapcallsffs_initcluster_wbuildsr_crypto_createsvwsata_dmacmd_writescsi_ioh_setbootsyncuvm_initaue_attachieee80211_crypto_attachsys_ioctluvm_map_addr_RB_NFINDif_free_sadlbwi_mac_gpio_initucomstopfilt_bpfrdetachcompress2umodem_openicmp6_initbwi_mac_shutdownbs_notimpl_bs_rm_1uvm_mapent_free_insertfilt_ttywritepool_update_curpagesiop_script_readhid_end_parsein_setsockaddrcy82c693_readbpf_moveiniq80321_hdlg_irq_mapostypevndbuf_pooluplcom_resetuslhcom_get_statusuvm_page_physloadaxe_iffucomstartreset_entryuvm_pmr_remove_1strangere_setup_hw_imwdcresetwdc_exec_xferip6_insert_jumbooptipintrqtuaggsr_raid5_intrusb_frag_freelistip_slowtimordsizerijndaelKeySetupEncprocess_initializebwi_newbuf30rt2860_load_microcodeubsa_rtsip6_nexthdrrtdeletemsg__bss_startumsm_openrt_tab2domdcphy_cdbwi_rf_readpciide_via_productskue_rxeofsiop_attachrijndael128_encryptVOP_KQFILTERukphy_funcssys_msyncdeflate_compresswarmqueuewskbdreadsbappendrecordevcount_detachsd_caixp_chip_mapsoftdep_fsync_mountdevinitmsgbufehci_device_bulk_startpciide_intel_productsuipaq_dtrmemsetcuio_copydatapipe_free_kmemufs_getlbnsieee80211_get_actionphysiosr_ccb_donein6_selecthlimupl_sendwdattachmii_phy_delete_mediain6_unlink_ifaicmp_mtudisc_clonert2661_rf_writeuvm_pmr_insert_sizesodisconnect_spllowerumct_closesys_setgroupsmainaue_csr_write_2lxtphy971_funcsucomttyohci_device_bulk_doneether_crc32_le_updatemtdphymatchtimespecfixbwi_read_spromaxen_matchsr_raid1_set_chunk_stateuplcom_opensiop_lookup_productural_set_basicratesip_flushieee80211_delete_keykue_startre_watchdogsiop_scsicmduvm_unmap_removepmap_alloc_l1svwsata_chip_mapi80321_mem_bs_unmapicmp_errorwsmuxdevsbs_notimpl_bs_sm_1upl_rx_list_inituvm_swap_markbaddes_set_keykqueueopsrt2860_iter_funcsmsc_miibus_statchgvholdbufq_fifo_dequeuepciide_map_compat_intrubsa_parityidgen32rt_if_removesr_minphysscsi_default_getghash_gfmulusbd_no_quirkrt2560_ack_ratere_read_eepromsis_hostbr_matchuipaq_matchm_adjsr_wu_donemld6_stop_listeninguao_shrinksvwsata_read_regpmap_map_chunkextent_alloc_subregion_with_descrppsratecheckkmemlimitbuf_rb_bufs_RB_PREVrt2560_rf_writebwi_ioctlbwi_init_rx_ring32amap_copybufq_drainphysical_endbwi_phy812_valuebwi_rf_calc_nrssi_slope_11bbio_statusuhidpollmq_initsched_wasidlesr_raid5_initieee80211_ieee2mhzieee80211_dup_bssi80321_io_bs_mapuaddr_hint_destroylf_findoverlapwarmbufpagessr_raid_start_stopfilt_msdosfsvnodebwi_txtimelf_wakelockkv_anykue_attachhookdumpconfAES_CMAC_Initwi_rxeofehci_pci_detachbrgphy_cahpt_pci_intruaddr_lin_selectdead_badopbwi_dma_mbuf_destroypciide_dma_finishpool_large_alloc_niblf_cbc_decryptcalcrusys_unlinkmainbusmatchin_scrubhostrt_setgatetcp_ack_on_pushpmap_growkernelext2fs_rmdirufs_chowndofchmodatsysctl_intupl_tx_list_inituvm_shutdownkqueue_closepte_l2_s_cache_modeuvn_initstrlcatsysctl_int_arrbs_notimpl_bs_wm_8uvm_map_set_uaddrcdce_matchsoftintr_dispatchdisk_unlockpciide_cypress_productsufs_ihashremtaskq_destroycttywrite_bus_dmamap_createSHA256Inittcp_update_sndspacesr_crypto_doneurl_stop_taskpciaddr_device_is_agpsdmatchusb_freememudav_txeofproc0cdce_initufs_renameaxe_caext2gennumbersr_bio_ioctlbwi_rf_calc_txpowerudav_attachuvm_map_entrybyaddrsr_already_assembledusbd_get_hid_descriptorrt_ifannouncemsgsoo_readbwi_rf_lo_update_11gwdc_scrub_xferuvm_km_doputpagepciide_vendorspci_get_powerstateufs_opencopyout_statfspmap_modify_pvi80321_intr_establishm_catbwi_free_tx_ring32splxbwi_regwin_switchohci_pci_attachtqphy_statuscluster_collectbufskp_dma_contigcd9660_isohashsiop_handle_qtag_rejectwi_write_data_usbumass_scsi_minphysuvm_swap_inittcp_nowaue_miibus_statchgural_bbp_initdes1_setkeyunp_gcsys_clock_gettimeip6_hdrnestlimitcpuset_clearxscale_cache_syncI_rngfrag6_initsiop_sdtr_negbuf_replacevnodepte_l1_s_prot_kruvm_pmr_size_RB_NFINDiq80321_pci_intr_mapre_miibus_readreguvm_mapent_addr_removetimeout_setrdreadcrfromxucred__subdi3ntohsmsgbuf_putcharbwi_media_change_bus_dmamem_freesd_flushcd_setvolext2fs_mkdirohci_openpte_l2_s_coherentext2fs_direntersys_symlinkatmii_pollstatrlphy_cawdgetdisklabelrw_exitpciide_machdep_compat_intr_disestablishkv_pagedupfdopeni80321intc_calc_maskidgen32_initbwi_dma_ring_allocrt2661_amrr_node_freeifmedia_list_addpidhashrt2661_updatestatsrtprefxscale_context_switchuvm_totalencdebugugl_sendicmp6_ratelimitsr_raid1_createsys_mkdiratiic_searchdofstatatstart_inituhub_attachether_fakeaddrsysctl_tc_hardwaresmsc_rxeofscsi_ioc_ata_cmdtcp_mssdfltrt2661_alloc_rx_ringrt2860_updatesloti80321_bs_unmapuvm_swap_freeatu_newbufdata_abort_handlerbwi_tbl_write_4bs_notimpl_bs_r_1umsm_closeaxe_initsr_block_getuhidev_set_reportin_pcbdetachmsdosfs_vfsopststohzaue_ifmedia_updcd_sizettycheckoutqrt2560_watchdogpiix_timing_debugicmp6_mtudisc_callback_registeruvscom_set_linevm_map_unlock_read_lnaue_causb_explore_tasksrnd_event_spacesr_concat_rwpmap_clear_referencert_getmetricswdc_ata_bio_kill_xferin6_ifdetachcn_tabswaplist_insertsmsc_lock_miiip_forwardsensors_taskqextent_createrdclosebpf_freeddisklistin6_lifaddr_ioctlsys_fstatfsurl_txeofkue_devsbs_notimpl_bs_sr_8m_injectem_mta_setip6_mforwardingffs_isfreeblocki80321_mem_bs_freeseltrue_kqfilteruvm_map_lookup_entryhztoaxen_cdicsphymatchBlowfish_expandstatebs_notimpl_bs_w_4dead_strategypciide_dmacmd_readswi_handlergcu_miibus_writeregspec_fsync__wdcwait_resetdoacceptuvm_map_deallocateicmp_reflectieee80211_parse_wpascsi_xsh_iohext2fs_reclaimpciide_acer_productsffs_ballocnd6_rs_output_set_timosys_getgroupssr_raid5_xorieee80211_node_attachsys_linkatuhub_cdwi_start_usbgeneric_bs_wm_1ip6_raw_ctloutputkernel_textumodem_get_capsufs_startsigstkinitbrgphy_mii_phy_autoohci_devd__end__bwi_start_tx32nsphy_reseturl_sendcdce_encapufs_bmaparrayfragtbl8nd6_rs_timeout_counti80321_mainbus_attachuvn_sync_lockrtable_getaes_ctr_setkeyumct_attachurl_resetp2p_rtrequestusb_needs_exploreswaplist_findufs_quota_alloc_blocks2fc_fileextendsfilt_sigattachre_startricohrtc_settimeVOP_FSYNCbwi_mac_get_propertyffs_sysctlipport_hilastautoarpinit_doneusb_wait_taskuvm_anon_pageinspec_closecd9660_closeuvm_map_mkentryem_initialize_receive_unituvm_map_addr_RB_REMOVEsys_shutdowncngetcehci_rem_qhsii_fixup_cachelinetc_adjfreqrnd_statesm_gethdrem_dma_mallocconfig_rootfoundcue_cdputcsiop_resetsii3114_mapreg_dmaieee80211_phymode_namebufbackoffricohrtc_attachsysctl_rdstruct__divsi3uhidev_cdsr_raid1_initxscale_minidata_clean_sizeschedcpui80321_gpio_pin_readbwi_mac_bss_param_initrt2661_attachurlphy_servicesbappendcontrolukbd_set_ledssiop_update_scntl3pciide_nvidia_productsugenread_intr_filtopssoftdep_flushfilesipv4_inputm_getclrpool_headwsmuxioctlsr_crypto_read_key_diskpcaled_cdipforwardingohci_device_isoc_transferieee80211_get_cts_to_selfusbd_open_pipe_ivalicmp6_redirect_timeoutif_rxr_ioctlsyn_cache_lookupaxen_miibus_readregprtactiveksym_upcaseufs_makeinodescsi_xs_ioip6_process_hopoptsusbd_find_edescif_link_state_change_taskfilt_ttyreadsys_getpgiduhci_runcom_common_putcswaplist_trimcache_lookupaxen_detachrdioctluhci_allocxobsd_pci_mem_findrijndaelKeySetupDecbwi_rf_on_11auvm_objtree_RB_INSERTsysctl_tcurl_detachbs_notimpl_bs_rr_1umass_scsi_sense_cbrijndael_encryptricohrtc_clock_writeieee80211_recv_mgmtbwi_newstate_beginumsm_get_statusaxe_detachdumpsizesowwakeuppci_matchbyidukbd_keydesctabsr_raid_inquirysmsc_setmacaddressextent_freeuvm_aiodone_daemoni80321_gpio_pin_ctladdupc_tasksched_syncusbd_clear_hub_featureext2fs_vopscomcloseiopxs_mainbus_caeephy_attachsetsigvecsiop_dmamem_freeurl_iffsys_sendmsgi80321_bs_barrieruhidopenvn_marktextiic_cdbrgphy_bcm5411_dspcodestrcmpsys_quotactluhidev_matchsr_raid_startwuieee80211_get_hdrlentcp_mtudisc_increaseulmaxatu_txeofin6_pcbconnectdehashluphy_cakue_cduvm_pmemrange_addr_RB_INSERThook_disestablishexphy_funcsbpf_catchpacketffs_isblocksr_concat_createucomwritecbusbd_find_quirkuvm_swap_allocpagesuvm_aobj_poolsys_adjfreqpci_caqsphy_funcsuvscom_seticmp6_reflectsetrunqueueudv_attachsettimecdce_rx_list_inituhub_intrarm_pcache_typertable_inituaddr_lin_functionsata_set_modemii_phy_auto_timeoutsyn_cache_getnetisrttyrubieee80211_get_ratevop_generic_islockedrt2860_reset_tx_ringuaddr_hint_poolm_pulldownbufcachepercentbwi_mac_detachacer_pci_intrpmap_initufs_rmdirrlphymatchieee80211_next_scanpmap_zero_page_funcarmv4_tlb_flushD_SEminsr_meta_native_writeuhci_device_ctrl_abortip6_initconfig_detach_childrenrawcbpdc203xx_write_regsmsc_detachukbd_cngetcz_errmsgtcpcb_poolrt2860_updateproti80321_pci_make_taguvm_map_addr_RB_INSERTBlowfish_stream2worduhidclosetimeout_add_msecipip_allowsys_polluvm_map_clip_endufs_makedirentryusbd_set_configuvm_mapent_mergem_defragem_write_pci_cfgrtable_l2setvnode_hold_listlastdosdateudav_unlock_miibuf_rb_bufs_RB_NEXTuhci_add_bulkral_cdufs_linksched_choosecpusys_mkfiforicohrtc_matchzcallocural_read_eepromin6_ifinitin6_leavegrouprtlabel_id2sasqphy_caem_reset_hwsddumpiminnet_tick_tosys_chflagsobio_bs_tagget_hw_ifidKQRELEdelaypci_reserve_resourcessdstartip6_hopopts_inputselfalseieee80211_media_initricohrtc_gettimescsi_default_putsr_free_resourcescom_enable_debugportpage0_datavn_isunderusbd_get_port_statusuvm_pageoutpffindtypepdevnamespci_subclass_dockuipaq_breakqsyncehci_resetwi_setmultiuvn_clusterinitprocessre_gmii_writeregcd9660_vptofhwi_attachusb_camii_phy_downraw_inituvmspace_forkknote_enqueueudpcksumtcp_sendspaceurl_csr_write_4ml_dechainuvm_pmemrange_addr_RB_REMOVE_COLORffs_oldfscompatieee80211_add_rsnrijndael_decryptwdcdetachmaxlocksperuidfilt_ugenrdetachin6_matchlensys_madviseupl_openpipesehci_device_ctrl_methodsrt2560_plcp_signalscsibusdetachdisk_attachwskbd_displayioctllm75probeip6_clearpktoptsncpusarptfreeubsa_detachfilt_ugenread_intrbufadjustcom_detachieee80211_ccmp_encryptaxe_stopural_set_macaddrbs_notimpl_bs_w_2dead_printohcixfereephy_serviceinphy_servicemii_