ELFa(@4d4 ( @44P@DPDPDdD6D65ۣeDcDD@$$`p_D O!!&@00Q_: 0/D6dh@/ dd@0 6QQO `0 @@ @@0 @_-@p`P`D  B00 R ᓌР -Lt6 ⵱D6kD>main() returnedN   !,@@(TQ 0/O0C / -LM@$0t SxPp @(`V ` $0  6/@ $`0@0|0$ (0 a(  00-LM@4P 800 408 ,0 0p-LM@4` 8\4P08 00 p 0-LM@0P 4000  40,0 $-L$0 P0Pi 80-LP0 @ 4@0 00-LMP@ 4\0 4000 0 0-@4LP0`0@0 0Sl %P$ R000800   pd 40PQ `0@ l $0R 0 04 0 80h$0l S0 0-L4@^P2 `0@& 0S0 R000800 8 p 020p 0d0"U0000S04^0`0@ 0Q00C00S00hQ00C00 -LMt`|0P@@(\ 0p p"p 0 00 ,@p 3 /"" &P  0P,@ 0  0"P1PPF P7 P0S@+P0@S P< 0 0P  ) P(P P z @l 0\ PP  @ۣf 0֣a웑МL`h -Lp-0@s`𨝈V @GP10LP r05@ ) 0-Ld0PSt@ S S d e R000800   d 00@P p 0!d0   00C00m0'P  `l, -q0LL@`P R     &HP (0S @0xP (KQ  Q Q hP  K 0L0 -L$M`plLPP  @(K Ph 1Tp04LP#08,00 @P $ ߢ @},04 008 <`,@4@9t `40S,YP 0 0 ,@  }@"" t7@ H 0$LP( H}HxP} 0Sz 0,@ 0 O K0 H0P40  0 k , 8  ,tPp| ,0@0 d0<0@@  ,H8 P, K80("3 @ < @x0 0  5  842$,00 4080 P 0L ' @F!P $2Q "  0@7  @1 ,J  @&(0"0C H @R00000H0"0Hd@P@1 P" 0P $ ס@j  'JT @(SP P 峡 F| 0l姡@P  P埡 @嚡ꜝ웑ȝd0L`h Q-L` Q h! @PL0SP U@ !h@PpLPP Z U@ p-`LP mPpP@L0S@ TPp p-LM`0S@10@P%00 <#40H0P@ T 04  P@PL0SP U@ Kp0PK 0ED0H`0A ,0 ( $@  0` 0000  !g %p0a 0U U00s0#!13 300s0#pPp/0 010/ 0-Ql2x"@P@L p,l”x"p *0:\0///800="R  /// p-PL$`@6D0Fp p-PL$`@640Fp -`LQPp 4@T0000 L0 p-@L8`P6S\0&\0`0V`@p08 S/0S/\60 00/ -L@P0h -L@pT`= 0S: `PU% 0 0l0t \0\0\0S `Pd@TQ d@T Q d@TQ 000x&\01x0 1x0\0S ̞ -P80@Lt`800C80 Rp 0S Q06 00 D -@T`Lp\ 0\@0P0 ;0C 80 0 , $(\LpC 0\QP 0h  p-PT`@L\0D0 D0T\0HPD@D0 SH@P000\0phv  p-@80L4`06 Pp -L0`SS0 00S7 @T0 Pp4 <D 0E 0S P%40S %8%8 8pc4@T@p +%20# 0 000i"888S@P @000SIIII@T$ pPtl 040U01P#.#8 *00"*rPp40Sd@T00実 0p-L`PCT0S@40D000C`010'p p-L=2`Sp$P@p 0-L0PU00S @ lt 0 1S Rlw0P0h(Q00h艞4 -L0S8 p 0TX260P40   op30 , R8<0PP[ X<00 p>400c S@1p301 :J $JJdco@`pW00, RP 84 8:#: 0 P0>0 00\ 0 00S804E J ?oTPW,P ,p D<4 0`P(K0<904 D0~ ,P -LMP80,@+ pP@ `P@x 0040 ,` h408% >?4 0U1<04 80D4 ,@ 0 ,04,8嬁=D00%0 !0Pp1000  4D4 <"`p`4R0S@@60&0P0(K<2Sl@t s\u0K  ,0K@P  ^ [@J084 004`00<Dsv -LMPpFT` D06D ?0H0D0K $0KBP$ à ,0 0 P $K\ ^TX&@D 6 -LMP p@ `=2S ` R0  0SP`3,0(KP `2`,0 Q Q Q,  30,0 P Y4  W` , 4^= 8 t8P0 ` 04, 0P4~ 0\4894 ^0010; 8;!  00 0T\ϠD 0004 R񟗞DYXYY0 l!, 00Cs0SN 0$0`8040400S `0R{ 40~`P0@,0P0Ff(`0v,0`@ 0P`S|0p@,0`P0$D 0 4,巚솓d4Lt -QLP<0 @6 p`@V`!>V@l•x"1@  p,/.00b* T0!,!@V 0 0 i 0-@PL l2x"p ,p0=20? 6P0l”x"0 p\X2\"0 X2\" #+$X2U0CX2 l”x"006 p\ h20\-X2 0CX2="0 f PrPfP̠ -Llx"@p ,6h -@PL =2S <2S l2x"p ,?0hxl”x"p \ -L,M80p="R A,+('0T*) D<0@d %0& $Rڬ9R +ڠ9R\ Oڣ R 9R 0|9R t9R )R R RT004Y@(KA?CR 8R RU0008R 0.S 0!C60,ʠP 0404 QL0 pWp< 0\* @0S,0 0@ `p> 0W$0@ 0,$, 80 PP 0 0 4 0$0( 0 $::5% 0 (0 ,0  ,  @(K1910d0p@80S4 Dl2x"p ,D 2P0C" 0 00C3 R PS0Q80S*<Q@<M\K D @2 0S00D0h01D&0\0&\0xS`0`0D d2Pc 80T@@ 80080<040嘐D@60&D Ƃ$@D<2S(呕}y Xh -L@Ph -L MP8 `=2S @ $K 0p,K (0K7@P @Ἶ,0( 崠0 (0S <2S 00& 6@P@<2S =l@#n lnv -L@ᒽP0h -L MP8 `=2S @ $K 0p,K (0K@P @a,0( 崠0 (*0S <2S 00& 6@P@<2S l@m l0nv -L@7P0h 0-P80L@="R 09P0<2S00 -L@P0h -LM=BT (Km.0 >0 , l2pBxR` \p, @07/L 0@ ?0aP Z,00(Ko> -L80 `p0P=2SgX2Sz0 Q00@0!a0蠡0p00@l'mP8<\T@ 0&\@00 ;0CPU D<@ 0D@00 ;0C 4PUh06@Q 0a 00Ul0\@pPllP8C00J` 媔 mki p-L@(`P]p-80=\  0 `\0d hP%u  0-@LP\T0HD0 D0D0 SHH 0\T0h -L00`@HpP0 ?00i0 0  Q-LW QO Q iqq<2&0R<2`@6Sl2x"Q@  p,3@0Sl˜x"0@  p\6Sl2px",l˜px"@00\dT l2x"p ,@ <20C<27q`<20<2l2p ,v2lB˜x",0 0p\l˜x"P0 0p\6S!`@6Sl2x"Q@  p,@=Sl˜x"@0@  p\6`SVCl2pBxR` \p, @ 08107/l˜x"p@ 0\dTL sl2x"p ,@ l˜x"6p \2^<20C<2ipl˜p 0\2L6S@6Sl2x"Q@  p,@=Sl˜x"@0@  p\\A X (H 0-L@qPPm8kK0 0-L=2PS0X20QX2 @T|2 6S mk6SX20CX200 6^X20CX20 0-L 0@PS zqP 0P0 PkbP0 -L Ml2p$l™p x,l2p ,g0`2 P^D0S l2px", P~|<2奯 * 0FP@"0R02 2 !Ql™x",0 0p\e 0";P  3j. &00< 70 P @4 6@T ?P O(Kl™p 0\8h ;2<2@LATL`@D` @@@\IP@` TD 0*p :0P!=C 0D L`\TD ;0C(T"P@Ud:@TP!0  E@P P :0@00 ?0C 000LT\H@D@D 0l™Fx"P00p \m xhmp:l2pBxR` \p, 08107/l™x"0@ p\dZl l2x"p , l™x"6 p\Kt "P001"P 9PH婐 0< 0媊㜊 ԆH J\ -@08 SL0S Q600 D0 <0%0 0 00S00hf -L MP`80$ @R$0S 0S R060  D0 <0%0 0 00S008 KD0 0%0 0 <00S00" (K $0K0`P(0$ x0 $pD0S <2S l@h, g^i00v/// -ML0m: oĈ )-ML0`: oĈ e-L`P2 p<(00p04p4S80,0d080 400 }4, 0@< 07wq&88&#Č, @   Č 0in؇WEVĈ -L Ƞ Ƞ`,DP$ rpP@ 1UJ x1U) *@mX1U* P1Ue/G2@010S @ 0 v@P x@P0U% pv02 0 @  eC80@ be/2 7 0T &$ 40( m@rdAhdsd edAk~gdĈ -L M|@0#88#!6rP( > (  tqp* (@0P 0(20 0 , y 00P`t4Q!40,@aT@!0 '  D1400d80P@ 1($Kkl, 4+0<0, 8DP@ $KD 1؇܇ 8 8-#TLH%pq`P0@u qul 8 8-#L@(qPPp 0`upP l0S  0Fqpu0 pP -@Lv0Av܊0L00v  -LԀ`p0p7P$  >7@P P00 `(pPp 0P,p\0@P  0@ l iD>܇ТNآ -Lڎ -LԎ -LΎ X0 -LP<00S0(@#40àL|Q \0 -LPp<0P 40 àL  |Q /l0 -LPp 40D#"B ,0S 3/0P  |Q(0 -L0S|Q 0-LDP@0S0P0 T00  0|Qx0 0-L @R0PXPTP00C00S T0000T0000|Q/D0 0-L0@SP0\0 00@?@ Q$Pa(` q,p048<p@@pGp?P@P4P`0`kߍP h 000Qh@P4P`0`G-MQ= 0p`0GPz @jzf. 3*fχ*1 ʠu4# Q!ʠA0# 0#0#!0#0#\W!!"0 `V!0p0Ѝt Dԕ//1s s0<0/ 0<0/(/@-;@ 0$@/@-:@ 0$@/P/კ$0 -L;bhOaꀗD -LM=Y02pԀ0(@ P(, !  @`2  ,K0  0 `,0 ( @DY O@Y P@P AQ203Y$K`  0 p -L0M< @ 0<ß40 ,  :BEv 0s0SX 0""00S Z 2@P8 8< tX(K0@S "0H0 T2H@080 <2D @z <, P L0  0@@pX T  P`PPK`< pP L 4, : "@0D1H@T8@ @pDQa PKP! $X0K@1DA8@00S` 0 0c b"GS0c aR bW00S0 "XXU08 C4C2 C10Z{\PGX 0L wbD0@P0( 04 bXg4KX=  p0 *-L`MKOKpt)\PK*( )((@(Kd>D ;p-P@L` U (V1(#Q 0 0#0P0,PHDD( ,*00+ * 0 pDh^d^j^ p-L4ML`KP$@KX 00#0 QU W(p0@PX  W((Kp($0@P  80  -L`Pp  /PP  P@1J# {J pP 00 RAPPpX L(*.b -L 00s   * xux0t0 R h0 P L]@@ hy] !Y,`Oa0d^  ĥ -LtQ@p W0SI \!0Z0j005@*Z@ `.44 ;0,( )?V0 0pS PV@1@!c N(` )0`d0dS0 V0  `@0  oV,<44, 10d^8^^Dh^dD0 p-LM@` Q@KpF_KE0@P'@ -LhMp@TK  . TP`10KS "  S@1J#U0 M nI@P UT'*-G [I@P0SU@ K@='aD@KPK(0,0^$K(*'P -L MKyS0-0   K^D PQ-L M K\S 0 K^ <p-L4AMV0S: !0S0C01 a0S ;0,( (?0@ aKL'P` (0@ LT Up,<44, 108d^^^Dh^dD0 P0-PL0eV@TV0@-pPh1U``A`T1U!2``"1  1A3`Q#20@! 0Q@D@ ?2c10!0U%320!0U Pڄ 0P`   B @P21C0#!B <0P`mQn -L0MPKP@p80 &("0W"0`W2ŸP /A!b10bc@!<2n10!0\#3n20!0\ 1STt!<2n10!0\J3n20!0\B ,1`c 1ST!<2n10!0\/3n20!0\' P0S `c0 Sr0 `4p 2Cca0/"b 31Cc K$00L0 Q$IQmnųL0-\<< 0S 0R 1 P  px\ P0R 0D 4S1(S0S /2 S//ELF0P/////// -LM80 p|P P` .0a 0 cA, 0 #10 0   0000 0 `00  4 g n`V @^*21C@t"Z @ 000 00V @^*"!B@2fZ0  0 000  80 .> 00 , 0^nP`U @^C*"@!B`1f0`  0040, 0 (K@^**>A0@> 0Z  0 008 0S0ca, Mrnjh>00n , 9^upԀ\ӀҀ -L M@P(`p  K00p ` P 0SK -LM@,0  0a+2 僢`0 PP'22 Vp!@!P#*@ @T!*0S P 0P: * p0 PP  b* ^*(Kp PU* 0R P0 S, B$PP 0-L8MP 3R,0 pcP10Cs0S{1 R` (K  0*T 2  2@0 @T0W`Pc T@ *ZP` D` 1S H  85 41, 0 S   5@@SP 4\. @,KD 0 0>0 1!H0 4K 8K00K0 H q `x`tnۣe0Ҁ -LM D LPK 1 P 倀 ~pP@`V p@ ( ,00(K(!0dpP@(0$ (!0GpP @0(!.h@K 40pPP5[S p0  [!)3[L RP@0pPc[Vq q ^  0S!0(K. ! 0>00b>01 ! z 0Ll 0 D Q`a R(K1 0   ! 0 !.  . a0 S1Q>2=12>30300 5V*  ! 1 0KrP PDȡ `! 00\ . 0C0b!00`D 0! 1 `\ʼ#[Rb`   1Q5  `R R0 4 Q!RS  0 c, 0K4K ,0KP\1:00\,%* , b 00b$1#[0,0 ! Q 0Q**"!B001 0`1 000 #[0,; p zt.0a ,  ۣe0Ҁ -LHM@8QD1Up$0  @aV $K 0}P3P  #'V v K0d0  0\0 ` 0T0 X  0P L0 *0D0 H  0@ 4 8 <0 0<dK7 ( , 00 U) & v:n -L@P81S<@ -L M` (1@8 @  0S8 "P 0PSU *0 S   0 S  R: (K00@ T T@ T T TpH@ Dp  0T0S Tp p T p@T TT D H 0;00 0 40  8 x(! 0L  , (,K.,(Z0<0 v(1, 0(1,0, $,0 , (00(0, 00CS 0  c00 0P  @(? ( '? < |& 0` Ȍ.@P0qΌ  00 `~Kp -LMpP`$K0.> `0.@P0 0 `0 ~`P@(P  0``0 ``P  . . 0`x -LMP`P@" 0:#:S%0:#:S z'zW uP @ @ ȌP qΌ00p A~@P K0@ 0-L@Q P21C 0 P - QP P \  ?$00P0 -LP`@ p2PC@0  0000 p@P00R00S 0p-P@L? &%2AC `r 0P  ?M$`p X1!p-@!1@QL(!00>0>0 1 R70P/*"!B` ` 1 0a0`0PP PPP0P:21C  `0 ! ! ` P PPp00C>!00 cc!DҀ*0hO0hO 0-LHM,0 0@ L0 T0$ ( TK BP T0 P P ${ K {@Rx 0-L8MA <0 R0 !tH0S  `00(K a , @01 :P00 *0 `}PUh1PU,Kwp0@c 00 %0`C0K 8@ 0p %X/@F 8K%80 PKD KP0 L@ Hp P& P zPU 0- ,04 Kj 4K1@K@``ds0 30K2K0@ %<` `F<K %(K,z(N{$L{lУ |,ܣ 6-L␦Mh|0RPU |@K0 0@PU`V 1 P>!1 P5 tt1 P, ``1 P# LL1 P 881 P,6<$!00LE!0H\FyyyyyyyyO$p###lt&Ј4$XVxQXـXNH8@P,pXo`(2|\`؀d؀t؀Ĥ0ؤn@ld<䤑̤0T0 T00/ P/T0S0 /0ST0T00/P/0@-P@T! tx0S T R x0S\ RT0T 0T0t0St0ST@0T0T@0 0-L@PT0PS00 0U 0S0e00 -L0@S ^ x x0Rڭ00C0 0T0 T0 0t t0S -L @R T0S0@ R0ST0T0 0/0S/0S/   -L P 0  0  -L P  00 h0-L2I\0PU @+I0$0$&DPIPU 00D0hEI긘 p-@PL`I0$ 0CR0 S 0S  0R:)I0\0p C"I0\0pC 0-@PLH,0@I0 p-@`LPH,0phH 0-@PLH,0 @H0  -L M, H(@,H T3 ar0fP + ,H(0 SP0` 4p  "100 0c04 @P4/X 0f0P0f0,0(,H40 0b0(K䖐 p-LMtH 0x0Ht0@Tp PhH0 S$ `D0 gE0SH@Tp鸘D -LM@`pEH$0S $PP0 FE$0S\@000,0hVHL p-LM@0Sp PeH 0R: `  40E 0 BQ *ph0HT -Lp ,0 ;< ,0@ `PP 0-LM@P,0  xG0S h0XX D0SD R00 0S000hG\ Q-LME hp0OO$ !RBb^V )ڀP@pG21C Pp, (P! PG0S 0xx D0Sd X00G PRPppU vvhk䖐d p-LZ" 000X00SZ0PHZ 0O Y,@`mHPPppYp `0ST0 P0Bc&0@0@?IPp0Y@Bc 0p-L M `$P ` ?Ac 31C0R D0 R 0P, @`  $P ` $KKpMb?B `0p-LMT`P0LPH0@^ ,0K(P $@ ,` :Kp   p-LD0 p0  !D D !`00CS0pL`0Sp@@ 404 PLp, ^^ -LDbD@P0 hQS RP L M 2eL00S- U 0D  DL00CSL0Ȑ1SGUx0 0x0400@408@0UL0D0!0D00S000iPpD0 7L0,0CSL0p00p0D!R/$0 0@$0(@0L@!0HuL00CSL0ȴU T0S t0@0t0,0 L,0 Hu0 0@0 @<0 0@<0@@O^4  p-L@ M$KNC $0PQ@c=YB@DB ]BT00U00S Kpt0Tl0`GTP0@AGP$  0A02 Fc@B - L|Mx0P l l0@@@K\0\QT00SF<< 0S@hC$t<$$^^  0 -LqhQU $0"  0`0SR G?0$1S1 R. H00CSH00ڜD`LPt1@P `gE0S* iEH1FP0  !$ $ !10 RH00CSH0ʸ/QiD-LP000 0@@0~LA?0 1S `0oFP0  !$ $ !0O $ 0-LD0 00  !D D !h00S00T0 R0H@ <0< 80P, J0, 0^^-A" J1S 1 0<S RZ020CQ^1S100S^0Q:/0P/(0/ -L0rP!$ Q$1`s 0!<0 ! 0V 00C0@0<!0 !00C0 8 2028/ (("8/00/ 0-L0@SP P R000 i! 00C0ek0 0p-LM`P@P P \-P Kp 0 0 00$( $ 1K0 , $01KP K(00(00 00KP 00CS 0 00KP01K(00 (0 -LM`Pp Q B  Q D00BS 0 K0S@$@P K40K,@ (P 4@ 0P K ` -Lp`20Cs0S2 P@U R 00 0 PU@Z@@0S%0202S' ' P h P d8P  @P  4hj' 00202S8 -Ldh`@,H00000C400 20  2$8ȥ -LM8,0,0 (HihH `P : P 6,0 2h 0SM@PPpH0 0 0 0  @   {,  0@SP\ 0 0 PS@ R 0s0 \K 0PS@40s 040< 8 @ @cTڃ ?@cTT' 002PrW ' 0' 0Q q  0 Qq8ȥ -LM` 1R/2Pp! 0 , 0' @A  dK@  dB0ST0, 20R0(K000 0Q20p, ' 0,P0' x@@QB@BA p ,0! d @@B@@A  d00202S' ' }p' v0 -`LpkPP ` 0 S  S0S<0 ``0BS 0-`$@ @  ` -LlMPp4@P ` 0匀K0 0  00CS 0` V  KhV#l P0` j` -L Pq1@` 0 0qW 00 000   Q%  0R0W0S 0WP40U   12 1 1s 0U0 P00  121 \0-@ MLLPT 0 @i00, @i0@K0Хإ8 -p!P`hL@0D 04P  00R  0s 0` 0 0  00 0101 1s 0U0 P00 121+ R 80R O -L M, p0`$( X 0RS1!Z 1!00  \4 B:0BE c!03P> i2@`v_  V1@J0 SSBB c!03P; P2@pH,!$0(!`0\ 1!Z 1!X0R  U0 Z(K@020Tp 10 p@T @Tp 10 p@T ڸ`2 ^   1@2 1 1s 121 0$ ^0 000R$40 0$ -L@MX pP`PQ  0 S" T l 8 x 4 @ T 0S$0HK P0 LPq3[S1 #[RO RV R 0AS 0X (KX@0(! 0@`0 \@ 0T5 Z*,@ X, KP 0CQ  ZX9 000 ,@0  000000 0 s00C0r 00  40@K00 s0  r0000  X0P= 0S3 X00 K000c0 0S P0`0ڙP z ,1  , X0 m0S) hPT Nc` S`v$0< [0@000  X0P 3|00 0  X0 @$0HK L0 yP3[S #[r0SS S R*@L H0K*PHK  0  0  !D D !T PH0K`Vb @P@ PH0K@@   00C0 0p-L M` Q &00 4$K1?L3c@_#$@ P !B A31C010 $1 01P ,@<>@@Kp$ Mb1 0-L M 0,P0@ 0$@, 14`0 KBa0O# 0 @ !B L3 1C 010 @=K0Mb p-L@EPP' D`$0h U  (0P P p18P 0 1 4s0/: $ 1@00@@pp O T0-@ MLDP 0 @^( $D0 @^K0 -LMp40@`8 Vc>0 `0X0X,K@0 0` fP 4,0, b -LMp@P 8K4 8 ` @P*48@0 10A0!0Q,0 P@8 ,K ,oP8 0,0 B0R,0 P8  @'00KP (K4K  P`@Z`J,K ,GP0 ,0@T0P,0 J `'00KP  P "-L$M00 (0, p``P Zq Z `h8>\ (K00 (!H`P(0$0 !@0;00@0(!&`P1 I (!00`P0  P(@ 00P,K  `P`P:, 0d0b 0 R`/LA03/P41<  Z Z (1#208` @0S00S 0S Z ` P  0S* `C00 (!8d[`Z$1 !S`#`3R0 0!( $0S Vk `iDnpX -L Md" (1`2 0 X2 pP (K0  !X DD !8MI?C? 0 P lp hp p d ͟H" 0K @2 <" #>KB/K%K(q Dr q q 8r 42 L!  L pPF<,K(1Tr \ @QPU \"P , Rv 0 T20T2 pP00@,K`d 0` F P00KpP K(1QQ ([P  T `" 0P\ [\+; PL? C 0  !X DD ! \l$Q0STr \B \BTr  0S 00S  ? 0TST $Q?  (10(1 0,(1 , TPp PU  , R 0 |P00@`d,K 0` P00KP p|?Wzpxpv9 R[! 0T"00 000!100\00`00S00 pY 01  !o`XH! <`. | H1D!0>0>00a#6l0@!. @10>00a #6t p001%K>0#6x08! 410PX"08 X e B4! ^P> @( Q $5ZP  a \,Z`" 0P\'7OL? P  0  !X DD !x?P[ p  P\T0 H @ 0L@Kb%K \2$P X"4 w PPXN @ " $Q}T0S0# X00 #XV6 4@00PXP1T40 @0!!X0D  D !!XD @ 0!!X0D @ D  !X" 0 !D 0 D  !X2 q-` R 0  !X D D !1 0  !X DD !` 0R 0R `` (0 0 X"`2P 0`00QX"D0 q0@ 0@\d$0@0@0@H46ND\pMR X2@[692X"1C0 \ p 0R. 0R*0R'0!!X0D D !!' P& 0  !X D0D !`1P ` (001 `00,N 040 P4  PU,W < K4K U@@P/68K`" 0P!8EP'8 00040@4 0040408 $ 4(00(04  00CS 04 <4 +, <v4 !8xЈ֐$֐nD0 0S/$ R(0(0(0 , R$0(0,0$ (0,/ -L@(  X 00C0 #\ p-L@` $PP(0(0( 0S 44PP dP  *h8W(  W 00C0ph%|!X -@PL`\P pP 0  !D D !@\@ h+@@0.0$S$0#@0h R 0 0 0 ,h -`Qp0,!L`a ,@T ,0S ,1 r $@T{ DP v|< S# )0SD  $0 0  !$ $ !Y ,100Sn P H R )0S$00  !D D ! ,Y% H.0400 $0  0  !D D ! ,Y.04000S" P \ 0| +Pj  ,0Y0>  0S hP 4   @ p-L\M@0 S`  K\0lK`,PP0SQ K E P 0S Q lKP : PKpP 0-@L8/4P,0S00 0040@4P/0hq*HT p-LMPi/@T  0k,@T 0 R404040 /!S  = S (!D8DxP @U@0AS00S B.P# [#(KQ0Y077 0AS00S '.P0#0C0MBP4 1Y 0 0C0p[P'00C0Q400T  (1p0QP #0 B0C0 KQ0  p8)0$C4 C(L0 00^2YR 0  !$ $ !\1 @0\1800< D0 0  !$ $ ! <  0  !D @D !.!D  D  !@0Y@0 01H0S 3/\(5^4@ @0*8 <   p0x 000D0  8 R000 <ğ R0 0,0,P  p1S00!00400 0Yq,0 010400S0 0@0, 0R0$0(0D0$  , ( ,@ 0  , Q\  K8^ 0dd 0 d0 d,00 d,00D R ,0(K=9 =0 D PY | 0Q  *wY@ ,"<0S000000000^p<Q  D0 a R ,0d"Y  0  8"0'D000  0pH R L0L  !$ $ !    p0x 000) * U0 +  @!000K  @  p0x 000q mi@ 0)0P0|0;]'V/000  !D D !F \^`TX^\ #؁###X@Bd -ML 0  K -LM@00` $ 0@ @KV p-LMP`0L S@Kp0 $K0 $0 0 W@P($  0 @P`}@pV \0p- T`L @Tp08PS0P U@Tp4lh0 p-L@`TP 6/p  P $ `P@0pBY4ll @P-L8Ph P0h, ]XO p-M@LK`P 0D/@ @P V00Kp -L 000@0@0hi -LP PP 0-PL @B0h  0 \aR0\/-X0SLL L0S900S0C1S0! S0%5x| P> 0Ã-L0 Q-L@M'0S S -$K0`@K< A <  0>@T   0]P P pp0 0`P0@5f@ NW5PU`V 00 C8 -L`M@w0 K,  !6P( K @C$(@0@t lpqD\0CAD0@P@$U00Ã, 0ȃQ #@0S00'0l1,0T0a(K  W>0!C600 00 @0 P0&0P4 @@@ZBPP$ ,0  X@0 0cC61 ౠ0Ų4 0hh00S00#00!P0 KWt QP3-L@P`p:P )U h_  $W00/0 0 h10S /0S/O 0-PL@e0h0 Q0B0R/"00 h R 00CS0 /O0 "1-0L M!`h  P@p0 T  0S (K\"@ D 0@0 8pK 0! < 0T@ D00'#<0S  "#"P OT0 -L h  R@ 000P00O0 Sh1 000/O  0R00/  \0R/  S0R0B0/40S840/ -LM CP`<0 28 Ph (K)0  @K2"00@,0 0S 0S 0S PP`\ @W0S APP PP0@ , !D D, !Z P EB0U 0U -L@t`(Q N 0SK 0S 0S 0S Pv 0S 0S 0S Pp\ Pt@v`t 0S2 @P0 , !D D, !t P zv 0S tt 0Sv 00Qv 0`S -LPu`(A D 0SA 0S 0S 0S Pv 0S 0S 0S vPBp\ @}uPv`u 0S( P@0 , !D D, !v 0S uu 0Sv00Qv0`S -LPup(A` P 0SM 0S 0S 0S Pv 0S 0S 0S  Pw 0S 0S 0S P\ @uPv`wp0@ , !D D, ! v 0S uw 0S -LPup(A` Z 0SW 0S 0S 0S Pv 0S 0S 0S Pw 0S 0S 0S PZ\ @uPv`w p0@ , !D D, !u P !v 0S uw 0S-0` P0`Q`0P| @` ` p0 @P` p  t0@P`P`x0@pp /ɚ;6e l-@L 0x 0pt -L`,P p@ -LM< @0 `  0` ,p @0 @p<0@W(K1ap R1  08 4 !f# 0@Pa# 0c#F8 K V%S# 0@PN#< 0O#@< Q 00,8 K !;# 0@P6# @`07# ʚ; -L$MpS 0K< KH0K00K<KHPK`(4`@ 0LRQ/N`LaD#b $K0K< Kg( 4080`K<@K0/?@#bL3c 00Mbp@-` P`Q`0P@`=)A -B` P` 0 P`Q P`0P@`=)A -B P`  0S 0 L0|0p?B00CS0/Dx& p-L M``P^P@ H0P5F@,B @00Kp4_x& 0Qp-L@P`h0S, P @T @Tl 0;pS spP pP  0%pP  0-LPMdPK@ PP K0\/0  (  Q-LMP0S ` (q 0S * wP`(A0S \ @0S@Y(M0(!@0JSP 1QE 0S= Z  1 ?Q 00SZP/ Q '$ 0f `. .  Gx0 ?l0 d0 0S:0SPP 0` fQ$  p-LM@(`KPP SKp -P(1LQ \!0R00D!S0@TP DA`p @T` &@T00Q \ -L0PSp S" SP5Q  hP/ UP @T ` @`TV0S(1 h0 @T `@T 0 R `0,#0 S-L@+ S SP8P D(^)^0N00S(1 0 \ )\ 0 RD1^ࠡP P P )D1^ࠡP)^0N00,#//O/O//0 , !  !/ -@L 0@<_H'0 , !  !/@-|!X00CX0"A\0 00d00` R04X!00X1X!R|@P'/ 0-L|@P.X00X0 d d0 @d@X1>X1||00P'T00@-@P0Q0B2^0 0 0\00ȈT00@-@P0Q0B2^0 0 0\00ȈX00@-@P0Q0B2^0 0 00\00Ȉ0 -L RBQ P@  0P0SB`0ȈH' 4<_  0-PL` hA0!)0|P!0p  !$ $ !L000-%O p-L``1SPP  W  h0`!RTPX@U 0)0p`XP$ 0@pOp' -L Mp,KO,K0$ P b\, ( $ )P` 0P` QP`0P @` P` d1 S00d!0040Y?dq40\0T 0)0g<I0Ō@kɌ ̌, ( $ Oɚ;6e 0-@MLhTP \0 P@cP <@T0( KH000K0RI똣8_ܧЧ 0-LP1`00@ Qd0`@ T@dA?0h-ꈢ\' -P<L8 hq`@0)0|P0  !$ $ !A$"`1SX1SX1S | `1S 0)0@$d!R 0Q404040d!ROL' p-LP@` ^  000@0ph0 R 00aS0 @00p 0@0' -PL q @l0S` 0 R0@p00p@81@ 0S00l00l0p8 8R P8  R P@ @0@0 @80S@@00nS 0-L@XP LL 0Q0C0000S000' p-PL|` @p l0R0Cl00p0 0S008 @!00CQ pX0 R 0S P 0S  R/ //ᘙ p-LM@KP`Pp0p R R 80S@0S pp 0-8P@La000hs p-@8PLU`V  03/dphi ^@ ph0$F!' -L@pP0`S @ P@ @h  `$P 8Ds ,!P0  'ld䧑p@-(@0`PV S ^ R D0 T0 4 Rp0 Sp S V Vp,!, 0S D0 0S Vpf0 $10$1/ 0 / -P0 AL0@0ᤒ pb01 !0000 8<W0O 01100110@1100110 1 100 1 10110011Q 1! 101 R101 Q0  !  !W1011 010%0  !    !0 0Q 0 0S 0  !    !0  !    !0  !    !jX-08!0Q0A""0! !!Q0 1䜙- 10 P P P0  !     ! 0  "!   !  "!10/ @-0L .!$ $@.! ,0h4!/,10!0cS#3/O//, h1 018 @00@/O8@ R0@0/ 0S00/@-  3R $0  / 0 0@ 0$@ 0-`LH , !D D, !@T@T T $0 0  !$ $ !`p )0SP @T$0H0S0)0^" 0-LL0@S0LP02 @L0S0집 -L00@DJ 0-P  -LP`H0S$ P!D0  0)0@ H0S XhpL00CSL0LD0   D0    -Lp`PPOWo W0  !D D !.!D *D  !@0TL0H`'WY @T" T $0 x 0 !$ '$  !)  BRش0W F $0 W0)0ĕ!L00L0W L0 0L00 0  !D D !0 )0Si!L00L0 0p-L`P , !$ $@.!Vh 0001  Pa0S  BaP` ph0Sꜙ "-LM@hAP0 8  q8 0` !! ! !P!0CR<0 \!X, T1, <0 YT d! 0 $0 !4  0  !$ $ !L140 0 , !   , ! 1U01 0!101010|0P!0R000T1P1X1\18  01<  ,0 04  0`0@P `0S W000 0@@0`($ -L$0p 30#D`!0@3PP  B0@@  "! !  "!0 1D D , = SO !02R/,0S?@ D ,1 R>Z@q Q @_ D  D  !0@3P@R 0  !   !$A D D>@ 'Z, P @oD  >P  @0 "@e0  "!    "!0 z DJꜙ -LMPp`D| A0Zy Z @ D5 A 0  !  !,  0  ! 3 !0  0  !  !.!$ %$  !$00Z00S @T T @T,0Sv | )0S@ S S`o V (KoC (4 (K Q005B3h!R 0S  RwP Rs $  1 Pi0 1 10,0 1,   D1S0D1Dž ,1 R 0,0 0  !  !WH0P , ! , !Y )0S$0 D  `g,p3Y00Sj0P00S`T @0  "! !  "!0` oD0l V+ YU 0!!$ 0%$ !! , !$0 3$0!!,0SE ,P` H0S` 0)070  !$ $ !`12S201Ņ$0 7 14P0  "! !  "!00SH0S $0   00#!001 00#!ꜙO - LiN e Pp-L`Pp@TpU  D0 R@Tp P-L@3P h S-pL $1@T P,0SD0 h 0S  P X*@TZR% P@T @T P,0SD0h P X   0,# -LPp`PPU 0 R Q 0S U U U hlP@T0P \ 0S U U U @TU @T -`@L T 𨝈R%0R = B @QPP  0S  FPP $0s %P Tvr R0h* 0h% b0h@B0$10CS$1/000>7' 0-LP B50J/@0$10' 0-L00P$!R0@0@0 D-L M8 K0@ $J 08K`(LЁ' -`L00@P" pl 0@#P1 ^1010  !!!0 ! !!0P1K 1P 0R 10P0蜙 -L$0@S ?0D   10 P Q$0 0  !$ $ !L1Q 1$0 d1|1s D bQ 0D   10 P0  !$ $ !$0 , !$ $, !$0 -LMp 0K0 0 0 PP 4K Y`PE,1PPO0HL 1>`Q5 0D   10. P +  @0 & W01 B0 !   !0  Q` K `(K00 U#V#J 0 ` 0A 004P/1,@ȟY P`v0S`PxPBɚ;@_0 -L@TD0  0!!D 0)D !! 0 1  @T # -LMP@AD` p01X\TPaD0  1! 11  (Ko !0 0000 @4/0 , !   , ! !00V1 0!10101(K蜙 p-L`P0Sp@ T0p X@T R00000  @Tp R00000   6 -pL@` PmPW` P 00  00S00@ P0-LPP@@@T: 0P0T 01 R0D00= 0-LMP0S Q@ R  R 0A@S0@000SK `&P0 0 B00 0@@0  0S0  -pQLPT \Q 0 0CW . \, @ R W`1`!P$0 70S( ^ 0 f0 00@ pf fW P0S  9 : -6OQ/ 0-LdM@P 00 ,@ jP\ $0S @T0T0 P \P0S P@PTPTP ßP  #P  ß@|3@lß`@ 0T3  H8ß@Yy X@ P@ M 3RX 30T  lAK":"X0pŸP P0PXP`0 P0 X ` , < 00d d h 0@8`XH` p@T$( H0,00@P48 d0h0` Y"  ` @ AKT0K @ P A @0 B!CAKD EFG@@:X\H!00C000 .\(KU 1Z \ L 0L PP0H0 ?H , d 00< p l 0@8Xp L0@``0L0 $`(pH0HT,00@P48 l0p0H ZPNNX\OX,-P  0S 34\^ wQ/0S :P/0 (00O -@LPp`T  0R 𨝈UT hG MP-L0 0S R K P 0 P-LM0  0S RP K P-L`p @ 0S 38PVPR00SP0 @ P00 ht -LMP p, vU`$,0 SR00 SU0 0S @V  P00` ,  D000V R S  D`P @A P00 -L MP K -L MP K Pp-LP`  0S p@U@R00SpP 0 nP00p ph Pp-LP`  0S p@U@R00SpP 0 HP00p phR@- @Q\ 0@- R0-LMP@@ KP0T30%K00 0-LM@P PQ'0@S),tX@ |$D$,pD CP20S; 2|K020S0- t2ol2 R`Ÿ 0HŸ 002,"@ 0@cFP 0Pj1@10S  A10S-10S-10S-10S K3/P 0T\ 0M P,1,!0à L :6 0 0b 6+z 0 6#r 0l 0e h0_( XX)|)`̈X**)**O\ȈQ Q-LM`@p E 0B@S񟗗44444444444444444440BRSd`@$L4h@<@tT LdD  K 0E 0> 07 P 0R\9\9^ H9R? #K b$  000QY@ @T0 @A  07&Rt8t8\ `8R 0 Q~V #NKF PB70S0000 00  00KfrG @PPi00CUSPcD0S^ @_`pd 0!# L7L'O@ǟ 0G$ǟ 0?ǟ 07Ɵ 0/Ɵ B'F,K , 7P,0 CRS0A 0, DƟ  6Ɵ 0Cş ş L@ P00R00S55050B ,R Bn  #>K( Lş 0 0ş 0 5  4` 4 7ğ ğ hğ |LD @PPs0Sp g/n-l 4e B_C0(K ( n(00Qß L@$ P00R00Sp3=dC K0 ,LP1 R. 0S$ŝS 0 ,Q!A 0~N͠ 2  2!A 0`Ÿ A 0Ÿ PfϠ 1 0 0 0  t1 \1P 4   0$~^OOa0OȈ|Q48lX<ܝdDtԔ\ x(*`Mbs_,n$q0i*)x)|)0 Ȕ (`q`!Д4,x -L@MP0`S( G 0B S@$K!XK>@PX00C S xph`X-@Xq P (K $@PP( (i@P1( H  a R* @pppppp2@P 0@P (0 (K0 A `TK07/Q@  8T Q  V@,HX|@t sي 00  R/* -Pt`LhAp \0@ H$ <0! dp`Hl`00@@O*H0S/ RC40, 10000  H /* 0-@PLM0 Q PK yP000 0 0 0d -L -`L⬠ PF40 1pPU H0@S  PUT0H000000 PE ) R'* -LU00 u 0@T `@T <0S`<0V<0V0 00D_ p-@L|` H0SP )0S U0  !$ $ !p 0p-@LPhQ`p`P PQ 0D   10 P  @00  ``p `pO0 Q0-LhAP00  !$ $ ! H0S H0S 0 )0 0Q D0  10 P HP0Od -Lh$0K 0  !$ $ !#L OQ/0hL O Q0-  0LS  0RPhAQ | 1D0l 0  !$ $ !00 0) 0O p-LM`PP0 R @ 0PKp(@K0 5DzP P00U00S길p[ -LMD X`p@ @ V0<0 B 8 K>@P08KTe Q MPJr R @<*@P#@(K00@TP c ZQx!x0 O S.AJ`Z@D <@<@PP ,K vP,0S@ D 0<0 D <0S xD0< 0BD p0@@<0U 00R  0@ k y2D_x -L Mp@P` (PK .P KPH -LM4@K`PXg넠 p& @ t3WP$K 0/L_0@-(P40@@T @0S0耚0@-(P(0@@T @0S0耚0 /ယ`0 -L0P@S}?H H0 Ӓ< ?A3c0 0 hMbd_p@-RRP` ڔP`Q 0@0$0@p rP`<0Q*0P`Q 0Q.hx@-P,0$\ $0(@h -L(M@Pp Pp 00@PT x0H`K  d _0  @D0T  0 I @L(K|) -L(MĐHKPp@`   0PP (KP X0@T @T P@Ph|Q-P00CS0Hdx- L0  800 0 _d_`_ 2-LMPp@ D @< @P@"0 Y@P n @   1 P`A$0 @V 0$@ 8K@00 K @PS0@ ,P  8PK`U0 0@0@R8PK`0@P`8P 4` P`8P 4` (0@cT@PTP@DT8PK`(P,`,P5P0@80K408@,5<@0Y@ !K P@P$ EL \%`q< (`@P0H 0 @P@04 00(K耚hP_@Bʚ;lt$$ 00S0/008H_d_ 0-@0LS  0 21C0`ÂQU! 0 0@ R0P0R0 㚧@0 0R0 0R0000 $//|h0@-HpDP 0@`$^500@ @0S耚ʚ;@-HpDP 0@`$^500@ @0S耚@B -LM @0,0 @ P`0 pc5F$0@X0 @  , R @0SW0@ ꀚ -L4ML 8KLQ00KOH D L u!%!H0K0W@T@0 <@ JG 8HK8PK`0 p pW0@R00 ,@ 1. <쐟P`@0K 0 @9L00@8P 4` զD0 R , L0I@Ph8 K @ .(KQ0@P`S0@ KP_ʚ;``_ܨ -L M  (Ko4 噦0PO4哕0 , !%!P` PY` V0pK0@p0p , L 0pKpW P$`p(Ko UP_ K 0-LPd 0Q 0 P0@  0P_ -LMp,K,P ,0K `500@K@B -LMp,K,P ,0K `500@Kʚ; -LMp,K,P ,0K `500@K@B -LMp,K,P ,0K `500@Kʚ;0S P(0P// 0R/ɚ;-R \D0\\ ,00\00Q?B  / R/ 00R0/@-\ 0 l 0@=Ɍ ͌   0 `  \    0 l\ 0=Ɍ@ ͌  0S0 -Lp M4K J4PK`,0PU`0`S!X0  V 00(K X࠳00X\P 0@P`U -Lp M0K`0K(0Q SJS T 0$KSP\ 0T0SP 0= @ -LM`1 0 \XK(pK0 X1 R 0@=)B -B h(@K0P Q  r RP Q 0R  R 04K 04K, P cR4 0 ,  >D0@Q[3(pK0@=) -4 0 , ?B -L$MP@`T$KHK ;` 2 1C0T@0H D <@ 8P 4 p@    0K<K040S 0@K0P% U T r R 0@ 4 <0 8@  4 (0P cR< 8 4 0@=) -< 8 4 Q4 (0R  -L,M`pWTPU TK ;@PHX  0K, 0p w@P>U@; HPKTKP8P4W4[On<KH D0 @0S yH0KF 0-L Ÿ00 0!0 SQ Q 0!010 P01  0]C401 0R 00C40!0C4010 P0C401    B4:B80 1 0R 00C80!0C8010 P0C801   B8"< 1 0R 00!010 P01  @@T@0耝(.N6 0-@LHx0P ,P 0000000耝 0-PL@^0 0@@ c0cS@ x0 @  P0P@k08 00 0PP^@0耝(N8 -@0LAah(0 -@LTh T0p-LϠ \?@ Rphp00@- 2Ts -p 0LQ|0Pl @0`OP, 0O0@T1@i]s@B0 p-@ `LA\ 0O, 0O0@T1@ph5s x0p-@L`\ 0O, 0O0@T1@phs00 / p-P0@L@p`_0@ 0R0000$00 @ xp -LMP`pA @T  07/ @T0S Y R000$00  00 @BT | -`0Lp@P0 00 $  $0@$@  p-P`L@T00 0@T Q:phT  X'&( ph4N% CRQ},2 p-LM@P R00phR d%0 S ` @0 0S( phȩ䩑 -Lp( `PP @Pp ` @@a 0 @$0 b / -L@X hTꌝ / -LMx`@hQpp'!$ $p p'!`D0!!$ 0 $ !!O -LMP 00pKA 0h , !$ $, !@0pK `P $(0  W `P@0@C@ 0 X0h , !$ $, !T O1 -Lw -L@,P@0D!| 0 0S0#Ps | !D0S0 00/ON0 p-@ lL1P0Q0@@00APl0 0CSl0 kl00CSl0 P@ph, p-@LH` @00$S$0#@0P11S1ԅ1ąp -L MXbhq/,KW,@K0Ta Q0Z0s0S"$0@TP c \, ( $ m,KP`0P`! QP`0P!@` P` o(QlTI 0T30  D0 , ! @, !|W0)0 000I 00| KP0U $0S00S0T0@ SS0Ō@ kɌ ̌, ( $ Oɚ;6eOXNt0 Pp-Lha\@ !0)0!P|c000Dp $O T0p- LH`hA0!)0!PF000'pO x!-LMl1`, V\1`T1@T= Hq@T8 )0h 0Cs0Sl0l00l0S5h0 dVhPD D"1@0 h D @1Q)0S! !@T(T;,oA!"1!S 11 ,#ܝN @-L8@ s,0 $0 0/A!b h8l_gfffN0- @ h1S 0 0  !  !P0S0H H000  !  !NN -L)0@S S 3#0D   >\ 0C !!L  !L0)0 |_l0S|0 Sl |$!D0R03 550505,ON0 0/NN 000/N 0S0/X/0 , !, , !/ Q-L@0Q0P (0@ @-0@ , !, A,, !Q 0 @ -L@PT`p" p@T $0SV V$pW V V V $0S 0 @TUUp!!\8 p-L 0P`@0S 3/@p@p p-L@]PcT`p04L P PpUpph0 U PpVpph 0-P(@L000(0P(@000C0 R/N -Lp`@TU@ 0P$ RU00000  U@N 0-L$0@SP  P 80@ P0  00h !!Nh -L,bMP$W0S 2 Y0S0C0q 0P 0S 3/P a400S0t,pV -`!0S@ @ @0S W0S4 S00q R0A0 R0 0 00   01 Q0S  1S R :0000 0R008l Q 2!N̪`Nت p-LP`@P0 0 P $0STP ppN -LMp0@`/Pa 6PP` 0 0( @0S* 000l!PJ$p @RTR 0pP> T*p 0!R30,00Q0S Q0!R 0S S0 R 0Sʵ! 8 4 0 ( $0T   dl,ȫ -PQL 0 Qp0S`0S 0Cs0S 0S@0S 2 0RZ 8/0S `0SD` -L0@S`p80S)0S  3/0SP-0U 0S P  !Pp0S i00S0h 0\J0S DDp0 $:7諑, Q-LM0P0 4 ,0 (  0 Qp0$  0 R `0S 0Cs0S  0S@2 0R 0S `0S`0 R , R $0DS0 00,K4Kc`H\ -LrM@C0S 1 E0S00]X\ 0 QP @U D0, QQ00P t@@00 PXJ D Y  9/$!0S  0S V p0S0S   S00 0S ,0 8t00CS0TP(K P q0R00WN̪N`t -@PL` pP  0h[V6/ 02 -LM0`, SpP4 ( 0 $ 0S"@00Cs0S0hP4K0S,K@` p-`@L PP  0php茬820P#/! 0Q "/@-(0 S<3(057<@ @00@09780<S"p* ;@ @0@0< 7P`@ p0@ 7 :$T0P7<P`@ + -LMP80S@`= tpX94Y (@Ġ 00 ,0  ,0 ;< ,08(K PP`00 @$"X W Y 4POT 4SD4K40XW0 /NONQ S 8Q20 R  \  \ | 0 0/0|  /| 0!|  R  R | 00/01| 0 00/0| 10  0| 0/< P/0S/ 0 S/P/ -LP<0 R 0P 0P RN -LMp/`P@)P (KSP<: c0K   00Bs0 S=/(K0 QP20A0@T (0 0 S @ ;P) @TX \ 00 -P0.Sa0Is0Sa0BW Bs0Sr0XNޑЬ -L MPp`',K (0( "4#220$ 04D"P 0 @(K, h1厡Ph ,0P 0t ` ,h1 ㈡,؋0<  h1,y,ɋ pܬOedA( p-LM(PK zPKp(0[S  00Cs0 S00•0S@`Q @@Q $P10 00-L~MK@x Kd0kPP0^K0 @@0@0  K0XSQ $K0k i(p T -PQL`. 00S`S%p0@T@T 0S /0P0SP020$ 0440apCWPE@N -L@P TRP0@T @T 0S$D@T?蠭N% -LxPM` 0 @T $0s (0n @TU 8@K Kd ҽP RO <<8000(,(0000Q U 0#4@P0 'PK0@#88#D a'$B0Ꮏ ,0KH@P VPPpT00S 0S V 0Sd 0SI 4(K R 0S(0 @ 㑽&P0&10T0U0S{ꬦ0s0Sj @pPP000  " 40 $ 020$ 040 0060  0ş0a6 0uW 0S% |" 0#(#4(@"!| ,40T,8 8#$"Q r  \0RT5  @p p](5 ,Ƞ Ƞ,$0a0"" 6p pK4 ,Ƞ Ƞ,$0a0""$"Y꼤pKV 0S|  @㉌PヌPYP 0u03V0SVU@E( K0^*SB ,K0 PP 0S& 3\#   @OIhP X,0S] S7 ,0@#袟0TPPp0,K 0NGPP /DPa~ 00K2P 0,S0 0 P ,@0 `}@T@T $0s (0$m@ThFP ,0 ,(,("4#220$ 04 P0 j $`@P 0tP@ P`: d P pW (0 P @ ܻP @VPPz,@0 [D@< 0`@P P@ P`NNN@|(T,0DVĮ%୑쭑,4)씒ȭ䫑< ԮJ1 0-@PL>,00S,0 0had 0-LM80 < (,00Cs,0c 4pK4PK`d0,l PU`QOJpx X1 Rptx 0@=)B -Bptx d0<\+X< PP`8p0OP` pPPT`8p<8<0)(KHP`0p 0OP` pHPL`0p4@0 0@@0D@0=@P` O?B -L⬀`0S Pp@0@S 0PSp0SP`p@00@S 0PS  0Շ  0χp 0 -L0@S 3/e/ LRD0 0 00  $0 BR NONN8 -L~M @(0 0 (0KKd0K$t KP(00 K=(00(0 0-@Lo*(00(0T p-L(0P`E e PA X00  V@P0 000P@$ ` P 020$ 044$0$0s  @jXP sL0@00Sp3/p7NON\eN\ -LM@0p#8|8@#P2 8 0 4 ,0  ,,"(Ÿ, ,0 " 20  a04 @8,*\< 0S!  0@  i0 0D cD0I  Y4  0LS@0!*P: 0E40R\!: d R000S,0R0#03P0S<08  , 8 0 00j0 @R , q 3P R] v @000@0!Pb (K@4< E>* W?: R e 00 R0S8,0R0#03P0S<08  , 8 0 0@ 0  i0 0D cD0I 0Y40\@ * W %0 :4 S R!*0 0@8< @ <0@4@< 8 0 , @#40 8 , A-(p@p,@ P$`(p,A -LMpP`@P    0  K -LMP`Up@:0E @T;P  \@  T=: U 0  T: 0U Q ,  0 U: 0S)P0pe000 0P T T0S*@B0ep0 R000 g `# 0-L PR00 @P @T0@E0 00h褸 -LMAPU^, p`C ZQ  @,0FS0$P(` 0@ F,@ ,0 0 BS0 0R 0 0 ,0p0  0000 0 (KPP- p 0S00P0P00   0Z0 0    {P ,0@p @Z  '@_8O 0-Rq0  0 R  Q R0S0 S0000 00Sa0 P00/O 0-L1Ps0< <0<@<00 @0$ 00P0OO 0-@LHP < R00 0S000O@-@ 00bO 0$@P/ 0p-L0M`PU9@ 0@0 0 0K @0 080 4@ ( < 0  , $` 0$ @ K}L 00CS 0@ Kp͛O -LD@ R 00CS 0 $0$ 嵛OOO 1-QLM`P 1Q! |1Q t1Q@ @ 1Q, P1QH1@ 00@00(00  @@P0 KvR@PP R 00CS 0# 00p@  0PaU@0 PPP@H D @000000G}flvt~fwt@OOOx0 -L R`@0 D@00000 0OOO -Ldp@`A@P H0 S  n@OO 1- L@P`p\ 0-Q`P  000^  S 0El@Q@1@!T !`P0Q 0Q`#`OOD - L㖶 P000  0Oa0? Qp-L@p`0PA R  㧱 t0 P0R0 R H0 p 0S0SU RUOa0Op@-`@\( 0S% ^P) ^ R  R@ 0 0 R0 00 S0  0S\ 0 0p0@ 0 0  R \,  R/ 0^ 00 S 0  0S0S0P@ 0 S@@ 0 @0@ 0 0 0S00S0@ 0^@@ P@0@- R 0S^ 0Sk 0 0R 0SI0SD \  R0 0 \0S0  0S R( ^ 0Sm R 0S 0R 00 S00 S0 0S    R00 000 0 \0S0  0SR 0S@0T 00 S @0  0 S 0R 00 S00 S0 0S    R0 R 0S@0T 00 S @0P  0 SP y -LpX5 PU?P0S`X`V  0S@W `RP 0WPP 0RPPV 00SZ  `X `V 0S` -@LP ((0S 5:\ R0P 0 \:0 0/P/((0S005:SP//P/( (0Q 0#03SP// P 0S/0S/P/0S/0S/0S / P 0S/0S/P/0S/0S/0S /P/Q00S/Q00S/00 / -@L(0S0(0  0x R P;, RQ000(0 0 , R 0S00CS0,Q R000 00 ,Q 0-L8MP@xP\00M 000$0  $R00# 00$0@ P@$J P L0 80C PL0 @T d1d4 0 `RE@AK00001Q 0004 $0 00  0'lLK$@ P# (0X 0T:d Q00000$00$ $$  d  (̰З 0-L M@ 0P02 00#^ 0#^002(6x0S K0(K0hKd (0PP䰑ė 0p-LMP K 0  @T# < 40`RH0@ 00bS *< 40@RH0@ 00bS` :00 V @@  P R0000 0  PKp 8-Lǰ,0@T  @Thϰ( p-`P@L00  0PPSph 0-PL咰 00CQ0& QU  0S喰@T0;8@T0 0S 0 008~@T0 0S0t@T0(P 0-@LhPb0h^ R-LM0  04 0 00 0B0CQ0 P0U@ 0Sʠ l, 8 o8 0f8S8pLpZpi 8 08 0 0 $80,,0@\04 0d `P 000 P00@X 0@@ @(@<@0@4@xpH@L@|@@@l@00W p0f.Q h @@@@@@@t,0^@0# ,1,0˯$000T0 R< !0S 0 00000(Ko˯8pL 8 8 80V H Zʠ Z \ l`P, fX0X PP0l,0 ^@00Pʠ,0 Y00PH֐( P P(4L@0- \ 0Q| 0 @ P -L MtptP`@F ` 0 04V`V pPK_PLx֐ 0P \/| 0 @ iP1 -@PQ 0`L U00Sp 00S@P`0U00PWP$A WW V0 RUh0\0 R P0w3 PV  0U00p[hOO R-L\M !|  x p PL L p h P p%PP00mPr @ p `0 d0 \ X0 l pp l 0AZS[tDDDDDDDDHD 伂DDDDDDDDDDDDDDDDDDDDDDDDDDDD| rd00d0 d  `@@0X0  \0S@\00P0ds0S(@Kd h@  RY ( K2h 5:R\ X b\`L=h0 PX URT T d0T@@T@ dt `T@aTZ L W00 S 00 |0  @DTX@T  Z L W00 SX |  t0S @eTZ L W00 S000 |  @Ddd d  Z `@@ X d00d0 d  `@@Vx-0Pu`X0 s` @ b` p0dd dSd Pd @M P@@o1>A P`0h@0  dh@ d(Kd 0R( Kh@h000(K0dc dh@ \`P]d-d *d @' P@@`-d0d d@  P@@`l\ P?Kh TP ?K`@X` >X R p0pX p d00d0 0\` p@vd) P `@@d@ 00d  X d X pdd Yp0+X Tp0lPdd p0 d d H@@4p d0 0d0 ?0\ h0 h8PR@h =P h0\Pc U\PT d0 p  H D `  0S S S`D@H0?K0(@+@?D Ry Zk L W00 S  | p @0P? K@h TP ?0K_pd @ d 0'P`d0@P 0@x@ d0 l@ X dd\ǟ P edd  d0@ P@@`Zp d00d0 l00Lp l l!0000L Qp `0 p*P 0@ \l \ p00P!0l 00A 0 \?\0 p \PT 0@P`@0@Po@0@P`@ | @DFL W00 S |0  h@@h@ PU):hZ| `T @`T?Z LW00 S000 |   @D0| @D*0| @Dd `T@aTZ L W00 S 00 |0  @DTP | @Dd  Z[ L@W00 SF |  X| V U)Kh %(0Kh0 P@0%&"Ph`ah ( Ka5(@K 0 00dQP` @Dh@ h (K00b0 P0@P`@]000LP  Rl   | 2 | 0Fl| Add  d@ H  H@0@H0 D@ 0 H D y| #@x@TpH0D@0z `Pf  P@ l@ \2A@QHK<@00` !0@s0^S!0@s0^S^<,Z5 LW00 S |   !0@s0^SL@W00 S |  !0@s0^SZ| h=/PT D@H0?K @I| DH0?K =^ Z LW00 S>00 | p 0@?p \0 ꔱTxph Q-L@M  K 0"( K 0 K(0 -0- L M0CQ0  0( K  K0 K( 0 0-LM@TP 0P40 R@ 00Xp[ --LMPe 0 l,0 R@ KXp[ -@L -L - -LM0 > K -`0-LMh!D0 ,1 Q  ,1 0 " KO - -LMp@p 0` ` `P 40 R0` ` RKO 0-LM@ <+PK0@ /+[P @ P> K0) --LM@xP p` 0@ @ @00 R0@ @ KO 갱 p- -LMP0P S\0`A LP 8,@ 0@p[dı% ` 0-@L   00CS̱d챑 -ML  0@-0R? R  b1#880S$H(Y `00L  0S`xxHp|` p-LMP0r` S S S S S S 0 S S S S S SLp@KP u p0 S S p8 -LM Q Q00 P Q Q P  Q Q 0 Q Qs  Q Q Q Q  P Q 0S8@0耟rp`00 0 s`v@TVP0  Pv000 0s`v@T00s@t Qs (K,`KtPs xȀX $3-LM` R"SP2 Pvp nTNT _kp@[yTYTYTyTs (K(KoNp nTNT hEkp@\AyTYTYTyTc4"20S @P& Q 0S$P Z] P 0s 0s 0pᜢP[ @q,p   0@ t!0 s dqP.0s@&Z0$ S (Ko(Koco@aA00c10a0 0c10 i(KoP 0, vP00 00, sL(KoptTl%`ȀIJXHĶ| -LsprcY 2` "0S* @P 0PS# 0,P0  嗝PW WP W0S0SSPc0ISEHQ0S<@0@S nPWc0ISt\D(cY 0  >0p00Lx00SS Lu4|`THԶt -LM`pq00(@0 S SPP S@S(K,KP0, R ڜ?P QPqP |2p 0 P,00aZ<f 0_p` r -L0MLKT ` spӛ#0#S W C0SP @$0 @S 7P0  墜$0 @PPSU ,PK\a 0Pn,@t 4# TP0i  KtKZ,0so a"T,*",p RP 2"PP@ PE $U @DlBhB@TLŸ r0s S (2 P2\ r0s S 1 P!P001 R$ @p 0S! 0宛P0  P0S S0WpH(K<4[@0S P 0S 0僛P0  P0S S0UPp@0S 0S 0dP0  ϛP0S S1pTApt`,0D@`4 -LM0 S SPpp0 S S P S S S S  ` S S ` 0 S SP\0S @@0S P }P@0S@ T T`` TPz1 0 L B*R񟗽@,\l 0 S 0` 0$KT ,KP4, 0 T ,K& K(0K0@P~,"[2[G0@ T ,KPp,  RR@@ Rw040 Tg ,`K@P,_0@ T_ ,`K@P,d 0@ TQ ,`K@P,e 0@ T? ,`K@P[W0@ 000 T*0@ qiy000 T?C 000 Ÿ"00s03S0000 r000 mT0@ h}000 cx0@ _t0@ [`|n0@ Upj0@ Qdf0@ Mx000 H,`KCP0S A,00 0Bs0 RS 0Bs0 RS Rt R R R P,00& K(0KZ@Pf"[2[,0@ @P,0@ @P#,00@ & K(0K8@Pc"[2[,b0@ & K(0K(@Pve"[2[,R0@ & K(0K@Pfd"[2[,B0@ ꐞзl\x|$<췑 -L[HBg<(4屖P(P 5ghꬸt[ȸ///N/-// 21C/p 32C/ h0 $P/H0 P<0p,0 !4$ 04/0- $ Rl0\`0S  Q 1S0Ġ 8 8#$ $ /E/// -LP@p`X`PV P@ -LMR,0 pP ' `0S` VP 0 S00űՀ @P 00 00 0 00CS 0 ,0 -L\M@$P(x |0 0P! P:Z`Kp  0kP `Kp  !xpt rPh Z 0p1 0 R0| Rd `p 4K|0, 40KH#`pQd 01@`ep6d P 3$ l 20  !$ @$ !0p V0SM|Q! 4Kn4KQl W0e 0s0S<,0d Vc\@ < 8 i<0S]2"l A $0@ 0 S 0  ! @ !F!l0h hQ 0  ! @ !h#Q q1 Qx ph 0pS t ԛh(KV0R,0dP00Ӑ@ 0R@KV}l 0x @ @ < 8 h xp0Ph p h S$ɚ;_Q4_ʚ; -LM`@Pp 0PK hP K<P P $PK WP0p -LMPu Uh ?\poA3cO40 0@ $"4KPU`7G$,0  0(KMb@B 0-L,P@P0PP0ڝP H 0R0000_ p-@L ĈPp!00@Pp` H 0RP# $0@ 0  !$ @$ !pdd X0 00 ៾唝00@Pp)0S (__ -L M< D @ H 0 , 0 DH00Z8 40 782a070`0PpC @@# Z!ڴ~ PP. 0,0 0   P <040 !<0 0! ! 00CS 0~ Z,0  ^, 0 0< (K Q-LdMPx | 0 `c0x P0x BY[X@K ӕPpKl@ @ T@KL KH0KDK` d0 h |P l 0`P RW  '`PQ 0  !$ @$ !v` #V V|0S ` ሜP` \ d  ~P`P h uP`l 0R !l B(K  0Ӛ 0l l 0 d @XK p`0 h 0S  ̛`P\\ p 4K, 40K"pQ\ 01#@pe(6,\ 0S 㛫p (0t  !$ @$ !l` x0`Pd0S` R! 4K4KW0 X0) 0s0SO,0\ Wc\@ < 8 -<0S!818!p ,A $0@ t 0S" `GW0X,0\\00@ 0R@Kzp 0 @ @ < 8 0  !$ @$ !F< p08` Vu ɚ;_Qʚ;<_ -L M`@Pp 0PK P KPP $PK PA p -L(M`@Pp 4PK ךP KP,04K(K#( $ !B !  p` -LlM@pQ1 0 P  T  Tf 00CS 0 } (KT PK00  哚P< 0TpHP D@ 0 4 ,0 8 p8p 0S4W10p8p 0S+W) RP0  H KP80,DP`c0pǏ@ P`,0 DPH`00S  o80W pP 㢘P #P -LM@`PpN|P 0 K 0 0 0P p[ -LMPp`.|@P 0 K $0 ( 0 0 0@(0KP@ 6 -LM@ |PPB 0? `f 0-L@LLP0L\ 0<L00L 0-PLP0 8 ^0 @0@n0C00 @,000 b_֐$֐ l -$LƐ:0 `T@P D@HP@Pp0uLP 0( 0$@,(4,0 804@ 80<@@ 0  0  -`$@AL0LHPp  0SL0 p0u03R0SL0 pWQL0@0L0L0 p p 0 0b Sp!L0@0L0 -LL0@@  {L0D00Phh@0L0L0 0-@PL0L0P 0RL0 fL0 0L00T sP0SHPU L00L0Q0H0$0hkT_ -@$0@$@L -L$@`P<P0p0P0\! Q4  0 0`SP1P! U P! `Pb0 00S0`%0eS``0p\V@ P00CSP0+ 01RL0< 00b S,*L0W003L  L  `P`P 0L0շL0  00L0ͷ 00b S:4 P00CSP00L0ḷ m#`T\ ` p-PL@PL0G`P pw4 ` P  000p֐$֐֐ b -L$0HPU L0P00P0 PYP L~   ZppbQ0#02S2Q@. 00cTtLf  0bQ0#02S@Q`P P00CSP0A QH L0V,∹Q a0@L 0 L 00"@`PL0,B0S 0 S0S`Pj P00CSP0L0  (0L0 L0  (0L0Q0S V` P0 `0CSP0 `0 T@!pbT `P00T00S%V 0L0Ҷ Ϯp`V0 0S00g 0%0u<0L0ᶶg ᴮ``\#`ZP000[!d_ p-P@L@WP@L@H@`P 8@ϸ 0, 0D0p -LMP@ p`@P@P (K, < F,K8 K}@PO, 0 S,0,0X0K$`,04 K}@P4000㸐0 0000$0  8 0004 000HH`, (00(0, 00CS 0' 0 (00(00 00CS 0 8K@ @P <8kv,w`<8}4}0v,v_0 80S /j g -@$LP %0$0 -LMP$`pl 㔍90  P0S T00 @0000 0 0  K$ -L$@夡PA`p L0SK 0SH ` `  H0S( `V&000 0 `0aR R3S `@`xp000  0 `P h0R ! *  3S3S`  0-LM\@P$L 1\, 1\ 1\0 ,40iSR rSJ   0" K0<1\* 41\0#300 < (1 @ (1 D P00<<00P 0,< ,0T00<000,< ,0  K0h  0K0h螯 s@~fs}ff@s@ -LM$  0& K -L M$  0~! K 40 #p-Px"B L@!r rL0`<0p@@8@00Pp0`<0 p-@@Lpp 40`#\`"B P R00 0S00p p-@@Lpp 40`#\`"B P R00 0S00p -p@Lp 40x#t`"B PH L00bO 0$@.H0SPP1P91 -L0S 3/ p-@L0`t00t0Pp0s0s S//0\ X ?AcQ<?Q? 00sL 0Sr0dSd0s0>/gfff-\  )0h SS\0 0/``R  Rx0x0'' Q Qx0x088 R/AL0 (- @L 0㫐0Qp00  (00H >1>1>1t00  |0S 00 0l0$0(Q`` Q0-LM@P@00CS)))))00 0P岬@K0-@x0l0`0KL0 20O  @{````` >0- L@㯏0 T;:|@Ph0h0h6(h 2Hh .00 8 ,P0 00PL0``& 0-LP 0NP0.t0R0 -LM@pP`H0St0t0# 0  0S 3/H0St t  0  0S 0t0H( (0PP  -@LȠ`^VH ph10RUzV tp t0l0t00哳H0U kh@ 1HX  Ol -LHMP(Kx3 t@"A@1@KX3E$  1   000c0S |P @T ,KoP@T 0KgU P 0 ,0R:, @PTD0l<K<0L@ ,P 0$L H Kz4l2l0S40 <0KP0 @<0 8@ 4 @$20S@0 jQs )0h pSS, Q )0h SS\0 I P ,0R:h0p,0 Q)0S㈑ S】 dx1Yp1pA@<4+81%Ϡ.,0El<@K0.0H@K0L@nb  @P` nKP0 |0 ,0Rxi:D0fsP,0R:$0 H0K`0 @H0 D@ @ TF HB <>,xQ@KLɚ;@乑칑'k_kĹ -@Lt0 | 1hZ -L.H0@St0hs0t0HHE -Lt0@@0  P HPt0@0t0!00S3/Pt0@0t0 -L  Z^ Z Z Z , Z00"# 0@d 0 d  HPL# 0?0S 543,5(354350tq . a0JS J0 `0JSr5@5@5@5@5@5@5@5@5@5@5@5@5@5@5@5@5@5@5@5@5@5@5@5@5@5@55555 0 .0Pc0>H p P`0O0@`d  d >V J0>y  0@d 0 d  HP 0>cJ` 0s ,!0 Q0As ~|A0J\ZSP pP`\H0@d  d Pk =^p!p(p'p)Z)p2 l 0@d 0 d  MH PI>SC ?` -LP`@t0 p  U 0  0-Lt0P   % "20#0 P0S0 0@@T 0h@T00 P0S P ^T @^? -LMPP  봠(`(pK @P ( @P` @P ( @Pt0:t00>0> p-`QL@pP\ YPUUp 2-LM@P0 S50 ^ B?@0CS+1 ? R  t0 ! T0N>K2n @ :t0\ ~0S萟t0 :t0>%`,pKⰎ > PP , P PP0t 5*0t .xr0c Q.PPQJPUZ4 -LMp0P`,2 8" 4r 0r |4t l@0  82@4<$0 02S  I3#0h, R  VR8 0H0XDVa V(ڠ#?0@ @V' 0>H >`` 0> 0O`l0@Pd p d iʨ0H0Xe VR  NEPS0`FpH0XM2H0tBXC82st0H0t0`"`2U0 02Se  R`1l#K 9P0 T42S042 0S 10S  p0R>SV0B@Q Q Q EVrH0C1D [ |0PX 0U @S00!O 1FL0S9  ǡ  1@P0  -  42S Kу0(K l 42 S ,2R#  0" 002  #002 R4K⮃  002 HO`O|QN h -L@ qP` (Q/Q)t0 >;.t0.Fp0t #40,àt x LHQHPp5 (2 Q HP+ Q-L@ t00t0t0 0t0 0) P P y  -Lt@ 0R'0 t0! 0)P P UqQ  p ̌t"$ L32C 00t0 h`` -@0LS00> 0Q>|  00CS0 ttL" -`ppLoX0 Y㨀@  0@D  D 9@P 蜠% ,t 00S r PWP|@$  20P; t zRxW  a @h0(PTgʣ/0S\(0Sڜ0  P H Pt0@t0 0S 3/Pt@tt  p [ |t  0S, 0S  0S 0SH 0SW~ X)| 㝟t t 0@$  $ i0 t@0  th0@t t    0R20,50t o pG0 $Y"   A0GS p0S P 0S 0SL 0S W   tp(0 h0S&  .H0S9tq  0S 0SWt W W@ p p(0 S|P@PY W 0S 0S 0S >0s0S>>>t  N$0SqSo m >t 0bS@1@#Te@DT^0p  y t  (Wt{pq !W|pm 'W`pj W X?0|S W 050<,(0 0S050-| 㗞tWtW   ^tt { Wy 0>(2xW 0S tWW: tl 0WtW  > Rt |lQf0>t>tW  |@ P0 P p p P P 0 @Pp0 P P W 0@0S tt/ W   at~\Wty%op0t#40#"B )W}p ^W~p  R @0S,%| z``` -LMp 0TT X<嘠pP<0S X` T 0T 0T 0T  T` 8"0"@h?0c\N28P 8 X(KT =  S| ̜V !1pP8 0DE |0PB 00!B4  1>@@<0S9  㩜,$!(1@pP 0\Gx#W  cy 0'B0Sj8P0 F 8 8D8 0R,0 !V8;0p0 #pp0pOgfffN1 -L0@  (0 P0S0(   -p@Lp' 40#`"B P0O 0$@0  $0St0191191 0S𩝘 40 -Là` L@Ap(0P  UWt0P.H0SP    kPʤ0  Pt0P -LXMP|0 U`' J;U# ;U J0U l;Ur F`;U zT;U 0;Ut 0UH 0;U6 p(K;0S, 0 SD |0^ @00 1F0S f *:@pP :U+0CU*0CUd:Uf T0CUJ H:U 0U0:t  @6 5,0t R9p9U 9UIA?p 9U; H9U :P90S\9X90Sx %$0Sx9pq9U  y 9U> 9U5 8UcH0p0`Xt@ pSP X0S Z t0(0(SpE  @0h p(D0 @0CpKl0 p H@ @ $ApP6 \3b0(!\` p\ra\KW#Q0CUZ 0UGt0p;t07U 7U (1 R |03 ,1 RD0 l0`' 20p@7U 87Ul0p0 7U 0U弅,1 QD0 Pp 0Qp| p&0Zp ppXFt0p;t0h6@p` Tp#*l0S  V| t l0 20  pP!   l0tpP @  |P  || px Lpt , |pnTp@ a,1 QAD0> 0p ,SDx0p8x0 @8x0  x07x00@x08x00 x07x05 p1  T|p+,1 R :P|pPp30St0t000t0t0`,1 @T40S R.\ 00CS0 ,! 000,! 00,!| ,1 0 !D 0 D  !p(0Sb0S  3/pPt  0    00CsQ 00000!30 !0l0 10C<0  0@-0S| x 00 QRT0 BR 0P@@ R00c!R!<0b-L0P R 00c!R!<0b -@Lp RP`$ 0  BQ0A0 00C 0 0 Q  00b \20 200 00SPP0 0 -PL`V@.Q@*pQ% 0S a0 aR@@ y z P 0a0 0S00`dd0Vp@hQ   -@LP x> ?P 0SBx0 S B>! .000 p-@`LP >bV`0 0 0P  pUB> N -pQLP@p4 Q( Q+ `0Q! 0P ` `0RPP y`P  0a 0 0S 00pe 0W R 0   -LPa@ Rp5 R0S* 0 0 0P \  0a 0 10  0P000  00 10   O0 -LMpḠ0S# 0S 0R Tp(KPDKD@K 00h! D0 ,1 P |[/OD0 ,1 0S ^[ p-LM`PD , @T Q Q0 S 0  !D D !Kp`[at -pPL` D0 ,1 @T  \ 0Z `\` -pPL` D0 ,1 @T  \ 0Z `[` p-P L`D0 ,1 @T  \0 CZ `[p`p80 P/0S/0S/P/` -L@P P*0Ss0 S4P: P0-LP@0P QT 4Q R0S0T0SR\ 0l0 -LPpU`@T * \4@0 t;tPD8t D0-00@1L0 u0@0 Q-LM`  pR KuPP VU 0 @@cV@1`d t0V 0 pPqom j묺\t 0-@L100! B! 1P  %@ 0Z1U1:11`c 0-L@P@0SU 00 6t 00 0PP 1  T0S3 0 SP00 P-LP p-@LPᝢ 0R* @ῢ`p`000嶢VpCPp 0-@LPz 0R* ᜢ0000啢0P 0-LP@@P04U00  101xQ0hc` -@LP,Tp` UcPP 1PDP 01T0, H0P L`X@T@W@ t@pP @8 p-@LP`pPP7p R'000 0P!00*1! D Dbs1!D 0 !X@T@1  0 1 p0 1 7pD ?s P 0-LP\ P@ L@ḡD0  4101ۡ0 Q 1000c` -LM`P PQ@ @ R*@PbTp1e#Zp pP  0j0  - DD0  0 P0 pP  P'00h00,0 Z  0j0   r0   P@0,0p0p -LϠ MϜ4 0 ~Q44  10 K0dpPq X0,0 ,@KbDD0P@@@`00X  n000 S0p00 XFWB @ &P`? Y& 00 0bX1! ' 0S  ; SX1! 0  00b^! 0 4r4 EPh0X00 "rX,(K, ʚ;ຑĺ -LMh -LQӻRQ`pP PP 0 \@ @ 0S*@cTS5X V ʲ! 0P0 000000f0PP" 1 `000 0X0j 0    0S 0S00P 0PX  -LM Q-Lp@`8W 0 0g 0 1000DP% 1 A @AQ PPQA@AA00D00 0g0` ` pG6` -L@P  r -LH@HPHp[n <0@T0hc(<c -@ ML 0@I;0`< 0@6(뤠p夀P0@ @#5  00uPU`$KmcpP X XPp , 1 0Y0 17, 717,` -L`RPp*Q+U! 0Q*U 0ScPPVU 0@`T@! 7/P`dVP   |Th R-LMp`@0,0 +PP V@`;,K⼠,0S PP3 젠 jR",0S W gpZ @1@! @`d oVPx0Z0 c; 1,, 1:1,i -L1`Qu 0,0Sp* 0Xcp`!Q@@T P 0D P0 S`:X4k`X  `V00S 0 X@1@! qo d 00dS 0000 X  V00SR`` pP T)1  A @AQ PPQA@AAD00X@@X 0Xpc`0 i1002 02/2/RP/0S/0S/P/00/// -L@Q 00Q02i -L @R00 0S004 R0 0 Rq02i 0-@QLP 4T R$wPP@00i軑  0-@LPP n0 -@Lp`@T PU00002 P02@T P7 -LMPp, 00 , KI@P P P T0PTP0 ,RX \ 0`h 0%`hW00S Z0 ,00(KW#VgXg0PUSUY  0 `Q ,0 0P@, R  0 R0W8\fEW3PP00W00SU& `0, m 0 0f 0 00 J 00 0w00P0@,0 0 *1g @PP  P0 XU( ,0S 00S VU 0S:0f 0,0 m 00f 0@,P V0 1e 00 00 0? p@| -LM`XP@@ 0 p@ K -LM@0`P-P  Kp0P h 0PP 0S000VT 0V`H 0V003 `Otx 80-LMh @   0KO -LMP\`@L0h0p  @KO p-LM@p`09@P 0%@ 0 <0h0 @KpO -LM@0`P-@  K耀0p 0  8@P00Ph 0 @O0S R$  /0S$ / p-P!80Lr$ rp0P`P0P0<0<0H@,  3,P03p0`<0DTd p-@80L\`$P| R0|0 0S00|0S808p0-80$P @P @$P0  191# 0/#R 00 40Q h0 ?SRP p-@80L\`$P R00 0S000S<0<p@-8 $3O 0$@P/ -@L<@ D0ljxh -$LM^P` 0S \  000V Z VW@3O! P-@L 0S 3/ -L<0S  0Pb0c0 UP[R8 W0@ 4(@ 0 Q P:0O0@/Tʪ ,$h@0S, K4  ,@T 8젠PW0]0 X00S_ ; 1W 00S ,0S  V@Kd@ @  @40P, 000@P`pVP #0:0P 3 8 h0R0 , <00ʼnh -@L060800ᶉ h 2-LMPL0!,0 32C0`,0S (K#0a R 0 彳0P 4 40 0 @@40 0<0<00D D03 X @3P`p@0 0@P,hh0 \`Z`0 \   0 X0 P@h!   00PZ 0 06<0 00 0W N OcQpjO 0-L0P@ 00U0 8P6k0hf b60hԈ -RLpP` 10^ V@ @@ 0R 0 `0aR \^P 0 0 F_T`V`0   0 1SS 0001P00S 0 00!RR 0001P000$0S $ ؼ@10/ -LM @S 1 !@ 3gPK -g 0-P0@L@1S0S TBP 0@A00iP 0 -L@HP  0S 0&  0 0 S-`;0SpLPp3*tU@ ; 1,7p P YfpPV@0P -LMp`$ K@P $ $P0  00CS 0$H9@ K(K -f@P $  00CS 0 E  0@P(0J@$yH -LMp`$ KkPP  K(K ePP $  00CS 0 X  $0$@ 0PP(0 P$D%@ K (K0D@P 000$  00CS 0 (P t@(@P0A?AS$  00CS 0 ($@$ D$ D\P06F< 0\l@P C03輑 R-L MpD @ 0K maPP, KPP (K$#,,0< $@ 1  < 3S PT0 00B ,`80 `,K4 KzJPPI0 9 a>@ 3SCU`4]C,D`0P,2< 00CS 0 C3SP0 0F6!PP  904 0005503 P#`6㌂ PPO | L,0 0 8 ,0  ,0@, $PzD PP00R00S(U `4B,C`@ #P5P,08 K0, (00(0, 00CS 0  40000@P, CɶL~f -LM @90 @K -LM ʠ K p-LM`@ KPP p0$5  00CS 0PBp p-LM`@ KPP Kp K0PP   00CS 0B0  $P P -@PLQ 1S 0 Sh0 R0S0 0C#qW P`Z0 ` 08/WP@TP/ P/( /0S00(0   (/PkP/ 0  0C0 00C0BLk -L RrR0@0T  (0 (@T@T (f (00C0( 0(0RJ @T@T1& 0^ R`3 P  Q 0Q(0  00 0P pLW@P@T J P0S$P @TZ@WPMB@TPZ& ]00$Q d0 R0 l D)@ R 0R@@kPkP 0S  0zW uWꀢ -L MP4 `0S |2R P(K \ 00^D2D L <2,B/@!bQP0p1`l f] @>W; 1_ ` 1W ]  @n8@ T 0X0 Q 0 0@Cp0PK 0sE 0sB 0SSC W, pX 0@D0 0,000  1  V04@,K \, ` PW,pK†@ V, `FV 00C 0,00C0  B rPp \7Pj` PPe`P$Lkgfff Q-LM8 040 2 A< h 0@!q#Wt 0X]40 0  0S Wt4@PW P@0S$0S S  T;Pz W ,]WY40@P` 0< ` 1  000W@PM CP, @VJ0 1P5L@@TZ,0S(PK ,],]U @0@0"W,]00S  \(K4 , ]W0(P00 (P0 ,]A 0%V40 @P@8  @X, W  B 00C0 ,]P APOLk00S S/P/P/ -L@T000S S S00h0S00 S  R  R 0S00  000 嵳 0-L@P0S000ID 0h[ -@0 LR )  0S S S 4刳00 -LLMpP0S/@ (K iQ0@0jQ@h ?UP 0D H0 D 0 BpKp@ h0 l @P %@P\`0S&@ K"@(!08@PTX 0R)@ 0 . 0=@P  t P  0(1  $ (1 ( 0 ,  0,$0t  $0  `@ʚ; 0-L @R 0T00m#0S 64P0PP80 R  Z0h0hZLk -LM0S@80Cq hR3PU/P,VhP`* pj0 p 0T 0lK00@0 l0CdP DP h0 l < sPPX@T TDK8TP ! #0P$KPx#@K 00 0T XKˠD Kˠ 6PPX0pT0(! 0$0( 0(00,@ ,@8 -L0@S X0S0S S S pHl0l HPD pZP7@8$0$ 4P  Q-LM@p`6 PXP Q00S0v03Q0SQ=hX@(h8$   0S -X Z p- 0Sp c̱ M V8[TPC PA 00 0 3@P  80@ 0$@( 80<@,00@@ 4 00 @5U6 Rg R7 R5 t|0S( S S Tsyw R P00T0P 4 `0 a00400P 0l 0D[NPV00,0 0"PJ UpJRO P` 40 0c c 0PXP0 4P0 b0b0 0 0Y0( %W 0S80 P@QP 0P7W PXP0Y0P90 PP, P" DDk<4,,,,,0  /lllTk 0P/0P 0/lll0/TkA-00, C6pǏ,0' 0S@ 00S@0@0@`P`|Q P` `Pd` R$0$0$00 $0 ,0,( (0S@llhkTkl ll 1-p`LV, 0㇃V#\- 00 C6OPU`` R$0$0$00$0  , 0%, 0,04,0 $ 0 `UU0hklP -L00, C6pǏ,0 ,05,0褐0@ P` pp0 0 $ 0<0@P``4p p`d hk llllTk -L$$q PlPll ll p-@L`,0 P0X z|,0  ,0  ,0<,0p,0 p<Ppl -LM`T@PKL@ HP p<@P ,0 @ K,0/,00,0,0/,00,0,00,0F6 -L Mz!0 C6B6cOᬁ`p`Vp\ 000S @d _0,0XS00A1P&Od 0P$qP3! 00a&0@S000R 5 0.@k]P R00C1/0 @Lx0 K!00\ 8?2cdS0d00ꬸX48lkkdktlfffl\k`kQ 0-LHQP00  0@pP00h衦hkl -@Lq,0 ,0;,0,0 `B 0S h10S 3/,0,00,0P <Q,0  !!0S20S 0 @_Q t0S(0 08z0S*,08,0*z\,0:0,0t,0 ,08,0z00zp0Skkm`khk 0-L,0P M,0\<P,0 50S 10S 3/,0 *   ,0  ,0  ,0 # 0 0@ 0$@,0@ ,0 0hQ,08,00hy,0@0,0|0,08,0(0 0@(0,@khk|h2 -Lh!T2TP DrD`UC Z ,Ÿ0 P?Skh 2PP2 0 P?S52 ',0a :0S ,00S  3/P4@@!0,`PP,!0S<  !0dzRt0SZ00S0p R`ꊉ,07,0`]yRt0Sʐ80p R8 0S 00yOlhkl\kkmm p-L,0` @0#4 R21C 0Q ,  , ,0<,0phl,0TP0,0@( h000phpO -L pRh 0ST0(, P00S $0@SQ XF x0 0@x0|@8P` 00 0@ 0$@04 ,@,0<0,0P 0h  0H  H ,08,03\P S5X@ @h0 0@h0l@Z@,0hkO -LHpP`0S 0@4@ R @,0 ,0;,09` R T,0 h,08,0h.x(1 -L P@@!q@0D0@`P 0 @_R P`0PU`/R x t0 R0S< {VQt0S0p Rk`k8hk\km S-LM<0 0 8 4 D# , `P C0P@0 @P< p4 00S 8KgP8 K t x0l p0000<PD@P R00,3 `< P,"(K2Ԣ"P`0PU`/R, At0Sڜ22 RA<@划>0P`#6pǏ P`?VU@P3 P <OP`0P`OV t0S`A0 ?V8A!0"E 6w11 RU@Px1x!h0Q h1 Q \AHwP!0)x, p~,0@;,00@@a 8g@,pbQtU \0p RmD0p R,0pI0 D8l!Cehk\kl8`kkmOqlm -L@ 0P  -LMp< ,0 , 0 0PP KTp P ` PP ,0 ,0 8,00 wt0@T P(KP @00@@0D@, , s Ľhk -LMp,0  Z0ST0(P Z p0 0@p0t@$K0 0@0@, \) , (08P0`@ (0,@8< <1 h000hkO -LMP @Pp, Z `@`P P U (Ko,1 -LM@hq -L0Mp@PpP `v>0Z ](K4K0P ,@K@j0PE,04 @r,@ T { 0P< RPL < PR/J`L1pPUpG&J0O U00PP<@T L1P @,0;,0 < TL Q0 L<L0$\H 1D AL 0@ 80 P`(080@ (0,@8< @0H/,0dp90,0H0 Po`40K  Ptx 808 04< @0`\D 0@0 0D0 `0dPh`H40K, t0x@)D , L0H|0(P`80P `0@H80<@(P,`'0< h000000sE)hkdO `0p-LX` T0@PT0 Q00cR0bc00cUppk8k-,0D 0R,0 L @R\0P P0 P0L P0D pP`Hp0P` ppPt`HpL/,mhk -L Mp00` C64 /0`0d0R00 ,@ dph#ژ0K6@ 4ٵ0@00儻P`0P` P `00pC6 ?S (KRQhk -LM||@P0@P0 0 <(6@0@0 @0`d`hp m8mhk 0-@0LQPD00d>d f0@0V 0-PLLQ|0P0P P0 LP dp0 0@p0t@D@0D00d(e,0 <0,mhkVl 0p-LD`PVD0 ,0F0cLe`0S EVp,0D` ,00,0 R6,05,0 RL L0L0P00PPp0 0@p0t@pL R@P0P0P00P0L p p0 pt D H00@H0L@00s Vmhk,m -LD0`S 0H@ pHL L @P 0LP`p0 ^Ppt ,00,0s,00,0hk,mm -LD0S L @R1P P0 P0P0L  1p0 pt ` H00@H0L@@@1 Y#* @Pp80 pt 00#6 dP`v0@ `w 8 c00CX:dD`堐堀pW4tphAtP Th 0 `T ,t\p^hk,m4mmVOqm̽l,00,0| -LM0`0@,Pp 0ʠ @ @岨PT0 P`'HH0HP h@lPp@tPKhp)됱,m4mmhk8mmؽp@-`@\( 0S% ^P) ^  R  R@ 00 R000 S0  0S\ 00p0@00  R \,  R/ 0^00 S 0  0S0S0P@ 0 S@@ 0 @0@000S00S0@ 0^@@ P@0@- R 0S^ 0Sk 00R 0SI0SD \   R00 \0S0  0S  R( ^ 0Sm R 0S 0R00S00 S0 0S    R000000 \0S0  0SR 0S@0T00 S @0  0 S 0R00S00 S0 0S    R0 R 0S@0T00 S @0P  0 SP y -LpX5 PU?P0S`X`V 0S@W `RP 0WPP 0RPPV 00SZ  `X `V 0S` P 0S/0S/P/0S/0S/0S / P 0S/0S/P/0S/0S/0S /P/Q00S/Q00S/ Lp-@DPD` ML< X0P`P@@@`Kp O\1@P W 04!0 R B d 00 (0 0@(0,@ ) U W)0600 9 0G  0@P  7h0 @P p0 00 @P $ !Onnxn p-L@`TP@P  R0T 0@ PPP@p0@0@@P1 -pLQ`P0Sȸ帡 0R1P tW0p$0@40$0 9,0(`8DX0S: XP 0mN(1P剢W, W  @0@00 0S 0Rؼ0Pm8 RR:0.S `0  $0@`5 TpT  @000R 90.Sꤢpnn X. WFʁ qp tq U<9 Xt0   0 0Su0000rtuXYTU0SVt0 TY t6 q: R Q W0 t 0R XY V0 qrruuXuVzrQ4 p-L MPK0@0% `K0S 0S  0`%PKp  -LpP01 0101 P`u 0P@`PU`P `400v0@0 @ -@L0J0 0C0hN\o 0-L@PrJUT004J0P0T 00   R0\o -0LS 0R& 0 8 `pPi@ 0 0@P Q $  (0S 0 0@ 0R0 @  -L MP0@T$pK `K$0   0`w@P \0DS PP|PHPP 0 0 @K 0 @ 0@ 0$0 @ 0$  0@Q  0S v 0  0$  ? 0R 0 0@ -L MP0SIJ@PN d @ 0@ 3 cHQ d0S\  0@  0S ` K  `V $ (0(, @P$0$#0>j0S` (Q,0, ,0, $ 00V 00F` pK@'`(K 0P (`P S(S(TSdTLS#``T $0`P(  0Sa 0`0T$0 `P 0(0@(x0SO P ( R,0,0,0,0$0 $0 ,0( P((0$0 PT) $ 0P( $0  p@ 0R=  0R) (C`[`0P@(0   ($ 3@~(0$ (0S&(0S 0R$0@P 0( *`$ -LM0 40 1Ph1,0 080 EPA`V@ p pppV2T 0 P9 ,Y(1; @PMP$ 8 ` p4@00 00$ 8 0C ,0 ,0Y40% Y Y PP P(K`P`(KoY0P1, (1'P PUO 4-L M$@ 8 0tK\oL -LM@ 80 `#0 R\ 0 [  pP0P0CS,P P%0 ,0S 0 9"wP  00X(0$  Ppm X(0$  0  R [ p0  p,0S (0$ rp ! śÛTh -LM`,( 0 080 R0 0(40 S P< 00  , "<@0/S D 0S/S 0S/S0dS@0 c0/S ,,0SɌ,80SɌ,,Ɍ,@0S , ! 0U D0U 0,P (0Pa  A"0Sy 0Sv 0 ,  00,P @PD R,Z ,0 jb, D@0,SɌ,P0 ST@T$  "I P, L!,K0 p8 W^ ,P,P0 S SJT30 S ( @<@u <@ D 0S/SY0c@ 0/S^0/S ,`jnj ,WPP{,  (00CSP  z40S,r @Q p!0.SM0.Sʌ,HIS,hR 8 @0! RN # T+ 00(K0/S 0 db<0@S@ p0S4 0p03R0S@,PɌ,p@ ?@p  pt,@0 R1(0$ ,  0p   , 00S (0$ 4 Rs (0$ o p@0 0 jȌp,0 @pXo@  -L(Mp0,0((! 4 P 0S 8+0E`V/ R+ ,0 80CQ 0S/S0/S{L Q0$0 R 3  0/S dq %P8契 ``8埑00(KU Pz8(0S < P `Pu,0n 0`"\ RU $0S0$0o0S8$わ0`0K0@4 PP PK4` H0 D@ 8 `8l  I00d R8 `?`0PS8ZXonp@-`@\( 0S% ^P) ^ R R@ 0 0 R0 00 S0  0S\ 0 0p0@ 0 0  R \,  R/ 0^ 00 S 0  0S0S0P@ 0 S@@ 0 @0@ 0 0 0S00S0@ 0^@@ P@0@- R 0S^ 0Sk 0 0R 0SI0SD \  R0 0 \0S0  0S R( ^ 0Sm R 0S 0R 00 S00 S0 0S    R00 000 0 \0S0  0SR 0S@0T 00 S @0  0 S 0R 00 S00 S0 0S    R0 R 0S@0T 00 S @0P  0 SP y -L`@V3 ^=0S`PVPU p` 0S`` T PR 0T 0RU 00SW `PV p PU` 0S``P p P 0S/0S/P/0S/0S/0S / P 0S/0S/P/0S/0S/0S /P/Q00S/Q00S/0-l@0l S0/ UTR p-L@PT `P`@@T@p 0-L@PT P@@T0 p-L@`TP@P  R0T 0 PPP@p0@ 0@@P0 /L0P/P 0S 0R/P/,p -LM` 0p00Ġ R 00@4h 04 0Q$0 $PK @$00$0 0s0P@$00Kb,p0 l 0 $ \` P0T0L0DH @08< 40,0 X0(000 00/(0S 4 R808080 Q(/0S40 40808/000/ 0-@LP 0  P\ 0,0 ,0 0@00S,0 ,0,0000@00qq0  R0S,PPL0000 00 0 ,0,0 ,0 0 0 0/qq 00C 0/S/0S/,DP@0000 00 0 ,0,0 ,0 0/qq -L@p`\(0S 4P7/PU (0S \ 0-L M   K0 P K耉-2L?0Q Q T 0S0SqT0S /0  0 R  R T 0\ 0R0S R/ 0-P$@ L0R 0S  00S P 0$0$0@-P @Q -0E0@U@P/  - Lt,9,0 S0 h@0`0h p x`<@@PD H00,T0X@d\L`PpZ $7BZ 7YZ N7eh n7 -Lp@T P` 0 `@S 8PQ 00 R 0 QR0輢0 p-L@`T  P @T V8 Pp@@0Q @`0(0Sp3/p輢 0-@ LR R000 ,0 @P D0S& 0S0 00@P00DP0S S t0d 0?T0 R <0< CL0Q0P0P0P0!CeVUUU -LP  p R R000   D0S 00hJL0\0P0P0P0A!Ce 0-L0PS@@00CS0T0@0 @ @0S0@ 00@P@0"딾 -L@p`PHH\ 0 `P  -L q`D@TP# ,0  R ,0@,0( 10XSYD@TPX 0D D0S “ -LPp`,% $0"@D0S  0 @PkH0S@D0S 咓`@ R% V@ p0S'PG @VP p0S,0&,0 X.),0;,0@U@ RDP- V P @PP p0S,08,00t 0_@P    @VR *̾ؾ P-LH00CsH0  S00Hh^ p-L`@VP ,0   R000   pH00H0!CeQ@- @P-\ $0 R 0@X|)41 -Lh!R  1 `V2 p`V , 00S,0p Pp@N XHYpW Y  i'X0@Z 80`Vp,廑$帑O'5 , 0-LP@Q0\0$C I 00Q L?P @0  0S 0@0@  0S 0$3 0S 0 0-L@PT0(  !:000  -0L@ 1 : -LM@X `RR RN`0SKRISG01 5:X 唀PT;pP0X S ` R,p  X`0,0 \;pP  19(K0` S 4|?pP0Sp\" p0,  P00U0Sp0p00p$0 p4W?pP$0 P<$0 &eP7p p-L0@P`  p }P$0<$0pQ$0<$00 p Q-L Mp@@ @+ R t1\ \ 0R@@@A 0,` K0S S S -` 0 KiqV`x 0 Ki VQ0PU 0S0S PU-` $f9$ $P@=30 00 0PU `9꼢hk Q-LMp`0@T$KW40 U@P $JW X -L0h0CS@0  h0S0hO -LM@P`U000pJ<0Q`:U3 V%P8U 00CS0 `0l0 @B&0,  0  K 0SK 0N<0 Ki3\  0凐児 僐ܤ0D\ p-L0@\ !0ph#] (0S 00CS)0 S p0pQ 0SZ|0S ,hQ00000000 ,0S,0 ,0,0000@0pTQ 0S00 S2 T 0S00 $ T0Q( P`Q T 0S 0RV`V 0;0;0$ 70T0TQpqx0hmO -L0@  T 0P Q T0  R 0R 0r03P0S 0  -L0S8 0-L @Rh!  0 0S 0S 0S 000 00CS00OL t 0-@0hQ0CS0L0 ]P 0q0S0 0O -L0@ P`  P<00!\P0#1pQ  RP  $PP 00CS  R0 ꄀ 0S , R 000000 000, R(00  , 00  , ꬿqq -0L0CS1!`h2?0P1@p  0S 0S2j@T @T T 0S @T $ 7 T PT0PpTT0PTPT(2T`  + 0;0@ SP Y0S    0 0 -Oq -L M 2 @_W, 0 4 hQN qa@0 ܁? "0S0 01 R@C!0S8 P`UP,PUM P, R000000000,     0S 0T00,0@ 04000P0d@(KV@ 0S 0S   Px \0P\ `0< X 000800qhkOqbqq q4p p-0LM@Pp0 $0KT WpP00 $` P$  $``L  6 0-L 0PS@  @6P0@6꼿 -L⼀p0 @T`@U  0PPt0h!0P  P͌@U`V8ƌW,Œ0p @T,pOĿ近 d0-LP孌L0Q P 0h袌(h蟌 t$p[8D0 -LP@U3 PU0 `0pP ~5@pp P 0$0 p0 00$$0(0$0 *1/0B0Z 08YZ 08@輢 0p-L M`@|PFt@ 0ht@@PIX 0P0@PA@ @@0 P0PPKphbqL qT4pqq,p0 -@P0L⠠`p0 L RP0P0P0 0` EX00 0SL0 L0P0 @P舣qb -L` 0p-L@Q p(0`LP`LQP0P0P 000`p -PpLW(` `0P$@@0$0 0 @$0@0$0茣 0-LM0K@ PP000  0P P/0 ?0S0 00N00080 P$ 00?00ꜣbbb 0-LxPp0@P H \0R H H0 ?R40 0 00hqN p-Lh1hh!` \!LL0H P1p$P0  @ T zP @ T R0 B ʠ R S0( pX( 0PP 0 g0 OqlbpN  0-(P(@L0iN0 000舣qb-0<2 -L@gP 0S $0 R 0 0 0  -LMPp`H P' 0$ 0$S0S 00T(0 $@ 00 0@(KP K0S -L MPp`P. 0+ 0$S%0S" 00 T( $ 00 ,@  0 0 00K(0K K0S -LMPp` P' 0$ 0$S0S 00T(0 $@ 00 0@(KP ә K0S -L MPp`P. 0+ 0$S%0S" 00 T( $ 00 ,@  0 0 00K(0K 啙 K0S @0p-LM 40 0CX \0 8 0@`K`0 0@ ;PP KpL`K(!0/PP(1 Q Q7PP0S0  @0p-LLMP `40 `K0CX \0 ` 8 0` P L0(@`Kp -L0M@`pVP( KPP( 0 P 0S$0S P 00CS 0 $K(940K 4 @P T0 P PK 0c0 0c -LM@`px+0P*.@P jz K0 hK`@ @0 < d` hp 8 r@PT0S P@KPT0P T @@K 0PTK@ K Pˠˠ =@n0 0c  -LHM`@-0hpK@0<0 ` d h @ 8` /@P TP 0`@ S0@0 0 < d h0 8` @P T0S P@K7PT0P @T@ KP@ K@ -LM@ @K -LM@c0 K -LMjY VpP /@P0 R@ (K0H0 0pKh lp p D0 @P @P\pW@@KU  V2ጐ 0:#: 00   V  V @XHKXP W F V-@00 0X\KH KM@00 00 0 -LM0 : #:: -LM c:#:: -LM @{ -LMc@q -L MpPz.P K<@K @+P0PF 04K K P 0(@c,` 0P$048,0/+ -LMp`E.@P KPH K ` 0SP< PP8 0aPP1  0Sc  03PP%0 H000(K  0,0@0,0(SPP0S (l0P# u 00l PlPSPPK 㜀 00@ ( 000 0PPk  0 PPd@;0  0 d0l &@KP@ 0|@ xP PP -LMPhp, @P t 000(K` $000 5 @P00$00\ 00 @P g00, @ O S-LM 1 P  0K(!`P~<@(p0 X2h `0 0t K\ t@ l0 d@ X@ ,`PpPPP u 0 S  ` @K0p0(!@ P 4`KTK,0KL H T` , 4p 0 D < 8 hLK`PV 1 V!D0 c\)ڰPH0S6  `\ ڰP<0S0S 0@bP"`#(:00 M(K00 ,0S `S000L@@0S `H @`D -LM `PQ4 0 , p0o 44 @P#X4 000 R@080 r 0Sl0 )4 02 UT (0 4 40SO 4 @P 4q, 4 W000Q 4P a(K8(!0@P*4 =80 04K,K 0 K0p@ T0Q0A/ 00  A0,0CUS4 0,@  PUh0P,,@ 0 K0`@,@0Q 0A/ 00  A,Xo -LM` Pz@P"`ڠ?p@à ( K@0D0"D0P0`<`P  [(K, ` ` -L 0S0ET (@ 0#40àL D-L0T 40#"B ,0S-3/ 0-L@0@PS <00S 3/%40 "!B 0kp00CS#``t` 00/ 00/ $00// 00/ *p-L` 0TxP ,Ġ C BD@@PT 0#8T8#0!$Ō 20=p -L -LMp`T 0 #88#$R@)@\& Q  R1@\00 T (K 0#(#4(0" $ @P T00   @ T (0 T@*. à 0L|@ @IT (_( 090d00(  (0T `0d;0 -LAs 0-LM0T  PQ%4@ Q X0s HL 0à L0p 0-L M P@T 0PBK0 -L (T0 !(!(q"$(r 0  /T 0 p-@PL `0  @ T0 T00 @p 0  /T 0 -LMP@ pT0 R  R r0 O  00`? V- (KP? *40tb f (0P0  0f 0`P 05  06/`(KoP0  *40"!B `  AW 0,1S 0 R0,!0 0 t 06/ `! p -LP0S- pD@T` ,0  R ,0@,0 XD@T`0S  0q -LM`P T0( R  $01 (4Rp R@% 1 W#*1 R 0s 0 2!1C0QX *@PBAD 0*T @D1 W:@0s 0 1P3!2C0$Q1 P4|p , KP ,0S$AGP3ᘐBC $0S000(0 @ * 0 @T@@P |)p -LDM@X `P 0S S $Mq 0SPXZ0P T@3  $ R21C"0 \ `@ K0N 0Cr 40 0ǁ4PU0008^ , @0 d`P7 Q  0PP   B ఀ0000>~* R3 `1C"A c3  1C X0 ` 00@ 0j ss,nmQQ R/0S  0/ 0-LPd@% P 0 0= cd0 -LMp0@($ P PK0`KA90 004 0 0 00  S 0000S K$ K PPH$ F $P A S $0 $0 $0T $ 5$ #40$ 5$ #40$ 5$ #40$ 5$ #40$ 5$ #40$ ``0$ #40S$0 d  S0$ 0d0#4s00S0$ 0d0#8s00S0$ 0g004 $x0s0`0#8s004 $x0scW 埽Pm0z T0XV 0s0^\ S0 0S0e NU0Z0 -LM@0 pSP4` x0s $ h iP(K  d0WlW;`0 00 , `pdX01Ydp0$00W 0, r 00K3PPX0 G,2#tp 0Q= x0000s7 1PdX0A1 A,0KPPdX0A1x\0080 Y `0X,  c BHd04K ӿPP 4D JPPX `d07 `冟40dD80c  4Ӽ4嘼 -LMd@H0S` 00S` H0S $( $00  %0H0` -LMP@04 x0s` S0p`d R#*d0X  B0C2!03r T0Q` 0M`P0dP$00i/d 0pi ‘ 0-L0PQP2t0s D4Z080POx0sb,t 40z@Pp0, Qg p@ X,0K@P4 Op W0@t0x@4 , 4@ BP‘s‘(s -LMpP @ 02$p  0 !P  0P:0RT0T$pD 0X!^4E  T0 #T1 01$pP0S6:04lP4`P00W0S W \( K,0K-($K ,0طPP$px~D 040 0  $p5P K$/ -LM`4pP4K(K 0G@P$,K4K(0執P,(0D R:S 0S Q0S$KP, -LM@Q`PdX 0`32aD6"\\050@0 0P_pPX 0\ D `X H0@ a 0PHpP 庲00 0-LM$4   0-LM`4<0  <0LPD p,K8 K0PP40K8K,0PP.0, D0P*0@SD0 @0S0S 0 FP 0,  @D00S`p\(KUP0T<\PP0L<00<0 -LM4p8K,K 0b@P80K8K,0庶P30P,D0P *@,0PD0 @0S\ 0` \ P d P 0 p(KT0‘‘ -LMp( 004P @4K,K0C00X @D4 0`P1(K4K,0``P-(\0D0 R (0S  @000 A @D\0 0S (f`P 0\ 00T00S$K觱(失 -L M, ( S0 S0 p_(0S q$K``0\p \H 4`x0sA ,K` X0H0bLd0 pPA,D0 @ 3  BP,0x q4P0 40X`0S) U% q@0S (01,K (0K,p pP(S0 `@0\p,p\ 2W,,p‘‘ -L(MP(dp^L 4:dX0  a <à 0, `PX0,d (#d X4K>< K,0K&`P,0( SH \00K H 40<Kw`P00(\ D @H P S 0 0 T0 0% 5#40% 5#40% 5#40% 5#40% 5#40`  `0#40S dS00d0#4s00S00d0#8s00S00g0040x r0`0#8s0040x r0c00,0SKED  @  D 0 @ P9 ,0 @D0CS,03(0\ C(0< K`P0 (4K A(X>`P0K<K40`P00\ (D @d 0w(K0E0`PL R S0 `, x0s P0H0  H L0,`@0P,` H -LdM | x 08 t0 @ P d x` 40\0 S0p p(K|@ 0Pp |x ϺPp |@0l@ ( KK0P Pb P0 p X0 T0  \ 0X00\ P\X0 q P `m 0Y 0 S0C R .RY0ph0 d0 40 0K`d@ K,0KP@\8K00@K-@P20P88PD @0 s 3S00S9 X0S`hp R PP pᄯd00d0 AT X vVX`hp  V 0fh2h Q 0\0"'p [ x | x0p0 SX` 0X\`S  P~ T0S08\ 0 0  80KK P`(p` 0,0\0 x 4r` ,0SPZ VPR,` 8 v 3\x0s00@`Qu P00P00SQ  O u | 0Pp ``0S  Z R p \ ,40KPp l0xS40 0;0|t pT X `\(pX0A,00.S  R R0.Sp`R ,` P ``0S  Z R= |'x|0  x | ᳺP   u |~ 0/Pp ``0S  Z Rr |x|t0 @40hQ`M0p0 h8lp@ dP p `\ ,40K Pjl R P0 t |h06040x P   `00S | 0Pp 8X`0@,0h ( l0\;0p *p|t ?06p 0 t |50\60 ,40K@P!lQ P  &40 x0 m\ ,40KPp 40l R x0 |t p 060|t Pp@ 0p@ 60t |P060 40p /d 00 00$  / 0-L`P @4P 0 40 00 -LM0K@``P000   "-LM0K@`OP0   -LM``B0$0 ,` (  h0PSp 0S\, KU  N 0 P$ $KU\ W‘ p-L0PS@d  0< 0S  `P  0 PfpD0S 0S p-``P,0dSd L L0@ 0@T  T0@0 @0@ ,00@$( Z BZ  ex  t p -L  p(`P `R 0T`@0Q `<  ;$0 :$0`" -Lx0s009 ,K|@P)  `_U/KX`Y KZ g@ 0(!  `Vt B 0`,0@dP,@B_ZP\Z ZYOKZ Z Z  x //E//0 d B40R+fpfpf(fpfpffHfpfpfpfpfpfpfpfpfpfpfpfpf\f 00/0   / 00/ 00//5w-造倐 @!0P#@`$ y"`\ 0'@(?0H#<0O  $S ` @&0#@/8^nCCX좙N 1s s s /40<0@l00l /0<0 0<0\ @0Wd0X@P lp@ lP L \8BAQU<&`d0 ` ` P6,@K.QdT0@K @履P,KP8 K0oPP`0K8K,0ǥPpPUX^OT(0$  P 000F)D -L]M 0t d0x1 S 4  UKFt!tA ! 0`Vd1 `A a w 0@qtq`x1` 2R1 `AT@ 0@| \! X1 t1\ xqd|!d0baY_K`W?KXd PU`X@\0A ՟pa50 ` 2 P V1Q0 W p!p! l1 0h1 x< K00K,@K@P 4K<K,0CP 4X! , 80 cQ!D! 0S> PR Y?K `p`p Q { da `q p l! h! D!A0 P0S 0 @`pR Rd ` da `q p l h !DA0 P0S dta\t x!|adAd0faY_K`W/K XPU`X\0d pa50 ` 2 PV1Q W p!yl!rt1W_K`PX`!tA 00b0YKt! xAd0PQڌq0 0(Kx0s | \ X %0x p40 40Ȍ; \ p@0T P 0B1KhPQ  OKiAKp(4 (@K tLa Hq r0Sl:UKt!bP x0 4p! l1 0da `q h1 H01 da `q B0 4(000S0P@X `H0 a@0n2O0 0@ T1 PA B!K_hPA[(0K 01Bh!UKh 0@4YK4p l  j ጟt1Y_K`WKPU`HPXa0 0W@0RZ|4upq. WK^K`tAPU`Kd `! *4ctAW_K`PX`!V dqRU'^0OK,A1KYoKA1[   0(pK00tL H! s0\&:UKt!P (SKPUd `! 7x0s 0@T1 PA 0UB1K U0OK,A1K@0@T1 PA YK?P`P` ! YKt1?P`P`da?V taWKY_K`PU`4|a 0OY_K`PU`Y_K`WKPU``D -LPMd dd P dX  T d0L0 0LS P4H  Sv (MX L Td0@0 @TReT0Pa 0@0@TZPTX ,0K\PSTLdZD 0MJ TpǏ p X4 SHP`dX0@0@0@ a31 Q2D T0C` @ < X8 0n9^ ^SZn<ZRQVp l0 T 0\0 4 ^d0l ` RLDd0S*d0l u\ R X0P H` \0b@  0l \5 Qh0 |tTl0pP` P `5>VNP1hV0R3Q ʧ Ld0 0SXU H Pd0ppp匡0 4D008p0tP`l0Sm t0s] THP`\0d iZ!L / d0Rp:LdP P00 T D8Q\ ,H0d 0S* 0L\0P00T \c H0XORH 0Kd0P P\ 0jT0LQ00帜@U]:x0sU\0STT\ 1p0SH `0Xt c a51 Q0VP @@p ` 0 0 0e0Is đ -pRLPP` U @W@1 pWP`Iđ8 0  - L@p%PP@ A`@x0S @:0S 0S 0s $0S0 $ `RV( -R0,(SL`@ P U 0K녁 pVP  s@TZ,@(P  ]qP (Z,p(p@ 0-L80@PS0S  R00Q0 0008P PP 2I0I$đ<đ -L p 0S 0 `V`V 0S 0SH@P1;s0 -L@pTP- `0S8 }PV 0R`@TV 0S hP0S@ S |s0  -L @`;0pS*x6Tz l6T :`6T T6T bH6T P46T3 <(6T g6T% 6T 6TP0P0P 5T :0CT 05T 5T 5T P5T c5T 0T 0CT0S i/0CT 7L5T0P00 0T 0CTP 0P04T 4T 4T 4T PP VP4T 0T 0CT<0P0p4T] 0T0P;0w 0CTsDT@?Ph0CT` 0TW 0CT^0P:0[3T 3T 3TQQ0PP 0 J#0#OS,`P 0S0P 03P10PH0-iL0P0%0P0S0<00S b80SP@  i0P0S0D0 QPL@0P0=0P0LR0@S0@P@0P00P@00P0=0A PF 31 0 P 400D0P0 i PP (1 T (1 X X1T +0T P1T :(10SP1T 1T0S i0S0 0RR 0 0P H0Tl 0Ti P{0PP080_kB @}fwBlB mB tB@f@oB@nB @wt@|B@vB fB@hB yB}BqB@iB vtgB~fpBfB{Bp -@LH0S LQ`S0`0P `S0`0 -L M0  p0 S00S@`0^P, 40  R400403 0@0 @ @` 0 g0q  ,403/:0`S$P ` 00S* P 0  $  (Ko(K( -LM`Q9 0Z P 0 PR@T, 8 8\ @T$ = 00 000@0\ (4KpP 800S80  0 k<0S101@T(K ꄠ 0-LMRP  (@K  K(P U 1[!0 !K0 1-L M K0,0   K0 -LM@PTp8@ ' 080 @T = 00000  0(q4K`P X P0  <0S80080 @T8(K *P0  p- L$H`@0SP hp0  - L@0PS`  0R` q\0 0r\0= $0S:1 $ PQI :0S QM p h!$00S%:`V1 0  0`    `0 0  @(0$00 pP` #P0SP`0 0 0 0 (`đ Q-LM`p Q -iQ Q pQ0 )*00@T p-Lp`h@QP \0000 h00h0LQp,, 0S00000/ᔦs R000  B /s0 R 0 /ᬦ/ Q-L M &2 H00SH0<6 KH00CSH0ʴ&,006 6 1K, KPi 00  0/ R0000 0 /0 0cP/(s p-LP0@0cS`%P  0P@ R#p(bP!00p 0 \%*0Q25 RP#:p R#:p( p-`PL @90 P ` `p( -LM$pK@P `P $0$@ T1!Q K2!  P -L(MH`K@p( PT  ^4@K8p   K-0 000 0cS 000(sss p-@Lh`XQP &r0S0Bs0S6 (08p1/ -L MP@6s `DKp;03K6  P@T@T 0S 0Sf@T0@T V 0 03K6|P$KzP 0}, 40DK03K6 P6i x -L 0Rh?lđQ-0 P P P-@0 H0 D 0 p-L@`T$@T JP 0 RpP U 04P1 S 3/PUpp茦i$P0 0-L@PT $@T P0000茦D0 0-L@PT@T 8P0蜦 0-LMP@T$@T P0S P 00PK@`T SP,pKR 8  PE`P@T Uꌦ -LM0S $Q 00QK$@`T SP,pK   \PE`P@T U -L$ML RP1P Q P 0 R BPQ PPL P (KL0D1YL RI8HK pW5PU P( 0Zp PEW  UHK`@0Sc8KHK  Z Y UL0 0eL 0` 8KHK P PE Ꜧ 0-LM` V ! P0@T PPPU,pK@T PU r * `P Ks -L`hpnUL0PU ,0S @3/A@PU` p-L<`40@TP @Tp p-L$@`TPC@T@ P R000(00  PP 0S\000 00 00CS00$ R( D0(0 (0 ($00 pp茦P 0P0 - @L01 - @L,0P@  @s8 0$    0$ (0@ 茦 -L0PpS!$@T @T P  `P%  P" h M@E0/SG09S@P P L 0@T$@T P000@p 00  (00( `(ꌦ 0-L,M@T$@T PP @T @K0 0KKP 4P Ph<@K D  P 4P XK茦đא 00- P@L0 PP  ,P,00  0P000 4P400 8@Q<0 -L1PS 8m 00S0C0` p pp0 @0p`m0060l00A  -L@ R`! d!  110C0C11uj 10`P RZ -LP`p@QT 0@SpW@0@Sp@0 0C@0 KjH0T0H0P U p-L@0`P{#0p -@L606 h#0 Th>s0<ꀗ 0-PL606p @T f@T1S :0hA# 10`P  R`! d!  110C0C11i RZ p-L M`0@TP@T 6 &P1LS @8 K KP@TKpi P0-PL40d00@T0@T0  Px0P00 R8d0P;4d00 00 08@00 R P0s -Lp`#WP,PU) PU7 0SXQ 60@^)*0 0# 0 0#^ JP Q  BP PUP^ Pp-L`Pp8Qp Qp Pp@Pp 00 08O8@ Rp0Rp2/pdۅ -L`{0PUpPU 0W6 @T@T 0 R0S P@蜦 -LPL0`Vp%`V" 0W@T@T  0S P 6 P R P@蜦 -L1`V9 `V4 0Z@T@T  0SPU 0 pR*0 0# 0 0# WY  P  蜦 -LP0@S PP $M 0 PahхQ -L@ 9h$ƅs -L0pS 00Cs0 SP@ 00 CSr  RQP@T`U 0S U0S; 0`V`V P P0gS"\ 00Ls0 S0gP ^0P@@00L\s0 SL0!lr/0A!b0RPXP0S ꔦgfff -L@pP?`P R-62/0P@ 2/ p-LMK`f@PP PP pPP P  -`LpMVpPS KV ;Vo ^;Vg 0V pFx;VF*p;0SaP T;崖V rD;V< P0CV0CV*0CV 0V 0CV \, 0P 00 p6 0#t0S Z@ )p(K'pPVF Kp8:VpPGppppPyP: P& P/pY9V@Y 9V @N0CV[ 0CV 0V 0CVpp 少+p(9V Y@ e p8V3 N0CV 0VG 0CVfpPPp 6ʕjp~8V )0CV 0V 0CVM61pp 0V ~a08VB 0V 70CV<pP[P1Sd  3/00 p:7VS ~7V%0pp 0.7V3 k0CVhpP8 pP3 Pp L7V- a@70Sp@MpPP1S&  3/p0Tp 00 8pP P pP00 p0pp 0!pPLPK ,0KpPMOp ^t0pp 0M?Pp P p L@K  ,0K00 pl ;00 p0pp 0pp 61pPPK@ ,0KPpP@@ 0@ p pP0p t0{pP6  $q 00 Mh kpj$izi xi i$yi UJii i$ii ii i i i$i i$~i ?qi i Fi@6i(Kii T'N -PLr6 ";62L! X!P1`481<_Qc/} R1 0 00  h  RX10 0 0  $Qb@T 0 0L@T, 0 4 8 < 0@T 0 R 010Q 2/@TD0 01Յ…vHM` -L`p8bPP `0(0LP  @AT  P@TbPP !-La唁0@0S000 PT 1S @1 RPH T &0S# T!$0@(0$@0Q!R<10 R ' 8p < mNT00PP  HpP !h  Jp$ T5Œ`tƅׅđ -L@T(00  0 @ h{Ꜧ -L@B00S0 0000@hgꜦ p-L1!S0#R@:6 h0 Q00 0  h00h0Lph0 p0h0 0 0 0@ .! , !\@P `0S ph000 0@@0 ꤦss -L0@S St PT0S h0SQ0S 0S  P 8אHH-0#" A0:  A0  AQ0A0Ab0@-PR@00\  1!2# #!0М@-pR` @P@@^ 0,>#! """!1# 耜   -L@@ 0 @1AP”\ ^ 07004P”\ p-L@`PT6 T T/p = 9p0S 0S0S @T  ' #p3000   00p@T  ld p@0^  0@0X B0000pƦ̦ -L M@ .PK4pK `P7PBT,@T)  P P0 CR Q4`0007T20CT2 P X20CX2 `(K  -L M@ᔡp.K4K `;PP .0[ P(K40[ PBT@T  IP  CP0007 }@P"  T P00 pP2 S0P"04P0%.PB T2 0T2PX20X27P -\ \:6S0d0\-P0P0p040\0\ i2i 1i i i -L@ႭD0H2 D0CJ2I" 00/00 K2 @MLb p-LH2@%P0 `m D1l n`pP Bl00@! 0@SP1m 0P20L ph -L MP`pAAQ2@ U `(K 咯RN\\\\\\\\\\\\\\\\\\\\\\p\\\\\\@.K  vp bPP7@ @  ph  dq㲡Q- n@P; 1 018m1/@.K0 p@P\q .K 0%X@P61  6  ?0S0 p!1R8@10d!R`Q@P10dQ! !0/0@ 0@ 0 0@0@ @Z#T#@DWD 0VbP  0py_7@đʚ; Q-L0p(0 &[ 0\  1 PM  @P11<<110P`  00@0@0@TD0? sP> 1' 6  `4Ux = U 3U00S 0S k_  ]P ^_00@0@0@XC0? sP0  !  !3U0 3U0  !  !Pp @0S} R@ D0Rk@  100S၁@10@  @ 6Y60  !  !P@ p0S` Q0  !  !Pp @~0S7 `Qn\0ST 81RP0U/`\ 8aPF    .H00H0^P0S8E5000 0PP0v000 0PP0c0\000 0PP0y괦s5݆sHMvQ/`0S9`0/0 Q-L@0CQ:T0Q %0CQ6@06!T 000p02i i \ -LpP LP 6EUp d D20S30@ P` 0O0@0@ R R 8S/^/Q@ȡ@ D0RH00H0] 7Q@]d0 3A0 @  0100S၁@10@ 0 @ , ! $ , ! P@ `p0S 0@ P` 0 O0@0@000 0PP0/đHMssđ80 -@ LP/s p-L`@PP p 08s. 9p0&0 P1D!0 Tl0n m "L 0Pp(@P'đxs (-LP hK/Ԧđ- 0  \ / \ 00SP/ \/`0S S 0R 0 R/21C 0/ p-L `RPp0#U T pu @\00000  T p -P`QppW@L jTh 1R' 1RP  0S\0PS000000P 0S 0S \@ P @P lP6   R03 Pp`PP`p  0 ^P1 P!Kp PU00@  01 PU@PP  f @P0PP!$P5i 6i( -L@`p  PP 0` pP0  0I.ő 0-L @PP 0  Ti-0P P 0 P#.8ő`ő -pRL`@PPU@ - L0P.Xstő -L`@TpP@T 0  "!    "!P U (s @Th#s-0S  0 00Sp@-0 @PbUe\5* 0`  0`R Q T 0SQ 0S p?^00S eR 0SP 0S p~3p@-0\Π@    @ @0 -`PLp  0  0S0 @Q<* 0 RQ 1  \0R 000Q ^f 2 @ 0 @ PP0S:  0   @ 0 PP00R  0S  0S /000S/ / -`L0pS0S 0@T  0 0S@0SP U 0Pl 8/PU 0 p -L@`0 4@P0Pp@ @ 0 0D0 80\ 00 00 0( (0p 0bb'!L$ 0-@0LSP0p 0P000h -L M 0P%0 R (0P0 RQ Kh", 0 0P h0 l0d P*00PDP K,0,(.,ős`tőbbbsőő p-L@ PTR 0` 0S 0SU 0CS 0 p0R X+pH+ Q R 0S0A 0 p +p 00CS 00S0S\0 S  P RP 0S T T  0SP+ 0 p4+p0$0p#pdƑƑ<ƑƑős -L@ T@P0S R0U0U R0 0T p Q 0 S R 0U0S 0 S@R 0S 00 0 \ ,!`P 00 00 @0000``p  +`sƑ -LMⴒ`0P@@PRPU%Uㄢ||2 E= e8Qk*0PSh 0RS BQ:`aU"0S`1 @q RL!``0@ 0  @@0S  P@TXppW0 P @ 0 ,1, K 0s,0S@2\P P Q0h 100 0  d 0 00d0 R 0h1000@r*  0LStbbhs$Ƒ -LM`0@ P 0  @@0S  ecPVP  $PP  0S PU<P Pp\$ UM 000Sp` 0 @ 0V@@0 @@ 00 0  @ T0@S@@Q 0S!0S   0S`V  0Vpp0 pp0pST@ Q T00S 0S ` 00CS 0000R 0  @)!0ǑǑs -LM` @  0  @@0SPU 00 Q *0 R  0R  Q 0P(K0S@0"0S  0S BfU10080 PPU  0X 08 RPU1000 @PUn08QnPUg 0 pP 0\ P  S 4 4 0R !\00 0S0!Xp1Z4 40 0<  ,0 <0 "0p, 0 0# ^P 0R !P0  0R01p Wu0  "0 0 0#\a TP]P[b Q0-L@P0h$0 0P0 @P00T00S0P00T0P0 -LPUPp+  R/ U`@#0`S(  @R" R 0Z P  0R:PW  `  w 3 -L`V0spW0 0S\0 S  P RP@T#@T 0W0P Y( 0.0PU% P  0R:7Pڌ P@P 0 0 0000P@ 0 R 00 0@o'' s,ǑƑ Q-LMPp0`%, K0, R@V 0 `0  `, RR,c000@ 0 `P@  0 P @ 0-P0@LPxcQ 0000h0 / p-P@LT`7pP0P gPpP 04 a!0S00@@plpt0 /t/ Q-Lp`@0P* S 0S-` X xUU` ܑT0+$+<+<+<+<+D+h+*x++4++*<++*<+-` PI @` f @ 0 ` `l`G'-` 0S+ u i`i`W! @T8`0 0 0 @`Zbh``P`9` 0S  0`XǑ -d!-LM0@,0 0T` 00 A p@T3  0 P!0R!R 0SP 0 P P  PW  0:WP 0P [iP Tp@TW 0P LiP T(K^^ptʚ;00q R3/10 P0 /ttdv0 R3 0% %'/ttP (0 P0 Q//tt 0-L@PP0P0 A0t  -LJ-/// 0-@LP0P0 080p PP 2S//x -L `p0pS:0PP@P 4 #P P%U0pS*tJpP/Q/2 S R 2S,00CS,0/ R00000  /x@-Pp 0` V@1@!^ *0 00^:Vn@ pP0-L@0tPP ""0  0 y0 -L0PS& @T<@T ,P,00,0@Tp+ 2 S@rpT0W0 `P C,0T0r,0  @ 0``@00 ``pxP 0-LH@PT0H@T  R 0 0 0 R 000 00   0S0C0 q$H@T0tdǑ -LM\!0T0@ ,P @H_@PXT@XP`PX 0S R 0 0 0 R 000 00   0S0C0&  P7 0 0O`0 @$PH R0 0 H 00  000(K $tltǑ P-L R0B 0 h$Ǒ 0-Ll0@CQl0d00Q 0 P# Q00C0E8P 0P   00hW 0 00h# $tuǑǑ 0-L MdP@TX0T( @@0@@ @g,00K0k$뀩ȑttb$DǑ0 -L @R  P\ 0@ 0 0S0 00 tP耩t -L@lMpKP`@  00 >K|0 x t Z4\T 80!l  0h d `u K 0-LPMP,0 l1plK@p @hP U0P @P 0 @T` ` 00 0 0S @  0hP 8 p0,(K,@ d0 l00l0 8 ,0KpA`P ,@ l00l0,P d0   tt p-@dPL`  @P l04 0CRl0 Apd @\ 0vP@ d0 T0 P0`RQ TA@p0pd0P @Pl -@00LS0C0ppP`- PP70 @0P Y@P 0@0d0 %P@ \00` R `R`𩝈0S0C000S* -L`p+PU@ 0 R }P@P@PPU@0S =@T P l0d 0Cl0 0 R 8@T 0SgP C@@P -L@PT`p PpP% 40S P. P4P& PW00 SQ  R 00x440S3p\ 00 g44P -L` 0 Z0 PD 0`@PD 0 10 0BR0U `  P+@ TXU00  S@7 ,0S4 00S 0/0S, 0T0 S, " 4  R R000 վR000 Z0 P P,  P 0 S@, 00PUP U 000004 @ (K 0Ѿ -LDMdKpP @ƾ1X[6R XU  R0 P P]0S` @T 0SC0P0 @T3 0S @T, W L 0X0 0 D P80S` P 0S 0 60$00d P 000@T0L0 D0 X0 X$K6l 0?060_d0 0 P000Ꜧ -L(MP@P`0AS`(KHK `3 0`T<0 H D 4 @ \ pP 1H0vP0CL SXX8YX,XD@zPGLd1``L1L 0<0@ X < = 400hS `301  0`L@`U @%T * 0P U`P  `h0h!@qBK#  ,0KK21C0b ?A1c0vtYOgfff -LhM`0@S, PK@㟽4 00 P0 | x  81p0 l 60d0 BK0 `X 00Sp PU 0S K d0d L r0(0 0l0@04 0帀 0P00000 0@-L M0 S\\X\\`P,P uI@P00SAX/ , @@  2,Pp @Z `Q 0 70 0BR0` 0GLPP+p W@00P0, 0 0(KP,P 5IU@@P00S ; FI1@HP,P P,P H 0-L40@0PP XP 0a]P H808 a0h400400hRꔩgfff R-L@`pP TU ?H@@TS S *@jI0@ 08 T@S# S U *@HSI0 00 U 0S @0`v P@ @8`U 0S @000 -LM`@pTPR T= T  0p (K <etQt@ h1S p@ ^pP;h1 Q@180A Q000 1 0  \0@004 0XPd ` a `R \0p40 pU P Ppl00C0 00C 0 ,00C0000O\v --LM0,0 pR \d2@TX P@T3 0 !0R1S R SP  圻P P  唻P` R5 0Q 02 0BSMbbbbbbU d `X0P `0aR  R  40040aG(K 0P [P YQSG8p240`U  0IP0  d `X0P `0aR  R0P 0  2QP8 r 0Rz 40040P0GPo0Pktʚ;t0 -L PRp`P@8V PӼ$p  0h5v 0-L@Mp8P R `K\@K@ P0D0 !H 0P0  < P 60$00  \00 0o`0S00 0v0 p-L PRpo`Pp@6l 0?0h0,P0彺  0phv -| LP \@EP@0Z0 `p04 0尦T 0 @0 0mv --LtMP@ 0U00 ,@ @  0SJPP 1 0S`V p DBF(KQ+p_V V(p sP7p  0E,ǟᘀ hP`0 `0,0V^PWp0&1 RP P hP p PpH0S `pX W p0@000S `6 V 70@@<6 R@TX 0IPd0ScyC ͿU %5T017p}-pupq 0x%0 0s@8 @0T0 . T00?T0SK@㷹 00 K'0Qd0 #Q R 0#S0S0@S(nlxjxjpjpjpjxj0S@@ @8@qEP pP `j P`/pd  `P 0`pYl00l0Q 0 0s03R0#SlQ\ QGQ 0P@ F@P@Q  pP4T0SR K ppP*`@T 8T 0S 3/8T8@ 0 0 04 P d 00 0d0L $(4060r   d0080S 0S 3/h@T J*$0\ 00\0r8 $ 0\0 p|0S K,0K_pPd,`l00l0 RK 000  0|0 0 h 00 4P 10 8 | 60t0 80 t  0 Ki0P @P7p  ᷸ 㔾@  K0@Od 0 (0,@r L(  10 0~Rz K ,0KpP, R L ($,`l00Cl0, r00 0, 4060, d00]Ovȑp 0P 0CP>@t 0C!/` @#2// 40P 0CP$0PN=@ 0C!/ ̇ P P10/"10/4/ P PP10N / 0\ڣ20S*>000S \/ -L8@S0CS8 06 l8S06p@-@P`0"U@Tpb0P"U0p0"^ " 0S0R  ^P0,0,P"ОP P0Q00P0S/>S/ / /-RrHr@rrHrD\ 1 R 0 p-L0 8@SP+ 8`S S:0 00CSsrrr0:0p080p080p080pHȕ\0 \8S 0008 H8"R -01 \ Ql Q-pL QQ/0@S\tdt|ttttlttt7P  PP nPP,`0$ lHɑ Q-L QQV$P7PP: P6 0@*S0uuvuuuuuu vuuuuuuuuuu(vuuuuuuuuuuuuuuuuuuuuuvHP 0P `PlP`@ 7n$ɑ -LDM₮@P`" 0 . 8Kշ pl d d0SQd0p0d0 H"0S7 82 1h0 h08 {W *>0 RP0PS0@ P h倀 0 8 L8 [RS70[SN0S 8KP0(K0 C8 Kl 0R l 80[S@80[S8K0 l@P P 0 8  0B 80[S`Kt DlPp0@| (Kh 0 }8 [RRh0 B 0p|  @B/.  R-L@\0TT 80@ 8,n>0Q0bC8ɑ`ɑ! -L0p`S1o Qo1/^PA 00S   R` V0 00Sq  00S 7 17 ^ V 00S  ^LQ L1GT@# P 1'R! 1/>0LLQ xL1GsT@Ll8:,0`2. |ɑ$ɑ 0-L08P # 0sQQ B0S10s Q p 0S1pT0Q@@R0w00@ F0  -@0XLQ@ Q; Q` Q`  V`!0S6  pP V%  z 0 PP R  P4P8 S84PSX14``D 0S8X {p `  -@L1^"\"R`2`2`2 jh -LMp |2! i D10Lo 㽵!P`000` VP O0S /vP> 0 `8`n  V P\AL1 R!  0S 000 ɑ|ɑ0 0000  /0@- @81T^* T- 1T^  T00S00 000008S  0S00 000S8 0C8 @ R 00 T00S00 0S0 :[0(0CR 0 8080 0 T00S0̫8  / 0 ? 0 /? 0/? 0 2"/8@P&`phpppPpppppppXpppppppppppppppP/ // //8 01S^/X="!B10b#=/0 0 \=X= p-LOPT`@@T 0R!  PV Pp -L\MP @p`ܲP)tK   nK ͲP!hK  HKx0xXX L00 0C 0 H )0C08>;\ 90S* @0K ᫯  TK0RK@@K80S0K坯  LK♯ FK╯{TK \0  By  P\9` p唀\(KX@\`<>0<>R;\` -L$Mp@0 @00L K0 P80JKK0KY  DKU >KQ 7 LK Н  B ˝ S9P <PC 0 0 L0P 0 L0C0 `8@K"4 0040 "880 "4<0   d ᓝ   0 0  00 0@0@ (K= 0=: -L@P  Ǵ00 0- LP@P 0⡝@0 -LLMP\ d `0  \0SKS0K0 SR K QK @⸮ KK⴮ EKⰮ0 0S 0? K>0K=pKy 0S 0 0S00000p 05K 4K50K`0`SK#4l0 d0l#|t 0 t*d#h l*XdXL*4`UK 00>8 $ 0S0 10PP ;#91P0 0@00S000010PP 0S:=0=88 @4>04>88 8@@ 8@ @=0=~8 -L@P  s00 z0- LP㪲@P 0 È@0 -LpM   790P|0   7P|0 0 R |@ 0S p|0 PP`0P`@P`| `0P "4 <003 00 "8 80 040PP "40 HK jPXK8K J8Kh K*K)@K00j St0 |ol@ |@p  `x xp 0^ p x  Z < x@ap 0 0aT@!0TP$pT (0K  0R@R`0# 0BV!pڀHKH Kۉl08Ks0l0 l#4h K*0K)KωT`tdQt p  @p 8PS t0S0 0. t Rt    V HKH K⣉ 5P/ 0XAHA 0 0#0Q| 0 0 0 h7|(K; 71P0 0 ;|7|1| P0 0 /8P0 0=0=?7|=7| =0=47 -LM`8p8  P 0 3 `1C cR0~>XU 0~>NH>,@X&H0,R&H 0h lɑ(G-Ms000 Q000s00@P # "!!r ! 0?s0 `|0 p$ " r"$Ẁ_ 0?s0 @ t@@0 $ "r"$ 0?s0 PuPP0 $ "r"$ 0?s0 `v`` 0 v$ "r"$ 0?s0 pwpp 0 $ "r"$ 0?s0 x満 0tu40# 07w@~ 040# 07xp 07q 07| 07@t@ 07@  00 0 4#0#00Ѝ4G-#00p(M 400400   a    ă $ P 0 "$"r"$ 0?s0 ~ 0 $ "r"$ 0?s0 |0 $ "r"$ 0?s0 ~$ 0 $ "@r"$ 0?s0 @t@@ 0 $ " r"$ 0?s0 |Z(Ѝ4 -L(M@`p00SX0આ8K00S0,0K00S00,0KPPK0+0K)0K*0KlS  0  g@ @T  (K8K  h2K d8K  ^2K Z8K  T2K  P8K -LPMp t l d h p0P  0R]dPP 0 @\ d00S  x D)L 4P`0@ H#H8p,t0!$P`0@ @ 4p0$ P@S`@ \P *p5PT ' p 4PTT@0 0 BjR T 0S TdP T0@00h!!R xt `0\ #H0"HT.X# ht Eo⠠0`!1 0 zV[L@K  u0h 㯕TP0nZGp @PX  0@a0h T@! h0ẕX dZX .P@ 0X 0U` pF5P`o jZ RPPpp B;41P  pX 0(> 4T d00S0d 00` \0"HHN ;T\41TPP0 0 lp=0=3T3T U4h0t@Eo`⠠:l p,>0,>3T30T0 0S:p3T3l$>0$>`KT p3@T@ p3T@ lp=0=3 -L@P  㣭00 -I@LڭP 0 1! -L,MpP T L f40PH0  T 2PH0 0 gR H 0S TH < < 偧P` P`%4P`H<<s0_  0 03 00 "880 040 @ 40L !R^ P`P 0@0PLCoS 8@K9 8 L;T< 0bY[H@0`pD @0 D@b@ 00gT@! D  d0@   L=Y@`p @D 0WpD  0VP3Pg PgY P P U`` P   P L0PCo"88 L0 1; *31PP PH0@0 0 P3P3 0 0L 0P!P0<T @! 0@Lړ 0@P 0$$$$ P @  L0ȓH 0 0 0 T2H(KP T=0=x2Hv20H0 ;H2H1H P0 0PT=0=_2 -L(MP pPL H P0 0R`<@K d 9K`  HWP 30P@0 P f1P@0 0 BjR q@  0S @0 <@0 @  fZPPIP@@ PD  0@a0h T@! H0?D { dZD +P@ 0X 0U` p2P`; jZ RPPpp B;621P  D0P,@K 0 810H ,0SP1@(K ;@2@ 1@0@P0 0~L P=0=1@10@0 LP=0=1@1 @ P1@ LP=0=1 -L@P  {00 -B@L㲫P 00 -L$M`H L D B20P@0 L 0P@0 0 iR @ 0S L@@ P ]D0\ 2\D08@K1@0, ,400 30C 5K?  D6L0eZH@@`P <  0@a0fT@! < d0<   D;Z/P`@ 0V 0`Up 1PpH iZ RPP  B;911P  @p < .P1P# p0 0<@ 0 ##Ƞ#\0PD0@ 0 0 0 L0@(K00 ŠdHL=0=0@0@ 5}S ;@0@1@ P0 03H L=0={0 0 S00RS/S / // -L0p.0R @p>0#200   N000N "" N04\0N8 |2S 3/0 S= 0=/0 S= 0=/ -L 0S(=R0= l -L 0S(=R0= l 0-LMP8@S0P0 0 0S00 0? Č 0h0- 0S0S0S  0-LM@KP 㾣P P P K0@K \Σ 㧣P00CS8@,,=:  0-LM@KP᭣ ㆣP 0S††† †††K0@K |ᕣ nP0S††† †††† C@ -LM@ p$rP,0  P0 Y 0 0帡m:P)0 Ye: 010YZ:`A1vQ,  P @vQ`AP , 1 PF0SC  Y=: 0$ 10Y2:`B0v X P@#v R`BP 1Y: 0Y41:0 $r r0020Y :R0Y:60(00*0z0 R=(0=/ B^0 R=(0=/R -L,MPQ =0=(K8S \ 0P $0 L } p8 0Y`40 : 0Y:0D < H @ 0 S@`  Sz `pY: 0Y*=0=H0S 0SD0H   =0=LP804@$<0<2 @0^p>n @Pi "0002 R 3 878 8781Q3#51 RY 868 !000 lo6 T1QLA@m 0084>H8 S808=0=WH` 2SD` ~ S{R=0=v+@K  ١PkPi0Sf0< S < `<P P D 000t08680D < H @ Odʑ4 -LM pQ `P đ@=0= KDĆ@~ -@L h腧 p-PLP`@ วP p  ⌡p 0@S  d -LhM0 #R(KH8 p&` !0$P0 " T #0P0 X :% p\ 0X%p:\0x0 t0 ` |0 p0 l0 h0 d0 X0 0 S pP  S xP  5|P 5:S P`X: p0X*=0=xQ 0S| R 0` S`1'R!=0= 8S `\ Q=0=0`/. @ |04 P  PP 8P TSt 3  p R  HTy 0S :Q ;@:0 4|0 ݠ '٠0 0  -Ϡ/>0$0#sp0X t x t0> CR ` t0S hP p *SlR 0X0 g2S tP c S`R=0=Z+@K (ᘠ qPO0S dP K RHSF0lSl @8 jb x t ` | p l h d X :hP ?MdQ ?/00v8Sf8Sct0XS (1 R? 868H8Xt30' Q 0 Q'5 Il0SP  L ] PP7 L KQP0d0]PH00@  <008 A?!#[ 1 hL KEPh@ 8687-\" ڰ\ \ \0\ P\ \ =0=\j0_0 p-PL,`@+00p -LMp( WF`(K(0S(  Q 0  + 0@`W1(PU l,@P,  PfjU; +1P (0S 000C `b 0+@P  *P [+(W+(U+Q+*K+ -L MP`p 2S 0 0@V0@  0R 0(@Ko)MK L0R >0 >+LP $ ꈎH -LM` 0PSp :@00S Ն,Ն8Ն`ՆY/PP=0= 2K $1R0S: 0F0fs0?2K(  00 PP  ~$K2K  ߞ,K  ۞2K2K  Ҟ,K Ξ2K  Ȟ,K Ğ0SFKE(ꪪ -LM`8 p1N#2,0 @P0M(K2> 0Q 0, S PU @0@  `k*00 S0 00#  VP00  OP4 U 8'* 000 @4`k`@|P| |R@4P .*4o$0, : `8 -LM` @PU$  SpP! 0 %atH8pP@]d@80X `PA @< 040$Km8S $K蘡졐@ʑɆ -L Mp`Q00  PUh=0h= W DP  ʵ(Ko)@d=0d=o Z,  BUP!h=502h=5b:0S  R ,0S000Z 8S 1R. #0"=00 ,0 0Sp=0p= 8S 00 0 08 ,0Z g Z7 Z)Rt=0t=$ 8S@d 2 Y TTd Tb 6mDP  ]1@ 00d(KoR)0 0@W0@t(K8SmRt=0t=h8S ' 2Pl=0l=\6  0Y8 6 t1 00@0 0< =0=B=0=>8 0@8TPT=0=100@*  pP 00000@=0=  pP=0= DP  ִ 0(Ko ɜPx=0x=  0-P@L !ܜ '؜0;:0 ΜB0 C[0\Ȝ%#53c0t0d D0u & 8 6000& l (p08t (780dfh -@PL`! pᣜ' ៜ:0 0;╜p Cp\[0B0刜hT Rl8-S0}3535t0c00u d 060 &06(l 8p0(t 87 |x 0 0|00|00|00|00|00|00|07P000H8S000dfh >-QLMp %x>Q @l>QJ `>Q X>Q P>Q85P0 00,.h@Pd 00 bPu=Q /=Q ^=Qf =QW =Q^=hPP^80 3V=Qr s=QH 0Q 0CQC. 0PAD=QR @8=Q 0=Q (=Q.<h幦PP.=P P|1'R!v 1/>00L888S8S H8Lp R 4P<Q <Q |<Q  0jP(KP<QP H<QD @<Q;hxPP!<  R 89 8 ;4P8;Q ;Q ;Q8P900;Q ;Qh ;QI@K! 㬜8S8 HKI0KP! ㉣PH; @RPpP:h-PP8@ 20s0S4P:FP  xP8#m<000X=@ `000S :hPPx0SSP002 1Cc?PPgZ@`P`8  :00?00? 000 ?00 ?000 ?000 ?000?S S S S00 0?00?000?0P0! P8P#500(008S.H' 㡚PPP1@P 0S`АK000@P 0S:   ἢ`℠FPP 8@2 8P㳀ᴁ/+㩢Pd7hVPP6A0AS2P'8 ' S'  l`7 P'20CP6h.PPIK! PPI0[ SN@ I [HK((4PT6hPP8 0S8 <4P8{ 6hPPu184P208k5hPPe0S 858 4PX5hݤPPR8 n 0S864P8F8P2#>1@ 5hŤPP:@x 㫙P8;8v8S8 * H' 㚙P4P!4h妤PPȘ 7 0S774P4P888S78SLP,4h判PP@ P PA 0 3hpPPtPP8K  oPH8pH(HK;:0 I0Kc 㰚P858 㦚4P8;8 JP00CS#M@` R0 0S- Rʉ Q0e ! c#-Q z0S00000ec00 ӠPPy PPrY`@ 8 B<4P8X-e_00?0 _??0?S0?0  /0 / /  /0  /0  /R0 ? 0S S S S ?0?0?0?00?0?0?00??S 0?84P68 㬘P0Q H8p Q4P n8 ;4P8ii 6i(i8ii4Oi i8iii0p0 -PL@ p[`Ė \[ lV @[0S  a[00[0 m= a0=[r@ 0-LH8@SP \t80Ct8`0/xʑ -PXhL0X8娐@PW@ Xpt(x8R0V 0`S>W0>@  -Lt(x8@R\t(x8R p-L@`PP=0=  6H ''H8p p p p-L@`PP=0=  p -L`ppV@PU@ 8SP]U@ -Lt`Pp@@D@T8S 7 p-L`vPP @0@@p00000d HX p ]~ʑ -Lt@P @0t1 -@LTp^`PHQh 0-@PL#-50t1tP0]0h -L@ h#  C 0-LHH/P00000000 /  8 00000S /000000001( 0A? ` 00000000 P  Sړ 0<0 p-L`pPp1G(1RT@@$@ p0R@(l10@S: :  (@R :0R@ @ 2$ /0 /0@@ @@$@@0SS S S@@/0A?@@  1 S@@8   P@@p @@@@ 0' HP @;?P@ -n^H8LppPpW/~pn12GiT@ 8 0  H8p RiUA2gP0HX <0027ppl -L6P 8! 858S808@PpDS(=V@ `8S `"PW 0RVp@W&  HdHHp08& 0108 l7  W07pP'0S 808hT0C7 8ʑʑʑ 0-L@P0&=0= P0P  H8.0(0((0  0X0hʑʑʑ -LH@Q `0H8hx -`8L SR R. R 0SHXTA000\# p@TPU 00000S40S00#PPHX Z\ 'H[[ 08p2S  3/ Z 0-L8S HX<@000000P0Qʐ0P/ 0V.R/P P P/P/ 0V.R/ 0V.R/ 0V.R/l p0   + "40/.00 .0C 0/ -Lr@P 0 0 K -Lr@P 0 0 K -Lrps`PP0 &D'  @`p p-L`qP@P   ;0 B 0P Jp -Lpr`kPP @  K0 B  0`1  - 200-P 0 @PL@D@ 0 00-P 0@PLT@#@ 0 00-@L0@ P0 -LMSPp" +@K\ 0 0  00CStl dl l l Pl l l l l l l t .@K ̐00P@ `6?I&40`P0`R[Z&40`0yA&40`  0 "#400<0P0^8 O(K00P @`  ㅐ00@`  z00 @r`  n 0r`0@&40`P0`  ]00`P  R 00r`P00P00P~ @? S0C0P )0 0S  0P * 00r`P{  0 00Pr`nfcʑˑ "0-L@M+pK`0P 8 00  0d0C0` 000-@P0L00C0d0C00 p-@ TL` PP T000p; 1phU ˑ p-LPr` @Pp00`  0#40 b pr Rs  /R R-L[8p p\L@`:S 0<O 1 PP^F 0 B ;0\ 1 #      pP. 8P G8T!40  Z 0#40@ : ;[PJ7[0S280 !8 00c0 00  0  6\0  |p0  H ' | p-L@pPC*>0( `0\ࠓL;0\    @P (0S 00c0 0p  R 0S /0 0@S  R/@R/`R/ R/ 048<3?#.R#:s R/R/R/ -LMpQ`k PX P = @,pPP`!P 000ႎ ~' z8  VV90< 0@006@00! X7ST@10X'0 6'L$K PR 0"a痷pPhp@~\@ 08AH@]V 6 $0 @ f졐Lˑ@ˑ -@L`AAQPp T 2P PW 0iSSSpW!0 8  0S L㲁Q  ]PP 1 018 P!1R2@ P10dQ`A@ @! dA1010/0@ 0@ 0 0@0@6   0oL7Pxˑ -LMPp P 0iSS3 0 SPP=0=" 6K  ᆍ `P=0= 8" 2S"[2R>0> U OV 0P0(K00Sv8808(F@0@0 0U  "[  PP=0= @0@S00岀41 "!8S0' "0K     X1  0@00`41  "[1R %@ @ < < r 0< S2<0 w00021  U`rs`P 08`qHh\@000V8 $=0=Mꈎftˑ -LMpQ`Px A000U[ U: U" UH =@0= U @U U @P  0@PXገH(x0r @P ]@P= @0=x @P 6 !⧵08 xx0((@P 8S x @P 6 !≵08 Z &ˑˑ@ˑ -L,MD  0@  H,` 0@P pDP0  `p 0@  L#D<P`(0@!(pDD#L`!4 R @ P@ *D  L LP @>0> @>0>(K\1 S:D L P< `L,  04Pa b04P0< 0 B@21Cc@0H # 4 H@0 HD @0Ș8L08F E0@A$@`D0@< P#D pC <P`B0@< <@!(#Lp4 H(,@ c, L |@D4 LP8 <0 S  0@,H8` 0@P pPD0  ` p 0@#D <P`0@8 8@!(#Lp4D0 \`!@6@D4 (Ko<0D0@ 0h@ lBD!p@ 80,?D@L LX̑$̑ -L@ML  T P  0@,H`T K P 0@pPD0  `p 0@  L#D<P`(0@!(pLPD#L`!4RpH I*L PJ 0$ D B L  P<a b0cPep4X4:d d0X4 %8 % *,0PpX2: 0X-:0SR+@K ៊ xP0S8P  S4L@4` `4` H`>0>(KH>0>\1S:8\ L800  0R8PH`@ @21Cc#̀ X < 屋X0HL 8(008F E0@Ap$@`D0@PpLC #D<P`B0@(!(D#Lp4 X@(0PXH`80 %HL< P@ 4Pe 0S 00L H0hH l D0Ds0S2@1C qpc# J0HL~!8(404@4 0` \0  0@$@@``0KP4P 0@@@#D<P`  0@@ @@!( #L4P` P T(H`4⻉HL PD 8  0@p,H@` 0@PpPD0  ` p 0@#D <P`0@@ @@!(#Lp4L0 \`!H@6 HL@ !L "HuLP!⹲$ 80ꌡX̑$̑ -LM d1S3    0@,H` 0@PKDp0P`p 0@  L #D <P`0@(!(D#L`!p4Rp&*9  (K@C PP!0΅ 0 pK?Kp P@P  `>0> >0>\1S:T@ P  a b0cPep4X:d d`0X: S 0PpX): `0X$:00S0SP QP R+@K lᶈ ㏈P0SP  S,7 P  R 0S @T| P  1S @p tQ  0R  00 0 h lY SPP P KP L0S  @0S4[SD ? !  0@p,H` 0@PpDP0`p 0@  L #D <P`0@(!(D#Lp4 0\`!d10& k@ş8 09 PPI   04P  |PUp F E0@Ap P$@`D0@pC #D<P`B0@!(p#L4p^O .1q匁|1`a ҇  P3#  \X K  0R@ @21Cc #̀  0H 8(@008F E0@Ap$@`D0@PpLC #D<P`B0@(!(Dp#L4 P(`h p  PbPS 0S[0 D0Ds0SS2P1Cqpc#=0 0 堈0H!8(`~  0@$@` 0@PL#D <P`  0@(!(D #L4P` P T(`  P @ 000  0 " 8P .@K t ͆P0S0SP PPUPUP `` Fd̑$̑ -LXMt p d1S0 p 0@  tH,` 0@PpDP0`p 0@  L #D <P`0@(!(D`!#Lp4Rp*a b0cPep4Y/:d d`0Y# *(0PpY: `0Y:0SR+@K y RP0S0PpY*X 0S (Kt0SS=X  pt*P t KoPt pC_0N <0@C ]tp!p? k`KPP'p6pt 0 p>0>t \1S:t p0Ko `p $80 .ꕡd̑$̑ -P`0OpL0  0 0@0@Uho0bS 0bS;0S>0>0S: S<  040\a0b $c Q00\0S 0D 0Bs0S0SS"R 0Q& &  /   BcPP=0=0S0S1S 0SRPP   0S  h   > p-@ TL`PP T0 00p; 1phBl̑ -`LP pP `J @1 0<! 80  00S00 00SS /"4 0 0  CCq0Cr B#4Ac Ba0b 1(Q T`P0/0@ 0@- 1S 0S  !1R 7`101 @ `10dQ`q@ p! dq101Lꈎ M-LM0, rP 40 0@ GP( X c @ ;@#$  0,o1 0l!"8 0l!"4 0l lk14 0h!l"880h!l"4<0h! Z? 0@h1lA,@& ,(?$Kk)400$D#\#<@ pT l<[#4@<8@ FEpDPCB040[A0!⫭8 ~ $K̑ -LM` pPJ Pc ᗅc1 0`!"8 0`!"4 0` `_14 0\!`"880\!`"4<0\!!D 0S0 c 0 6 ?$Km!_ T80D. 0#40  002 `c ;c1 0`!"8 0`!"4 0` `_14 0\!`"880\!`"4<0\!!D 0S c0  0 0& ? Kii! @800 K5@40d̑̑ -LMP`Q<  $pP; @c ߄0 0  ⅃ 〃0cS  ` d 6 0$Km!⴬P8 0< H`@ $Kd̑̑D0D D 0< 0h"n0 0CP($8 0l"d2/T * I`ІQ 888888x2-SL3/ t 0-P8h@6800T0 Q L0S 8 878087808S 2/8 /8o S00R/o0幤  -L@ RT' X'  770C0C77 10TP RZ 10P  R' '  770C0C77 RZ -L M4  P8s4p4 [`*>0 0 , pZRi Vf PX0\0  X@0^  V~ 40P( 0, 0\ , = PG 0\2  0\, P00+ S+ 0Fs0Z[0s` Y0[`0 0 V0A 0Z\000S , 0r0300 (K\ Q 0S\P0P  P\  -L8PS@p `8RS=0=8V 6H8S808=0=U 80X'  lHȐ0000H(H8dH^/̑ p- Q` `VLP0 0Cs0^S@0 0Cs0^S@TtT`PP\UDphV 8Vp@@$Tp@͑ ͑( -LM`X@UpH TC KK@K`KJU U:[0(R6+ (d4R'\D@ת 8LT0HH:;8p0\@4 0 8$ 308 08L0EStLtL0ML0ESLMMMEN-E Bs0Sr 00R 2 1C00 2 1C00脧GDp tQ 0 S"0!B //~{ -LM" P3 p0@ 00@= 2K~=2K00<0<Po:00 P,K~ ~ ~0 4 K30K14 K<1 0D$K账 -LM< @  P6 p  0@(0@ 6K~0P2K<`0:00  P`0K~  ~< ~@ ~0 8 K70K18 K<1 0D(K账 -LM0PK`p@ @T@W0 BK,` /0K0K6P d\0l 0B Sl00 R< W K\ ᗼ  -`L0pPh0PUPU 0S 00@ }P蜦 -LP l0S0Q 0S 4QhW   d00d0xґ -LPM`0?s JR (K0 0Kl h0 },Kh }P 0QK 0 R<0@\ωd \ <@ X@ }P 0X RI ,PRH X0@(\@@ 02pPI Q` E 0PUB  R`40 S P@K,K 0` d4Pڦ8P8 0K,Q 0 R<0@\P 0 R@,PP@K,K 0d實 0#X000 Zp0@X R (宴 0Pc @40l Rl0S[Pd A}00d :}hl 6}0Kh 2}0̠0 >K*}\ 8K&}3 3K0? K@0K@ K 0CD0d |PWP@K,K 0 0dp0 |P `2d 0Sr`40 S~ P@K,K 0k` d4P78P8 000p0 T   pd|`0T X0 1!`0O0@T0X@`d00d0T0 R0S'00 @`0T Z  R    B `!L`P DPU0P$00 P0C0  B z40`  FPd |d\ |LP@K,K 0dʥ8 0 0$0; 0 W0P7 00 R+@T+ @T( 0 R(0S0`4S2 $`O0(`(0S3@$@0 O`0(@0(0$0%000}z,0 Rwgfffw0S S / P// 00 BQ0S 0`00//0 RP/0S1 Q/ p-L M@00CS0 KpΒPP 0 $0 ( K'K8 KTPL` R000 00  60 |2i -L MP`Q Q 0 R 0@SQ000P1S@K06 '|pP  00 0C060,Ku< KtP@P``0S 0  0 0 00pP60 {@1i -@L VL0S  O000@ G X0-L @ᬳPPL0S0000 垳PP @ 0-L0, 0\P< \#\ 6 0 Q@T@T 0 R0\ <00^R0h0蜦6/H0@-\@<0\!\ 6 0 QQQ 0 R0 \ <00^R@xꜦ ( 0-P @LRhP 0h00 00h/ 0-PLP0T0 @0S,tT0 -LMSPpQ 8@<`KP1SV  3/PPHᛑ,0S 0,0 0 S4H1,0,0,0\0 0(0XMt0$0&r0 ,4$R0( 00L0L0&&r0r0 "  %UY (KI0SHt&Pд_PᕴP1&Ph0S(K00 [h i  0-@LPrtT00!R00P<   aS200 -@xLMTP`4 `6T4 1CT. V Q?Q< 0 Rp6Th 5 0CT+ 5T' 0T$ 5T C 0CT 5T 0TC0@,0\0 0 V  0d@(K6@0 @p45Ta0CT(:W P QQ 0 R<0PQt p4T L4T 4T P1Sg  3/@4T0S' X4TWU 0 W  lyp800H 0X X0986 `HI| <0pS Q 0 R 3Tk0CTg3T 0TX@w0CTX 0@P a1@_-@]R@C,@N6Q  U@E8@?290S& 00S^& !0Sx @\@ !0Sc 0SP@  05@P,㢓1@TC86 H@6 t1H8PKP1S  3/@P*@ 1@p,bn0X\0,0 <0YRY H h0c H@&~ ⴐ~iii i #i "i i@!i %i -`R  S LMRP2Q 1CQ 1CQ - $K0  0S?0S<1SS81SS40 S1X2U0 1CU- 1CU0 %d@K@pr srTK or1FSY0 30K4 K0K 0  d0pR  d@KHr0)t1U  p@T, d@T' 0 RP 00W1U PK@#r &rK88 "r6`K$X Xr 0 t1 rDK!r88 r6 FHH r\0 0\8`KHH qFqii@ii ԑ -L@=0\\ 0P6 QQ 0 R<0T L0T蜦qQp Q/28 10:  /0   /w -@HLPʪ0H0 -L@\P` 0S$00S( P>0  00@ 0`W rP( 40S% 8P" <00s00SR pP @岨T PP 0 R1d0 0R l0040S 0-PHLP d0@0ZH@$ H|r@0 Q Q H00S 0S$0S(0S X@QPP L H0( R P0QP0 L ԪH0 p-P@` PL >r00P30800p -LHMPH@T `\pKH`@ 'rd0P ,0 X 00T0  P 40d @d0Kr 0' p-L@0` 0S @P P q00P30(00pph 00-@@ L0& P pHP l0 ' #<9P R 0 0 0 R000  R 00000   ,00C,00hb  p-@``LP 0P  $0P  ,`bphG+)ԑԑ 1?-L8MpLPK`@%K 0 a 0K`cbP0K @]b @b$001K r -LMp0 @ `ᴀ, [ P@T 08 40 @TL IU3SE l0  ,0S00S` 0S0S0S 0Sf , oP0S^ 0S[$0SX(0SU0S<0S90S6 0S3Z 0 4ZZS 4 8@ @T8(Kl0,(0S Y Y30S80S , R ,Q80YS, R 40S80S0S0S0S 0S 0S0S0S  :oPe30 Sa8@ 0S -L0>00>0b0b0 ;J!Ox ?0йՑՑ -LM@P  ]PhA --LXM` 0@ ,0 p0?s0PdU &000(K 0$U$Q  0EiP %000`P%0000(S(|1 0  @AQXH趇|5 R 5 R1  0004 R U000T@ڴ000T@ʲ1#U0 0U R 00S 0)SCU00U000}4 R1 0010000K 000Pd0`p4p 13 RU |3 RQ T#U  10URTK d@K XgtPK Sg Og0 PKS0KTKs0Kc0KtKdKe `Ke  pKe40K0P(  0兤4P 2 R# |ZTh@mTc꼹 @X@V@T@R1 (0h4PIU600 d|aD@K f0 C0KD K0s S@0  0@0 W P 00\  0S? 062 LP0  05`P000  001DPK f0 D KC0K0x@0  21C0` 10\ 0( K?KCDpK Ce0 D0KC K Q-L M` 0S`  K ŸA0`Ձ` 0B!S#$‡d‡‡‡‡TÇ,lÇ-`&R 0 `P圇`U 1 R`÷  0 Kid p 0P Ki L 0 0\10000Z ! 3 6S0$3@T00T0DP 0 0@0@ 0 L L10 008008004D0KX0 T p0H 0 U!<  6 0S QQ 0 R<0 0TQ Q 0 R 0RQ  R 0S  T I0S 6 9@,1<10V0 0S \00@00 H0?s0\-: 0 P0SS "Lx00x0V 0D@\ pP p QH Q 0 R0@PN R d0 \0p`0S`!(@L00L0 ЍP!A@T00T0p 0?s0S(@1<12020S [pP pQH Q 0 R (0RU` (0RH  F@PPP W"0D@pU 0TP  0 D@K TD`KX@  qP9Tg @D00D0aDK3@X [$ Rp-L@ P` PP @p@pkS dS5S 0 PphmSnS)`1RP9 0 0 0PP@ 0S@ 0 Rl0l000l0l0P@@ T+P( ,@ 0@ 0l0 00PP 0S 0S Z@ @P @-@" --LM 0 0 P@ pl0`00S :(K RR) C@P7  xq0y`0 Q0 ?08 p0(0 0H  P4`0S 0S0?sR0Q0S "\00\0$ --LML2pPD2( U s PUG @0 l0lى@(։Ty R 0S8 RS( R 0RX$  !0@P l 10S@0  (K 0@P@ (0PG-(P )0(0 PUX$ l 00S@0   (K 0@P (0P (P @$K0R 0S 0 #@004  B4 0 @ ʚ;$ Q-L`P0@, 0t03Q0S pX Qe d P \ x 0_ Ts ,p m_ 0`S0SN 1p-p 0S0S/p0(0pbpTU0 p V+p 04 , 7=?20@P~^?01q x0  0 Y Y 0  0b?001 QY P\0`0x 0 0 %(0* 40 , ')+!0,Pp 0S;0@ < 800T0  2/ P03?0]iԬج0 -@Q`RLMQp % 02K R RP VPU00U0SR< R R @00`eV00S RU 0,P U 00 N0 3?0N03?0  6St00 0@ 0h1@ -L: 0R: 000 0Q000 H0"!B 00C04 00C0H0"!B  ԏ -LM@ᘠ`P0( Kp @P 0 0bS,0@ZP hl!X -`LPdQUp @wTP0d1 -LpP:: S 01 Q: 1@PV X\!cI  P`> 0@1A: 0s0:AQ00Q000@ P 0?0f @ XD` -LMp0S Y0S~ S0L0X0@"2  ! 1L0bLR|2HAC|2 , Qlh"0Q>X2 * ! BR0 0R000@c "0@?0d1S0d!000dq0张001,pR01 HL!dpd!> 0H@P`1dA@/ X7 P@800# L %0%0g@P^/ ` 0x!|1w]@ [ X2 @1C 40P!@ TX@ȋ4ԏ<8DX` -LM@P qKD` X ! P01 df ` ! 7LX.0S&   0, KwPP> c b?0@X1A P 먀p0P0Pd @0 0@0d (K2"(0K!Q|1H0 0P ( 0 P  㪟pPz X K t K0 QZ 娀00e  *1Y8!0l l|S0SD0Dž p0P0P!= S@ `0`S$ 00s  @@P {d @0 0@0d ~0@P !q0[ 0 "r0 00| 0 Q0\000:0:#TP!#X{ WX$| -LbP|p@!P |4Q+ Q() WH2ųp@20S S03T@!t @T@@3b? St`> @D`t`w1 10S> S A !0S01S 1 g`P \ 67Q1 QL  Q3 0n Cw@ Qp0/ 0nC0@P10%Tt h1l1 zS 1% A5g0 R0! S 1 !g0 R p00n C PN.n2 2:20Sp pS:0S0 Q020Sp  p S:0S R00n C2,9ج -L|0W`@ptP@T:Dezp0 Q!oXP𨝘@Wz80 PQ!h`'XPP𨝘| -LMT` 0, K@pP 0 0R  (K 0aS0BD 0a0bSN,P 0@l l0<0 l0w0w0000S S,0S H000 0PP 0 0 JP Pp 0D@D0t t 0S "2S1 `0t0 R!:t0=t0gPx T0X1P pbT!0hR0 0010P2 84!0,"?0000p:Sp: S 7 100! 00&?0D R1 0cS!`> 0@P1TAA3P * 0(@0 @ tZ `l0@P !0 80UP00? H@l0 PJ 7? <X0 A-L@J 0\:@T 0c 0bS R@TL*0D L1M0L1  l B&I 00C 0D֑ -L6| PS@p@T  0S 0 K(0 ( 嵞V%  @0S1 `0V 00000U | R l0  HPP 2t04t0t04t0萝 -LM`0 ნP P  00lSں 00lSpWP, $ 0! lPU0U0 P` 0O0@0@x CM000e0     0/8 4 0 W  1QS PR R<00000 p U 0 0lQ0P,@ P尀T㲁 ,00S,   0R (K R 0` 0R(Ko 0 Y  0R;  $!0000 0a1 0P,@ P尀T㲁,  0@_8@ 4P @P@P0,0 p 0@_8@ 4P @P@Ps R00000   0R ꐝX -LM@Ƞ`P0( Kp @P 03?S * :S0:,0@P pt!X --LlMpx0 0x04 KH 1 0#2S S  c(K 0R \:Yi 0P`hU,` O U`` ` b 2 @10\1 \( ,0@Tu 0,#21S  S R0 000`n^,` e 0R0% N:Y, ``F V`  հ ڼ 0S  0 <R PP  0H  80KP 8 0R1:0000  R 0S0sy 0S0S 0so R   0S0S0Sc P0S_ `` t000X 0 @@ @ 3?003/0 ?!0/!P P > 0`0"!V00 V 101:  vP} `z ,`,``,` 0   (0  ,0"I@8 `` jH 03?D0  2/@ 00` \KcKd`KvF0`K`xK 6K`KlFK0 P  P ( WF |SF 0_  RG0Pi2`Vu= P $9PU- 0R #3R101T |0@  |1S S,P~ 8P0 00(0PUH R 0S:D@TL \   P1 0#0  @`` 0\$ȟ041ʼ^ H0K0(  0 PHQ @P WX!0 b0b S0@ @0 \  `dP`PX1 na0fR ?S0 0,1(1 \ \ \{ HQ 0T!R D00bSK0c\2`V !00R L0B 1Ɂ ,0\  Po P ` P` P`0` 0 `` 0, `l,` 1\0lࠣ ̣ 1ɱɡ0,` 6,`VSw00c 0a0PU0U00T/0  0 00S 0R  X t00t0`P  00cS{10cSwʰ@ U = @P 0(||PdKEKE\ \ 1@01Qh$T80 ?0!{ `70S` 0dP`XP& 80KlP 8P 0R0% *̢0 S'HQ T1D 0bS00fSڜ N 0K 199000 | @0 PU101 00cS10cS  e&,`0`e 00 ,` H0S DT10cS`!0bSڰ-  `1R 0R 0RJ6 S &02  0 @>t0  t, Po P ` P` P` Pr`` t00d0KcK ` 0KKK0|0 'K`,v 81Q T!D00bS `R00^0SK ^+0S[ dPX`PM p(`PUM p(,PX 4PP|X֑|  lxH?̋0(^ U 00lSy00[k6 S`7a` 1t0Ut 0 0bS 000 0 8?0yt0`0`SS1R!P1Q!81S !c' 10 1000, Q#0C0 P ^1P  P 6 Sʬ`!P00S,` PP V| yQF QC Qq0AS=DDDDDpDCU 0bS R 0bSQ0P,0S  0R0Q000 H 000 SH1t0 Ńt2P3CMy 0 |1S S 0,s |3t 30S r p3P3C&y 0 ( 0Y e000@2@4@@ rP 00cS ,`,`[6SE ? S=0lSڠ$6S$! 1S !10cS000l P`0 ? 0 0 H PK`RP` @0Sj8\  <10cSPl 1RS 40|%0?0x Q$1U6rP1%#Q  !T | R l0  HP 0 !0P U`0bP < 0t t0ăt)tt 0p!0bStň h1Rh!0 0bS6 0CS񟗝dHH(C\BG7P3CHxU  <7P3C9x U P0  'P0 ?0$x `f & R0`S0SD t,0K  t0ts  A @ A`0 dP`XP ,dKK 0Pp?P pr 0DP @dKK 006P a00 f chR0TT10\1'G =06 00 0T@bt0t0006 #000)0)8?0wt0`0`SA M00C0Pbe  P`0`0,` `0`` 0PHZ\!X00bSTūʠP`,0ȟ  堀夐P,u :!`P`dKHKK 0 P`pp0S SP @P101 P 0@U,`V  0R H1 0c0cS000t 00t0 Q f  00cS P00C0b0SH00@00L10L1,`v0SR:0 N 0k,`GQ `10cS0\1D T!, R  00cS0`S 1S:6S0H 0R0 @0SS8\   <10cS`ml 0cPoP ` TP` | R l0  HP 0 t 0p!0bSth1Xh< 1R 40P.0?0tv < 0 t0ăt!t0t0S*t0'S1R!P1Q!s010  0R3Q  dP`XP0n aS0 RP0000 ``,0Po| P` TP`| | R l0  HP 0 2t? R P W 1 0S 6 t`0 PH0S @0S ,!S0b#S:(1, 0(1MPt0ătt 30St1 '0P`SRt43 R 0 W? 1< 0S9 66 t,0``,0Po| P` T P`| | R l0  HP 0 P0 I Lt0ătJt0t` 0S!F2t}u``up- ,Q(Q}QcN 1tauYEut0Ńttac: 0S P*9`Po000 * 6!0s06s0S ڰ' 10 1k0 WP!nP  P$1u'8a0 !0\@` \` @H$!0, 0cS 圠Ť(d0X -L) --L0@00qQ/s0A1h1 !S0 Q xQx<0 / t&r0 S0Һ6 匜BDp֑ -L\M`t |0@p thtf x,400aS7!0! 1%0  d t0t !0rRP1P!<Pnt   Ust@TP"P3 !3 1t^hhX0w0W1!Xt0 ` ` X@d` P0\Pb0c3UPX. X dQt0 \:0 t0|1S SD S . p p(K1Sd r0SH1X:S0!0bSU Q:!0 aU0b0bSTt 00aS  0Q ^ 040@x p Xp  dXʃ` XI r0 S X RU0!0bSL)0O@ɟHD 0@ D H0L@pP IX00S; 1 0X@0 @0XX 00t 00 0t@ 0S0 (p  Dt00t0pPx $HX00S 0X0 0X0 0 x0S O=x0@ x@  @B t0 1R B X401 03?0l0\3?0 l TK*=l 0#10 " X0#U7UP! Q0\  0c&!U  R \ Rq?00 cQ0ՠ0 x6 Q01 ?1202r R 40 1 0cS!0|0 ( |1S S S0?0| x00| h q0%00|SH ;0!p pQ.l1l%hQl@00@0t 00 0\0tS \@ 10cS0`!t`\| 'UDr40 @ V:50 S   pl@T0KX!0 TKd40,12/ l S l T13?00,1ğd00d0h00h0t0 d t   x0S t0 t1 0cS 81!Sp3xC <8!0000@J 0RF P#0?0Tr40; 6rF70@(0CPs00#$ 0h 0|0|H P p G0 0t0 r[t 0UPp|7 p 1 q @0S0KT@Kz(0K T@Kc;@6t  T @ R1! l 2?P0 ; 1Zl 00bSL!HAl0p000l0p0<(!0OTP 0@ P T0X@l@T KX0  0TK07Q p0(S p \Ap  p 2RAR 6Sڈ0p@@p Xtht0S d0qN|@p@ HFp@ C0Xiج N֑d0R1\R!/0  Q/ 0-LEM@|0(Qr0S - J_K  8;K S&|> N&|< I&|1S# |8 A&|( <&XKd'XT 0:0X!K0\Lt'DH %&00|, &| &0`H p-LD@P`P00T00Spd0phx3 -LD@PpTPg d0 \0 _00h(W0W0 xP7S @0-M@L0  @ @:Kא,e| -LD@@6S SX06dlhg6S(0 R3QAQ@QN 0-P@LT0 R00000  C@T0萝 p-LP8`@$ 000pX p-@|PL@`t0xP t06t0 @QpD@p0t0-p p-L6| @SP@`X 000<Uu@0 Rph06g 00 0XN -LH孍PPpL 81p@@P0.@7 n a@@ nT  n0 0R  t 0|020s Q?B!r &r RڀR0ü6l0 $1 1h!l!l  00|1|1 <0<0  w x DPxz4g$ ?Ԭ -@xLP|P`E |P3 P@, 9 ~9p0:0`00#$##̠   0(@ 0#0 s S 0P P1 00 001@ J9+0 08 (00 @ `P |1S S(0 0 S0 0 0H 0 00(0S; p1p`i 0-L M@PfP 0@@< 0@4x 0dsd\ 0;S<00L 0<0S<K0hQ(ޖ`֑֑@|`ie֑ -L(M@PpQ` (K0S0SE UU 0ES៕GU UB 1 R V< 0S \  0R:<K8  <0K[#[L0pUA P. @ 80R3/ DQ 00cS10cS0 0S0S s娐 0pP 0Sl0 R L03PAP @P < K0P8fא| -L Mp@Q` (K0S PPQ 0@SxŸ-P2 PhŸ( P% U V!  0 <!<  P] @ 0R3/ DQ 00cS10cSq 0.1 RV  0 ! 0W 4P745jP4 1 <4{ P4 P/ P)P$ ἿP  P qP40 0 0r 44 0r0P R 0S0S0S 0S R 0S0s  PU  PBP p 0S =P P Z7P|X֑ Q0-L M@P K00S S *0 `@PS^D 40PK0hS$ 0PK0hS p-L`$P@;p -LM` RP*Q: 0Sp ៻U ᛻(K(p0S/p0S1p (0S8p@ 8H0,K@pP3ShA\1h!0 p0W(0S9p 80,0  `P7p @ p/ 0?0,0Yx 0(0003311010?0x q l 0H S202,00,0(@0 0 PpApO Q-Lp@` 0v03Q0S3Q~蔈蔈D䕈蔈|Ȕ蔈蔈蔈蔈蔈l0   0 o 0 o蠺`Y ݺZ ٺ`l0L Y`-`l0   0o-`VR2Ÿ @`P`P l0L| E`L2l0 Pi  `2e`-`喌l0 E 0S 0S$0S(0S( 8`l0  0S  0S$0S(0S9` d1l0<,\80@,10`00mQ@`V_\(0SP@` `K`Aᆽ`< 0ocl0 ,0,0  w x )֑8אԬ Q-LM 0S K0S0S P0@ SAP T \ 0 ! HP]0P @0S   0ꌭL -LlM@Qp PU (K`VP0@Sl jPf P 2 R X 0 Sx 0t0 p y L0KLK0 -KPKL`KDPK|P x LK04 Pl Yg x0tP 0R:0@K-h`K0 xt@`PK}-0 g0KhK|-x 0P PWI [pP"[lLK0Dp P$l LPKLKP DPK|P  DKLK0fPx p s DKLK0VP eLKD Kl  | tl pPlLK `0Xp PN[DK"[0(吾PLא -@@0L@@h --LPM0@00P 000 , 0#2S S* и,P ̸(K0l c0K 0 Sp #:W1 0S000 U0?s` 0 dV) 00V0S 0000lP c0K 0 SPp * 40K<P 4 0R0%p *t坊000b/HKl\00 l 0S 0S0s l0S0S 0s ^p : 0l0Q 0c`[V^ V d@Kn,0ld0Kc`K KP1  `7`Vg h l0  c@(cT4 `V @0 l Rl0 2  (0U0(08  0.0S 000AlQ> V 0`d0`dV RY#0Rl0S` ,0S00S40S80S0SE 0SB$0S?(0S<hQ@ %0Y@P9 l R h0l 50Sh@0   h, KU h\5l 0S@0   h,K 0y ]h ,0@dKPRP$᪷,P 00 00,0 @0 ( h` al\ l(@ 0@ `V l0\,0 l T40S@0   , KU l 40S@0   ,K 0*l^ l0  ,0S,@K @0S@ )0U l0  ,0S,@K @0S! 0 @dKP ,0PK 00 0`h0SQ l\ h2l 0S@0   h, K9U h2l 0S@0    h,K0 ᳴h dK,0@ PP h0@1dK+0d0Kc`K06K 0`0 l, *P@l R  0C000> $0l0"!Q$00A ( tԻ`V<0L00! 000lQ7 p  0 (@ 0@1`l *Pg#0Rc8 R 0R\( R 0RV( h蜼`h @HK00p0 0l00h` A꬞X֑ʚ; -L|#Q-@P P*R 000PM 07N -LM┅4 8 +0K `ᤵ+ ["2S S (00(0$(K( 0P "2S S % 0Py`P + ["2S04 * K嫳0S000 0 48<43?#:*0K唳0SY )Y( 0S:Y )Y p 0S 654 R1 (Ea3PU0 )PU& 00 R@T@T W 0S 0R Z 0S )P$00$0埵y040`O0@Y0@ )YwPB8 R LP  0qAr@ D0R@  100Sa@`10`@ 0 @ , ! % , !4"@P `X0St )X ( f*K 04) K 8<3?#:)0K傾P% 00 04p*K 0)0K pP  )0[S 0 0Q'@ჹ`P6000 0p48<* 0"""̠0)0[:3? ""4"(0 +P|@\H00H0 0 0 0000 @@^֑HMssd0 -LQ1  0 {($ 00 0崴  -`0-LM R1   00  0 Y K 00 0咴 -LMP)0Kp @)0[ !#R)K R zl (0/0(0 (K%aVT 85,  , g001S %1S 4,  , W0701S1S1S ,1S Q ( ĶPc|$700001S41S81S 0SF Su 0S< S00S S000(1S 1S  ᒶP @00@0s  #0?0庐(1 0 ! )[Z Z <#/(00(0s00S 00S0 0 0@`000"(0C?s00#400I0 0B 0)`[V V_ ḳd"/(00(0= 00S S) +0K`0+ K*K*0K 0* [48 <*2/00#,##8 0000 1S S 0 R. 0(0C@0@0@0 R00C@  00C@0@0@ 1 00K(ʲ00) 3?#:+0K 0(0C@   00K㴲00) 3?#:+0K 嶐0+ K*K*0K堼*0[0 +0K⟲0  㙲0?90?0ԬG-0P` 0 8<0#40 0  (, "$ 0 8<0#DV M @*\\\s\`FX#P0$$$Ġ0 A 0# !0# 0#$0# 0# # ,` (V@  Ѝ0 8<0#40 0(, "ĂV0```r``F0 0! #0 ?0@0cS40 <@0 0<0 8H0 0.\.D0 .4< pT l D@[/0K40)KH[@040 *K4.K @ 0KL +K,pK-PKL0K  8L 0#<0 "( 0#4080  Q HU(K 08 @-@ 0@$ $0 0 00 /É#EgvT2ܺ @ -LgM hKh _b4b,d  ` 4! O ii0x  .j x "`0(\= 0ln$ n (ci 0 i 0#  ਐX0༑ cc *̐ 0̀ 0 Taa- &b=l$l !P .c 0i i<L!  ii 0(`- 1 0d H,0* 0ba=ii$! D  &c 0b D0@ !c<  nn )0`- ,0<` 0 ( 0= fbf$8 c ! . j 0j4` " 0X 01 X1!ffl `a  a匁`0 =,*a -,!caii4D 嘀lTl|Dp 0( &Q4b  #00P" .0_) 0Q P. 0 x`=,! P `% (Ϡt cQ-0.0a ! #0%, ba0 !t ਠX0# . " 1 &! 0韠夐  "0!0 `͌@)d@P "D 菠*Ȁ P) Ȑ=!l( Q @ ,M! (`cQ '0 %-!) 0dad0A )$菠@0*& *tA韠=b $@"  P,@$ P XꯠA cA 0%P#00` $P%Q Q `_0-P aQ &`!= % `&a ab o` `D "`"  XA,`&a acA oa 0` 0#`#00Q $`&a a 0oTa a0-aQ(`!T= D% `&a a o` Tatb )`"`& a  A, O@A `p @cA0*`#001 Q01 $p&`@1_-Q  aQ&a0,q `!q t% `&l` ` =b &,q`"  @,p&l`cAopa  ,a1 0#`#p00P $`&p` p  Tapq0-aQ&p`! &p`% o` =bap p'  @& p'Ϡ  cp'@1@ 0# @#0p 0,pQ0#-$aA0%pP!菠0 $ p% !0ba ,  P(0&=`q !`q % `pQ '! %c- 0 #U bA菠 `0 T!唀 0 )`崐(  ࠠ唐0  `* != &np!菠؀ ca  0Ā崠 @ ( Tؠ )0)Aq 0 p(韠0'p-`ἡ !1bA͌  p#ἡ,!0'@q菠 .` pa p(0  = 'qlca!ꯠ  01 <  0唠 p*0弡'0,q菠 0 1  <1倁 ഀA p(0᠀p1'ꯠ( p!ؠ1弁 -n*༡bA   00 (1 1((  `lq p#='p`菠ca͌!01  l1 p)1ꯠᜠ  '0p01 .0A p#0`A-'pl@!ꯠbq  ! 0p? 0?Spp0L`@  go@pb@  Q?0YP@p I?0Y@P 0 -LMP`p(K  ! b62 R1<0Q0^ ~?@ Q R 1  !1PF\C K֑͐G-Mp @ 0H0 P$P`(`H`,P  0@  00@L ` 0(, 00($ 0 ,j@ 0 0!(P,@ 0 0f . @ PX!,f. 0$0@P0L0(  0,P$ (0,@@8`< TD0P@8p'0@ 0@R? @@0 ^P` ! "0 ' (>P`p  pZDA p Cp@~R?䐍p0)*0! "0P`0#@$1Ap0)@*j耡V?訁嬑jv 0@1ANO0耡0^`ZxQ|aZ^`X\R- !R/ !1>1AN0AQZ_`Qanaq`Qa]`!1AQaa嘑圡q夁p▏P  q0Nqᖟ d@'|А L$ 帡|'i `P_ጠḡPPF`#*όἑx$P(`*i剛YV džlȠPt嬑aQɠP _)nƌἑ娡婔*p †@P`8 P% `&P`P` P% `&ଡ`n_`P`3\P``a  TXA娐Q$A<@0aR)*c4P嘐圠0`nf_`> P `j 0 @ D0H@b? 0 @0@00 d0#@$0@D0 p T! ")* b_`ALP4 PZf1AN0nAQb?j_`n qj 0 @ b? $Qn0@(q ,n0@01fO0 4Qn0@ߍ(ΐ -pRLPD@`A1>0 cWP205:P` @1@ T@D > `phW@;@ RpG@D  Q*H0 0@H0L@W`WP @1 0S@DR𭝘H0 0@H0L@SH0 0@H0L@ -RLM D@A1>?0 @c ZP20(:Pp , Y,@P`1@P`@PD` l?Z @<@ @J?Z@D @Z P 4@1@ @D <0-@ PL$P r@0@0D@H0L@0͐ -LM, @P`H60@140 0@ 2 05< 80 40K  <0KQ,@^Pa@D HL%  0pPP0P,PP%,~ p,, @H0 0@(KoPpp `, Ppp ,@0P0, `PP -Lp 3 0 @3?P`0@@\ i <0-@ PLP @0@0D@H0L@0А 40- PL{P@ @0@0D@0ѐ -@1_`@2?`p0@?L@0D@*  08PP0?PPP( 8 @0 0@ 03? 0 R  : oPP8 `PP8 ~0P0PP@ `v -Lp 3 0 @3?P`0@0\ i -L` 0   RpP @0 Prp00@B Up000@-pS`P@0 0s0s0 r   00 p0000  " @Tp@-`RPp@0 0s0s0 r   00 p0000  @Tp0@-PQ0@ PUr r0 0s00 0@ 0 0p@-`RPp 0!0S@0  "@  80#440# @># b1#  0^ p  0-@PLX 0#40 "( 00  0#40 "( 000Ґ0 -84 0<00 0( $ ,   - @Lza02  -LM,PK`pS ,[  V R03000[00K–\< ,[  T R03000[00K 0Q1 0Q11 P0#1@1!