media_tablesr_discipline_freebwi_rf_lo_devi_measurewdstrategyrt2860_set_macaddrttyprintfi80321_pci_bus_maxdevsreaperprocsigcodehpt_chip_mapipip_inputdeflateCopyieee80211_send_group_msg2comttybuf_undirtysysctl_tstringsr_meta_clearusbd_start_nextxscale_cache_cleanDfilt_ttywdetachamap_swap_offpool_allocator_nointrbwi_pci_attachsys_sysarchallprocessrt2560_disable_rf_tuneBlowfish_decipherbio_validateigmp_initmii_phy_add_mediacpu_reset_needs_v4_MMU_disablecache_zapMD5Initem_txeofpcaled_gpio_pin_writecryptodesc_poolbus_space_write_raw_multi_2ffs_vfsopssysctl_mallocwihap_ioctlieee80211_outputfrag6_slowtimouvm_pmr_insert_addruvm_map_hintwant_reschedrt2661_amrr_node_allocpmap_bootstrap_pv_allocatormsdosfs_mkdirkthread_create_deferreduhci_free_sqhieee80211_ioctluhidevsubmatchcrc32_combinebufq_simple_nscandevid_freeboot_eaddrre_rx_list_fillscsibusactivatend6_timercomcnpollcatu_matchbioopenbwi_phy_set_bbp_attenqsphy_servicecd_patterns__cmpdi2sr_crypto_create_keyssd_ioctl_inquiryscsi_xsh_adduvm_pmemrange_addr_RB_FINDraw_detachscsi_xsh_runqueuepmap_get_pdeural_read_multiaxen_txeofbs_notimpl_bs_wr_1domainnamelenehci_pollpciattachigmpctl_varsusbd_get_report_descriptorsd_thin_paramsip_rtaddrfiledesc_initrt2661_enable_mrrload_dsatag_switchurl_ifmedia_statuspciide_pci_readatu_get_cmd_statuscue_csr_read_1vrelewi_set_pmwsmux_do_displayioctlohci_alloc_sedem_set_media_typeem_update_link_statusscsi_xs_errorprtrealloccheck_consoleamap_freeem_detachin6_domifattachnd6_rs_dev_stateugen_get_alt_indexusb_blk_nfreend6_prefix_lookuptc_getfrequencyrt2661_mcu_cmd_intraxen_tickuhci_device_ctrl_methodsbwi_rf_lo_adjustsync_inactivespec_printukbd_apple_mba_mungeext2fs_lookupmsdosfs_openehci_hubdext2fs_linkvop_generic_revokeohci_hash_add_itdieee80211_decapfilt_sigdetachfilt_seltruedetachext2fs_renameipsec_def_authuhci_add_loopusbd_setup_isoc_xferttywflushcd9660_rrip_offseturl_startwskbd_default_keyrepeat_datacomcnmodeclosefcomioctlumass_cbi_resetscsi_ioh_deqsoftdep_sync_metadataif_clone_lookupgetmicrouptimedisk_openpartmii_tickip6_dad_countem_pci_clear_mwiatu_complete_attachumct_breakuvm_pager_dropclusterfilt_generic_detachuvscom_rtsip6_getmoptionssensor_task_unregisterehci_intrlist_timeoutbwi_rf_calc_rssi_bcm2053wdc_ioc_ata_cmdcd_get_parmspmap_extractrt2860_set_chanin_purgeaddrnd6_ifptomacamap_unaddural_watchdogmsdosfsread_filtopsuvm_pmr_insertcd9660_printsr_meta_saveohci_rhsc_enableif_congestionnfilescd9660_islockedin6if_do_daduhci_root_ctrl_transferrt2560_amrr_timeoutcue_txeofrt2661_amrr_node_findatu_rxeofaue_detachpipe_kqfilterdowait4em_configure_k1_ich8lannforce_pci_intrext2fs_openpmap_devmap_find_papmap_kenter_cacheusb_insert_transferaxe_matchukbd_keymapdatasr_meta_validateuslhcom_readstopprofclockbufq_nscan_destroybwi_rf_on_11bgnullioctlcertance_irq_mapsys_getentropypte_l2_l_cache_modeisohashrt2860_rssi2dbmmclsizesparsediskre_eeprom_getwordrt2860_calibwi_set_debugbwi_regwin_selectbreadem_intrieee80211_node_copynd6_rs_outputamap_lookupipctl_varsapollo_setup_channelpmap_page_removert_timer_remove_allwskbddevprintuhid_intrpcaled_gpio_pin_readrt2860_free_tx_poolwdc_output_bytesatu_ioctlieee80211_classifyaxen_ax88179_initproc_stop_sweepieee80211_media_statusiophy_capmap_set_pt_cache_modescsi_xs_exectcp_usrreqmichael_keyieee80211_setbasicratessd_interpret_senseuvm_map_pageable_pgonuvm_addr_invokeudp_usrreqifmedia_initrtable_l2ext2fs_vfsopsuvm_mapent_freeext2fs_inactivedead_bmapif_getgroupmemberssoo_kqfilterml_enqueuecpu_startupusbd_set_hub_depthamap_refehci_device_bulk_transferuhci_device_isoc_transferwdc_ioctlamphyattachrt2661_updateslotfdexpandcoredump_countsegs_elf32sr_wu_inittickswdc_ata_presentpdc20262_dma_finishmsdosfs_closerd_detachpool_do_getext2fs_setattrsysctl_clockratevn_rdwrohci_close_pipend6_need_cacheip6intrbwi_phy_writesyncer_maskwdc_default_write_raw_multi_2uvm_pagedeactivatecy82c693_initufs_unlocktcp_ctloutputrt2860_mcu_cmdrt2661_plcp_signalukphy_statusieee80211_derive_pmkidMD5Updateblktochrifmedia_setscsi_iopool_puttask_setem_setup_interfacebio_lookuppmap_createuvm_map_extractsr_crypto_meta_opt_handlernd6_prelist_addufs_removepciide_activatesysctl_tc_choiceptsignalboottimecd9660_readlinkxscale_cpu_sleepVOP_ADVLOCKaxe_watchdogwskbd_mux_closefrag6_inputuhci_device_intr_closecompressBoundpmap_alias_distunpst_sendspaceffs_indirtruncsmsc_cdieee80211_add_ratessr_raid5_rebuilduvmspace_freetcp_rscalettwakeupext2fs_inode_poolffs_ino_poolpci_detach_devicesmii_phy_statusmsgpdc203xx_irqackcpufunc_domainsswapdrum_getsdpVOP_PRINTfdsharepci_subclass_memoryuipc_setaddrugl_tx_list_initicmpv6ctl_varsbwi_rf_lo_measure_11bfintek_matchcdstartgf_premulfilt_generic_readwriteuserconf_disableumct_methodsvrefin_scrubprefixusb_detachipforward_rtuhci_device_intr_startbwi_rf_lo_update_11bem_access_phy_reg_hvohci_device_isoc_closeuplcom_attachurl_int_miibus_writereguhidev_activateAES_CMAC_Finalsr_uuid_formatuvisor_cdsd_cmd_rw16ghash_updatesiop_cmd_putbwi_rf_set_chaninpcb_pool_initializedsys_nosysbwi_regwin_disableat_pollallproccdevswsr_rebuildxscale_cache_flushDumodem_get_statussys_mlockallwskbdcloseuvm_sysctlucom_do_closegetsndiskmapopen_bus_dmamem_unmapsys_fchflagsnamei_pooluslhcom_clear_fifouhci_device_intr_transferarp_poolsmsc_ifmedia_stsukphymatchuvm_pager_putdiskmapcloseohci_device_bulk_abortbwi_newstateem_access_phy_debug_regs_hvudav_cabwi_get_clock_freqin_canforwardieee80211_clean_cachedsmsc_unlock_miiohci_device_intr_abortieee80211_tree_RB_INSERTpmap_destroyip_oursscsi_mode_selectkernel_pt_listuvm_map_freelist_update_clearetherbroadcastaddrieee80211_rssadapt_updatestatssii3114_chip_mappte_l1_s_prot_urvfs_getnewfsidaue_rxeofem_cducom_attachudp6_ctlinputitimerroundSHA512Finalaxen_miibus_writeregarm32_vector_inituvm_pmr_size_RB_PREVscsi_print_sensewskbd_update_layoutmmopenffs_inode_freeohci_device_intr_transferwdc_cdpci_findproductamphy_statusukbd_intrrtioctlkue_ctlscsi_xs_putuaddr_hint_functionsieee80211_tree_RB_INSERT_COLORprofprocswdc_free_xferip6_inputbuf_free_pagessleep_finish_signalicsphy_cdwi_usb_cmdrespsr_crypto_alloc_resourcesgeneric_armv4_bs_rm_2route_srcnet_tickbootduidehci_pci_activatespeedup_syncerigmp_sendpktloop_clone_destroywdc_ata_bio_doneifmedia_baudrate_descriptionsv_putcsr_scsi_wu_getbwi_rf_clear_tssim_getptrukbd_caufsvnode_filtops_bwi_adjust_devideuvm_fault_unwireuserconf_common_attr_valsched_noidleuhci_add_ls_ctrlobsd_pci_io_findsys_getitimerhid_get_datadonicewdcstartcpu_configuresr_rwohci_pci_attach_deferredip6_freemoptionssqphy_funcshidkbd_delayed_decodeieee80211_amrr_chooseusb_create_task_threadsieee80211_end_scancdce_txeofbufhighpagespmap_fault_fixupdcphy_serviceuaddr_poolrn_refinesgeneric_bs_rm_4hmac_opad_buffersockargshpt_setup_channelhidkbd_ioctlvop_generic_abortopsr_raid6_set_vol_statesetregsupl_rxeofsobindvmcmd_map_zerovfsinituvisor_closeupl_caubsa_paramcnclosetcp_do_rfc1323ip_fragsin_addhostwdc_dmawaitmii_phy_setmediain6_ifpprefixkd_trylocklo0ifphostidwi_alloc_nicmem_usbusbd_free_bufferuvm_pagermapoutsr_raid0_rwif_downallext2fs_vptofhnam2blkrw_statussr_raid6_assemblecoredump_writeseghdrs_elf32rt6_deleterouteip_maxqueuesysctl_ttyieee80211_chan2ieeeuhub_cain_socktrimext2fs_dinode_poolieee80211_node_cmprtallocsys_mprotectuhci_alloc_sqhieee80211_std_rateset_11gdequeue_randomnessuvm_km_kmemalloc_plart2560_alloc_tx_ringcue_casyncer_maxdelaydeadprocml_filterstart_reaperehci_root_ctrl_methodsif_rxr_info_ioctlsys_fcntlnforce_setup_channelvfs_free_addrlistsys_setrlimitsys_sigpendingbwi_led_blink_startrt3090_efuse_read_2loop_clone_creatediskmapwriteem_hash_mc_addri80321_timer_initeduvm_map_cleanuvm_pmr_get1pageicmp_redirtimeoutttyclosewdrestartugen_isoc_rintrcomp_algo_deflatemaxvfsconfml_dequeuetimeout_addcpu_cdip6_forwardbufcache_adjustnumcacheobio_bs_freesr_bootkeycmd0643_9_setup_channelural_write_multiuvm_pagecountcpu_initclocksbwi_mac_fw_alloccue_sendwskbdioctlmii_downin_pcbhashbrelseext2fs_unmountpsratiosdminphysohci_device_isoc_methodswi_usb_tx_lock_tryaxe_unlock_miicpuset_delnd6_rs_output_timottyoutdevice_lookupehci_device_requestbpf_sysctl_lockedwi_usb_txeofsr_crypto_preparecdminphysschedhzurlphy_caem_allocate_pci_resourcesi80321intc_write_steerrip6_inputtcp_totbackoffvdropuserconf_basesr_raid5_rwpci_subclass_displaylooutputrt3090_rf_readcue_setmultisoisdisconnectedcpu_coredumpxscale_cache_clean_addrrevbitssvwsata_drv_probedvd_read_disckeypmap_clean_pageuvm_aio_aiodonesr_ccb_rwpmap_clearbitieee80211_mgmt_outputcrypto_freereqsyn_cache_rmclrbitsuvn_putigmp_checktimerscsi_add_linkpci_vga_taguslhcom_set_baud_ratexscale_cache_clean_minidataieee80211_proto_detachmii_phy_statusuvscom_matchcommajorcrypto_newsessiongeneric_armv4_bs_r_2enc_xform_aes_xtssoclosesr_ccb_freescsi_detach_targetinstall_coproc_handler_staticwakeup_nsys_connectbuf_daemoncrsetskpcluphy_funcsieee80211_bip_decapbufq_fifo_createohci_root_ctrl_transferipv6ctl_varsroute6_inputbs_notimpl_bs_w_8board_startupsys_socketpaircnreadpcimatchcertancepci_addr_fixupdounmountuvm_swap_allockthread_create_nowuslhcom_matchhidkbd_bell_fn_argtcp_ackdrop_ppslim_countarm_picache_sizesr_map_rootttspeedtabns_scx200_setup_channelkqueue_readcd9660_mountuserconf_maxdevre_pci_attachcue_inituvm_pmemrange_addr_RB_INSERT_COLORfork_tfmrateacard_setup_channellxtphymatchi80321_bs_initsr_hotplug_registerpv_sizeuvn_sync_qin_proto_cksum_outwskbd_activatewi_media_statusurl_miibus_statchgnd6_purgeaxen_unlock_miitcp_keepidleif_attachheadnextcwi_scan_timeoutuvm_wakeup_plaiszerodevuhci_devdciphy_caauth_hash_hmac_ripemd_160_96umass_caem_hardware_initgeneric_bs_sr_4lf_freesys_fhstathotqueuenullmodemohci_hash_find_itdbwi_ds_plcp_headerprobe_addrs_eepromif_attachdomain1sys___get_tcbraw_recvspacebwi_mac_set_ackratesieee80211