@T0#1z +K1 P0#1  R03000[x 0s00#0K  R03000[x 0s00#0K -pLP`@~Vz_1 P0#1`F aV@  Wb0`R1!~ M20VS  2𭝘1!P0#1z_ 9`h@ t -L@M`\PKp@!@0\0#0@@T  K @R-L@M@P`${p  01\PK@!@060#0@@T` kZKpA -L@M`\PKp@\ @0\0#0@@T  ~,Ku @R-L@M@P`$\p f00\PK@ @060#0@@T LK\pu@ -L@M`\PKpG@eX d@0\0#0@@Th  ,K @R-L@M@P`$MXp 00\PK@/ .@060#0@@T2 KXp@ -L8MQ@\ ` 0K`0  `@D0E @X T  D@ H `0S< XKD@L0 P@ 0K @K@:?pP9@0K  `p#$P 8K@p < \@K@ KD@K 0KP8KP@ PP L` `VL` `XPK`0@@PU`P`XP T` H``FvH` @K50K =P(KҐ!! -L,MP T0  P0< L !<$T <H D @ P Z @0 0S<@0 8K(KT 8K~  0KzL8K8 Ky@D0?pH P280K  `p#$ 8KT8p 4 a 0K ]HK0@ H D Ґ0p@-r `Pr .`@ 0" 0 @ . .0 0  .pҐ 0-L0 10P   0@,00@0l -LM Y300 R.* 0 01,  s@#X`p  0$0#s@ `V  %ppP ,0 $p ,0S* l 4-L@VhG-DMQ@P8<04(, $u 0  0 "<46(`pɃ.808000#@$ ! (0 @0 0@ p,p(``p` pp 8*ǃ$ ` 0! "0#@$0 @@Z0 @00@DЍ -L 0pP# `$P`f# $ -LM@ , (0 0 (' ,0Kll 0#@$d0@\0\@P'`(,0KL `0#@$0 @ V0(0$Kegylarensetybdetmodnuespemosarod -p (0L0@P c=(0'00@`)P(P``0!@"# $0P!,`"I  -@L  -L@pT(0P0(0 iT: `  eP@hT `  @D XTPT  o  -L0MH@K`pPT 0 ~K -L,MH D `L0 (=@ LPH P\ \PL=PG 0: S t0D 0 ?Sʲ LpWHK ?Z>@,P< ?pO>UL20 Rࠡ02 0 P^W L#0Sࠣ0 PW(KL@p10P80 0: SxDQ0X0S<0 @p0O0 , 0, qTp P p<0'' ȟO@ P00P0 T K <@/0@Y80 4@ lb @p,0O0 p"X^8W[80< @ 0 @0 L@0t t0Dp 0 ?SʎHR0T R80HRI< @0 @@,,0 0 u@ 0@ 0 0 j10P. H<1< 0 .,0 0 TX -LM,  9/0P`,0S,@p,Q@T@a0 9/p0 P`(K0S,p;@,0S@S0 9/@p0P` G-MP$`Q0l0h 0Q0 1>0   @$T  p00 Rpp 1Tx?>   c0 i  0S0W d@JT 00` 1^Q?>   c0p@ C  0`0CW^ Bb 0  R 01Q0110`1X100a1 $Œ\ !  0S 02S\0 P3Ѝ1>0   q  R 0101 -L$MH L  p ?<`0OO^P`1>PL 00B"aeQH LL08`0?pH>   c 0㠢2!s0F PL0` l2RH LL8`0? !> c 00POP>p@` Q 804 \0 0S. 04  0 S ^,@ 0O QD  RH  0g|h ?(KLH,0p S0QK 0H 0 ghU X$ӐHӐ(ב@ב֑ ב -LXMpD@ 5 RD @ 4 `0040 0@@DP(0PpǏtP DPt8@ ?@d_;D< 8 <@`8P a4!, QU1U.Q4^P1D 80@Q< 8 @ D0DP @ ?  <@. _@P @ P;8 Q @< ( D@<8`04 cQ PQC` 0:@0 d3R D2@, 0PŜ00 P0 0^= 0);D 0O L0 H@ 0;DPL K @_`p 0P* ᖄ@_ p@ lP :DL K `F,P:DppP l0 .?:P00C0@2 RT@T0,0!00C0D@00@P <K 0(KD ɯ 0t :@ `P D0O  d  %h D0h@| x d < /X T  ?@0XK0@x `0 \@  x |K 0O R" /d@ hP9,`pK@popD @0@P%0 X 00 , 0 P CQ/d0 hP9,XpK@<PU T -LM0 @00_Bd @P R b04Q RPQB K }@P  <D 0S 3SK U -LMP 0 ,0Re~8  P, ? |!DpPo0P`]8T1 R?\00Q`0@S6* 1R?\00&0 P000 `T 0@5 ;L# 0@4D0 :   S  ,(K 0le=S XZf  B ?>L0S@3C " B " 0GflU בב`ב -L\M` p0S]`/0@0T8Z0LOPo P` 0OVʶ <4 S?590 @ `40 P8 4(DP 0S>6p\<@<`0?0 0P@`WPo<4$  $ 4 DL0@4 D d6 HP/<`0 800c@ QD0P 0^<@ 6`  QX"<<@_ `00P"008(KoUF`  0dZev `@ 0tdlş0p `e(K< <@$80`$8D TLÙ@TP D T  n < 0S1P1@\?\0 0 010 0@ 00L40 00 ^$00C00 ,Ե0 08  [UW1> 00@ 0000?L000 #40 000800 DbclU Xڑؑؑؑ -L$M@ D A`PP0S(K@D P, D 0 $Řh0 R 0S0S\0CQ B0S P3,02SQ0ɯ 0< 8 5D ɯ P 80<D pQ7'<0 ɯO/`< K 6`00 c Sl`0QQQ /0O^ Pp0 `40 14> PAO>@ L H LPK` P`PU`0P 0S@4  0R  0P  PU 00 c0`0D nVp 0@_@, 0T P3b Q800cOvU80pV,巴 %l ّ -L0ML `H T P0 L3P0 R00S  L PD D\U #000S T08UZO 04 R40 p F0SFpW\ T K D]@ < 8 Z??5 `p0 , 0 K 1> 0`# 8p^ 2Rψ0K0O` 0@1 >00SIJ 0@ <0 TZ p T K p:Q8 4 }Z8PK` 1ψR` 1> 0 #0P @` ^$ Po j$ 4 DHL0S@4 D  j 40Z0C40  j! 4004008@K0L DB@@ 0A R!4Ʊ @ < S@ < @K(K80, bYm \^ 1/X`0 0O0@1>0 R!00 \ c! 400C40 i! 40040T0@Tà Y3 1>0 10  $0@0C$0 $0L80  $ 00C \ 0  0 R 0O0` @1 >004²00 c! 400C400 a! 400C40lU -LM ,  @_ 0/3 08 )34  ?n0 03, `p 184@8 0 @ ,P\ 0T AB4CQLUPB!A0 00, S000 ĘT@!V4 < 尤x<0PQ`0041P`1`#Z ,1V`!@V`YL#20T 0U00 RH3 VHY@0SJL#20T 0U 00 RH3 Vt\AZ@0YLØ2 08@ T@!@`02 08 \YYPL20 80S@@2 08` BVPZ,(K004`.1~,@ 1, TPL#2, P\08`V04`V PT PL#^08@T04`V P P  -LMP0p40 00 `@$4 g1P @ 0^c^p(K XO ,0P>* 00 ,0 0 X= H#0S0C0h0 K yP 4 (0 0pP+0d0Q5h@T'dp@l0S 0l0@l0SEl@l00S0l0 00 ,0 H#0S00~ R_0 DP]0hp0 0$] ^cӐّ8ّؑ8xّ@ّ`ّ -LM d $5S- @ 0/d` 0 f pVt x0l@02 SSQ K @ P u1PW K  t@x4\ \e1\ (K R4KKx0KPK0@0@ 8KPo 0KP4 R@0@K0(00 0K80S` 2 K Qhʼ /Ÿ ?p_ R1@P` OP` R0  RP80@P0(0Sn A0S] ,aZ0S[ 0Y R%@ ad0 @` PPtx0>S SQ00nd0P c 0S7Qxd "t 80Op ZZ0K00 n;P' Z @0(0SF ,央C"0K@,K00#P,0 D0@_0 Z,;0勮0500D00 c0@000 R0,,QH x4@d03t0,4,,0<,0, D,00Q4 K @ Fx0S 4,H ,0<,0, 0D,00^0/R 0DS[@ \8@ ,0[[<0SDO@$ .0 '/ 4S P00x4SPs84SYUHPFtT@4K0c\D_ r8@0 <0@ [8[4SQ:N$ڑcӐ?@ڑdڑڑ8ؑڑّڑ M-LM0@0 00SR  0S `Ù< n^D? ^@t:Q\QÙc*d tN0@d P.0@0S@TR 0 /0 , @P<4 S94 M-  Q`p2ڰ0h h (K#3 -P @ 0([Z@84 S ?g.SP0K0?cӐڑ8ؑڑ -LM P@8%0  ,= Rh10  P 4R00 0a QUUQY00 @0@@ P  b PR0b1rl1eQWUY90YQڜpK4K 0P  40! 0C40 X`V 0  LK0  ` 00,KuP ,0@D 4 !T@_N R   ,(KW-ʣ 00@@U0 @ B>LET2S85@%0L00@T  T R ( 0@<0K @000@ 0 @_0PP P0@ c# 0S4!#Q P030 :@!<0  \(000  卬X,Np֪p @0a0C @E/  V0 X 10( R" 0P 0 @ 00@ @ bb R3a@`QVRpl ^< 00 %P O 啪K00P @ @ bb R3a `Q\RH:D 0`( 0<0K 0 @@@_0PP % P @00 @@) 00V4`d 80< b201 R2Qx0<0d 2t0!<0 (0000S*@5L 0` U 85@@0L 0P@T \ 00 婮P  04@,L@KTQn 0( E0T@# *00P@/00\@^00 T|0 ()@0 @`<0K0 0 0O0 @ 0@P <@K0KL@ 00厭, d0 c# 0S4!#Qx d03t0, D4,08,aP H K !X X@@0 00vU VX( 00@ @P 0@<0K0 @_0PP 4 7 04Dd @08@)D/00h00dh0@   p  ^Ve2(KP,K00tEۭPV, l0D !8 ,NC P  000K @P7 000X00 0 d0 c# 0S4!#Qx d03t0 (0OL@K` HK` ,偪,~ _00D40080@ WOڑڑ-  M-LdMh p l h0P  ` H `0@t 0H@ Hp0SH \H@  ?*P L `ph0@0 pKDD@ ~d ,0}$$h000(80d 0 @(, 80<@, 400)Q, d0tx *d嘧@Pd D|8 `0 0`pd@\ D0 nPt0Q 8100`0t R(0$ @d< \p8p p0K`0 @tX0 T@ H0`@XpK/OpWXp T LR! @ 0Q  ã?  8 AT\ Rz  p@<@(KP Q81H0@ ?@@ 4 00 Q0 p ?Wx t0 `@tpxd0,K cS S8RCQQpA0hXK P@<,0@ P< `@xKh00@pDp@p XK4pK`F0OLX T TJʒP Sq < \ Ikd*@<@ d P L dŧp Pd@,0;,0帧`0_Hpd  l\ \4^ ?XQL), KH0 PXKh@<,0@ P< VrVOhkۑ R-LM( $! `P+0AQS+(!@0T" Q%(0( ?S= Qh0S (0@ 0 @ 0  P(K$1UP PPJK ᐊ @0DP<0@@,00@408@@0$qW@ P pl JKy85(A01 0J_K`P `0JKP P 0O`0@0@3r b RTQT2  1 .K  0! 1 H D t p@_P`PO@P <` KPU`Ġ 8P 4` 1!H0KX0 ORp0t@AqN 0@`^ p1@K(0 Q OQ0(0(\45$S0:+ JK0``0@0,0K0 ` 0PPR0JK  ,0 00 P;05(S*P5,8JK0`pp@,0K P@00PP($ 0d0 " A `iPP@ 0 A#O 1#  )1 ?p 0 P% JA`-8pP P P 00 /1>0 A! `gPP@0A#O 1"1?0P HA`p-8PP`# P P 0 r3p/1>0 AR! "@e00 @0A#O 1#"1?0 @0 P`% -LM 80 4 P0 l1\ \RXlX^QVp00 < #4 0 004,K 000倧PP8 ,0R44,,85D 0 80 (K, 00 @@<,^3 . R Q485@ 0L 0 U///// -LQXۑ\%P0R /0 R40Rh0 S8P0!R/TcXC-0 LS03Q% 5p00P5,5MS ڬ4S9Ӭ4հ4S@0Ӱ4Ѝ0t0O/Rs QE.1EPo,`SH@P ``P`P`,L` `0` `@0/@P@ PP`O@D%0U4e85X< 8P 0` 4 @( X0<0 8P 0` 4 < KƸ<@$0#= ,K ,0P@S ~ 0 0P@@ =S  P@(K MwN눎Xڑۑ p-L0@SPd 0D0S  `P p0   P;p -LM, `20\%R64d 00  8@c_Úd t(`p`p<@D_@,D!`Vp ` p, , 0C@$0(@[`4P8`,P0`͸ NTۑ -L$0P p`  9@P`@0 S` SV@ &@P  (0 5 @ -LM`b$0p ,PUMT500#0DPP00U  R@ $KPH @T0 @ 0@@ع 0 QAP吼 Lzh v r$0`B:$0 R-L, T\:/弢P ,6 DP\%R  VWL T0@@,P X < X0R8 X L0S~ h L T`Bs L -5@0R5 <0ST$0 KL5<s00!@ P L O  L hL04\%R0L 0L,0h Dh0 S, ,0;,0,庝L ,@ L 00 0 m0=S50< 4@ @b0 @ $5S,01@0D @D PL#680D00D0 ,0Dy,凝0,@ @80 P%@00 \ i400p Po00HL$d0P` l, @\5.\$Q @PD 0 L-90 $Q,0DSP 0$D00 ,0STL`H  00S 0S0T 0 T0@000$ T(*($ LH0 t0$000Ld ( 080@,0@T0T  |<0S0HC0 ,0 H00@u/ETu/0L0S^`P`000 S:O4/ 0@ P'# PQ] 0 #0 0000 T$00005L;PEJ<L 05S004%T80@P0 00 L0 H}ՐTۑۑ -L,M@$0H ,@ L (K`2 YL0H  @@婷L  X`2, K 0D0 D:o //K@P$Pf,@D`PcD0DP#L3P#L3h DFDh0 S, ,0;,0,MD(5`(0D/ D,L  D 40@D0L#P@ 380Pp ,0 D,(D@80pQ"P@0D\D4 0g0`H4LDd/ ` 0P1,,K#Q0 吠P ,iJD 5D0$%R,0DSPD0$% D,0SL0H80 D0 0< K4 <0 0 ޴C H08ܑ -L$Mp@T*$K AP@ 0 ڶPXd, @ @^0O 4 0 4 4 $"0@<0 8@ @_@P< K @@P1x=``( Kd00 l  \,1. Q@P (xZ0,x(0, D  W,0  (aC=JLܑ -LJM`L QKh pP/$M5%0S& K `@0Ss0H1  P5$ FU$0eH1S $0nDP ܐK Z 0|PP6 (K 0$00(!$00$0%E  K$03H $0P I$0$ܐKD Z 0LPP=S3$0 KZ 0:,p @0,00C0 0K(P 00副PPp0SP3 (4 PP   H! PP=S$0 `H5   (1PP , H! HoT  0 #40SPmP $0 LMM0(!! PU$08P1 p 0S T T 0SPĹUBO@Z KYOZ Z  Z QKh  > 0,L\& $ # Hp0 S6 \YH! $ 550055  T-K_PP K Z <  0(!  P "UW HPP@Z PB_>PLZ Z P5YOKZ PZ , Z  FPP 5H00#0 @`ܑۑۑ D1-LM8A8!00hqɺPP1aºPP GP  K,PP  PP 0   B 姺 /n 0u/P 0 00 `2@,  , 刺C'O(ܑܑܑ,p p-L@dP`PQ @@d`p@ -LMp0S| 0HS0D ,0 `RK ,06,0 RD@T AᔘDP`U@7 , 1P0S,0O X p0S0S 0S ,0 p10S  3/P,07,04Ꭰ,06,0,0S0S᪚P XD 0S' 0 ᮳/P0D R` ,0S0C,0 pGT00S~ $0{ wd Q0kܑܑ -LHM` `` X \  D d0\d0 P \P P P |~GT05S*P(KDQ X@0d0U 0T0  45 S: \XD 00K3PPdD X0 8 H \4 @ < LP D d\0L { 0j7Z ZSXj\XRQ|VtT0,0X 8D @aP T @ PP]8^WTP0 0SN3 Rx d ,$ S0t03U0Sd000X\ XT p850 0c Y !YP0 HHT0`d PH H 00H0,K0 0PPdX 0  R:0S*,`,啙,0 DP0" Ud T0@P 00@pb b R3a`QVRtUrT85@0L 0l,X @0(D d0X 00 @d 1d 0S-X0@0X04 Q`  0S 0S d0 0;0X Q U D0-X00X00\l L RX0@0S PX4 Q8 R d0X0P 0S P`d@K @80@X40l@Q  X Fݑܑ -L$M@ 8 d < <0 040 45R@(K 8`P@ 8, @Tp <04| 00@@\ 3.,D\KG ,K@ 0勛@Th<$P(`,80 0cZS_ 0 D 8 n @PU,80,@ @T; <`80P`ppWXHP D` +4`850000 P c `1P P^R\QZ!R` ?SHP<$0  S(0S,K@ 0@@ @@P(0$  <<000sW@R,P @P(0$   <`0<00\4P 05R[@U -LM(D @ P`œ0< 0@ DPK`?O# $Q R<` @@$0PPQ0@ ,P ʅ `0@K00p@TPW0@ ,P ZP8P @\D K X8P0O0 K 80 S0c0 jD@Xd 4 <0$@P 0%`p 0K0 8@0@8@ c00T4PP4P 0Oʓ,0@ DXP@  R\ 4  $ 0@K0@TP7"0@ ,P 0pW`P8P  (K Qp0@VPwP`p8P V{@PY`4` D0Ky -LxM @ (T 0 ` dP@   0004N@ UlPKT,@K 0@P npW,p m 0 pG10WX ,p 0Ot0 p@ M P 9T Z v00 400,0  @D,pW  1@_t@ pP @  PU 0ȟ$ 0 S @0G@S,0 @ t@pP@@0 fPZ 1Ppt(0 cS S0RCQQ@P0(K @ ((0P0/S ^  Q| x  P  R|0@! (0,(0P`p` p0d|! V0^ 00,( (` pP|K@P| x WR} PRx0 ,0 0Qo00Ri Uf D 0,0 0P\ @P0P@$ 0 SN0p@tP( , b2 R512Qx0t0p( Ɍ,"t (08P0`@ (0,@8< T h000u@P j@ F UZ010@=hkO -L M P0d  000S P K R/0 /0S  00<0/40 - L00h菼 0-L8M@PK@D H d D0K@BH0K @<  0 01K0 -hp`@LP R R 0S0S 00<0 R 0P0Pp0 -Lhq`@P 0S0SP 2PPO 0-LP@P 0S0S00 0-Ld@P0 K 0P 000  -LMd@ R 0S` P 0Sჲ0S `0 0( $0P 00 00( ᰀ000`  s -L@MH 0L YDDpKP`1hAL,K 0 @`CP+,0S(\% P 0( (Q  R0.SR 0.SH0P 0@P`Y X0P(KXO -L8M0P( @> P@; (p@ K\09@Pha0 `p@P ((0( R-0[.0[S!"[0R4 0R R ( 4(0K(@ @P ( T (Q l$K@@(@O..ݑ -L(0(\;; 0P 0LS L tPUc 0 00h X0 `  -P p';;H 8 06D 048   00K& (@ @PHQ U@ 000jU> < 02PD  ;;StP@0dt00S (0 00KPD 0 o <\k p0\h 0d0 p\c H D d2@P0 04 0S*0"( (0S0000000@0 @   <  0PD 0S D  (0 00KPD @@H00 S 0;0 8 D)060 8 P'0D@ 60 ኦ@00H0@@S H8  060x w@Ps8  @P060K 0ȫD@ fxP `dL 0R L td;;Sd@PPD 0et t0ݑnݑ///////-//// -LM0K@P00 p-LM`0KP @P00d00 Rm@F@pl 0R, -L0S00?,c 0-L`PT @ӦP 0 40 000Dd d0Q  0S/ 000//E//00CSG؉ىى؉ىى4؉4؉ى4؉؉ى؉ىL؉؉L؉؉l؉ى4؉ 00 /(04 / ;0(00  @00 :0 800 00 00 1s s s /40<0@l00l /0<0 0<0а@l R0l0/ 0S00/0-@Q@0d0 08@0@TP0 @$P @0/00 000! 001@Q@- 0@ 0$@/!00100000@Q 0 S /1 91/  -LMd@P0Y0 ,0KpP 3 G(K,0 d`t0t 0p0pP 2 0 ,+ )  pP000,1*P",0  0 ,0pPMOK l , 0ppP0 " ,00|2 000, ,t P P 0;02n -L MpPd`0 0"&1S0:S*0 (孫@P d0 d00 d0(PḪ@0(KS000 \0(@ \0`@ 00\` P KS-L 0-L MPd @0d0鴝K00d   0d   -LMP`0d0CSHtl0S q$ pT0 @ 0 Kp0S@t0@pPt0sx0s4D?t8prlPp@Ὃ,0 @90 0坺 @0H@0Pe DQS  RX <1 T! TL1S ,¤aPH @P%0 | ,K z@P(,dPH M dL L^H LH 0RP0Rk 50 0Q, P00R00SP0S \PP 0 0 0\!P 0@! D 0DQT X < 0 .R 0㍻@HP 0RT!R H14 R@H000  0 00@P H  B 00C0   P!L0S H 0 L 0: S XQ@P1D 0#6 LH@PX!R' <1SH  B L00C0  B 000L 0@L, Pd @P@Pl mݣ,l f, գ00 0 0= 0K ᒘ@P@0^j dPPd`Uj X!Rel FV ᴣU 0尣' 0غ @ 0a 0Q L1 wL0S]B@` c4p0Qn L p0Q@RbNOK P 0@P TQC H!00C0 H B H0 001l \V4XP Q4T1S 0P0 ➩  80 0P, ```VP(Kf4   40 ,80 P;P   0 ,80`P %P  4800P, P -L$M`p @ PZg ^ 3: @f p@ P`K 0-@ MLP  0 @' 0 @' 0 @'pp 0 @'X 0L @'@@0*080 K0Dޑߑt ߑߑ$ߑȡՐ -L !Q 1S 01 0AS 10 ! 10A0 ..hߑߑ -L !Q0.ߑ p-`L 0!P"\  QP P 0  `p Q0S  0000 00`p- --ߑߑ -L@`$0 0b<@#6 SpT𭝨Q0@ PP P VT\P0!PR00R0S0 !P ?\<@ -LP@!ƌ0C  0S0 !h- -L`@VP`PVp$ 0SPP 00 0A S 10  ! 1 A 00CS0 UX01SZP `FzU 0-@Lb P0 0 0R000 0 p-"fL@P  00b0fS 0S 000  p--Dh -LM@p, ,P'0, Q@TO 0S64`V3(04 0  !( ( ! 0,` ,P(K 9 0 B  a  !( A( ! U=,00,0 &`P  0Y>PG, , R-PL@c"pP`* $F%6`@00 @  b10QeP@  00!< R$0$ (0p($$` b-@L I 0@sb Bh $ 0-L0@0$ R(0(0(0  R 0 P 0S P 0PS0!P 0S 0CS0Q0PS0000h, T1-LXM`@PTpF pTK0K‐K( 0@ , (0$Q\ $ \0K((0$0^X0 $ ^0 !0SU000 0R0p P ^0\Q@,0(0,0\QX0(00P0X W0S(Kn ,0-L8P M@0 0P@$K0h  -L$MpQ@H L  `D@ Չ1P< P 0SC@WeQ0 0a00P 00< @00WTa 0S0C0@0 DP @0 DP T\LPpWAD!1P 08 0P 4 ,0 @W1 0SPQC0WdP00 `00R04P4 0080P0  'JD 0S U0000PRH @W(K@Q Q0,,00000DP 0@0 ++ -pLAQ@`P Q RU 0S  0Bs𨝈U  0h<0 00RUh 0h+ -P0000L00 0@Sp` 0Cs𨝈  0h 0h  0Sa 0 -L M!Ơ$0 @p<0b # X 00Cs 0X5X(K  0@ 0`"0Cs@aQeb P(T   bX b 0@P b K0 0 0As Ye`\100 !1 0 00 0!0c0,0 K P4 !B,0  P!44 40 4T P !# o @YbP10  1` 0b 0Eseb g i 0I  i0B  ꫪ -L@\`P@z 0Ss X$p P@P0e#viŸ0 p b10Qe P 00@P0Sq W 0 <00!  R 000 00 000W 0  c!00CS0? 00Cs2D0`0 D0< @@ R$0(0$ @( $@l< P@D00D0S $@0l#6S<"(0x#8\': WZ: 0$  c<"&0000D  D 00C0o 4# $@o  #$@@-^ 4@T 0S (00  !( ( !D4 -@LPkS00 p-PL  `P@ZS`0  !( ( !Yl9p 0-L@PT 40S 0S 40 0C 400ht @P0Sh p00Cp0(0 0  !(  ( !03#;X -LXP 0 0-@LP MLD 0P@!(0 QAK0hHX 0s0 0/ Ap-L00@_1 ` P 0S P 0S 0SpPRpP  P 0S00`@ Pp 0Sp-(븦P֐ M-L MD @ < 0 1 <@0@S[0D0H0 S0@ #2AN@4@ 0 H8 < 8@0aV5  Y, ,t 0S(s X] 4@T` pQ10@P0SPVR  B00 U@0S RP000 ,`V80H@0S80 Z!p00jp0(KOW0`pD0OWVDQ<0PPR0OWVZp p00jp0YD4@T0P pVX4@R긦X p-L0P@ R,`p0@S0a!p R P 0U10`P V000V000C0S R000  p&='븦l -L@P Q M-LM0 0`0 , P 0pO# @  Z (KY 3p PP (0 @ 00CS,,,,|,, 0SC40S0Q7 &0 , !( (, ! 0C*0pW0pO  &0pK#*0@Zp|%0O#Y40S0QC !g-9 -`ȟMLVF &(*0&Z W0  pV(K -L 0`s0CS 0 R$0$0$0 3@T (4 0  !!( 0 (  !!`!0@T @R&R00R @P P!p00Cp0 0Rc #i !80XpQU @T 10@P PH Tp00Cp0@0TPpWDXv 0-L MXPU@@DDT 0P, ((0PK00c$0  -LMpA P #$0KcP   $0R`0@P@RP0S  L @!0 000P0 Rc  -LM@0A P #C2 S<#Sp c 0Kc`P  L2 S<#S PQ R000 R 0QL2  S<#SPc J 00`p -LMA   \̠#@B2 S<# Sp< c 0K`P   L2 S<#S PQ R000 R 0QL2  S<#SPc 00`pkp c p-`L@ 0PP p0S 0  0Sc `Pp@Q0@S> c p-PL@ 0`P p -U P00c P`p c -`LP 0hpP  V@ 901 P0 0S1000C0SH\000E@Tc p`p踦@Q0@Sھ -LP F& 0S\1 p @U    0@S/D P #c0*P@=  0@00`+ 0S5p00 x.@ R 0 $0p$0c P@ dTp`@0$,$($$$T4c DP8d -L M@ Y`p PD < 0  !( ( !DD @ Xp :@P`0s  0@P (0 0X   X< p<0DS@ @(K0 0%@S8 '08 P  095@P 0  !( A( !.!( &(  ! P 80 10 0@0Y`p4 4 P4 :@`p@T4 0R  &*G60 ,0 T 0PP (0"0  !!( 0 (  !!@TP 0PP0 P4PPh>@0 , !( (, !0|!@0  !( ( !@T0 00@S@ 70@ Q30  !( @( !fPt S@P @ QL(0 a0  !( ( !B5  LP @ 010 -`/ML&@!*$Kp 0K @ $p @ @@PP P   L 0 , !( I(, !  b3K -Lp1PUU `t)V @P'P@@P0W  X R`P0@P @`T. P`P^ 1@P  W00X0S \P^@DZ(`U `DP 00 0/M0Ѝ/ -LM<0 D00 @8  @0@(K80< 0R40 #404p# "B 0 8 0`P`"2P0#`0 e p,0 @ :@P`,0@X Y@| 04 0  \ : P L H0 PKrP  0PKh p0S Ɵ000%8@P4  4< D0#10#0#Xm 5h  Zş< 4`1 @01D0 40S    P08 0 Œ0LP  (00  !( C( ! 0CPK`4p h0R 7@0S} 0`.P W)W@ 400C400`0 !( 0&(  !,P0!!( 0&( !! , !(0 A0(0!!0p+PK 0P0K4(0 {40  !( ( !4c+PK!00L006@ ]4l 10 1O4Q6 P4*0  !( ( ! :4 <0L< bxP T PK0h{\"+(00  !( C( ! PK0C 0PKH5@*(0 0  !( ( ! !(08 000Y0T$T@Y Q-L`pP#*@JV  0.P T   ? @-6(@004@ 5@(80<@ 3@( 0$@ 1@(( (0,@0(6@P0T@/X, 0S00000 /cO -LM KLHH0 #Q*0Q*b"!B10bV,(1 -L@TPp`D0! R"Q )00CS aaaaaaP l l0R*QP 0l Q*QpP@TVX0 RUQ<0h<0`@T#X -@L<0<0 $0-@L*@0@1萱 X00-LMLL P@h*0LP @@7K0萱.  . Q/! ` -L΂n^P`Up(S N@{ PeGM,(0 hS  h4V.  . Q :/ -L(M@ .  ^P U< p#: (K  P e8 !fV @,K , 0S0R*@VX 0 9TP  @TF (18P  14@K0@ 4 0@ `&P)4Q @\ 00000 0J84Q|< e<@ bP 808"0$8  00ꬸV  R-@`PN`@L @ppO .0 "  @ 萱 0-LM R h ;KK 0' P0  l3.2 K :X, -L$MD @ Xa 0H#Y*qZp1H`00X80 N J$J>00>0Sp1x# Z00 W0~Sp8  Wz3X@3 8 ,0K @ P0d,S0!D <0 ` 4PK@` , 04@ 0P @- Z<0cX@ (Kꐱ>00   -L$M pDL 4 T4 K0 < 0SP h"h2QP8 \= \: L0`@,K< ,80, ` 0!P4@,PT 8 ,:,0 @T 0\ 8o,:,0 @T\4K,%(K-LM0`~0^@Pp0 0` `P @P 000T 0 ` 00 0P  K0 @PDB@##l4 p-LMP@ <||` 0h/  `0R0  bL@P 0K0 P 0`Kp묩cV# -P`pWL𭝘 @P4 (0 0  !!( 0 (  !!0 0@P`:P@`XW% 0  !( ( !Q&%  Pp00Cp0X -LMℑ,~(Kh!ph@P 00  00 P>41W, ,02 0cP`0  !!( 0 (  !!08 L:P@zG`W 0h %@Pp0xDt0h!R .W00S,(K, `෶,,  aEꬩ#O -L M0`SpP7 0SB0SS4KP40 0 %*@,Kh P T,.&R*<!0R*0a"!Bb 0 00  000 JU l 0 0S(K0@ 0`S00  ,$B0 0S V, 0Q-L@00S 3/D00D0@-@0\ P!P1Q\ 1 !Rp#p3` UQ030 "aS`^ Q0#02SQ#3U0#0 2S&P/ 0 S(0$ ,00\/1P/ S-L:`p$@0P b V @c V:E2 f@U>0e S 0SR F@"U0P@0F\2 lU" R!0e S9A U R0ST0l0U 0SS1:Q0P@U 00b S9R R0e SYD0S0e SI9@0S,  `0R 1P `0R 1/ -@PL`0P`@T 0Q-L@ 00S 3/D00D0h0@-D0DQ 0$ 0PT0ST0SH H0RL L0RP P0RX X0R 0 00R 040c@P4@PP80S@Q 0S@ R00S0 0-L@PP D0 0U:$0U#300< \00\0/ Q-&:0@2 DP 0Q:0Q440Q*<0Q:@0Q:HP 0 R 0Q:0Q4^80Q*XP0Q:0Q4 0 Q:<*$0(0@-P Q0#03 P 0S @@1 Q#3PQDQ 0T # 3P R0T # 3S RXQ T0#03P0S T0#03R0SHQ 0T # 3P R0T # 3S R\<0@T # 3P R0T#3S4P T # 3 Q 8RT0#03\0S 0<*-$0(,4 Q:80P34<0Q:@0P34 -LpPU/ 0S,`@T1 T R& @TP @0 0 R0 0` 0S0@  0S@@@`vP rPU 0 00p 0 0  R P< X? P@0T 0` @Q0S0P  0SPPP`CP ?0SP080S0p  0SppP@*P &0Pp0p 0 0 y0S@00S0p  0TppPP @p -Lp` R 0SPU 0SZ `0 0R 0S0S @TP R0 0@ T`@0S0P  0SPP`PP @@P Rk Q 0S R 0S 0R 00  S`00S0@  0S@@@`:R 0S0Q 0@ 0S0P  0SPPP@vP r@ 0R 00  S`0d0S0@  0S@@@`VP R R0 00 0@ T`@C0S0P  0SPP`P5P 1@v R 0S|0P 0@ P0S0P  0SPPP@P @ \ -LpPW8 @TD@0Sp`W`V p 0Spp U`P@ 0U@@ 0R@@V @@TX  p`W `Vp 0Spp` 0-PLP@! #3Q0 R  0 S R0P 0 Q@@00 0@0P/  S/P 0S0#03 P/ P 0S/0S/P/0S/0S/0S / 0-,LP@P'0 Q00R03SQ PD0$ T(0, 00\ H00SP 0T00 -pL@P` 0!S8@ T- P $ (0,0 0S*:@@P` $ 0S X:W WP D0P X0P sV@ 9P@ A0P @<* P 0S/0S/P/0S/0S/0S /P/Q00S/Q00S/ -@,L P0 3H 0-P@L0000hA p-`@LP005pph0/ -L0@hݶ0/l0/J -L0@PP (00(0`0pANPpP3U 0P0/⪶ M-LM04 40` P @xh 10 Sp!z3S0CD  f , K00K0 P, PFY`+,PU (0$ 0TI*,Q $ (0g 40R8T:<0R@T*P* 0@P@T :,bP,  ` P(K0g00T0@ , K00K0 PP  840`@y z7, ,P `00T* , U p-LM@0 (00(0pP`?!㏵P  0 00 @0 0 Y (00(0p א Q-L M8 <0 4 ,0Q:00R, ,(K 4 8 @Pa 0ZD0T I 0ZD0JA$Z(0, 00Q8P 0Z? , D0@0 0000 X <  l2 R $08PZ `1`!QP!U< @ O l@@P, pW) < 00CS(,,ddl,4 t, 4 m0,0 0,0 4 d40S0Q(0VZV X 0S00S @al00CS0$0 Z `1`!0 R <0 L0 D04p8Pl ^0l 0l0`0P@<` 0@@, P , P Z D0@0 0000 Xi$0Z `1`!Vꜱ( -L@`T0000U ЭD -L` PP@ qT p  fU $0R P@T,(0, 00,000  0@@ 00-L M@ PRP x 0S YPK0$0( ,0 0 $ (,@ @ Э\ 40-Lt @RAt>00 0-L\0P  P0hD0h<@00\ P1\P0CP10+@*X  0-0L M\0\0\ 0d R@P 0| @l 0dd @PH 0@d@$K0hc+@*$+ -ZL%ZMUp`f< , , < @p$0X,*@0(PS$d,P  << #D06 0 @P004 48 ,0S,   T  , oL(P$$ bP!  b0@ `h,408@0 dPtu00Le:[T$0 -0L1PU qa\@TP  P1\ 0P10\0T00000 P @P \P 0 p@Pd0. d0d0S00>00~ -LM@P`p # :#:S  0(  ćć  P  0o 0 R>0>0 1001 !:# -LM !Q 0R aR >0. R 0\  0UP  0-LMPP *"*R 0^* b^ >0^ 0\.0 H R @ (4d 6R0  0P 00`0S*#0X - L -LQ 0  (1` P00 P00S#-@ !Q 0R aR >0. R 0\ ^$$$0. R 0Q  0 0C-@ !Q 0R aR >0. R 0\  0 -LM0^    ʠ,ʠ\ 0R lR >0. R 0Q  0 -LM@ !Q 0R @aR >0. R 0T`V0TK p  0P $PK0@ $@ P @\  -LM 0 S0 , pP 0 _d`V[0`Q U > SR UP )YI>0^PUF  i:#:S?0Q<0S9 4Q6,  > r1p (!t0 6@Q X= 0H(1@ `,K 0 @ @T,000 R   BR ҃ 0U@(K 0@pW P sP @ 0 S0  @W @$@@ 0SS S@T@S``> 0 ] 0 @ SE ST0 P_0 @   0`0 p(1@ `,K0@@S0`0   (!t0 6@Q 0S@T @ iXʕW@^ 0K(!{@P0L 0S @ @ G j 0 C0R    0 0 1  ? -L,MH T H   JP $JT0D >0 Z< *2 P08 40 ^8 0ZP L 4 T TD8 0}P4 O4 PoP , KPw ,P. 0< R*L<0,$ QSf 0Rc:D0<Y!0000 . 0 0 0 R( Y0 Y0,P,  0<Q PH T8 LD8 哠L 44(KL -@ Y@  Y@ 0R0 ,0<  a P 0S0000S 0S,00 @4` @dP P00 PH T8  040 4  -LM@`0S0 pP (K 00Q, KfjPP00@0S 0 0K PP000, R 00CS 0,0,0 00@SP 0 0 00/p@-`@\( 0S% ^P) ^  R  R@ 00 R000 S0  0S \ 00p0@00 R \, R/  0^00 S 0  0S   0S0P@ 0 S@ @ 0 @0@000S 00S0@ 0^@ @ P@0@- R 0S ^ 0Sk 00R 0SI0SD \   R00  \0S0  0S    R( ^ 0Sm R 0S 0R00S 00 S0 0S    R000000 \0 S0  0S  R 0S@0T00 S @0  0 S  0R0 0S00 S0 0S    R0 R 0S @0T00 S @0P  0 S  P y -LpX5 PU?P0S `X`V 0S @W `RP 0WP P 0RPPV 00SZ   `X `V 0S ` P 0S/0S/P/0S/0S/ 0S / P 0S/ 0S/P/ 0S/0S/0S /P/Q0 0S/Q0 0S/0- @0 S0/ UTR p-L@PT `P`@ @T@p 0-L@PT P@ @T0 p-L@`TP@P  R0T 0@ PP P@p0@0@ @P/ -@LPP`p 0  !( ( !00C0, 0 0, U,0 `$p0,0P0  !( ( !000 -LTM@ < `Kw K 00-L @@$!( (P@@$!0pUh0p@-P 0U"F#``@ 0P !T01Rb`0^p谱, -Lr\R2$ RP@L0R P U3 @0Q  Q*60 0 0R0 4 R0B60  B0CR0 \4 `LV`@DPV 0 SP@!@P@ 0R:P U\ `LV`@DPVʹ|r60 0 R \ `LU`@DPV谱,Dp -LdP *P0  0 P0@ 0P 4X -LM, 0 4  0P8 <0 @  $2$$b>ȟX 0R #v @_<0@TPOTL垽(00\Qh!D0R A0R @  Th!D0R 0R `3 (0 0R0DA:#:S 440Z C$1P*VR, 4B !F @<00@ 80"&@!(Ko 0@ ?SʮR@0D0@T P0U ?@P 0QʚP(KSkhkXOq -LM4 Xp`V@r V40S  0SQ2 1C 4 000(K 40Ph 21C c 00 P; U, Y `FJ$&0RP08@@0D0H0L0: RYH 0  !( ( !0`VTY' 0, 002TA1C 4,00?4 (Ko974 @Pl 00.\(Ko* h g21C, c 백, H| -LM,aP0S  A* pW$ >0n`0gV@P0U,>0 N@ U $`KP% $J 㸬Uhh@0>0>0 0iU 븱 <*V,X -L−M™0 @0 ,  0 @@q^ p80 0b\0 "6!v21C!@cw `ᷓ0SG 0PcW@"#<:2TF1C! cU`` ƠTʌ0P08@0D0H0L0 R 0S0!% 0%0" 0%^  n2`1Cc 0S 0pePcUg 0, >0>00 00 >000h 0P00C $ (0 0, `\0T(XL(K,묩,5,X 0-L .!( (@.!U@-00S%(00A R$10 0  0  !( ( !@00C0(0 00 000000 R 000 0 !( ((  !  B R$0 0  X-(0 C RH 000 0  !( ( !00C000S(00  !( ( !00000  0 RX00000 < R$0 0 00 X 0-L(0P RD10 0  0  !( ( !00C0(00&,0   PP@0!!( 0(( !! 000T(00D000!!( 0 ( !!00  P PꬩX-000CS00h0d0 0000 !(07(0 ! 00C 0䬩X -L@ $0\ 0  !( ( !QA 0  !( ( !A000A -L$MPŸPLŸ`8 4 @0<0 @VPU /<0@PPOTFt 1@ ?S,) Z 0s ,0\(0\ʘ1!hD0QHP`0@K  0 @0 ,@ P,P @(KR1D0Q Po0RO 0@VU勹0@< 8 K VV 0  !( ( !h0 Q0  !( ( !SkXhkOq -LM0.`p,@K 0@ , (@ m,^% P 0 0  !( H( !@T000(0 @ 0@ ,P^$K謸 0-L( @4Pi U 0  !( ( !0  !( ( !U00C0, 0 , 0( 07QN ]Qb 000Ȍ00C000S 0  00C 0 R00ƌ0  !41(000(000#!0$ S0Q0 (0U PU 0  !( ( !0tPQǠt00 0  00C0(  Q,0 0  Xy` -QLP`pW1 T(0$A`VP @0Ds(0 0  !( ( !`VP0(0 !P0  !( ( ! S-LMP0K4 0P , D  .0 P.0@T2 6P` P `4 00000p  !( H( ! R000,0 0   040@T(K% P00-@HPL|0幼PE0 0d $ d0E@d孷0hּ $ -p0LSP`(0! R& @0!!( 0c ( !!0,`SP' \ \ X4 (0 u!(0 R0  !( ( !`P0S>G0 !( 0 (  !0(0  0  !   -LM`00 pP@, 0 \  0   , 0 .1Y0100&@D@ @ƾ,p(00 (K,10,1  0!!( 0 ( !!~0@ 0S, h p0S l0R` (P0  !( ( !000Ÿ Yn P_Q0@% (KY 10  00E @ (10(1~4P4@tK, , K00K @P00 P 4K4 P  @0  !  ! 0P' !ᴿ(@ 0! j@ V00 mc !ᕿC0P(@khkX -LMllslß1@_@TP0U10@@ 0dS $S1011a d0Sz P12d RP@D0 Up",0 lh0Q `2PU 0O Q ,R0iaX@@V0 W X@@VP ( p0S; ^  0PIT 7<1W0H<1 ! 㿾P 0  !( ( !`FPP40A4  !( ( !(  W{0 , !( ( !( `Fp0Q  ^ R `ecagNkhkX -LMqh1L0q``V  0s``V 0B`0d 剶0,0 V ,000 B6C0 P@|0` VH?,0, <@R87(DaOXؤ ĩh <-LM0#h1,D0$3 P3@8pWl 0 00, 0 6 BQ4 0"@ŸPo?CSD00D0W0 #0/Q R 0O0S@VOL 0K;WQ u@ ׵ ,0R0S̰W 0T00000 0R0000<00  ᴰ|޵d04P`嬵L1@8pW@ H1p孲18p0W1(00 ,@ 4PU 0a0c0K;W 0ȟ 0X@T@0@PoPU`Q x0D0Q Po0RO 0@V@U@P}OXĩVUUUhkk$ 00-LMx @hD0QP `@\=0L/LPD0@4;P0 ($0 QOĩh0P( /p@-`@\( 0S% ^P) ^  R  R@ 00 R000 S0  0S \ 00p0@00 R \, R/  0^00 S 0  0S   0S0P@ 0 S@ @ 0 @0@000S 00S0@ 0^@ @ P@0@- R 0S ^ 0Sk 00R 0SI0SD \   R00  \0S0  0S    R( ^ 0Sm R 0S 0R00S 00 S0 0S    R000000 \0 S0  0S  R 0S@0T00 S @0  0 S  0R0 0S00 S0 0S    R0 R 0S @0T00 S @0P  0 S  P y -LpX5 PU?P0S `X`V 0S @W `RP 0WP P 0RPPV 00SZ   `X `V 0S ` P 0S/0S/P/0S/0S/ 0S / P 0S/ 0S/P/ 0S/0S/0S /P/Q0 0S/Q0 0S/0@-P@\' 0S$ ^) ^  R  RA 00 R000 S0  0S \ 0000@00 R \- R /  0^00 S 0  0S   0S0P@ 0 S@ @0 @0@000S 00S0@ 0^@ @  @0@- R 0S ^ 0Sk 00R 0SI0SD \   R00  \0S0  0S    R( ^ 0Sm R 0S 0R00S 00 S0 0S    R000000 \0 S0  0S  R 0S@0T00 S @0  0 S  0R0 0S00 S0 0S    R0 R 0S @0T00 S @0P  0 S  P y -LpX5 PU?P0S `X`V 0S @W `RP 0WP P 0RPPV 00SZ   `X `V 0S ` P 0S/0S/P/0S/0S/ 0S / P 0S/ 0S/P/ 0S/0S/0S /P/Q0 0S/Q0 0S/p@-`@<\( @0S%<4 ^P) ^ @ R 4 R@ 80@04 R0<@0<08 S<0 < 40S48<<4\ 0@0p0@@0@0@ 8 R @\, 8 R/ 80^<@0<0 S@ 4<0 < 40S48<880S<<40P<@ <40 S4@8@ 0< 8@0@@0@0@40S<80<0S<0@ <40^4@8@< 4P@40@-4 R @0S8^ @0Sk< 0@0R @0SI0SD 4\  @ R0@08@ \<<04S<0 < 40S484<88 @ R( 4^ @0Sm8 R @0S @0R@040@@S<80<0 S<0 <40S4 8 < 4 R00@000@04@ \<<08S<0 < 40S488<4R @0S4@0T<@0<0 S@ 8@<0 < 40 S484<44 @0R@080@@S<40<0 S<0 <40S4 8 < 8 R08 R @0S8@0T<@0<0 S@ 4@<0P < 40 S488TP! @TV p80 #R 0Q:p '88 8 a800lS`1@P11TV@808 V0b#6P  Q,00000Q 0| SpW*`Yj# \ *q| 0S` ;Z P L<h/t0^ p|lKe|Q ꬸlO!Ce@  q-Lh@M t00t0 pH09LK pP00P00Sp00p0X00  -L M 0R d% @\0!@@@Y0P  0@<|.t 0l@1X#KhD0AP 0,X-4-`-h-<0@- 0S0 x06BQ0(0 a("@_400 #U" 0 x0T0 -LM0 p>0n`Q70 a@P($ R, p060>0. V @P b 0 K0 P  ah K fp 00f#&Bp 0S* 0p 0c#&p x P-0L R.  . hR[ 00 0/ -L4M0\   `PX Zj @<0t"0 0S_0S@@ \P  Z00ST K0R00n\  0 0TS0 B? @ġ00 KhP  @H` Dp < ,@ L 8 @@ 4 G 0SV (1@ XPKR`0@H V @ T00T00S` T\80 0C0 S V(K R@fX00\0S T0 ` q0ST AXT`Ph \kT Xh!S(1PKX R`O -LM= -L 0S0S\xpH0 `0@,PXW𩝘 M-LM 0  0 0V@` 0 | x t0 0 |Pt Uvx0KzpP` P 0  !!( 0 (  !!:@p Q P`|@TH 0x`KP,0 P  P" f ( f & D0P0!!( 0 ( !!( } R 0Qn :`@|p\b R 0S P0000$剙0S0  =0(K0T`p0@ `P@0T0 |@ 0K0@x0 t@ 0P |` c|t Q 00 (  0 S@@   0  !( ( !0#:3@`pQhj0!!( 0 ( !! 0 S x@K0 0@K0 pK, K00K @P0 , @T 0!!( 0 ( P!!T 0^I ,0TQ. (0n0  !( ( !.!(  (  !P    0Q0 0PP^P ,0TQ0 S  0T01 T9᎔~00  !( ( ! y( u0\0$x Q {@Txa0PZ xt00 0!!( 0 ( !!A f@xPT~h4 -LM`p0 @0U ` p KT0  0-LM@0/ 00H00 0 P0S P0000| 0S 0 Sj00    $Q(0(0(000 K0K0hۖ(0S $@T U0 0S3 0 0 R,0, 0@$@T@Ty,@T 01 P= 0S0  $Q(0(0( 0<0],@TKph/t44 0... -`PL0X p0W048@ 00 0h!P5h!UQO -LM  00 D"0 0S|  0SS 0 0 0  0S$0 $0(00(<0 P700 R< 1 Kh 0(!NP#pK | h0 P000p p0 <0S$0 $0(00(<0 3  ᣕ0 0P0(K ᗕ 3 0T  0h!#40   L0 K0 P,0p(P0` @u(T 8 0#40"!B 0SPu.OԱphd0  r.. -L M@R \IpP` 0 0!!( 0 ( !!0\p:@P`0s d^,  (0  X 0p\0 0RP P(K0 0P0\`p \:@`pPUY  U P, + (00  !!( 0 (  !!PU 00 , !( (, !0!P0 P^, PPPU ,K 0PPP,0 , !( @(, !u,00 ,(0 w,0  !( ( !W]Q00R 0S-LP P00S00S000PQ00R 0S-LP00P00S00 p-P@L` Pj00Pc` ap p-P@L` Pij0,0Pc` Hp -L(M PU`@w0S 0S0Sl0Sk 塡TH DK0EUS  P @Zvp`42@0TL0 O l0P ! P R ,0S00S40ST 000Z00S @0S p0:0 S=  iP @U (KZH\@0S V 3S<0S80S> ,<K iPW= R L2/sUp40S;80S89 0 Py 0@S.0S/+p 0P" R㲀 0S0s 0S! R 0SI  0 ȋP 0 1(K 0 000  0, X,  (Ko?s0 S 0  0P @0 ,00 ,⾃00S0S gsP ,M. -L0MP 0, S( "0S/`0Sp 0S 0S0sg ,0,pSe HKH`K@K,0K [@P `$K 0H(K0@ @`PH R d040,0 ,$[w0S00S40S6 @ 0P@P0`0S00S 40S80SQ& ([p@0@p@ R1`00S40s80S($0 p0h!OQ- 0`SQ R R \Q0S0 P0S0 P Q 0S 0S Q1\ /\ R 0S0S 00S0 /\ / 0 3  0 2P//0s /0s  /6/A0AS/ -@L-C  (m  $m  hm 0- LPYm  @Tm  OmC0000  0-LM@PKgT xK0hgT00  \a00 PQ K0 S K0א$ R-L@p`hR00Q fP/.00 S0 bS2QST -L0@S 0P P S T fPP P0P P PHא -@L@Pԑ -LMp@8PK`f0K0 80K7K\P d 000S 40S K蜟 0-L@PT@T Q 0S 6fP0 p-LM@00CS0 Kp?ɂPP JK:fKp`0(1KN/K'KTP R000 00  6 l2i -@LP 6 k 0-LM0@pT` @T 0 R BePPT000:PP0P04 86 lP70P0+ @00@P006 0MKeQ/K|PPh@0S 0  0 0 00p>$K6 kP1i p-P`L@ 6 k0PP700  PP@ p6 nkP -PLQ@p# 0S 0S QRl0S 6t0$0`P W 600_P1S ` 3/`Pt0$0~Pa0S A`P000 ݌ i -@L0M R00 0 0  Q 0@00|  BR|  008KzV00S 00S40S80S \ dP 0> K.0|8 100S<0SMא -L4MP `I0 `0S01@T$ p@T 0 R00 dPpWʘ@TW  R Q000 RuK <@P000 0J K.080@ bM -P00`QL0MSP, |6H0SvUSr HPPl,HpK&P-0S x |0S[Rn8 RUS H0S |0SNH|G@[T h0s ,@0@0@0s @0@0@ P, /d00d '0@0Y@@b,G0[S@0[S?0[0S[Q 6?s0Q (K9 P 7 R0,0 Y ,U  j (01 000) (0&1P00@0@&  `00 |0 0 00 00ႀeSBCeP d0 006SAZP d0 L,0@0@l0@0@] K.0| \0-0S S/ @Kh icP6 000`*0 K.0 9oKjc<9K$0p@pK@K唠K0 K$0C , K 0KP 0S0 0РР0KEcDğxK@K\KpKdK;c ğcpKpd@KdK6?Lp 5K @P   cP TCOK@c3( 0 d0K1 0K ! 1 0 儞P, t , KcP 0LS0 0083 d0KXP b ßpdKcKdK6?Lp 5K Ĝ@P   bP^  COK@bd0K1 0K1 t2( 0 ! 0 9P, ), K PB 0S0 00W1 R s1 R  K.0,80 a, #P0 H1 R 0 K.0X I᭛n᪛0 R  K.0,80 2 , KP 0S0 00aZ p0 RG C6?3K<0 RN  K.0,D80 AȶlMאhא)x)Xאp(` -LM`Sp@ i 9#QP 8Q Z*8T0CT*8T 0Tѿ-P 8Q 8QUW  ^DP(Kp8T h8TK 1CTJ 1CTE H8TZ s4T+ 0CT' 0T$ 0CT! 8TZ0CTo:X 7T0 7T 7T P1S  3/P70S-Pt7TY 0TX !h7R/PUPU  0P|P6T :60SQ 0S0S 00Sy 6T $0CT6T0CT*%0CT0CT*!1CTM1CT (6T ,6TP\6T 0TU Xq 0s %`V& $0s %`V 0s l@0@0@0s D@P0@0@$5T 9,0CT55T 8 0CTV 0T>0s P`!Q R@ 0A0@0s PaPU`V@ 0AP0@1P 4TH 0TD4T 0T@`2.`P3T 0T6`Px3T#0P0d0lP#@ T3PU*P KP`` pP4K K@KᬐK K 0P 000Y@0[d|0!s @0K x0 K@ KH0 D OP, f 0S,00, |00|0 2@P,!I@=`2 ?`P>APE,㦀P/0@P0@)0@0@(UPUPU10@P0@Q0@0@ R 6?s0R Rz 6R00tK, KQP0,0S岽P,\6?0liHMi iildiHNi4WiHeiHii "i %i i i>Ii i Qi lFiRi Si !i -R  SL NMR`1 \ l4Q 1CQ 1CQ - (K0  0Sn0Sk1SSg1SSc R`3X_ 1CX\ 1CX0I `P P@QK@`0SF0SCpKs_  r_K n_@T00   1FS0K0K@ \`1t +  pX`K1 L_XP80T@P40P@00L,0  XP T@ P L '_P  8@K-_0)H2X  XK "_`!pWHpWE 0SY H`K _HP80D@P40@@00<,0 XK HP D@ @ < ^Pt1X1 VOK^  ^( (RK^`!6 K_K`` ^|| ^ \`1 $1 "!K^T00   cK_K^( (^`!6 `F` ^ 00X墼F^pK`^  ^K ^2iiii  -LM`pV 83PU,P  0 , PUE 0S@T@T@T 0S,0S 0iSl PJk `2 R ,  P00^00Sd V0 0p,@ ,0S3 ,  0S9  0@hl*P hl* Z 0@hl+P hl+, 0 0@+P +,(K 0@*P *1@P ) 0@)P ) PZ,0,` ^RlʗRV ^0 0bSPRXWVU P yꜦ@< p-LMJOK`JL0XPK @HI ]0000#0Kpx)) -LM⨀K]8 u_pp@XKtPKDpK` p  K`K, `K_`K|K{`K0 Dp (KאHא -L1@S R lPpGP4 P2 GP 2PUU` 8]P  2]P U" U00 0  0 0 0  0000#0 UP#P P ]  ]P -LMPpPDa0S"$K,1@T T P0-@T3P0`0S 8 ᧺8 ᡺0S 0 @ P `p pP@ P`p区8`0S 8800 ်8 ڹȶt, -L`AM⨐K80 @,1 \, ^&6hrP?s00K 4 KyKK  0  Te K0[yKK00P 0KDXpK D 0 `0K_ KA0 , P  YP @P 6l0S0 000JK E\(a wKKGOK `PK0 P0U0`0[ 0 s   KJP (KKP 0 R ,!lܹ N/Y00 R 0,!ǹ אȶ`x 0-LMPl0 S *p0 S:6SK00CSMP' 6@T @T 0 R0 K0Dh0  78(KMPHא -@L$30000#0 Q-L@R  UMRp` K\[0SX .SV T 0 0 \F .\C ^D 0 a?R0as 0PK0KV]0[ K A [R A0B s0S  RNKG KvF []PKqFGE[0 0 < B06 ? 09[0 a 0 -LMP$;P T @0S1,{T@K;[\8@Kp@pK?K 6?3K`P3 40S: Zf@K?K ?3K͔@P 40S) h0  00CS0 2 Q 0|{h0 0h0$Kp2 QZ@f@pK?KXאhאN -LMp\Pq@U:T`WU 0U* 0S PUp00W00S 0 0eS1!@P00S` PP"J 000 0 000!0 0000! 0000 PU` @Z J0 000\`@Z 0p X W00Sy Q p< AH @ @y`X 1 1P00Sb v0&QA A0d@ PP"J 000 0 000!0 0000! 0000 PU` @Z J0 000\`@Z 0 v0&hVlF`FJ0P`ZZ v0&QAAp< dy`p0 }Rvpy0`v0&P @@p(Kv0&hVlF`FJ0P`Zv0&QA A0d@@!0KY`8?)@K00 0@⸠S@ S2 0 0000!0 00Q & Q 1#[2[[[00!0 000!000 `00S S 00S S00S 00S H EP P/Q2 0 /ሴ0S S/00S S/00/00S/ -L`QPp P P^0SRPNV @T 0S/o A3 AP1 YZW% P d0 0S &@X  000 0 V* 0S' A,2@P Y ZMuP GuP 0z03R0S0S\4 4X, V Q Q 66QA P d00S PÑ P00Up 46@P 4q ᬑA VXP P PU 嚑A @Y BPP AO d0 PA pF 1XPT0SiS@ -LMP @ @ K 0-LM@K$ @ PP  R d800S80S 0S0K03A p-P@`L0S S p0P P0?s@T ~tP V 6S p00S p0@0p -L@`pV00 R R 00S SW 0S PU P Ct P( 0?0V 00S R X ,t P V?0  R t P 6?0 -L(MPR ( `  5 @T3 0S0S0SM (K04`PDpKfW0 C0KD K@TL(L(pH0 <rP$K݉ pىpX $0 -L 廀p3شD :R-LPp`@ P00T0S PPS *P0S @ 0 0oPPPS T *PJT(P R(PP Q UPPP -LMP @`04! 8<3X K1͇U, 10SP K.0P80 PᙬKx  -LM0@W 8$H 2  , (K 0S `  H:XV @,: 0@ `P, |! !=0@@8DH@T GTb T TIW 2@0  @T[ 0@084HT TW 2@0( (, @T :TW  "  00@0@ ^ K.0@ 0 T \T1T:UTm W 2@0x x| ,&0@Pg !}T{0DSjwW " @00@@0D@ R|gW 2@0  U{XWN 2@00 04 BW 2@0H HL @TN,%0=P8  =/W 2@0h hl @T4'U@,H%0!P*  W 2@0P PT @TU%,$0P  >W 2@0` `d @TU ,l$0P  [2W 2@0X X\ @TU,#0P  r0W 2@0  $ @T T ^ K.0 K.0W 0DP@,#0pPy 1 0P p TUP 0A @AQ PP@QA@AA  D000( @PG F0 0 000f0C0(~0 p(0  8x 0@ 8$H+/ȶ(OX֑ -L4M`PG5 R UVppV  (Kd0 4Z D@KE0 <KC0KDKE k , #P 0S  W@P'pP ; > @@m0 0000 P #PP : RP 0P d0 0S L 0@H0 H `000H0:  H 00@@@ DH0 (DHv0@(0@@@@d0 L R H00 DH @ DL 0%"(PP m0P 0@H0 c Q:d 030 S H P0bS q:P0`@0DS:/.00S\@sDH 00b  0 000" 0St 0Sc 0SY 0Sd 0H(0Cs0?s00#$ 2 <2 0:P " 00@0@"P`00@0@"00@0@F `d$aV H00  L DH L@ D^ 00S0C 0 000S0C0000S0C00 00S0C 0 0 00SL   `Aja00SHPF 0SC 1 0( 0*m CP70@x/ Q-LM# @P`p, ( Hw@P 5", K  =wpf`0, K $K -`Lt@40!0c480!0c4< 0P 0c4D0 0c4C@@D0 00Q@0 00Q DCP@10 R h 00 S,H  0L0C#0 rPpPrP@ꫪl -L, 0PR*0L /T,  0S*4@pD`@` r@X4<0,0 H8@G00 Sj,l -LL(Q/0( ,S  3S001 001 R0P// Q-L M@P 03S`  KA0 ``0L/Sf`FXFXF4G4G4G4G4G4G4G4G4G4G4G4G4G4G4GF4G4G4G4G4G4G4G4G4G4G4G4G4G4G4G4G4G4G4G4G4G4G4G4GFF`EXFXF-`^` 0P Kie 0 Kie 0 Ki}ep0 pAf뀀0S` pP@y5\04 @PMf`|HM@x א/ܴ -L4M@PP` 1KQ<RIGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG\IGIIGGGGGGHGGGGGGGGI0Q:0K BV0[00[ 01PڦpQ: &0K/"[00SV&0[0(pQ:N0K( VH0[00Q:0K V0[00[ 01Pvt坟D p-PSLPKM0C`@0%T  @0QPp@p -LM"0K@ p3T!0[!0[00QQA@P00U00S ; 1` T ` `uU* 0 P@ -LM p0@b4?s0(` V `!3T(P 1T +T (KYP*0V':.0K ,0[S! -0[.@[ 01PZ3T0V:*0K o3T*@[)0[)0[0101PP<T000 -L(M@0P l 0(K0 /  )04Pllb 0 R 0 0( P @3T +T1 P =PP p3T0000aa 0V 3T TP00P0 @x2@P  (K<T<T +T+Tl0 3  l0 2  )0P0P0P0 @b 0(K48 <03?#:00 = )0PllL@K _@L0[SH S; ZB 0S> l0.  )0< PllT8@Ko  0PE (@P  00Q}l0 1  )0u0SlEK0[0S S $KK0[0S@ -L0P0@S ڀS S S 00@0@ 0S 1  T@P`0`p `p0 @ -LMPRp"@3 1:S: S UE*  hp  PbU @0SU30 PbU(KU(`V20 50K ?003?00 ^;SJ: 0U  R*Kt?2[ ?s001@P  H+00h &*0@0 @P0h @P,0@0 @P0h @P<,0@0 @P0h @P@ -LM`@p 0)S0(P 0 0Q( Q0%(":P*0@P  (K( ,0KP , 0R:0( ,0KqP , 0R0% *8Ҝ0 EP00@@X֑ 0-LtM40 ! 0S H/9I 0@,/9I0S @ ? > #=0@8HX " 0@.P`p0@ 'RP00`S, d.P`00@X0@ 2  X(K(P 00@X0@ 2   `p! 00@0@\a Q0ST @pTh 0Se0Sb0S_6a-P`00@X0@ 2  $ 6S ,10@#P (m,#= 0@l,8Hb\,'= 0@@,9IW0,8H 0@,8HL 0S$0S00@X0@m 2  $ cQ0SY \@ ^y ^ T 0ST Q0SS 6 \R ^[ ^ 6 \H \i ^? ^00S S $40@\f \z ^m ^} 3S$,KAP *P`00@X0@ "800@80<@"00@0 @ ,0?0S 0S0S0S@p㜀 0 (, $/r 0 `VA 0 (0BSc:(R 0S 00 (000S T # 0S 0S0s 0S0S 0s (P0  0 @R(P0T@ 2@  @D 8V X@V00S8 K,K 2 1C 0dȟ1 0 D8P` 0S @S,0 R(P`00@X0 @o 20 04 e0S0S 0S$0Sf >0b0S xg0S d0_D'> 0@$'pP0 0  {PP@ { -9p{ i9@O P-L@p` Pl d0P-\l$%30 0  l\"W A 20Qp :Q Q: 0X P 2P\ W4p20^p  p ^*`Q  Q 333:^*\0 ` 0 X p Q* ^ ^:P 4-L4M@pW`P(@ h5 8P7' 4p@ 0 0@ 0FSt܆-0(0 0SH$0S 0S@T5 n8@($KU R 0(0 U R4Kt24 0 Sr 3  U R,Kb2,0S0ǕU 0S`0S0S0S Q 0SPjXK$?2(@0 P0KO KT@ HK PKlP010X (0  4P\kU 6S_10(0 U 0S`0S0S0S Qk 0SPP70S8 @T@T U# &0S 1P R000 Q0K10PJ kNP 6S0A`NPP0(0 9ZNPP00S0?00S1 S7 @T@T &0S 1P00(0 <Pa 0(0 <P ( KP 0S0 00p00S6?000S SO 0-L M#A(0 0 Q, 쌌 Dl *$KPH 4PE 0P0a V(pW@V   91PpphP0PK``W@ ;oP PpP`D@K1pP`P `P`PpP 8PP d0SpdP`p(PK`P l0p0,PK`,0 P PP`P 0Pp0,PK`,0 )R0-L@ P\ Q@0@0S*@ P00\0S ?P 0 :RPPp0 @ 0PP@\ 0S @0@ 0 :RP@  R-L@p`HPP T V @  s0P; 㸼177 )R-L0M`P(P @  <@hp0 T P$KW ӻPT+R< 09R9 3R0R,R( .R *PT*R〠s 9R 3R0Rj.Rh +R *PW RRVW 0SO P᜻RRB1 R* R"R0B<SNȑȑȑȑȑȑȑȑȑȒȑȑȑȑȑȑȑȑȑȑȑȑȑȑȑȑȑȑȑȑP<(ȑxȑȑȑȑȑȑȑȑȑȑȑȑȑdȑȑȑȑȑ0B ( Q񟗯Ԕ\d4l0   ( v0P 0 (00W)R POl0#90(0 l0#:0(0 l080(0 l0#80(0 l0#;0(0 l0?(0 l0:0(0 l090(0 T)00S0(0 l0(0  00(0 (0 0(0 l040(0 l0;0(0 &RZP5 W 0S<0 B( <R< \\\\\\\\\\\\\\\\\\\\\\Ė\\\\\\\\ld8@\\\\\\\\\\\\\\\\\\dPZ l01l0(P 7 7PPl0l0Z l01l0(P77PPl0l0l01l0(P88PPl0l0l01l0(P88PPl0l0l01l0(P66PPl0l0\Pl0l0<< Pl0l0\Pl0l055 Pl0l0l0\55P Pl0l0l00/(K  PX? \Pl0l011 Pl0l0l0|\66P Pl0l0ul0q\88P Pl0l0jl0f\88P Pl0l0_3S[,0SX00SU40SR80SO5 R9 \I PH0 SPCAl0>\77P Pl0l07l03\66P Pl0l0,l0(\77P Pl0l0!#R RD R( *P>R=R;R <RP>R=Rx;R <R޺ 0P 0 0,@ 9P ,K0H @PPx#,0L@KS , -,000 庺 0 -㯺P @ !PR BPP#P<ȑ($RwRu #R R CP Rt R'Rdl0W0 0S 0 0'PWT ^0$K !0P Po@R7 1RhW7 0Sp0 @R! 0@1S SPdP@`^b8PP[W 0ST 00Q5R,7RF@RX 0R#0P 0 (005R+P*R 0BS$+W 0S+0P( P Pl0P00l0l00 0l0l0 00l0P\POא! (R-LPp( B(0qP @@0S1` ʹP  0 0 7P 000 0 0 0 -LM`@T㡹P P0 0@$K =00 03?0 , 0007϶P P X}pP ; 1Ꮈ7 0 P 0 0 000  ,0Pu@p r -LM@4 8 $4 @a@DX0000 (@iR@f4`垸@PP^ P  ぷ@PYl1(@ pp`, @ 4 ,0K:@PG400 s0l,0?s0Q#0,00   f$, "$ 0L0?s00#40 0㓺P!  R4 000,0)) , )<`00,08 Q ?@PP7@(Ki -LMPPK p  PKdK0 0 + +W? 0Q  `K !_`P `ʷ\ȷXƷPT÷0K0 ῷ^K R (K4Q  \K !=`P8Q  XK !3`P`Q  TK !)`P`\0Q S 0  X0 S@ 0@T0@ S 0@@TP00(@CT0:U `P``T R U7 00T  T0 <00`0S U& 0 0 `00`00`\0S U 0< 0 \00\00\X0S( U 0+ 0 X0X  XP P0SK`P ^@ 9+ " B/+  L'0S$ 0S!0S0S -`P0K0 0@  /P5 6d3 `PdPn0SB ʟX0 0@^KX0\@   Ws 80S<  y d^04*8  R00 0S 0:3?00##$#8 00sN 0@KP*0 xK0K*00K( ,0K 0 K0 ( 0\`P; AV4 00@0@,0S "P X00@X0\@P c &`PdP ?s00#4000 0S@T 0@@ 0P L0 0@L0P@ ,0S " P00@P0T@0 R 0S W 0S 1<1,0S S Q Q  4KRP0K 8@K@`Pt40 S 0 4 W h0S 0S ` R 1@K@01,00 <0K ! B9P`P#1  @01,6 0SX Sz 0S\ S% ,W l0 80S,20Sp  p S:0S RS: 0BP`00S S%40P,0@K-`P@ P0Si1<<1,P " 00@0@,6S0 0 @P0@P3` P3` X0 0 @X0\@ 00SB6  0$0  0 0,700S76 0T000,-d00@0P@K$J)@ @ ^=80S44Q,r 00S S00S S PS: 0$O h3P40 X0S  ,00 (40`P,0S "`0 0@`0d@P00U"`px0,0@Px0|@ 2p pt ,@ 0e`XPc 0V0 ŴP(`,0S 2 P(`h00@h0l@@T @T 0 R B(PT P 0S , 0S ,6Qh00SdᄴP01  00S@ @$4 000SW h0Sp  4 mVP p0P0@p0t@ 00S S~(V`U,0SZ " h00@h0l@O\0S3`0S0,000@ -LM@` 0pR :P" 0S*  @000g@P @P 0K⯹P  0R0% *TD0@P4  0 01 @X֑ -LMP4 `DP~ hPz 0pPr 㵴P 0@(0@ (0 0@0 BY0`00 W 0* B'Vq  '`0@ 040P0PPPPPPP '0S 00S P P20`K<2'40@@1P6*K2K0 @ 240 S & S S Y00 @r(K y'2  2B  !2 !` X'߲/(8א -L@T @T 0 R40S C R4 ,0  ,000 @T p-LX@0SpL`@ 00@TP @Tp T00-LL@MKP0`0 00P& 00@0 ( p-L@` 0?0P&P 00S 2D 00040p00040p -@Lp`0?0 / 00SP  &P 00S  0-LM@ `R0%P ::UF  0S g 00S0SB S1@0S 00S `V `V 0 R B?&PV 040S 00S0C 0 0 (0KԷP ( 0R0%P *(5$2@P $(60SN 0SK0SH0SE0SE  ?s0! C66P/x1 `V: `V7 0 Rp< B%P 00S0S+ 0S(0S%0S"X. 40S S0 4 0SY 00S6?s0 0#4 00SKx0t  %P6?s0 0#4 0P 0004X֑/Mbl0GS S S S /S 5S/ p-`@L(P%0V00@ 0`p D1-LMp0 W``, 01PU, PV,`U,$ W,0 Z:@,c%0 0 , C*0V(02200 @ &"P,`UW@ 00S @3@#,0(KM -LLMl p t l Rl` d p00`0 2X\  \ l R `@0Ph0 %*t R@   0Rs21C@ \0Z0\0 XlP t\ p0Q @3@# d"(K @$ @  PXl00x < d0(0h , 063d0sT \P`!Q R@<9 0A 0$@|040p =0 t`V& ph`pV wP0"`!Bs 0P:h0@0  p0 `0Vs21C@ Q0@ 0$@V K.0< D0@ 0$@pl@\{ ,0( pS/\/8 0)P2 S-`Lp@`PQPR00S`RU  i*P ` V V*` X  * `P00X00S U  `,` | )0 0-L R0P0;S000<S<00p0@T@T 6@ h0  dP Z@T0hZN0  {ZN -Lⴀ pXjZ0`V 2P@T 0>CS0`VD0$E D =0, #5#3 04NMb |0- LP8)0@ 0P0 0@  ,Š?0 % :,#3 000uMb P-L \  R @T 0 S *01 0 S00@ 0(\# PN -@PL_ 0SZ 0SP ` `1 RLT1` V 0SBP/ Qq 026 1`S0$ V0@ \ 1S 0 R  |Ӏ0Sh0`0p(@P0" ,彀$ ȶ(@x@@ -L‡x pWl1dsY`1P P0 @1TB? U(1\~ 1`^050305:000T @~ 0`^* ḽT0\ d0 s`pP h \0Q R USaQɌNMlM -LdMPHpK`j"@KV0 H0KGK?\P,  d0K l0H!0Cl0,d0  R00 R* V3(KV s[,@ VZ  DP @K@4"0p X0  ,0K ]P,Q <0S ",<0S Z 80 R V H0 R .0 K㌷Z80 0  ȶ -L0S0 0\#\ 0Sp0 0 ( "0 , "0 0 " 0 4 " \ 0PP 00S&0?s0S 0:YꀗLN -Lpᜠ@T0 `uQ0$00O0@(0@W0@ 0@$ (Wl -L8M@0`S$@ P P  $0D@ KT> (0$K [@P26~$P/ d0 , 001 1 Ba0  P 0002 K.0N0 ww 00S0 0 0 00S S<6K@4\ X0 ` 6?6KE B R m@0 @@0 P0 1 0 m @m 000 iȶ/H -LMPK$0 {0 S m@夥P d 00 @00S00 U( 0S @00 0 pp    0: l`K0`000 0PKGD0 UO0KP Kk0Kl K d@K <0SQ R 0 (S P ỲP H@K #K  0K0 (,K0PPj,H@K(`   x0(0     0 0S} S QX @?s0@#$0 @@"4K,"0Q0 K@@Z "P`00@0@"00@0@1@EP PPT$ Q(K1 <10.0KK- KJ; 1:2L1 RCP Q +P m@0 @@0 P0 1 0 m @H@Kvm 00S0 0 0{ 00S Su <6K4d@KX `P \0 XK6?6K K.0խ0 vi/ȶ  -LM0 006 @ 0000 0 -L0MP$Up\ `P\ +E 0S8 0RT0 0S0R0S\!000SX R|1 0 00  Q\!00C0 .00N Kn8 P80(1u K0 R 8 u.00N KR P800uuus 0 0 |0Bai0N K.0 @)8@ <0luȶ/ XMb -L0M@Ÿ`PQ ,2 0 A  00$Kq0S 0Sd 6 P8| PJ f00 0 0R0+P 0V0 0  < @T81-~.00R K㽬 P800t00R K.0 @姬8@ 0t.00R K⛬ P80p0tlu 0@ 0 @0Ba;~@/ȶL(Mb -LAM<0K$1 @P <K LK& 0Q ! 0%P :U+ p\K\K `V+ HV0S0So06@P  袢(K  ,0K>P , 0R0%P *t5@P $(<0S80S40S00S $[t5R XU0S XQt\ <KPd \0[S S @KH P R! 011 0SS 0SP0SM0 s 3X RF T0S t)@K.0LK Ϋp tD4 R \K .0@ tw K.0㷫C/K.0@㱫8 0s0Sb <K K.0㢫 sUS0SQ sL [ \K! 妯Pp`P`: lK@/X m0 00S S0S. \K K.0qm0A s<K P} N <0S 80S40S00S ᷡ@K K( 00KKO@P d0  00 R[ NQ0S us[0[0S)6?5K%1 R esH0SD0S@0[S!<0RPP@SA 80S40S00S/  @1<K @00S@0`0\   <K0\ K<K K.0ߪ $s ȭPP 0pNa `D00@@\$2 <K\ KPϿpKexȶ@X֑/D\,0\hא -LM@0P  <Kp0 LK `V" 7 R 7@P  (K  K.0{ K.0@u 80tr 0R0%P U:Uc \pK 0 \[48\l, \h &300  L0[Sh @KH (nPrL0[Sd |PP@ 0PAK0Pj 09 U P? 000b:[0[0S \6?5K 6 R  K.0 Zr  ,0KP , 0R0%P *vr5@P $(s K.0 6r Rg[0[0S S45 RS <%rO|P5 RH rD4 R r<K岭P4 R3 r/U m0 00S t4 R#  K.0㪩Dm0p q 0P < R 0X "30R0 ;0m @R@U@T 0m Q 0 0@  r0S2d0 0Pd00 @PTq P0 U 0Tgẟ PbUc 0SW 0 U  2SP2"0 F0,U+Q  K.0&@< 8`0dqU 0m 0 m Q7 0 00D"0!R00S "d000m \P |a @0@4PP% 40U00S 021!0 ~d0  T0" 0 R 404 t0 0l.P0P 0 a#ȶ@tX֑/`4@x/tP/0S/0S/P/@-0s l@0@0s H@0@0 @/0@0s0@0 @lX0 p-L@`TP @T 0S PpM -LDMP0pQ 0S K Pd0 `@K@`d 0P0@ 0 \ XP T` pM -`L@I`P0Sp 00S6 ?0 -Lhd Q 0 R  0p q |0@0@T0X@| T 0@0@L0P@0@T0X@0@L0P@ȶl -LMpx@8K 㑪PPc OTZ80K0   K0K 0K00K0 840 0`,X@  @ Ԁ <0 0000 4 0000 8 0000 < 0000 0 0K8K0K0Kh0d |0 0A@00 K P 1`VR KU1 R[(K0H@K0 0  8H04D 0P,`@0P< P`0`@00 0@K 0K8K00K@ h0d |0 R 0|  R #310" cb ` | d0 R Kv K.00L` )o`8 0$ oȶ: QNHd0 0-L@PT@T 0Sx x0RHP 0 -LAMPp0, p 2 R v K.0㞦x0l n (KP2@T@T T p0 x0x RP kPZ HK (@KHK;P01 ` ` EOK@ 01 `  !  ,0KHLP,P J,p00p0Pl00Cl01 R, v K.09 K.0x@`1  K.0P+8 0P hn,X 0 R X@0 R v K.0 x08( Knhȶ @ 0-LMp ,0 42 R  K.0x0 +nP(KHpK00 @U @Kd`KGKH@KPJPK (\Kd@KcKF@@p `  ,0KKPP%p0,0Pp0  I41@T T p0x0x R @T, R l0S0l0,BI0 R @K K .0㈥x08P m P `P L0 R  K.0m8x0(8` mȶ 0 -Lt@T 0 0WP <P 2S@T p-L4M S@T @T l0 P @@2 R T5l0 p0K Pp00p0@T 0S00S@T@Tl0 p0PUK l02@T 0S00S@TQ@T 0@ 0S P6@T R 0@00 RKpuPp0p00p0 PP H1 R F K.0㽤x0$P m`P 0 Rp0@T 0@ 0S EP000000@TF K.0㒤x0x` lp0T l0 p00p0@To 0S00S MMȶx -PL@ h0@#10#T`p9 p@T 0 R0@ x0P 0֧P 00Sp`0WV ` |00C|0|PP|0`0|0rPP|0p0|0 -L8MP p0bhd|0S K @P 0 R N K.0x08@ ;l꤀ R000p tP @| FT00CS0| : 8 lȶ\|0 00" 0-L@P |[P0Pt0S0t0t@0hb0 -L@pT@VHS0S p0t0SPU P0S0@ 0S00S@V -L8M⼡0pQb? R@0S;ڀ| PP5  @XP(xt@岦0( @0T0 8D0S0 00Pl0@Y  q000(K P@t aP T0 R V K.0 x08( Ik긴 ȶ  -LM@ $Tx@  1 ;x0 P l0l00l0l0l00l0l0 T@0d0L`d0T@XP\0h L`Pph \0`@l0 p0 X 8P l0 @`V|` o P| `Va 0 R0Tx0P 0*P 0@|  pDK 0 d4 ^*h00\*r 00 @ B  K0S@T0 @ ʜ 0a ct2^R:R40 x R 4 DK0 0@U h00 d0S |@h0#10#0T0S@(K|0!0|08)DP|0@0C|0i@PZ \1 RV r K.0x080@ QjGd0, S l0  , K@P 0 R r K.0,x08 0j '),P l0"d@,0h@,,P4 dh4 dhMS_ bl ȶl @ -LMPKdpK,P  HK `K   | xK@H0K0 HKG@KhP ` p KdK@Kc@K吠 K 8 ,0K~G,P 0  E, l0S0$0(K0l0,'E,0 -L@T@TM  -LMPHKdpK `K,P 1  - K ( @ $ xK@H@K0GKhP 0 ` @Kd@KKcK㼠 p x`08 ,0KP"G@,P 0 _E, l00Cl0T0$0(K -Lq1Q 1 REt@T `P h0  V: $00S0U  RPU00S#@TV5 U  0P <P 2SQ@NTV U  _| i li0P <P 2S``ӶU `V`xȶM@1 -L RPbh0 ,$0Sp$ R0 0 00  @T P @T6W ]00CS0 | hp\ 8 hxM x -P0Lr@`PP BTg *$0*SB 6 @T7 R㔑00000  @T P@T P @ 0``00000  0``@}T2S 0 R0R,| P  `\;`00 Rh0  Mxo00Cs0S/6@/\ -LM`Pp@<K 8 T2 R h0  (KZ 2 R 2@P  K.0㒟 K.0@㌟8 0g<0S80S- 0R0% @:P4 d@KH RP#`\B 0 A@ m0 00T; 1 R <K K.0Xm0D g40S00S 0 R g0@P $( ,0K<P , 0R0% *Hg @ 0@ <K@"oxȶ@/X֑ -LMm@底P Lb 00 000Sؑ ;ȕ 2@@ <( 26P*PK2K00)@K0 0:pp@@@@0 0`00P(`X 0 T z0(0@@@@@@@ P m@0 @@0 0P0 3 !00 2m . @?s00#40P@0K 0@@`Z "P`00@0@"00@0@<0@P @D$(Kეixא/ -LUM<0Kt1 P2@p<K  p h0  0Ổ(K6 <R <`V 6 R 6@P 裔p K.06 K.0@08 0@rf<0[S 6 R <K K.0 af;0[0S 0R0%` :VU d@KG -P 0 K48,  | tK`%0f0K 0x 4?s0@P@PWt@ pP 6K 0 48<PKvXQp# @`Q01`P:0SQF 4 R  |f@p4@P $(VPQ 0S `\> 0 A< m0 00T7 3 RO <K K.0㐝m0D eB ,0K⍙P , 0R0%` l*e@T7X3 R  de@03 R De @ 0<K@ @^3?0{37OTo0Tl @V0$%#5$"#3 000\0S] SW 0 S [K0 VK_1K`K0![l1 ,2 [K#0!K0r  #30 !K00K 0 48<3?1 0  4A Q 8 <3?1 P@4[K @.0 48<3_ U!*@1 RE p K.0 P0*e:00S0 R  K.0Ӝ  e@ Rp0 p0R@1*TP%*0 R p K.0㹜 @0d @@Tx <0 R  K.0㥜 X0d@ȶ@D|l/d X֑ 6Mb h  Q- P-R 8P *`N )Rp-LP@` :R P!P u@p@phIS S @phuP  㞓0 0 @0P @@phP 0S 0S [@E @P <@" -0-LM Y  ,0 0 P`0P @K3 0 P @ 7 0 :R$ ( pP5 @ ~ @,0K  ᎮP/ 00 RY @K J(K 0S0( 00 忔pPW㜖pP7 00 0 :RH, 0 @ 4@K 墮P  4/H R d040,0 p0 0r#$#̠`#8 0v00,ì 0 :R0 q 0 R:(0 ㈗P P4@0( = l0( 20 ,K` 0 :R 6@P0 04 i,0S "0C 00@0@\ 񟗥;>>p> < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < <8>>==X= =< QOo Q#A0L ;5> QOo Q#A0L ;56 QOoOoOo -d L 4 0-L@1P@t8 4 <080H < 0@00 Q-LPM@8 P `K"P2X00S K@T0 0PL0 0HD00@<008 40$00(,0,0(0$040 80<0D0H0X\08< 1 -LMp ! hQ1  @410@M G08 0B`BK  01 ! q 00  00  00  00 $00 ( ,00 0 400 8 <00 D H00 1 0 1#BK P ( p10! 8`H0@0@!t1*4 t t!40L0C0(KhQxQNtQ]V, OX< x -L@Q00  h%4hN0  "!zN ȸ X @-@Q >0^ 00\R 00$0(000/ S-LP`$ S S1!p $pU4W@ PH `@H `@P h`bbp@ PH `Z( ` Pj $@L d|OpONMp@-`R0 0@PU ^ 0P@PU T0p@Ѝ/T -LPpᡀX`@  (0@X -LPp!X`@  ,@X -LPpᡀX`@ 0@  XX -LPp!X`@1@  \X p-LM ` 0  @K P`P@ [P% :8 ^  @ ^ 8: S@*21C " !B 0:0^ 0 Kp -LM`@Tp*  R $ PR @0PS L   0 P  @R(K @ x -LM@ \ 0P 0 0c80 0圢Xp{ `Z}0 K40K * 0 0S 40 Rs @2.! ,  080@ \ @, T>0R:00P^ (K\ 00a, : #::cS1!^, ,8000`\! R P 0pWB21C0,0,0 X 0 `021C@0  R< ^ 8,0 0S< 0 0p  , Kt0,(!(, "*46*80,  ~p V|URV -L$M$( 8 R`4 080 0 VR"PpPP%4V@1,K080K `V 00pR00SP 00 4 $00( 0(K -LM$(`p R,0W80,  PP p 3U00S 0S  @,K(K QR , 0 00$( p0$K -LM@\P$(`3*KpȌ$  K$K pP$0 0 $P(0`p.  08$֐֐ -LBL >-L0^0P0@ n4P 0Y`p@00T*U U  0# J0SjZE Z p j Lא֐$֐֐V 0-LM(KpR(0 $ '`00^*P0.Ơ\|@ : 0c \A 5110a00:00$00$  $ 0S`V Y K, $ (     -L@p@  `,PP  `00  000$0(0 0P0@-@P# T!00Q:P  RR*> 00 0 bR !. .0 00 >00 >a 0Q00> 000 -LM4 8 @<0  8 080S 0 Q 8Qꤛ3p(K`J-K+K80< R,` T: `@aQ40pPW ^ U:>0 >0 S00P`8< pd0Wp! <00S<0 @8<0\,` pT: @gpW PV:`e PU4 00Y00   ^e Q:>0 >0 S00`8<pd Wp!0fWp!U <00S<0 w @`8<0P,`k `gpWPU@ePU4 00Y,0  Y Q:>0 >0 S00`8<pf Wp!0dWp! <00S<0 2 `@ ttbJ 07c0 0 1, 0 + LJJJNX p 0  ؐ -LM@xPQ $3\ b  S] 2"S0"IpRIOI1EII1@8 DI1 8?I2XRR0S  Z$ t"10@T \\"$Km(IP2 RJ D2DD ?8R0 A0B%@I Z$K I1  II  0!h!pHPPHLHZ2 : Z18lH1 0\HT$KmHH1P 1R? 0\1LŠ0aB%@0P @`H1HcH`H]HH $KmHA<ؐXQ 0%tOlOlېȔ\OdOOOې\8@$ OhO  $ @00-L8@P 0|1x!0hNOO h W": PN@ 0 P 0 (P P(1.S,0C0 |+F  0p \0 R 0   0p XNON -L(MCH #000D 0, !D+0"3D#DhQ@#UP0S\@rX (!0S jH0H XN@! pD `` 0f P< X }(KX080  $tED H 0HN@t T*<2 R0S H 0R6BS 0 "0Sp 0C80 H0D4 00 , 08, 40x!1S0 @ 00K'@  P< X bw80K0 DH 0(#80"*^000 -LMP`0 E*&:0:6hS1SX 1:#UTW!jX%P@p 1P*0hT 00p0@ RW 0j8Xz 000bQ0d0(KP\ D0R , K$k, hpVNV{ -PLM4p:#5 `@7T0000 00@00000p0 RZ 8P\ 0R , KX, hpZ (P*hVNStUURV{ Q-LM5 1@@h1S 0܁؁``T* pPV @T 0S 0P` RE WpP, KpP ,*h@pTW# ! Q80!0 ! 0@00p0 RP8P0 KP(K0*x0h`0@P\ X0R , K$, hpOVNSlUUtUVS{ -~LMpT: L#eP@X*`1!0SA 00@00p0S8p0@S P\ 0R , Kp0 ,+hp P\ H0R , K  , hpVNSdUV{/00 -Lh!R0 @ON 0-LNP000/0 0 /RR0 0 00<10/p@-PQ@` %ʠ  00S0C 0 ~ ,210P  21C0P: #50 p p !-LMDP Q:0Q*b"!B10b0 @ R  R 0S0U 0`0 0 pK $0K @00P`$`p0 R8KP\ H0R  $_  hp,VSNV{ p-@LP`TpphT0 R 0S0S R/: #:/ 0-LM\ - \0!: 1@00  >0 000Ppx0 R0 P\ X0R  KH hp0$0SRRxUNV{VR 0p-LM!P Ό 0@; 00 `+  0; 0 0p0 Rx 00PpP\ T0R  KD hp 00PpUNV{V0/RX0@-@P R 0S \ RRX0@-@P R 0S \ RRD1@- P818!Q410!,1(!$18 1!11 +0ˠ 0 0j0 UA0 0N@ 0A 0 0 0 0 @408 ,0N{RRU|VtUSSdUR|UURURURRhUUSߍpUDUVRSxUR -L01 ,!(1s$A 1@A!a1`+ 1+0A 0+P0>Aࠟ 00 ؀0p 0 B0! 0 0P 0 0`@0P0?@/0R*@0 0 tU|VS p|URpUSxURUSRRRdURUhUSUURVRR 0 R 0a B0/U P-L MD @ H 0 S S 8 < 4 3#0 <0 34 080 >0>0S00 } " !:@`#1@X3X3 >< D0H 000p(0SD H0J&6D H0 ZX H0D@46ZS#PP D@ !: RP 8#8ZS#@D倒`!6?>41 @H0p`V@" WU>000p$"R0S P\ 2R , K, h`pV@D0HJ8ZD0 H 0(KD xQ"6;x!#;81@h1h1   0H000p(!0SD0H:JD0 H ~P\ 0R , K, hpcP\ 0R , K, hpp0p 0 <0 d04 080 "DP&?L$?H"?SRdURRxUNV{VSURRUtUpH p-LMX`PP @ 0000@PKpR -SLP`p@ <P 0*"5060@0>V !:-LMP@0S! PX :d!#Š`1@ R` 00004qp,1 R081! 0S 000 0pp0 R P\ 0R  K  hp8P\ P0R  K@  h h>SdUNVRS{V -L4 (h4UR -L4 0 ST,0 R 0 Q 505055/3T 0-LM0S | 0@T00 KKhL3L0.0*@ @@@(0@T 00-@L  PRt ^P `00  0@@080)  0P=TVRN  3-L⠃M`0 0 0, 0` V5 0SpPP F201@T 0 A@ p`P 0 "!B 000 \ P `< VYZ @: JT * P XJ<T:HbHrT\$,$R$B00"v A0!m 0!e ~!0]!0X1@ CD?FD@b0$J!