_amrr_node_initdiskerrwi_startcd_cdieee80211_state_namesys_preadem_media_statusscsi_moveehci_root_intr_abortkernel_pt_lookupkmem_mapcd9660_check_exportuslhcom_detachukbd_translateconfig_pending_decrqsphyattachaxe_startieee80211_input_print_tasksoqinsquediskstatscdce_attachdes_ecb_encryptudp_inputnchrtoblktblehci_sb700_matchihashrn_search_mresettodrusbd_ref_decrpcaled_attachufs_readdirsys_flockiq80321_startpvwi_usb_do_transmit_syncspec_badopbwi_memobj_read_2msdosfs_linkbufq_nscan_dequeuepciide_unmap_chanbs_notimpl_bs_c_1ohci_root_intr_methodsicmpctl_varsigmpstatsuspend_randomnessmichael_finalvn_initialize_syncerdpipeselwakeuprt2860_get_rfxscale_controlcd9660_quotactlsr_rebuild_starticmp_sendadjtimedeltauhci_root_ctrl_donesiop_morecbdcy693_chip_mapcdce_watchdogsmsc_newbufsiop_ppr_negwdc_ata_errieee80211_choose_rsnparamstime_uptimevm_min_kernel_addressuvm_pagealloc_pgcdce_intrsmsc_rx_list_initfilt_uhidreaduvn_wlistuvm_pmemrange_addr_RB_REMOVEsowakeupinsidetcp_autorcvbuf_incbufq_queuebs_notimpl_bs_r_4prefetch_abort_entrysigactsunsharetimeout_hardclock_updaterdattach_edatagcu_miibus_statchgupl_detachrijndael128_decryptttkqfilteri80321_pci_conf_writem_tag_deletecd9660_ihashrembwi_phy_readsensor_findip_fragmentfilt_timerusbd_endpoint_countsys_statfsSHA1Finalsensordev_deinstallsched_nomigrationsinittimecountersys_sendsyslograwin6pcbtablepmap_protectkprintfdevice_unrefrc4_keysetupdcphy_matchscsi_startuvm_pmr_addr_RB_REMOVE_COLORin_cksumvnode_poolzombprocessrt2661_rx_intruao_shrink_convertvnode_free_listtcp_savetiuvm_pagereallocbwi_setup_desc32iicprobeinitsensordev_countrt2661_stopiic_ignore_addruvm_fault_unwire_lockedklist_invalidateuvm_km_createthreadubsa_flow_endpciide_attachdes_check_keyrt_senddesyncsogetopthid_report_sizeuvm_unmaprd_matchricohrtc_cdusbd_ref_waitsr_crypto_calculate_check_hmac_sha1pollscandomaininitsii3112_setup_channelvflushbuftime_secondbwi_pci_matchacer_chip_mapip6_forward_rtwskbd_get_mapentryuvm_pmr_initsr_hotspare_rebuild_callbacksbcreatecontrolsys_mlockieee80211_setup_nodebioioctldvd_read_structvdevgoneumsm_intrhtonsehci_pci_attachubsa_setbucketkqueue_writesys_syncieee80211_reset_scancominitaxen_resetrt2560_newassocenodevobio_bs_barriersr_raid0_discipline_initffs_mountfsin_delayed_cksumfintek_fullspeedi80321_mem_bs_allocrtstatttvtimeoutatu_startkd_waitokabtstacktimingsafe_bcmpspeclisthbdwritecpu_idle_cycleversion_to_spcVOP_INACTIVEwsmux_do_closepte_l1_c_protouvm_mapent_biastcp_syn_cachernd_event_idxhaltpciide_sis_productseephy_cainphy_caieee80211_std_rateset_11akputcharbootargssys_getsidRMD160Initdisk_gonewi_write_record_usbcue_csr_read_2uhci_device_setintrm_trailingspacefileheadrc4_cryptusbd_alloc_xfernextvnodeidcttypollsr_meta_initural_startkp_dma_zerosensor_task_ticksys_swapctliic_dumpcpufunc_dfsrbd_reqbs_notimpl_bs_rm_2copypktoptsin_selectsrcrn_add_dupedkeymsgscpu_exitip6_initpktoptsbwi_get_eaddruvn_getwsmux_add_muxbpfilter_destroyunp_attachohci_device_isoc_starttcp_syn_bucket_limitsys_renamesr_raid6_xorqpci_vga_procfrag6_nfragsip6_log_timeem_deviceseephy_statusinphy_statussii3114_chansetupxscale_cache_purgeDscsi_activate_targetuvm_km_valloc_waitufs_ihashinitunp_defersys_sigreturnbwi_iter_funcsbflushehci_device_intr_transferscsi_link_closeipsec_require_pfsswapdevwd_cakue_sendsr_raid5_openingsaxe_tick_taskvn_readnclrunegheadbwriteleavepgrprt2860_set_gp_timerqsphy_cdarmv4_tlb_flushDkernel_pt_tablepmap_get_pde_pteuvmpageropsuvm_page_initohci_root_intr_closestatminsr_copy_internal_dataehci_root_ctrl_closeem_fill_descriptorscast5_decryptbrgphy_copper_funcsxscale_setuprt2661_set_bssidnamecache_rb_cache_RB_INSERTpcaled_gpio_pin_ctltcp_timer_funcsipqent_poolif_attachdomainubsa_requesticmp_ratelimitieee80211_rssadapt_raise_ratesr_crypto_decrypt_keyuhci_rem_loopuvm_km_page_initrttimer_pooladler32_combineieee80211_regdomain2flagadd_entropy_wordsrt2560_rxratergephy_load_dspcodesosendtaskq_initdosetrlimituvm_pmemrange_addr_RB_PREVrn_inituvm_objtree_RB_NEXTsr_scsi_probecmd_channel_maploopattachsiop_update_residural_rxrateieee80211_save_iewdc_input_bytesusb_abort_task_thread_procRMD160Finalrt2661_set_slottimepci_get_ht_capabilityscsi_cmd_rw_decodeprocess_read_regschainlengthbwi_mac_startwdc_pdc203xx_vtblusb_fill_udc_taskpte_l1_s_prot_masksys_unlinkatural_disable_rf_tunettwakeupwrrn_lookupthrsleep_unlocksr_wu_release_ccbspciide_ati_productsrtmask_poolsmsc_write_reguserconf_show_attrsys_execveamd756_chip_mapite_setup_channelfdallocprfindrt2860_updatestatsrt2661_alloc_tx_ringscsi_donert2860_set_bssidchkvnlockhw_sysctltc_ticktockrt2560_newstatephtree_RB_MINMAXuhci_device_bulk_abortpmap_alloc_l2_buckettcp_syn_cache_limitnumvnodescomreaduvm_pagefreeehci_device_isoc_abortext2fs_inode_allocswcr_encdecbufq_fifo_queuein6_pcbbindpool_large_allocicmp_do_exthdrreaperbwi_bus_initcoredumpfilt_kqueueugen_cdmalloc_roundupusbd_strpipe_readuhci_root_intr_closeuvm_map_addr_RB_INSERT_COLORifioctlsys_utimesusbd_do_requestnd6_storelladdrrip_initsocreateobio_searchusbd_find_idescpmap_cache_statemq_enqueueureadcatu_get_dfu_stateaue_startufs_setattrrijndael128_setkeyieee80211com_headlogprimemhookdoclusterreadcast5_encryptsys_exitpciide_chanfreesbtryuvisor_matchm_applyaxen_ifmedia_updswcr_processudav_startaxe_lock_miirt2560_detachwdc_exec_commandudv_lockbufqswdcintrcd_playHMAC_MD5_Updatesys_clock_getresaxe_attachsyn_cache_insertrc4_getbytesswcr_authencttystats_initpciprintpci_mapreg_probeem_allocate_receive_structuresbrgphy_ber_bugucom_matchnd6_umaxtriesohci_device_intr_donedochflagsatdcphy_reseti80321intc_read_intsrcpte_l2_s_prot_kwnd6_setmtu0nd6_debugip6_maxdynroutesuvm_map_pieumodem_cawindow_deflateehci_root_ctrl_transfercpu_cpuspeedpciide_cmd_productscpufunc_iddefrtrlist_updatert3090_rf_writeurl_csr_write_1_tr_initSHA1Transformesymieee80211_defragcrypto_invokeosreleaseubsa_breaki80321_io_bs_initVOP_RECLAIMscsi_probe_targetsr_raid1_set_vol_stateip6_getpcboptbuf_releasert2860_newstateucom_cdsiop_update_xfer_modeHMAC_MD5_Init__modsi3smsc_txeoftcpqe_poolpgrp0mainbussearchurl_watchdoguvisor_inituserconf_changerdcide_holduserconf_helpsr_ioctl_setstateufs_advlockicmp_initsii3112_chip_mapcdst_pteuvm_growinet_ntopvfinddevieee80211_node_cleanupE_ldsa_abs_reselected_Usedral_pci_attachpciide_unmap_compat_intrugl_attachrt_msg1ehci_device_bulk_methodsether_delmultibrgphy_5709s_statussave_rtesr_crypto_get_kdfmainbusattacharc4_taskbwi_watchdoguvscom_paramexec_sigcode_mapsys_gettimeofdayipsec_soft_timeoutwdccommandshortieee80211_rate2mediavcleanuhci_device_bulk_doneiophy_servicecd_getvolsplassert_ctlsys_getresuidsys_fhopensr_crypto_ioctldos2unixfnpciaddr_do_resource_allocatescsibussubmatchrtentry_poolbufq_restartuvm_km_pgremove_intrsafeext2fs_sbupdatein6_init_address_ltimesdefrtrlist_delsys_fchmodatu_watchdoguvm_unmap_detachieee80211_recv_authehci_add_qhupl_initusb_dev_quirkswskbd_srcopsdopselectuserconf_common_devhfsc_purgestartusbd_devinfosiop_wdtr_negral_pci_wakeupuvm_mapanonvn_isdisksys_selectbwi_attachdeflateParamsbwi_mac_initbadaddr_read_1vop_generic_lookupin6addr_intfacelocal_allnodeslogreadumsm_cddead_lockieee80211_name2regdomainbwi_nrssi_11gtcp_issphysical_freestartfc_largedistancesys_setitimerisofntransurl_attachnd_prefixsmsc_tx_list_initvfs_unregistermii_phy_flowstatussmsc_ifmedia_upddisk_mapselwakeupumct_set_baudrateffs_reloaddefault_chip_unmapem_initialize_transmit_unitcnwritert2661_reset_tx_ringumass_bbb_get_max_lunin_ouraddrpolloutehci_device_bulk_doneuipc_usrreqnd6_na_inputvflush_vnode_bwi_rf_lo_update_11gaes_key_unwrapem_media_changerip6_usrreqin6mask96coldunp_scansbappendaddrbufqs_mtxbpf_maxbufsizeextract_entropyufs_islockedusb_detach_wakeupffs_unmountffs_vopsdofutimenssys_pwriteisohashtblwihap_shutdownuvmspace_allocrevarpinputbufq_nscan_peekcd_pausecompresshashinitttstartumass_setup_transferciphy_statuswdwriteipsec_keep_invalidpciide_channel_dma_setupuao_detach_lockedpci_devinfoumct_set_lcrieee80211_parse_rsn_akmrt2661_newstatesdopentcp_tracemii_phy_resetip_getmoptionsuhci_hubd_piixin6mask32__moddi3disk_countohci_confdpmap_page_protectdead_openscsi_detach_lunsr_ioctl_inqkue_setworddodup3userconf_attrwdc_kill_pendingbmtphymatchicmp6_redirect_outputroute_cbsys_futimenstaskq_createexphy_cdreadepcpuset_init_cpuscsi_init_inquirylxtphy_resettcp_slowtimoieee80211_std_rateset_11bre_setup_intramphy_cdcd_play_msfpmap_remove_pvtcp_newtcpcbsbchecklowmemswapmountffs_mapsearch_bpf_mtapsys_fhstatfself32_load_filesys_getpeernamert2860_alloc_rx_ringrt2560_prio_intri80321_bs_subregionehci_device_intr_closeehci_intrieee80211_get_txkeyscsi_strvistcp_set_iss_tsmbpfwritedoingcachesys_getrusagescsi_probepdc205xx_do_resetauth_hash_hmac_sha2_256_128aue_reset_pegasus_IIuvm_map_addr_RB_MINMAXbufq_destroyusbd_get_cdescnd6_prunert2560_set_chancomconscflagm_getbwi_bbp_power_offffs_truncateuhidevprintmii_attachuvscom_cabwi_rf_workaroundttylclosecmd680_chip_mapconsbufpwdc_svwsata_vtblpool_allocator_allocsiop_cmd_getwdc_default_read_regchar_typeohci_free_sitdusbctlprintvn_closeuftdi_readudav_csr_writeuhid_do_readdoclusterwritert_timer_queue_countusbd_close_pipeusbd_deactivateffs_writeieee80211_wep_set_keyfilt_sowdetachnd6_initip6_maxfragsm_extref_mtxlimfreedoutimensatuhci_reset__wdccommand_intrrt2661_startuvm_km_free_wakeuprootvnodeehci_initifmedia_ioctluserconf_modifywi_usb_rxeof__one_cmpldi2cpufunc_nullopcd9660_ihashgetumct_camii_phy_detachatu_media_changeumsm_huawei_changemodewskbd_add_mux__muldi3umct_cduhidev_caurl_lock_miiip_mtudisc_timeoutrandomopenin6addr_linklocal_allnodesamphy_cabufinitubsa_closebootconfigscsi_quirk_patternsuserconf_lineslimit0ciphymatchuvm_md_constraintsif_attach_commonE_abs_targ0_Useduniqdosnamesr_raid5_set_vol_stateinflateSetDictionarypfxrtr_lookupext2fs_mknodvttoif_tabbgetvppgrp_poolsr_concat_assemblesmsc_ioctlsd_cmd_rw12ucomstartreaduvm_pmr_addr_RB_INSERT_COLORucred_poolxscale_cache_purgeD_rngcpufunc_ifsrip_insertoptionsdes3_setkeyarp_maxtriespmap_uareacd9660_bmapaue_eeprom_getwordukbd_cnbellphtree_RB_INSERTrt2661_initnaptimedcphy_funcscom_obio_attachufs_dirbadentrybwi_rf_init_bcm2050bwi_get_firmwarelogioctlicsphy_funcsubsa_databits_bus_dmamap_load_uiogeneric_bs_wr_1strlenrt2661_intrsensor_task_workinitialvnodesuhci_cdconfig_suspendieee80211_parse_rsn_cipherpool_page_freewdactivatecopystrsched_nmigrationswdc_do_resetiftxlistsys_pipert2661_free_tx_ringural_setup_tx_descusb_detach_waitarm_pdcache_waysarp_rtrequesthw_vendorbwi_mac_testieee80211_encryptxscale_setup_minidataext2fs_reload_vnodeelf32_check_brandwi_cor_resetudp_initieee80211_recv_4way_msg3i80321_pci_conf_sizeproc_trampolinesys_rmdirem_attachcd9660_vfsopscpuset_copyem_get_bus_infobrgphy_5709s_funcsspec_accesssocantsendmoreusb_rem_taskpte_l2_l_cache_masksiop_sdtr_msgcdactivateuvm_vsunlockether_inputlockstatus_splraisequotaoffbwi_phy_init_11b_rev4coredump_note_elf32fs_posix_sysctlif_slowtimouhci_root_ctrl_abortsmsc_tickudbtablewi_setdefwdcattachufs_printem_rar_setuaddr_lin_createfatentrywi_update_statsAES_CMAC_Updatesiop_startbwi_pci_devicesusbd_printBCDsys_statrt2661_txtimeukbd_apple_mungein_baddynamicieee80211_keyrunlineswmsdosfs_symlinksys_symlinkicmp6_sysctlpool_p_insertclfreeconfig_found_smem_check_phy_reset_blockuhidread_filtopsusbd_interface2endpoint_descriptorfdreleaseehci_disownuvm_swapout_threadsural_bbp_writetask_addknote_attachmax_keylenrt2860_ioctlieee80211_tkip_decrypt__assertif_congestion_clearnd6_dad_ns_outputin6_prefixlen2maskuvm_pmemrange_use_insertudp6_outputieee80211_prfcn_devvpcom_activatewi_get_debugmaxfilesupl_devsuvm_pagecmpuvm_pageactivatein6_addr2scopeidgf_mapdma_alloc_bus_dmamap_load_rawffs_mountrootrd_cduplcom_paramrrw_statusuvm_map_pageable_allsleep_finishehci_device_isoc_closeipqtaskq_next_workrn_fixup_nodesmsdosfs_strategycd9660_vopstimeout_delem_ioctlural_media_changeuhci_alloc_stdrt2661_load_microcodeieee80211_chan2modeif_delgroupspec_strategybwi_rf_initiic_cauvm_pglistfreebwi_tmplt_write_4usbopenext2fs_readsoo_statwskbd_cnpollckue_newbufuvm_map_isavailrusage_pooldisk_detachstrchrtask_delsystqubsa_methodsehci_check_itd_intrscsi_plug_poolrgephy_capci_mapreg_infouvm_pmemrange_use_cmpaes_xts_encryptrt2661_free_rx_ringuvscom_cduvm_pmr_size_RB_INSERT_COLORauth_hash_gmac_aes_256crypto_driverssysctl_int_loweriftovt_tabtcp_backoffsys_chrootehci_odevdubsa_cdieee80211_rssadapt_lower_rateumodem_dtrehci_device_clear_toggleuhci_portresetrt2860_attachicmp6_redirtimeoutenc_xform_dessoisconnectingarc4random_bufpci_subclass_processorsr_wu_freeehci_check_qh_intraobj_pageruvn_iogeneric_armv4_bs_w_2MD5Transformmld6_inputgeneric_armv4_bs_sr_2em_set_eee_pchlanrgephy_mii_phy_autobpf_d_listsr_wu_allocuhci_root_intr_donesyn_cache_cleanupip_pcboptsfc_purge__data_startrdcide_setupifmedia_delete_instancefilt_timerattachE_ldsa_abs_data_Usedurl_caenc_xform_aes_gcmml_joinbwi_mac_stoprt2860_txrx_enableucom_breakpdc205xx_pci_intruvm_mapent_allocudav_miibus_writeregacphymatchicmp6statgeneric_bs_w_4inflateEndrt_checkgatebufcache_takesr_set_vol_statewsevent_pollsys_profilvmcmd_map_pagedvnciphy_serviceugl_stopin6_pcbhashlookupbpf_detachdVOP_UNLOCKpmap_uncache_pagesingle_thread_setehci_root_ctrl_abortsyn_cache_initcd9660_wchar2charieee80211_find_txnodeip_ecn_egressether_ipmulticast_maxsr_raid6_createohci_checkrevbwi_dma_txstats_freeuvm_init_limitsukphy_cdentropy_input_rotatesii3114_dmacmd_writein_pcbconnectem_free_transmit_structurespciide_dmacmd_writeVOP_POLLVOP_IOCTLrt2860_node_allocstatvarsafepriluphy_cduhidev_ioctlwdc_default_read_raw_multi_4ip6_copyexthdruao_swap_offmachinebwi_newbufwi_cmd_ioVOP_CLOSEbwi_reset_rx_ring32uvm_anallocin_pcbdisconnectuvm_vnp_terminatewi_usb_rxfrmsys_getpiduaddr_rnd_functionsipmultipathunp_dropugl_matchuvm_map_advicetcp_mtudisctimeout_startupcue_matchrt2860_eeprom_read_2fintek_read_regrn_addroutesdactivatefilt_msdosfsdetachural_detachuslhcom_methodsukbd_cnpollcdoreadlinkatdvd_read_manufactundstackconfig_activate_childrenip6_check_rh0hdrieee80211_input_printdomkdiratem_allocate_transmit_structuresnforce_chip_mapem_mc_addr_list_updateremrunqueueatu_initial_configusb_fill_udf_tasksoo_closesiop_handle_resetumodem_rtstcp_recvspaceuvm_meterumodem_intruhidev_maxrepidpmap_needs_pte_synctcp_ackdrop_ppslimuhci_ifcdsii3114_write_regehci_device_ctrl_donemaxthreadnd6_lookupin_insert_prefixieee80211_cache_sizescsi_iopool_runurl_openpipesukbd_countrylayoutbwi_led_durationsys_getppidsr_raid_request_sensescsi_ioh_pendingmii_anaruaddr_rnd_selectrc4_skipVOP_READDIRdomainssys___sysctlsd_cmd_rw6arm32_dma_range_intersectin4_cksumextent_alloc_subregionrt2661_node_allocneedbufferin6_ifattachtcp_rst_ppslim_lasticsphy_cabs_notimpl_bs_rr_4SipHash_Initohci_root_intr_doneiq80321_thecus_irq_mapip6_multipathusbd_get_device_descriptorcd9660_initumass_fixup_yedataiicprobeipsec_soft_bytesmichael_initnselcollemul_elf32usbd_open_pipeohci_softintrmsdosfs_lookupspec_pathconfmountroothook_listhook_establishem_copper_link_autonegbrgphy_copper_statustcptv_keep_initsys_chdirext2fs_diremptyuserconf_cntdcphy_caE_abs_msgin_Useduvscom_methodsext2fs_inode_freescsi_io_get_donexscale_cache_clean_sizebuf_objectip6_rr_pruneuao_grow_convertjmicron_setup_channelusbd_desc_iter_initsbcompressiic_smbus_receive_bytepmap_free_l1nd6_outputSHA512Lastcdevsw_lookuplogsoftcsys_adjtimerijndael_set_key_enc_onlyuiomoveiohci_device_clear_togglesr_ccb_allocwdstartwsmuxreadamap_splitrefspec_open_clonewskbd_do_opensd_thin_pagesnclruheadscsi_move_doneural_next_scani80321intc_inituvm_aio_biodonern_initheadusbd_get_descvop_generic_unlockrt_timer_adduvmspace_shareentropy_poolpci_get_capabilityieee80211_print_essidroute_usrreqdeextendspec_vopsem_gate_hw_phy_config_ich8lanieee80211_wep_encryptsr_raid6_openingsem_receive_checksumieee80211_recv_deauthsched_init_cpure_config_imtypetcp_dropicmpstatcom_irq_overrideudpctl_varsuvmpd_scansys_getrtablem_prependsoftraid_casmsc_resetinflateInit2_cd9660_pathconfin_pcbrehashsyncer_delaynore_tickre_resetin_arpinputpmodehci_root_intr_transferufs_accessin6_embedscopeif_alloc_sadlphpoolunix2winfnmsleephfsc_enqueuepiix_setup_idetim_drvsreassignbufuhci_confdsiop_minphysip_freemoptionssr_meta_rwsohasoutofbandieee80211_release_nodesch_setup_channelbs_notimpl_bs_c_2nd6_dad_duplicated_bus_dmamap_unloadieee80211_free_allnodesmsdosfs_fhtovppte_l1_s_coherentbs_notimpl_bs_wr_4maxvnodesether_crc32_besiop_setuptablesinflateBackEndieee80211_add_ssidcpu_reset_address__explicit_bzero_hookpgfindatu_rx_list_initobio_attachsoftint_pendingtcp_ackdrop_ppslim_lastloadfirmwareswcr_compdecbwi_mac_lateattachral_pci_devicesip4_inputtcp_inputsysctl_dumpentrydkcksumnd6_gctimerieee80211_ccmp_decrypturl_csr_write_2iptimerip_inputwi_set_txpowernd6_setmtuaxe_ifmedia_updwdc_ata_ctrl_intrmii_detachusbd_get_endpoint_descriptor_tr_tallyudp_ctlinputudav_rx_list_initpool_sethardlimitpci_subclass_prehistoricip_freefvfs_lookupwdc_default_write_regrlphy_statuscpu_info_listicmp6_mtudisc_updatesun_nonamekmeminitnd6_ns_inputdeflateEndmq_filterdevice_refehci_device_ctrl_abortffs_syncrd_root_imageuvm_map_submapsr_hotplug_callbackscnioctlrt2560_startufs_vinitsys___tforksr_ccb_getbwi_mac_fw_load_ivpool_primedevid_allocm_extrefpgrphashtbldoppollrt2860_read_eepromifmedia_matchget_crc_tablestatclockuhcixfersiop_ppr_msgrt2560_tx_mgtwi_read_data_usbdvd_read_physicalrw_enter_writeuserconf_argbufatu_media_statusMD5Update_intm_tag_copyehci_idoneinflate_tablesiop_pci_attach_commonpci_io_findrt2860_free_rx_ringpmap_l2ptp_ctordata_abort_entryhid_get_itemrt_xaddrsmsdosfs_getattrip6_maxifdefroutersm_devgetwritedisklabelin_ifdetachmsdosfs_printkernel_pmap_storeem_write_eepromin6_ifattach_loopbackstartprofclockohci_device_isoc_enternsphymatchupl_ioctlundefinedinstruction_bouncesys_getresgidprocinitatu_switch_radiomsdosfs_readdirdead_ebadfextent_do_allocbrgphy_attachusbd_interface_countnd6_timer_taskobio_cawddetachsoo_ioctlswap_officmp_redirect_timeoutforkstatwi_card_identaue_miibus_writeregi80321_pci_conf_readnet_ticksicsphy_servicenull_setkeywi_send_packetigmp_sysctlin6mask64ohci_rhsc_ablesoftclockre_gmii_readregieee80211_node_freetc_initupdate_modifierffs1_compat_writepdc203xx_dma_startblf_decryptswdevtdisk_lockuhci_initbwi_rf_gain_max_reachedarc4random_uniformsbwaitufs_reclaimdorefreshcredskv_intrsafeem_access_phy_wakeup_reg_bmscsi_xsh_set_tr_alignsr_meta_opt_handlerrt2560_alloc_rx_ringsdwriteohci_device_intr_startxscale_minidata_clean_addrfilt_logreadsysctl_rdquadbwi_mac_fw_inituvm_vnp_setsizevmcmdset_extendural_cadefault_product_descaes_key_wrap_set_key_wrap_onlyip6_use_deprecatedehci_softintruftdi_paramuserconf_hist_intextent_alloc_regionsys_mknodbwi_mac_config_pspmap_proc_iflushext2fs_mountfskill_vmcmdsuhci_device_ctrl_closeuhid_attachbwi_rf_off_11bgufs_mknodpciide_phison_productssbinsertoobin_lifaddr_ioctlknotelf_advlockpffinddomaineephy_resetwsmux_do_openfreepci_device_foreachricohrtc_setcaldorenameatwi_ioctlrt3090_freqsffs_hashallocswstrategyuserconf_pnumehci_allocxbwi_plcp2ratescsibusprintnamecache_rb_cache_RB_NEXTehci_root_intr_methodsmbstatmtxsys_getpgrpuplcom_detachuftdi_breakukbd_ioctliicprobewsonewconnufs_direnterrt2560_set_basicratesudav_csr_write1uhid_detachgeneric_armv4_bs_c_2pffindprotocom_obio_caudav_watchdoguvm_pagealloctcp_saveti6wdctimeoutHMAC_SHA256_Updatenchrdevfrag6_freefundefinedinstructionuvm_pmr_use_incaue_cdrt2860_switch_chanre_pci_devicesaf2rtafidxnamecache_rb_cache_RB_INSERT_COLORnatsemi_pci_intruvm_map_vmspace_updatepciide_chansetupqsphy_ca