@$B!PF LX!l0!;<1 P0(a( 0   `Z6 0  PR6 0 PJ60 `PA6D\(KY 2 1C! c@@= << VRNRTUUlURSUtQRRRR4T S(R4UHt -LM@00bs^P `p  0" 0RP m4&20100CS00`4tpl0 R P\ L0R ( K( hpVURNV{ -LM0 @PUY 1h1S䑟 0 ZC @"4TP= @`X:#5p  V7 `1V4 4XA0C4 40C40001p(1 R P\ 1R , K, hpZ 0(00Z@@ 0(K 00S Z `0P, KkP ,*00h0@OVSNV{ -!zL'2M1@T$ P `i0 0S 0i0(K 1 P,    ,x0000"00!B,pH 1P@0S q3,UVR -LMP/00,KQ쀟00 0  0,0 ( @z:` #! P:0l PA 5110a00``(0T0(0J(  >I00 )# "X$K,RV -L0@0CS0h3T  -L,M@ D "{A< V%PPp 4`K8P V @  0 @4 0` `@HP$X4@$ 8$:# p`0 0 S p0 R8ZX@8<@ D00<00(KP\T0\, K8 N, hpꐱ<HSdUVNV{ -L$0 00$@zT -LM@\pP8 \`0`$: R2P0 $6; #;P1@00  0000p0 R P\ p0R  K`  hp<0`0:(~:dUSNURV{VtUT p-LM`P@f0J$E00 P   0000@p0 R8pP\ P0R  K$ hpNVhUURNV{ p!-LMddAd80 0 0H08p@a0p0S1(!(Q0 0000p0@S @P88 P\ 0R , KP, hpP\ \0R , KL<, hpRSTtUVNUUUR{V 0-LM@0 8 0 0P00p0 R@8T 0P\ P0R  K@ hpSUUtUNVR{V -@ 0@aL0h!R?= ?0R Pp 00#! \@R00 0  "!0SON 0-LM@PD:\ #!Q090Q0)n"!B10b0  0i0, -@!LPMpW$-  240 0i0Q$ :#5^ \  \su0 P08.8 3 0 Q 3 Q (Km h3X#0U0S00 L3P3`  00R^ 4! Q:0Q*b"!B10b @QQ 0U0T 0 D00D000 S2 2x2|2000000d"p\"0SR04  `i<2 0 SP 2p!a0S\1(!F! Q:0Q*b"!B10b x @PtPq 0U0TD00D001  1p!0S 0P0\ 0R , K, 0h p\su0 d\PY77P\ h0R , K8}, hpߐhURRVU,SNVU{ 0-LM0D @P U`@D h 000 j0SN  1X[ 1h1S 0 XS PUN `@0  000JS$E0p  1 !X11 00 Y R @p0 R P\ 0R , K , hp0Sh0X \0h1S 0 X(PU(K8@PUVOhURRNV{ -LD00l -LD00aAQ/P Q-LM@< y*$:< :6S 1 4 ?P8 4@h 40S80 0 O:#5`000  RJB 4Ÿ0C4p"pQS:0QP*`"!B10bPH   6P 0 0Rp.f00|pt1 R>X+ `!ZN X1h1S 0 ZF 0 J 0 40`S!Z 1h1S 0 Z 0T80  <0S(KW 0Z 0h1S 0 Z8PFP\ \0R , K@, hp(,SNVVO{ -LM`8 < 8 43R ,3h1S 0 80S 0 <0V #4 %{*040 &:<:68 S1pP `j Zg:#U@TI 28 吒pRpW22  00R:h$ QL:0QI*b"!B10b W22  0000Bp1 RMX 8 0f0 R40040 0 S0 P JjZP80P!S H1h1S 0 80S@1$(K< R00S4 0S 4  80 S 0h1S 0 80S04P\ 0R , Kd>, hp8(t< 0f S0000 >VOhURU,RRNV{ -L M@ Pp`P<  " Q:0Q*b"!B10b0<0  @@X%@@U @X   (K< @{X @ :#58 0S40  4 Q< ! Q:0Q*b"!B10b<0S vD00`00 p<0\<4  \  @ e p< @0@M34U3300Q @000$ $4 T8 80崓崣@p0S( 0@ 3!* 0 S@ p0DS P\ ,3R , K`, hp0Sh &0Q  "U- 2h1S 0 U% X2Z@  < D0 0@00 ~ 0 {n(2U <2h1S 0 U@8@1@-41\ 0  pl @  0 p`, 0 `8P\ 1R 8, KP8, hph(!U <1h1S 0 U@(D B*DP p/ - 0U  @ 0@`p x0U00  040R@L@P4 @*hD@4T,VtURRVNU{OSShURU -LM⨦@ 0S:(K 0@ R< I#)2q`6 PUR ` r0h0 R 0h0p$6@T, @T' 0"* !0>0Pp%e0S P\5\, K B, hp@T0@6Q0P%DD5\84,%< 5@:#:S55%$`Q,K@P p 0LEP 80,0 4, 4,Šdd0PpP0S8$8* `*:"*#:S/* 4 $$PQ  0EP 8000 c30 3,Š0Px3pp0SX#8*0`` 0rP@0h0 R3(# 8  PN2 #$ Q4 `  0DPx 80,0 2,@8@8"0,Š 4000 @0X"pP0S[88"8*8c2p B0S 8P\ 1R 8, KQ8,*hp0"0!B0h൐8  !001 0+; !0,K?Pp0K?PZpP\ 1R 0 K0 hp# P0\ 0R 0 K0 0h|pl PX0\ X0R , K0, (0hp+RVRUNV{RtUSURdUS0 !Р!0 ! !0 0-Lp0 40"!B P0P0بP0 R00 0l1R0C00p1@C\PU0T 6 @^@D H0L@0,p8`[ -LMDc3Dt#\0s `C0S TC0S!(!(q"$,,1(3p042 <P< m 0Sj 3/@P1t OK2~Ϡ "K(2 $ ȟ<0 0<PPZ0S? ``p p, 8R ," 60Q*42@02 " 4 1 <02 JP4< U-,"` 60pS1娑XA000|(K82L!082 08",S00S, 0ES`TH0000000<000000000S @0SO0!(!(q"$|0y0v0s0|p0tm0lj0u3Z,NTUxʴ[8`V,@B0 0-LMP0S K@P K0S@00p @  0@@N p-L,0`  DP`N@^P@@eN@ 0I,0 H 0H0D p0V -LM,0 ( D >~p@g00^0PH XU@`D@ $@K( 0z$ 00ZUj K0머V -`1LM0800 0(0K pP (KK pP@0(4 P 4 Kp0p , 0 ¸pP0@ @_0  Kp0 尸pP0 00GH 0-LM  h Q $ (0 @ +  @.P 0@!.@ @1:40 0 @4PL L@E@@19$ R(0800` E`0$0004 K0tFO$0 / 0-LpN/ -L0  -L/0 Q0-L@P0`M0 0hV Q-LM`R>00~D1N@pdPP B  0d0T09*JWZ3 Z,K00K 9Ā00P`0`   p0 R P\x0 \X , hJpWZ (K ꐱVSNV{!1!01!!!!00 / -@LP 000 -@LP0S 00,00S  0 0-L 0R0OOO0O0O0O 200 RO 200 RO 200 RO 200 RO 200 RO 200 RO 200 RO 200 RO 200 R 200 RO 200 RO 200 RO 2 RO 2 RO 2 RO  2P00 RO@A0P0A ROA- QQQQQQQQ RA- 0@P`pQQQQ R@-M Ѝ@-MЍ! !P: ZŒŒ#! !P: `B!,aB 0>ZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0 p@-@P`R p0-@P0/R0-@P \< 0L l4 @P0/R0-@P \ 4< 0L lRQ@P0/QP:/// Qp-LM@P` S 0Vp pppS`@rP`&0-@P0/R0-@P \< 0L l4 @P0/R0-@P \4< 0L l51@P0/ Qp-L M@P`S K 0V Kp  Kp K@rPp`(Ƞ"(,Ƞ 8! p@-@PpS`b `c0#3 Q a l.^#(8.(030# 80 (3#0"P@p.8BA Q ! C2 Q-L@P-S'pU#`S PW0#03d g0U f  e00#2 S06"l P@X t@P` r0(@pP` a@-@ \B/@-@/0@-@QP a0 ^1200 0100 -L\M@P`p H5^`0p(KSP 0R p#83Kst00 X$rP 8"(KK<K3KsK#KKKSKx p :@K>[X: K0x p0 8@K6[X.[ L2[HG2[ B\ : Bp@ >x:p@ 6hR6@K80Kx0 p 3[pS20K0KnL0 |  0KL L LJ 0| S  j0R A EJ FK  0SbZ X#P l %*P0 l l0 Sl :\ p L4p Bl /@P@ x0pL0t0 \ ` T h ` h0|P0X0 Ud , HPPt d8RIPP:p^x\p@T0T \  a n @"((b.` P0n`s #Ȱ  pP0x\ pT0^ P000A#Ƞ`0 |0`I00XhFK 0h 峐`0T0Z`0 T ^" lP p ZL0l C0n0l A3><Z0@L0["[[2[x h[[$[3[xhlp@-c@bP`T !L2pQ:P:/// -LM -L MKyK K0-@"P#0/40 $ R/ 8 8#$R/40 $ R/ 8 8#$R/ 0/ 0-L -LM @ 0-L 0-L0!P!/O 0-L AO0/O@-0@ 0 0@0 x0S/l 00X0R 000R000R000R 000 R/x\ 0-L 0-L 0-L 0-L 0 / 0-L/$0 -L0S 3/z)X$0 -L0S 3/m) -Lf) -L`) -LZ) -LT) -L M 0 K@K,00S  P k(t\( Q-LMP`Oڴq0ST 4KP 0 (S  R04P 0` ,0 G,04@K0@K#@@ t> 0-Lp@  "!0Sx b1!P@3HT]  01 0!!%0P  "!1!@ 01 0!!0P  "!1!@ 01 0!!0P  "!1!@ 01 0!!0P  "!1!@T @ 0!!,0 0!!Ox\ (00-L P@! `A0x\O-0  "!@ @0  "!0!DOx\ 0-PPL  R*Q U3AA8CS)D)(((0) )(('01P0@' &  &  &P   @ 1@ 60\0#60 0! #60 & < L`l P  8`ON  0O   ! -- -o#R// 0-LX0@  8T0 $4T0 8P$4X0Q;+S  ; S800  ;  S00R@@@X  (RP/H0RA/0R /#R!/&R/ /#X0/0X0lLT -LX0@ l 0-LX0@ TPN \0 B 6 +  `0   Y f t ?\00L  00hGL (0@L0 &7\0L0 &.\0L0 #$\0L0 #\0L0"X 0@ X h00<0L0 0\00LX 0 h0X 0C+ `0  LX 0 h0X 0C+ `0  X 0@ X h00<0L0 0`0 z 0-LT,0@ P0 P0 o0S|0  oPS  |00PP0S -LTP `00Rp @$<0 T ,00LP@, \00Q0S p-@X0L$!;98T8}@P=dU 8 T0$4P` L0SpX0 p8;T$8p 0-LX P@+ `0   @  P0T$8 8T$8 <8TGX0700l@X0 8t} 0\ <C3  `0 + +0T$8 8X0@ `0T*, ,0$8 8T$8 <8| 0X00l 0X0@}T 8 T0$4@  @00lF& 0-LTP 6& 0 08 $4T08 @$4@h d0R 0h Sd0 P0d@Np0 -LT`@0'  2 1C P ^{ Y$8 80T$8 8X0@80T$ 8 $84  X0 h ߐ& -@Tp P`0P,@L 8T0$4T0 8P$4 @,00,0T0$84  00 P, 0P 00S0P 000 00P0P8 T0$4T08 P$4X0@@ & 0PVP0P'0S \0P`0  8 T0$4T08 $4    0PVP0P  0PVP0PP0P 0PVP0P    0PVP0P@ 0PVP0P 0P0PVPP0P0P -L$0Tp@  `0 0,@8T0$4T0 8P$4 @,00,0T0$84  00 , 0 00Ã0 000 0008 T0$4T08 @$4   ! 00ƃ000ƃ0 LP GP8T0$X 4 00ƌ0 00ƃ08T0$ 4 00@ 00ƃ0  00ƃ0& -p(0LL0,S<R R R d0&  8T0$4 0&mRT0 $@8`8PF 06/ 0T$8 8<& 0-L @0dPP 00 3@5 ? 0寿P  媿P00t& p-L@P`P  |7(0tL0 P8 T`00X0T$8 40 \ppht'h('/ 0-@(0PL 00ES \YtYYLY0& l00 L0"S 0 L0"S 8 T0$48T ;$80 L0"Snp p-` @LP 0?.C""(0L0 P8 TP00X0T$8 40 \ \0 `0  ph0phT0$8 4`''' -L@0pSD0S8T$ 08$8T :8T$84 8$`8@T0 8P4 ;5/8T0 $48T :$#:8$8T 08$8T 08$8T 38T$8: 8$`8@T0 8P4 ;5/$`8@T0 8P4 ;5/8T0 $48T :$#::8$8T 28$8T 28$8T =8T$8w0 88T0 $48T :$#: :8$8T X28$8T @28$8T (28T$8< 88T0 $48T :$#: :8$8T 18$8T 18$8T =8T$80 88T0 $48T :$#::8$8T 18$8T 08$8T 08T$8< 8$`8@T0 8P4 ;5/$`8@T0 8P4 ;5/$8T 08(he A` -L@'vh 0-L@0PS D0S@8 T0$4@ 0]00T0$T8 ;8P: -@LP0\ X0, B#0;8T $868T <$8-8$   L0"S  8T048T ;$8 L0"S 0& P0T$8 400S.eeefeefeeeeeeeeee0& P X:P>T0$8l 4>d0h 0Sd00d0@ 6S0 0S, ]S% 0$8T 8<$8T 80T$8 8]`T0$8 4  dPM0 +0S, P -L P  p-`L@P  q(0$L00P08 0?>C2@0 TP D 0 0h X0 B40 \ \0 `0  GP0pT0$8 4`' 0-L 0-L//000  / 0p-@`L P`@p0@- @$T P@  @ 00 0 00bS/- 0$ 400`S -L  $B (0  -L000p p-@LMP㡹0U` U U p1  Kp0 s03R0S0LāSkkkkdk MP pP) @P <1Q Q 0RS 0R S  0 E0 > 0 6 0 0 x@0@0 %P0 c0\  0L  08  ,<(((l((((()( -LM80,Q$ 0 0 )() p-L00P0`@qT  0 p0Ds0S3Sp0 ph  0|/t20040365 8<0 <1Q@|Ppph20 @ xph20,X L20,8)h)x*))pΑ)d*)%L*8* *))) -L00S S S@ 0T<8 @DP 0N*@B 0-L00P0p0Cs0Sࠃ @^   02020 ^oo,ppppq\q pxoxop p p 0$ R0@$0 @@@@X 0SC <0= P$RFD1R;B0CS0h<0= $R2 1R:BSV@< =04R SV@@ *<0= $R@@< =04)0S00p0 0p@@0[5 00-LM@ PK000l0p0lPl0S H0 l0S4p K0r* 0-L M$ Kp@`$0  lR00000   R|Q P P 0S0SPP00000P P 8P0C8 8S P0 8S$ R P000 0 0$ RKht+ -LM@0S ,0 0S h+ -Lt,M `p0PK@ @ P KH@K$ 0$ lt 0-LPt@o 0hXa -LPpX  `i@P @C0 `P 0tpXa' -L4M `p4PK@$@ @ KTK 0u<` P Z@P  a(@Tcht -LpP`@P P 0000 P`> %%%Ġ_0 P0pPm -LpP`@P P 000 00P 00Cp0{PN -LPp`q@P P 00 00P `@0V01Z #0 pSP& -LPp`H@P P 00 00P `γV010# 0 p,P 0-PL&@P P D0U<0 0 0 P0P00u' 0-P2L P@P P 00,0 00 P0P0 -LMsP`p P0@P P 8 0 0 0 p{P' 0-LM@PP@ 0$ c:M  㢴  㞴  㚴$  㖴@w0 0-PL@P P 00$0 P0 P`0'  -L@eP  9h3+-   -L@ 0h[(b p-L@p ph(b -LpLP`@P  ,(0pP `S(bt -L`pDP@P  ($0`pP8(b -L Mx@T K\ 0Tx@@ @ 8 4$0@ Kh 0+Xa8+(b -L M0S` Rp0@ 0SZ" R <00SN >0!0Q\ 0CPP6 04SP0Z00q 0>S< P:<00S8  R00 0S 0 48 000S# 0 8<04@(K  0P'PP"+P0 SP R00 0S 0  4800 R 0 480@ N -LM*Q# QC @Q Q0 8<04@  0(, $  Q (Q Q |0 8<04@ 040$K0 480 @ P``0S<0Q 0@,0 (@  0@,H`,0KPp0@PD0`p0@ L #D <P`0@(!(D#Lp4  0  8<040D+ -LPp`@P P 00$0 0"U0P  0Pl -L0@S`MPP `H ^00 R00 A ` 00  0#40   0 0`P>00;00`0 P`80:0 0p0 pR00( R00 R 0)P 0 0 00 000000C2Cp  P 0 0  {`P ` -L0PSpG 0SpC `P p>  埰00 P700;00p0 PpQ0:0 00 @ @[@B Z (0S<ȎȎ0X0[0 R 07P g P p 0 00[0$ 00b $0[ |o  Y (0H0[0 Y (0@0[00[0 pPmp؄ 0-L`\P L1\ D1\08!Q+ 1\( 1\" 0\% 00\ 00@T  04/02 <008 00  0 000h40h2` 022 022@02 202QQQ` Q@/ 0-L P@| 0\ 0| 0\004P/P 0S0S/P/4004/4\040/ R00/R@-@ R R R R R\000QA S S S S SL\00\ R*R Q 00\  R\R R R 0Bs0_S Ĕ\00 "#0  0@801000  0  0  @000/00Cs0S0/  -rPLppq `<P@ 0@p0P  誶 -LMἀXP`0-$K5  6?`pP$0K@0# x -LMA 0` LpP 0p(K   0P 3pP  0 ,0 մD @᭮L ⩮ ⥮,0s 0{ x| -LMA 0` pP V (K0 $P 0 pP8@0dS,K 6c)[ 0b S @/+0[0@ QY,[ 4 00 < 8 YUYp00P P Py408 AQ<0xX /p p-LMPx@Tp $^>0 0Q`! 0$ P 0ă \ #\ @ 0S@ S Q PT $phUP P -LMR pO , 4 P`,  VP- 0`S0S呯8 ⫭P 刯4 ⢭P0 0  ♭84 000 P0R ,P ,(K Q-L  脒 -LMp<0= @R 9`R PPß ZPKD `K9@KL \  0`@ 2 p  "20  x@T ^ 0S[ 0CS2H8( Rp20  Rt20 Xv객pxhhhȝhhhhhhhhhhhhhhhhНB x 0. 0SP U0S 2 x 0P@S QQ 0As0_S2l" x P@0S(K>0D!D0 4 0 0SP x P@0S x x x x x 꼠F긠D괠B갠@ꬠ>ꨠ<ꤠ:ꠠ8꜠6꘠4ꔠ2ꐠ0ꌠ. 8,@px| $$(d\TL!tl|PXd̅ Q-L@   -LMp`PP& ᔲ@P 0 j X4|  (0|P庀`000 0S 3/P V / (K0S 2V02 : ~PP 3 < : 1:/Z V2 z000 Q 1/<0 @R yRz R  ``v`308` PP0S2  xQ xP Q R 0S ! 0,K >0"0Q_C 202202 202,04PKS!2$022 003S2Ա02ı0 4@ `PY 80S 2 81 -x 1b2    ㊱X1 -c]`Rr0Sn$ ṱP 1!z2:2B2<2 P 0S:P 000  뼀 :mxxP8 560 ReEP`< : 1P XLo( xdthhh0@-@QP0 2T?\0S 0R00@ -QLp`@0P12^.?\0S( 0R%l@P" 2`,=`P2 00 0S 3/xP b ۰`+ а -PQL`0p$2U!2S 0S @ % 0@P P00P00S 0S  -L0Pp2S``@ "@P00P00S`R@-qr@ \^  @@X@ -L MP`0p5P  P 2 L 0S@ 0S @P(K>0 !0QP 0 0P)0 8<041S,0  p @,0@S 0pS Z      ' p-L0P`2S@2@Spq00r S\ o/ -L@=P T, hj0  !  ! -0LP 0pS` `@ 000@ P`R -L3PpS` `@ 3@P`S0@-qr@P\^  0@00@0@0 0p-LM` Q08`000 2S020 23 0S0 003S0 @00H{040ph=0(Pqn0길%// -RL(M000 `  L0 \npP  PP L# 000 p 0~@QT0 8<0 0Y@ H D0  0 8<040>00H@ R  t0sPUuL  R  &pPm  I`Pe  020 a0p 0 P P P2P P\s0@,0  Y0 040  8 0<0 P 0  8<040P  0@,H, P`0@D00P ` 4  p0@ P#D p<P80` !(< 0@p#L4P` P`  x@0s H K P`P`(KY0P`0P`_P`YP`S N 0p-P@k0@`2L  p 0 S :;;S 0S (0@0@p`0cS -L@` ZPP p# |@P p 0 0l0 0R0 P0  0 0#40  ap4W00  0u -L`PpN@P P 0000P0V0B0 P00%$P00@00p 0P 0-L)@P P }>0P0 0-PL@P P  00}.A0 P0P0 -LpP`@P P P 00  00G0P0p`0000P N -Lp`P @  0L 0'̠''D;0(T @0pP@@  p-L`P@P P  0, 0f0C P0`Pyp@ - 202 0p0Cs0S0S 0@ <0= ($R 0A0 0 -Lp@` NPP p p@P p  0 0_0C p P0  0 0#40Xp+W 4 0$ R p0u -L@` PP p# 8@P p" 0 00 0R0 P0  0 0#40pW 0 $ BQ p⫦0u -Lp@` PP p @P p  0| 0_0C p P0  03 0 "$ pW y+r0u -@Lp P @1 PP @( h$00 0` S#t䷎PԷԷ4ĺ@[ 0  00 ;0@qT0#303f@@\0 @00 30 00 @:0z@MT00 [0 0030 0 + e@8T [0 0030 0 + M@ T @\0 @00  30 0ӥ0 @:0/@T0000[00 0 ""Ġ" 030 0 + @Tr0 3 0,à 0#200噥b[0 0030 0 + @T000L[00 \0#? 0@> [0 00 ;0@T.0#30 !  000  00\00    0 :0@{ 0u -L@PT x`P e @P \ T0 0t1 0R0 `0  0 0#40  RXDP@hp 0T00 T"" 0T00 T"" 0T00 T""  0T200 T  0T#20 T0T TT(, $ 0T T T T8<040 T0TTT(, $ 0T@T3 0PT0u0Sꌽ/ -Lp P`@P P l 00 P `堤 WC00000&4 0`P p-ML@`0 PPP0\3 : c 0PKp -L M`S@P VP K  pPP% T%J 0S0a0a010 P0 Br R@0Cs R@J 0 P@P.P0EsPU ;@J -LMPp@`$@ VP   $0K `@@@@}P $Q 00  00   K -L MP $ p2L@1$`P @+ (K $0K@@@ pJ@P$ R@ 00$000$ 0S (0S T0 c@ K0 x@ N -L,M@`,@ pPP @I ,KN 0@@@@ p@P7,\:  04 <  @8 0K@@ p@P, R" 00 0 <0,  08,0 0 40 ,0 0Q t 0 @Q(K@J(0 @> N -L M@`,@ plPP @( 0K ,0K@@@ p@P,0S@ ,0 ,  ,0  0 R T0 @(K0 @ N -`LepP d0( 008,d 0k40" P T 㻤 00 @ⵤ00 '7<  @$P0 0bQ 00  0  R10'88'#  4000i  j00ꠉWEVˎ 0-PL@0h#88#!@P00 4( 40bS40 000h -ML0Ǝˎ )-ML0Ǝˎ -L (0`lp,@ SȎɎȎȎȎǎɎȎȎȎ 0S0C 0, 4+0<0, 8, $)a0sP@QhCp0 0 00Cs 0 h340, $)a0Q⠇)0K<0h0<04$080P<4$080 -L(M 4 ,000 0@Pb4@2a 000,0 僇PV 0@t( D @ $0D@ @0 B40P "L0 0i@P0Pp@b4@D2,  yP6 0W*(( (h(%D P`@ W :;0@!0 D00014 p0,l 0 0 0@0 <02 (K (Ko0  2 0@Q  R0@L0 H@ L@[L0@S<0 8@ T <@[W 000!!0@0,׆P 0 C(KoR0uǎ -`L@0#88#!spP 0@ 0<0,04 ;,08 P@PWh:0"0<0 p ;Ch'(P@tP 8 8-#DL$`-PP0@ 0p @T  .0" "2 KC^  2<2 Q- L Q 0C@00E0S A  8 8-#DLMP$`P 0@ p0 ̠pP@0T X,@ @@S 2Tp 0, XpP202Q 2T-0. 2 Pp W T .2 02 .pP2T02P 2p02 .]p0 ' 0-@PLᝆᲆ00TΎ 0p-@`` (0,R00Ɓ0L0LPʆ2  0\ 0Q000CO@ 4 K (0X00ph?ꜳ %(Ɏy ,-LMK0  K@ -L Ƞ Ƞ M,dP@ &pP 0@ @$K 9T ,9Tj K0CT 0CT 9T 0S@' d9T 'X9T X@9T :c 0@@ 0@`p4K`pʌ< @< `@3T 0X  `p8 Y1#Q,@ 0PP Q(K 00' p-LM@`  PP @  0`2@p p-LMP  `@@P P @ 0PPP @p 04<S-P0 8<041 0(, $! -LMP  P=  0@P`P 0tfZ   P& 0 @P`P  T0S`W S Q 0 SQP-` ` 0-L@PP0rP00hR -L M0  pLV`P  xPP  *@K %0*0K  000 0`]0X  K0 8<04@0 @1A 0(, $ ! N 0-PL@0h#88#!@P00 4( 40bS40 000h -L0@0", 0p0Cs0ShL200S70S0@<0= P$R D0R h6, P Ph -`L0MePg 1(001,0!Pd088004 0 <00SG ( =1@KD SpKL BK0 p&P  7 0@'<X@7^*8 8*#Č,   D@ Č 00@(K WEV䉒 0-L M`,0 2p[-@ (K0P@.P @D D@ 0K ,0K @PPPQ@P,P@ 0X!!0 # 0X  \% \00000S, , 00000000S 0` 0 R@08 0 k@0^vdud@ N p-LM@P $`ၙD @L \ $ 0P  $jp  $ap -L Ƞ ȠP,D`$0pP 0@ y@  2V -2Vh <2Vm 0Vp R @^2V 2V 2V @ @ 0@X2V P2VR<2V8 $2V` $2V0"0 @1VX 1V e/@1V! :10S @0 &@P  I@P|1VA   @0S<@2 e0@ =e/峘e/㑞@} 0.@v Q@o 0 mP@h @c%$ 40H N@rdAud@pd Q Q@qdQ`vdhdtd@AedAmk~gd -ML0H )-ML0H -L (0`lp,@ S|4 0SK0C 0<04S0<0,08;,0, $)a0Q@Gh]p0< 0 00Cs 0 hN40, $)a0l}D0I00h.0<04$080LP<4$080p0 0 -LM8 , 4 0@Pa82` 4  , }P0 T 400@t( < $00@04<0 N20i@Pp x802,  YH 0@Q `  0 U0(!:0 0 D00004 1 p00,l404 0 00 40000 (K (Ko4~ !;0 0D0004 p0 ,l4 02 0@Q  R0S0  ;,|P 4O(Koi R 8#8 S  0 I0  .`( -`L@0#88#!vpP 0@ 0<0,04 ;,08 P@FWh=0200<0<0p :}Oh&(P@sF 8 8-#DL$`,PP0@ 0p @T0 !22 022  IOa  2<2. A-L@Q `L`h0  0 \0   H < 0O@00|C 0-@PL|7}0g0 ,-LMK0 k K -LM0   LP * pP  8PK,@ a0 `80K, K. K- K7@K +`K%\1@0 `< R<\ < < (K 0@p P,H`0@ pD`0@ P p#D< P`0@!(p#L4 0 0@ ! 0  8<04 1 #000000 N 0-L @P>0\ 0\qP00hP01S01S00h^ 0-L0MP<0 ,0 00 40 80 pPF0FP Pp`( @@K P 80K @@@PP @0S 0S 202 /  0 + Pp` f@ 0 0S<0S< 0 Sj c Sg  Sd (KP000P Pp`<00S S{ <38#0S KLpP;PKLL P05`s2 8) rɌP0PHK ,4 R #:0K9KP p-LMP0 S@ Kp `KdQK ,  4 KK0K R #0#̠##DKK@K0KL 0-LMPU2K0@K2 M00K@0R #K0K@K@K& -L@MP/\`K@@pN0[0KT0< Y K\@KZ@K WK!XKP1@R@ #0U0K^K -L@M`\pK@P@O0< [0KY K\PKZPKL00U0K#4V0K" @0E KA0KHPKGPKF KDPKCPKBPK @R@ #Ύ+K p-LLMPd`KL@Ẏ:  0\K `0K_K 0 @S 1|0]Kc0KaKd@Kb@K墎Kp0@\K `0K_K啎6TK( i,K eDHL0d p-L$MP<`K$@y @08K;0K9K<@K:@KI $R$ #kKp -L M`s'pK PBV@@$@d ,4%0K$K0|"0K!K @d 0- 0KK(0T 10KK'PK&PK#PK<K -L; S Q Q Q K0<00 PUO W \P\ 0l@L00Tq @ ;P*; S  0 @0Es0 U:S00P 2UP 30Es0S0EsP8UP 00Q10sPQ0 *@K  Q ;q 0 9c0 0]0 0W0 0Q0 0K0 0E0 0?0 @090 030 <-  0pE{ p@0Sc00 RLP jYD0WB ; :0Q? 0Q3>  0p-LM R3 00S 0S, @P`0S0C00 00 ,Ar oR: S>+  R0S0C00K K 4 0 Kpl Ƞ00 Ƞ-,1XP ( -L8M\@`  #4\ : 40S P 3\! 13\f ?3\ 3\ d  0 `P3\ 3\ 3\ l3\@< S\$0< S<1ShP03\= 3\ 0\u 3\PIP2\ 0\z 2\2\ 2\P 2\p0P       00  0P0 0tx |0 0d  0`P  00!0 pPPC  9r\ P$010l 0R 1  i遌1PP,Z0P     00 M  0P0  Bd p p PPz 3  \0$\ 0PP\5W W WW @W W@WWW@ W @`W WWP -LM\ 0\ 0\ XP* ,1 P0\ 0pXQ 00S00XP ,1 r 0, Q}f~fvt|f 0-LM@00CS0P0#0@- @.@( d0-L Ƞ Ƞ,A0S040000CS0( (L0 (-"LX@T 00X ( (-(L" PP0AT PP0SP X`VP 4p0H0PP X`P( -LX@pT` ?#< PcU " 10p`dP0S 0S0 ,h] (h00ာ0S، Q-L  -Ll0PS `1 X@T( 0S% Dq00CS0`000 R00u0S40S+0 3 1CUP ㋈0Q!ڜ 0 S00 S P0 hOT0 ,00 DC -`@@Lp PDi 0 p  -p0Ll0 `R0\0) \0` \` 0 d0 0 B0h $@ 0+P\ttPp@0S P0P`QHhN (L \ P`<%(0Q` 0c/p ; S/P/ 00S/ -L@Q I(IPItIH000000<00000000p00s00p000000 <-@00000 L!pW`V0S \ P0 UD*\?  _020Kh02Kb K1K/K,0K+PK0PK.PK-PKP_0[  PPp e  0wP4P L0W 0@@W  oPP @TJ@TZ*KP*0[ < -L` ! 01 R011 01XQY QP@S G o0+1X P@0Q0U0SU2G? P0U0T R 1\\ T 0\ 0S  04 \\T 01[Ol H0KhP!  -L^KBM@KPEp `00  PnV@ p = p<0d n@;0E:PD`d T drn @dknX Pe}dn @d]n 0 `o$K08HPT  -LPp r;` W @T Or Qq `q P|W  6r,rqkꀬl`TÑ0@- @ 0 XPX ăP \0S $0R Q0 0eXi 0-L0P@P0T T000h40h -L00TpW1 434 \ ` P@ 0`S 0 0 \PP f q8P f qP f q fq0 0T0 -LMpT0000 uP40 @0S/ 0S-+T 0S&`0@C P P0 D;Z P T0S T ` 0S(K i P 0D0 0 ^  1 KP5 0  T ` 0S BS0S00 0 t ,  t0S00, Dk00 0eT ` 0S rP 04  <     0 00 0 0 00 Q00 0 `PrP  T0Su q00 <'a00 (! c$$$$\$% -LLMP@ 0@%P5 Q4Q7 0S VK DQ0[T`[S [僐`pP00V00SsWV8p8P f pW P f pf p0T0(K  0SVK Q0[T`[僐pP00V  R  f pP` f 02q`pP \` X "2Tp 0P `0S00S 0S$ , KP,P? 00S H| (sAEP jf}Bf< `pP8x <, 40 P\P H_fpop@W-00>0S S\f 0pPF V4p ` 0  p@0Sd  }? 0  00>0S0 S !00`00\pppV  P ? 0T0 R 0@0|%0%T &%\%%(&%H& -@L0S 0 S  \q0 0bS0/ -LMP0 <$21C01 0>=4Q *@$?4S0>48$P0R 0>4=4@4?4B4A4D0\0X0 0$0(0,0004080<0@0 0R_ Pl p 10W,0  WI,8(p`P@HD@ ,0S 4*0JS쭏h0@,0\S Z 񟗶$,4> 0@4A$A4KL 0RP0 0BL00 h h(K0P0T4T \04X00=4) Q0=4ȅ0=ȕ\0"L0 0P HL0,$0  h h0P0T0P0TB4W0B4 0$B4S"??Q/$ (0R+10,"( ?,##B4W0B4 0(,048<@DW0 ?$,?R10 ,?$ȕ,0B480 004P ^0W ! 0^P RN \P0M ! 0PF RD \0`0044<40CsQ<2 1C01Ad` 00 4!ld <40s0S<4 @h  g04X04\<$21C01 0{10` !10!` o h 0g\X` ,#`0 @-P@P` Pp1 p#01s^0P5@10LNs\!  0g1"s0#RP/ m p-P`L@ m@8d0PpD -LhMr `pKP@P <0S SXp0 S D0Sl@P$K s0-LlMp t 0  `KP@P @0S<p0St0 SZ80KYZ@Y @(K -LhMp sPp`K@P p0S<0SW4 ,p00,*{Pdg0P$K -L 0q 0Q 0`00d/ 00-LMPPQ@ @X @ @XJ@PK0P -L MP4 0@P@$ X pp 0P" X Gf8@! 0K4 GdDT 0K0/K.K-K+PK)`K,@K*pKP (K f  -L M@4 0`PP@) Z P)  lpP# 00` 8@^0K4HdDT0K X0/K.K-K+PK)`K,@K*KSP (K Fl R00 R0Sp-LP@` < @0Q``F Cf0  lph 4f -LMR@80 pp Gl8`0^3K04KFT,KGD4K 1K/PK-@KP2K0`K.pK5P00P00S0,0 Y G8e k,(K -L MR4 @p ` `  l pe8P!0000K40EFD 0K )@K/K-0K+K.K,PK*`KSP @@X k(K l1-QL M@ P1Q& 1CQ K01Q800Q. Q< Q@00 * 4K K0 S;#0 0 eQ Q Q@00  D00 8 040P D00 8 04;0PH00 H00 UDUU@ 0-L904@0090p PBUpP0TP TPXP XP@P @PPP qPYPP<P j<RP@ @ \q  q4P0[P@ 0-PT 0(PXP @<Hf j90p090TppPx<'&&&X'l'%H'd,' -L@P )P 0S0 P/ p-@@PLD`p R0p0 0S00p@0P ?S $0/R (0 (p-L"PA0mPp1s sL0p`<0p@@8@00Pp0p`<0 0-L Ƞ Ƞ,@Qp0?P@ PA @` P0S@l -LMP0@`pPd1T X1T$ P1T:  0p K1T 1T 1TQx xP 0x00 xP ,1 Q0$K0P P @8 40K@0P-|00|0|00|0}fpUAUvtnU~f 0-LM \@.Q@@00CS0@0\0 p-LM@0`PpD0PUp LePp8 L04PPp `00-L Ƞ Ƞ,A00000CS0P0 0 -LMP|0p@ @@K8 40f@0P` (K ``P0S P0*||`0&P&V |00|0 P pKRP@0T0V0S T@#T@!  `P #``' `00-L Ƞ Ƞ,A00000CS0P00P0 ( (0-"LAPPLf fxP0 8 80- #PL*0AT 0P P0PPP Df g|0xP0|0L0 0-@PPL |0 lxP0 0h|0|0alxP0 p-L90@0Q$ژ 0 S00 S P0 -pT`00CS0PP1 8̏ 0p-LMP@<0 K40 K0080` 0 <0 @ 60 D 0D @0H 厽Kp̏'`1S00`/-T1S0T0 p᐀KPF@P @0S< p0#8St0Sp1@PWp q ePi  @ PP1 @0S< p0#8St0SP 8 R Wʔ80K0B000 !0n 3 0p0@ 0 1SWpp# PIφr@  0 pΆ  0 pOφ  0 pRφ 0p p(K80S00 1S80K4^Eφ0 1 ᆕ' ?p-L`L@P€ 4_ 00@0@p -LGM`0S qW!  @ D D!2P  0(K 0RFOC Q<000W@@ !^P= P: R P 0S 0S Q0(K0F?C, PP \ P 0 S  0 S Q0( K0F?CP ^Y BT\1S ppY` ]K0\ @ r T(KK ^_^ -L 1PSp @`1"  1 S`@ !n^b1S 2S i6_ `^Yi۔ 0-La1@PS \P }PP  *d0Xd 0 ' c 00-L<M XQa@$K $ P \K0(D -@Lp`PP D5W30 0Xb10Ya1P  c\֏ 0 / cQr Q 0S// 0-@PL/ P0h1l!PP0@  P@T0蔅 0-@PL/P0h1l!PP0@  P@T0覅 -ph1lL1PS` @ ,P@T iꐅ 0\ 0-PQL@ ,0p00h6p0 0p-@TLPP2P`0T2S0P2L ph p-LM@0P PD0SKp`KL P 8 40g -LpM Q0p`@P0 - Q `opL 0`i W@ p-PQL@ 0P` L`PU php p-L1@`SPp3S 3/L phl 0-@LL90P 0 X3-LMP`<0,K4( KL0008@( 0,( 0@,( 0D,2H RpL 0f, @(@ 0$ @P#h2 R; \2R 0b#Q0役1(BS/0)!N K0 S1At 堹1S 1 @M0zSp0,$K(p!PA $0> 0?C0C5S588$$$$$$$$$\03 rL03 m<03 hh܏S%pԄ(d\ُ؏ُ -LM@K K 0UPKY0S 0r0/S/s 0r0R ZR R/0S0w00/0S 0{ z0 /0$S$0w00/ 0p-LM8P^0 KP`!KED`!K K@KK`K`K`KPK`K`P[Kp 0-LP0@TP 01S01 1S A0 T冹 AT 0 1P AT10C1010C10' -LM@0pP`#P  KT 00p 0`D0 D00 <Q P p-LM8`@0 NTF!0L0QSPM@N@O@P`RL0@Kp 0-L@0PP000 0P0 0 \0 00h -PL0`pP 01 s@N=00 00 00 00 00r`Z Zr 0@P00 <QA -LMP0p`P800@0NĠL0MpQN`O`PR`S` L0@`BK -LM@0`pePP10@0<0L0MNĠQNPOPPRPSP L0K -LM@0p`P@P  K0 T0 s00 P0  H00 <Q P -L MP0`@P. 0BS+Lh4  0K@b RY0S 0S00S S S 00 b0K`!T T 0R0 R !ZD 0@@{P  RTXpWe  00 b0T T00 6T1 V \T% J 0T\00 TL0Q0  0T800 @ 0  0T5 T 00Q p 0@0 ZPH 0PP^ UZ 嬶 奶 垶0Sh tYc00 04@ 0@G:S 0S (,(X(((( p-LMP0`@P: 0BSlt0j ihPk@8(4 $ 0<Q  R 0PR 0($ 0,0Kp0S YT0@0CS0000 0PTP KphT}\ @P840" <S  j ih0k($0<0CC$C8 0840 ,R 0|KphT 0R0Q R XD 0@@P R  0T T00Q Kph00 Kph 00 Kph0Q0f  0`,[Rx00 Kph@ 0@P@y0r_S0U BP@ 00h 0($ 00,0& 0($ ,,J7 8)USBUUSBS)(`))) -LM0 0p4 P 01M HĠN=S e 0 B0g U0 !d00Cf00 PR  , Ch0C$C 0HHLjki Pmno@, s`p 00q0lrpW4 W 0Ԁ0 0ؐ000䐊D d 0(@P00 <QA(K X p-L@P`@0`S 0@0VP00P0PS 00 U@p -LP@`@`P V@耟00CS0p0S Q @@0 @aVp @T ᐓ p?]0W1 p 4]A -L0@S P`P 0S 00CSPPP -p0L00 P4 080q@P 0X0 Y 0\0 ` 0S 3/4-`PX0S 0S 03X05:S PS0X0YP XQ Q #3Q0@S񟗗@ 0@S<0S=QX0S S 004 D0PS4< @0PLX0Sx 0`@0`P? V@X 0BSP2 X R[ .:R,1T0Y 0BS;@@0t!p!}l!{h!y@!w0Y0Q0Y0M0Y0I0Y0EPWiziPX@Y@\@`@4K`PY0X0P)=>iai7>0S}==y`0T04> H0hP ))!) *؅*))d*&8**̅ -@L0 04JS00X0ĵX0ĥ -L@40S0 0$ R 0R  R0Y00Y0 ?00-L M8P0ED0KKB0 KK@K0KKKKPK3K04: p0-LMq4 䅑 p-@L0`0S00PPp 0-PL@000S000(0RR00(0(00 (0SP( P0(0 ᤛ0(0 -LM@Q` $pSJ8lx2 %㼠 V00 " 0>00 01 0@0 T0%(KQ( 0 R* 0Q'0(00 (0SP( P0(0 (KoH`0(00(Ko00 0!0(00(0*40S840ń\ -LMP@4`0P3 pW00 00 0! T@  0 P0(Koe0+ R  RW\ű0(0(KoT@$ 0AP(K$* 0-LMP4 0S K00K @KDV P,KR)@K0R L( M0 Ax* p- PL~ZT T0@`>0201"(08P40`) "`p$p\ p-LM`PK 2@!<202 &T00004  00CS0pp p-LM`0PK22 @< ; 2S00004  ʒ00CS0p_p 0 00CShpx` P P@/7P,@/nPX@//l/`/0// /$//H/0AhSwxxllx``TTTT0// /0 R// Q Q0-L@P  ppp0@Tp `0s00s0@jPj $,4<//// /// // / // /  -L`Ps0p(#D""Ƞ" [@0@ \0W W 0 0q48* < 0"*#"#?##Ƞ  0RG&Wp W 4 0 48000L0Ba21C0aU  Q  R ${0 0 颋.@P /////!****08/ R-Lp h10 P`!0@,(Pqd0|`0 *08 xP`PC <h胈+,(D -LMPz+K)'KLH?P`,K@ 40(PKP,PK*K)K&`K%K'$K0 -LM`Spq, 0@ x@P0K0 K/K.0K-0K@@0Vs@P0`@S@0##LĠ +K)K,@K*0KP  岮@@0Vs@P(K\+ q-L 0KM # 0 R-LMPp@k 0($ ,PE0Us`@@@0 $0K80C$K!@K @K@K@K@K#K"0K@P  lK+ 0-@L 0($ ,$P0 ($0h0 0 0-@L 0($ ,$P0 ($0h00400S S  . }>T0 -LMqP@Ct?%d(K(K'K%@K#`K!pK&@K$PK"0KrP N  K+ ,0- PL@0 08[@Q \00HS X00 0R B0HSQkP0C <0hN q-LM K0 -L@9 &&h 40-L48P@ @  0h$0 @-L@x(D3Q2 8 (hd0 ,-L@48''hP0 8-L@x8p  %%'hP0 -LPpq`@`P@TDhgT 46 %#!1 0p0+0 -LPq`rp@Hr @T,hBT 0($h0+ -p0@LQHX (,`8`P` P H l1 RD 0 srPq`H1  `h : 1 R6 K V X  # a b0((70 d0   Q L0 R 0 srPq`  0 R  -LMqP@Ct? %d(K(K'K%@K#`K!pK&@K$PK"0KP  奬 K , 0-AML(@P0PS 000U00 -LPqp@h @TxT $)P@곃dT 4@0s d0,, p-LP@@☃dT 0@s0SdT|Ipp`@0 @4TEMFm-@ `@T 0As0S TpD,x -L@M`pAP(k  M h^ p-LM`K 0P;![1 /03 0.A[T1T!AKtE,,,0   O"01[ 1Ks#3000! 0![0S!K0r   0![^0S!K0r   0![F0S!K0/E-E  OE-, & 0p -LP0`ኘ2P  \^?!0Cs0S@@\  0@\ 0E=0s R0psR0C‚s>}s? Q  -o   ? %    ? %   ? % Y?0Cs0S  X ^i t 0-06L0PS0CS006 0h迕(0 0@0@0d, 0-@8PLP $00PP0000PX 0p-`@L `f0Z(  p P `TPP `8PP `ph0 -LNM0L! D 0@ D  D卜P 0 L!\Q 0! 0 \5` V4X 01S ST8S S< z @! ğL 02P1 `40C 0,1 4pW" P0@@xh$00p7 G͉P2 Bpr0C<t0 x, p-LMP6`=@Sp0  BQ5r0CH8Sp1SF Pw 2 Roʬ1SF @LP  c K@P tP  c IPU1  06p1 RF0G@T00S*,00 tP  zc *P p q Bp 1AS  00S:A BT  10R`!d!  10C1 10R''  70C7,00 tP6;6ppQ 0ⰶ0 0@0@p -RL@ YY  `Y) 0 0@0@p0` |Pံ 0 T0@ B  0, -LJMR`p \\ \7 p"ˠlB0L  @N(K,0K ,0'S0 0@0@0@@Pn ; 1 1 @! @0 0@1  048<@!#8:#:0 041,!< 0S( G=  1xH P10F8NKp0p0P0100 (0K, 尐@14 81 0ඒC0Wb@!0@ 8 80K@0 4 Pdή<$0e 倧zp$,, -L@pZP`rC $WC <T0 p`  p-L@PpH!0PH0S((((((x8pD8xhS |'D8S D(Rx8s0 px8px8p~PC $gQ+$V d0 -L@PH8S h0j 00-@L0P  P PP ; 1  `0 0P¦ 08廦,左 峦LPXT-0-,, 0-AMLP@000PP P@ hIC=0T04刦 0偦 0T-t- -LMpPC` @T  @@}TI |  T? P@ y Kx(|8p0?, 0 1O I x<:P) :0 [@P U  @j` 0G@PS@P P9 <0@@P A!ˠ0A-  P@"D8Sp( 6' &60;@06D(R  @m B@g4嫥`ꨋ000--(..-H.PTp$h. -L`P@p P@ %똑1T- |10Sp1TI 0lr@4T@ H1T# @1T   4P@# Q606 0S06@ @@ @ 4P@D8S 6A0AS@@ j0rr@6A0AS|@i ϖ1i i i -L@4P6A0AS4@ -PLq0 `/0 200S 0@4DoJP 700@P t@P 4C $} 0  C <} 0-LM@Kt KPP 0X X岤K0  P fM墤 ^M... -LM`0 ?UP t Ki舤. @P //0PS0@0S/0StqP   0@0S/0S?s ?s 3#@`0 C @@$  |3 C  0 <d |@|{T ^pP T ' 3@PQp 0P!2 R X?"SS0DH88(@<. Fp@"P㚎?- |"P2U@@PE㌎?- H"PDU@@ P~ 2-P "U@@q1-@ !Tp/ F  F@PY?N. !PU@1!9!|1|!|10@!0` hF.oL1"2D1/288!F 4 X0QZ!< D0C.<0@D BD0 K Ki胣 Ki} Kix Kis 0fQ. $',)0/<xvL\&. $@'0\r/4/`/x/2@ -LM0S07 P <1}.}t+}(}//// 0-LM@0S 1"0 00 00"& 00P0 & 0S0 P 0 Ơ0PS0/0 x0-LMl@ R 0R TT0 LL07 @宣((0( (0+ 4]6n<0||P4 -L pP&l==:8;;<@<|<|<|<|<|<|<|<|<<<<<< = = = =:004@h P\`,h 06/004@` P\`,` 06/004@ P\`, @06/004@` P\`,` 06/004@ P\`, 06/004@` P\`,` 46/04 0\004@` P\`,` 86/004@` P\`,` @06/004@l P\`,   l 06/004Pl @\`,W0 G2 0l 6/004@` P\`, G  ` 06/004@` P\`,` 06/004@ P\`, <06/004@` P\`,` 06/004@ P\`, A?6/5 -L @pP&$??@@hABPBBBBBBBBBBBBBB$C$C$C$C>004@h P\`,h 06/004@` P\`,` 06/004@ P\`, <06/004@` P\`,` 06/004@ P\`, A?6/004@ P\`, 06/004@` P\`,` 06/004@ P\`, @06/004@ P\`, 06/004@` P\`,` 06/004@ P\`, 06/004( ,0@4(  Y̌,20 0\004@` P\`,` 46/ x04 1\004@` P\`,` 86/004@` P\`,` @06/004Pl `\p, @l 47/004`l P\p,T D0 0l 7/004P` `\p, @D` 47/ 0-LM4@0@ P hX%%t0 t0-BLbPf` p!00A@! 4PQ,@4E@ "-@@`0Q!Lp 0Q P004` p\@A,Ġ  048/ 0@ 0  p0-LhBP `20A@ 4Pp,@05@ -LP 0-BL"PpA p@004`@p \P, 58/ @ 0-BL"PxA p@004`@p \P,Š  08/ @R  0-B`L"xA Pa@00@4 ,04 0 p\@ -pLPM,p 0p "1,00 `0@P0P000BPL Ut A1dp 0W, 0 P㇢L0 400000(K00C 0 0b0a0&0 UJph0 R 0R P0$ \@ 0\kkkkkk,! (1-L 0p\\` 0P@UPSZ䐟䠟P䀟0  aR  `` 0P: ' 0TJP\  SP 0S0@ \$0$ @0 \kkkkkk p-LM@` 00r0  @(r0 , 0\0 ,P 0\0 0\P 0\ 0\pkUD1Tk -LMpW7 3 Q3"U00\Wp W[ W!Bm2"``m2łŸ2"#p " 0\ho\̛$@ @0 Pz 2 "QL b00 0\0 ,A0,,,0\!0@ 0@gk|!||0q<1p`%!ᶚ\A\1+ ^Gm0401"#``垚`,`0P0㰀0 , P0\@0 \xAkkp6nkkMbkkx1%14]kSVS1 kk1^P1/  p-_ U P0`@1L40\04 0\p -LP@0S04 0\ 004\ h_q \00-LMP@40@ 0  P0P0h њk%1 -LM( Kp*!0[;S"0[;S#0[S $0[S %0[SS &0[ SS K004@ P\`,#0[" [![$[840> 06/004P @\,[%`[&p[ 210!0 0cs0S }.L B4d800 8/4 320!0 0cs0SQ  0-LMP@004, 4 (??0  KK0KK004 ,0[;S0[;S0[S 0[S  RR 4 QQ K0 8?0}> 0K1K KK0 0 -LMp` >BPP @t00@4 0  PD0D 0@0p (Phk^$]t\% 2<2 0-LPp@p,+0h'x -@L40< 8 0-LMp@84@ < @@P+<p408 \ p408@ P\`, 76/ p408@ P\`, 57576/ o408@ P\`, ;=; =6/ o408@ P\`, 296/ o408@ P\`, 76/ o408@ P\`, 666/408@ P\`, >>2>6/8o408@ P\`, 76/oX o408 , PX 6l40< 8408@ P\`, F46/@T Yo408 ,T Jo4 08\((208 0nP0" 408 \408@ P\`, 86/D0T 0D0 P 0n(+$Η嚘22:5`2h2 Q-L Q 0-L@]PPP jnVt"R0l2ptR0 Qp-L`)Q@@_&^Zl2p+,l–p+<0\l2p ,l–p 0\p;2 0p-LMP@'lB`h t P phPN@Ppl2p $l•p0 xX0`8 0`mP  ;2P0p phx `\mFl•pt"0t2p( 3%]<3TH3(32/  -L00400T0s//, 0P/0P@/ 0-L@P0P0l0 2 0 0ğ 0-L@P0P0l0 2 00ğ 0P0/0+0 // +-LM0q`0p@P 1! `1@ @  0PT 0T0 T 0T 0T0 T0 T $ 0 kkk|Q -L†xpx@0 $TPT` 0 $0 @$kk -LM0唀p}O@T 0 $`P``  z0 T@0 00C 0kk/ -LMP`2pP @@T l002  0P𩝩0 YP𩝩20`U4@O 2U 41CUk ;1CUCP 00#30000002UD 0CU4 1Ul 0U0 @00T1U 0U000 0s00T000000 0 00 T0 00T0 PPP@P P \ DP$PPPD0 00T0 00Tğ]t@ktyt zt lt -L0 A@P0p4`t0 l0 2 0删t0  0 t0 Ŵ0 00T 0\mt0ğ -PPL 0R4a@p@嘀T QI d0W0  t0 0$ T(嬠 ` | t0 0Rt0|  l0 @ 2 0X<D n00004 Tğp -L M@lP0t`xp|0t0x0@@0W PPV 0 pPKd3 -L@MPp<@0`4pt0 00 (K0Sʤ0 0 JH0S t00t00 HhK@ XPP @h D 0@ TThK6 00 T00 T "-LMp0( 0RQ`04$0S R @< S0sp  S0sp  S0sp  0 spp 0spRp t@H " 2X @@D00C0@P a0  00T0  T0  T0000P 0P 00$0(  0 8S0&6R l0!20P  0  00 T@<< s0 T  0T0  T0  T0  00T 00  T3ğ -L M, 00 pP@) L@PU@ t 3 # 0 p   0@P Ry t0 00 @(Ḱtɱ2 00@K<x20  0h"0900080006002000000f0@4`B?I/0  0Td j$ $  00 T 00 T $0 + )'0tt!,0"\ 0 ťt@P t  t nttt]0Sa 0 lD0@Y4岫P@2su+ğ@B  -LM`0@4 $0S 0@ R8 00   $ 00So $0 0 0  YL:| x0 0Rx0| D<k00 S㘐 $PP  0r , p 8pɪ, PK, 0 8 0j8 t0  0t0 R80H[^8 l0!20  $?0 0 圐0Y8 0 0  00T8P嘐p 4 /c0S 4Uc(K08 l0 20P 0  00 T00000 0PP0Ojl0, 20 | $ğ 0-LM4Pp0P` Pk 14 QJ D &i\ "i kP8W 00p!4  $P) 0 T 0TA  04 0  PT 08 gm$004| ,0@ ;0l0 @0 0 P0P PDБ<͑ksiq6n{%|QL3kk33// 0-L@PSp20" 0 0-LP2S BT r0@T0hp $p-PBL`0 \• 0\d@@T g2 , • 0\B0 \p 40-LP \B 0\d@@T g2 , • 0\2 ,p0 -L@0\g” 0\hg -L@9 )=9  -@2RL`\p, 007/2R< `\p,< 260C8<7/2R\ `\p,\ 07/ w2b` p\P,ETP` s<02008/”d 0\Rh 0\”l 0\Rp <\|2{”}"480 \y2xz"”480 \i[ 7 0-L˾@P ; 1P 0u@ 00-LMM,6 2P ,P ˜L ,T2PWP 2L ,pyp?Wʼ0 0@0@ W-ʴP`0@P` P`,60 ppۻ0PPG1C1˜bNK@DL 00< =2|P  J ,K^0 0@\0@,6 0 PP㬻=2B P\`, 06/2B< P\`,< 06/2< ,p2B P\`, 06/0 0@0@(KMAC -MLM2S6Ё;66=@S (K1bKSIO PP 0 SfBThš0 \š2A02 0\  00š0C1$ 0 0l2R @` \p, 07/1 S& @LP  `Ia1S0 Q BUr0C 00S:A BT  10R`!d!  10C1$};x6;6~34 0p-L@T \2X ,”X P0\ 9 9@/ P` ;@\9 " P 99 )@ 1S2BT P\`,T C?06/p0m9P`@P` -@L”0T \2bX P\p,X 07/2R< `\p,< 07/2R\ `\p,\ 97/”0P \R 5 ; e *2b` p\P,E40` VP08/2bt p\,t <48/2R `\p, 07/9”R@0;9`T \p,T C?07/0i{ -PL8@`p 1T$ 0CT)  00[@4T 0T 0T0/9_@4T@ @-@6 0 R0@@ @06i 5i 6i( p-LP`2S06p40 0@0@ph 04 -Lp@@TP2B| P\`,| <0406/—0T \2RX @\`,X 06/2 ,P — 8 ${2|"} ,— $ 8y"x2z ,022 ,P0Z—0x2y , < (}z2 0{"|2 0-LM@`BP Pa•/0 +pPXor0T!8@@(c@o0Xh 0Ph0!1! 90! |101"0 2"  0娂]  0p'l"R  ^W-Z l0P(K"0^"^@<8T4x䁐hlkL4t4OpenBSD5.7RAMDISK-SUNXI#8 @(#)OpenBSD 5.7 (RAMDISK-SUNXI) #8: Wed Mar 11 18:05:45 AEDT 2015 OpenBSD 5.7 (RAMDISK-SUNXI) #8: Wed Mar 11 18:05:45 AEDT 2015 jsg@armv7.jsg.id.au:/usr/src/sys/arch/armv7/compile/RAMDISK-SUNXI expand 32-byte kexpand 16-byte k n;AvXaM ְdx Copyright (c) 1982, 1986, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. Copyright (c) 1995-2015 OpenBSD. All rights reserved. http://www.OpenBSD.org d8pXP8 $$extent_freepool_p_freepr_find_pageheadpool_do_getpool_init@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~!#$%&'()-0123456789@ABCDEFGHIJKLMNOPQRSTUVWXYZ^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{}~Ͼ󨷵ǎԐѥ噞᷵ǎԐѥ???????????????????????????????? !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????U4a`UXV|WTV|UhU'|Un; &C vkkMPG&"֊/aK+d 5ӆ1 q^h,`@yFgKrޔԘJk*OņךUfϊDx%K]?!HpcwucB0 mL5&/ᾢ5̈9.WUGz+2ўfD~T; ʌ)k<(yv;VdNtے lH]nCĨ917Ӌ2CYnڌdҜI%ϯʎGooJr\$8WsQ#|!>ݖa B|qؐ_jiX':'8+3"p3-"< IxPzY e1ƄÂ)wZ{m:,PPPPPPPΑΑ Α,Α<ΑHΑTΑ`ΑlΑtΑ|ΑΑΑΑΑΑΑΑΑΑΑΑΑ֒ΑΑieee80211_newstateΑpԒ3<0 tG(Α9$ϑ!ϑ08ϑ0d ϑ40ϑ`ϑRDULϑpϑT ϑ|" (֑5XX$ϑR(ϑ,ϑ0ϑ74ϑ6D7P78ϑ <ϑ72@ϑ@7Dϑ6Hϑ7LϑPϑ6 ఑0,Tϑ@XϑX\ϑ!T`ϑdϑ6\hϑ5h#tlϑ7xdppϑlÑR`ȵ7|07tϑAxϑH|ϑCϑJϑKϑϑϑ@ϑIϑϑEϑEϑϑϑϑ5Ƚϑ7ۑ7ϑ8t ϑ0'ϑϑ!ϑϑ.ϑϑ7B<7*ϑ" Oϑ\`ϑJϑh 7vϑl7Xϑzϑ(ݒϑϑ7ϑBБ7ő6Б*EБ6 Б6 Б0БG$Б:Б7HZ БE\$Б:^ߒV(Бw,Б0Б74Б@@@ @@ !" 1:7 25@608 943 @ A BC D@EFGHIJ K RSTU V X`abcdefgh ij8БT@БUHБSTБR`БhБFpБIxБVБEББGББBББXББDББ Б7Б@Б5ББ2ё6ёё8ё0 ё(ё90ё8ё4@ёHёPё Xё3`ёhhё@pёxёёё"ё ё!ёё:ёё1ёёHё@ёJёKёAёёCґ ґґ@ґPёXёfґg$ґ`,ґa4ґb<ґcDґdLґeTґi`ґjhґpґpґ arp_rtrequestigmp_init}E#(DoKgpqrstuvwxyzzHywwPQSeA~ä^':k;EXKU0 mvv̈%LO*ŀD5&bIZg%E]u/LFk_zmYR-!tX)iIDɎjuxyk>Xq'Of ɴ:}Jc1`3QESbwdk+XhHpElޔ{R#sKrW*Uf(µ/{ņ7(0#j\+ϊyiNeվb4ъĝS.4U2u9 `@q^Qn!>=ݖ>FMT]qoP`$C@wgB谈8[yG |B| H+2pNrZlV8ծ='9-6d !\hT[:.6$g WҖO aiKwZ *C"< Nj򹨶-ȩWLuݙ`&r\;fD4~[v)C#hc1cB@" Ƅ}$J=2m)K/0R wl+pH"dGČ?,}V3"NI8ʌ6 Ԙρ(z&ڤ?:, xP_jbF~Tؐ^9.Â]|i-o%;ȧ}nc{; x&Yn쨚Oen~ϼ!ٛ6oJ |)11#?*0f57NtʂАا3JAP/MvMCTMўjL,QeF^]5st.A ZgRے3VGmaךz 7Y<'5ah,4$8_@r %⼋I<(A q9޳ ؐVda{p2t\lHBWЧQPeA~S^':k;EXK0 Umvv̈L%O*D5&bZI%gE]u/LFk_眒zmYRڃ-!tXiI)ɎDujyx>Xkq'Oᾶ f:}Jc13Q`SbEwdk+hHpXElޔ{Rs#KrWUf*(µ/{ņ7ӥ(0#j\ϊ+yiNe;b4ĊS.4U2u 9`@q^nQ!>ݖ=>ݮMFT]qoP`$֗C@̞gwB谽[8y |GB| +2HprZlN8Vծ=9-6' d\h!T[.6$:g WґO aKwZi *"4$8,@_r% I<( A9q ؜Vd{a2p\lHtWBQPA~Seä':^;kEXK0 Uvm̈v%LO*5&DbIZ%gE]/uLFk_mzRY-tX!I)iɎDujxyXk>'qᾶO f}:cJ1Q`3SbEdwk+HpXhEޔl{Rs#KrWUf*(/ņ{7ӥ(0#j\ϊ+yiNeվ4bĊ.4SU2u 9`@q^nQ!>ݖ=>ݮMFTq]oP`$֗@Cgw谽B8[y|G B| +2HpZlNrV8=-6'9 d\h![T6$:. gWҖOa wZiK *"$8,4_@r %<(I A9q ޳؜Vd{a2plHt\BWQP~SeAä:^';kEXK U0mvv%LO*&D5bIZ%gE]u/LFk_zmYR-X!tI)iDujxyk>X'qOf }:cJ1`3QbESwdk+pXhHElR{#srKWf*U(/µ{ӥ70(#j\+ϧyNieվb4Ċ4S.U2ኤu 9@`^qQn>!=ݮ>MF摵Tq]o`P$֗齉C@gwٰB8[yȡG ||B 2H+plNrZV8=ծ6'9- dh!\T[$:.6 g WҖOa ZiKw *h8,4$_@r %(IKy xZݨ31Y'_`QJ -zɜ;M*q//^SShѹ,` @ȱy[[jjFˍپgK99rJJLLXXJυkл*媪OCCMMU33fEEPPD<KKܽa ppB>>|ĵqffHHaa_55jWWйiX':'8볘+3"iip٩3-"< I·UUx((PzߥY  ڿe1BBhhAA)w--Z˰{TTֻm:,ccƥ||ww{{ kkֽooޱőT00`PggΩ++V}׵bMvvʏEɉ@}}YYGG AԳg_Eꜜ#Srr[u=&&Lj66lZ??~ÃO44h\Q4qqثs11bS*? ǕR##FeÝ^0(7 / $6=&''Niuu ,,Xt4.6-nnܲZZ[RR;;vMַa}))R{>//^qSSѹh, @`y[[jjԾˍFg99rKJJLLXXυJлk*OCCMM33fUEEPP<!KKݽa܋ pp>>|Bqff̪HHaa£55j_WWiІX:''8+"3iiһ٩p3-<" ·IUU((PxߥzY e1BBhhиAAÙ)--Zw{TTm,:cƥc||ww{{ kֽkoޱoőT0`P0gΩg+V}+׵b׫MvvʏEʂɉ@}}YYGG AԳgԢ_Eꯜ#Srr[u·=&Lj&6lZ6?~A?̃O4h\4Q4qqثs1bS1*? ǕR#Fe#Ý^0(7 / $6=&'Ni'Ͳuu  ,Xt,4.6-nܲnZZ[RR;vM;ַaֳ}γ)R{)>/^q/SSѹh, @` yȱ[[jԾjˍF˾gپ9rK9JJLLXXυJлk*OCCMM3fU3EEPP!KKaܽ pp>|B>qĵf̪fHHa£a5j_5WWiйX:''8+"3iһi٩pَ3-<" ·IUU(Px(ߥzߌY  eڿ1BBhиhAA)-Zw-{˰TTmֻ,:ƥcc||ww{{ ֽkkޱooT`P00ΩggV}++bM櫫vvE@}}YYGG A쭭g_E꯯#Srr[u·=Lj&&lZ66~A??Oh\44Q4qqsbS11*? RFe##^0(7 / $6=&Ni''Ͳuu Xt,,4.6-ܲnnZZ[RRvM;;a}γR{))>^q//SSh,@` yȱ[[ԾjjFgپrK99JJLLXXJϻk*O媪CCMMfU33EEPPxD<<%K㨨QQ]@@?!pH88c߼wuBc!! 0mҁL &5/__5DD.9WU~~zG==Ȭdd]]2+ss``OODf""T~**; FF)kӸ(<y޼^^ v;dV22tN:: II Hl$$\\]½nCשּׁĦbb917yy2CnY77ڷmmd՜NNI੩شllVV%ʯeezzG鮮oպxxJo%%\r..8$WsǴQ#|tt>!KKaܽ pp|B>>qĵ̪ffHH£aaj_55WWiйX:''8+"3һiip3-<" IΪUUPx((zY  eڿ1BBиhhAA)Zw--{˰TTmֻ,: @6؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHG"(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDlɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~[/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxqg jgrn<:ORQhك[Z H!x-ML.RN8D( `hz=Skc|j9{Б/Uڅ?AZX_f ؐ53eiEVmv° GJBnI[#Q")yq~ ruo7ӎbwO$26󦻬^lW%㽨:Y*F?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@h։։Չ(8숉腉$׉  0ߑ<ߑ HߑTߑuao_find_swhash_elttvmmapbsy\nd6_rtrequest_bus_dma_busaddr_to_paddrApېAxې Aې`AېAې`Aې`Aې`AېPTېAې AېD<ܐD|ܐiܐ iܐ i<ݐ $i|ݐ0$i|ݐ ,i|ݐ0,i|ݐ .i ݐ0.i0ݐ!i@ݐ !iHݐ)i@ݐ )iHݐ-i@ݐAiP<ސ -iHݐAiX|ސAih|ސAix|ސ`Aې`AېPA ېpA ېA ېA ې/A ې?A ېA ېA ې/A 4ې?A HېOA \ېA pېA ې/A ې?A ېOA ې!$08HP`\hppx(8HPX`hpxHpxH`hpxPX`$0<HT`lX$px$X`hpxPX`hpx$0<x$0  (4PX`hpx((((4Ld((0(@(P(`(p(|((((((( 0pmap_fault_fixuparmv7_attacharmv7_find_dev!A  !@@@@4VSL D'2X'Ðl'XhQLca(`L'2'2(l++++++++++,, ,,,<,HQP,p,,,,,,-8-T---p0--. .@.d.......,/\////$0X00 0 0 (1 d1 112H2h2222,3\3333$4@4h4444 5 $5 <5 T5 h5 5 5 5 5 5 5 $6 X6 6 6 6 7 7 H7 p7 7 7 7 8  8 @8 `8 8 8 8 8 9 H9 d9 9 9 99 :(:D:X:|::: ;4;L;d;;;;;;< 4< D< X< < <<=$=@=`=|===>(>D>X>x>>>>??8?X?????@D@t@@@@A@AtAA AB4BlBBBBBCDC`CtCCCCCDD0DLDpDDD D D E TZ>Z>Z>Z>Z?Z?([?@[?`[?|[?[?[?[?[? \? $\? D\? X\? p\?\?\?\?\?\? ]?(]@D]Ad]B]C_D]Dq]E]F^G,^G@^G`^G^G^G^G_G(_HX_I_J_K_K_K_K`K`K$`K8`KT`Ld`N`P`P`P`QaQaRDaSTaSpaSaSaSaSaSbS0bSLbTdbUbUbUbUbUbUcU@cU`cUlcU cU cU cW dX0dYLdZ`dZdZdZd[d[d[e[,e\He\\e\te]e]e]e]f]Lf]f]f]f]$g]Xg]g]g]g]$h]Xh]h]h] h]!0i]"hi]#i]$i]%j]&Dj]'|j](j])j]*k]+Lk],k]0k]1k]24l]3ll]4l]5l]6m]7Pm]8m]9m]:m];(n]<\n]@n]An]Bo]C8o]Dlo]Eo]Fo]Gp]H0p]I\p]Jp]Kp]Lp]P q]QXq]Rq]Sq]Tq]U(r]VXr]Wr]Xr]Yr]Z s][Ps]\s]`s]as]b(t]c\t]dt]et]ft]g0u]h`u]iu]ju]ku]l(v]dv^v^v^v^v^w^Dw^hw^w^w^ w^ x^A0x^BPx^Clx^Ex^Gx`xaxaxayb yc䷒?lԒ[ 0$040D0#T0*p0 ~   #ĸ Y$иv@ܸU(DPDhDtDDD D D D "T@Dxxxx   3 Ĺ! ̹1b蹒1T(@k }Y (@L\ l0|123࠺5$7ĺܺA --0-@sMTfff `f hff쓒f쓒fff$f $f @ BpG ĻԻ仒 !$,<L\l̼ܼ켒 ,<L\l|ĽԽདྷ$ 0 <HX d+t1A<)0` Ⱦ Q ؾ 侒 0D)FeXl  Կl7l71( 1ђ'D0D 8& D& L& `& t& |& & & & & ]D lԒ $0<Pdx     ’$’(’4’L’d’t’’’’,1`’’’’Q’’WÒ Ò$Ò0Ò8ÒLÒÒÒÒÒ Ò Ò\Ò pÒ |Ò |Ò  B6Ò< Ò< ÒÒÒ Ò Ò Ò Ē" Ē( Ē) Ē* 0Ē0 8Ē< @Ē? HĒD E G H L TĒP $ `Ē@ pĒ ĒĒ0Ē2ĒUĒAĒAĒAĒĒĒĒĒ}WȒSŒl ŒEŒ 04Œ0LŒTŒhŒ ŒŒhŒ}Œ}Œ} Œ}^}PŒŒƒƒ$ƒ4ƒDƒƒDƒ Tƒ Tƒ dƒ dƒ tƒtƒŒƒ$ƒ4ƒƒƒƒƒƒƒƒƒƒQ ȒQ ǒF ǒF ! 0ǒ Dǒ \ǒ tǒ ǒ  ǒ 0ǒ Pǒ XǒXǒX ȒX $Ȓ8Ȓ DȒPȒ\ȒdȒ!pȒK0r|ȒȒȒ= ȒDȒ1Ȓ1Ȓ1Ȓ79ɒ7pɒ7qɒ7s$ɒ7w0ɒ7x7y<ɒkHɒk Xɒk `ɒk"pɒk"ɒk"ɒk"ɒk"ɒk"ɒk"ɒ{&"l{"ɒ{"ʒ3"ʒ6"(ʒk @XɒF4ʒ@ʒ DbcdfHʒhXʒihʒmxʒmʒmʒmʒmʒmʒmʒmʒm!ʒm@ʒmPLm ˒m(˒m<˒mT˒mh˒mx˒m˒m<˒m˒m˒m˒m˒mx˒m<˒m˒m˒m ˒m ˒m ̒m ̒m 4̒m L̒m d̒m̒m̒m̒m̒m ̒m0̒m̒m ̒m̒m͒m8͒mH͒m\͒ml͒m|͒mŐ͒mʒ͒͒͒͒@ Β~Β̒0Β========== = = = = =================== =!="=#=$=%=&='=(=)=*=+=,=-=.=/=0=1=2=3=4=5=6=7=8=9=:=;=<===>=?=@=A=B=C=D=E=F=G=H=I=J=K=L=M=N=O=P=Q=R=S=T=U=V=W=X=Y=Z=[=\=]=^=_=`=a=b=c=d=e=f=g=h=i=j=k=l=m=n=o=p=q=r=s=t=u=v=w=x=y=z={=|=}=~================================================================================================================================= <Β\Β0TΒdΒlΒ|Β Β Β8ΒΒΒΒ ΒΒϒϒ0ϒ'Lϒ=`ϒDtϒ^ϒfϒgϒnϒϒϒϒВВ В0В@В.PВHPX`В]lВoxВВВ>В0 В$ВpВcDcD@В  g 8 !8 "8 p8 q8 ahș ehș ihș thT whT h  * + , aT    tT w p zE ВE bђE t ђ9ђ^0ђ^ Lђ^ \ђ^dђ^|ђ^ђ^$ђ^%ђ^+ђ^nђ^yђ^z^ђ^Ғ^@Ғ^lҒ^Ғ^Ғ^EҒ^JҒ^OҒ ӒӒ$Ӓ0Ӓ<ӒPӒdӒ<ӒpӒpӒӒcӒz Ӓ@Ӓ @Ӓ @Ӓ@ӒӒddiӒ ӒBԒBȒBԒw(Ԓw8Ԓ0wPԒxdԒ xtԒ0xԒ2xԒ@xԒcUԒ""(Ԓ"IԒ" `Ԓ"'`ԒAԒQՒ 1 2 Ւ Ւ_0Ւ_8Ւ_Ւ_@Ւ_HՒ_TՒ_dՒ_sP_tՒ_A|ՒeaQՒՒՒ#9 ɠՒՒՒ Z8 IՒ  Ւ U8 U8 Ւ Ւ Ւ ֒b X֒ P0 ֒ `2@֒ P`֒%֒%@֒%֒FȒFȒF F@֒FA֒F0B֒F@BF`B֒FC֒FC֒Fj֒F֒F֒FגF!$F0גF@גFA גdA,גdA4גPB@גQB@ג_Hג_HגFA0VH$PגXג`גp' 4hג!xג!גג ג!Tq0גג ג0גגג ג0ؒP ؒ!ؒ! ؒ $(ؒA0ؒD8ؒP ؒ0PHؒ1PPؒ`\ؒ`dؒ lؒ awؒؒؒؒ9 ȒؒؒWؒXْْْؒؒؒؒ,ْ Hْ\ْUtْW|ْWْW wْWPْhْXhْuq0ur0Uْ0ْ0ڒ0ڒ0(ڒ0 4ڒ01@ڒ0@Pڒ0P\ڒ0`hڒ0axڒ0pڒ ڒڒ9ڒ9ڒPPڒPPڒPPڒPPڒPPڒPPڒPPےPPےPPlԒPPlԒPP0ےPP@ےPPPےPP`ےPPhےPP xےPP ےPP ےPP ےPP ےPPےPPےPPےPPےPPܒPPܒPP ܒPP(ܒPP4ܒ MM MMM} @@ܒ} Hܒ} } ePܒeȒedܒeȒJ@xܒJ%@ܒ6ܒqܒqܒq7ܒq8qܒqܒqݒqݒq ,ݒqLݒq`ݒqxݒqqݒqjݒq0ݒq2ݒq3ݒq6ݒqݒq "8 ݒ3ޒޒ 8,,ޒ 2<ޒ I0SSLޒSS SXޒ Shޒ tޒޒޒޒ $ޒ % (ޒ )ޒ *0 +$ .0 Pޒ ޒ ޒ ޒ ߒ   ߒ ߒ 0 (ߒ`8ߒphגZȒZ ȒZ 0Dߒ: Xߒ: Xߒ85pߒaߒaߒaߒaߒa@ߒaAߒaEߒa`ߒaaߒaߒaߒaߒaaM aMaM${4{H{\{#\{#l{#{%{ \{\{\rS#\~aT)bT8bTYb 1`f`$1@c\xxd x288bTS&@\WQdtșp p%șs%Tq&p'p(p0q0r0p3r5$pSs5rUvp ș!T  1 P Q R S p` q r s( t0 v0 w8 x$ z0 {0 |D } ~`  D P 8 P \ P h p T0 쓒[Sx02345679:; >0@Pdt    #4'D)X+l*3 !R 'lԒJb$8Lc`tt]  hch]<ӒR !R !R ! R ! R 4R "HR !"dR "R ""R "R #"R $R !$R 1$ R A$ ? @ A B E G H K M P Q R0 \0 _ `, a$ b8 D p$ rL qT u \ d #lԒt8$ $% $% $$$$$$$$$$$$$$$ $0$0$\ \ $<P` !LpL%|L+L-L.L2L8L\L]LaLf(Lm4LLLXLpL|LiLWLy33.TU KKPD4 Tu B@0t@Phx   n ZZJ ZPZP ZP(i8dlԒ Lgdg|ggggg g g (g @gTglgg0  0 W#$  Mb$ d0x$  3 7 A oF~0,~0,~ 0<~ 0H~ 0T~0~0d~2p~2~2@|000`@_33x x         , < !L\h<U8 8C@CTChCSApS!$1!160ș0 P `( c@ fX gt !g i i qi r 3C0HC#UH#U`#uxjjjjj!$8D5&T5'5`5h5&5'5*5)xE Er r \{1@@@@O ,P8 @ H T \      " #d % &lWZ`șWZWZWZWZWZWRt    !   444 4 4 444444T44444 4$>4@(S4L#\Ldl   $,!<"D#P$l(068=@NOQ V4WDXhZt[^acdjkmnq tx$|0}8~DLX`t|(   @Llt  $ 0 @ H P h p x            , D "` %x ' ( ) @ C E G L S V W, ]@ _H eH bX ep f j l m n r s v { |    , <  P d l             ( 4 < \ h x          0@X lx $H#678D^ckno$u0w8x@{T|hph 08@T`tl14BEN0U@]Xc`dhit{}<08<DLT`lt(8@H'\-h5t03:AFSTVZd np$|0}HPdt  0 L \ h x! ) 0 < O Q V W Y Z $g v 0x Hz T d p             0 @C PF `G h\ pk |y          9 ; 8A Lb o \~ ` x            4& 83 @E PR xl v }  X   : = F \ }  , 0 @ \ p   U^fg~ ,\8@T=\hp `<>DPc`el v(<D8HLTTTd p401EKcf$h4 <3LALJTg\olt|, Bq  $50S@WLrXtdl04'FUW~10EDhLjd{ lt&7@a t  $ , C8 @ H /L 8T h 2@t a y  = g u   ! !!!0!H!4\!Mh!t!)!!!!  4= ! ! !!!! !!"`A#!W#!x$"p'"!(",41("43<"85@"y5D"#9X"9p"@"A"@$@eaQ@X@W@@0@ w@Q2@U@4@F s%^^DĤdDĤdt\ďď8Ώ`͏=lR*o o]opqIssJsRHt7t Zu u u uKu`v@#jv`v`v`v`v`v `v`vH@`v Nv _Lw xny\{ { { {E{ t|m|Kf}A}[~~40R €jԁ?ȂnF "J6ʄabcde f g h i jklmnopqrstuvwxyz1!2@ 3#!4$"5%#6^$7&%8*&9('0)( ) *!+ , --_.=+/[{0]}1\|2\|3;:4'"5`~6,<7.>8/?9:;<=>?@ABC D E FG HIJK,L.MN-OPQRS T/U*V-W+X Y1Z2[3\4]5^6_7`8a9b0c.eh i jklmnopqrstuvwx yz{|}~ mMqQ@zy2" 3#6&$7/{%8([&9)]'0=}-?\./0+*1#'2#'345 6,;7.:8-_d<>| .'`0+*~5^q,?azw&12~ "3#!'4{"(5[#-6|$7`%_8\&9^'0@-)].=+}/0$1*2*3m4%56;.7:/8!d<> bBeE hH iI jJkKlL|,?nN~aArR,sSzZyY2 "3!'4"(5{[#6$7%!8&9%!8'0-)}].-_/0$*2`@#3mM4%5@#7:/\8=+g= aAkK~xX}iIpP& eE ,; c d tsrqQ'?ljbB|oOuUv.:yY{!\"12< 3>!(4[")5]#@6$+7%-8&/9'*0, _-=^.%`/z0w123n4m5$#6gG7h8fd/ 2"@ 3#!4$#6&$7/{%8([&9)]'0=}-+?.|/01'*2'*3456,;7.:8-_d<>\ .'`|0^~2" 3"5%#6&$7/%8(&9)'0=-'?.^/{[0+*}]123@4#5\|6,;7.:8-_d<> 1!2" 3!4$"5%#6^$7&%8*&9('0)--_.=+1#~2#~4'@5``d\|2"#6&$7'%8(&9)'0--=.^~/@`0[{1]}2]}3;+4:*5\_\|-+?\0345d<>| .'`|0^~.\0345|d<>.\`0^~xje.> u i d c htnbrl'"poygk,<qf;:-[{.]}//?0=+3s4-_6w7v8z9: ;<=>?@ABCD E 1!|2"@ 3#!4$~#6&$7/%8(&9)'0=-'?./[0+*]1}2}34{5\6,;7.:8-_d<> q,?azw&1|2@ "3#!'4"(5#6^$7%!8&9{'0}-).-_/[0$*]1`2`3m4%56;.7:/8=+~d<>\ aAD$bB8cCA!dD2eEC# fF0 gG? hH@  iIH( jJ>kK;lL4mML,nNB"oOI)pP7qQ9rR:sSK+tT5uU3vV<wWF&xXG'yY=zZO/#6^6,$7&7./[{E%0]}J*3;:64'"M-6,<17.>N.8/?Q aAD$bB8cCA!dD2eEC# fF0 gG? hH@  iIH( jJ>kK;lL4mML,nNB"oOI)pP7qQ9rR:sSK+tT5uU3vV<wWF&xXG'yY=zZO/#6^6,$7&7.--_V.=+T/[{E%0]}J*1\|W2\|W3;:64'"M-5`~6,<17.>N.8/?Q eEzy1+|2"@ 3*#!4#6&$7/%8(&9)'0=-'?./[0!]1$}2$}34{5 6,;7.:8-_d<>\ -'?.^`~0!]/[34{2"@ 3##6&$7/{%8([&9)]'0=}-'?.<>/+*012345\|6,;7.:8-_d<> .+*/2\|4eE a`~}kj!1@-2_ /3#!;4$":5#,6^$.7&%=8*&[9(']0), -?+'.xX%//.{0wW}1qQ|2qQ|3sr4"5`~6   7fF 8\ qQ@1!2" 3##6&$7/%8(&9)'0=-'?\./0+*~1}]2}]34{[5|6,;7.:8-_d<> 1!2@ 3#!4$"5%#6.=+/0[{1]}2]}345'"8;:c.d\|/? 1IqQ@2' 3^#!4+$"5%#6&$7/{%8([&9)]'0=}-*?\.-_/0~1,;2,;3_^4i05"678.:d<>| /1,;`2,;`3_^'aAcCeElLBAnNDCoOsS[ZxXzyzZ|{ bB{cC& fF[ gG] iI jJnN}qQ\vV@wW|xX#zZyY>1'~2" 3+^!4!"5%#6/$7=`%8(&9)'-./QP01qp2qp3$4506,?;7.:8-_*d< bB{ fF[ gG]kKBlLAmMnN}qQ\vV@wW|zZyY1!~2" 3#^!4$"5%#6&$7/`%8(&9)'0=-'?.+*/a`01~}2~}3  456,;<7.:>8-_d<> mMoOpP1!2"@ 3/!4$"5%#6?$7&%8*&9('0)--_.=+/[0']1<>}2<>}3;:~4{5#|\6,'7..8d /^^[0]4``{8aAcC  eE gG#" iI+*kK76lL<;nNFEoOMLsSa`uUkjzZ~} cCmMrRsSxXzZ1!2" 3#!4$"5%#6&$7_%8({&9)}'0'-/?\.'/0*|1<>2<>3+45@6,;7.:8-=d][ .~/"^4'`eEqQ@2"#6&$7/{%8([&9)]'0=}-\.-_/0'?~1+*`2+*`3456,;7.:8d<>| 4^    ڏTڏ@ڏ܏ۏ|ۏ܏܏5dd5(I*LBCDOMPJQNRK(I*LCDEOMPJQNRKd4(L (  2 v      W 1 Q `  @  0 2 A@ A   @  @ @   P0 P  A   h }  } } } @  85     L+ L L2 D   O  {o  A @720@02_D0H0L0\0;51.`0,***|00 0 l(000400000#0 00s"D#4$%&'0 8  "%')`56<=>KVXZcfk3 3 3 3 3 3 3 3  3  3  3  3  3 3 "3 f`&3 g`*3 h`.3 i`$3 f`(3 h`,3 i`03 j`43 k`83 l`<3 n`@3 o`d3 h3 l3 p3 t3 x3 |3 3 3 3 3 3 3 3 3 3                    " f`& g`* h`. i`$ f`( h`, i`0 j`4 k`8 l`< n`@ o`d h l p t x |           # $ Zp [ \( #"<$<-.q2q"<<<>> probing for %s* mapply: no match function for '%s' device>>> %s probe returned %d >>> %s probe won >>> no winning probe %s at root%s at %sroot device %s not configured not configured unsupported /dev/%s%s%ccannot obtain vnode for 0x%x/0x%xcannot open disk, 0x%x/0x%x, error %dcannot read disk label, 0x%x/0x%x, error %droot filesystem has size 0filesystem type %d not known.. assuming ffs use one of: exit %s[a-p]dkopendisklabels not read:root device (default %sswap device (default %s%s)%s%d%croot device (%s) not foundnetbootroot on %s%ccan't figure root, hope your kernel is right (%02hx%02hx%02hx%02hx%02hx%02hx%02hx%02hx.%c) swap on %s%d%c dump on %s%d%croot device (%02hx%02hx%02hx%02hx%02hx%02hx%02hx%02hx) not founddisk_unbusy: %s: dk_busy < 0 disk_detach: disk_count < 0dklkdisk_attach: can't allocate storage for disklabelwrit%s%d%c: %s %sing fsbn %lld%lld of %lld-%lld (%s%d bn %lld; cn %lld tn %lld sn %lld)extnt%s: start 0x%lx, end 0x%lx %s: region not foundextentplklog%s: %s: page empty%s: %s free list modified: page %p; item addr %p; offset 0x%x=0x%lx != 0x%lx%s: %s: page header missing%s: %s: incorrect page%s: %s free list modified: page %p; item addr %p; offset 0x%x=0x%lxphpool%s: too much uptimepoolsdma%d0123456789abcdef%llo%llx(null)0123456789ABCDEFbug in kprintf: bad base%s: table is full panic: splassert: %s: want %d have %d spl assertion failure in %skernel %sassertion "%s" failed: file "%s", line %d*FOUND**UNKNOWN*0%o0x%x%3d free slot (for add) %3d %s count %d disable (pseudo device) Unknown devno (max is %d) %3d at ??? %s flags 0x%x %s [] ? Unknown argument command args description [count] number of lines before moredev add a device8|10|16 base on large numbersdevno|dev change devicesattr val|devno|dev disable devicesattr val|devno|dev enable devicesdevno|dev find devices this message list configuration leave UKC[attr [val]] show attributes (or devices with an attribute)[mins [dst]] set timezone/dst toggle verbose booting don't know--- more --- Error unknown state already enabled %3d can't enable free slot %3d %s disabled %3d can't disable free slot already Unknown routine /%c/ Value missing for attribute Unknown attribute change (y/n) ?out of memory. flags changed %3d can't change free slot count%3d %s changed Unknown pseudo routine /%c/ %s ? Not same device type No more space for new devices. Device not complete number or * is missing No device of this type exists. Clone Device (DevNo, 'q' or '?')Insert before Device (DevNo, 'q' or '?')Unknown command, try help Argument expected Dev expected 8|10|16 expected DevNo or Dev expected Attr, DevNo or Dev expected timezone = %d, dst = %d disautoconf verbose %sabled Unknown command User Kernel Config UKC> Continuing... addchangedisableenablefindhelplinesquitshowtimezoneverbose?pollselectpipeplpipelkpipeclpiperdpipewrttckoutqload: %d.%02d not a controlling terminal no foreground process group empty foreground process group runningrunnableiowait cmd: %s %d [%s] %lld.%02ldu %lld.%02lds %d%% %ldk ttyrub: would panic c = %d, val = %d m_copydata: off %d < 0m_copydata: len %d < 0m_copydata: short mbuf chainm_copydata: null mbufm_copym0: off %d, len %dm_copym0: short mbuf chainm_copym0: m == NULL and not COPYALLmbuf prepend length too bigmbufplmtagplmcl%dkm_apply: len %d < 0m_apply: off %d < 0m_apply: null mbuf in skipm_apply: null mbufWARNING: mclpools limit reached; increase kern.maxclustersrequested tag size for pool %#x is too bigm == NULL in m_pulldown()unixsoaccept: !NOFDREFnetclssoclose: NOFDREFsockplsbcreatecontrol: message too large %d sbdropsbappendcontrolsemi-panic: sbcompressnetlcknetiosbappendaddrnetcon2netconacceptunp_disconnectunp_connect2unp_attachuipc 1uipc 2uipc 4piusrreqinconsistent bufpage countsbiowaitbufplbiodone alreadyneedbuffernobuffersbuf_get: dup lblk vp %p bp %pgetblkbuf_needvabufinit: can't reserve VM for buffersnchplwtf? leak?vop_generic_revokeallnameilf_findoverlap: defaultlockfplrelookup: null namerelookup: lookup on dot-dotbrelvp: NULLbgetvp: not freevflushbuf: not dirtyvflushbufvinvalbufvinvalbuf: dirty bufsvinvalbuf: flush failedvwakeup: neg numoutputsoftdep %d vclean: deadlockvclean: cannot reclaimvclean: not cleanvgonemissing aliasvgonel: not cleanmissing bdevvgetvnodevfslockunmount of %s failed with error %d WARNING: some file systems would not unmount retrying syncing disks... giving up done vnodesuvmvnodessyncer vnode syncermount: lost mountunmount: dangling vnodevn_lockspec_badop calledspec_ioctltag VT_NON, dev %d, %d spec_close: not specialspec_fsync: not dirtyspec_fsyncspec_read typespec_write typechkvnlockdead_badop calleddead_write: lockdead_read: locktag VT_NON, dead vnode dos2unixtime(): month value out of range (%u) detrunc(): can't truncate root directory, clust %u, offset %u deextend: file too largedenodedeget(): pcbmap returned %d extendfile(): attempt to extend root directory extendfile: pcbmap. .. doscheckpath(): .. not a directory? msdosfs_sync: rofs modRRaArrAatag VT_MSDOSFS, startcluster %u, dircluster %u, diroffset %u (LOCKED) dev %d, %d, %s msdosfs_strategy: specmsdosfs_rename: lost to startdirmsdosfs_rename: lost from startdirmsdosfs_rename: updating .. in root directory?msdosfs_write(): bad file typebpfattachbpf_mcopybpf: ifpromisc failedbpf_detachd: descriptor not in listbpfbpfszifa_update_broadaddr does not support dynamic lengthegresstoo many interfaces%s: can't handle af%d looutput: no header mbuflo%dunable to create lo0loifmedia_add: can't malloc entryifmedia_set: no match for 0x%x/0x%x ifmedia_set failedcan't establish softnet handlerrtmaskrn_init: radix functions require max_keylen be set rn_initrn_init 2rn_delete: inconsistent normal annotation rn_delete: inconsistent mklist refcount rn_delete: inconsistent dupedkey list rn_delete: inconsistent annotation rn_delete: couldn't find our annotation Mask for route not entered rn_addmask: mask impossibly already in tree %s %p at %p rn_delete: Orphaned MaskNon-unique normal route, mask not entered raw_usrreqrt_timer_remove_all: rtq_count reached 0 rt_timer_add: rtq_count reached 0 ifafreertfree 2rtfree: %p not freed (neg refs) rt_timer_init: already initializedrttmrrtrequest deletertrequest1 RTM_RESOLVE: wrong ifa (%p) was (%p) rt_timer_timer: rtq_count reached 0 rt_timer_queue_destroy: rtq_count reached 0 %s: wrong ifa (%p) was (%p) rtentryroute_init rtable_addroute_outputrouteunexpected mode %uUnexpected mode %u%s: invalid channel freq %u flags %x %s: invalid channel (NULL) Bad IBSS channel %u%s: bad channel ignored; freq %u flags %x number %u wlanPairwise key expansionPMK Name%s: Michael MIC failure %s: %sassociation failed (status %d) for %s %s: received %s from %s rssi %d mode %s 80211scanfreeing bss nodeunable to setup inital BSS nodeactivepassive%s: end %s scan %s: begin %s scan invalid group data cipher!invalid integrity group cipher!management frame too large: %unull node%s: sending %s to %s on channel %u mode %s %s: failed to queue raw tx frame %s: no node for dst %s, discard raw tx frame %s: station %s deauthenticate (reason %d) %s: station %s disassociate (reason %d) %s: received msg %d/%d of the %s handshake from %s group key4-wayEAPOL-Key frame too large: %u%s: sending EAPOL-Key request to %s %s: sending msg %d/%d of the %s handshake to %s %s: open authentication failed (reason %d) for %s "0x%s: no recent beacons from %s; rescanning %s: bogus xmit rate %u setupassociatedsynchronized%s: %s with %s ssid .5 channel %d start %u%sMbshortlong protection enabled %s preamble %s slot time%s assoc_reqassoc_respreassoc_reqreassoc_respprobe_reqprobe_respreserved#6reserved#7beaconatimdisassocauthdeauthactionaction_noackreserved#15INITSCANAUTHASSOCRUNauto11a11gturboaeatauazbebgbhbnbrbybzcncocrcyczdodzegf2fifofrgrgthkhnhrhuieiqj1j2j3j4j5jmjojpk2kekpkrkwkzlbliltlvmcmkmomxmyninlnzpaphpkprpyqarusasgsisvtntrtttwuaukuyuzvnyezazwAPL1APL1AAPL1_ETSICAPL1_FCCAAPL1WAPL2APL2CAPL2DAPL2_ETSICAPL2WAPL3APL3WAPL4APL4WAPL5APL5WAPLDAPLDEBUGETSI1ETSI1WETSI2ETSI2WETSI3ETSI3AETSI3W,ETSI4ETSI4CETSI4WETSI5ETSI5WETSI6ETSI6WETSIAETSIBETSICETSIEU1WFCC1FCC1AFCC1WFCC2FCC2CFCC2AFCC2WFCC3FCC3AFCCAFRANCEMKK1MKK1_FCCAMKK1AMKK1A1MKK1A2MKK1BMKK2MKK2AMKKANONEWOR01WWOR02WWOR0WWOR1WWOR2WWOR3WWOR4WWOR5_ETSICWOR9WWORAWWORLDarptfreearp: ether address is broadcast for IP address %s! duplicate IP address %s sent from ethernet address %s arp: attempt to overwrite permanent entry for %s by %s on %s arp: attempt to overwrite entry for %s on %s by %s on %s arp info overwritten for %s by %s on %s arp: attempt to add entry for %s on %s by %s on %s arpresolve: %s: route contains no arp information arpresolve: %s: route without link local address arpresolve: %s: can't allocate llinfo arp%s: bad gateway value: %s %s: malloc failed %s: no mbuf invalid argument to in_lifaddr_ioctlin_pcbinit: hashinit failedin_pcbinit: hashinit failed for lportIPv6 pcb passed into in_pcbconnectinpcbplinternet%u.%u.%u.%uicmp_redirect_timeout: bad route to timeouticmp_mtudisc_timeout: bad route to timeouticmp_erroricmp lenicmp_do_exthdr: m_getptr failureipqeipqip_initaeshmac-sha1deflaterip_attachrip_detachrip_usrreqsyncachetcp_pulloutofbandm_pulldown malfunctiontcp_output REXMTtcp_outputtcpcbtcpqetcp_inittcp_usrrequdp_usrreqipip_input: should never reach herestart = %d, len = %d, fs = %s ffs_alloccg: map corruptedbno = %lld, fs = %s ffs_alloccg: block not in mapffs_freefile: range: dev = 0x%x, ino = %d, fs = %sdev = 0x%x, ino = %u, fs = %s ffs_freefile: freeing free inodedev = 0x%x, bsize = %d, size = %ld, fs = %s ffs_blkfree: bad sizebad block %lld, ino %u uid %u on %s: %s bad blockdev = 0x%x, block = %lld, fs = %s ffs_blkfree: freeing free blockffs_blkfree: freeing free fragcg = %d, irotor = %d, fs = %s ffs_nodealloccg: map corruptedffs_nodealloccg: block not in mapffs_clusteralloc: lost blockmode = 0%o, inum = %u, fs = %s ffs_valloc: dup allocfree inode %s/%d had %lld blocks out of inodes %s: create/symlink failed, no inodes free dev = 0x%x, bsize = %d, bprev = %lld, fs = %s ffs_realloccg: bad bprevffs_realloccg: bad blocknodev = 0x%x, optim = %d, fs = %s ffs_realloccg: bad optimfile system full %s: write failed, file system is full ffs1_balloc: blk too bigCould not unwind indirect block, error %dffs_indirtrunc: bad buffer sizeffs_truncate: newspaceffs_update: bad link cntsoftdep_flushfiles calledffsinodino1plffs_vget: alien ino_t %lluinodeupdate: rofs modffs_statfsWARNING: %s was not properly unmounted WARNING: R/W mount of %s denied. Filesystem is not clean - run fsck ffs_reload: dirty1ffs_reload: dirty2WARNING: soft updates isn't compiled in ffs_mountroot: can't setup bdevvp's ffsroot_deviceffs_fsync: not dirtyffs_fsyncffs_write: nonsync dir writeffs_write: typecheckpath: .. not a directory First bad Second bad %s: bad dir ino %u at offset %d: %s bad dirufs_direnter: newblkufs_direnter: compact1ufs_direnter: compact2mangled entryi_ffs_size too smallufs_strategy: specufs_rename: lost from startdirufs_rename: lost to startdirrename: EXDEVufs_rename: same fileufs_rename: lost dir entrychown: lost quotauvm_addr_invoke: address selector %p (%s 0x%lx-0x%lx) returned unavailable address 0x%lxuaddruaddrhintuaddrbestuaddrpivotuaddrrnduaddr_linuaddr_rnduaddr_hintuaddr_kbootstrapamap_unadd: offset out of rangeamap_unadd: nothing thereamap_lookup: offset out of rangeamap_add: offset out of rangeamap_add: replacing null anonamap_add: slot in useamap_lookups: offset out of rangeamap_splitref: split at zero offsetamap_splitref: map size check failedamap_cow_now: non-resident wired page in anon %pcownowcownowpageamap_wipeout: corrupt amapamapplamap_pp_adjref: overshot targetamap_pp_adjref: negative reference countanonpl%s: can't allocate entryuao_set_swslot: uobj = %p uao_set_swslot: attempt to set a slot on a NOSWAP objectuao_flush: strange, got an out of range flush (fixed) uaoflshuao_flush: weird flagsuao_detuaoeltplaobjpluao_create: kernel object already allocateduao_create: asked to enable swap on kernel objectuao_create: hashinit swhash faileduao_create: malloc swslots faileduao_getpageuao_getudv_faultudv_detachudv_attachuvm_fault_unwire_locked: address not in mapanonget1anonget2flt_noram1fltamapcopyflt_noram2flt_noram3flt_pmfail1fltagain2flt_noram4flt_noram5flt_pmfail2uvm_init: page size not setkm_allocvauvm_km_pgremove_intrsafe: no pagekmallockmthreadvallocwaituvm_km_suballoc: unable to allocate space in parent mapuvm_km_suballoc: unable to create submapuvm_km_suballoc: submap allocation faileduvm_km_init: could not reserve space for kernelkm_pgrmkm_alloc1wkm_free: unmanaged page 0x%lx uvm_map_clean: weird flagsuvm_mapent_addr_removeuvm_mapent_addr_insert: entry still in addr listuvm_mapent_addr_insert: map %p entry %p (0x%lx-0x%lx G=0x%lx F=0x%lx) insert collision with entry %p (0x%lx-0x%lx G=0x%lx F=0x%lx)vmspplvmmpeplvmmpekpluvm_map_splitentry: split address 0x%lx not on page boundary!uvm_mapent_alloc: cannot allocate map entryuvm_mapent_alloc: out of static map entries vmmaplkuvm_map_setup: rw_enter failed on new mapuvm_map_protect: kernel map W^X violation requested uvm_map_teardown: rw_enter failed on free mapuvmspace_fork: no space in map for entry in empty mapfork: encountered a submap during fork (illegal)fork: non-copy_on_write map entry marked needs_copy (illegal)uvm_map: kernel map W^X violation requested uvm_page_physget: called _after_ bootstrapuvm_page_physget: out of memory!uvm_setpagesize: page size not a power of twouvm_pglistallocuvm_pglistalloc: Upper boundary 0x%lx not on pagemask. uvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX uvm_page_physload: can not malloc vm_page structs for segment ignoring 0x%lx -> 0x%lx uvm_page_physload: tried to add RAM after vm_mem_inituvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: pmap_growkernel() faileduvm_pageboot_alloc: out of memoryuvm_page_bootstrap: no memory pre-allocateduvm_page_init: lost %ld page(s) in initsize 0 uvm_pagereallocpagersegpgdaemonuvm_wait emergency bufbackoff pagedaemon: deadlock detected! pagedaemon: wait_pla deadlock detected! pmrwaituvm_wait: failed to free %ld pages between 0x%lx-0x%lx uvm_pmr_split: lost one pmr Flags: 0x%x, will panic now. pgzerowarning: resource shortage: %d pages of swap lost swapdrum_addsw_reg_strategy: swap to sparse fileswstrategy: vnode type 0x%xswap_off: swapdev not in listswap0x%04xdisklabel reserve/dev/%s%d%cblkdev0x%xuvm_swap_init: can't get vnode for swap deviceswapmapuvm_swap_init: extent_create failedswp vnxswp vndswplksbrk: grow %ld failed, error = %d uvm_deallocate with null mapuvn_iosyncuvn_cluster: offset out of rangeuvn_flshuvn_flush: obj=%p, offset=0x%llx. error during pageout. uvn_flush: WARNING: changes to page may be lost! uvn_flushuvn_termuvm_vnp_terminate: io sync wanted bit setuvn_attachuvnsyncuvn_getpageuvn_getNULL pointer passed to ip_ecn_egressNULL pointer passed to ip_ecn_ingressin6_prefixlen2mask: invalid prefix length(%d) in6_are_prefix_equal: invalid prefix length(%d) in6_unlink_ifa: interface address %s has no prefix in6_purgeaddr: failed to remove a route to the p2p destination: %s on %s, errno=%d in6_update_ifa: a destination can be specified for a p2p or a loopback IF only in6_update_ifa: prefixlen should be 128 when dstaddr is specified in6_update_ifa: valid lifetime is 0 for %s in6_update_ifa: the prefix length of an existing (%s) address should not be changed in6_update_ifa: failed to remove a route to the old destination: %s in6_update_ifa: addmulti failed for %s on %s (errno=%d) prefix ioctls are now invalidated. please use ifconfig. nd6_prelist_add succeeded but no prefix invalid argument to in6_lifaddr_ioctlin6_ifawithscope: output interface is not specified %s: got interface identifier from itself %s: borrow interface identifier from %s %s: interface identifier generated by random number %s: failed to get interface identifier %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x %s: no ifid available in6_ifattach_linklocal: failed to configure a link-local address on %s (errno=%d) in6_cksum: mbuf len (%d) < off+len (%d+%d)in6_cksum: out of datainternet6icmp6_redirect_timeout: bad route to timeouticmp6_mtudisc_timeout: bad route to timeout(src=%s dst=%s tgt=%s)ICMP6 redirect sent from %s rejected; must be from linklocal ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) ICMP6 redirect rejected; redirect dst must be unicast: %s ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s ICMP6 redirect rejected; no route found for redirect dst: %s ICMP6 redirect rejected; neither router case nor onlink case: %s icmp6_redirect_input: invalid ND option, rejected: %s icmp6_redirect_input: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s icmp6_notify_error: in6_embedscope failed sanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d ../../../../netinet6/icmp6.cicmp6_reflect: source can't be determined: dst=%s, error=%d ICMP6 checksum error(%d|%x) %s icmp6_input: unknown type %d(src=%s, dst=%s, ifid=%d) icmp6_mtudisc_callback_registerENOBUFS in icmp6_error %d ip6_nexthdr: m == NULLip6_input: packet to an unready address %s->%s ip6_initcannot forward from %s to %s nxt %d received on %s cannot forward src %s, dst %s, nxt %d, rcvif %s, outif %s assumption failed: hdr not splitscope error in prefix list (%s) nd6_setmtu0: new link MTU on %s (%lu) is too small for IPv6 ndopts == NULL in nd6_optionuninitialized ndopts in nd6_optionndopts == NULL in nd6_optionsuninitialized ndopts in nd6_optionsduplicated ND6 option found (type=%d) nd6_options: unsupported option %d - option ignored too many loop in nd opt unspecnd6_lookup: failed to lookup %s (if = %s) nd6_output: can't allocate llinfo for %s (ln=%p, rt=%p) nd6_init called more than once(ignored) ln->ln_rt == NULLln->ln_rt->rt_ifp == NULLrt_llinfo(%p) is not equal to ln(%p)dst=0 in nd6_timer(ln=%p)nd6_storelladdr: something odd happens nd6_storelladdr: sdl_alen == 0, dst=%s, if=%s ifp == NULL in nd6_cache_lladdrfrom == NULL in nd6_cache_lladdrndp info overwritten for %s by %s on %s %s: failed to join %s (errno=%d) %s: DAD detected duplicate IPv6 address %s: NS in/out=%d/%d, NA in=%d %s: DAD complete for %s - duplicate found %s: manual intervention required ifa == NULL in nd6_dad_ns_inputnd6_na_output: source can't be determined: dst=%s, error=%d nd6_ns_output: source can't be determined: dst=%s, error=%d nd6_dad_timer: called with null parameter nd6_dad_timer: DAD structure not found ???nd6_dad_timer: called with duplicated address %s(%s) nd6_dad_timer: called with non-tentative address %s(%s) %s: could not run DAD, driver problem? %s: DAD complete for %s - no duplicates found nd6_dad_start: called with non-tentative address %s(%s) nd6_dad_start: ifa->ifa_ifp == NULLnd6_dad_start: memory allocation failed for %s(%s) %s: starting DAD for %s nd6_ns_input: invalid hlim (%d) from %s to %s on %s nd6_ns_input: bad DAD packet (wrong ip6 dst) nd6_ns_input: NS packet from non-neighbor nd6_ns_input: bad NS target (multicast) nd6_ns_input: invalid ND option, ignored nd6_ns_input: bad DAD packet (link-layer address option) nd6_ns_input: lladdrlen mismatch for %s (if %d, NS packet %d) nd6_ns_input: duplicate IP6 address %s nd6_ns_input: src=%s nd6_ns_input: dst=%s nd6_ns_input: tgt=%s nd6_na_input: invalid hlim (%d) from %s to %s on %s nd6_na_input: invalid target address %s nd6_na_input: a solicited adv is multicasted nd6_na_input: invalid ND option, ignored nd6_na_input: multicast adv without TLLA nd6_na_input: duplicate IP6 address %s nd6_na_input: ND packet from non-neighbor nd6_na_input: lladdrlen mismatch for %s (if %d, NA packet %d) in6_init_prefix_ltimes: preferred lifetime(%d) is greater than valid lifetime(%d) in6_ifadd: wrong prefixlen for %s (prefix=%d ifid=%d) in6_ifadd: failed to make ifaddr %s on %s (errno=%d) nd6_prefix_onlink: %s/%d is already on-link nd6_prefix_onlink: failed to find any ifaddr to add route for a prefix(%s/%d) on %s nd6_prefix_onlink: failed to add route for a prefix (%s/%d) on %s, gw=%s, mask=%s, flags=%lx errno = %d nd6_prefix_offlink: %s/%d is already off-link nd6_prefix_offlink: failed to recover a prefix %s/%d from %s to %s (errno = %d) nd6_prefix_offlink: failed to delete route: %s/%d on %s (errno = %d) pfxlist_onlink_check: failed to make %s/%d offlink, errno=%d prelist_remove: failed to make %s/%d offlink on %s, errno=%d prelist_remove: negative count on %s nd6_prelist_add: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_update: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_update: nd6_prelist_add failed for %s/%d on %s errno=%d, returnpr=%p defrouter_select: called unexpectedly (forwarding=%d) defrouter_select: more than one router is installed defrtrlist_del: negative count on %s nd6_rs_input: invalid hlim (%d) from %s to %s on %s nd6_rs_input: invalid ND option, ignored nd6_rs_input: lladdrlen mismatch for %s (if %d, RS packet %d) nd6_ra_input: invalid hlim (%d) from %s to %s on %s nd6_ra_input: src %s is not link-local nd6_ra_input: invalid ND option, ignored nd6_ra_input: invalid option len %d for prefix information option, ignored nd6_ra_input: invalid prefix len %d for prefix information option, ignored nd6_ra_input: invalid prefix %s, ignored nd6_ra_input: invalid prefixlen %d for rfc2374 prefix %s, ignored nd6_ra_input: bogus mtu option mtu=%lu sent from %s, ignoring nd6_ra_input: bogus mtu mtu=%lu sent from %s; exceeds maxmtu %lu, ignoring nd6_ra_input: lladdrlen mismatch for %s (if %d, RA packet %d) rip6_attachrip6_detachrip6_usrreq mainbuscortexampintc irq %dampintc_intr_establish: bogus irqnumber %d: %sintr_establish: can't malloc handler infoampintc_attach: ICP bus_space_map failed!ampintc_attach: ICD bus_space_map failed!irq1023/spur nirq %d ampintccpuNo support for this CPU type (%08x) in kernelUndefined instruction in kernel real mem = %lu (%luMB) avail mem = %lu (%luMB) Warning IRQ's disabled during boot() WARNING: not updating battery clock _bus_dmamap_load_raw: not implemented_bus_dmamem_map: size botch_bus_dmamap_sync: mix PRE and POST%s: curaddr %#lx not in range_bus_dmamap_sync: ARM32_BUFTYPE_INVALIDunknown buffer type %d _bus_dmamap_syncProcessor failed probe - no CPU ID %s %s (%s core)%s: IDC disabled IDC enabled DC disabled DC enabled IC disabled IC enabled WB disabled WB enabled LABT EABT branch prediction enabled%s: %dKB/%dB %d-way %s unified cache %s: %dKB(%db/l,%dway) I-cache, %dKB(%db/l,%dway) %s D-cache %s: %s does not fully support this CPU. %s: This kernel does not fully support this CPU. %s: Recompile with "options %s" to correct this. unknown CPU (ID = 0x%x)ARM810ARM920TARM922TARM926EJ-SARM940TARM946E-SARM966E-STI ARM925TARM1020EARM1022E-SSA-110SA-1100SA-1110IXP1200i80200i80321 400MHzi80321 600MHzi80219 400MHzi80219 600MHzPXA250PXA210PXA27xIXP425 533MHzIXP425 400MHzIXP425 266MHzARM1136J-SARM1136J-S R1ARM Cortex A5ARM Cortex A7ARM Cortex A8ARM Cortex A8 R1ARM Cortex A8 R2ARM Cortex A8 R3ARM Cortex A9ARM Cortex A9 R1ARM Cortex A9 R2ARM Cortex A9 R3ARM Cortex A9 R4ARM Cortex A15ARM Cortex A15 R1ARM Cortex A15 R2ARM Cortex A15 R3ARM Cortex A15 R4CPU_ARM8ARM9TDMIARM9E-SCPU_ARM9EARM9EJ-SARM10ECPU_ARM10SA-1CPU_SA1100XScaleCPU_XSCALE_...ARM11JCPU_ARM11CPU_ARMv7wr-thruwr-back**unknown 3****unknown 4**wr-back-lockwr-back-lock-Awr-back-lock-B**unknown 8****unknown 9****unknown 10****unknown 11****unknown 12****unknown 13****unknown 14****unknown 15**rev 0rev 1rev 2rev 3rev 4rev 5rev 6rev 7rev 8rev 9rev 10rev 11rev 12rev 13rev 14rev 15step Jstep Kstep Sstep Tstep Bstep Cstep Dstep Erev 10step Gstep A-0step B-0step B-1step B-2step B-3step B-4step B-5(IXP1200 step A)(IXP1200 step B)(IXP1200 step C)(IXP1200 step D)(IXP1240/1250 step A)(IXP1240 step B)(IXP1250 step B)step A-1step C-0step D-0step ?step C-5step 0badaddr: invalid size (%lu)userkernelFatal %s mode data abort: '%s' trapframe: %p DFSR=%08x, DFAR=%08x, spsr=%08lx Fatal %s mode prefetch abort at 0x%08lx trapframe: %p IFSR=%08x, IFAR=%08x, spsr=%08lx r0 =%08lx, r1 =%08lx, r2 =%08lx, r3 =%08lx r4 =%08lx, r5 =%08lx, r6 =%08lx, r7 =%08lx r8 =%08lx, r9 =%08lx, r10=%08lx, r11=%08lx r12=%08lx, usp=%08lx, ulr=%08lxssp=%08lx, slr=%08lx, pc =%08lx Fatal abortUVM: pid %d (%s), uid %d killed: out of swap data_abort_fault: Misaligned Kernel-mode Program Counter Non-emulated page fault with intr_depth > 0 uvm_fault(%p, %lx, %x, 0) -> %x V7 fault 00000Alignment Fault 1Debug EventAccess Flag Fault (S)External Linefetch Abort (S)Translation Fault (S)Access Flag Fault (P)Translation Fault (P)External Non-Linefetch Abort (S)Domain Fault (S)V7 fault 01010Domain Fault (P)External Translation Abort (L1)Permission Fault (S)External Translation Abort (L2)Permission Fault (P)V7 fault 10000V7 fault 10001V7 fault 10010V7 fault 10011LockdownV7 fault 10101Asynchronous External AbortV7 fault 10111Memory Asynchronous Parity ErrorMemory Synchronous Parity ErrorCoprocessor AbortV7 fault 11011V7 fault 11101V7 fault 11111mmrwpmap_map_chunk: no L1 table providedpmap_map_chunk: no L2 table for VA 0x%08lxpmap_map_chunk: can't find L2 table for VA0x%08lxpmap_alloc_specials: no l2b for 0x%lxpmap_bootstrap: No L2 for L2 @ va %ppmap_init_l1: can't get PA of L1 at %ppmap_bootstrap: No L2 for va 0x%x, pa 0x%lxpmap_bootstrap: out of static L2spmap_bootstrap: WARNING! wrong cache mode for L2 pte @ %p pmap_bootstrap: WARNING! wrong cache mode for primary L1 @ 0x%lx pmapplpvepll2dtblpll2ptpplalloc_l1_vaalloc_l1_pgpmap_map_entry: no L2 table for VA 0x%08lxpmap_map_entry: can't find L2 table for VA 0x%08lx%s: va %08lx ftype %x %c pte %08x fault on exec pmap_enter: failed to allocate L2 bucketpmap_enter: no pv entries dump to dev %u,%u not possible dumping to dev %u,%u offset %ld dump area unavailable device bad device not ready area improper i/o error aborted from console succeeded vunmapbufvmapbufarmv7_io_bs_free(): not implementedarmv7_io_bs_alloc(): not implementedarm_clock_func.setstatclockrate not intializedinitclocks function not initialized yetarm_dflt_intr_string calledarm_dflt_intr_disestablish calledarm_dflt_intr_establish calledarm_dflt_intr() calledresettodr: failed to set time WARNING: preposterous time in file system WARNING: preposterous clock chip time lostgainedWARNING: clock %s %ld days WARNING: CHECK AND RESET THE DATE! atag core flags %x pagesize %x rootdev %x atag mem start 0x%08x size 0x%x atag cmdline [%s] atag serial 0x%08x:%08x atag revision %08x uboot tag unknown 0x%08x size %d softintr_establish: unknown soft IPL %d%s: armv7_devs == NULL: i.MX6 SolidRun CuBox-i : i.MX6 SolidRun HummingBoard : PhyFLEX-i.MX6 : i.MX6 SABRE Lite : i.MX6 UDOO : i.MX6 Utilite : i.MX6 Wandboard : BeagleBoard : BeagleBone : Gumstix Overo : PandaBoard : A1X : A20 %s: board type 0x%x unknownsunxi_attach: bus_space_map failed!%s: device %s unit %d not found %s: device %s unit %d not configured imxocotpimxccmimxiomuxcimxdogimxuartimxgpioimxesdhcimxenetimxiicprcmintcgptimeromdogomgpioommmcsitaracmedmadmtimertiiiccpswomapidsxipiosxiccmua1xintcsxitimersxidogsxirtcsxiuartsxiebootfile: %s bootargs: %s unknown option `%c' cpu not recognized! %s booting ... arg0 %p arg1 %p arg2 %p Allocating page tables freestart = 0x%08lx, free_pages = %d (0x%08x) initarm: out of memoryinitarm: Failed to align the kernel page directoryIRQ stack: p0x%08lx v0x%08lx ABT stack: p0x%08lx v0x%08lx UND stack: p0x%08lx v0x%08lx SVC stack: p0x%08lx v0x%08lx Creating L1 page table at 0x%08lx Mapping kernel Constructing L2 page tables undefined page pmap The operating system has halted. Please press any key to reboot. rebooting... reboot failed; spinning Attempting to power down... boot device: lookup '%s' failed. boot device: %s wdsdcdraidOUI 0x%06x model 0x%04x rev %d at %s phy %dmii_detach: phyloc and offloc specifiedmii_attach: phyloc and offloc specifiedmiiautmii_phy_setmedia: MASTER on wrong mediarlrlphy_service: attempt to isolate phy: %s, rev. %d : RTL internal PHY rlphyRTL8201L 10/100 PHYRTL8201E 10/100 PHYIP101 10/100 PHY: Generic IEEE 802.3u media interface, rev. %d: OUI 0x%06x, model 0x%04x %s: no media present ukphyrgephyRTL8169S/8110S PHYRTL8251 PHYDiagnostic Failure on Component 0x%02xTagged Overlapped Commands (0x%02x = TASK TAG)Decompression Exception Short Algorithm ID OF 0x%02xASC 0x%02x ASCQ 0x%02xCDBParametersError in %s, Offset %d, bit %dActual Retry Count: %dProgress Indicator: %dprobe%s(%s:%d:%d): %sCheck Condition (error %#x) on opcode 0x%x AT BLOCK #: %d (decimal) SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Setoff INFO: 0x%x (VALID flag %s) COMMAND INFO: 0x%x ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s DEFERRED scbusyunknown error category (0x%x) from scsi driver scsi_done called twice on xs(%p)unexpected xsh state %usyncxspendxsscsiiomvscsi_xfer pool exhausted! scxsplscsiplugscsi_cmd_rw_decode: bad opcode 0x%02xNo Additional SenseSoft ErrorNot ReadyMedia ErrorHardware ErrorIllegal RequestUnit AttentionWrite ProtectedBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare ErrorNo Additional Sense InformationFilemark DetectedEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnCleaning RequestedErase Operation In ProgressLocate Operation In ProgressRewind Operation In ProgressSet Capacity Operation In ProgressVerify Operation In ProgressNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Not Ready, Rebuild In ProgressLogical Unit Not Ready, Recalculation In ProgressLogical Unit Not Ready, Operation In ProgressLogical Unit Not Ready, Long Write In ProgressLogical Unit Not Ready, Self-Test In ProgressLogical Unit Not Accessible, Asymmetric Access State TransitionLogical Unit Not Accessible, Target Port In Standby StateLogical Unit Not Accessible, Target Port In Unavailable StateLogical Unit Not Ready, Structure Check RequiredLogical Unit Not Ready, Auxiliary Memory Not AccessibleLogical Unit Not Ready, Notify (Enable Spinup) RequiredLogical Unit Not Ready, OfflineLogical Unit Not Ready, SA Creation In ProgressLogical Unit Not Ready, Space Allocation In ProgressLogical Unit Not Ready, Robotics DisabledLogical Unit Not Ready, Configuration RequiredLogical Unit Not Ready, Calibration RequiredLogical Unit Not Ready, A Door Is OpenLogical Unit Not Ready, Operating In Sequential ModeLogical Unit Not Ready, Start Stop Unit Command In ProgressLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorLogical Unit Communication CRC Error (ULTRA-DMA/32)Unreachable Copy TargetTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureHead Select FaultError Log OverflowWarningWarning - Specified Temperature ExceededWarning - Enclosure DegradedWarning - Background Self-Test FailedWarning - Background Pre-Scan Detected Medium ErrorWarning - Background Medium Scan Detected Medium ErrorWarning - Non-Volatile Cache Now VolatileWarning - Degraded Power To Non-Volatile CacheWarning - Power Loss ExpectedWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedWrite Error - Recommend ReassignmentCompression Check Miscompare ErrorData Expansion Occurred During CompressionBlock Not CompressibleWrite Error - Recovery NeededWrite Error - Recovery FailedWrite Error - Loss Of StreamingWrite Error - Padding Blocks AddedAuxiliary Memory Write ErrorWrite Error - Unexpected Unsolicited DataWrite Error - Not Enough Unsolicited DataDefects In Error WindowError Detected By Third Party Temporary InitiatorThird Party Device FailureCopy Target Device Not ReachableIncorrect Copy Target Device TypeCopy Target Device Data UnderrunCopy Target Device Data OverrunInvalid Information UnitInformation Unit Too ShortInformation Unit Too LongID CRC Or ECC ErrorLogical Block Guard Check FailedLogical Block Application Tag Check FailedLogical Block Reference Tag Check FailedLogical Block Protection Error On Recover Buffered DataLogical Block Protection Method ErrorUnrecovered Read ErrorRead Retries ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block ReadNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite The DataDe-Compression CRC ErrorCannot Decompress Using Declared AlgorithmError Reading UPC/EAN NumberError Reading ISRC NumberRead Error - Loss Of StreamingAuxiliary Memory Read ErrorRead Error - Failed Retransmission RequestRead Error - LBA Marked Bad By Application ClientAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRecord Not Found - Recommend ReassignmentRecord Not Found - Data Auto-ReallocatedLocate Operation FailureRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorData Sync Error - Data RewrittenData Sync Error - Recommend RewriteData Sync Error - Data Auto-ReallocatedData Sync Error - Recommend ReassignmentRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data Without ECC - Data RewrittenRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With L-ECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteRecovered Data With ECC - Data RewrittenRecovered Data With LinkingDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationMiscompare Verify Of Unmapped LbaRecovered ID with ECCPartial Defect List TransferInvalid Command Operation CodeAccess Denied - Initiator Pending-EnrolledAccess Denied - No Access rightsAccess Denied - Invalid Mgmt ID KeyIllegal Command While In Write Capable StateObsoleteIllegal Command While In Explicit Address ModeIllegal Command While In Implicit Address ModeAccess Denied - Enrollment ConflictAccess Denied - Invalid LU IdentifierAccess Denied - Invalid Proxy TokenAccess Denied - ACL LUN ConflictIllegal Command When Not In Append-Only ModeLogical Block Address Out of RangeInvalid Element AddressInvalid Address For WriteInvalid Write Crossing Layer JumpIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBCDB Decryption ErrorSecurity Audit Value FrozenSecurity Working Key FrozenNonce Not UniqueNonce Timestamp Out Of RangeInvalid XCDBLogical Unit Not SupportedInvalid Field In Parameter ListThreshold Parameters Not SupportedInvalid Release Of Persistent ReservationData Decryption ErrorToo Many Target DescriptorsUnsupported Target Descriptor Type CodeToo Many Segment DescriptorsUnsupported Segment Descriptor Type CodeUnexpected Inexact SegmentInline Data Length ExceededInvalid Operation For Copy Source Or DestinationCopy Segment Granularity ViolationInvalid Parameter While Port Is EnabledInvalid Data-Out Buffer Integrity Check ValueData Decryption Key Fail Limit ReachedIncomplete Key-Associated Data SetVendor Specific Key Reference Not FoundHardware Write ProtectedLogical Unit Software Write ProtectedAssociated Write ProtectPersistent Write ProtectPermanent Write ProtectConditional Write ProtectSpace Allocation Failed Write ProtectNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedFormat-Layer May Have ChangedImport/Export Element Accessed, Medium ChangedPower On, Reset, or Bus Device Reset OccurredPower On OccurredSCSI Bus Reset OccurredBus Device Reset Function OccurredDevice Internal ResetTransceiver Mode Changed to Single EndedTransceiver Mode Changed to LVDI_T Nexus Loss OccurredMode Parameters ChangedLog Parameters ChangedReservations PreemptedReservations ReleasedRegistrations PreemptedAsymmetric Access State ChangedImplicit Asymmetric Access State Transition FailedPriority ChangedCapacity Data Has ChangedError History I_T Nexus ClearedError History Snapshot ReleasedError Recovery Attributes Have ChangedData Encryption Capabilities ChangedTimestamp ChangedData Encryption Parameters Changed By Another I_T NexusData Encryption Parameters Changed By Vendor Specific EventData Encryption Key Instance Counter Has ChangedSA Creation Capabilities Data Has ChangedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedCurrent Program Area Is Not EmptyCurrent Program Area Is EmptyIllegal Power Condition RequestPersistent Prevent ConflictPrevious Busy StatusPrevious Task Set Full StatusPrevious Reservation Conflict StatusPartition Or Collection Contains User ObjectsNot ReservedORWrite Generation Does Not MatchOverwrite Error On Update In PlaceInsufficient Time For OperationCommands Cleared By Another InitiatorCommands Cleared By Power Loss NotificationCommands Cleared By Device ServerIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledCannot Write Medium - Unknown FormatCannot Write Medium - Incompatible FormatCannot Format Medium - Incompatible MediumCleaning FailureCannot Write - Application Code MismatchCurrent Session Not Fixated For AppendCleaning Request RejectedMedium Not FormattedIncompatible Volume TypeIncompatible Volume QualifierCleaning Volume ExpiredMedium Format CorruptedFormat Command FailedZoned Formatting Failed Due To Spare LinkingNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorEnclosure FailureEnclosure Services FailureUnsupported Enclosure FunctionEnclosure Services UnavailableEnclosure Services Transfer FailureEnclosure Services Transfer RefusedRibbon, Ink, or Toner FailureRounded ParameterEvent Status NotificationESN - Power Management Class EventESN - Media Class EventESN - Device Busy Class EventSaving Parameters Not SupportedMedium Not PresentMedium Not Present - Tray ClosedMedium Not Present - Tray OpenMedium Not Present - LoadableMedium Not Present - Medium Auxiliary Memory AccessibleSequential Positioning ErrorTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyEnd Of Medium ReachedMedium Magazine Not AccessibleMedium Magazine RemovedMedium Magazine InsertedMedium Magazine LockedMedium Magazine UnlockedMechanical Positioning Or Changer ErrorRead Past End Of User ObjectElement DisabledElement EnabledData Transfer Device RemovedData Transfer Device InsertedInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetLogical Unit FailureTimeout On Logical UnitLogical Unit Failed Self-TestLogical Unit Unable To Update Self-Test LogTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has Changedcomponent Device AttachedDevice Identifier ChangedRedundancy Group Created Or ModifiedRedundancy Group DeletedSpare Created Or ModifiedSpare DeletedVolume Set Created Or ModifiedVolume Set DeletedVolume Set DeassignedVolume Set ReassignedReported LUNs Data Has ChangedEcho Buffer OverwrittenMedium LoadableMedium Auxiliary Memory AccessibleiSCSI IP Address AddediSCSI IP Address RemovediSCSI IP Address ChangedRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureATA Device Failed Set FeaturesSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorData Phase CRC Error DetectedSCSI Parity Error Detected During ST Data PhaseInformation Unit iuCRC Error DetectedAsynchronous Information Protection Error DetectedProtocol Service CRC ErrorPHY Test Function In ProgressSome Commands Cleared By iSCSI Protocol EventInitiator Detected Error Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorInvalid Target Port Transfer Tag ReceivedToo Much Write DataACK/NAK TimeoutNAK ReceivedData Offset ErrorInitiator Response TimeoutConnection LostLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureErase Failure - Incomplete Erase Operation DetectedCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedMedium Removal Prevented By Data Transfer ElementMedium Thread Or Unthread FailureVolume Identifier InvalidVolume Identifier MissingDuplicate Volume IdentifierElement Status UnknownSCSI To Host System Interface FailureSystem Resource FailureSystem Buffer FullInsufficient Reservation ResourcesInsufficient ResourcesInsufficient Registration ResourcesInsufficient Access Control ResourcesAuxiliary Memory Out Of SpaceQuota ErrorMaximum Number Of Supplemental Decryption Keys ExceededMedium Auxiliary Memory Not AccessibleData Currently UnavailableInsufficient Power For OperationUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change InputOperator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedFailure Prediction Threshold ExceededMedia Failure Prediction Threshold ExceededLogical Unit Failure Prediction Threshold ExceededSpare Area Exhaustion Prediction Threshold ExceededHardware Impending Failure General Hard Drive FailureHardware Impending Failure Drive Error Rate Too HighHardware Impending Failure Data Error Rate Too HighHardware Impending Failure Seek Error Rate Too HighHardware Impending Failure Too Many Block ReassignsHardware Impending Failure Access Times Too HighHardware Impending Failure Start Unit Times Too HighHardware Impending Failure Channel ParametricsHardware Impending Failure Controller DetectedHardware Impending Failure Throughput PerformanceHardware Impending Failure Seek Time PerformanceHardware Impending Failure Spin-Up Retry CountHardware Impending Failure Drive Calibration Retry CountController Impending Failure General Hard Drive FailureController Impending Failure Drive Error Rate Too HighController Impending Failure Data Error Rate Too HighController Impending Failure Seek Error Rate Too HighController Impending Failure Too Many Block ReassignsController Impending Failure Access Times Too HighController Impending Failure Start Unit Times Too HighController Impending Failure Channel ParametricsController Impending Failure Controller DetectedController Impending Failure Throughput PerformanceController Impending Failure Seek Time PerformanceController Impending Failure Spin-Up Retry CountController Impending Failure Drive Calibration Retry CountData Channel Impending Failure General Hard Drive FailureData Channel Impending Failure Drive Error Rate Too HighData Channel Impending Failure Data Error Rate Too HighData Channel Impending Failure Seek Error Rate Too HighData Channel Impending Failure Too Many Block ReassignsData Channel Impending Failure Access Times Too HighData Channel Impending Failure Start Unit Times Too HighData Channel Impending Failure Channel ParametricsData Channel Impending Failure Controller DetectedData Channel Impending Failure Throughput PerformanceData Channel Impending Failure Seek Time PerformanceData Channel Impending Failure Spin-Up Retry CountData Channel Impending Failure Drive Calibration Retry CountServo Impending Failure General Hard Drive FailureServo Impending Failure Drive Error Rate Too HighServo Impending Failure Data Error Rate Too HighServo Impending Failure Seek Error Rate Too HighServo Impending Failure Too Many Block ReassignsServo Impending Failure Access Times Too HighServo Impending Failure Start Unit Times Too HighServo Impending Failure Channel ParametricsServo Impending Failure Controller DetectedServo Impending Failure Throughput PerformanceServo Impending Failure Seek Time PerformanceServo Impending Failure Spin-Up Retry CountServo Impending Failure Drive Calibration Retry CountSpindle Impending Failure General Hard Drive FailureSpindle Impending Failure Drive Error Rate Too HighSpindle Impending Failure Data Error Rate Too HighSpindle Impending Failure Seek Error Rate Too HighSpindle Impending Failure Too Many Block ReassignsSpindle Impending Failure Access Times Too HighSpindle Impending Failure Start Unit Times Too HighSpindle Impending Failure Channel ParametricsSpindle Impending Failure Controller DetectedSpindle Impending Failure Throughput PerformanceSpindle Impending Failure Seek Time PerformanceSpindle Impending Failure Spin-Up Retry CountSpindle Impending Failure Drive Calibration Retry CountFirmware Impending Failure General Hard Drive FailureFirmware Impending Failure Drive Error Rate Too HighFirmware Impending Failure Data Error Rate Too HighFirmware Impending Failure Seek Error Rate Too HighFirmware Impending Failure Too Many Block ReassignsFirmware Impending Failure Access Times Too HighFirmware Impending Failure Start Unit Times Too HighFirmware Impending Failure Channel ParametricsFirmware Impending Failure Controller DetectedFirmware Impending Failure Throughput PerformanceFirmware Impending Failure Seek Time PerformanceFirmware Impending Failure Spin-Up Retry CountFirmware Impending Failure Drive Calibration Retry CountFailure Prediction Threshold Exceeded (false)Low Power Condition OnIdle Condition Activated By TimerStandby Condition Activated By TimerIdle Condition Activated By CommandStandby Condition Activated By CommandIDLE_B Condition Activated By TimerIDLE_B Condition Activated By CommandIDLE_C Condition Activated By TimerIDLE_C Condition Activated By CommandSTANDBY_Y Condition Activated By TimerSTANDBY_Y Condition Activated By CommandPower State Change To ActivePower State Change To IdlePower State Change To StandbyPower State Change To SleepPower State Change To Device ControlLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackPacket Does Not Fit In Available SpaceIllegal Mode For This TrackInvalid Packet SizeVoltage FaultAutomatic Document Feeder Cover UpAutomatic Document Feeder Lift UpDocument Jam In Automatic Document FeederDocument Miss Feed Automatic In Document FeederConfiguration FailureConfiguration Of Incapable Logical Units FailedAdd Logical Unit FailedModification Of Logical Unit FailedExchange Of Logical Unit FailedRemove Of Logical Unit FailedAttachment Of Logical Unit FailedCreation Of Logical Unit FailedAssign Failure OccurredMultiply Assigned Logical UnitSet Target Port Groups Command FailedATA Device Feature Not EnabledLogical Unit Not ConfiguredData Loss On Logical UnitMultiple Logical Unit FailuresParity/Data MismatchInformational, Refer To LogState Change Has OccurredRedundancy Level Got BetterRedundancy Level Got WorseRebuild Failure OccurredRecalculate Failure OccurredCommand To Logical Unit FailedCopy Protection Key Exchange Failure - Authentication FailureCopy Protection Key Exchange Failure - Key Not PresentCopy Protection Key Exchange Failure - Key Not EstablishedRead Of Scrambled Sector Without AuthenticationMedia Region Code Is Mismatched To Logical Unit RegionDrive Region Must Be Permanent/Region Reset Count ErrorDecompression Exception Long Algorithm IDSession Fixation ErrorSession Fixation Error Writing Lead-InSession Fixation Error Writing Lead-OutSession Fixation Error - Incomplete Track In SessionEmpty Or Partially Written Reserved TrackNo More Track Reservations AllowedRMZ Extension Is Not AllowedNo More Test Zone Extensions Are AllowedCD Control ErrorPower Calibration Area ErrorProgram Memory Area Update FailureProgram Memory Area Is FullRMA/PMA Is Almost FullCurrent Power Calibration Area Almost FullCurrent Power Calibration Area Is FullRDZ Is FullSecurity ErrorUnable To Decrypt DataUnencrypted Data Encountered While DecryptingIncorrect Data Encryption KeyCryptographic Integrity Validation FailedError Decrypting DataUnknown Signature Verification KeyEncryption Parameters Not UseableDigital Signature Validation FailureEncryption Mode Mismatch On ReadEncrypted Block Not Raw Read EnabledIncorrect Encryption ParametersUnable To Decrypt Parameter ListEncryption Algorithm DisabledSA Creation Parameter Value InvalidSA Creation Parameter Value RejectedInvalid SA UsageData Encryption Configuration PreventedSA Creation Parameter Not SupportedAuthentication FailedExternal Data Encryption Key Manager Access ErrorExternal Data Encryption Key Manager ErrorExternal Data Encryption Key Not FoundExternal Data Encryption Request Not AuthorizedExternal Data Encryption Control TimeoutExternal Data Encryption Control ErrorLogical Unit Access Not AuthorizedSecurity Conflict In Translated DeviceXS_SHORTSENSE scsibus at %sscsibusprint: qualifier == SID_QUAL_RSVDscsibusprint: qualifier == SID_QUAL_BAD_LUdirectsequentialprintercdromwormscanneropticalchangercommunicationenclosure servicessimplified directscsibusprint: device type T_NODEVICEvendor-unique targ %d lun %d: <%s, %s, %s> SCSI%dremovablefixed %d/%s %s%s naa. eui. t10. serial. wwn._~ offline: %d targets, initiator %d, WWPN %016llx, WWNN %016llxscsibusPLEXTORCD-ROM PX-40TS1.01MICROP 1588-15MBSUN0669DEC RZ55 (C) DECEMULEX MD21/S2 ESDIA00IBMRAID 0662SIBM 0663HIBM0664H3171-S2KZ-CDFRSS2FQUANTUM ELS85S iomegajaz 1GBMICROP4421-07SEAGATEST150176LW0002HPC3725SDCASSONY SDT-5000 3.WangDAT Model 1300 02.4Model 2600 01.7Model 3200 02.2CR-2801TE1.07CREATIVECD3630EAC101FX320Sq01GCD-R580B1.00MATSHITA CR-5741.021.06Memorex CRW-26421.0gSANYO CRD-256PSANYO CRD-254PSANYO CRD-S54P1.08CD-ROM CDR-S11.70CD-ROM CDR-N161.25UJDCD87301.14ATAPI CD-ROMSCSI CD-ROMNEC CD-ROM DRIVE:260SCSI opticalSCSI disk%s %s(unknown)%s: %lluMB, %lu bytes/sector, %llu sectors, thin, readonlyata_polled: xa isnt completeata_polled: xa state (%d)no free xfers on a new portatascsi_disk_start_stop_done: unexpected ata_xfer state (%d)atascsi_disk_write_same_16_done: unexpected ata_xfer state (%d)atascsi_disk_cmd_done: unexpected ata_xfer state (%d)ATA Port Multiplieratascsi_atapi_cmd_done, timeout atascsi_atapi_cmd_done: unexpected ata_xfer state (%d)atascsi_passthru_done, timeout erroratascsi_disk_sync_done: %s atascsi_disk_sync_done: unexpected ata_xfer state (%d)atascsi_disk_unmap_done: unexpected ata_xfer state (%d)atascsi%s.%d.%d: Port multipliers cannot be nested wsevent_read%s: event queue overflow wskbd at %swskdetwskbd_detach: %s didn't detach cannot load keymap: console keyboardwskbdwskbd_get_mapentry: %d(%d): bad entrywskbd_load_keymap: %d: recursion too deepwskbd_load_keymap: %d(%d): bad entryusb at %sendtaskusbatskusbtskunable to create usb abort task threadusbtaskunable to create usb task thread%s: root hub problem %s: root device is not a hub usbpalock: USB revision %s, not supported %s: can't register softintr pre 1.02.0usbusbd_desc_iter_next: bad descriptor usbd_desc_iter_next: descriptor length = 0 usbd_desc_iter_next: descriptor length too large usbd_start_next: error=%d usbd_transfer: not doneusbsynusbrefusbdetusb_detach_wait: %s didn't detach out of dataiface desc0 lengthusbd_fill_iface_data: bad descriptor(s): %s usbdly%s: device addr %d (config %d) exceeds power budget, %d mA > %d mA %s: port %d, set config %d at addr %d failed %s: No free USB addresses, new device ignored. usbd_new_device: cannot find HS port%x.%02xvendor 0x%04xproduct 0x%04x"%s %s", class %d/%d rev / addr %d port %d configuration %d interface %dHomeConnectBluetooth3C19250 Ethernet3CRSHEW696HomeConnect 3C460U.S.Robotics 56000HomeConnect 3C460B3CRUSB10075AR55233Com OfficeConnect Analog Modem3Com U.S. Robotics Pro ISDN TA3Com HomeConnectAolynk WUB320gStereo Plug CableXX1XX2RT2770RT2870RT3070RT3071RT3072URE450 EthernetUFE1000 Fast Ethernet1/10/100 EthernetXX4XX5XX6RTL8151XX7XX8XX9WL54RTL8192CURTL8188CUXX10BWU613HWU54DMRT2573WUG2700USB320-EC Ethernet2664WT-Sinus 111 WLANSMCWUSB-GSMCWUSBT-G2PrismGT USB 2.0 WLANSpeedStream EthernetAR9280+AR7010RTL8192SUZD1211BWN4501H-LF-IRWUS-201WN7512MEZ1000 RDAUSB 2.0 Data LinkWarplinkAcerscan C310UAcerscan 320UAcerscan 640UAcerscan 620UATA/ATAPIAWL300AWL400Prism2.5 WLANPrism2.5 WLAN AAR9287+AR7010ROPEX FreeLan 802.11b802UAT1ACT-IR2000U FIRHHKB ProfessionalI/O BoardI/O Board, rev. 1AWN-8020 WLANAWU-120AN986A EthernetAN986 EthernetAN8511 EthernetAN8513 EthernetAN8515 EthernetUBS-10BT EthernetQ-DriveSnapScan 1212USnapScan 1236USnapScan TouchSnapScan e40SnapScan e50SnapScan e20SnapScan e25SnapScan e26SnapScan e52AirPrime CDMA Wireless EVDO cardAWU2000BWM-168bUSB-HASP 0.06One Touch 535/735SpeedTouch 120gSpeedTouch 121gMacAlly Kbd HubAU9814 HubMicroConnectors/StrongManNEC Kbd HubAT-USB100RT2070RT3572ADA70 SpeakersASC495 SpeakersNeptune 3NTL 250 cable modem5G UPSCG-WLUSB2GOCG-WLUSB2GNREagle IEagle IIEagle IICEagle IIIgnICEgnICE+EZUSBEZLINKNTT DoCoMo A2502ADU-E100HADU-500AKeyboard/TrackpadOptical mouseHID-proxySpeakersiPhoneiPod TouchiPhone 3GiPod Touch 2GiPhone 3GSiPhone 4 GSMiPod Touch 3GiPadiPhone 4 CDMAiPod Touch 4GiPad 2iPhone 4SEthernet A1277iSightTrue Random Number GeneratorLeonardoARK3116 SerialPENTAX Optio230WLL013 (Intersil)WLL013Voyager 1010USB 2.0 10/100 Ethernet controllerAX88178AX88179AX88772AX88772AAX88772BUSB-N11RT2570WL-159gA9T wirelessP5B wirelessUSB-N13USB-N10USB-N53USB-N66MyPal A730WL-140Parallel10Mbps EthernetUC-110T EthernetUC232A SerialUC210T EthernetUC2324 SerialDSB-650CTG121NWN821NV2AR92713CRUSBN275WN612AR3011AR9170USB Cable 205STK541 ZigbeeUHB124 hubW-Buddie WN210DWL-900AP Wireless access pointAT91 CDC ACMAT76C503 (Intersil 3861 Radio)AT76C503 (Intersil 3863 Radio)AT76C503 (RFMD Radio)AT76C505 (RFMD Radio)AT76C505 (RFMD 2958 Radio)AT76C505A (RFMD 2958 Radio)AT76C505AS (RFMD 2958 Radio)ATC-HA4USB USB headphoneUSB Audio Speaker1200UFRITZ!WLAN NData ModemRTL8188CEAscensia ContourUSOTL4 RS-422/485USTL4 RS-422/485USO9ML2 RS-232USOPTL4 RS-422/485USPTL4 RS-422/485USO9ML2DR-2 RS-232USO9ML2DR RS-232USOPTL4DR-2 RS-422/485USOPTL4DR RS-422/485485USB9F-2W RS-422/485485USB9F-4W RS-422/485232USB9M RS-232485USBTB-2W RS-422/485485USBTB-4W RS-422/485TTL5USB9MTTL3USB9MZZ ProgrammerCard readerF5D6050 802.11b Wireless adapterF5U103 SerialF5U109 SerialSCSIF5D5050 EthernetF5U234 USB 2.0 4-Port HubF5U237 USB 2.0 7-Port HubF5U257 SerialF6H375 UPSF5U409 SerialF6C550-AVR UPSF6C1250EITW-RK UPSF6C1500EITW-RK UPSF6C900 UPSF6C100 UPSF6C120 UPSF6C800 UPSF6C1100/1200 UPSF9L1103 Wireless AdapterRTL8188CUSF5U120-PC HubF7D2102F9L1004V1F5D5055F5D7050 54g USB Network AdapterF5D705A 54g USB Network AdapterF5D705C 54g USB Network AdapterF5D705E 54g USB Network AdapterF5D8053 v3F5D8055F5D8055 v2F5D9050CF5D9050 ver 3F6D4050 ver 1F6D4050 ver 2F7D1101 v2F5U002 ParallelBWIFI-USB54ARUSB100N 10/100 EthernetUSB100LPUSB100ELUSBE100USB2AR EthernetBCM2033BCM2033 (no fw)HL-1050 laser printerMFC 210CKeyboard/Mouse6ch ConSerAirPcap NxCANOSCAN N656UCANOSCAN N1220UCANOSCAN N670UCANOSCAN N1240UCANOSCAN LiDE60PowerShot S10PowerShot S20PowerShot S100PowerShot G1PowerShot A20PowerShot A540PowerShot SX100Netmate EthernetNetmate2 EthernetUSB Chief Bus & Protocol AnalyzerAndromeda hubQVBE-300 PDACASIO Nameland EZ-USBEasyDisk PortableMy3000 keyboardMy3000 hubCM12402 Eagle IR CamCypressKB-8933 keyboardIntegrated CameraPro ThrottlePro PedalsFighterstickFlight Sim YokeWUSB54G v2WUSB54AGUSB200M v2HU200-TSWUSB54GCWUSB54GRWUSBF54GWUSB200AE1000AM10560884 C-Bus Switch5500PACA C-Bus Controller5800PC C-Bus Wireless5500PCU C-Bus5000CT2 C-Bus Touch ScreenC5000CT2 C-Bus Touch ScreenL51xx C-Bus DimmeriPAQ PocketPCA1500iPAQ WLANW100WLAN MultiPort W200Personal Jukebox PJB100iPAQ LinuxCW6622CDMA Technologies USB modemCM-5100P EVDOCCU-550 EVDOCNU-550pro EVDOCGU-628CNU-680CGU-628 disk modeC11UWL-210C54RU WLANC54RUVIGORN61RT2573MEye Q 3xQuickCamEther USB-TFEther USB-TXWirelessLAN USB-11FEther USB-TXSWireless LAN Stick-11FEther USB2-TXULUSB-11 KeyCG-WLUSB2GLCG-WLUSB2GPXCG-WLUSB300GNMCG-WLUSB300NWLAN USB Stick 11FEther USB-TXCNomad IINomad II MGNomadVoip BlasterE-Mu 0202BlueCoreEx1300 hub1500 UPSOR2200 UPSSiemens Gigaset 108TG54USBthermometerKeyboard/HubFM RadioUSB2 HubCY4636 LP RDK BridgeSispm - old versionSispmSispm - flashPhotoClipUSB-FOB/iBUTTONJ-6502 speakersMultiComHenTong WK-668DM9601Axim X51vTrueMobile 1180 WLANW5500 HSDPADell U740 CDMAEU870D HSDPADW700 GPSEarthmate GPSEarthmate LT20Rio 500WL-200UCHUSB 611GWL-240UXH1153 802.11bC-Net CWD-854 rev FRTL8187AccelePort 2AccelePort 4AccelePort 8ZigBeePS/2 ActiveDUB-E100 rev C1DWL-120 rev EDWA-130 rev CDWA-131 rev BDWL-122DWL-G120DWL-120 rev FDWL-G122 rev A2DWL-AG132DWL-G132DWL-AG122DUB-E100 rev B1DWA-140 rev B3DWA-160 rev B2DWA-127DWA-162 Wireless AdapterDUB-1312DWA-131 A1WUA-2340DWA-160 A2DWA-130 rev D1DWL-G122 rev C1WUA-1340DWA-111DWA-110DWA-160 A1DWA-130KVM-221LCD-4300ULCD-8000USamsung LD220IOGEAR DVI GUC2020Rextron DVIStarTech CONV-USB2DVIDisplayLink DVICMP-USBVGA10WS Tech DVIEasyCAP008 DVIHP USB DockingHP USB DVILenovo DVISUNWEIT DVIVideoHome NBdock1920Lilliput UM-70nanovision MiMoLenovo ThinkVision LT1421Polaris2 USB dockStorage AdapterRockChip Media PlayerVigor550Vigor600USB LED Message Board v1.0Sensor TerminalWireless TerminalANT dev boardANT2USBFlash DiskEW-7318EW-7618EW-7717EW-7718EW-7722UTnEW-7811UnTouch PanelDiva 852 ISDN TAhubmonitorBarcode ScannerGoldpfeil P-LAN29UOLD-USB/TXLD-USBL/TXLD-USB20UC-SGT SerialUC-SGT0 SerialFT323RELSAMicrolink USB2EthernetUSB-I2CEeePC701 camera1S serial2S serial1S25 serial4S serialE45 EthernetCentronics1S9 serialEZ-USB2U4S serialUSB PrinterISD Smart Cable for MacISD Smart CablePerfection 636U / 636PhotoPerfection 610Perfection 1200U / 1200PhotoExpression 1600Perfection 1640SUPerfection 1240U / 1240PhotoPerfection 640UPerfection 1650GT-9700FPerfection 2400Perfection 1260Perfection 1660Perfection 1670Stylus CX3650Stylus DX3800Stylus DX4000Stylus DX5000Stylus DX6000CX5400ER1 Control ModuleRCM4 interfaceXTNDAccess IrDATwistSambaCPX-USBCMSPWL-430UWrist PDAT-Com TC 300Pirelli DP-L10Connector for DVD drive8U232AM Serial2232C SerialFT4232HFTXPS/2 Keyboard/MouseMJS Sirius To PC InterfaceOpenRD JTAGKeyCANdapterMindstorms NXTCamOOCDlinkLM3S DevelLM3S EvalJTAG/RS-232OpenDCCOpenDCC SnifferOpenDCC ThrottleOpenDCC GatewayRR-CirKits LocoBufferDMX4ALL DMX interfaceASK RDR 4X7uChameleonOpenPort 1.3 MitsubishiOpenPort 1.3 SubaruOpenPort 1.3 Universal2232L SerialRadio ModemiPlusGamma Scout OnlinePropox JTAGWestrex 777Westrex 8900FHF Dual ISO ReaderCCD cameraATK-16 CameraATK-16HR CameraATK-16C CameraATK-16HRC CameraATK-16IC CameraServoCenter3.1USRMini-Sound-ModulKL 100WS 550WS 888Funk Energie MonitorFHZ 1300 PCWS 500RS-485UMS 100TFD 128FM3 RXWS 777EM 1010 PCCSI 8EM 1000 DLPCK 100RFP 500FS 20 SIGUTP 8WS 300 PCWS 444 PCEVER Eco Pro UPSActive Robots commsPyramid DisplayUnicom IIIExpert ISDNRS232 OptoBridgeExpert mouseCLOCK USB IIExpert mouseCLOCK USB II MSFExpert mouseCLOCK USB II HBG1-WireTNC-X packet-radioVCPD2XXRigExpert TinyHO870HO820FT232BM SerialKWYSY6Y8DB9Y9DGQGDUSBUAD 8UAD 7USI 2T 1100PCD 200ULA 200ALC 8500 ExpertFHZ 1000 PCUltraPortSprog IIInfraredHomePro ZWaveCoastal ChipWorks TNC-XMaster Development 2.0Oceanic instrumentSuunto SportsUSB-UIRTUSBX-707ICD-U20ICD-U40MACH-XLOAD N GOICDU64PRIME8ITM TouchscreenMatrix Orbital USB SerialMatrix Orbital MX200 Series LCDMatrix Orbital LCDMatrix Orbital LK202-24 LCDMatrix Orbital LK204-24 LCDRelaisTira-1DAC-2Accesso readerUR 100CLI 7000UM 100UO 100PPS 7330TFM 100UDF 77UIO 88R2000KU RNGBCS SE923FT232RLCrystalfontz CFA-632 LCDCrystalfontz CFA-634 LCDCrystalfontz CFA-547 LCDCrystalfontz CFA-633 LCDCrystalfontz CFA-631 LCDCrystalfontz CFA-635 LCDCrystalfontz CFA-640 LCDCrystalfontz CFA-642 LCDProtegoR200-USB TRNGSEMC DSS-20 SyncStationCANviewAMC-232USB0TT-USBUS485PIC-ProgrammerPCMCIA SRAM-cards readerParticel counter PK1APP 70 dust monitoringIBS PEDO-ModemCANUSBMass StorageAH-F401U Air H deviceType 6 KeyboardType 7 KeyboardType 6 MouseSmart Power Strip FX-5204PSBase Station FX-5251WBVirtual Eth DeviceYP3X00 PDAGPSmap 60CsxIque 3600Dakota 20GPSmap 62sGDM720x MASS storage modeProx-PU/CUGL620USB-A GeneLink USB-USB BridgeGeneLink Host-Host BridgeGL650 HubGL641USB CompactFlashGN-BR402WGN-WLBM101GN-WBKGGN-WB01GSGN-WI05GSGN-WB31NGN-WB32LSMCWUSBT-GAuricalGoCOM232 Serial converterGWUSB2EGamePad ProCF-writer/MP3 PlayeriMate, ADB adapterExpert mouseCLOCK USBDA LeaderHWGUSB2-54 WLANHWGUSB2-54-LBHWGUSB2-54V2-APHWNU-300HWNUm-300HWGUn-54HWNUP-150Gunze USB Touch PanelFlashGate SmartMediaFlashGate CompactFlashFlashGateCrossam2+USB IR commanderHandspring VisorHandspring TreoHandspring Treo 600WinTV FMHWUN2HWDN2UF200 EthernetUSB-100DVD-CAM DZ-MV100A CamcorderDeskJet 895CScanjet 4100CPhotosmart S20DeskJet 880CScanJet 4200CCD-Writer PlusMultimedia Keyboard HubHN210WHP-x9G+ScanJet 6200CPhotoSmart S20DeskJet 815CScanJet 3300CCD-Writer Plus 8200eDeskJet 1220CDeskJet 810C/812CScanjet 4300CCD-Writer+ CD-4eOfficeJet G85xiLaserJet 1200Scanjet 5200CDeskJet 830CScanJet 3400cseDeskJet 885CLaserJet 1000Scanjet 6300CDeskJet 840cScanJet 2200CScanjet 5300CDeskJet 816CDeskjet 970CseScanjet 5400CiPAQ 22xx/Jornada 548Deskjet 959CJornada 568DeskJet 930cLaserJet 1005Inkjet P-2000UHS2300T750 UPST1000 UPST1500 UPSR/T2200 UPSR1500 G2 UPST750 G2 UPSDeskJet 640cLaserJet 1020Photosmart P1100LaserJet 1018HN210E EthernetPhotoSmart C500PPC6700 ModemSmartPhoneAndroid phoneHUAWEI Mobile E618HUAWEI Mobile ModemHUAWEI Mobile E180HUAWEI Mobile E510HUAWEI Mobile E181HUAWEI Mobile K3765HUAWEI Mobile E353 InitialHUAWEI Mobile E392 InitialHUAWEI Mobile K3765 InitialHUAWEI Mobile E173sHUAWEI Mobile E173s InitialHUAWEI Mobile E303PVR-SMARTPC5740 EVDOUM175 EVDOOpticalCD-ROMQuantis USBID-1ID-RP2C service 1ID-RP2C service 2ID-RP2DID-RP2V service TID-RP2V service RID-RP4000V service TID-RP4000V service RID-RP2000V service TID-RP2000V service RFlash Go!EdgePort/4 RS232Hubport/7Rapidport/4Edgeport/4 RS232Edgeport/2 RS232Edgeport/4 RS422Edgeport/2 RS422/RS485Hubport/4Hand-built Edgeport/8MultiTech version of RP/4Edgeport/(4)21 ParallelEdgeport/421 Hub+RS232+ParallelEdgeport/21 RS232+Parallel1/2 Edgeport/8Edgeport/2 RS232/DINEdgeport/4 RS232/DIN1/2 Edgeport/16Edgeport CompatibleEdgeport/8 RS422WatchPort/HOEM deviceUSB2 StorageIDE ISD110IDE ISD105Portable USB Harddrive V2USB cableUSB Storage Adapter V2Rate Matching HubEasyPCAP310 AnyPoint IIWireless 2011B82930 test boardIO BoardMini IO BoardPrism2.x WLANValueCANNeoVI BlueUSB-SSMRW SD-cardUSB-SDRW SD-cardUSB ET/TUSB ET/TXUSB ET/TX-SUSB WN-B11USB Airport WN-B11USB WN-G54/USETX-US2ETG-US2FT232RWN-GDN/US2WN-G150UMRSAQ1 SerialUSB2.0-SCSI Bridge USB2-SCRSAQ5 SerialZip 100Zip 250CDRW 9602iFP-1xxiFP-3xxiFP-5xxWM1080AUSB-LCD-20x2USB-LCD-256x64PC-60BJD 350SPECBOS 1201AirH"PHONE AH-J3001V/J3002VMP-XP7250 Builtin WLANMP-PRX1Optical Eye/3-wireM-Bus Master MultiPort 250DMiniHub 4000PKC-180 IrDAHKS-0200 USBDAQOrbit trackballTurboBallOrbit trackball for MacVideoCAM VGAUSA-28 serialUSA-28X serialUSA-19 serialUSA-18 serialUSA-18X serialUSA-19W serialUSA-49W serialUSA-19QI serialUSA-19Q serialUSA-28X/XB serialUSA-28XB serialUSA-28XA serialUSA-18XA serialUSA-19WQ serialUIA-10 remote controlUIA-11 remote controlKNU101TX EthernetKonverter for B1Konverter for KAANDigital Science DC220Digital Science DC260Digital Science DC265Digital Science DC290Digital Science DC240Digital Science DC280EasyShare DX4900Niche mouseGenius NetScroll mouseFlight 2000 joystickColorPage Vivid-ProAH-K3001VKPC650 EVDOHard DiskCD R/WAltiTrack9531 GPSUSB 2.0 EthernetjumpSHOT CompactFlash2662W-AROptra S 2450PowerSure PSA UPSLink Instruments MSO-19Link Instruments MSO-28USB1000WUSB100WUSB600NWUSB54GC v2WUSB54GC v3WUSB600N v2Camedia MAUSB-2USB10TXHG20F9 EthernetUSB10T EthernetUSB100TX EthernetUSB100H1 Ethernet/HPNAUSB10TA EthernetWUSB11 802.11bWUSB11 802.11b v2.5WUSB12 802.11b v1.1WUSB11Network Everywhere NWU11BWUSB11 v2.8WUSB11 v3.0LAN-GTJ/U2LAN-TXLAN-W300N/U2LAN-W150N/U2LAN-W300N/U2SM2452 keyboardM4848 mousePageScanQuickCam WebWebcam C200Webcam C500QuickCam ProWebcam C310HD Pro Webcam C910QuickCam ExpressQuickCam Notebook DeluxeQuickCam Pro 3000QuickCam Notebook ProQuickCam Pro 4000QuickCam ZoomQuickCam FusionQuickCam Orbit MPQuickCam Pro 5000QuickCam OEMQuickCam Ultra VisionQuickCam Pro 9000QuickCam Pro NotebookQuickCam Communicate DeluxeQuickCam Orbit AFQuickCam Communicate MPQuickCam E 3500 PlusQuickCam Deluxe NotebookN43N48 mouseM-BA47 mouseWingMan Gaming MouseBD58 mouseiFeel MouseWingMan GamePad ExtremeWingMan RumblePadWingMan Force joystickWingMan Formula Force GP (GT-Force)iTouch KeyboardUSB-PS/2 TrackballTrackMan WheelCordless mouseCordless keyboardCordless Desktop OpticalEmobile D21LC Mass only modeEmobile D21LCIIJmobile 510FUIIJmobile 510FU Mass only modeLCS-8138TXUSS-720 evaluation kitSheevaPlugD-Link DU-H3SP BAY HubSitecom RS232ML-4500MDS ISDB-T tunerUMTS USB modemCashflow-SCSeries 2000USB 5131 DCF77 - Radio ClockLUA-TX EthernetNintendo Wi-FiLUA2-TX EthernetLUA-KTX EthernetWLI-USB-S11MCR-SM2 SmartMediaUSB-IDE Bridge: DUB-PxxGWLI-USB-KS11G wlanLUA-U2-KTX EthernetWLI-USB-KB11 WLANWLI-U2-KG54-YB WLANWLI-U2-KG54 WLANWLI-U2-KG54-AI WLANLUA-U2-GT EthernetWLI-U2-KAMG54PC-OP-RS1 RemoteStationWLI-U2-SG54HPWLI-U2-G54HPWLI-U2-KG54LWLI-UC-G300NWLI-U2-SG54HGWLI-UC-AG300NWLI-UC-GNHPWLI-UC-GNWLI-UC-G301NWLI-UC-GNMWLI-UC-GNM2MetaGeek Wi-SpyTelldus TellstickWi-Spy 2.4iRicochet GSMODACOM Mobile wimax adaptorYUREXCAM_1TEMPer sensorSP128AR EtherFastSideWinder Precision ProIntelliMouseNaturalDigital Sound System 80Sidewinder Precision Racing WheelInternet Keyboard ProTrackball ExplorerIntelliEye mouseMN510 WirelessPalm 700WXWireless Optical IntelliMouseWireless Optical Mouse (Model 1023)Wireless Optical Mouse 3000 (Model 1049)Wireless Optical Mouse 3000 (Model 1056)XBOX 360 ControllerXBOX 360 WLANWireless Mobile Mouse 3500Microsoft LifeCamWireless Arc Mouse (Model 1350)SCSI-DB25SCSI-HD50CameraMateFreecom IDEPhantom 336CX - C3ScanMaker X6 - X6UPhantom C6ScanMaker V6USLScanMaker V6ULMidisport 2x2Digital WalletDimage S304Dimage XDimage 7iDimage A1CD-R/RW DriveFDDMA-620 IrDAEasiDock 200 SerialEasiDock EthernetMCS7703 SerialMCS7715 Serial ParallelMCS7730 EthernetMCS7810 SerialMCS7820 SerialMCS7830 EthernetMCS7832 EthernetMCS7840 SerialMC141555 hub controllerT720cV360USBLANSB4100 Cable ModemSB5100 Cable ModemUPort 1110MT5634ZBA modem1200 CU600 CU1200 UB1200 Plus1200 CU PlusBearPaw 1200FMDC-800DV2000PowerMust 800DiskOnKeyGPIB-USB-ABearPaw 1200BearPaw 2400WL300NU-GRepeaterPicty760Picty900Picty920Picty800USB2.0 Hub6-in-1 Flash Device Controller8-in-1 Flash Device ControllerMulti-format Flash ControllerTurbo-ConnectClik! 40EthernetGadgetUSB 2.0 Fast Ethernet802.11b802.11b V2WG111v3WG111UWG111v2WN111V2WNDA3100WNDA3200WNA1100WNA1000WNA1000MMA101MA101 Rev BWG111TWPN111E990E880E885CA-42 SerialInternet Stick CS-15 (umass mode)Internet Stick CS-15Noritake COMEMONV-902WExpressCard 3GV620V740V720U740U870XU870X950DES620 CDMAU720EU870DU727MC950D HSUPAZeroCDMC760 CDU760MC760NovAtel FlexPack GPSOZ776 HubOpenOCD JTAGC-1C-700 Ultra ZoomOV511OV511+BX50F UPSBX35F UPSBY35S UPSMDCFE-B CFMemory Stick+CFDatafab-basedPNY/Datafab CF+SMSimple Tech/Datafab CF+SMCF + SM Combo (LC1)Datafab MD1-II PC-Card8In2model 01 WiFimodel 01 Bluetoothmodel 01+ Ethernetmodel 01 EthernetSolid state diskDKU-5 SerialAC4 USB-RS485USB Serial AdaptorPalm m500Palm m505Palm m515Palm i705Palm Tungsten ZPalm m125Palm m130Palm Tungsten TPalm Zire 31Palm ZireLS-120MultiMediaCardTY-TP50P6-S 50in Touch PanelUB94SB485 USB-485/422AP485 USB-RS485SB422 USB-RS422SB485S USB-485/422SB485C USB-485/422SB232 USB-RS232TMU ThermometerIRAmp DuplexDRAK5QUIDO USB 8/8QUIDO USB 4/4QUIDO USB 2/2QUIDO USB 10/1QUIDO USB 30/3QUIDO USB 60(100)/3QUIDO USB 2/16QUIDO USB 3/32DRAK6 USBUPS-USB StavovyMU ControllerSimuKeyAD4USBGOLIATH MUXGOLIATH MSR6 in 13 in 1Serial ConverterAt-Home EthernetWL-503IAGWU5132x2 Interface KitDSS 350 Digital Speaker SystemDSS XXX Digital Speaker SystemSNU5630NS/05PCA645VCPCA646VCPCVC675K VestaPCVC680K Vesta ProPCVC690K Vesta Pro Scan CameraPCVC730K ToUCam FunPCVC740K ToUCam Pro PCPCVC750K ToUCam Pro ScanDSS 150 Digital Speaker SystemAKTAKOM ACE-1001CPWUA054SNU6500SNU5600DIVA mp3 playerPS2 to MacXkeys Programmable KeyboardCRW-600 6-in-1GW-US11H WLANGW-US11S WLANGW-US54ZGLGW-US54GXS WLANGW-US300GW-US54HPGW-US54GZGU-1000TGW-US54MiniGW-US300MiniSGW-USNanoGW-USMicro300GW-US54Mini2GW-US54SGGW-US54GZLGW-US54GDGW-USMMGW-USMicroNGW-USMicroN2WDSP-400 Headsettest boardExpress EthernetPP7000 series printerTravel Flash DriveG2-200G2E-300G2-300Colorado 9600Colorado 600uVisioneer 6200Colorado 19200Colorado 1200uG2-600ReadyScan 636iG2E-600ComfortMouse-in-a-BoxSony PCGA-UMS1PL2301 Host-HostPL2302 Host-HostPL2303 SerialParallel printerATAPI-4 Bridge ControllerPL2501 Host-HostUSB-1284 BRIDGEScorpion-980NMSM driverCDMA MSM modemHSDPA MSMCDMA MSM phoneCDMA Technologies MSM modemZTE MF633 USUPA USB modemZTE MF637 HSUPA USB modemZTE K3565-Z USB MSM modemZTE USB MSM installerONDA MSA110UP USB MSM modemZTE MF112 HSUPA USB modemZTE HSUSBAC2746 CDMA USB modemZTE USB CDMA installerAC8700 CDMA USB modemQuanta USB MSM (umass mode)Quanta Q101 HSDPA USB modemUSB StrikePadNeo1973 Debugi-Key 2000RT2671RT3370RT5370RT3573RT5572MT7601RT8070USB serial REX-USB60REX-USB60FRTL8188CTVRTL8188RURTL8150RTL8151 PNARTL8152RTL8153RTL8171RTL8172RTL8173RTL8174RTL8191CURTL8192CERTL8187BRTL8192URTL8712RTL8713RX610 RX-StickBlackberryRIM Mass Storage DeviceBlackberry pearlVGP-VCC2 CameraVGP-VCC3 CameraVGP-VCC5 CameraVGP-VCC4 CameraVGP-VCC6 CameraVGP-VCC7 CameraVGP-VCC8 CameraVGP-VCC9 CameraVGP-VCCX CameraUA-100 Audio I/FUM-4 MIDI I/FSC-8850 MIDI SynthU-8 Audio I/FUM-2 MIDI I/FSC-8820 MIDI SynthPC-300 MIDI KeyboardUM-1 MIDI I/FSK-500 MIDI KeyboardSC-D70 MIDI SynthUM-880 MIDI I/FSD-90 MIDI SynthUM-550 MIDI I/FSD-20 MIDI SynthSD-80 MIDI SynthUA-700 Audio I/FUM-ONE MIDI I/FGamepad 203USBCT57B Radio CableUSB-485-BLXG-760AXG-76NACyborg 3D Gold JoystickImageMate SDDR-05aImageMate SDDR-31ImageMate SDDR-05ImageMate SDDR-12ImageMate SDDR-09ImageMate SDDR-75JY-DV9USB gamepadSanyo SCP-4900 PhoneWIS09ABGN Wireless LAN adapterAndroidAndroid v2I330SWL-2100USL11R-IDESeaLINK+232 (2101/2105)SeaLINK+485 (2102)SeaLINK+232I (2103)SeaLINK+485I (2104)SeaLINK+422 (2106)SeaPORT+2/232 (2201) Port 1SeaPORT+2/232 (2201) Port 2SeaPORT+2/485 (2202) Port 1SeaPORT+2/485 (2202) Port 2SeaPORT+2 (2203) Port 1SeaPORT+2 (2203) Port 2SeaPORT+4/232 (2401) Port 1SeaPORT+4/232 (2401) Port 2SeaPORT+4/232 (2401) Port 3SeaPORT+4/232 (2401) Port 4SeaPORT+4/485 (2402) Port 1SeaPORT+4/485 (2402) Port 2SeaPORT+4/485 (2402) Port 3SeaPORT+4/485 (2402) Port 4SeaPORT+4 (2403) Port 1SeaPORT+4 (2403) Port 2SeaPORT+4 (2403) Port 3SeaPORT+4 (2403) Port 4SeaLINK+8/232 (2801) Port 1SeaLINK+8/232 (2801) Port 2SeaLINK+8/232 (2801) Port 3SeaLINK+8/232 (2801) Port 4SeaLINK+8/232 (2801) Port 5SeaLINK+8/232 (2801) Port 6SeaLINK+8/232 (2801) Port 7SeaLINK+8/232 (2801) Port 8SeaLINK+8/485 (2802) Port 1SeaLINK+8/485 (2802) Port 2SeaLINK+8/485 (2802) Port 3SeaLINK+8/485 (2802) Port 4SeaLINK+8/485 (2802) Port 5SeaLINK+8/485 (2802) Port 6SeaLINK+8/485 (2802) Port 7SeaLINK+8/485 (2802) Port 8SeaLINK+8 (2803) Port 1SeaLINK+8 (2803) Port 2SeaLINK+8 (2803) Port 3SeaLINK+8 (2803) Port 4SeaLINK+8 (2803) Port 5SeaLINK+8 (2803) Port 6SeaLINK+8 (2803) Port 7SeaLINK+8 (2803) Port 8NUB-8301NUB-862Root HubSN1 L1 System ControllerST268DM9620ADM9621AZT6688ADM8515 EthernetDM9000EDM9620DM9621DM9622Pocket AdapterSL5500A300SL5600C700C750E-USB BridgeeUSCSI BridgeImageMate SDDR09eUSB SmartMedia / CompactFlasheUSB MultiMediaCardSony HifdeUSB ATA/ATAPIeUSB CompactFlashCD-RW DeviceSCM MicroSpeedStreamSpeedStream 1022GSM module MC35SX1X65X75EM5625MC5720AirCard 595MC5725597ECompass 597595UAircard 580 EVDOAircard Tru InstallerMC8755MC8765MC8775875MC8780MC8781MC8790880881880E881E880U881U885UC01SWUSB305MC8355IrDADatum Networks SSF-7X Multi PlayersDigiFilm-ComboMULTICARDREADERU2EPsion Dacom Gold Port EthernetVStabi ControllerArkham DS101 MonitorArkham DS101 AdapterBSM7-D-USBPololu SerialSoftware Bisque Paramount MECygnal Debug AdapterEDG1228Argussoft ISPIMS USB-RS422Crumb128Optris MSpro LT ThermometerDegree ControlsTracient RFIDTrack Systems TraqmateSuunto sportsArygon Mifare RFID readerBurnside Desktop mobileTams Master Easy ControlRIGblaster P&PRIGtalkB&G H3000 Data CableIP-Link 1220Timewave HamLinkUSBAVIT Research USB-TTLMJS USB-TOSLINKThinkOptics WavItMultiplex RC adapterMSD DashHawkINSYS ModemLipowsky Baby-JTAGLipowsky Baby-LINAerocomm RadioZephyr BioharnessEMS C1007 HF RFID readerLipowsky HARP-1Commander 2 EDGE(GSM) ModemCygnal Fasttrax GPSTelegesis ETRX2USBProcyon AVSMC35puCygnalAmber Wireless AMB2560DekTec DTA Plus VHF/UHF BoosterKyocera GPSIRZ SG-10 GSM/GPRS ModemBEI USB Sensor (VCP)Balluff RFID readerAC-Services IBUSAC-Services CIS-IBUSAC-Services CANAC-Services OBDDCU-11 cloneCP210x SerialGPRS ModemGPRS Modem 100EUInfinity GPS-MIC-1CP2110 USB HID SerialUSBscope50USBwave12USBpulse100USBcount50YAP Phone (no firmware)YAP PhoneNetComm Roadster II 56LN029WL-022CN104WL-168 v1LN-030WL-168 v4WL-302WL-603WL-315WL-321WL-324WL-343WL-608WL-344WL-329WL-345WL-353WL-349 v1WL-349 v4WLA-4000WLA-5000LN-028LN-032WL-113WL-172WL-113 rev 2SmartLink EthernetsmartNIC 2 PnPEZ Connect EthernetSMSC9500SMSC9505SMSC9500ASMSC9505ASMSC9512/14SMSC9512LAN9530LAN9730LAN89530EZ Connect 11MbpsEZ Connect 11Mbps v2EZ Connect 54MbpsNUB100 EthernetNUB110 EthernetDSC CamerasMemorystick NW-MS7Harddrive V2Memorystick MSAC-US1HandycamMSC MemorystickClie v3.5PlayStation2 keyboardPlayStation2 keyboard hubPlayStation2 mouseClie v4.0Clie v4.0 Memory StickClie s360Clie v4.1 Memory StickClie v4.1Clie nx60Clie tj25IFU-WLM21seg TV tunerKeikaiDenwa 8KeikaiDenwa 8 with chargerMS3303H SerialUB801RICUSB2321X/2X/4XBiometric CoprocessorCommunicatorISDN TA+USBAUSBRH sensorInternet Access DeviceMobile AdaptorU-Cable type D2U-Cable type P1Slipper UIr-TrinityU-Cable type A3U-Cable type A4SGC-X2ULSupra Express 56KSupraMax 2890 56KRio 600Rio 800Nike psa[play 120EP-1427X-2 EthernetEP-9001-G rev 2AEricsson DCU-10/11LW153LW154LW303LW313ZD1211CipherLab Barcode ScannerModem modeStorage modeUSBPS2CameraMate (DPCM_USB)ZodiacUSB-PDC Adapter UPA9664USB-cdmaOne Adapter UCA1464USB-PHS Adapter UHA6400USB-PHS Adapter UPA6400FD-05PUBALLNET 0193 WLANZyXEL ZyAIR B200 WLANU-300CQuickWLANMicrophoneTWL541U WLANMissile LauncherAureon Dual USBKY-BT100 Bluetooth175/177 USB interface330 USB interface435/635/735 USB interface845 USB interfaceService adapter580 USB interface174 USB interface556/560 USB interfaceUSB adapterUSB to serial converterUT-USB41 hubTUSB2046 hubTUSB3410Nex II DigitalMSP-FET430UIF JTAGMSP-FET430UIFFusion Digital GamepadQL355P power supplyArgos Mini SmartcardToradex OAK RH sensorToradex OAK P sensorToradex OAK LUX sensorToradex OAK Tilt sensorToradex OAK DIST sensorToradex OAK MOVE sensorToradex OAK 4-20mA sensorToradex OAK G sensorToradex OAK MAGR sensorToradex OAK RELAYToradex OAK 10V sensorToradex OAK LN sensorToradex OAK IOToradex ORIENT Tilt sensorHSDPAThumbDriveThumbDrive 8MBU209 SerialUSB/MP3 decoderXXX 1100Optical MouseSM-2000G240ANTARIS4 GPSTEW-444UB EUTEW-429UB_ATEW-429UBTEW-429UB C1TEW-645UBALL0298 v21200 UB PlusAstra 1236UAstra 1220UAstra 2000UAstra 2100UAstra 2200UAstra 3400Panache Surf ISDNNW-3100RD9700NF RICUSR1120 WLANUSR9000 SureConnect ADSLUSR5422 WLANUSR5421A WLANUSR5423 WLANMC60 SerialVFS101 Fingerprint ReaderVFS301 Fingerprint ReaderVFS451 Fingerprint ReaderVFS300 Fingerprint ReaderVFS5011 Fingerprint ReaderVFS471 Fingerprint ReaderK8055 USB Experiment interface boardVW110LG773 Monitor HubP815 Monitor HubAirsyncG773 Monitor ControlCPiA CameraOneTouch 7600OneTouch 5300Scanport 3000OneTouch 6100OneTouch 6200OneTouch 8100OneTouch 8600DSC350Vodafone Mobile Connect 3GGlobeTrotter 3G FUSIONGlobeTrotter 3G QUADGlobeTrotter 3G QUAD PLUSGlobeTrotter MAX 3.6/7.2GlobeTrotter 3G PLUSGlobeTrotter HSDPA ModemGlobeSurfer Icon 7.2GlobeTrotter HSDPA Icon 225GlobeTrotter HSUPA 380EGlobeTrotter Icon322 storageUSB instrument cableCH341 serial/parallelCH341A serial/parallelCH340 serial/parallelCT-0405-U TabletGraphireGraphire3 4x5Graphire4 Classic A6Intuos A5Service Cable 750-923Jazz blood glucose meterPL512 PSURCM Remote ControlMPOD PSUCML Data LoggerWNC-0600USBUR055GORiNOCO 802.11nXimax CDCImaging DeviceIBM PC CameraFlashbuster-UUX256 MIDI I/FUX96 MIDI I/FRP-U200NetVolante RTA54iNetVolante RTW65bNetVolante RTW65iNetVolante RTA55iU640MO-03YubikeyM4Y-750XI-725/726XI-735MD40900UB81UB822986L Fax ModemZD1201ZD1221ALL0298Omni 56K PlusG-220G-220FG-200 v2AG-225HM-202G-270SG-220 v2G-202AG-220AG-225H v2NWD-271NNWD-211ANNWD2105PrestigePlanex CommunicationsUnknown vendoreGalaxHUMAXBernd Walter Computer TechnologyAOXAtmelMitsumiHewlett PackardAdaptecNational SemiconductorAcer LabsFuture Technology DevicesQuantaNECEastman KodakVIAMelcoLeadtekCreative LabsNokiaADI SystemsComputer Access TechnologyStandard MicrosystemsAdvanced Gravis ComputerFujitsu ComponentTaugagreining HFAdvanced Micro DevicesLexmark InternationalNANAOAlps ElectricThrustmasterTexas InstrumentsAnalog DevicesSilicon Integrated Systems Corp.KYE SystemsDiamond (Supra)RenesasMicrosoftPrimax ElectronicsEaton (MGE)AMPCherry MikroschalterAmerican MegatrendsLogitechBehavior Tech. ComputerPhilipsSanyo ElectricConnectixDellKensingtonLucentPlantronicsKyoceraSTMicroelectronicsFoxconnYAMAHACompaqHitachiAcer PeripheralsDavicomVisioneerNikonCypress SemiconductorSeiko EpsonRainbow TechnologiesI/O DataTDKU.S. RoboticsMethode Electronics Far EastMaxi SwitchLockheed Martin Energy ResearchFujitsuToshiba AmericaMicro Macro TechnologiesKonicaLite-On TechnologyFuji Photo FilmPhilips SemiconductorsTatung Co. Of AmericaScanLogicMyson TechnologyDigiITT CanonAltec LansingItunerHoltekPanasonic (Matsushita)SharpIiyamaShuttle TechnologySamsung ElectronicsAnnabooksJVCChicony ElectronicsElanBrother IndustriesDallas SemiconductorAcer3ComAztech SystemsBelkin ComponentsKawatsu SemiconductorAmerican Power ConversionAdvanced Connectek USANetChip TechnologyALTRAATI TechnologiesAladdin Knowledge SystemsUniversal AccessViewSonicXirlinkAnchor ChipsSonyVLSI VisionAsahi Kasei MicrosystemsATEN InternationalSamsungMustek SystemsTelex CommunicationsPeracom NetworksAlcor MicroWACOMe-TEK LabsEIZOElecomXyratexHauppauge Computer WorksBAFO/Quality Computer AccessoriesY-E DataAVMQuickshotRolandRockfireRATOC SystemsZyXEL CommunicationOMRON CorporationIomegaA-Trend TechnologyAdvanced Input DevicesLaCieCisco-LinksysOmniVisionJing MoldIn-System DesignApple ComputerY.C. CableDigi InternationalQualcommQtronixRicohBrainboxesUltimaAxiohm Transaction SolutionsMicrotekSUN CorporationLexar MediaAddtronSymbol TechnologiesGenesys LogicFuji ElectricKeithley InstrumentsEIZO NanaoKawasaki LSIFFCAnko ElectronicP.I. EngineeringAOC InternationalChic TechnologyBarco Display SystemsBridge InformationSolid YearBio-Rad LaboratoriesMacallyAct LabsAlarisVivitarGunze Electronics USAAvisionTEACSilicon GraphicsSanwa SupplyLinksysAcer Semiconductor AmericaSigmatelDrayTekAiwaACARD TechnologyProlific TechnologySiemensAvance LogicMinoltaCH ProductsHagiwara Sys-ComChuntexAskey ComputerSaitekAlcatel TelecomAGFA-GevaertAsia Microelectronic DevelopmentPhidgetsBizlink InternationalKeyspanLiebertAashima TechnologyMultiTechADS TechnologiesAlcatel MicroelectronicsSirius TechnologiesGuillemotBoston AcousticsPutercomMCTImationDomain Technologies, Inc.SusteenEicon NetworksStollmannSyntech InformationDigital StreamAureal SemiconductoriDowellMidimanCyberPowerSurecom TechnologyGriffin TechnologySanDiskJenoptikLogitecBrimaxAxis CommunicationsABL ElectronicsSagemSun CommunicationsAlfadata ComputerNational Technical SystemsOnntoBeADMtekCoregaFreecomMicrotechMotorolaOlympusAboCom SystemsKeisokugikenOnSpecAPG Cash DrawerB.U.G.Allied Telesyn InternationalAVerMedia TechnologiesSIIGCASIOD-LinkAptio ProductsArasan Chip SystemsAllied CableSTSNBewanZoom TelephonicsBroadLogicHandspringAction Star EnterprisePalm ComputingSOURCENEXTAccton TechnologyDiamondBayNETGEARTopre CorporationActiveWireB&B ElectronicsPortGearNetgearSystem TalksMetricomADESSO/Kbtek AmericaJatonAPT TechnologiesBoca ResearchAndrea ElectronicsBurr-Brown Japan2WireAIPTEK InternationalSmartBridgesBillionton SystemsGEMPLUSExtended SystemsM-SystemsDigianswerAuthenTecAudio-TechnicaTrumpion MicroelectronicsAlation SystemsGlobespanConcord CameraGarmin InternationalGoHubsAmerican Biometric CompanyToshiba CorpIntrepidYanoKingston TechnologyBlueWater SystemsAgilent TechnologiesGude ADSPortsmithAdirondack Wire & CableBeckhoffMinds At WorkIntersilAltius SolutionsArris InteractiveACTIVCARDACTiSYSNovatelA-FOUR TECHAIMEXAddonics TechnologiesAKAI professional M.I.ARESCOMBay AssociatesAlteraCambridge Silicon RadioTrek TechnologyAsahi OpticalBoca SystemsShanTouHiroseBroadcomGREENHOUSEGeocast Network SystemsDream Cheekyid QuantiqueID TECHZyDAS TechnologyChen-SourceNeodioOptionTodos Data SystemASUSOmnidirectional Control TechnologyTekram TechnologyHAL CorporationATIKurusugawa ElectronicsSmart TechnologiesASIX ElectronicsO2 MicroSystem SACOM Industry Co.,LtdAmbit MicrosystemsHTCRealtekMEIAddonics TechnologyFujitsu Siemens ComputersAgate TechnologiesDMIIcomGN OtometricsMicrodia / Sonix Technology Co., Ltd.Sealevel SystemJETIEasyDiskElektor ElectronicsTerraTec Electronic GmbHZ-ComAtheros CommunicationsPosiflex TechnologiesTangtopKobil SystemsSMCPen DriveABCConceptronicMicro Star InternationalELCON SystemtechnikUnknown VendorSitecom EuropeMobile ActionAmigo TechnologyVMwareSpeed Dragon MultimediaCONWISE TechnologyHawkingFossilG.MateMediaTek Inc.Ours TechnologyPilotechNova TechiTegnoNoritake itron CorpXIRINGAirprimeLarsen and BrusgaardVTechFalcom Wireless CommunicationsResearch In MotionDynastream InnovationsDViCOThurlby Thandar InstrumentsGIGABYTEYubico.comCCYU TechnologyHyundaiGCT SemiconductorSILABS2USIPLXAsanteSilicon LabsVellemanMoxa TechnologiesTen X Technology, Inc.Integrated System Solution Corp.Japan Radio CompanySphairon Access SystemsDeLormeServerWorksAcer Communications & MultimediaSierra WirelessAlcatelInterBiometricsTsunamiPheenetRaptor GamingTwinMOSTendaTesto AGCyberTAN TechnologyHUAWEI TechnologiesAraneus Information SystemsTapwaveAincommMobilityDick Smith ElectronicsValidity SensorsBaltechSharkAsureWaveWistron NeWebRadio ShackOpenMokoHuawei 3ComSilicomRalink TechnologyStarTech.comSilicon PortalsU-bloxOwenOQOU-MEDIA CommunicationsFiberlineSparkLANOlimexAMITTrustSOHOwareUMAX Data SystemsInside Out NetworksGood Way TechnologyEntregaActiontec ElectronicsClipsalGigasetGlobal Sun TechnologyAnyDATA Inc.JablotronCMOTECHWIENER Plein & BausAxesstelSenaoStrawberry linux Co., Ltd.SweexMecaniqueKamstrup A/SDisplayLinkLenovoWaveSenseVAISALAQcomELVAvagoMeinberg FunkuhrenZTE Inc.Terminus TechnologyAbbott LabsBayer Health CareQinHeng ElectronicsMatrix OrbitalToradex inc.OvisLinkThe Mobility LabTCT MobileMDSAlti-2SunplusWAGO KontakttechnikLongcheer TechnologyDresden ElektronicDream LinkPegatronMetaGeekFestoModacomAirTiesVertex Wireless Co., Ltd.EncorePARA IndustrialTRENDnetRT SystemsVIA LabsArduino SATP-LinkTripp-LiteNHJASUSTeK ComputerLink InstrumentsAEIPQIDaisy TechnologyNational InstrumentsMicronet CommunicationsI-O DataiRiverAceecaFeiXun CommunicationNetweeNPapouch s.r.o.AveratecZinwellSitecomArkmicroEDIMAXIntelALLWIN TechMosChipMarvellCACE TechnologiesCompareDataApexEvolution RoboticseMPIA TechnologyNORMAL_COMPLETIONIN_PROGRESSPENDING_REQUESTSNOT_STARTEDINVALNOMEMCANCELLEDBAD_ADDRESSIN_USENO_ADDRSET_ADDR_FAILEDNO_POWERTOO_DEEPIOERRORNOT_CONFIGUREDTIMEOUTSHORT_XFERSTALLEDINTERRUPTEDXXX%s: illegal enable change, port %d %s: port error, restarting port %d %s: port error, giving up port %d %s: connected port %d has no power %s: port %d reset failed %s: device problem, disabling port %d %s: hub depth (%d) exceeded, hub ignored %s: unable to set HUB depth %s: no ports, hub ignored %s: bus powered hub connected to bus powered hub, ignored %s: no interface handle %s: no endpoint descriptor %s: bad interrupt endpoint %s: cannot open interrupt pipe %s: port %d power on failed, %s uhubuhidev_intr: bad repid %d uhid at %s reportid %d%s: could not read endpoint descriptor %s: unexpected endpoint %s: no input interrupt endpoint %s: no HID descriptor %s: no memory %s: no report descriptor %s: iclass %d/%d, %d report id%suhidevuhidrea: input=%d, output=%d, feature=%d uhidno usable key codes array%s: was console keyboard ukbd%s: got polled xfer %p, but %p already pending %s: CBI bulk-in/out stall clear failed, %s %s: CBI intr-in stall clear failed, %s %s: CBI reset failed, %s %s: CBI bulk-in stall clear failed, %s %s: CBI bulk-out stall clear failed, %s %s: Unknown state %d%s: Invalid CSW: sig 0x%08x should be 0x%08x %s: Invalid CSW: tag %d should be %d %s: Invalid CSW: status %d > %d %s: Phase Error, residue = %d %s: transferred %d bytes instead of %d bytesBulk-OnlyCBICBI with CCIISD-ATARBCUFI%s: using %s over %s %s: isdata not configured %s: command protocol=0x%x not supported %s: bus attach failed umass%s: Unknown status %d in umass_scsi_cbumass_cmd: large datalen, %d %04x%04x%sRT5226RT2527 (MIMO XR)RT2528RT5225 (MIMO XR)%s: could not retrieve Tx statistics - cancelling automatic rate control %s: could not multi write MAC register: %s %s: could not run firmware: %s %s: could not multi read MAC register: %s %s: could not write to RF %s: could not write to BBP %s: could not read EEPROM: %s %s: could not read BBP %s: timeout waiting for BBP %s: device timeout %s: could not allocate protection frame %s: could not transmit buffer: %s %s: could not allocate rx mbuf %s: could not allocate rx mbuf cluster %s: could not allocate rx xfer %s: could not allocate rx buffer %s: could not allocate tx xfer %s: could not allocate tx buffer %s: timeout waiting for BBP/RF to wakeup %s: could not allocate AMRR xfer %s: could not open Tx pipe: %s %s: could not open Rx pipe: %s %s: could not allocate Tx list %s: could not allocate Rx list %s: could not queue Rx transfer rum-rt2573%s: failed loadfirmware of file %s (error %d) %s: could not load 8051 microcode %s: could not set configuration no %s: could not get interface handle %s: no endpoint descriptor for iface %d %s: missing endpoint %s: timeout waiting for chip to settle %s: MAC/BBP RT%04x (rev 0x%05x), RF %s, address %s rumomusbtllmemory size derived from u-boot bootconf.mem[%d].address = %08x pages %d/0x%08x board type %x unknownOpenBSD/sunxisxidmacohcisxiccmu_attach: bus_space_map failed!sxipio_attach: bus_space_map failed!asd?a1xintc_attach: bus_space_map failed!intr_establish: bogus irq %d %s intr_establish: can't malloc handler info statticksxitimer_attach: bus_space_map failed!: ticktimer %dhz @ %dKHz: stattimer %dhz @ %dKHz: cntrtimer @ %dKHzsxitimer_attach: unit = %dsxidog_attach: bus_space_subregion failed!sxirtc_attach: couldn't allocate todr_handlesxirtc_attach: bus_space_subregion failed!sxiahci_attach: bus_space_map failed!: AHCI phy power up failed. : AHCI phy calibration failed. : unable to establish interrupt sxiehci_init: unit >1 %d: cannot map mem space XXX - disable ehciAllwinner%s: init failed, error=%d %s: %d silo overflow%s, %d ibuf overflow%s sxiuartprmsxiuartattach: bus_space_map failed!: console%s: can't establish soft interrupt.sxie_start: packet too big sxie_start: tx fifos in use. %s: watchdog tx timeout sxie_attach: bus_space_map ioh failed!sxie_attach: bus_space_map sid_ioh failed!, address %s kd'({^~: TĔ̔    DXx4xHԷxLxH 4@H\@p@x6\\<(XxP ixT4ix0 Hix0 \i<|0<Dx0 px0 xHxD,xDDXxDxDxD0xDDxDlxDxDxDؔpْ ԋĞ-"V||\`wPwh]TBXBBD`B,GB\B`rruLwCpp0ouDwAlqpuHwAȂoiMDTE @ @ @   )PWEVrdroot k7vDvWEV  08xT <  T0.xN/mntp. NT x@@<@T 08xT <  T0.x T x@@<@TU Tx T3ݩMA T)&.TR TR AT܎4T܎4T4yRQCSTT$TR 8 f3TF#Tdq0Tdq0z0lT#h1T;'T;'( " S"T]7TݮBTGZ7}-T&#TLTGZ70 z *@֡T꺊!Tֶ1Tֶ18 @ H P X ` h p x Q' \2 j8ONXi e-6#YApq aQbhP4kCm0 N`p+ybjw6 'W+(n!S~uZSMfDvR nDžY=0PE^8~tzSCr~"=$76~UenJBBU)4ߺW T13/4fuDρf- !f o4?j‚bGO6O̱JJ`#gIm1j cj7, q R@ 5KP"Ik JXC1ugKa5o'~HKWwNnG$ +Q]Aڪݵf81ZVWA t6S*QOo)2Rd~B~F- ?QGh J2$H̾a"*\<R i3UFKаen/ZN&8a W»xBE[ F𛂊 n{|M8_0dw%6=Lh./QC,$(Y> ZK| 3,Ԑc]Ug yXu}u:oa+ 8"AWp7ݸԼV9Y}NLz0O;|nLȩTnT>W &EYa T7TtjkBV% 1:''>Z'#cuҧ\Y</OG*jN cWr9@&W?mH)Q/9Q9kNGde@^VCmDDx8$OKTa !iDl3#:tp q  ... export VNAME=$(sysctl -n kern.osrelease) export VERSION="${VNAME%.*}${VNAME#*.}" export ARCH=$(sysctl -n hw.machine) export OBSD="OpenBSD/$ARCH $VNAME" export PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ umask 022 set -o emacs set -- $(dmesg | sed -n '/^root on /h;${g;p;}') rootdisk=$3 if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES mount -u /dev/${rootdisk:-rd0a} / echo ! : > /etc/rc echo 'erase ^?, werase ^W, kill ^U, intr ^C, status ^T' stty newcrt werase ^W intr ^C kill ^U erase ^? status ^T cat <<__EOT Welcome to the $OBSD installation program. __EOT timeout=false timer_pid= if [ ! -f /tmp/noai ] && { ifconfig netboot >/dev/null 2>&1 || [ -f /auto_install.conf ] || [ -f /auto_upgrade.conf ]; }; then echo "Starting non-interactive mode in 5 seconds..." >/tmp/noai trap 'kill $timeout_pid 2>/dev/null' EXIT trap 'exit 1' INT trap 'timeout=true' TERM set +m exec 3<&1 4<&2 >/dev/null 2>&1 (sleep 5; kill $$) & timer_pid=$! exec 1<&3 2<&4 3<&- 4<&- set +m fi while :; do echo -n '(I)nstall, (U)pgrade, (A)utoinstall or (S)hell? ' read REPLY if $timeout; then timeout=false echo REPLY=a else [ -n "$timer_pid" ] && kill $timer_pid 2>/dev/null timer_pid= fi case $REPLY in a*|A*) /install -a && break ;; i*|I*) /install && break ;; u*|U*) /upgrade && break ;; s*|S*) break ;; !) echo "Type 'exit' to return to install." ksh ;; !*) eval "${REPLY#?}" ;; esac done fi #!/bin/ksh MODE=upgrade . install.sub while :; do ask "Root filesystem?" $ROOTDEV resp=${resp##*/} [[ -b /dev/$resp ]] && break echo "$resp is not a block device." done ROOTDEV=$resp echo -n "Checking root filesystem (fsck -fp /dev/$ROOTDEV)..." fsck -fp /dev/$ROOTDEV >/dev/null 2>&1 || { echo "FAILED."; exit; } echo "OK." echo -n "Mounting root filesystem (mount -o ro /dev/$ROOTDEV /mnt)..." mount -o ro /dev/$ROOTDEV /mnt || { echo "FAILED."; exit; } echo "OK." for _f in fstab hosts myname; do [[ -f /mnt/etc/$_f ]] || { echo "No /mnt/etc/$_f!"; exit; } cp /mnt/etc/$_f /tmp/$_f done hostname $(stripcom /tmp/myname) THESETS="$THESETS site$VERSION-$(hostname -s).tgz" enable_network startcgiinfo munge_fstab check_fs umount /mnt || { echo "Can't umount $ROOTDEV!"; exit; } mount_fs feed_random install_sets rm -rf /mnt/usr/libexec/sendmail rm -f /mnt/usr/sbin/{named,rndc,nginx,openssl} finish_up  . .. bin dev etc mntmnt2isbini tmp usrvarinstbin.profile(& install.mdupgradeinstall  install.subELFa(4P"4 (     QQ(K((88PPPlTTTۣe   OpenBSD -L0! MP@ -@0 @@00@00 @ 0 S0 $n(K(L -LM4 0 @00 ,K4;, p`Q) 0S0 402SQ GQ" Q BQ%KQ MQ kQ bQ gQmQ sQ 0T0 0 T 0000;nᡧ0"S < @P:PQ 0 40Y X0 40l0 0U 0T00@ P0 40$n(Kx -404@L , ݸ<Dlh -:LjM pL H 4 D0@2SdlxȌDPHT 0K9 ( 000SR R *L 0 sx9 0m 0\ @P0D9,04 ,HP00@9h cm 0@P0X H# U0+JP08H0+JP0x80h AP0P80@ c@P0(8A 0P0H00Q@0 14PKP|ǟ000S '،p,7 @r00 0dS Kl AzJY@, &0S<060S  '0S0S &?pT   Kkqp  X6PT#`P#  /P&6*KQplh&\6)T o?0PT3 K?qp0 5 RPPS : [?PP  ,KpP! ,P `P`0PHP HP,0x 0,0?,0 0 8  P000 rpWZ T 80KhLs`W 0S 4 @ll$0S 80(0S04lP `40S $4XD 0o4@0U$T!`K 3 0_400@ V 0` p 0@#0S0SPspp Xs  L3S0 @c P#" pp oXsH > PKdp0G Q20"0204$0 1,$ 00C0!00C01(4 0SR0t!iPP``p 0341$?5 044$2008 00 p/0$?t30L 0RP`5!"0@P  5S 1 #4mE40: S  (0Q(0 % 0d0 0(KoU4l\\ -hQ4L0 S!xP RM@PJ 4$ 0  R*0S PQ0e a0 0S` Q2|| *i2hP04$ $ 00C0$101 0 0C 0Ud -OMLMP <K@@?0@4?P0?@,  ?0A  h?0Q 153: P* ;h P 8P0 >0S> R:\_dN 0@04@> `0AO @ $4Dd">@>@`D@4. S04YX 0h /5h> 4僁@j@@= @PD@` 0(a S 000S @=`0V @=P0S $B`P 0P4}@C0 0c0bS4 * ct< D A@<{@ `DDt@d`<`l@L<0$d$`夤_@<<< 3<D0\0$(P@H , 0#3#dL\` 0d0 0\00L`0Dl@K+L 0T0X;05$0[[T+?0P<@<K0KhU EPvx ˟0L <R02000, \0)  0D0b+ Q0B03PD?$k4$!PLP@c@c`T:@`T\0L0\0J9P $ Bp % M'L0  S($ d0 P 4L 0R@ \0<@4b@4 0 4U 0X D@ ` @T}H$HP@`@40X$ 0 0C04 0 $X4 0800S pW%ZV:ce?'0 ȟ p,00m 0("*d4$0h@P70 aX8p D70S\7 SRtf7GB  0Q T#2   k40@Sa ? 0p /PoQTPQ&P ,7@ ǟ04>t0&0S<0S95Uf@ 0>W : Ɵ0W*>  M.K B\ 0(KA 0S <,$8#$!, R M.K0 B4%4TX:Le@TxE0S40S ڜ5 0N$%P0P# 40S4Q0 K54P[0P  S p40S$ B$ X40S04 T_> d Ƞ :D<L0S d0 P$ 0|8$TK@+຅AP$0"AH#2> 0$T8#Ė   d$yC40CX 0 C0ba00 20 QP:  a\Cds@PP@T:KJ.K 0CP B(P0S1xA(KT xT P| 4 dP- P    $ !P4U:0r=4#U0!\%X"%#*0`00@0d0 ZP 4#T:"a0 006# 14@`4V: 1  @0!T:0 %4`P,40U: C!P4 #U: 4| MK@ 㼄 #L0S `0#010CL F<PK Pp1 p# A4=K$<00 0 0 KH4 K3[0 KrP ,`P@ pkeP@c PU:4$hT$4@ $IA0%U@T`:@K  q 2AL0S `0d%0201|5dE=K᥃ K<0 0 0 0 G$02 K[0 KP0  %K <0Sp궬$dc{0V0F+=?0$"6?`6;lfĔ0  g s(KMЍH0Z0Z -"L<MȂ0r"`8K01lP@H = P  P0Sl c`Ÿ X08@ 2 P4  0` $8 000P  10S000 B 1 0S0 Sb10S 1!0!0S !l 7000@1@1@0,10S0(!1 P R `@T00SRT!0*$0S 0S  0*$0S 0Sl 1b(KZZZZwx  [$[8$$h -TL@>PD 05 4>P 050  NbZ> -LM K `p@Pq1 #f 0Sc bR KR MR% GRkR gR=mR wR8+ $+UKTH0@P%$+U?T<@P%$+U5T2U![RE-Q*0 0 !$/U"T0 0 @P 0xS S`p *S d1#pU T 00 ,a00" U_Z -Lq0 $Z -Lh0 $Z 0-LM-Py @PR  @Kႄp@0"SH1 @e 0S> bR KR MR GRkR gR  mR wR $T0@ (%T%@%T!ER00 !T00 @0xS S *ST8,0 (Ja800" ^Z -0L00ZZ -0L0~0ZZ -Lu0 -Lm P00[ -Lb0 [ -LZ 00ZZ -LM$`K✠p圀&m @PR=P @Q` 0 D ` 0R00 (0SXZ([,0 R0 ZZ -L ` -L ` -L ` -L ` 0-t0LP d0  a0R00BAq 8@0P 0R0 : 0([ZZ -L1P``8q8L  5PP  / ͙0S MdP00OU0@0V 0000 00 0U0 0 0 0S0|0K 0  `5`e0 f` R*Rb<0 00Z,[Z 0-LMPKdP \c0: S D4 K@.P0: S S000K0m @ - ELP 50  2PD40S0o DP4000 T0$ 42P 0 4l$20000S|8T$D0$D4 0S 0@Pd0S 0P 0P{c뀃S $0   $0 `0; S 0 @c$ #"c0Hc`V <h_0W, /$/#0sy3Q 0Ss*0  Q < P a "0  $coA0 0ALbA0 0 0 0  P0 0 0 0000000 0 00 00` 0 B000Q Q@0A AP0 0081А(q@00Cs0~1 1R0R0R 00 l R R *p bQ G<0 00$00S1OZ(ZZ [(8L[h[$[,[$ -d2LuM0Pb4Ku~4K 0( P,04 0  bR, 0@=94 0 =,0 4K, 1.@,P%( 0=- 0N"yOKP PP0!dPPT@ < P R T1TRMKd0@, : ,4\ -LM@pPg `P 0S nS0oS` =GPP00 @P @Q  0U0P P00 00 X 0000X  ?\U 0 00 ,K#, ?R0S@p0"S4 0 \@P -LMp`RP@( P(K,K_  0mP(0S$KMЍ  -LM0S S SL0 0@ܬ0(( KhԬ0hϬD,  -0L ¬h<< -Lp,P` @P_ 0 `$00$ (0@ -L`PVp@P_  0Sp0[  9m  -MLM7Pa `P =N@ P $@TY  1~1P t6_@ $@TYK(PEPE)0pP10S0#3P tPPPUp ^=V@PP$@T V@唐PK 00 0`VT   $@T(K <lx< <D -L0 K M, H$0@H @0 000 ?Pe bP@@  H$zp$00#D < 8 4 0a0@SM(@px0SdcB[8@ P R r@P00SxRbRbRPP,`pWP 0  s00 2U" |0@ 0S6P $@T 0K\\PPDBH@P ,:^ ! < 10D0 80080 4 H!zps1 pR18 040DR0Q  R`Z00R00S< R (10S00SD1APCP ,@P@ @0r0 0K;<Q 00S  00 $0SVPH PA0pK  0KeP  _P`Fv@T{`U(K@:D,@,Dx< MЍ -0L 孪S<4 -LM@P` 0`嶌Pp0SWz 0  兪p< p-LP@P,`PL;@ P  $P@@%]p -2LdM0ŸS2@P |x2T P < 00X@80 4@ 8`K0`pL0 H@ @r`0` ,p  8K'\ X ' 0\K( 1)0 , @T T * X1  0a$D @ M1(TD @0 9#@0 T * @1 08KG! 5180㐃4`T㐖) T * )1 0LK0!d `  1L@$H`d `0 6&`` TD`K0d`Kp`p0`K ` p p$ p<_< < P0Ro(K\Y@ p-LM`K @Pp  Kp@ -P 0`㓅p @E$0L0@!0 @ !k -L8ML L@P  0¡ P`L@L00U@p80 4@ 8K2Hp D 0pS@p <  LLL @T T * 0 0# 0㐅T㐖) T * u0 08K~#`p j080c4T|' T * ^0 0HKe @P S0H BD0S%P 0P@ PZ@@S,0@t00,000,0 ,0$K#@P ]#@PY#@P P+P +P +P O@! 0 0  0`10S @(ǟP4P@ 0@@`W0V0X0S VPDPP 0 KRP@ 0P pB0Sxu@,|P4Lx: $Hlx\MЍ -L 嗙L< -L0GM@K0$<1 4q41`P oP !hnp0 0bAS`GK0 A A0 叟P cR GK00 A0  A0K \P·Pl -Pd P\ ÇDG>K 0C 0C8 PN:@,D,X0 d4 -LM@pPg `P 0S nS0oS` =PP00 @TP @Q  0U0P P00 00 X 0000X  MU 0 R00 ,Kհ, ?R0S@pB0"S4 0M@P -LMp`P@( P(K,KQ  0mP(0SI$KMЍ -$0L0S << -Lp0)0p3 P``0PP @@ kP@ sP P aP @ Gmph00SUTTK.Do<E ,o먙:x<MЍ -L;mMЍk0@-XP @0 S S 00 ӑR\00 \00;- 0S Br Q-0L(  Q: M( -LMP`pa $Ko@Z0S 0S $00TS#T 0L8 -0L ѝw<D -@kM<LMB0@3Sth|0LXtt8tXH>  <> @0(P (P  (P &^= =hT? D?`PU@ 0!0T 0PP U0U0T0St LL>`}@*PL >@r4=.6$=j = /=c =(< < << <<(.<-<7<-x<0 l<dPv Zxp6 X0 ,Vv  & 6 @r  &0D0 !&F0G@$!6@C#Q 3R:Z&XV2 ?!|2!@L!6vC#00W #*Y/ L0S 2嬆X H0XL  Lp2Q &R@FH RD2TH@ (2R R H 2R T@F|0S~ Z =!P3T@1|@ w@,t{{t|h|A(8H:XedA| 4PpHht<`8T\dpxCXLpS35e: Z t0S<t0 @t@ 0 S9Z:;D *16 v00 倀X㐆 '0 Z|D! H!Z"x0 Z6 Ԁ Z|6`pF0Av0 Y% ` 6c# X0R@Q Z T0S#%*T|0匆Yx 0@1X TP`S@H!p0S0a @*  ("p!0U Z2 2Z2P2: Z 2Z0G0 3 Y`x0 @!T  &Xb% T@ 0qP*@UP!T@51i; Z0 Z0:U * Z Zʠ 0G Z3 3Z2U ZS 3ZRP0H #X0 i0R 00U , Tl0S\0S00l0 Z0X P0 \00 S0X0 p ZT0xh0 0T0  |0ϐtQːpQǐlĐhQd` \0廐XQh0SP T尐宐LTD P 夐H Q c,5`VDK9gD0K8K80 4@ yp呷PP'Kh g>KR0C6 |T x0"& A c% Z``0S00S H0S &R X :@X  0) &@$&0ST#3* 墪p&L'0P &0' $X ZH 6R X0 # 00V0|$!40x00t!40p!4 0l0 0h!4 0 d!40 `!40\0#̠##0X0###Ƞ0 T $0""Ƞ"$ P @""̠"  L!$ H!$ )0 `,00S880 @0 <D0v> $ 0@0 (  4 t(08Q* 0( ;0S 00 o0(08Q @(T ("U01U01hL08S X R 0XU0 RaAr1U0!1!!!!!!!C| X030#X0#S hbQT:Pl0 0 Z0S0 00 V00R:&Xh:Q (0 0 520#$ 00 0 P B240#$ 0 Sp, I0P , 0E Z600X: D+& B(KMЍ" -LM04PKpa@d 04 `|PD 0`tPG p00@TgP`uU!<U!P 0(0' 0FS(K ]P@ tg(00S xlg00(@ ^U 0(P?P@ -P 0(0 0$K+@$( P-L 6E3E -LMp0 :P0 000K0,K00 e PPc 0S` =@P l `cVTk!PC,00HiV0a!P,00? Z!P2 ,0$03lVL!P$,0 0)oVB!P,00 ;!P ,0(00S-!P0, 0  @P@Q0Sy 00S(KT\ @ 0-LMP 0XP@00  08S @<@ 8h׍$LPX$ 0 0~0 +00C -0000$ 0 0~0+00-00S $::  00 $ 00S <<  00 0$ 80 0= 0  K$00  0$@+0S  $", 0 0 $ -LM0@S00 K0 0 0`t -LPGot p -LPGnt | -LM K00"PGt -Lmh0$@0$* p-L ML@`0KP "0S G00Kp p-L ML@`0KP 0S G00Kp -0LS@ hKqG 0 << 0 p-L M@0K`P 0S lG0 0Kp p-L M@0K`P 0S PGt0 0Kp D0  D0 -LM0Pp0`-S000P(K 0(P @P 00S `;et0 0 0S0(-efKT6u p-0PQ`L@ lP  00 0 0 0: P0SP XP  000 00& P0SP DP  $00$0 0$0 P0S`P0P  000 00 p P0SpXp 0-,PL0@S _000@0 -0L0CS0 Ql M00-00Q0^   ?00Q@0 0^0 000x p-l`L@PTX0 P屋 HP8媋0始 墋p 4 -RLMp`P 0BS99999|xP@᫆T lhZ@ a@T {^h @WZ P8 Z08Z 8 Z7wZ 7nZ 7eZ 0]Z t7TZ@ T7@KZ  47 BZ  7 9ZPP? 1U 6(U 6U 6U x6 U  X6 U 86(@U  6 U 5 U@ 5@U 5U  5 U p5 U  P5 U 05 U 5 U 0U4U 4U 4U t4{d@4UL0pU04gU 4^U@ 3@UU 3LU  3 CU3:U (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x     p31`@U H3 %< S S$  S  S2  U  2 U 2 U  2 U  |2 U \2U <2Z R`K 0 P0d!@Ty.vaPKZ  \ z0wP0t!p UKz zP `A0Kdpd0\4!U KzKz(K         0 T D  < L       d t    8  D         0 4 D t T d L  <  \ L , |  T xPTX\ h $ \ @d p  -0L 媐P<x  - 434L\Mp| x a0@S(`DDDDhDpDD p p [Px  tp"0S|`AᨄP2Ut"N_p\2x@K |0x1|0 |P<a?8x =P$sD x5P!WtEEEE|00S xKD0t xKDt xpK0|K`,Kl0 h0 >P6~P1P,|0@000C S1 l,0@SP |0 B -Pl a?|00|0 |0Ql0S x` KEPlBh0S xT4 K PH!(K:@,:   t@ ht@   gt MЍ -0L 0᷏]< -MML Mh20`S@PP2P"K\D20P0: S dT2"1Q0T KP0: S pPbNNK @D@D0!p P`1: 0?x:*Kn6P'@10S#414!Q(1K0P: 0R 0R  |0R 00S, P`'00S APw0Sp00S ; T0c\ 0専PP  U K"Dhp -TTTqLlM`@PfP LP PP: nP sP hP30PPPP ]p00 cR1P R R 1@KoP \A0: S`  P`PV:\MMЍ9 -LP(@`D pXB@D 0 TMLLLLLLLLLLLLLLLLL Mp 0l @8P  0c 40 ,0 $0  0 P?>>p= *Q-LI7< @@0Pຈ`p 0@0  VUP`Wp(0 4p 0rQPK 0fQPM  0ZQPGTQ000ӑ; -|@Ltld\߇T܇Pc D D8ч0·ヱ<d,,, -P--.-.L. -LMe_~K@ oK t K l0 d d0 \ 0 D31 2 ,1 2$1 2 1 2`1 2\1 qK`$& -LM(Qt ,Qd^0QP 4Q0 8^0 80S00, < 807@@00@4 80CW@<Pv^0PP0P (Pm^Pg^0``0` (}Pp^^Qp 4p ZP T^9 @@004@a00,0 9 @P@`0` ,:^9@@<0P ` 0@VU,%^0pp0p p9@p@W0<p `p `P0@XW,^00 44 84 R20P `0`@p 0p`@P@ @@P8 0]84p\a W4 00S(K...... /4/d////(0 -(0e/S<(0<0(0L@0 0 S;eR\0 0-LMP@EP%00 0 00A0a A S WAR A0A0S7 A? K Q02^0A@ 0K K0 M-LM`0 PP@T t 0 00 0@K= 0-HLP0@S @00[0S00 - L@N0P0 -BML:M 0D 0'ㄩ0P@4 ;  @Z`盦`@@TBKLL4d H 8d H宋8$P0 8$ 0H#P 00P<  0/S 0<4 H@Pw :P( 8\l00P+P,UY 9PPI<`P P90cC10P @T,K9 D,00 PS t 8\#[ 9\P0  "Q@@P000  P00000  8\44044 PU 0S00X0P` @ ,K0 ,00 S|8 d\00\0`@PU 00S0V0S(0 K2P 0 0BS(ʑ8E\4$0 4$ 8ǟU PP P 2H~P P atsP0,K ,00 SP;;S( J\P 0,K ,00 S, 7IP 0,K |,00 S8w $6P 0,K i,00 S0d D#P0,K V,00 S4Q  08[4$ 4$ HPC P> P9 P4 P/ P* P% pP  `P 0aC0S0S 8X :X08ʑ 8u[44044 U8l[44 ,K`0 ,\  8U[4$ 4$ "V8dI[44044 ,KP0 ,\  82[4$ 4$ "U2`P1 C`XpP DP3"0cC1 @T000C S000 0,K 0 ,0S00S 88Z000 00"02pW Wr+Vo ,K@0 tPP`a TL ,K0 e000 P  @@ᭂA@2EV0 q,K@0 FPP`3 T _,K0 p4000 P  @@|A@2PWp8Z4$ 4$ 9,K0 <$R x0 8oZ44 HD$Pd 4$@T$@X@T(Kw<90t000$00001101@1 `1H|111h1111111122 2@2X2x2d22 -1LM0S.0080S(0  3 *#*00&#0 0S0Ph@P 0S HH}T8#00@ӑ3@ #0#00 #Rp"0 S0 @b0TQ ڐ20S 0SS x20STrQŸ 0`P B00CSwwwHxyPwT]nTgT10S 1 0R0DS|e/@ktpP `o6f0PPD0@0 ,PP $ !PPZ6 $00S0Q X 0DSUT e/@,pPP `P @,,08(|$@9P9<=h9:4x<8ledA68 200 "P:@-0@@0` p @ `PpW 0VUT -LM4P @@0`d0p4T @@0P<0@0 ,00S 0 P"{pxh: -LM@ p 0P`P, i{BT 0 @{l5 -LP`Jpz 0@- N 0zP 0dz 0LLL z@  T0 0@p:x::;L5x< -@hpLP` @T`7< @@`p@`{< 0-PPL @@@T0hݜ0 p-LlM`KP5pL e㪟@P4+1 , P5@Kp4;wrdA6PQQu  p-L`P@0 SRR d P@@Tpp -@LP`p狜pP ,P0 @@Tw -LikhfkH;\; -d2LJM0S @K X8Ÿ 0S00Q0SP @10S 1@G`A BCDEFP  P`@PX@TJK0!@'@ tP 0rSJKL!D1@/ۤ@P@ PrU<000JK0@ PJ~KpG"(0K@K 0L`0`P P$K2\a0 tD@T ^ P:PU(K,<?4~@@-0 CR 0R0 SR00 0-LPH 0S S 9 @@00@0 20018\Q  0fP30(8z(@ -LM (R  P`P`20 @P`x0 @@0P` V U`,` 1Z,  0 @@00@0 @P0`@P@0` P` P`ZY P `VUP` R 0 0 @@0 0ZY  S Q R Q,P2 `, \,P 0 2 px -R`pL`b9 @@p S R  QPP   0  p-L;P`00S@P`0 0 p -MLM, 0Sfhp0@p@P0p `p ` P0XFWD,00 c 0c#r"Raa  #x!x, 0Y, 0TBNK@D  x (KfP 00S  5Q'4[($[ SSa B RR,2ࠐ, ^\(KH@L55x<p@ < < M-AML M@ @DB^K8@PEfĖ 2l@8 4 BK@ 0"@@8 4 p,d[BK@-V+V@PP(@KP$`f00@Pf0"Sp0 ,00S fp00&Z Y  0y 08$44U+Vpp-V pR@w00 x  @ YZ< < 0@80 0$ P`  0' 0 :p5A$ 0S @ T S5!"p@\  pW R0D 0v (K < <@x<=?Y@@8@ -1L(M04 S8 k 2 RfP 00C C  P/0 , ȟ 00 ,0 @P0,P@ @P00!4 PP`vpwgw0vw^w4 ( @PU 0T7 x[}0tf 7#@ Iv @@FvA@@4P8 2@(K者@$A<8AHAA -L$M4 0 , 42 PP 0@ `p@ P@0 $$! @P0@K00ppq pqv0P 40"9 @@00` p0W V 0 R 0|l0|,@Q0PP0 K H4|40@"(KLA$A8A<Bx(BB -LM"9@@0`p\0!@Pp @P ppqZ wxxU t1R Q\0S 0S<08 400|? B0P 0P,T)S& 0S"0S ༉9@@p0P` PU`PU` 0@TS@ "Pi   0 0$3v(K5C$A8Apx<,CC -LM⸁`p7< @@00@P xt!, 0 `pp,q. < 00@ T S7< @@0p pW `PU`p0 p `, cpP`,q(Kou< 00@ 0S @VU P 4$0 `@`dTPP弤(KpCCxD,D$A< L1-LDa@pP@ U$! s SP"0S02 RPP 00S0`00y0@T ^  M<P@0 S0?SeU S+* 0?S p < <tDx< S-Lp!0Pc UP DP\dP uPWX 7< @@0(P4P8`p@ !R  `Pt @PYA @QT pP @T a 0ttz0/S @@<P8)(0t,<E$A<EwE -LM2, pR,A,!(P( @P` 磾P`, 2 @2 @ PXV& `@P 00 Ppq6t pq``-t, 2  @r,0" 00 (KxFFXFDF$A<8AF -LHM2P L R+P@ 50S| 00C C`p  R`@P0@P @PDPH0P$Pkp@PqppstuPPs/QP(( yWVVW X\TP @Q< R XY  0y0 9#@ r @@rA@@PPLH 2@@@#0NSnS PL2  )8 \0 40 @ 0 0C C P0("@P00@ ,P S0 S( 0 K 70pK0pWP   W0X 00 L P0 @@0P`PU` p `P弉pP0L@r0@@0P  ` 0@0 K  PU``P9 @@0Y@PZ 810S0,0KP^q PL 42 80 P@@` 0@ST 0@T00K`@q0O&'"< 0H D Q@ঞᆁ@P X0 T@ D (K者AF$A<8AGXGGG \p8G(H -LMCDE@FPG`@A B0ptP@ P`q` \0P 0S<<KhrP$$ rKXHH`1$A<H -L @P 0rS@q0`0P` !0S`Pla00C8SS aPaLpHQ@@p T@44KrT(10S * I젟p PP }P00@tP@@Tp|r@d{p T@XXrT0S< , I0p9II0$I+x< <,I8I0II -LMe/oKH5HLp044!06 P!   (Koq"P@P u@` P@ PT`U" P`@ PpU Tq@ PTpUhT0ST D 8I 4`p,@ $P0 0 `ppq pqq,`p0@#P0 0 `ppqi pq@hcq0`p8@T#P0 H0 `ppqM pqGq8`p4@"P0 0 `ppq1 pq`+qꘒ484 7b@< @0pQ@PP@P`p `p0 (("p0PppP` qp oKe/[uvxp7< @@0pV  U x0S)0S&h|`#R Q0S0S 7< @@0p 0 R0SRv 0S0S`dTP@C 0C` F   ! \1SU 0SSPPQ N 0@@0@0  B 0P@`@1p p p,Z#Y!0!@`@v_K`0@0@ TḀp S P `PU`A `P slmoK y  !1 R! oKe/q(KNMXL<NNNN$AxDOTOxO 0-LM H(K K0K0(@ $P pk" KK0O -LzM g6 66`9 @@0  "Y 0ᘠ! 0@@0 0@XWTS !K0@T SVU5 YU0O?P`P``4;D1 A %0@ ! 2 A !  ! @L5皍@ş @@Te/oKn`P t (K0S)0%@@0@0 Z(K0(KS )(K0D&@@9)`0C` eKe eK5gNKS:5 5@DS:@D <5 Fe/qKe/K Z9KN.KA0 BA B:  * k (̃Pȟ0S  Bq0:K0:K P ||0`uSUS OKe/  e/   hQC #XQ MQ AQ<  Q ?Q4DQRRQ UQ[cQG aQ= bQ>eQ] X:gQ\qQ mQ` iQZ lQsnQ\ pQcuQ^ rQ sQxQ zQ wQj P Ke/t 000500C0{ =w Ut p  gP x&0Hf@0@@T^ HZ (V dS0 ,%M J `Fş0S  <V @@. 0 1V d0( 0p00 @P 0STE0KP @p 0<e`P  0$TAe[0廊 40S Y@ 40S40S gNK@D@D,e/`PY')D$7P P0000ӑ yS P00 ӑnRP,400ӑyPgNK@D@D  M`Pde/@@0S 30S Qpi `@0p`p @TP0(p@ Po  0  z 0,o}V `Pu 0Sr @Pi  0#bqOK e/BPbPe/  Ne/ Je/KF kh e@ OKe/ 6e/ 2e/. lS `P MX&0S  0P C@0( e/00 !0|0s03Sp0 XigOK e/P P e/ @  ,P㚉(K萅wOO2fPj<@P`,x<\[ < <pPrdA80xP,<PPPPQQ@Q=TQhQ \8QQQRR(RPR|RRRRRMЍe' -T0L0S@ 640P (0 0 06SXS -LM, ,0Q 8P60P300S.00@Qp P0 `DV U@0`, 0S@P,0P0 0!Q V4 5 0 S p-1LM0SZta0SV h100CSXHTQL1  D1\5\\1Q0000.1@ KK@ P@#0T@0T0\ L` 0Q_ 0@TP 0Q T0T0 <00SPM5@I5Kp萧$TmTTT -?MLMC`pP30S9 SQV5QVp3 0wQ!VP#N500 Q R30SŔ 20ZQV"]P ?KK(@DR@D?+.P78@K0 3K4 ]PU0 : LK4 PPU0," -?KK(@D@D?+PPU0! ?+P @U!8K0@ 3K4@ !PU0x!4><1Y@B bP Kt 4 P0U0 !40 @_ 0 f4 0KN0, 0 KPfU ,04  ,0 `0WPV(KTTU@UmUUdUU4VV`VX 0-0L@T 500S iPڼ 0P0# ;;S 0@ TPp0 @ L0P@TP U0D 74 03@0XVV 0-T0L?M0S@00S ?KK0P@D?+P 0K0 -lb0LPPP2 P@8"000"0P002PU GUE&Pڀ;;SB a 0Q8pPď WP01@P1+T0S! T0S T0ESPT0 SDt3 $1 T0S {T0S wT0S  0@TT0 0 00TSPP T0 E3ST|00t ~3 l00Q PL/38*3VVV0WTWW -t0 0LSd0 \@ 0o RPT$ @3W -3LM0S2 2 2mP2: 20S 20S 2"2Q 220R0S d2BP 0: SH0D@@d2jk@X20S L20S @BPm`001 2P K c 0#4 1 10S 10S1 t1 X1 0S<1 41 R(1 DhQp0S1X!p0p00000S2 @0S 0 p`V 0 0 @PYP 0 \0 B00 @00@P0  0|$0pKT|DWLXpXdHX p-LMP K`@P'0P T ! \ZT  !!h@!!L@ FD 0aP kKpXXd:XX -L M0U@p) 5 005 5 5 5 5 4 QdTTXTT$4@  $PR0$1h4pG 4Q !AT000H 0: S ( 0lKpLflf -0@0Lk&kP P!0P pppp P>0pS  P0$ x,0f0 R00$ -BLP /00儢r"@Tfx"0Sp2pP` &`"0S 00CS00@Ӥ0 @t0Xy 6S0`: V0`0H zhPc  㞯P@'!0S0  rP ``qHA0S 00CS00Ӥ0ʚᥚP p %U(20S@ 0S0* 0S 0 P=  0Px=00x  H0 ` < 30Pc $ <  <ff_f -d#L M0PS 009Pb { p d23P =0S ="P40C S72222(2222220S H00K080KPT2 0000K@8K ,W0"` "0!V0@@L LHl 0 `: S*  S%  S  SJF S*  S@  SCt1  T10S; a=0+8 0 @1+0 $1 ]( $ "0a- 0 00+JP= 001T0 L   p0 L@p 0E P;00 D0 (K gg8gTgpgg  0-t0L0Sd0P@0S0S 0SU,P LT@T0茨 g<d0 R00T00SL0  D00S800S,0Q 0 -$ p-PPL` 0Sjs@Ptjp@P0/S00D0< S0P `@@@@pgg ( -0 0LS0000000S 00000S| 0@00x00S l&sh0PX# PD00S PبԨ  h@-@P*00S S R  PA0B0B0 Sa0B\7B0W BS0@S: P*0/S0 C7SS0@-C@C  R̕0̅ N 0 S0W0* 0L 0\00*0L00\*PG- \*00S S Rpp* 2P0L0A@L S"'.pΏ"'.aLZ`P0  pPo0@pS  0Opp0@ S: 1!>p \*0/S0C7SC-p 0RP`C!CR00 Q0%2>&B P`L 0S W*` P0@ 0P!00*0@00P*-S0!P \P0307 p-t0LM0@SPeP`K 0L0S LKp < -LTMpL%Pa=0`P`VUTSd@`@a ⵫pPK 0@<0PpK0@K 0KDhPh\h-0 CR 0R0 S#00 -LlMDŸ@Ÿ^ \P`p^q &Lp28Ka=0  RQTSAAa U 0@xK⩛1PxK0C@t1P[ 0P8 KP PQ8100CS (1 ,8,$8 #4Qa=0 QxKK00S y b#0 0BSRK  h00S [ D#h$K訨|DhPh,0hh4hh <hh p-4L0S$1`@ PP>000-S 00 00 00S  phb  0P0P! P LP00:U0S ll00:SLQ10 0 $(0VQ?Pp$@, :<hh P00 0P-L 0SpPАРP(,`P=@P xp P|xk@P0VPPS0    Up 0Skhhi -L Jt0i< -L JtPj< -LlM@P㐀K/pE@H`0@}cP :90pSP  P0: S 0( UVp$Kr -LM K`h 00s@PIrF 0SC kR bR&mR wR!$+%$+*$&U*T'0@P 0 !$/UT0 0 @P 0xS S *S d1#pUT@P@P 0-LMK@.PP00S0#3 8Pp0@ 00S S00 o0P@80     B@0 0 C8 <( -LM8 8 4 /ts/P800O0oPo匟p , 0 00@JSII(J(JIJ(JJJ(J(J(J(J(J(J(J(J(J,JI(J(J(J(J8IDI(J(JI(JIHI(J(J(J(J(J(J(JI(JI(J(J(J(J(J(J(JG(H(J8HDH(JI(JxH(J(JH(JGHHHHHHHHH(JIp,^,NP 040 = |(? = 0-S0S, c 0,0 i=W= pe-00-=  X=bPVT \-00P= 0-00-0F0=1,,0 00== Z  0Y P0 G<00 @0< 00< < << <0|, x<0 p h`, 48L,pp,0S=;0S , ,<4 ; 0BSPZ r0B8 SaW`00JT000 3RP/@TK D`pFPx[ p5PP ` ,PyP,Pi+0S  @PP  R h h0`0 0L*eP`ZPY :{{h*Wd:0`*W0T DP9P` ^P\Z00J@T000 6P2@TQ `P CPfPP |帑PP l /PQP(P0S"  @PP P P10`00 P`%8x唘儈ZP49 ,PlG0S 0Se`廴P 0S]70Z88儧P0c00@JS^T,T,T,T,T,T,T,T,T,T,T,T,T,T,T,T,T,TR,TSS,T\StS,T,T,TS,T,TSS,T,T,TSS,T,TSST,T,T,T,T,T,TOO$P4P,THP,T,TXPhPpPP,TPPP,TQQQQQQO,TRp膟@~P6PP 6P 6P 5P5 P %d6@P X6P 5\ 6P\@phv`*a0BS! QhQhQhQ(QhQhQhQhQhQhQhQDQhQLQXQ`00000 ` 00$00tS@ R[[,PZ45Z (5Y h4Y X3`P P @T 4X` pDGd@ R, M@@ TFj#3lQh4QPL O84@44@00  ,BWK 4W K@E@dP0V0= ^P8)3%PV/-U0"U0##0T0cPT\PSS0 ,#R00 R00 Q0048"vpB @1("(2 P  " R  2R  B P/ T1Q ) (1 \hLXr` `0 S|@5\^LUEP(20S`00CS0 0  0 P00S!1 |00S񟗏UUWWlW8 P8000hA04SzLP@,lll|ĨHhبԨllllllll<x<$m <l(m(Lmdm,lhmxm,mmm4-\mm nD0nn9  0`n`Sn <n̨:040S04 80 B4 !L0 8P000|@04 S0 (K -L@L0S 8 0R, 00 Knn< -0L`p0 PA?R R *RJ[RG!QQG (10SE /QCP0QS50@0*S SP0 0S P*Q^' 0!S@@TR 0-S 0S ]S R^R ]R\ P0QS 蜨 p-P/Q`00C@ nL R  0Tdp0P0 P0A*00AQ@*00pn p-@P`L 0P <000CS   0Ppp 0-L0L@P 0U(P  J@T0 o< -LcMbMKKM(@D"@D 8 3 ( p#g3mK`F`F K*K  0KPm0 0R0A`KpRV1 :*K(:KVx P,&RP \R0/S 9SK00CS& KP2SP  0KQ S @`T K 0fT  e` KV* R V ZKQC :K(=K 0` c Vp]  K0SX 0PSU 3KLL X0I  KP(v0@P *0S0R00S :K8S  K( 0U0(KQ 0 <[S:K(I3=K0CK0Cll(I<[S 3K*KAA(嗣K0(K 8oToxo<o -CMLM`Pp.0S s 00C00SӴ0S 0/S  <S  Y <0C<0S HKP,r0 @ P.0S 0S80S50S-10S(  0R# 0R!  0R S  0R 0R   0R 0R\pp ,= 0  -L@p  Q.SW|p 0S0C W` PPl 0##!>C=S0Hbp0H S]p@qp@qp@qhp@qCv.B B 0@<#!>C0  0#"@!>BDS0k?B0  0!!!.A0r03 R0S )0B0@ 0#"!.B0r03R0S @ 0##!>CS0@ 0#!>C;S0pq -pPL 0Sd&/h`P00  S,UXB .UQ   w PR00EU0{d@Pz ZV 0SP00MR CR cR mR00000X\ $0` R 0S P 000X% 0S" P 6 {_#000  0R  0R 0p e_\0P P0@@@@, Hs`sssss t  0t 0-@PLD 0SA Q0SbP4 0#S \S0#S@ẉP@   # e@+|p0Q0 R 0S  cP 00@ 00  0 =lttt 0-@PLD 0SA Q0SaP4 0#S \S0#S@fP@   # @ᡉ|Sp0Q0 R 0S  mcP 00@ 00 d 0 =t u@u -@Q@0@L@ M@!Qp$`K 0^0\$0 QT 0 K0.00P:$0  -h LM0S T`p0PU 0P` V$K  - LM0S0 0`0pC 0 SPpG1S | 0Sp 0S 0X"^ `V*X 0^  00 0(K   -` L0S `Lp0PU p@]]TP` V0 ' -0LpW- 00S)00S% S# S! ; 0`e@T h0S0S 0R 0@S 00]i]0 (  -L@LP @08 0MMP\  ,du -LM@`Tp. PU& 0S0S 0 S 0PS(K00@K0! "00 0 0e]c](K = -MLM\10SPO D10S 0/S BKAABPP & 1a0Q䠟0 LpP 0@K,K 00 0p0p 0&ăP  00PK1,0,K 0 0 @嶑00 0(K u ,u -LM@PU`p= vP 0S0S 0 S- (K00K0! $aPP sP 0 @ 00@P0 0 0Pf\0K _g (K =u -0L@pT` +QP 0SW Ea@P@D 00 0` 00@ =v -2LM0PS0 { ; 01pW@X ,  00,0 `P 0 S0 S R30`+ 0G0 0@S@,00I 0!`P< 0$00 `P2 0@ 000 0 xP 00 P oP@00S0x@0S`P +0 080( (K  <:864;0Q \dpxxt\.lhdU.T!PhH0 $#$(,"(hA. Q Q  w0S-.hC <8#"h.~~~,pL@h<`|8\ĂЂ D -3LM,MQ (K@ 30S  l d0 K(@T*^T IK@3(@D8#0Ρ K(@*OK(HJK0#(@Db御*@0"ᵡ*720S "ᩡ*+P% `V"囡@P߲ 0 L2勴 0! 0("傡 KK(@(A* K*(@1 Ra 10S] 1K@1@P 0Pp` 0I6(J@P/1)K0 B0/069K00C/0/0(/0/0 / 0 ԰K0L/0)K0 B0/ưK 80  K(@ *㗎JK(@Dm +(K <x<\Ъ`|ܪتăY@D l t \ d  -@LLT  p3p3$Xܪ -L$M@H <KL gH000T ,70  L z rHP@j 0 `S@@ D` &0 S6 0 S pP D0 K0,0,<4 ,!4$ !$4 <,,c<0K0S@ P< 8 4 0@ =9< 8 =40 <08 P@@$4 pWş` P`^`0S%0S0S*D`0#p5 !` R0 H 0 0 B0 00 0403  OrLD0 04!48#8@,HP ,|40S /0/@0㴯 h+Y`+\D@`0 FRL5+;DD4p0 S A+@PR+ +P@0 T$*0T@:@PQ* Q:L30  D`@0010QPL I@ X+DH0HP`Q @11:Q1 Q+p@WJ*P 0@$4,<4("4+! ~+pGW JiTO "0S0l 0 JR !pR@T 0W T( ՘P 0R+00@ c>'W` pؽD+*P 0@$4,<4("43+! d-+pW\ J TX$+BS$3  % `4E 40K00@000 ' 0)[R00@ 0  0 00  0`40030 ! D40<2S\>@K(P ʻ|#K K0 KP彳P=)Rx30 3@ *0K@嫳P830 2@ )0K@図P20 2 00K勳PDpB@KP,#<0K@P EP|< 80R"80KPoPn0;CS0eaBP"00PYP 2Q" "Q0S@ 0T& D&@f8c0`$@p A0 p\Kl`KTKPKLPK 0   0 \0 05K/P8 0T @]@P0S l(: P0 嶹 @ ᭹@ R 10S:lD @,Ԫ{Gz?x<ЅP A?(@ @Xl!X :8.AЪ؆ 44<4̇$0<| `LL ؈ܪMЍP -0LS1P`@t( 0S3T 00,'`T'%X% L0S `00S 0 T$0/S 0S : 0 S /S R耶 - @L R000 ж -LM0 ,  )O P`4 0CL 100R 00 `0001  L0 S  `0 X1  00H 0P,1p(0@S0  T0001{U V   q0p t'@0 00C0S  c 0000S Pq0 p 0000K101E(K ض M-LK0C 0Cp4  0pH.`<$] PA(0S| 1x Pu (0PqlT (0($4@_ 0(000@S@KPPxxY&P$H 0@S F*$:PFP(0@S4 0)p00S P 00DdKlt1!(Ph@((P$00b04pPÏ 0 0C0(K耶A< DpXd p-4P0`L@Ἰ0P7 %P10 0L0S' `0$ 0 000C S HP@X@`@h@p@80 0 000000  00pp p-8L@ChH1PS  0D P6ph 0S 0 R0 0 : S&L f#|00S V `"\L00SHP10f1phpl txpĉ -ML Mp$ l4 dK<   0: S00h4 h$5R@T 0S + 0S P! T  V0`00 0,0K4pdK`0 \` Xp vT0K;8DP0S@eP1 44 0S ?P $ P 0S 0TU 10C1_l3x#0@S0 OX3 @@d @3i0: S= Dp@ P 3 Ÿ0 "@_P`0Y"0 PPLR0,0K\p X 2 `0 @dKA0<"',2 X200S H+wE~KpG82 pG0Ϥp@P 0EKH`G H @ PG F0 0f嶤@PV 0dQ# 0M@P|xBP1 h4S00C08 HA   p|l$r @(@101>00 00 p4sl| GKk"000S (Ktp̉؉    LlxضT$ȊDH\ -ML Mp`@Py QAK @ @0/W  V V0W 00 0S:0S:Q@P A.KHH0 Q B B4NAK AA HK4t( -LM0  -LMXb0$p, 0 (@ḰP4$0S0 0S-,0T*0PdPP#0So H,@(0 TP0PPP0(0 0(04PQo0@ 0$@O$0SJ 0SG(,`YC00 P`  (0 PU` P$`0eP1 ,0Z00,V)U' P"Pd(PN 0 ``0SOPR(P 0$@ L,@D0T00000(K0 -QLpGHP"L8Q,0ST 0E0 @0 o 0 5!"@ 0$@$!0$ P 0 0SO 0$@ ]C5( `"P ᔳ0 (0@  e`tl0` 6CP /C$0S 0Sw<D -0L`00qP`00 0S0S 0 P0V:T 0Q 0 0S Q P԰̰ 0-L@4,!PL00S' `0$ 1 000C S (08@H0 0 0000000S0 0 00 aR08#80 0cP 0 4ײ 0 0 00ȶ 0-LM@P0`P~ LP00 0AS X`ltt0008 8l| 0-\0L @?PᐠD000S0S P 0ܶȰ 0-P0L@T 4P T00T0S 4 0S0S: 00耶 p-0 0LR@`PU p 4S40Pp 0-h0L0S XX 0 0CAPA T@D*@AA0000Ȱ԰̰ -@LPA00  -!LM0P`@0@U V!0S:0S* \2XXJWG@Q@(0@ 8 4 0@ @T$0" 0 4$P, d0 0P0O0 0P0O 8 K ẟ ?.00, bd@d0 09 L0 D0 (K$,  а - q@4$8 00P``0 0L`0(@0PPܭ`ppƭ0P@00 00PSEPTA(@QP$ , Ћ -QLMp  P W0X 00!0S:0S* hZd10 R QD14PoV;U8 a(0@P 0 w42 0R,0 0d00  0  ?d, 0`To 0 U5!"@0 @@ <0<$0@?@ʞ 0 耶ȶ -0p0LWP/`$`@E # U*W!00S 0 t2"@#0WH00S @ 0 42" \0Ld -0LL@Tx?d0 X00S L%DP $ 4@d00d000pԌ -0L: SpP` R@l  q PRq hP p-0 : SLP`l0@@0P`Vup 0-PLM @U  T T0U 003 0S/:0S+:Pm0'HkPb_x00S dW PQ0K@ G~ ,GK0 ,448p|DP -Lp`81$0B?' P4+DPP? 1 ?ᢝ0V 0 P0 00W0 0@0@0@ 0$@`p U!(,0 (4⏯h0h 0R X@d0 0.P8 $(00 Q ܶȰ̰԰h -ML MH 8`\0< H( <(  H8PPBHY4`F#@ 0h ` 0`p08 PA0 ZY8 0 0@ @ 0Ꮮ8 H42 R'8Q$*@(0D 0S H8BK!@00@P冐BKAHP@  D8X:1@@K8(A!A4( L L R 08HS H<H0 0m5 @(0;H80S00  ) H(L@00 08L/PPH8i@w  Q Q_ |0@Pt0 0  P Y4X:@(000(KlЍȶ -KML M0S000,0P> $0: S S  S S1Q;P@K h%RKK$H0B?ŝ  ,` Hp Rg80(S00Q0S+ @0 040( $P@1$C1/ !0@@ S  Bdp W`@PK@pK.K4 B$ `4\P 0CD PŸT 4  R    0 , <80S00  ! @00 0W NPP@ Q qx t0 l0PP@P 4 #1@`pX(KЍȶ -L`p@UTP  *0 R  H n@0SxP0Sd9 ` 00C0H <00  ,00 t3pxȶ -L0S4 0000 $000000l$Jp0\40@T12 P4 40St2 @ #0S 0S np P0S  0S L0S| P  x#0S 0Sd ` 0SP  M0S@  !0S0  0S   > 3 3 0 "0S "0" 0 0b2Q=T"0SP6@K P4bU2 0 0hcQh","0S T2@@@T /("0S  2@@T !00!Q0!090S 0K[A00@000 00b14;11;1.;0S" 0Sp  l10Sd ` P TK!P " (4,0K P 0S   d2I02 Y0PDԶ@,t|hhh\ p:PC̎؎  Ddȏxd (<Pxİ̶ضr0 -@LP.P !0*!0 S00)`倁pTZ  PpGT 1S1<0001118 !0!0 S00 s 00S m *-?Ps #P  @ R000  0R 0S R,0@0,0`FVpģ ̶d$Lp4h@ -h嘈LTMPpa  4%$00S# * 40  1114\4P% "1'2!1'40P% "1'2!1'L0S d0 U 0 UU U RQS 121 1114\U  121PP4U< lK⼫040K6Vh0 6@@@] x@ t p WVW  V V0W 00k@ 0S$ 1S (< 㽄PT   4Pp 㾩%0 0 @50S @(K xE0| U 0ShQX0ST P F00 P$0Ē @_@ PFQ P D0S ; 0S YP 4L$0/ (4$0B?˜P@P 80S 0 $ Y Y Y# Q;P 00@@# Q pC4# 0` 0CS 1(0 0  Y) Q L0ST R H4@#d@P1(00 00Q "0Sm gj@T Pc tB0 0001S U=PKPtt l"00 Y "A00  00   00 )&0 0 1 1lK d` `p T!4@ 4 @ 0 S, \A L0S @G8P ?@00X E0 0 P 0 ) w0@`pl0t@( 0dS*TW0@jVhxt` pp x x@4Tt`K((Kxd|pȑ`\ؑ(ض@@İ $\ -L st: 0  P$` P, 0   00C0 P 0 0000C0@0 @$P0Po%X:(Kl@̒ ԰̰h@TpĉضH\ -ML M,0S0 R0 0S-0.S*0@ST H)0@ 0 P8  8 )L0Sh `0e 0Sb (00 P89089 U(0L 01 R0*1K `000JK )1Kt0*a[S @d処P T8 / 0@`T0%TK8(K @8(K` ,0@f0,07 00C0 ᅧ@? P8  8 ,0SpP L0S0! *K `0)K0)1K(JK t,Q0 0 0PF0b(K0 ,00,06 00C0 G(K@@@T4 `V tP+0@ 0$@L&L0SW `0T 0SQ @&`  P8 8 EV%0 S Ɵ  0 S ş z 0@ 0$@0 $ş j\%(K>K$ P88 ,00,0P4 5 00C0-0S(  R(0.S%,0S"R$00 P8 8 8 0.S$00@m P89089 8,0X$0,00S`p0S: QQP ğ 0CSsc< 0 0AS ,,,0Sڴß0. < ,0SQ 0S 0T P< V0 : S0000 0 0 ) ,0S&ڒ~KpG pG@0 00RnK@`FP `F 000xx""T20S dH P< p ,0S00@!L0SU `0R 2 0 0B S !(!!0!!8!!@!!H!!!0 0 000000Q, 0B S !!!!!!!!!!!!0 0 000000 006py P8 8 |0  00C00(<Q89008 (K謓ȓ\MH\ ضLdĔԔp ,8`l| -HH1 0 BLF`PQ>  0  !000S4 000S. p@00 000S 0Wp` Gl 0@ 0$@X0  00C00 0 0 J 0Z*԰̰ܶض -Ԡp`L,P$ Q00S8 0S 00@003T  R<0 08, 000C0`pGW 踵d -L@@B R R 1 !! 嵠 P 00C   bppWo``Fe`tD@G!_v3 0@4l DT0`0@d)̗0 P-L@ ,00S ' hqp|( -L M3X㠓,  ; @P|c+ 嘞#`3R,XpW,D PU,, +'4 0@c00 Ԛ4@A ?$4@2 0$Ć4堤404忚4㻚04(嶚X?004Z0d2  0 TB+40S2PUy0 000 0 00 000 ,0,00 00000 330 330 330 330 @0L@00 D0QD00 550 550 55 d00d00d0d 0 d  ` @d0 00Sd0\^ ,%'@P+xP 00S p`P@ 0R@| aA=  T,` 40 (KhаS@Tdذܰ\|ܘ  -p6SMLM@`V`@X6K`h%P%3 ,0: S M Px {5P 3  iE0S  50SaP0`S$ l50S  l%0@dUde`5pp pppp1 10S P4P(0$<0P @9D0S40S4-K B BP PP@  ,%854# 20dP@0T0T <ğ<8ğ8$4ğ444p 4$@40S4c 43ST# 3R0S c$(0#@3P=PP 叏|3|#@랍C2PP(3$ R DtB0S 20Sl2RB?/PPT`p4 S  ӸĔ    P VDP|| `P4U<2 00B10@ /<2P0Q A/2P  .1P:.1P0@+!0@P04 21004Qh1 \1 .HA.0S01 P 1 ?$KذlԶ`t@аp|̙ܰ`h(L̚h\ (Pt?Aܛ<ض`̰ܶ԰Ȱ@-`0 X0 B@ Q<0<4 0000Pd -L9@3㉏㆏/@ -LMANK< }v 40  nK訜0 -LDMRl S V0W00l  PU10000C0Sl  @jX@< dK@l0 JP0d0 l0X ,@Kh Y0 T P 1`0 100 \` Xp dK$ 0T@K0`0 \@ XP T` Pp 0 dK h0 @` ( D0R/0h 0D:\`KVWH0 V W h ?00bh l0h  a (Kr  H\ -LT PyTYT nTNT YTyTp@|l0t< < <Hx< -0L@SPP T0Sl 0S$$ipP]  T"0SV 0S^^Spm 0SII@9p"0S@ 0 0S<M}M(;pU 0S -q-/pI @t# !0  0  0S^[^p3 0ST?@xMT?@` p"0S<>,pPp0S 00CS00@Ӥ0P\P@t@00S0#3 PP 0农h0 0S0 0`00E <00SL06#3 0PP< <P\XTx< <D@=LH - P0ĐL0`p@T rPP aNPP|>00U T 0S0`00 O0SL <(Hl < -Lp`@RQ嘁嘑嘡@3b0@S([\\[\\\\\\\\[\\\\[[[[@@@@@ 11@@ F@0  + zp0 0R000Sp00S l00S`00S<00S ^8OP@d<0.먙@XPT\Dx<< 0:HMЍ -LL0 L \ 00 (0 $0 0 \l ` -0L0 ` -0L0 ` -$$ 0L00  \`Qd d00A00d0ᐿR0R <4 -@L *<H -40L0S$00S  0 xd 0-L M@P 00S00S 0 QP K<@H RP P *@KD `80 0QK᷄p$ K0xd|hi -L M K,0 APH$0`Sp 0X000 P00RPPU@  1 ,  @A0SS c020 K8 Ԭ p-L MK,` 0 APG0S o0V000 P00 R0S P0   PBL0S S c020Kp( Ԭ -0L(M08@K( Вp _d0 \P0S@( 80 000$ # KX|h6i( -L M0p$0 00|t0$K @SG$0PS` 840  0 . KX4\ -`L MPp@Kp P$_1 @P'G 0S 0ʴ,0 $奃PK踼|thi  -,0L00Sh嫴` -LMP, 0P ,`p0  R100 ӑxRP 0G`p@TR X U_PPJY t H0 0D 0s 0D0 V Y sP8o P4Y 00D ST00ӑW0A 200B SR0000ӑW0C00P\T00X0S  _0PP0,0 @cT d@(K==Э -QL(M5K ! 㨑00 0K  # eP D@0@ 50K^00 (50K0ނP7K踼|hi  -QLM@ K { LPP K⾏&@K4 ^(0 峂p  K|hi$ -|0L0@S h ? R00S L00  Ⓩ,0T, @00 0 0 0\l`  -\1LKMp@DK Q&0W@0 < /a^P RoK`F!A^AP /R^000@pD K$0KDP  0i$0 R  a?0S 00S Q  R ("(04"40$ K8  `/4-0 CR 0R0 S00 Q-L X6 p`@ -0CU3@% R 0S,,0SR00ӑR00Hӑ@ 4 R @0 S0S <=x< -@RLP 0S 0+ &TC 1@0S<p `(<N0C3@ R 0S,x ,=0So|4@ l R @0 S0S400S(>hT>hDL <x< p-0LxMPK`@ K 00 @PPK֎P1 K0400  @T0S Da @K< ]00 (7PAKp航T|hi@p 0-LHM\@KPH ӏD \ \(0 PK0|hiH| 0-LHM\@KPH ᲏D \ \(0 PK0|hiH p-LM*@KxPx` ᐏh @ـpP  ჏0 01Kˀp ԵKp踼hi i  -L M K0, @&D$0 x\p  0ű06@K|P`x  `Md @喀pL  @rKፀp0ᖵ KL H hi i  -LM"@K %TT0 L@lp [Q"0[S "0[ S K踼hi ȮЮ -LM0@KQ !  P !\0 ?P 嗓- 0`p@P0S 0   0S-|-0lS  PPU@Kh|hi ( <4Hx< -81LM@8Kq`P  ៎V@! V/b%P  0ēp@ 'PK 0OnP !d400`ᏵP;@P 0 庌 <8P I ˰$K( xX4 -2ML M`K`K@KH A@ =H d[K0C 0 oPn` K0 Q( K18 PWK10S 2 0S ^KPE`@pH`4@K"IBP<K 2W[H[w[ᴇ[ᰧ[I[[f[ 0 ` $ 0S  @HP0T00S x@`PKh@p8T WLi(KP|hiHi@lx <x<4Pd p-L M.@K `ᎍP0 @~p'  Z00SA[TOE0K 2B0SK XկT001K,0H ~p4ⶳKp踼hi H 0|L i  -L M K@,0 B$`\p  0堯 V0@0P0S phP\0@Px`h@lP @P,0@Pp@tP|` K@B`ذذ -LPp`@P0 SDP 0S@ 0-@PL0 p:0 C0  -L`d00X5Tp@Pp 4* 00 0  2 X, 0-@PL0 p0  0D p-PPL@0S00pd00X L<8@P`RPPPpXd -@pL`@1PDP@T p-L$M@`P x <@K$ dPD` kYT }P@ 4` }P$㊲Kph|i$i$ -Lp@`PP hsd po0 @x80 0P(@P 蠯  -L@D008 ,V$00X(T  -L@D008 ,9$00X p-L$Mk@PP& 喂`@ C0P  `ሂ@TB{KD@K$pG@pG B[  0P ,p 3W R{P 媎"4QBKK$@D`@@DP 00xS  \P@40LUZ@$Kth|i ti  <@^x< - GL{M  W徉0K0 V {Kp8 ᮉ V zBOK`4 ᠉ V zt@K  ᒉT V TzF@K  ᄉ V z\@K v V z@K h V z@K  $ Zx V zpwp3`v`3  2"RS XZ 2SP@00W @[ T KZ[Q 4Q.@K #X:LPK TbP3 4 4KKDOK  }K 4 0V 4 TNzP[P Q[ U@, @ _t@ @ [t>vZu zVZ 01SW]K8-K0  0S X3 Xzph$>,AT 1S1S1S(Q$!000C S0:S Q $ h@Pc`T 0S,,Q;V@P T"R0S x@0S,PK "2S*0S' ,0  0 0 0h"Rd0S` 2S |[`1P|!A t0l |yP01S H10S N |0[ 10S ? x00S 00S `p@Y(K踼h|i i8i4iiiii$x<ȴԴiB  ,4@L\pi <xd -ML MPHHp@5@ <54%A05Q(u$5Qp5Qk 50S  U 0S 0SS0dCPL@Kbd7( ኇP Tx xPW P5|,P<uWP   ( xP㼭 <0 <0R$ 30S | A30St(q(`60 lD30S8)b)$'30S  W V20S@p `Q00S W p 7 @,0T `V@pZh20S`B`R 4T0@$0$@SFNKP@D/LRKLQK܆ T1 !xPYK4[S` SoKL[ <PPBP,SK[1K[!Q``P?K@ P@OK@@_KL[K <BP,S0 S/KTT$N0@ wPQBt0 wP0Q6 R$K||tTht <x<h6i(4bȶ`Kiܶ9i i  0-L$M8@KP$ E lS0S f0P00C SX8@K [SP8㙨00 (twp~ K0|Lhi$p 0-L$M8@KP$  7S0S 10P00C Sh8@K &SPHd@0 8?wp0SEK0|hi$з -LMpK@P4 օtH A ` ΅A0K0 R1 w@PCBP 00S0xS 0K`# rP 0 S 80A7S$ A0[S K Ό@ K5gP00@KP 0 R vP֫h@K$ u\ Rt vP`0X X0 vP@K踼|hi H`i4i$i$ -LM`pK@8 P`KB@ >0tP0 L0 0P0 b <P1 P0 0 L H @ 8 T <Px1PP0 00 C R0:S@L P$pK@` 80$ PD $0@@T0P0S+0(0 &P000S00S  (Kp(Pd`K $0K$ @(T $0D` H0 `@KX QL0 Dvp<q K 0ĸ̸|hi8 0-0LM0Q  ]PK6PP  @0SleP 0S 00StPU< 068`|8$ 0-TPL0@S s<0  0P@0000P h -LMpp0S 0+S D堪P`IOK`` <(@P,[Q307 OK.$ KQK duP 01S@K 032K4BKOKI_K4[ <?P ,Q_K. QK2 +uP01S KvOK.Ƀ` PK,2L uP01S ,\42j42f42b42^42Z42@V42RZ N10ST OK.ሃ\ PK(1 ptPL01S: T7,"(2 4"02 / @ PK0 UTP  K0 UTP $KhlLt|"i Xl%i tIi Ĺйܹ Qi 0`/<D$ 0-LM w1 <8#"m00 @$0K0 sP v01S 㙂@d\ OP tHp00Sd  PvK0hl|ȼP%i \Dt"i l|#i  <x< -L M(@K 4Qa( sp (=`P⫨(0 $0 ` sp ( $0S$ $ 0Gp@PU 0S \ x!pP@$0UL00S@ I ,"Khxi к8 <x< -L0 ,-O(0( KspU |hzi  -L0M@HPK`pv$  OV$K 06$ R@ \<@0P-Sp@dP4@ ,0,H K sp K$@hi$L 0-L$M8@KP8$ ᦁ ND0 <rp0 (S$ P lK0hi$\6l -L1LqLP`V,ا(Aᣁ0P00C S= rPCX@3  rP9 @* rP#0@ rP01ű0 rP0l 00<0 XrP0L0 0  hl|i zi ti i ~i  -2LM04 SP 5pP ?P 00S00C S 4p p,KO3P dY,P 00 80 |W X 8 0R00C SPm @ {NPe000C Sa 00S .Ӏ  aR #  ǀ  aR # pM M 0@T%P40 000 +Y sP$4 TR00S 0 R@ 0T 0"T0S$@$0S 00 0S 0 PU,2W}Z@@, {(K $4ȼ|`< -L$MD`K@q$ M tM qp 0S* 0S& 0S 4PP0 x⇦ `uqp0@`LPE`@TU0!` Khi$ -PLM@p5  p@0P-S2 `@CS ` ASaS gS 4`4`@4@ 00SVpGWP LP   LP  d)pGW0`,0 D$D4@ ~P(4pG`@ $@P40,0  3 3 Y W30S %Z W  lL|#0Wx0|0 @dH~PepW` 3QW$7~PWi 2Q`](~P @Q2 R @ 0S   BR X0S= 4Q ZdR ~PP Q82Q P $b  0pG2QP `Q M 0pG 0030pG`ꌑWAŢ x10S 180S1U10S81Q0` ,10S ,0 K,01,0 pP 01S00S00S* ,0T K,0 0,0oP  |d` HAػ\4LX8  ~hl  MЍL0LV}-H0H DD QPSR 0@-HH8@08 UT S R@ @0R0@000@-HH @0 UT S R( (0R0@000@-HH,@0, UT S R4 40R0@00LL|-H0H DD QPSR 0@-HH8@08 UT S R@ @0R0@000@-HH @0 UT S R( (0R0@000@-HH,@0, UT S R4 40R0@00 -L\ $R R \ R \hy\ <0S@00S\ R $08 -QLM D 50S 50S400S00  0 0 0 0 0 p        $ RR L pl4 0SRHD0S  L0.S(T0S0 0 `(V H`L@0UT@ P  SR 0 0D\1R 0Q LßK0S  g <@T ,#04K\#@K 0\4K@ K 嬣o ||2PP  Xn 0BS | \ y@P  I  I0 b : S SR  I 0-S 0` S 0V`0 ` @\1  pW3 RQ 0@PS| x@ P 8 `U@K` PK`P ` `0,!`.\|P`0!t p lP ` \~|0h  \v|0d 0S0`0  0 \f|` \ 0K80 0Sd0  @7 @T(K|Hd8DpCx|L@  -1LM0@S! pPk 010Sc10S*, N0,0 K40CSH\d(dd(L0.S<0S (!0S7 0S  Y,P`M 0S0v03U0S  L.L0SPLP d#`0X2@Pr0S 4l`8@Dd  -L MPpuP UP 6 4 KlP#[R6 &00&0 6 p }UP \6ƥP \fPX@L6 10@GS\\\\\\\\\\\\\\\\\\x\\\\\\\\\,@\\\\\\\\\\\\\H\<\h  4P`\\5 544?4 44444 0s4  x4 04 4 P4h4D4T4P4 8404,4444 333333 33 3 3 E3 3 3 3 3 @40@1 h3 @43 P3 D3@3 83 0#;$#00000#00"0"0000C"媼p 2 `r00X2Pf0Sp20S{p20Sw<20Ss20So10S@j20S@iX,K 1 R $ 1!0S 0S S S! &!10S!h1!0S110S S S!t1 x!10Sh!1H!0ST1T1000SD!00S 0!01 00S!0 !0S110U  0(Kd00S p00ST ht@\<X PDp04Xtl8@L|`xTHh:ܾ̾H(Hx\\ d -0 CR 0R0 S䔾00:  S-L  S# S  S00S//00S|| x00S@@\00S= =HKI 000S* * < <x< -0`LPpHP  0@0S 0L 0B?c 0h@L T0@0SD00S 0: S@|H`tP -P1@0PS$0pp41400S0L0p1`0Sp/ 0S+ T$0S,J,ӽ@(0  R :@T  Ľ @ 0Sx / d帽$ {@PU000S, o o褽|H <T tx< p-\`@LP 0S $ X00S  函@Tp <x< 0-0P0S$0L0x00S00d00SX00S H00@T0ss0|HtPT  -LM,K`PS 0<0S <10S010S $1 0B?e pP) 0S% ,0W @T p  p$ ,0pW@ 0S d@ TT PU800S, l H` <x< -LM,KpeP4 b0QQ @P0@0 0@@0|-g1 000  0S00!000  R,@0{r0]r0P<0S 410S(10S 1 0B?_e a !8 -80 ` $0 T00X,0PU @ 0 S |y@40T\ 0SP  <i Y aP(Kh $H` <x< p-LHM@` \ P~00000S@P0`P``KRQRQT@P@`KCXPK0 @14PXK$Kpl (hDhPh4 -LM0<0S t30Sh30S \3 0B?d 8CK.KI B BI@( 0S #Hp0S$  "0S 2L 0B?a 0<K⤠( 0<K@"0S|0   h `"0S T0: S S 4"8"8 #$ 0,`SD@0 0f!0g10S  *Sp  X 0R!0S 10S8,L@"rh10S\10S 0: S0: S&<0S0 !4V0@0  ,V @ tnp1 0 (0K 08B @900S  6Z?(KH`|$x,4@LLX4tPhT<h <x< -0L & <d -젟쀟p@L`P/0Sr 0000S?`0 CR` p0R0 S X0X0d r 0000S?(κP R <\= <x<MЍ -pL@P`nP`  p00pT@P a@T l0 P @ mtP@0㕓#PU`pW*<:p  0-LM@P  K0K PPLqp (00S( %K0$@ -L MP@ `$K 0PP+qp $pP 0 PPqp ,00S  : KMЍ P P P   000@00    00  0 $04"4 8 #R@-@ T 00R  0)S0/SR 0 0^P@-@ T 00R  0)S0.S R 0 0^P@- 0c\ 0@=9 =00S@ -L  (< p-L_M.PAPt`e?VE eK 0K 0|1B q 000 Q00 ӑ @PQ@KX jtK`a ㋙ )PK↙<@K\ b(P  e_Kp <P (Kp== -pL`PA@ 0g%U0 St&bpap&ap`pP  $ @TU$  6dpPW  -l1LM0l  y 0D8Y YhK0 0(0 0,00$(0480P@`p $,00< 0 Pp 4@`p$5PPp e @  1Q0^l0  L00@ @gl4b@T {(K=l}}}} -LܞD D D D D @@E0@2Sd4$PXtT`0D0P:;M;0/SS" CS AS%!GS LS gS aS cSlS sS 0<0;0 0;0:0:091P0SS000K 00 @8 0S 00S 00 80SR; #1 4Kq4 =R* 0P 0@005006P l0 000 0啐  08 0K< 0S 000S 0 S0 :$ 0K p0S 000S $ ;OPP  VK`P`AZ 0vZ :\TVx: P:Pʄ 奭*; 00ꋓP 0X00K tP00S 000S  9  X 08^07[0 00v00Q@K h Y   70 P [` *00  !g<9 N 09* 0K%)P00S 000S 8 8P4 0:;7 0< 04Ka4 < R 0hT(<0K`p <30:;:0:;8(Ūp27$@dXX HZP 00 4!A$7D 0 0P 0PP @K Oh $g   70 >P'0S00Q  fd60  D66 PQ/ @K h   7@0K P [$\0q@00S 50 4|@%0)0 _P@q`50  @U@`K@)p' 0@@ p_P)0( p_P~4 0Sx9  hD4`%0 R0HS004 0 5.$ 0 %00;0>4 iP N ,40l$0 0B0 S@$8#80F3@0,@ @ 3 ,0K_4 @0R,0 x3) ,0Kr_p DQ,0K ), * `_p )+ , S_p BK0  Hg d30S:00  P0 0 0K0 eM>K0C0 40 5@K X0 T p P mP0S i\ rP0  $ <5 R @E0SX5X \50 c0BQ x50Stlp3MЍ 0-8P8@L4 *d  0#<(t - L*h -BMLMpP4t0e0,@00 ,0 4rP dP jP4@+ aP( uP zP! tP!P, @j4 5gp 000C S0 L$媦p00S84@,0S 0KÎP 㨊Xnpq 1 dR 0+S 3L4  L$ H@TPp00F S.VWprP`V@0W0P 0p `@dPa 0RR!>C 2#=S0X3d@ PR) *) *) *d) *() *)@ Td0 T?#C0 2#0@0TT!>C 2"0r03 R0S !00C0@0TT!>C 2"0r03R0S @0TT!>C 2#S0 0RR!>C 2#;S0~/x1@PQ0GT1pW*@10S HKpLJ 1HPK`<K0S@<0 8@ 4p ^p( <K<@ 8P 40 P/g P %㒩HQ 0+SL HXä Y ` (fP 0P|̅MK@D0L$V Se먙@,8<@:,LTdxMЍC0 S S  -`0@P@@T0 LQ <00S 000S.6:+H P `  -L@PD/4 p-L@,cP `%0p -2 B 0LP@0`P 0S00']d2M $ -2942@c0P/S @PaP 2 B 30S ),',%,#, 1R]P @aPPE ,U 0+S-S0Sf*Pc*Pp+]@P@`%p`UPE00S3PZPP700S 00St0Q. /'p9v8P6PP\ x L` XX\`d:dlld X p 000 00@`  0-L@PU0 0 ID -|@L0p0h I0\0L I0D00 I0,0 I00h D -L@`0X {IP0@ uI<0( oI(0 iI0@Dh  -L@$000P hh  0 0S00EI D 0  06S000| ,0 0@S200 @-0 4D044D 0P 0- L0S( 4 @ 0   0r@0Q@ DLP 4 0T4Z0@0h0H  -0L gap0q 0 -0LPU5 40 0@044D 0S"040P`0$44p Td$T(d,t$0@044D $ 0*apqh1( -0Lp`PP#0 4@0$($,T044Dt T$= P 404(0$00 4siH 8 p-L@ 00s'0@  -4LpMP0 Q $$0R($0R,0Q00:$($? 20€0 S 0S0,$R030 5: Z02Z00 L R 0s0s* 30S 4 3 R 4SAP3 3@ 40 400@000  83   0 0 0 $4(D0@0 00 2P$($6F`IpIpq QʡP4S4S 4?  0+`p@Pq@1'M20dtŸ q 00010*b%pl P'-1 4D0O4D0P0030d4t|10S) 0SN+K X&RL10S@1mKP(0 S 0S1 0S 0 +00 00S$00 S 0 0 0  0 0  02 0 ,0PN*0(K4 |    < H      0-0LPU ,4S0C$(QP40@[P $4(D 0@$4(D0,40h0 -l@L0S~p D0,$R0,4$4(D 0@$4(D0,4 -1LpPW`Z 7VYp q  V0U00I0O(?   69F$4S4S  P4S* 4S&p" 0ꀀp 4S4S:AT0Q$(080@00,00  -LP l0 P 0R 0R Q0$4(D0,4 -p0L@T 4 x 04pq hW0 @/p p$ 0 010#=Q0S4:Ss0p 0 00 = p-L 000 x 0Pd `J&P @ r 0 04 (0$ 8 =p<040 0 ,0(0 000  $00 000  -LMp@P `@_00C0 S%"0 .S0K0 $ K K p-RL@Pq0` XTUp -LM`p$ @PD0 `p -L|@||PM$pK(`K  [(0S0C(0 0$ 0b0 0R 0 000 K -LMP@p`X   e0` p-L@LMPK@%lX`@@00S x -LMP@܀,pK(`K, 0(  R,00# (000 0S( ,0S(00#D@(`K,PK 0S'@0 S$K  -T0L0S<0@@Y0 0@(0 00 $ -P1LMH!0SK$@K0$p,`K0PK%,0S(0S 0 ,00R$ 0 ܠ p@4`K8PK4 80@00l?T 40S4 h0 c\0@d0 YH,0 ( c,0 0 b00S C$K  0-P0@LT0 0S0 P0D@ (<00 0P0s300 $ -0L M 0 PK Ѐp %@(`K(0@00l?T $00S, (0S ,0$0 ,PK(@K$ 0S$ (0 c,0@0  K  p-LM@ 0S0 K K 0P 0 0 R0AR00S t 0 d@0000"`K PKy 0S ʈ"000 0SKp  - 0L00S H p-PL`@V0 Rpx00 AP@*P0P0A0Q:$0 \p  p-2b0@S2LTP00P P} P PS PMP $ Po  P> J1PD eP PyJ{}yFB00S S=A00 S njQA0S0S S _QA0S\0S SXx1@@`1pDA00SG?#=!p1 1R0R S P@0S00S S ,P@0S%0S S!( 00 S@ h@00 S 00 SS 00pPphp  ( -LMPU|||p`,K  ,P i@TI!,0PT@:0S0 0 0 0S 0PP4 -0LMK0 ! KP -LZ#P x0pq  T0 hH00S <@ e nD ^00.@0S0> G*.0Sed.0S:  _P  P d> PM T>0S P (> P> N0S $@$P T 0S:n B-0SD0eS`p]`p-@TD0eSe @D 0S Sf Sc S S/S 7S[ S00G.W S}dPx Q@H,0SP0!W@  +W W R0R00@0#0<0WT t<0WP h<0WuK* ,PN@ 4 @K0@0SP +aGQ0+V0;/P%WQ W W W !WG W*W @W07S,; 07S+607S 1*. W W !P 0#0CSXP;0S P LP )0K*pK*K 0K0 @0PT 0DcSqq\suppwzxwsXqpstLts\x0jK@;K@@P 0*@ T i舳x   -2LM0pS d2@T+PP0`|S -S` IP} PuJ@J@@ P0*T`V_ X$ 10S@ ,@)K P 0X00P0SF 04000)[ `@p9dvp@d0S 00CS00PӤ0P U g0H u RS @oJp@P000Sp8 x (4 <@ -LAMPP2  0hOpq) NK,HPKp@%`@ 0S PP   0S*P P` 0S:VK\  -HHaLp@P#R %RT0TS 0S %R #RP JPP@ R묐0ਠ`P@#R %RU0US 0S %R #R P  dI@ P R L H  -L@I 0 pS` R0S000SI`PU(P@000S 00   0-LlMKPP@0: S@@xK0 p-LlM0`0SP I@@ P} KaPPl00S0: S eI*@! P^, P7KpL h<<00S,0P 00S00C| ,  '00Sn  0S00\  -Lp@P`WV 000CW`K@tPuZ UX`yoXpWZVX (00S@ md   -LMp`p@P qV i 0 0-t0L0Spq p@Pq0T0U0000  -LP  00SR -L@pP`\T p200CW `20SWD200CW @w$200CW yUV UV P@ 1P @1@T@ ZZP`!hpP`qXUp4q2P P AP!XT 0 0S0uv 0 0S 0S0x  \p 00pWZYT+00 oi 00Su 0 , PL   -LMp`P P 0@IP9  Kiop@P(q&V 0ATP 00S dP@P 0p@Pq Kif 0 K  0PP0PP< P000S SP000S00P0000000   -0L`Pp@EP `VV'(` W  00P`p0@ 0 @ `000pW 000 0-@PL tP 0T T00 00C0 R( 00C00h0H  p-L@Pq P`pp P P@P40`0ps@Pp P P00T \  -L$MpXxWv`#0S PHC0S <#0 QPW 0L@ P08 40 TP ~B0S ('@ T T "06 P P p/ PB0* P 000 ,0 py0 , 0KP0K0PK`p@ !00<0  2\ P P=tA0S9h!0S5@H 00D @0  @P!0S !0S<@0@X P ` 0P`@DTʵ0@0Y@XW<0KPp2D00S 0K8 K PP*(KD    T    -LMpwx 0S P#0S t3tC 00S@_ 0drP0p , @P0p PA0 K  00 ,0 80K0KS0@K00* x @0P`Pɯ`V* @T PXW5p@q P P`pR0gt T"@tTP`80S4!P00PUo-c  8 TPPx1@Tl0ST!0; Pp@@G41P`@ @ P?P`@&0K3@PpA00S ( 000K@P*00SZ 0 P` D@ P P pc(Ko(KD    T     -L MP`, EP,0@cT D dq~@P X(Kopw0x0XW0@,@p(Xy z  V0 U00 1 ,0@c 01pP`q @,0T (1(,0@d@ 0@7pP`q XW 000S (Ko&@00CT h00SeD0@@x$0 0@@(K`   P ,  p-L`@PP  P p #@P$00S phP  -L`ppq|Dp@PqTh 0AUT0 h  -L MKy*K  K p-LP ph P`pqP0  Bph4@  B@PQ php  -LM`pp@Pq KP |00Sh0 W V @P,0 $K!uKP  P\0 0TSP0 H0 D0 @0 <0 80 40 00 00 xhldpDHt|000 @00<@d00S X00S P~0 @P 00 000000t @<0 0 td -p堀0L@PP `PPi `B `BP`@<@ Q-L?P=0@P60 `Cp3 PP 0p V@P  @P@P 0`dQA0`FP@PZ<0000Y$000C0f0@P<  p-Lpq0 @PP-p@) 崠`t T 0 @P00CV]P z@P@P0@`@40W 00 X`@P<  -L0<0  000 $00 00      -L0<0  000 $00 00      Pp-LP@1 00S PP@&` Rڔ@00SP 00S@@P @0 R 4000SP@p h@ P-L0P P-L@ P0P M-LMp020 ` @0,K]P W @"st VU`@p20S52 0@ ,PK, PP P% ,0 S P0P,!0 xA0,0 ,0 SPP b@1 F(10SXX 11 0,K,  &PPp00S 0@0@0@Tʔ0Z 0$K0 0CjRh`0 0\0L0p0 0 0P  $KD \ <hl @ -LM0@@`p P@D\0@@0@T (P \ 0  l   -PLM@`pS3 R 33\ ڼ0Sڰc000S0  R0  RtS(@K  00$ !@ p,0 0l0 0`  u0P0`0 2 \0S000S0 2 Ÿ0S#ڔ2 t2Rx2  d2 0TP _TPP^@20SPPX_TP@` _RP0P0P TJ10SnSSjK11 1 1Q0cڨ1!0\A1!1@ `:`` 0 B\AQL!01`l  @0J$!00 0S10! GP`F(V(00S TP 00S STT0  0 P(Kt hxl@<p Dd48 0` 0PPP0@c0 0`0 P0CR0 `0 00 0Q0 $0 K(  h<T \ @lxL -L P 0Sl00hd P 0SL00 <0 ,0+$0 <0D<@ 0-1@LPP 0t03 P0S1 1 1Rb"10SmP h1hd1 \1 00BC\ P01 1 10R 10S T 00S00S 0 000 0000S U tPx0@ 00h0 0040 000 (00 0|d \ h]<@l   @-l0c- 0S 0T 0@0@ c= 0 0  <0@-P R 00Q   -L,P@`0S0S> @ T 0S0S: p\ 000  P`0 Rh0P0 RQ0@^0 00  Q-LP`pr1P PU 0 S0S:Q R`\ x1U 0Q 00X@R%Q#@tPE(`@0 0`p9pq7  0@P Y0$X!QP"`@0 0`ppq 0@P U0T 0/`p $$0S0  00e( `  0-T@L0S0dS0 PP(000P6000x -2L0`Sp pq WVP2 X 0S0S:0S 0S{ 1X1 0 0Q 0 @0S@T6S4P[1刡@0_0@P3pqI  0 W0V  0U5T30@. P'0帠@00@P Jpq R 0 U0T 0 Z (   -L@P`p@Pt 0u 0 X00S L0XR@P*TU0@ 0 50S, -50 S  Ra0@ S-00LA0@S0?` 0-L MPP @K0 000K0H  'Pp-L7 $P'.P ^P"L1L!@00 0%VP 1 !1L0 0 0  P- 0s0sph0^ ND3s H3s 0@D3HCP0 d00@#L3800 `P0 #P phpH    -L M@KV0s0s ?00@3KH  -,0L R0050P @B  -,0L R0050T @Bp 0P 00d  P Pk 0 d  -PL M P P"P00  R 0ShX0RH0  80< (0K0 K0K0 0K0K0 8 K   -PLM@) T TV\Q@p ` "00C0 S10R!@œ0,STT901 0b 00@0PK  0Sp` T 91` }@0|T @K9aT n@K9,0`04 e0$K$@ K84x -@PL Thd0 \.X,T*P(L&H$D"@ <8h2P $P,4Lt P6 P P0$  0-PLM@& P P*0mS MS hS =S sS wS pP hPdP`P\PXPTP@3808 0K10 SK0    $@  P-L800S (0 0 hXD Lr -PL M0 " P P>00K.S K 000 0S0-0S $0 0 00S00K,@Kp 8@P0t @0S  K0 4 CK,0K0 KTTXpp  -PL M0 " P P>00K.S K 000 }0S0-0S $0 0 00S00K,@Kp 68@P0t @0S  K0 4 CK,0K0 KP $Q PPP0SP 0   0PT$0$0S0SX  -Q0LM00SK0 M KL -Lp@P000C0 S @ h,,@0`0 C0 ST 2@DT  0@TU0 `0 p-L`P@0-S000C0 S ph!!00 C0 ST00^ap -LMK  Kh -LM 0R0*, ,i0* a  -0LhT -LPPM0 pb @`V0@ , `,KWV0  , <,KM 0S SV000S`B V? i e fV V V 0 1 0 0s03 V V V&@  00 0FSPV V V 0K$ KD$0S0R90S V0V 0= @00SSS 0010,K0,0 -V 0 \0   000CS4  K   -@LT`p"6|0pP@W \S0 S@$S X P 000S00|  -Lk@0 eJ0 -PLM8 B Rp,Kz 00S S 0 8K@|2 @9P8@ 0P `!80 %5*$P  P P+P -PnP! `$0+SX080 u!000 o0Pn ,80 0+S6!;,\!0Sn`z`@^PPh4K4@ `P,p 000CS;X$XXXX@ 00s03X@ 00&aFQ 800S8 80 S  0P 8 800S\0P8K @0S,,P 80Pd(KTLD X4< S 0 Q $ 0S C \ -dL`P 0SL0  D@  R000 $@$0TSdX -p@!`PLD PQ <  07  02  -LM d 0 K p-LMP`d@!0002 0@?Kp'@B -LMp(`w5@t5@@/0 P`  -LMK\{ K -锠PLp` 80@SP0000ST0S0#S  -L P P Pp h -0LMo@p@`!0K!PK / 000e/@PV-00e  K -QLM@Pp@tPp0%0K%`K 09$00 ft0@PW-00f $K -QLM@Pp@tPp0%0K%`K 0$00 fJ0@PW-00f $K -\0\0L@S L0 Pe,P p> 0 0 XP   0-L L0PS000@00 R+0 P00 0 W   -L@0@S -LMpP`5K+%P0 p`$ pnR sR dR @`0@SP  B4 0694`P K 0-0L0PS@ t00Sz P0@0S @00S b$00S0 Z0P `    0-L@PUD 0 0  p-0L0 S P` 00S 00S /0@@ct0P0S h00S ph1XJP0 @@@ 400T,0 phP  `       -0LM0  l0 `0Pp `K  0T0EPZ@PC   p3 -LM@ ` q3`\Q  0R QZY!X11: \` 80K@P8@ 4P 0` ,p mp3Q 8 00 0 00 00S0!P(K -@LPH00 -0LM0@Sp S00S 3f 0PcP@`0 ` r 3mF@P 4@PG`U Xp p p @00C000C 000C?001 0@-<0  0h0@P4 p 0q-  + Q 0%P#4p@q 0Q 0r S 000 )P LP808 PHZ0P:j$ \ H  ( |  (0$0 0b0c0AV   $ -p0p 0LS@ 0@s@3H0H0@0<0 80b0cA6$0 X@      | 0& -XL'P@L#D <80400,(0L  8$@-p^ 001`0S10tu 0S 0Sqr, R*Q'00S  0S qr 0S0S:\^00H00S 0S000s3 T \ <D (  0-L@P5<0  0S0S0 R0( -0L @p30S -L hP -  0R 0RQ^  QP 0 0S  SR 0 0 0R 0R Y00 0- LP@M R  0@ 0, 4 (< -@LP300h$00S0 0  @  < D  -LM@QPp@  PP 0T0 `Kp@&.P@ p 000  0S : `0R  T00S S@00S 00 0 0 =@  X<  0-@LPT 0S$  0 0P   -L M 0R\4 0 ,0 T  A8 0@i{ @ip4K0PO8 a# U  S R 0 O4K0@ 0@ U S4Kp0OP` U 0S, X D0,@ 0h @ @P(K<D  -L@MP`X T0 *@P <` @p < P`00X r T0s  T@0TX\00 Q R` 0@0C 0 , K00K p 0@, K00KJ p 0@P`wx R@0K0S @ 0bS0c S  0PB0SH 2Q H l20SHH  S H  H QH ,B00SHH H-@L H@D ,LD 00K@%P  AP 8K00L 4@K @2P m` p\XPB H008KL 4@K@ P3 PQ 4H@8D00L  @"AQʸ00S 4H@800DL  @LLDJQP 0 `L@D>@@(K ( < t \ P (D D  -L4MP43@(3$H D @ < nPzP Z 08 40 `8 4 8 4 V8K0`2pq tu Q P`2YXtu 42 0@_` pH D *tu UT@P1 0@_ QP1 0 QP`p` p`VpH` Dp t u  80s04q 00 4 U80T8@K0t u U0T00" 0 0K 0 )Ph0qr ,0S00S0K@ < 0HK@K 0(K, 4 D  -LLMvwJ 010 @0R0 , (Ko00S )np@Pq f, R00Sp q Q0P 00 V58 00CXZ (Kon(KT  \    -0L0@SBPTpW"0000S　`3p@tPq G`00CV80p (    0-LM K @K0tu  0K0 -0QLMp 0S#BP 0y:*R B0S 0S"0S002 d ZP\B0S vH2 00S 3P `@P1p@Pq}@P$10S S  1 ````%vV@P 0@PLa0Z c@Pt u Z JX@Ptu t,@ (P u(8$,K  0pP h00S00X0S  D0,K * $0P$KD D ( l   < -L 0 0S0 hD (  -<LP(h 00s030hD (  0      D P  000  000  000  -LM0 $ KK0 0 3P$ K -@PL \TL h| -1LX@ @@ _DđQ60  @`Pp0S0S 0` 0?0080  000S i    h `  -LMLp`KP p@P0[SPKT[  - L' P00| MЍ -0L >< -LMp@RP= 0S<0S S5 [1 *P) 0B?S%NP (KP P`$KP  $0SP(0V`U S0S P00 K -L 0KM#+ -L@M0pD[ ,0 ZP,J@@PP :@PPl 00mOP f@Pl0 &#3 RD K∣L P T t3 hh0o,PH 0  0S004P PH 0' r0 S@ 080 4@ 0 0S ,0K0r 40K,K80 PP0L夔IY@P 0`D0 @@ `0L"<0 T@ 0 "@P" TPP 10S L  0!P 0@ Kh0P S0h0@0[?S $P `$0 S@@R Dᴌ@T,ᭌT K0 <d@` -QL|MP p`Q`` ? 0 吠Kȟ 0`刌 d P1C P 0@(@Kh0P Sh@0[S@,0  K,@K0 @o, @R, 0a,0S(Kx <d -@Lpd 媦P|B  P @0 S00H@PP@U@`@`$P@@h  <d0 -`PL @8pPP @0S P@ -LM@`p 0C)@0S$ R@Pk  0@Pb  0TZ00 W0S0܋(ً }(K  0-LlM 0@pP  KGp ,WF0: S S aBK0  -LM0 p, 5 P -p$(4000000, <0  Z0 \ 0x 0 p50 0 8F$2d 0( (0 ,(KoE(K rdAP\ -L@_d"0p @$PQ   wp00PP X{00 -0L0@_ d"p P$PQOP @ qp00P0S b@ -oLHM`PdK@ p`0[00SHP0[00SC@0[00S>00[00S9 @P3  $Kw$ 0R  0R  0p! @P  $KZ$ H0R  <0R  0SKEFI PART 0-LPq@P0,60 -LM ?KP@Dt h@KK@ P`p$ Ό P 0U@(K -LPM p`l @` p1!o$h@K&> @ P@$ Ό @l 0TP(K -L`p@PP,0  zsd -&>LP`@ @$p@ T -PLM@x U01U01`$0pK0pPo` }V K p-n@PL 010100C1ph} -01L`\@ h!&> .>C\2&0]280S0<2<0S0S00@20D200CL200CH2 0P2 x0TR(0Ġ  0SR 0X2e0`TX2h- U 8 0 S00 _Q0S0?S< 0S 0S0?S0S -!0LS PU $ m p0@)P@c"@@cPE@@PcPPcP@ -P!LQp$ hV0 @ A0C2. 0 $&Ta00d0@ -LHMpD W/z-z(Ko)z! 08 @  `0 @P0p4p  V< 8 `*`, pN040(@00@P4  0@<P+  0V, D 80$婈(K@ M-LM@0Z P`VV`Z!0SSp P 00 ,?0"1000 00 0,?0"1000 8y 00!0000g00 0`$K 0-LM P @0?000 1<000!00! 00RR?000 1<00 000 000 8 -L Mey`Hp SY.DDwD B 1P @@^W 8  %[p`W`$K4P 0-LM aPMP | p0R dKS`p P@P D0D 0ᣄ! >8PPP| -LM$, ,K(PK0 @P(`\p  ,P( 0 PP(@Q , 囇t Tᔬ#@T$ X勇$0㖣#A 8傇 @$$K0\| -(@L l0S @ -@L  &> xU -L4MD( (Kt(0@S$x$pK0 p@$P\`  010 (p.@$0Q( S`  $㓌.LPKp薌$0N0`0LK000 K0 < -LF -LM1@"S92RS]2SPp_P00 "^K`Ɇ/0~p v@*Av0@h00S   B0 @001A0 Khl 0-PL@吆d0 -L M KP`p0 @ 0S  s!$0c#!aRR phh@0S`VTw H[@X@_ ?0_K 8X -L M$K0 p@$@PT`  \0 0$0P (31P K  -@LlP  ;Te <@_ ?0 ,Y 0 0p -LM,K@`0 P,8 4 Z  ׅt8$0p0 `Q$ 8待\PH @ @D 0\P0 PE\ 00\00 \0 \ 0\00 0 S8 Sh!0&0P0`! (K   8Pdx -LMK`8 00`j80 0xv(4 pv$KlMЍH 0-LM Pሌp ANK@D+0\ P @P@ᨊ@K0 -0LS@ShI; -0LSh; -0LS0Sh; p-0L@T PP[0`00P@ `pp p-@PL`l l`\ 070P0) P@Pp0pD -0L 7ݯ<L -2LM00 S Q 10S 1 o1 0RA00 0Y 0 00S SI|10S? p10S;00^SY,  0  00S$S00,0 (p0S00p`P@ 00Q0P, Z00QP0  @j@a ` P@P%hp\P`@ 00 0 !0 0 000(K܈ 0-L@c@ kPPdM0hV -8L$M8 0D eSH  fS8 8 `㠈堘p@ < 8` 4` 9eU *HU BUAUi00E S$OEU CUuFU GUUU LU RU IUaU VU bU cUsU lU hU iU fUoU nUqU rU|xU vU  T7uU U yU,'U $7UW00F S7 6 6R6 0 00C00 ,K, 0R& P00R0Sp AU|6P\&00X&& ,Kǜ, 0R P00R0Sp655 @55 @5z%00%0w5 q5 @5<0F@j 0㚊L|5 ]t5 Z8 Z004 80 M4 04<@ 1Lb0$00< 0A4 ;$0 $04 @4 4 *4 ' 4$00#4 $0@P xP0\P00D=9<4 ,4@0`pSp@0 @DH$4@XpP3D 0c40}@ T4巤(3P)`pj@P 0 S 00KP`0S0#3 BrPP  (<ኤPU< @R@X00SX00SH0  7H 2 0S`"0000SH"0000S 10ShdBd\RL2p` 04"0QP 0B1 )P !<5!8Anp`0Wt10S 0)}X 10S00S0  X\p3 0P @P PMPHx@U0 P 00S0S@,  <8LTdl: l <x< 00 0pt0P$ 00C0 R0 pxt -LP -LP@P-  p-PL0` 00 0@ 0T0000D S0`8``0 0 0S0ڬphpptx-0 CR 0R0 SHZ00 -h1L0`SPp@D傂@<10S T (10S  Zπ@00S T 00SY蹀@T 00Sp`YWc80 400S h  hYx< <x@ -L|P$;  -L P;  -L⡥P; 4b -LoP;  -L 30S:S0S6R) 20SQ b 0R20SR pp2 2R T"p2HR 0R08 KPK:h D2b PKR8 K-_00C020S 0S0`KH Z\ 0S00R0S QPK000`` ``` `P 0S!0S D10S`10S h10S`@ X``0pT 00S0S0Sp0X`00s03V0S 00S ~\00S-`(Kl0| l6@( -L dPP✀p@`4S S S  0`S P2@kcPn0S +9MЍ -L 0(Ω<@Xt -PPL, `P( @QP# .P 00EP Pp>P. P p3P P@T -PPL 0S4nS0oSP  0@ 00@,`PJT0P@8 p`Pp`,P 0-d0L@PT 0P<00s300S @00S0 -LM,Kp%n`P+Y Z P Z N P!Wt V,00Y Z PWt E,00?, ?CP@OD⍏H_E`VZ -GML MP PMK @D @DUPppKP`0: S, KpP  S`,@K P pP |Pp  upPV6`,@KLP0  *@P@PP @䜾@00 :@P P吾:00`P T00SH *}@0.P$ K  -LM KWm`P?pOC7 0PPZ P tP VPpOD`VZr -L`pS88P@!hP aPP fPtP vP0 P0 0Sx30@< KSp0@d  P00S +\00S P00SXe UA oPP@P@, :MЍ\ -L $~٧< -LM0@00C0S0@0K 00#?00S  3@, -L@<P   00A SQh 2 -L@$P   00A SQhӕ 20 -L@OMpKx ,@ fxRE `,@K6mP) gP! lP 9P,sP oP& uP xP! 00000 0000 e k  X !pRpta00 SM0K1PAA@痃P08! ,0P( 01 0 1 5 ! `#0A YLK@D@DKp O6U00 V00 Y0;;0 KAA, >Kz@PkPl -Pd P\ k*KP0C!0C 4/z@*z@T CM ?p@ P : UhfRp10\NK@DlQ@D0d!wj0S Y 0  0S j0S KAYA 8U/- R@,K yP ,0#4 P >  TR(Kx4`t -L(ML DK#PldPP0AD0 @@ <0 8@ <0KD0 @@ DK<(P({ $  t-0H +0K)Kl\: b\' N\ T\6d\ f\ t\U n\ p\} v\ y\x 00000w000+K *Kzm0KD Qp43 0 l0哛]ޒ#XP0ST :P 002`@  P H;@T \^3L"0S `/ R4  0S<nS0oS040 0 0"0"<4K!P0H0 1 1 唀:L!pOp]1XL QKT1!T11AD@t P 6P _pP`&v0P 0PH0S  `Hp@`p P  P  P F/  0X* (K$@,< :ІL}4$ -0PLM` T PKp%`  2<`p`3|$@0v03T0Sᕚ p-0LSP: @N P I P D P*00S S  P P|0`@ P`000s03@T 8000S0S pp4$00 0  0 0 -LP}2  R-L@ ȉPTl2 P-L ɞP_2 0-/LPȢ@P000+0/00$+;+70  p-LlM/`ᩢ@P KP0: S 0PrS@   Kp p-`PL@P00S 0 R mwiwV \00S |JH0H R 8Vw,Rw(0(Nw㡢p $|0 --LM0 0 ㌢ --LM0 0 K --LM0 0 K -L@1g岟 hln -41LQM pK  ^P@`K=h8`PP10: S 0R 000(YK@=Pd1: Sp lvVPP S00S )@P U@ Kr\l| --LM0 0 b< -LM @XPp`` 0 P  0S000 -LK0 #$ 0K\ K~K` p-LM@KP`d Kp@-P`pP@0000100 "#  010 " 00000#200 #  000 " 0#1000 200\x0@0P0x010P0x "# R |0100#R0|0340P0|0#20P00000 <- 0@0#1C0T\T00T00@-@P0000 "  010 " 0#100 #  000 "  ""  020 " 0000 "#  010 " 0100\x0000x " 1 |0100#10|0#10000000 <. 00#2C02\200200@-@ 0 010 0"!#1 010 0""#2 010 0"##3 01|\0| |0 01|0| |0"!#1 01}0| |0""#2 01~0@-@ 000  |\#|0| 00|0@-@0 <0b0  |\#|0| 0b0|0-   00|Q"Ġ|0 00|0|  00|\"000G-Pp`& !0\.@0 .Q@ TPG@ G-@pP`&! 1B$0l\:  !0LJ$ ^: 01 @ 0 0:#P`@G0@-P 0@C0  # 0"00 "  \0 -ML M HK00 R)0[H [0 @0;KH K)0K A 01 R;K KA00 R02 0/K0S0H4 =K0C/KSY0HK 01 S20>  KK-K?K@A BMK@D% KK @A#mK`FK A)}KMK@DpGK A'KHK A+K- K%KJ@A1]KBPE >/MK @D%-K B 3mK5 K `F@ K%rOK-KA  RK04ş,"00|Q"$L1,"0  RK  0 0|P"0-MK@D0 K]K0 PE+-K B K K@rK!MK@D5KA;mK`F K@K  KI 0@K yXK H00 Q9}K`KpG_KROK rK oK !MK@D p`@@ TMK@D!-K BX}z@v@rT-K BChe@a@] TMK@D!-K B,QN@J@F2TMK@D-K B:7@3@/dT-K B%"@``2V-K B  9MK@D;mKr/K`F7 K @@ 10 R7 K@p rL=K!00"0 0#P1 1@0 R(KA M-VMLM@00 Yp @h?XfKPa 00 P 0 Q 0 @ @P 0 0Q R@K 0B_KQboK` @ K 0@KH@K`KA 3P ?  ?  ?00RP` 0@Q5 R 0@Q(Kt  -LMpK@JK‐joKP 늏K J= C HP C 3  ;  7(K -LMp`ᨠKPOK  တ&  "JK  =   j_K 0-OK+t ',#  2  2 2 (Kt" -}P`L@    h 0-L@P ,0h -LMM KK(@2 " P" K(@ K(@}K! K(pG(@OKzK,(Jp0P1 @RO V  eP00pS`` P ?X@p`V Na뫒먙T'@,\'p':MЍL 0@-<1PR P @ P \ l0B^ ^@51:^1@3:4SD 8#8S@@@  <,4$ !4 $X$,,<0  0ASP 00b00 -0000qS00l0 Q000S0 #h00S 0 00bR 00\ q00l\ P Ptp51PhP  (PT$P0P 8P40,($(u( T((( p-@L M0KP`  @ዯ0S /VƠx 8 l, #44,< 0 8 , #444 ,<0!0000Kp( ! p-L,MK0 T@|0TP` d8 <K K$0K, (P $ < 4@ 0@ @@MpGVKp4!( -L@"000 0P 0;0) -0@LP pI `  0B0 S` a0B0SW`BA0B0S7`BR^ XdTp †  PP2:0d0 -X1L M `R R p(op @_0 K 跮 \  0Z0`PU U'@ $  0f #<4!4"<00P0l0 P A PT  R00 -`QLP@9 p$0CV3@ 0P,<S ?>0S6>@  R@0 S0SP ,00S>i>i> < -QL@B <d84!010S  >pP WP Pp0 CS   ^P` W UpZ td0  CS @` VP<00S$ W =m)x<d <4 p-LPL`@LDzd8 T0td$ N phx< )) p-+QL M`Z  QW Q Q;0QP -0AS4K2Q1H@K0P M1\%  0K1 :@PP 0 0 >t0 hdd0 0 S L00S $ 000, 0S00Kp))) P -LM` @ cQ (Ko<Q ť< P } (Ko< 0\ p P , 5p P,p @ % Q Qp QP Q Q,   Q Q 0S0S0S0C000  ^ P @U@00R F |cT pB0P0; XcPW 0 0 0vcY $qcX $ jc, R X @,  ^c  Q! Q! !5:Q! Q (Q! $Q 0Q! 8Q! !|!x!x:ct8cpl! P6ZX.c0@00@P =@TP,cT(8<0 L L0 c00S (Ko 0  c  00S (Kot (Ko-<(K  * *L***D*****(u( (T((+(+x<P8+L+l++d < -T L0R S S0RS  P0 |'< p- 2L M0`S{ Q g;u0A0S1bb0 0CS7 \(@Kb:Pxbdb\\!Txb@H!R >, kbQ Qcb`b |5, Zb 0 Sb -|00S 0@00@P <@TP8 <0 L L(h0 2bKp *+++++x<+P+,,d4(,8,d, -L@p+R&.`PaT cT gT 80S, 0 0000T4(ß0 0c3 @  p 330 @0`0$ 0 0`P h3lC0\S0C0PP OD3P0S(4E30 30S0C0@@ 92P0S/20 20S0C0@@ #2P0S|T20 @204S0C0@@ <2P0S<10  (20S0C0@@ 1P0S10  10S0C0@@ 1P0SL10  10|S0C0@@ 41P0SLL1`0@fS@s$10S-Q OP 10S Yp@&.c{P 0S 0R 0RpTD4!  ,X,,,,,!,  ,|, -L$M@8 8`K pK4  0( 0@ ,@ $@ @@P P PPpS0 @@P 0@@`0@T:K-- 0-LM@QP0S  0S 0S0S0S A 00 S;(@K  P0@P* 000K0 c\  0p0` 00CAQ BP0   K0`/ ~@-<) -LXMLD0S` :P00$000004X  3P X XX X  s sssPs30P0@PX Xpß0 00@Ug Us UjU !Ub~K 2 C1P#/ VP0L@K0  L  ,0KHP D P  ,0KL P, R h 0ST 4,d0S 00SS 00S S 0S 8#8 $#$0 0L0S`X\ [ 00{T%$00]KZ00X*\1@T& 0 P: P  < 8#" fP P  #00S  ≧P ᏠP Z0000 p d (KH X D-T `/4T-t---- P-L(7$0$ f`P--<(. P-L@ D05p4 ] NP~4!h. -0LM@P`p(0 0-S@P `(  `@DT #Ap3 P (0KPp) 00S  0Pp 0 0S0  ܉^KPEtp PE0`K+xp@N0S \80 , i 4j^ lt. 4!. c. -L@P`!p'0-S!P  P PP P P`` ` T0 @T  `@DT00 o{@4!  -@7L M 0R`@00 v0gS'{0K< @ 8 4 /64P0-S0@ F3S00H00$0t t0p04T04 0T  5  5 5  5  80! 680 5  `R h50SS TGv-`R (50!S(`R 40!S40S v40!S 440!S p40!S xğ00{{\$0ATğ00yH$9puzsyqyo|m|k{i`RM  `RG  \`R@  0<0 S`R7  @ I`R- D`R(  `#0009`R 73w1`R +`R  ?0,K, R 0"0 @P  P0S: 1 `00 z0PP2B[* `0S 0S 0 P s([0S0C000t[p\L0@P0T:c}(K. H0/4!-,0P0t0 0000 -PLM`'ړ1뤒2rR@ nP TP dPtP vP qPX2T2@ L2H2y@@~"W1p 2P 2A11pPk p1`e0@SZPP P J1 EP> PQ`1tQ R dH1p< 10SZ  0pT T T T" T  TT 1T Fk0 >d0@@(?㟅@,4!  D0:|0 0l.$00S P"!P D0@-p0Q h@ .P0 a#2 B0L0R00PL0L OQ00B0H'P D4 L4T4X4 P-L   <4("4#6  CX -LQ 0S 0S Shةhu0 `4X -LJM2CP8@K O 08PKS7`K00[S/0[0SS/0[0S S  Q"[-K04"48#8 0 .K8KT"SH G<0 KXTX84 -L-KH $M0R 00S \:0-K0W K( p-L`!\P@+0R0S  W pW XW0S     0,($  phxWp,D4 L4T4X44 p-L^P@` !^p0S 00SS 00S S 0004"48#80   "10Q0S T@ph6W800S (ph-W0 ph'WD,4P P P !P($  W44445-0 CR 0R0 SG000 -PL$M !P   1Vf!1 VR10S PA !P B P !P" !P6 P  S S0  V00SV00S Kh~ Kh/"P   KL5D5T5<5$55555555x5555D6864@6 <x< -L ۙL0SPKPP |2P t"0 S00`\~)T`s"0@LK P KP 0BP0 P R 00S S S R  㒜PP@᨜PP0 芙L0!S V X wPPz2D @1P0 _@P #d1PP0SH1 X \P ᫜QLOl7x776 77777(8P8x8848Jx09 9l9 9X909`9DOl99999 :~:9:38!d:H:0::0:7:::p\8 <x<DJ48;8@JtOP <:POdOP ;J ;`;<0s<p 4 PJrGrF00 S 4 p@ @0S 400S0j@ 0D0 H0 P D0SD@H0S H:86Q0D0 @0@a@J rvP 0P0 뀑pǏH B8 "b0OPP @ p@4 }HPP `P`U<"0S H0S T0S#%#("0pÏ0S0S*P0SH20S/ 20S+2R&Q$ 30OTS (30S(3#<3#s(\30S\3 p3 f(3PQ /3qr P0S0S0S 30S 3P40SDpP ,'02 2 2 P H'P \ D<0s <V `2q0q8.q,q*q(K -LM0T ,0 X \$ d@P X70S,08.0 +(PH  0 S H$ PD  0 S D$ C>K0C0CLD `4 PD ,0X$:!P PpLp,0X$熗P|> x ㊚P d ㄚP T6@ D\$@@pLD  ( s@PH$R  \$/pLD PD $,0LD PD Wp/:`߯@@ۯP00T00S4 T2*P0#03V0S+ H40@0ïP@@ᾯPTT* &W 0S ,0X$&,0 L$ P$ FP CpL 0L4 P4 0[S]㕯P P0#03V0S @T 0:S+0p0@T$ :|/Px U P00S P:R V  R0305P1 : :a ` pPP$ L$ PW 0S V @@V 0S /xP@@@`@#0S}0#U0 @0 T(>E,U4;30>PE <0V' ,V -4L!M 0R,0 0S 00SS  0KDpKK 0p؜ ! 1 q ̟P <   <P 0S S A)X<0S L<0S@L0P8 0K0< 0P0CS< H!R ; qW, 3܋ ȁ  -; 00CS; gH\   ^ x[@T K  8K DK0 K40KpK P 00Sd40Sa80S^ o [0[[(,[ D0[@[$Č<4 4 "<, 0 K0 p @P`$,0( 0( ,00 K0KK4 80< 8K4 80<p@LDKX0 K40KpK@P`$DH儛P 7yG00S40S80S  [[0[`[ [P[[p[@[h1 [唠[lXᤀ[[[\`@p[D0[H[L P [T d4@1 D|<, ă $x q  1,(p,4Ɵ&<.  01*$t$%,.t0pOD@Po86D@ 00CS, Kq4L K1@P 05F-0[ [R~[Q}0[S o5 @ Ƞ,Ƞ0 4,40W50S le@T $ 00 t`'D  PP0S((0K  # YP`K` |ğt\hğ\plD  8$P,V 0t0t0S `,0K%PP4ȓ0S S ß,  ,0KP |, ) ,0KPPVIlI|PJt>TP|>=> J>>>E?h??0??XV???4V<lO?@<@4`@h@TVRVx@@ -LM<ϟ0 8?`44ϟ00 (ϟ(?@P00ϟ@P 0 , 00 8 T` Pp L PD D0S > 0RS 0S Q00-S ? t,K R>d&K\>0S D0S   80> 04 S< 0@ D00S0H0 bPN0SpNP00<0S<80S8`= `= *xp0<0 08 SLDPQ 00|SM P>;30S 730 S  <8h= /n@P000T  T T/00P<0S30 SPP<0S 30 S ,<0S  0S DQ;0S  ;;0S q|;P PHD0S ;0 P}Q  d X PjL 0 00S*  R'P;,0 :)00|S @ ?, ,0S  H*0S00@:: |, ,0S:< V40 d:0S,0,"]KP0S;0 (j0 SJdQiP0P0 2P0: S L)0S00H9  90S 9P90S S@9 00 L90S,0,\90Q,20hDy0E,@0S,0,\ -p X@`T;(0/S' 0S 80S0S#'T@K00/@0T0 P@ 0TKS#0S*$0S000\7 \PPX``u000 1 70S3 60S 60S+6R&Q$60OTS 70SD7#K07#60S7 >6 6U QH&0@VD X>$>4F  , HPP@",p60S,00#30#,A1p3P Z100 P@T@, HPK10S H840 S4 4 40,; TL00L0 Q N0S#CgT0K 0OT0 P@ $0S D0S H$0S 0TKS#0S*0@0 P@H0S 0S,00#3 ,0PP)0S, , T t T 0S,|,0@(S吃̣ `p0Sp@h30S000@00P 430S,00@,0P 0 L0S (CL 0HB20S. @20S D20S&,TK0S0S *p20S2#"2#<20Sl2 X2 H210S000#3 0>0PP 0 SGD!0@10S,00#3 ,'0PP (G40S0 0 40,<8~@0S@ y0Q]NQ11P @0SP@CAQ 0 00PtOl7LOdOxEPO=J@@PTlV9;|<r\MXOII@3lx<[ <P8L8@J@AADAl\8PpAtOxEETdO0T@(0RtD0Sq RQSp00Sf 4 0Rbv p\ X qY 0l h lK\0Kd0 `@ pK0\K@PdѠ 0"G?@0S,1 41 @ P10SX1<  #tQ01@P@@40S ,0S40,00S0!0S0S<8(K -\4LWMPpP` X@K8g c$4X  00KT P LP Sp!xPK#P P#xK 0P#xK P0x0[S xKX K00K/P pd 3 PH3 004`Q,,@#30P ^K E000S  <P,'0S2 _F`P( P.0S* 0S 0S  <㽎P(, y.@.@`PUVj1 0 <\xq 0040 @04 K0@ PPB0S (0K  # PL@HἋ@A@᷋00QS P 00S 00 E~PPㆊP  80K8 ,eT0<0 (K|P4VCAxAATJT8şşea0%Ҫp_K`pP`%VF% 0U0W00SOKD%0 \T B$%a@P詪4K, p pW^Z0=Ɍ@p ͌$@0S0DS*40KXK W(4p   p4  P`^Z0=i@ m⠻@P̶ 4 0< 8 LQ/KPA@PoK a0#Ga#?_K`<@#<pP<#Ld0n2ZYK 0nPژ2@"R D2SOKn"a X WOKa"aB2oKP,@P '/K 脻 0/K V땵P@P =a0!ש4a!ϩ_K`(<@<pP!Ld0ḩp1p0S0P dPPOK  H^ ( !LPH00S 00CS0 0  0 H@P W000(KlE\ATAtOPOdOJ$x]dE\pEETEE6G.A(GL0G@GPG`G <P -LMH@0s>0 Kͺp 0S(wt@ -LE%@P 00s9%@tO -LANKM @D+`ဖ᩺P#P ~K pG<@Pp8[/Sg@ ҖP K08SS/SK\MpG 0-0L0M0@S DPK0  0 PD0SH H 40}P] <K0JG -AMLM4 p@8 T2 0S2@ P 0S 0S4 00P0SxPP 0S`R0 S0/R0 S?]06 BnK`F@+ܕ(0K 4R/S@/04B+dѕუPIh!X0080 0\0 ,$ 0BnK1儑儡4D`FP t1p3\\ PPt 0P @,100CcSX108P 0p30$0, BNK0@D;P X0005P [N@PP@h00(K8JJhArrGGJ@JGP;TlXl HPGlAD -LM0, -PQ00`R0LMSpF ,20SB K"@,^KPP_PQPOK@D^K|0!屧Q`$}PPJ؁P PU  0?;t :;Pd!MP T(0KP@x0[SP^0x@KU @p PV`PT@pP 0w03T0S P  X0 SpP h00S`0  (KxO!4H@HDHTH <DP`HhHtH|HHHCP`O p-2L0PS 2|2 :t2 ph2 R`2`2PR L2P 0S0P} 20S MPt10S 11 :1@ @N1 @H1 @B1 @<1 510S1@1 (!0`h0PV P 5@P< 0@PP 0T.S@D0P00 !I:TP sP00S00  V 80 2: R00  00`p`OPH PP  Hi/IpP 0_ KJp  tK@ @P mV0[PS (`K,<4("4!<0& ]P ɻP@ P,P OP ỻP PtK   0(  0 ?V0[Sh00h0 h̠,<4Č("4!ČtPK <.̌@ h0 \ <̠Č8#Č ̌ 0p @@ x@P(K蜬T@,$HKJXKpJlKJK:'V|] -LM@Kp4 PzIpU 4PP|K 0}pq ([(00 .T RI Ph !T  @L`K5[d $!0 Spq  4I PEL0@S8 D0 5[T 70 #1 1`  0S00S 00 00CS000`( (8[\ ,` 5[d !!0 pq LK H P  L R w:Ru 3Rr 9\D ` V f 0D`P<0S@Y D@ R3:0R0*H 0pq 0@d 0 @R0  ,KHP 0pqw < dL 0PH 0pqe < 0P!80<P S l  0IP80@80`  5[\g0`V d 02P[ 0 S( RQS 4 0@  K@ HKHK0   P40`/00CS& 0=pq   0 `  0P 00S  0 `P@( 8[T,V  c(KL$Lۣe@L\L -LEM@K  $! @ (1  `Gp @P`KK0pq !:[31 R !GP !HR! P7[ሐK0O 0pqn hK8 G8Pfh0S@pKX0KpP7[UG011 0@1 A )Aq@ 0 p0@001 A 00CSp 00@1>AAN1  @@:[^ 0 , 7[ 0Kp 0Rpq hK8 3G8P !h R :R R ~X0K\ YZ i $(0XK`H0K  v !XpKXI WE0@T?!S<`K0pq A?K0S@0 @ p@ $!(1`0$(!0K%`0K0 @K p0pPq H@ e $!(1Lp`K0pq Hp $!(1J@KH0KQ`R c $(0n`@K   ! @0K  7[@T=0 0@ @1> Aqᄁ Wᣎ X  a$(0D`[ 0 S@ RQu @P@ P @@P@0$(!@ P K@KKKK0$(!@0` F00CS;0Jpq !(c@p`@ @0 $!(1@ p 0@1>A0 ,! !.pKpW ` $(0p`0@0@@0 @ :[pW0KYZ 0$S(KL$Lۣe@L\LMЍ -000,0P L 0 0&3V]<L -4LDMppT0@-S@XwP00 ;4vpB pP> P. Np p 8p@ }zwT\@KiX0 0X0 !d!T1P*ܱ0K *10S 00#40Sj@(K@! {F'P0S `ㆶX ザ@ 3'p~0S @ ToJ't0p@]L:|LLLLdgLLLMMM 3 M4M\MMЍ -L +}UXN< -L0GM@K0$<1 4q41`P oP !p0 0bAS`GK0 A A0 1P  GK00 A0  A0K PPl -Pd P\ uRG>K 0C 0C8 #U:@,D,tM0 Nd -LM@pPg u`P 0S nS0oS` =*PP00 @uP @Q  0U0P P00 00 X 0000X  "U 0 00 ,KC, ?R0S@ps0"S4 0@P -LMp`5rP@( P(K,K  0mP(0SzK$KMЍ 0x@-PQ @p`0N S3. P P 0 CS @ Tp@-PQ @` Q 0 CS @ Tp -L MPa0KF00K!PU`V\2P`@R0 @(K^(,<4("4!<@;S0 @<0@0 @ 0S0SP `0/  @a0P0@ (K3@0(,<4("4!< 0S 0R@P0 R 0b 0O? š 1>A\0@ (K@0(,<4("4!< 0S 0R@P0S0S* 0KppP`P0`0@0@p P`$K Pp-L@P6 PQ5 0R14 40 0R+((P P% Q# 6P ,,P`@PP Q 'P 808PS <<倕P`@ Upp -\LMP` #p 00P  0]" 0@T K -LM0 ̠K" K -LM` 0K'4p00BP0@ T,Q a0"<4!4"\P ,KA0pW,00,0  50 R, (,0 " R:(K -LM@   @ K@ K00P' 0!K -LM`P @pp|O o ሳpoO tP 10151m;`0p\O0 T`  .pNO  0QoWX4X`XX -L M@T<Khb@D0 .@KX -@̠Lp`.0'.TP! .U.S Ut! 000t0 00000s03-T0S _T _TX0#0`@T=X -L M0@SHKh  P @L0i/BKY0Y -`0 MLȠ ,Ƞ0p7O KhBtDYhY -`0 MLȠ ,Ƞ0ɘpO Kh#txYY -LAMJ_K, ,KOK᪺rp`P#0S @ =rP @T T m R 0SR( K0ACp <fr`V440 JKp, ⿸(K+OY p-40L@P(lH,jH0hH`@<`cH V@ph]Hp -\LP2KpP`N 00 @0 0@4 40 0040404 00 4 ( 0$ P` 0$  nP(# ,P nP, 0P nP08Q 8JP< <8 UPU@ @P40040`8 -LM, pP BR00S ,G0n,0tR0S (G0n(0P<8S 00`<S$0 00S`A<G8< 0V 0V^18SYLHpa@<G01800Aa@<G, 0188zJP<@ 0!ط0<8 <.ꅁ`<G,0@188^JP<$ <8 德< 8 0!a@80S1S 800CJP< 0!硷PU `W40040$npY\`Y -LM@P4K 10S  7 KSp0 0 m 0SD 0S  !4@K$ $`K PpP 0S 1pt* @T `P$4pK@0PS @ UT $1 1P @F`40(K  p (PI`P ( (F   F@4pK0S  F@ T<0 80Q KZ Z Pp 200\.P+D(8%," php|H8h[<H -L Mp@p P 84p, (2(?J@P –Q0Ka( 000 0 2Kp 0S  L P 2[ p{Kl`P q#0S @A0S  ͨp^K @0S0(K0(0 2 PU00@0 r@ᕩ0"0@8K tH0s TXcN$Kp[r|[[([x [[[[\ \ -L M`*324 PB2 @rP0"0p P*J`P$国0"ߖpP*,0``Sp! `"ӖpP0*,@P``*0 pPv*@`P"庖pPm*``p(0Sj !宖pP0`*(@P``0 pPQ*@`Pl!啖pP``0p0H:E1=U80 80S ,1 A0 !zpPp``+*P U90 sP @`P.0 sP @`P#0 sP @`h MpP 5:L P(K],\8\h\|\x\\O\\\\ ] p-0LM0@S`* ZKPE*WP *㟃 Px%*pNhP  K@*㏃ PD%*<>JK@D_>Kp]]@]h]t]] 0-LMA0SI :v'K@0P0040 0R  0RP ]#00@Tl@t00S0@ n<@,A  80P& 808Q 1 0S{S0000S ? 0S  0#S ,Kx00P 0@T 0 ᔭq;p` \, KaDad_p`@P@ b2P@@@  q @F880S  HBp$@,(0K* #P P忣p@0<0 P尣p@ 堣p Xp  (p|  ph  <pP kd@<408Q 000[(K@,|8@04b$b:0b@K" 0@ 0 1d [P {@ H$H08#8d K#d[0c0K0d`K\0K 0 [0K0dKK6K5K5KX T % @ @H$H Ġ$Č Ƞ,Ƞ(K 0K$t0;x`,$3KC<  2K0K2K \P  0@K   0(K!x0K`t0x@tpxPpKP0 Ԛ@K P0K 0 0|0 xp tP  dp@`7 (KLj p-LM0 0 p@G7` 0K`p87TPP0<0@ `Ԛp(7 0@Kp\jtj!j -LTMPnpK02 ႂ `PP 0S 7tlP<@K o LP @m6@0 KjjlB j p-LM(R0 0 @0 KœPJ61[S1[SQ @K0 ᮓP360 塓P&6pt0h$ K┓P6Dg $0$0@$4 0S$Z 0@(@0!,@0D0D0,`K, (  mPs6@0< 0, Q0( <00 VP\6x)0 hIP`!KpqB@jkpBHkyBtkfB@kkLgBk ?wBlvB Dl -H1LM@Po., N/,ҡ , j0S9 1 "860 006. 05WS Po0 P% 0` ,U@@p@  Pd0` ,U  @pWNY, 0 @ 0·p@TlN7 -L$M`Pp@K2@00B1S^3\ c+, 废,  nX  0K0ާt Wp00d @pp 0H`p P*P`SU ,KC(K+\l -LMpZ@`P & p. P!P`0`01:(@T anP0  0-Kgt -0K؀p`p P *P` W@:Z  ǀp(Kplhl -LDM0h PD)U,EhQ ,yU`  U 5%1 @ pX`Kd@ \ ` 0>p P!$W4N dSSd 0A BS@ AS?IS6 LS:3fS5 XS eS26lS) tS-#T d p Bd '3 0s \ 0 QQt0:p@p0` p @@@\3ho 0 ST(38 0T00w0S 2 0WpWڔR 20C Wbp @YX J SQD IQ LQ0 BQaLfQS XQ[JlQ tQVh 0Q 0Kc0哦 "0  4KX4,<4("4!!<@5 8KG8,<4("4!!< *K8"[04"48#8T!@@!8!00$!$S!0'pP$d0`:\Z`P` pP`P`dZxY `0qpP`P`Y)㚟(K}tlO=lllmDmhmxCm`ffmH00CS0<0A004 U100CS@ 0@00C,  @p0P@ 6 Pn P \0uP 00S Pp(K D\ <P` <̅ЅLwh -LMP0@ T T.YpP- 弐0帠S0@0*@P`P 0S  0~  0p3PPP0T@ <(-0 CR 0R0 S00 -@0LP`rPe`Z !`0VhE`c0SUJ L0SF I0S\\@U`T x]P 0`!Sb/*0S@,0@00US80800US00`zUPX*\00S` lP { U 0@0^S00\P0S <"x< -LLrLLL`~@0S 00CS00PӤ0GGPuG  Q/0 Q@L00  P00CS0^A0T0V S0`0CS@ 0 L!0A800 S0!00 U`!00000 +0S0#3 PP 0S0`00h` 0S0`00^V @V00 00 0 <0 ` < <`4wh((  -3LM, 0 0 S@`TA3P, `3@, P00T$00 R0 Ch"000S 00CS00Ӥ0EoEx0S0  CP 0S0@ P X R/ڈa刡0 RP\00" PXd00CS0J@A00B o?0P0CS 0P00^ X00p 00S0#3 [PP !sW d0 00l0 pD0 00@00S <00SWpGp <`h(wx -L M4 pRŸP2 0A`00 p30!00P PXP1 dP00CS0W|A0^0O L00CS0  00CS@ 0 "005"0 0Pp0L0| 0P:Ad"0S\ PPᗆ$2 , Q#0 Q@L00 P100CS0A00CS@ 0!0e0 0P0p,00Cs,0 @00p 0 SD R/ Qa0 R@L00f P00CS0+@0*0# V0@0CS 0x@00P0T@ ?H0 p000%S!S "`"hЅ8tw -"LM00 S2 100 r 0 R R$K!P\ 0!S 00ZPT`1$ L1$0 S8u, Q. Q q0K00`Pa00CS0.@00& &0@0CS`0@00h0H0$0 $ 00$  Q000 =$8"`"wh -0LMP@( pX 0@T@@T@ET P`P ` 0S  0i  0pP  0T@0(L -2L 2ŸP pqb匢倒刂00 QP0@.TR 'Tf $TL  T T%T,Te +Tp 9T0T1*B?T@ ^T ;TdU!0   r 0 R00B S   1@s^T-T`Pt 0^T-T00PS@  1@s 9S6 .TPP00S. /TBPP) 0T00S 0000XPPS 0;T0 0 0\ P00wPP U(00S(8P= 0X< -0 L`pP0 @000 00 ,S;S;S "PD 0S0S0 000S 0 0 p<  -Lϟ @ t 000 Tpo iT  &WT HT ET !T =Tb TGTbQTt VT^ PT@eT cTI |aT gTP rT mT kT9 dpT UnTvT< tT *xT P:zTPD0 nR pR lR 0P0P00PP =  Q Z,>0S t>0d>PuP0 nR pR lR 0P0P00PP 8=  Q /=0S ==PK==]PAP0 nR pR lR 0P0P00PP h<  Q <0Sj <<VP,0 0SS0|<0S <0S* t<0S r ;000 <@P P0 nR pR lR 0P0P00PP 8;  Q ;P RPPP0S!SL + P0S0 0S @P ; ::;0S0 re X:000_ P 0!S8 ! P0 nR pR lR 0P0P00P\ 9  Q P0S+ O W9`V :PcGTPPgTPZVTP P0 nR pR lR 0P0P00P\ 8  Q  P(000)90SP0 nR pR lR 0P0P00PP 8  Q ) 80SP0 nR pR lR 0P0P00PP x7  Q x'00cS0 d'0S XX`'P0S000 nR pR lR 0P0P00PP 6  Q 60S @7@b(7PP\0 nR pR lR 0P0P00PP 5  Q `D60S 66P~ %0h&@ 0R P0 nR pR lR 0P0P00PP 45  Q .5SK5ePI 0 nR pR lR 0000P 4  Q $5 55:PT`pP40Sc @Ti40SeV`pT P0 nR pR lR 0P0P00PP x3  Q 30S. s3P( 0 nR pR lR 0000P 2  Q d3 \3H3P 0 nR pR lR 0000P 2  Q h2 220SP0 nR pR lR 0P0P00PP x1  Q ?10S |1 Rt1 d110S 0 nR pR lR00P 0  Q L10S d10SqT] P7q 0000 10S1  1 j@P# P0 nR pR lR:0P0P020P =&&ȇ\"<@,t"x"`h"""$=t ,X|"$@0 ld<P 40  Q 00S 0S0!S+M0S0S @0P 00P 0 @(q0Q`0gS  S &:00C S#pS rS`0`0`0`0 1@s|P000`00V SV 00 S20S< p,2  1 0 S 0 Sl lRV000x2@  z@P00CS0PB00H ERT P pe 3 @ #00CS0(C0h0VLL0P"P3d#0 S0000W0#00#0#00# 00 0nS pS lS0 00 00 0 0\ 3PP0 nR pR lR 0P0P00PP T4  Q 40S 444 oj4PD|P40S$8pW40SD/P0 nR pR lR 0P0P00PP x5  Q \50S &50SPhr0 nR pR lR 0P0P00PP ,6  Q /PTRpqW QWPl6 P|60 r 6000`P8 60S6 R6 6  6BP&0 nR pR lR 0P0P00PP d7  Q 0S0!S+GK0S0S`7WT7 70~P8(0P00 0S 80SqWP@80S^0 nR pR lR00P 8  Q I 8 8 P010C0S  &I1@s P00$ 0 nR pR lR 0000P 9  Q Y9)00Q0 mP0 nR pR lR 0P0P00PQ 0:  Q .L:X 0S<:d:'Mp:0SPEP0 nR pR lR 0P0P00PQ :  Q  \;:;ⷦ$;0S0 08; @; &P X; PPx P -LtM d ,W\e\5\\\\u\U@sP xP pP00 @ T0 ]$9p0 10 00b0 0S 000-S 0@S@ʜ000 00C0 wxTP@KݣP0: S  0  0vP 5nnnnan@P q2b#000S 000S 0PT30S 000!S 0+HI0S 4000SC 20SsRbT0S ࢟"P kuPB-"0S& 4"0S"l420S  l2Rhd2 0L20SD"0`004"0@0v"000 S 10S!@0`00}@00@P @P  @Pt t t$ G400CS:0 2`2 0hQ0 QP\00  P5 0l0CPdS 0T"0K@0,  2 0P0@ 0S0!`V&0 VP\00R  P00CS080t0CPlS 0 \!0 H001 00@ 0 0c SC R/`p0 RP\00  PN00CS0@00 e0P0CS 0PP00T(0 00@(K`hw -LM  @$" (2 8P  Ld0S  0@_K  0 B AP$" b  ," (2S  S ;#rPU0 U@L00  P; 0ß0CS@ 0 h0gT#00ß0S 0 w K 0P 8"RpW$0 W@L00g  P00CS0U0pŸ0CS@ 0 X0#D"0 Ÿ0S 0< BwK`0S 2S ,\    ?K夳Pk  "向0pf 0 Q2 /hQ`0 Q@L00  PF<00CS0AA009 ]60@0CS 0@00LW "1 $ mp00S 0T@ v HvQ"(K(`hwD -L M0P䑟0C0 4 , 0Q000< 400pP^A mPX|0`00pP`P UDA  MPP!00CS0:A0F02 /V00CS0  040 P,00,0 p@0d 0b, RZPP  P(K`h<L -L0  0%Su0 SqB 0S  Q.0 QP\00  PB0@CT@xR00 Y0<0CSP 000G0  Q@ 0S.@D/\Q)0 S0 @!!0S 0S0`00 tQP d!000S SPFq@a$@00 S R0 a䀟0 RP\00pP00CS0#@0[0 0P0CSp0XP0H0$ H0@00 wh$ < <` -@p@@0LP` U0@ P0 R00R00 10B0S F1@s @@ gR0000 X -`吀L p Q0@P @T00Cs0,0 (0000 0&&0&& -2LM0s22080  20sgxB0Sl2  i`"0X0 @0A0 S6Ddd 000  0' 0 00 0 00L000 000 000 0000 0 00   00#0\L 1   @Bp4`K07# @D0 0C0n##0 C0?^NPnʬ00Sxt0x@C d0 \0T800@ \P00 (K&0&& `&$h -PpL0` Sd0 0@P 0 P 0 5$ 0 5$0 % 00=(@@&&&wMЍ; -/L@p P0S @P :0/S @P:0/S -LtM  UP  40CSP`4``4``4@  +P. <0S P$ 0hc %tP0$ `j @3/Q@ 0T/S/$$0a0pSp 嶹 ᪟"00pKCp4S :S0: S0S HP0S H0d弥H0 S 0S 0S 0 {H00: S/ h0: S 0: S  H: S  S<  S S  SC  SF*q3)D!0S t0ShF 60S P/(!0: S' !0寔 0S q3 0S q3 Q -QP PP ]0S Pݚ(KH\&&  Dl -LM`,8/(0$#$Sp@1 04RP" LP PP HP*iP fP$pP2@ rP p! 0p1  pA p" 00@ qn00L"@8"mp,2P@eT20Sp 10S!00p u10S 1SpZ 0pe1DN1a IQ@+A P !#h%T+t\P 0. 00 00000Kp@0S  #0: S$ Y6t00S00S !  KK1: S<00S800S  먙 :̉&H& 0-,@,PL(   <\ -0 L8ٍP A0S x&̊ -0Q:#:0 0L`p(n,0 0@4n@xPP 0(wPW   TPP 0S wP0<0W ţPP |wP0W0 X况LXyPP 0-SX0S $wP&؊ Q-L@ X\PP@ 厹P 4(w$0P hq&  Q-L@ T:PL<{}P 4(cw$0P hP&   0-LMPAK@A jp 0K U04B d P XP9w A^KPE8ᄒP,(0PHK0,&<  -LM0D0S ,P  D0SHPⵘ gp !HRB30S 30S3 x#30S 00CS00@Ӥ0**@0S t0;04PtXQ ѱPs( 040 0@ j,0, 4(0 $@ i4K uP(sK4PL  - L⦳輗 -LMK 1P[ [4 0 S0S (0SX -MLM8%pQ y;dPP50S s`640S /iP 40S  K P$ 40S RJNK`@DdK@@DK 0X P (40S es`40S 4[S /zP `+;+;3 3`V KJ3@T Vy)Kd!KP0D#:  SK RP Pប`)KD cX20S  sK  0$`x AfP p20Shr`[K(PEPE9K) 4@P `?V00S 10S 0S  墲0S`` K DK0$P Vt10S d劲``d0S X1 R D0S0 @,00@ 0$@4 ( V ^ x P V-00S)r%V00S D0)KS,0D0 D K d00S<0@K08K0 9K4VS 2`(KL0@ؗlD4P(, -ML M99 , 0igS0,0 xY,@ 0P P( 00L]lP 0L( 0 0uS0nS0 0, 0,@GlP BlP0L8 8 0@KT8 :{GP, 3 "P 0@K dP`@p@T k PP㝓,01, c, ,0SU 0 0 !0@S07CK 7A 0@pK0g帗D8 A 0\ H( `8 dTL STu 1T9T-LT NTYaT- VT}bT* cTnTI gT4 fT.hTz lTz2rTp oT? qTrHtTY vTm_L lT :0@DPH eSbF,K /,00SX l600>\&G T9 P( I< 0 00(00 >%P;0075\+9 P 3H( 5.: 0E,p 00.S.0@0K`8,0 , g b90,0 0x 0 0E000 ?H%000!P P D(5P嬮p@P5@XIP 4@0H8S 40TS4T 0HST 00 R|š$0s400s030 P CK.KI B BI`X( L(00 @0-S 0SH8SCC000S40C S;         l30S|{ 0S.P,  @KjP @KX$#0K P *XHPH00: S 0 JH00: S S0S2P" 8XH0S d"0SP d(H8S)0S @+8!0S  +P10SP @pK !0pWK P: V`<H!0S t0S<10S  H0t\0l10  P8 P P`0S00S 0S P |0SoV`ػPPX00S MDH84<l@XX^E0PEU\EPE@- 0S  00 0 0cRÌ`@0  0"0Q1 P0 0S+*ҋ, -0L0S*, -`QLp@00SP(0^ ^0 01^ 4# # !^#$""1^"4##!^#$""1^"4##^#! ! !@D!$""1"#T T $0@T0 01 #*, 0 "Q p-L`P@@Tp -pLAM0`, . 0J/K(1 |00R0@KJ_K   Pf@0    pd`0,1((K 0@-@P $^ 0 SΎ809P  L0  ( , 0 8 < lPP0P@-@ $P Q < ^ 018 0C0,0<8 0 Rp-PL@4 0@Q1S``.Pp(0 `S00`(0,0S0 ,00(PpUE20Pe$00E`S0,0$0p040$Pphp`9X90%0  -@PL $Q ,0S 4Q00$,0$0P $P 00  00 0@-@P \00^ ^l\P:0 -LMpPL $`VI 0S<0S0S < 80 0(K08< 80080< #4 B80< <0 S0 h0 hh0  `h0S @ 0 0P 0@P0P $P 0 S<0s3 -P00@Q0SLT$PUQ (\N ,0SK 0(! `P 4P $ 0(P0,p .dLS.Q :%<,0Q P0b0bS.00 L P0l0S.0b0S>0Wl0 $0 #4 d4p$`0% -$@L40pS` $P0 (P47 (Q$ 02,(000( PcU4:b c (0,00 0e0`U`1`!  cPU 4e c(0,00P00( 0S00, (00PR:0,0 -pPL`P4 $@T1 0S 0 S+0 S  > ;0P P 00( 4Ubc(0,0e ~c,P0 0 -L0MPP  $PU 0S 0S0S0 S00D < , 0H0 8p<`@ 0S񟗗%H3H3H3H3H3H3H3H3|%&'''L(t%)(,,$../$00 1H3%h%\%< y< !  ;< 0S  0  Z  0RJv`V0'Z_P0S'r0$ 0SH͟`F 30 `  0 0p8Z  0RJv`V'4<'<,4<0`80 00p 0S < H  D00<`8p k 080P\ 0S  07s`0Z  0RJv`V 0 S'''' 0 0T0 0+X0 00LP 0; 000!q`F<07s` Z } 0RJv`V@˟("('8,Rc`0@ 0p@0Sg DQ01 S@1 @!T`  Hgb@0D H0d d dD H @0Z M 0RJv` V"'5t  0 0Q\0`d 'w`FR0 0h Z + 0RJv`Vʟ00 0'hq`Fh\0Q* h00h0S S.0L T0l T/p l0PZP< 00<0h0T03L@ C 01QZ  0RJv`P Z  0RJv`V:7q 0`ah UP  Z  0RJv`V:^`a7q< 6 0n00'q`F(P   Z  0RJv`V:71a q`AZ  0RJv`V:71a  s`AL 0S \7 000 h0 0h P*d `0h ^L x:0S! S>/΅T 0 l@L0T l0p` 0P< Kl0`P00X0X 0  p0d P0< 0 h6 05T030CL01 P0 Z . 0QJv`S4  03 @C403<1 R0 Z  0RJv`7|`lS``@ 7p0  0@ L% 0H000HQ Z 0RJv`V:1H0C07q@ `a @ 00X030CP01 P0 Z 0QJv`8 03 @C803<1 R0 Z 0RJv`7|`l@``7p'0H00D 0HQ Z 0RJv`V: 1H0C07qD `a D @,0DD 00`R00< jD Rr @D0 bSH @c 0 bR a(00b@40bRD@0 Q10l@0D0H0lD0 0 R0@0HS 0L H DQC @0H AD 0H 010S4  Z 3 0RJv`V@0Dl00@0@0Q00 H0 a8'4<,'<4 <S D@  00D`@ p0 0< H00D(08pS<`0S 0@P @P0< 09,0@ pc`b0 00@ 0@0 0RV0 f q8 QS@00<`P  \ 00R40 <P<  < <(K,G-|M⠀P00\ 0 S |@0 2R02BQ0`\ @00S@T@ \0@ @@@'@\ 00S@T 0 sJ QR0Q0P0S< # 000 Q | 0S4Q 0$A\0P P 3ß(0,  (,0 3ß(0,00S0!Tp!p1' PP#0 \00LS`$P08 8  8 800@0i^040@(,Ŏ0@`@0ià0%3l l 041 R @0@# R@0B00|0 02S0C8#(@  P P@@a800@|0T"C$ \ YPi0 \00cSPR :  0<Q00SA 0P0 0pa 0bC1 0wY $ 0S0`4 @8914 @00Q  0A0000S@010p|ЍƔB  0`ᄕMЍs -0LP00S x0xP pp00l h0hH0P DT00P'<00S0  4\T<XК -L M0@S :P  K0V R0K4 0-L M0@SP P K08 R U0 ځ K0D -L@Mp` 36@_P@`L P H W0p&oS0000\&gS0000H&mS00004&fS000gU) PU HU LUAXU fU RU:uUrUhU% oU1w0ES- P@ L@ h50S ``V1@*_@0TS0F0H@ ` %ApP5` 0bSP0SH00 HQNYX00HD D0 4PU5 080 000C0S004K 8@ᕺ0S@8 ;400S  < X @ 0@ o8K0K, KsP 8 ;0<0 ,00X @ ,0 \3@T/ @000C0Sd4KP ݣPP\"00Y0S T ؄400S 0< TP X0 @ 4/|P\ < XP + Ӏ20S P:+`P@.+@P <  p0@ <0  `< @ < @   `P  p d mt40C S*@@@@@@@@@@@@@P0S   0SN Gp 0S  l>?HQd R:Z <0S00D0 0S X0PSTH0\ { D0cc 0S D0c0@ <0hP LQ X RH00 X0c0,  D0>xP hlbpR@P0S @먙X`\T:TdMЍp@-`0@S8 <0S9\6 00S0C;ౣ;0 `\'P <3 ß0#@P0"0 PY@0,0K2D0 T` Pp /&lKA&&0TŸ0D2&0S \{F~KpGL2pG0\Fp@P 0FKH`GH @ PG D0 0fCF@PV 0Q# 0$@P`t %p$0R0C0= `A   x4st| @00000%0 00 "x$rt4s xt$xt%000400S (Kt̉,&%l&T؉&+hc + Llx\d&ȊDH\ -ML Mp`@P ٖAK @@ 0%WV 0S:0S:B@;&P 0A.K: SD0P B< B4AK AA K4d&t( -LM0  -424 0`40L  8 ;;S0 0S,0S) R'PP!<0Si & @b80 TPp<00PPPlA 080P<  80K 0SF0SC8 Z@0@0p0 8;;@TPS@ P1 \.U+T) P$80 < R B+ౢ+ \b 00SOQ8 0 @ H& @0Tp0000 0pl&0 -LM@pQv 0 t0 @0 P `0O?  4D;$+4 0A40 4P 00SO0 @/8/늟KP 3U,(  80@ e !UX0  P 0S0S(KDl& 0 0 0& 0-h0L0S XX 0 0CAP T@D*@0000$$' -@LP00p M0-LM0@0P0b S#00CS<_P_h___#0#00# K0蔞| 0-\0L @?PBD000S0S P 0'$ -LR,M00Q P 02ZY 0L Q OTS2p8\0@/  0@ /0@D @ /TS P20S 0@@ _ 0 , 0 Po 0 @ ?< 80 <0,  ,@8< 1! 5 @0O TL H 40 0@ 9 S70DPK` P `LKpÏV@NUL@10SF 0@40  (@j1K `vp0CXh Tx 0Cp`0( P8 zB0\œ\00 S 0 0 R \00O008(LRLHL8 0C 0PLH@0S00ZY 03 LP@0, 00YP{X P#L00\%0R0 0S @0 @0 0S @0@t00 0  XT(0(p 0( `08DHS000(KL\l&(T,&(&Ѝ&& -LM<0@S0<000@50\%5R000 @|5`0\: S SU SX5^00(Ŗ /RHQE\ 5^h0S< 0 74^ JKROK,JKKOFK0 J?K45 0B?>FoKRNK@DX T K< 8 4@D`E D @e 0 X%0H@RP5 (@ \5DS8% L0/T ?408040#0\P0(00s03t0p  0S. @0TS>@0` 0T0dL`DcP/0\%00RP%O0 @PEO0@僭Ÿ0 P0%(0/p@0S ( D050 X05 HH08040 \5SU\0?0 0 A1 0<  0j0C V 0 V  V00000002@ @2P0\%2R< (8 pt20\%2R(00s03t0p  0S p00<00820\%@2Rp껐 20\%2RTtT10K0\%1R00d0X0I10\%1R00000K 0$@10\%1R000D0d10\%l1R00000K(0,@810\%@1R000@010\%1R00 000K004@00\%0R00$0H000\%40R0O0 @0O0@00\%40R4h04O0@tt0 0@0 0+F60p(K0&d&l& &U TX&& -L MW @RS? 60S 0Sop P60SqFp s00Fp s000 ST6@P6 H6H)P4f0d1(60S 50S 60S ?SJE0SM 0SH b 0SC , 0S>  O080B R OT dR b \ 0#K`P``0H`"d0B !} 07/R0O?0@l&@@c0 07 0q<B K2@岸<40S 0;0 @d4 Q PL30ST 30,OPso/1"p@0@_004@xGp8/3`"<KP@  ha$C0S T[X@@T p0C0S $LI@T a2@@2@2@20S lR@園004 020S- <" 0S&P`PY`/1"@ 0Od B=A 0ZPap ,0 X1倁0qSl1  `1@01;@0 ,0TQ@1@.0@L*(p1%P10S+ 00SL 410S00S(-P KsP " (0K |P $00S S(K,&T&̎؎$(&h+$l&  &%Ddȏ&X&(d&`&tPH$&&%& &&$r p-L@M P`K 0S 0S  x -L`pD"DDDRD0@0[dS3 YSM NSODbS cSJnS= fS& mSB&pS yS=7!0 0 00" 0 1P(xt!00!000X >0SD1 80 000000001 ~p00PV=P@eQ=00SK=H=TQ  0e@DTPl0P&T&`&@,$&,&hh%&+:' -L M`4 pP,  0l"`Ud"0@0@Q P 0,20SM ŧ0 }4 0 u,0S  ~P0 a!0 0S1 0 @010M0x!`p1l0 @R Q @e 10S 傧 0 : @P c@P000 .`0 R0000  0S0S R0S0S p 00 @0@P `JZ0(Kģt,&4&&|h@&& -LMp-0 O !S0`¯  ï^ 0Po xΟ1>0 20 P`ZY 0p>,0W4HTLd@D͟p 1>0 2 P0 `XWD lKI,>- 0,0Kp=D0 h=h͟d=  0x@mɯ P0pO`xp.0 0 ` /l} 0O0̟\% R`` p 0x0OWV0 @ / l,0S< `L0S8 DlP| K0@S\0/ 00@1>  0S P` p0@00K0@ aP0 @ `K`p` p  Bp p 0@`  @0p0  !AP @  ˟0 t p 0 e:ZY P ,K0\%0:0 pWFʟ R(0 ?"P!Xl 9"P0S 0 $ R(p4` *"P   $"P0S 00   P   4,)0\5S ,G 6009ID000PzDO@? O/ i0y\Ő@ \00T"S\45S:05S:  R8\ 0S 0 0S0s H0S Hh\\x0S \@4P  h0\%40RO0 @O0@70,hǟ`|` \u W|00 0B?5QpP tG0SO S C| Bt0R 1!(0p P`@ W00S0  0SP %0S 5W1(0/1p ^ @@|`@tpBP1!X0 PW00S0  0S $0S 4W1X0/1@TP Pd 0@ 000S00S 3P XV T3PDD <$00  RDDc0\5S 00   0S 0 00  e 00  pß'603@P00lKT P \Kl404Oa#p\` Xp \%Rh0O0STG 2Rh0@_@00lB  P 0S P. Rb(r0\5S\0h0\0K0@ `  O00P@  E @ 1 Ÿ0\5S ,E0@t`K`pt` pp tp WpPX10 @P!00`0/Rr Q pnYZj x ?SR@P@TP0` @0 00MT UJ  -`P1 _ &d(&X&0&T,&%U 0Tt$$|%%|L$ %&&ؑTl@@H$|tȑ` &l&d+0U pT唠! i ;FL00`0K@  |0@ x@ ,0Ta0 (K p-D0 ML08, `L0$ 0`%PKpl& -LDMl@KD F0 0p 0 0,0K0D0 $ U0TD`P T@ PP M0lKS  0@P0 g0Rp0,0Z@P0 (K&l&d+d p-D0 ML08, `L0$ 0`s%PKpl& -LM4 萟, . Y,0PP0,0 0S \  p@0U PUT0 R 0S  0`pHX0,0 ,(K&@-0 ,,0PQQ0P0 -UML M00CS@d 8dT PP% @ <P 0P/  P ş 0PQ c Pe\0:0090?aJ [tU pE l5l`KD D 0K1bt5 V>K0C0Cx5 $5A| %5 0,0K5D0 [oK000p00 0S S$< 0-;;S< @00 x0k0S <0ttx% 0 <0\Tx% 0p LD0SD 0?0?0 00SLP0 \5 S0@0 @0@0@,oD0\5 S33( K)ɠ(K 0 \5 S 0@d1 `A P0@\1 XA 0\5 S,0(0,0p0t@P( R01 0#\: R 0\5 S0X000@|5 R0T0 P@ lK0L0 H@ tD" XT: 200\\"2 P0p00P`G 0SD 0ST> st: 0  P$`lP,  O00C0P ?00090@!0C0@0 @$P0PFtX:0 P00a0 @ 0S0S P0@0PU:F(K訒l@̒ $'xd+l&T@%`D,&ĉPH\ -,0LM 0 07#Pl -<0LM000 0@$#PhC -MLM 0 ,|@T( BP#0@ST (m00P 8)  089 0S_ (\00lP88 RP(O0JK01 0*1K$0,)1K60)Q[S @ AP 8 400P`U)UK7(K P8A7(K` 1A00 @0@PfB00C0 BP$P089  8) 0S0Se0,01 0pJK)1K*K)1[` 00`"0 00 0RV0`(K00 0@0@00C0(0K B(KPP@T) PRAP0@ 0$@0SW %5P8) 8) J9AP ş MB 0 S \ş ?P50@ 0$@0 $ş /5(K K@P8) 8) 0 0@0@P 00C0890S   R*0.S'0S#0S R@$B00P88 8) 0.S #000P89089 0 0@0@0 @PR0Sß5 10128:scP;00CS񟗱ر  0S0S $ß0{P0S0S0S  0S"0SŸ 0ZPP @0: S00S000  0 - 0S)0S&~KpG pG@0 00RnK!@`FP `F 000!*x10S G<X PP7 0S0S00@@0S 000P89089 00C0 0hU8008 (K\MȓH\ LdĔԔd& l&T,&%,8l| -1 0 B!1L S|!000PPQG  0  40S?.0S9 `00p !0S  0V`SP P 0@ 0$@00C0=00P @ 00-J 0Z*0 $'&d+' -,0LM 0 04 P' -LM4, `: P , -1 >p0S:  0S 0S @00CT RX  0:0D 0@, 0@P`HX,&&& -LHMl@KD @1! 0,0K1pD0 j0!Pop [VSUQTP P` ] 00CS?XPȹPԹ$O Q  A 40S 0S00 R# @ 0\5S00  00S     0|0@P`d@p 00Xp40 ,0W 0 (Kd+ܺH$\ll&T| & 0-80 ML, (000@PK0Т& -ML__M>Kp0(HCHHK \1\?X>0S`XKPayX0S$5S(N0S %0S P  K0P! $5 KPXQZ$UUȭUTURʴQQ$PE``0P3  BaB00B $"11000 0S 8 $U.M0S P& 0S  $QPEP`0\3  BQ@5 B0$   B110L 000< K P!Lq QV0hK  B0@ hKl0K0K0Kq>8T0 20 P`ZY\: HK ND 0, <:<*d: "XKLaZ`0KO Hat,0 0 Po/0 hK\aɟ0 S 3 S(K L0XKL!OL8<KHS."KL` `XKTa`P`KLV` U8K=CHK\AhK0 0ta `,00CV8KD!Xa$5S88p  $  HK\A(0, S0Q (0Q,`,`0\58S K\x0  R0R0  !HK\A x00Rx x00Qt0Q04hK  =0S\08Kl!=L5XKsGCLQ0aXKtO a3 Po 00CS  000 0ǟ0C R 0\0R\0000 P20 Y  0tfK0 0ZKt^@T6 LVR\0R\0000 20 00CP 0hKnFKP n5 1> 0 S2$ ER`0K@5ARK!! `0 0(K(K1 0K1 ! 1!2(K1 0 0`8 0iS^000$5S*87l  0@00^$0 d0R$0`0KU0018a^! BB.A.A BS8K!080ïPHK@A ThKDa V `$5S+l0h P0@` Q $%Q  !0000SPp0PQ $%Q  !000$ P0K0OP0 L@ `0K K0O`0 \@ X0K `0OX0 T@ h0K 0Oh0 d@ L3L 2%P MK P0 0KPP K\ :(K\p!rP K P HKp!\}:2 a0S K\  M0HKS\0\A8K! Q0 SK\hK\010 0 0 S5 1(K-BP`05" HK\A40 SK\K\010 0S58KLL/1 KH!"@(K-B0@ 0P@`UVHKdAZXK\QψoXKag%,& d(@TTh& T| &%ȣU 0&d+l&K\$0,PS(K\!K`0@ 0!S`0hK10 0 0 S1 1(K-BP`05 0@S`0K10 0S5KLL/1 KH!"@(K-B0@ @0P@`UVHK`AZ0\QhKS\0\at0 SK\\0 8Kl!|P K P HK\AQ0SK\\00S\08Kl!: 2 KL0`@P``K,0LPtL2@@L5?^s h!h`KP% CP MKb P 2 @@ (K -,0LM 0 0P,00 0 `+\+X+0`+0T+ -LP'a  R-L@ rPTa P-L sP a 0-/LPr@P000+0/00$++0  p-LlM/`S@P KP0: S 0PrS@: J9Kp p-`PL@P00S 0 R H2V \00S &yH0H R 8,(0(KpX+\+`+$|0 --LM0 0 6 --LM0 0 K --LM0 0 K -L@ە\ hln -41LQM pK  P@`K8`P10: S 0R 000(YK@Pd1: Sp lVPP S00S )@-0P U@ KT+r\l| --LM0 0 < -T L@H*P4T ``edA -L M`P@P 0Ta0C0S0T00C SdMT00@ Sa>A, , , R R3#!5 "G9, P 00C   34,  Q0 0C#0 0 004800000,0 0 B4 0(P3T| ,(P0@@T0p`?!&8<0040(0, 40(08 40 ?34003000 000R ʤ |`0B000@38@0D3Pp03,0 @@0 ?{&0E ?u& ,d d00d0V`$@QPU`0P3  BB00B %"11000 0S Rڬ0 0 0(K̗ě0@d P-L@ ,00S 6h],&|( -5LM Rppp= h5huPoʠ 0 @PD0(\%$5RR1 T04Poğ4ʠ 0 P(4 \5 S S ST  S 3S3S |ğ @p?t0 T4*` ,P@ڴQ0\%4R  S0@Sh` VŴ0 0B RR40AQR00QT30S0 @ O0TS¯0  y 0S3 0R[ 0RW 0RS 0RO 0RK 0RG, ,0RC0 00R?4 40R;8 80R7H H0R3L L0R/P P0R+T T0R'` `0R#d d0Rh h0Rt t0Rx x0R 0R 0R  0R 0R\%\5R" 10S ``!1@h00p`P   \0PaA @T4:010\%R& 0O044D $0O84 K]P ,@喒 w\0: S t,lt@P\@>0S ,<],+6P$U> R0C=P = 0S= l ?=0S Xu -0@}崍=P` ` ` + (0 S P\ = P(0@-<0P @a$]0S<@T{<_.K B B,Pr Pn |l00P 54 S0 5S6 @Tlp@5O,505 ï @% 'p P5PW5U ˟˟+˟; 岡&; @;0S|; 0h;00 T(+ ;R  0Sp  h+848@00@ S2,@ @P @ P 00S>@ P,0H0PwD@ P o 00O D,D@0p 0 Po/D`0j0!0S 3S1 0  p? P0 `t!1>,@0 200L1 DR0@`0R1 0 >`0@  0#0p@P`H@ ,\,  H0O0080Q0 0@0$0HP0C0e0$0L\Y8K@ K 8 4 40W8@V (K0&l&&&U & -0Lp@P` d #0S0S @ T @ 0 @Tpw 0X L000 0 0000 @  @l&& 'G-P8嬐 稠p`@10CB>A>A0B0W3! Q 000 80\@80Pt+Lpp@-8PP` P P 00Sp001 #@e0000 #%1?FA00 0Sp03 0 Rpp@-8PP` P P  00pe@0@0A#O 1p"1?0FAp1>0 !A pp@-8PP` P P  00pe@0@0A#O 1Ìp"1?0FAp1>0 !A pp@-8PP` P P! 00s3p@e00@@00A#O 1# "1?0  0@ #p1>00 S20#ApMЍ6 -LP`  PT  P P@  P8  P( $ 0   l  , +$0 000, R('  0 ,' -@LƹP ¹ P $庹h跹 0-L@+㊼0PP HP}"P@@៹Pq"P0蔩 -\0LM@(0K( 0 @ K$ K0 P K$)K0' -0L@ P  h訙 --40LM K 0  喿 K蘩 -`0LM00 0@0 K P @ 匿 K0' -t0LM $0K 0  $  K K0P $0@i K0' -0LM0S P ІQX@0 @00P 轆>0'ȩ -LM  K K0K &p@ dK 0-LM 0PS    KK0~&p @x0 >K0( -L@4[3a"` 0S00+ -p-LM@0`P0 RKP0200  0S CKp -0-L$@KM0 0 [*0P@$0 S000 @ 4 00 0SK0 --LM0 0 4p)p K p-PLP` :8 0TnpP uP@$@p0S PP@ PpXP@$0  @pp3ct - 0LP`p, 0S) 0S& 0ȺP 00p@xt 0mpd)PPP@ V0,0,0(`@,@(`@4bc(' -T1L000,Q,p5@p 0`n(P0 ,@T"0 0R0 0Dp 0 0S 000EP 2000 {JPPI@000 ,@T ('̪t  0-|0L@0S,@TH0@;PP 40LP@IP PI0('  --LM0 0 oo  K -LM@Yp`PK! '-P4$0婒$0 $@ -LM@o0pP0K:pt PYp`lP Uh ,O0!K P 0N`\0N!0[ 1S000SU% 0N@!pP0S 0S 0S , ,N2 , ,NNr X W WQPH_  0S fX 0 (K(0 9'00 ,E{` Kp`/?ȫ p-`L0S+ @P(  k 0P00 (0, S , , R(0(0phJp0 00 pbn ph p(' + -Lj0@000,@T p`P磐p0S P, Ǔp0Sރ0 Sڃ0 S @ T ('Ldgt,' 0-0L 0R P( 0 @0 PU0st d0  0m ,@Tꂓp [@0S 0+ (' -L@p$ ps 4 -X2L$M0  D2$ ,0 (@  $K,K0a#p\0-S<1@0000,@Ti! Ip/ Xp`+ P#8@K _'P 4` 0` 8P 1 1P &<0!$14`劒,$!1G K 0 @p`P#40S 0:0粏p0S P+ ֒p0S0 S0@ S TP01@K+`('LdgLL 3|,' 0:0P+0 K+ -L$MWpP*0@K &P ,p (p 0P >1 :110aS1 @0 8 <` 4p {%@Kb w PK l`T!T fP|3 ]p@ 5Tr0S  0S( IQ 0 0R0$0 $@K,\ |p 2"4 H0xxx pQ00 SKL+L 3ܬ+ 8 L| -LMCnKЁ+~Km+i_P|VPP|(K 0@K(P $ tt0p ,P (ʏX<0 ,P <(=u ȑP 00p$`K 㼑p@ Tс0S $0[St0S p0@T$00 S\XD0 @ K 3Ltԭ+ 4xX+@ -LDM@&PP H D]AP 0(㽼  k;*P ](P W fVP sVp MБЁqP !gp`10S<   P 0 P0T  P< (@K `$ ` 0 p , $(p`0P 8@K# :% 4P 0P 8` / /XKVKTK00+w꤮<LȮL*++ :   MЍ 8 200 "P: -LM@pPg `P 0S nS0oS` ='PP00 @P @Q  0U0P P00 00 X 0000X  GU 0 00 ,K, ?R0S@pp0"S4 0G@P -LMp`2P@( P(K,KJ  0mP(0Sw$K -000 0LS    ėj(4<د --LM00 @FP 80 6j 7j,jhH p-\0L0`SP@8 ,qP(php(gdܰ 0-t L@h\P\PP P 000y@P 4,($@04'edA((| -MLM0@<0 8@ =]P = = = % P |ˬ =t* P-] p4`Kh* dz -N0@&S:* * . . . * @+ . . . . . . . . . . . . . P+ + . + , X, , , . . . - . X- . - . - p. < +0 `P40S<0t:  .t L"p RQ`<@0@0 L  @< 8 `"4 <R 1 `4 ;R  1 `4 ;R 8 `4 d;RX 1 `4 ,;R 1 `4 :R o1 `4 :R _c0 `4 :Rx O0S \\*TF@P!P@ @000:,!P*:1  o-xɟ00)<Kbp 80S<0S [ 0s 0d  0Spxm!P 0d h*dp0S89P ( 0e 0bS t80S \@KO8PT0K\0 X@ < 4(1 R0`: -W pP& 3!P! ^KPEeNKPE@D@Dh(0\(\8Pp4(88p  H\70S- !PP(OKe/."r?K: 7x* (K |J lZ p <42 =C02 =$2 7P00C,0P 0 1K," ("  6 Rp A 00KPp }S  ,K0}pP#}F  ,@ P|PP P  P,  |,0?,0 d  bP ``rpWZt50S EP uwP| ` |  x l* c  0ZPx y}  Ix KHPm}  x=40S 0: Sh 3 0: ST e`:@Pl  P`P`0P00@ Sx Sl| 00A Sa>@2 : 0 @@00@0`:   0 S`l:   |(0@S`Ld <`KP h30 0  0 0@ 0 @@*0 @@0Y@P X 20Sl` 0PP|2|`0O?   4D;S##t`2^`V u2 (2 R P 00C   R |*(0 S;30 R 0S1  0#R ʄ101 S90!0S`1010p10S xA0S d10se00!0S00S00#1ѣ10L@Kp:  x* `00S  P |*p8,00Sp F x Fw(,( ,D@,h,d(|(p,t,(Աl,,,8(Xx,t+,,|,Ȳ=:PL\/n<(L$@(80@S8 8 8 8 8 8 8 8 000 10B 0# 0 10ydг80@Sx9 X9 9 @9 9 9 9 49 000 10B 0# 0 10Od -L80LS$8: : `: : `: `: `: 9 0S01S 00  00 #A10 #1 0S d -0LPA@`|  `   0BOpcP VB?㖃! p    ( -LMp`Q pD4K iP00SDDT[0 PEP 0$E((( ) -LMp|`Q D@X4 iTP8D0 PtP 0"E(()8 -LMxe@D lUd  0 L5QD60S 0@p4 00 yc@040 0@ 70PS`08 `?4K  P04K80Po4P 0` 0P0o ?S4 RlNc 4 0 @4@84 `R`0_P 4K  ß 0S0C0 ?0@3C  00C0 000 ?>0@3C 000t30SvL3  ?  p0O<0 8@  0 0PO`&,ᕃ< K  < K ` F!P ,` 0OP## ?@00C0laD@00QH 4D AX18 8 04  ` P80 $0`ï @ 04 D0$ 80p00`$00 8040`!40 040 4KoQ`0ς`0O1>Q`0P0 20D080U00@ d 0 0G4K(K))U Xp)h, - L0R  P@Ĵ -2LM00 S8 4 K0lG0 P2R@ d z 0= 2P)? 00C 08P4`\\0`"1>\\0?0 80(R0! @ d Q2 0; 0@4D1 00C04P ,0OT8`S8 K ?0O,0 (@ 8K 0 0 O Pop@P <` @S!.Ǐ@ 0@W< !@p`p, K 8KT x `? ` d 0 0@P0 0S 08Kx ?: 00 08Kx ?/ 00,9$000 (00$Kkhh,))U X)( -LMK@P,0 K`0@ P A P @ P C_ ^# 0!C p  0 K4 0@ 0 @ ^K`pL =0@0O$+41 ! d 004 0 KA,)( -LM@PpGK,`}$1@ 0 A SA  9 K00` 0  0K ^ # ,K01B00@S  0K42P L=EK0@0O4;0 dH04 0GK DK(Ah,).,( -:L0MP0OH0 D@ P `HL` ȟH08dP0L@ 唣#P80f \0, 00 40@,, 9I0 40 XK0PP9 000P P 0 0 `t0 x0 0Sx0x <0@V@pU@PK`0j080S.ʤ8P ,0@0CX00+! 0\ȟ0 00@00t0x 0T0 T0 1X0 X0 0\07 0\0Gǟ0 \00B`0 `00Bdd 0R%Ø=˸ 0P0P 0lGP P Q\0ςQ\0?00 20  0^0C 0nik&6PF08 S`0O@ f  v0000SI 儆0dƟST0T@@0d0H00`<0S 0d %XP@PdP55pPZd@`{00P r000HE0800`Y,U,08@^P( 0` E!400400,p80P0` ,,\`0\`0?0 0 2 0 , $00$0,\,c0tS`0O@B _@D 0000SI D0cST0T@@0sd'000`0 S ß0d XP@Pd P5XpPZd@`00P 000080"2P8 0SX h!40Ÿ0@40 Q`0 Q`0?00 20 $00$0 0X84@P`0„0R$b00@  TJ00 x0`pWp@ 0\5Sl@PlpGW0H0HO DP@,00 ß @d   (a!0 > 10S70܀80P)0p@[pl@`x0W0HOH DpP,0 /0Od y 00 0 080P0x `R5U(K)(( ))U h,8(T -LM  pK@<P D,;P4Ky_;0S ;RQ:u 00?d: @P0=6:p   Cd;:Qp: `: Sr\ mQ (:  S4Z@ ,0};ttJ @P@PPjɟ 00T 0L59 0$ : 049 0B90A  M;`0UT T0PD R@: R08R0/;Y00 8 04 000cH0 400cL0 H00O85Xl,4bTTȸk (ht@(()x<,((h, )) ؐY Z400S40|  00 00 ,00p0$@QPU``0^3  Ba0B 5 =0 B110L 000@x0`S0 0OH4LD ,L=2 000`1Pm P=LV>00h0 h0 S:h0@2 0<0L2 0\ X2 0 0R0PT0XT0P0P0HU 00 400@x0PP40@s0, 0a84 0 =(0 H4LD0 ?>0 ?0 ;0 4 D0,40S0 ,d@8t<~4P` 4  4d U0O?`@P$+4 K ФTp Ԁ@p4P~`{| 5P`8, 0帀D @ , DK< K,0KPTK*P LK<0KQ  P0 @ 5K< 8 p6, 08dP A0`@ @c0 0@` R pQ 0ȐĠ J)F#Z **0PX70SR@P'  *0\%$8R48\5*0^H*0P<8(8Q0\5h80S7q |8PwP Z8ppD Kup [P :P vPP8 0(Y0 ,i R01:0̦PT&~ 0I *`p㸐K:4K`0S- 0O ,00 /0Od *P0d PcP@c@t 0 S RL  T  @P`pPZpJ0P,0V0S R :0S :P㽪 :4K0S P  ?>0 ?0 ;0 4 D0P , 50K*0`PTH4LDVKd ]00 f0 R P000`P pV`0 008P40  @@A@p< 008#80(K 0-LMoX0@K P0,L 0P< PY  oPK0)(),MЍ7 -0L 傆(<H -LP`p'L @@P0/S /ɩP@0.S0S .S 0S `V4hW p 0S0 PP,)h -1LMXp tt8'l10SR 0: SN -5PJ n0 SF3`K<* [1 RA@9PE9 0P 00S 00CS00@Ӥ0#@`P0S 00CS00Ӥ0 PpYTyT$K$)< ) 2^ p8 0S0SH OP, $0BSpt t pt t |t t t |t ]& 0S R H冄P 0S l0S \pX<`pa@Pl0S ,O7o^)$) )(),) -L`p 0!P@0dP PP RPiP@ rP fP P0@0@ Sp0 0bSAX00S 0S D0U $0媧먙)()$)): ),)MЍ -000 0LS    ㍧1P)<(-0 CR 0R0 StU00 -@RLP 0S D| 4 |TH UF 0@SB 10S<p `(</U0C3@ R 0S, ,U0S|U@ l R @0 S0S400S(>h>hTDL <x< 0-PL@0S(0h{BQP x{t d\00SP e <T 0{ (0h{1Pp <x< - L P6m @0) me -LM@/v"P0002rPp2 lR dr`XT2T"PPPfP tP  Qp2 10 bSP PP P 0@SX :P510S Ya@a,@ pQl 4  PP `@a0<S 00K@P k0S 1 0S0+0S% 3KP ,K ピ 04 P,00S 1040 8K[P @00S df5 0Xa5=P)1d@,xmlȺ:̺10D11MЍR -0L M<t -LlM`p@/ov@ r3X0 @#P0Wf?PjKPȔP j P0: S }j0 0X  (Kr -LMp`cs[[h0,0 mP pP,  <,@P (0 $+P~!Pp001 @R Ԁ@`p)q @P0/S ,0S  j #P00U00S>P8`@PA먙@,:MЍ -`LV@pPq \V Vfb[RC[VS  0 ^S0 0]S0 $0[S0.P =P:P 0SE  0]S0\\S0nS  0S ]S00]S*@P"\R0[S  S nSP \SW0R0000P R @꠻Ȼ -`RLp00@P0@ s0@0S S ;S s0@0S S\ 4R0gPV@ @= -L`?0rS aS bS6tS {S1-000, XP & 0R0 S 0A 0Sp  P 0  @T0S04  /` V,d)  p-L`@< 5P @P 0S0 (T X0 R  P +4 0$ 0S5p+$, 0-LM0 9SP0S*$S /S\S @PP 0@00 00 KR@@84T -LBKCM@\M @ 50KP T L$ X4 Lt 447P@, LPwP>@,~PLt ,0S , ,0 r T000,0 R#R ;R Pp0p000Pt 00,0PPL ,tP,  , ,0 r 000, 0,S0P0-0S,0  , ,0 r 000Q,BP, , ,0 rP 000,00S ,0L00,R @0 S0U,  P0 SKh X ĉ 8 X p x ,00S,0  , ,0 r 000 0"0 00,00S,0  , ,0 r 8 000L ,0P$ 0S0L0P0` L0pL4 ,00S,0  , ,0 r 000,0 ;R  R  a,00S,0  , ,0 r  000,00\St E,00S,0  , ,0 r 000,00S  *0P`0K00 )l  0eS * e 0`S01:6`   \S0S S@000S0lQP 4K@P000M,00S,0  , ,0 r D 000,00S , J PU00B,||(#p;,@f5 0T1,00S,0  , ,0 r l000,  ,00S,0  , ,0 r 000,0S 0 , K {,00S,0  , ,0 r 000,, K 0S_ `  0b0 S&01@ 0S 0 P ; P B @T0 @, 6, 0,0 0\SSH. r,0P,  # ,0@,0 P< Q<H l 00  `84 @4 D4 X 8$ 0hS * h 0`S8 01:@!@ @4 P<D$\SQ# RD `@T`FD + ,GP \  0 S0@B 0T0S@\T&T\00<Si@`Hd  S 00`0Sxxj`P0i`H$0, P4 ` 0p40S 4 40 r 00040 gR 9R1R*Rn R;RcipR wR^Vt`YpWV`k44K 0@s@<a`@0S40 4 40 rTD 000 S XT#%A+40  40 400ST$0T02 T$2@TT"p e囝0T$40 40040 sS,0  , ,0 r 000, 0;Sy0,0@,@ 0\SS ; 4` @P\j, %D PP40 P0s 0 @ T F 000 S 4+X)T)pd)1̼<d, Ƚнܽ4+T`|`)\)ؾ0@T| =8h,,, ,0 0Q᧖ᥖᢖ᠖PU,P  , ,0 r 000,0 ;R0,0 R T@ 0`S0 I t@TP U 1 r01 81jH1(K -"LM0S>̂r`P y @R"2 0  PP@d兜 0ld"0S 00CS00 Ӥ0 r@ #00010S 00A,KM1P0S00#3 cPP h1@c0S c< 0H 0 , c4! 0qa00!0P 0 0S 0傾PP@c  0| 0S 00CS00 Ӥ0- r@ 婄d+++ <(l <++ -@L 000@@3 0-PL @ 0P@000<3 -LM0S`p00S; :SiP 000S S,"PP 0@c喛 0l0 00T2 0DD"P<< R$"0 00001,Kk@P# Q000 ,0S:, -, R,0  RO0#SL0nSt1 G0H00@$!0S 0#S0nS 1  0,0 ,0S ,0+;, a0 @\ \0 0 0^0^ d 0000H000 0 00,00C83+++l++h+$I+|, -霁圑圡L`Pp@,fP aP eP EPrP uP nP @1 @@p 1@  0yms1 Hp0 00@pQ @0S@Pd0@JP b勚< >@,,++,x<<:+ --LM0@``0 ps0DSL0@ D0D0uy  w JTK<++  -LA@PaJ  -L▃@Pa:  -L◘@Pa*  -P@Lp`Γ8 0`%P 0W%+ -LP`p/0wS {S& sS'0 p +P 0@na 0pp0 pp +P @\aݙ 0(^pPU -P` PLpK i@ W000 2 0 0 -LM`0PPp@0S! T 00S S@D 0@0V l0 l00 T00?0P S  0P$ h+ ,,$-0 CR 0R0 S J00 -L`zK((MP$pG!0 0R R0姻@P x*0ۻ P0` P0V00S06#3 dx`PP `0S ` <  00$ 0$K+,x<l < <+ -l/LHM<K0l 0D00d /.00d0Q0Sm d@PT 0" R 00$P RΟ 0S40SPL d 000> D R000P R(N 0S͟0SP) d0QM 0Sd͟%!%*dd000 R000 R͟lM 0Sd0 p3Pd  i d@0=0C>S񟗣L \ \ \ \ \ \ \ \  L \ \ \ \ \ \ d \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ ȩ T d Ȫ \ \ < X \ \ h \ \ T خ  D \ \  \ \ [k 0S K00 000Pl 0 0 0d0 0 @d @ Md  d @00d@000S4 ʟ0S1 /0S3 R  BP00'0` c X* J0S 0 ʟ 0 0 d  J`0s tP  P KP4[S 0yЙЉPD9< 0U 9`PVp )000 \P 0SHP" P 0St\ \` H@V VP 0iS,GPnP`0VS80S$$Gl80S  G@80SL86#3 t^PPt ^0S ^) g$80S0S 8] jP 00S aPM70S0S7D 㷙0S>0S: R  B "P  ` <7@)@& 7" 70S|0S 6 |dƟdf 0STF0 0~P0 0 0 0d@0 0 @d @ PP6d 0h0 @T\@ X 50S  0S0d 00  \X0P< E0d0  @` `PX0 DX0T0   00 `Q{d D0p`Z&Up% \U 000C SS p0&S\SpPğ0@0S :K@ l0@` T$P0001 P 0s3 \0@8 -PaPQPPLM@pdP ?P aP tPp;` ` 5ep0pQ9y y@Pp 000 000P@TY 0@K+yP 000 <000"y@P(K`aaaDa -$L M 08 , xxx0@P`p@ 4 0 0!0- + pP0  UP dP ?PtP@  xP,p  rP 0<0 @ 4` 8` #dp00  P +\-\0S0 X3@QX Y 0S 8D < b(Ko80S ,0<0 H @x, Rp`=00S40S l l0+Q H0S C l@0H @0 cdRD@T=`P <2e  i`Pv3p)Vx0 ,Q- @x@P! 0 4 Rkk00+S H R=kt B@0H =  @0 Uc\DDT D < >0V0 @D0 xDY00@0  8 R000 Y 0 0/P00 f0 000000+QH ,000D RT0wPUw<(Kaa`a__\h3adDaL` -L,M0`0rS tS eSƟp Ɵp< Ɵ0p<0 |Ɵ{< p& 0 0 P8 4 0DiP/ UP' LP RP ?P#hZPP() fPrP+# lP( pPuP' xP  tP P)P) '  @,8@ 0 40  X0p+p-0E P LcpP@U,@  ,K+fP 8 0@ R 0K"fP 0 1S +R-R0S00Z 070S d$CT400S w y9S,4y0S4 0Z`.SZ  w@ g/ P ` Y0D000  3# 0~ 0,0PtBP@T P3D08s@ vPV 0 -Y0    y~B\T@T20 H L vx 0 R pV 0j 0P a H R24zB0 (vB0rB0 nB0jB0 eB0 `B0\B0XB0TB0PBMB0 * .40S L0!S?B06 h 8B\5B-Y0 P8+B0< S$Bda BW @T@TTX|``<0*{'9P0 `@0 D 6 00Spq(Kxa_a $(04<h3 -L M00X#wSPPL3 UH@pp `0 pP ?P VP vP0`  ap0U0,0 00 S0?0,0 00PS,00,0 4P 00p#40SP u Hu0p03P u uPP 0 S ,.PV 0BRSiA00CSU` V'MV 0|1|PA40ShKA `<V: PDA0D@A08FRNJ 4>U4 1.*00SD )<0/SP0S d@P<@T dH hd<@L K>U \0(KPaaPx@`3da|a0fP p-PLUhd0 0S `,@)T @ T >pVGpdPa -p@QL@ mP@pP@ !]p001 PR@'@1ST00pS@` T`W　 [V  *[ ;[W@ Z00 , =$=@ap'` - L0 0S p`@0P 0@P00s03T0S 0 00S @ T0 0 0aPa -LMD@KP[0D0 ?P pP :P  000<= _]pD0S pp`@@D0T!0S00S 000P(K0Pa -LMQp@ 0V`  0 gl0V< 0 `< 0i ,  0f(K訙'Td -L^MPp@K`:7KFOKCPp` #0@@@@ B+p0S0LK``7K$cK!@K0- 41`ßOK P`( $ 0@ =9@( $ =C 0 0(!K 0K R4 0 , c0=)B@ -B4 0 , Y0K`Q P( $ 0@ =9( $ = 0 T 0 PŸ (0K R( $ 0@=9B( $ =C 0 0 K c0KPR4 0 , 0@=94 0 =,0 ,0  40K R4 0 , 0@=9B4 0 =C,0 (D 80LK c@0KPRL H D 0@=9L H =D0 L K 00@( K4PK @0@l 0@ dL0P4 0lbK<`,`?B|_D -LXM@tPK`ሀ-  0lp 0 0 0$K_P0@0@aSS8a`3p`aa -DSL M@p`?PM SPp#Zp0aV.W@WW# R:K@=p,` 0  <0 0RL@D`tP@p@N:KS:\N:0H"00P `0 A0SQy O:wW@}W(3D0 1I@ H0 `gW aW oW uWI@`pW |HPlCZIPC `@rU@ gU oU XU wU@ xU uU D0H0@0@Y @`PU P0-W =W +W00,U` \P 0S0S@ W(Ka b( p-@L PY?P. 0A`P@] 0S 9 X9 @TpP @@`T 0-S 0S pP<9po0S`pa`3 dP4@ -`L| @nY?P@ dp:G01 0D0P0S80 40 R@a`3aPabp` -L e0ppx0@ P dP0@OP@1,K0!$ ( , ,@$0T :( @`DA A0@$@ ( ,0 ,0@@( ` ,0 PaVP@ KP00SM@P<0$TPU >@ Kaxa8a  0-@ 0PLP 0c0 -LM,@KpPqd똀RP @0T : @`DA 'A0@@0@1S@ VdP` $Ka -L,M`L P P3B 0 40 0 H 40`0T` <0 8 n:6P8@ YD  <0  cR <K4N@0S000 P:/00D  D H0 <0 cR<KN@LH P 80@ @cP0DAp0hC1a@0 0,0 [P,0ST PRQp D0@ u` P`@0Z, KP 100S PU80=(Ka -RLM p<0 8 f @S`$M4@K0"00 40 , "" 0PTPU 20 /lnqd2P0 %0`400fC180 < 0 2|@; 18 0 p@00Z 0P 稴P P @80Y d1 : 0 1 80R1 !8P8 쐟pBP @PAp P X 140 8 4@,0T :p00 @`DA A0@,@ 0 40 400,00 ` 4 <08(Kaa`aL`T`3 \ -/L`i}HPDp`@PP@  iQ T -d1LHM Rp O P@AF <@K lKX0[l0`0 Y@[WP[T`[Sp[\[b?`0 l K0l K0KLK0 `pNKMK0 S0S 0S0 S0S0S@K nP $0 pp(K0,dh_4 0-LPL@ x0S C0Ux  Tp0 p0@TP0__(x R`Up0 Bx p0_ -@RLM`PJX `P@TT8`FV000S/SAP pR :@e DA A P1p00WR :x0@e DA P!0@0@ T T 0oTa*T_ p-Ld`MPK0S bd %L@PSA0S T[xa -L M0S, 0@ 0@0R$0 KP1[S S|ࠁ ࠓl 0@pP[n1[S < 0zpP[nK_aLa4ht@t3 0-L@PX 0S0S : 0S@ |@0Pad0 -L ! 44bP, 303 0 h _ g d_ Pp 0 00 = 0-L@PP0@S0 0 <<0 40 ,0(0$0 000<<p<L<D<H<P<0@-p 0P@0^R0>S@?S00 0 @ R0540 0 D<< -p0L R`0PpX0`T0@TPT *U@(0  000p<H<d<L<P< -00 LP`p@?  r 0  ^000@S 0@00 @PnU:=4,D2p -p  L2 20R291@1P10S 1 19a威P@U0c00D0c!S000p1HA jG41@0T@1 <10RpW1 1a 1P0S0d@cp@`PU 0 0CR0 00R0 0R>* 0R <CP@?@TX0XP@t0T0 T<L<<<a\<`<<<d<p<H<P<D< -\0\ X0LP0/0A00808 Q005 Fhd<X<D<<<\<L<p< - P P0  0L 0@0R_0DS + d+ t+ + t+ t+ + X 00CH 000@00S (0 R000CRh`<\<T< p-40LP@`0@S 0U pX< -L - L 0   H< -LMP@p-0`d K"d@P P00<0P 40 T <<H<@<D<L<,00$0 00 c0BAxaa<< P-L@Lhp < 0 00  ^JT?@hC@= -$0L _ -D@LP`4p0S 0UP*0V X<P< -L@@T* -0L0\ 0@ 0 @ @\ q 0_Q $Q\@ q 0_Q $Q ^*0D<H<=h< 0-0L @P:000P:t0@0hd 0PP1: S0T C:0P(P00Q0T0L<d<D< -1L1`PQ p1p@llqKPQE r 0_R $RLVr0$r" 0 R00 ӑ UV r 000 R0 r 000 R00Q r 000_R $R @T0%"*0@nD<H<h<==;CLU -0 LP.000R<D< -0@ LR 00R 00S 0aS!R0S0S0S0 SS CCR00S0S  C<<D<H<Pa -0L << -0LH< -D0L <00S$0SD<H<h< -D0L <00R$0S`D<<<h< -0L0P 0@ 0 @!@@P Pq 0_Q $Q@P@ Pq 0_Q $Q \*0D<<<=h< -L -0L@JD< -LD0 <0@ 40,0(0$0@<<p<L<H<D<P< -Ls -0L0`P:00Ph$P0@t0 p d῭@X0@L0 DPD0@@@TDh,Haa<<<@<L<p<H<D< -D0L0S8000,0 (00@l<Haxah<a -0L 0<h< -0L 0B<h< -0La -0LHa8 P00$ 0S P0P3< -LMpP` ȀȠ04 <0 8 0 00 , {@@@@.4 0 b00e<08 040 00 ,0@ 0<T T(0@(KL<<<@<H<D<P3 0-0L@0ϠP|0x0 R  BR 00S H0F 0S@Q*0d0D<<<H<h< -|p|0L 0SP`:'L@  `u q0 0 0 H<@<D< -L@P嘀`@Pt0 pp 0 R 3 #P0 0V@ t0T0 D<X<p<P<T< 0-1L0@Th10SP' q0D@P R R "R 'R @P R R "R 'R R R "R 'R<P0S0  S S "S 'S P0S S S "S 'SP0S S S "S 'S  B0ST0 P@T T T "T 'T00Z@0al<h< -d0d 0`S00L0L  B P4$0 0 9<<<\D<< 0-PLM8 4@0PKK0K!00Cs08h< p-L0L@ xK<@<`0PP N0Q-pD<8<<< -tpPlp@LX`d@D0 <0 40,0p p*H<<<D<P<p<L<< -pPLQ DP 81 P0S0g 0Q 1 `gP@UH@DtP f 0 0 ~0 0 0C0bSZ PP@@T *@@T*D0 D0 P@tr0T<D<H<T<\<`<p< p-0L M @0 K0$KK a(K0a `P 0 P$0 `}0APX PU<BPMU'KpH<<<D<: d3 0-T0L@T8 800TPc@PdXH0@0<D< p-0L 0R 0R`P0P0 x0 EKl0@d/ 0R  BP 0 p|<h= \B <<<pD< -p0Lh0Q`0` \0 `0S 80 `0@SZ@dl<<<H<h<D< -L -L -D0L <00 R$0S H<D<h<00 ,00R00S RH<<<l< -P0L H00R 0@0S`D<<<h< -l1L M ``10 l0lp ,K0K(K4K `PY@W(4 50 ,0(PcVP00S@  0,gW(0  X (0000S/S d 0"W00S (4 R X(q$KH<<<D<: d3 -L -L -L -L} -Lu -Lm -Le 0-0L^S@P @t P0Pe0 -0L0Q @a`pPPW vd0@M@0@^SD @DT* 0P 0 <Ha<<a -@0 P00L0p|@`V U 8PP3PPo00Cs0H<D<<<h< -L0`p 0 S 0809\- 0P@ 0U P @T0@TD#[ Ϩ` 00000@@ @ <~W0@0 P H3x<8< --LMM@00  00 RK0N0 0  0 0Q K 0-PLM00 @R 00 |  Rd0 RH0 R80 R$0008x<D C > % & -d8LM X P8  @P 4P $P8  ȟ@0 |0 w 0@q b0@k <0@e0 ` C0@Z c0t@T #0`@N 0L@H 08@B 0$@<0 7 =0@10 ,0 ' 0@! 0@ h0@ d0@0 l  B0X@ L0D@ l0,@ >0@0 0 0  0@ *0@0  C0@ f0@ g0p@0 (0 H ?08@ ?0$@ 0@0 0 0  .0@ _0@0  0@~0 xy0 ht 0X@n0 Di0 4d A0 @^ U0 @X u0@R0 M0 H0 C y0A@< [0B@4 [0C@, [0@%D [0@ O0@ O0@ O0@D O0H`@ [0`FP@ [0P@ O0`@ O0P@ 00,@ 10@ 20@ 30@ 40@ 50@ 60@ 70@ 80l@ 90T1P;`5p@ [0@ [0x@ [0@D [04@(Kt<8<<PaH3% 4 T5 8 \3 2 t, 4G tG F F D C C t7 2 7 3 - tD 2 @ 3 l5 7 @C G TG F 4, 8- ; 6 p9 H d] & `2 7 2 % h= \B 8_ -0L0@c0 @h 0S X Sh  -0 S00@  0L0Pf h^H38< -MLMP`Qp| SpB_ Q 0P @TP82@ @TNK @D@D0"9U1`@:PP@T!f ^0S1`@S@TN PP0V,A ,1`@ @T P0q.K B B"0S @ P0^K PE@PE^ @T P0 0.KH0 B B$`9V< Kt<H3X>  -3ML M3|3|x3@p3pSl3ld3 \3 T3@L3,KX-,04#0hP0(s(3(#P`@@l0c0 B0E0b02 >-0S0 0C0 2BQ 2\"0 2 a00cCR@00>Kp0CllŸ48 00 4`A-(K4 CpPo0(K s`0xB"C00!00S1 @ PV 4 ጰPUX@T@Z@X00S 0l\ R T0S   XVnP P PT0 000@ t0 `00c+VY820 -8KR0``00(K@<<<L<aH<D<aP<\<t3<p<<<`<T<<d<X<<xaHah<<|<l<H3X> << -LJoK⒞K`F MIM,0Ip0) )1KX\/PPM@1@0)9K*KP00 @T 1U5 S* S W/ 00gW   S09W:0X0 @6P0f)![^R@/ ?40PX7(KH3= d] D <<P3 p-@L `P4$0 00@ S/@`@P 000$0 0 @ ph<l<P3< -PLpၣ`P& @eT(* P(R @plP00 T@0gS4` R 0gS:00W ; -LMp `PUW\@0 S<KkPT U0U/S0: S SK[P1: S  0 SU0U/S 0: S SR  K[P1: S/0000@0T :2 @`DA A0@0p2 ` @B@0U/0 bR;P000/S /ТP 0 1 00@ @6=P0g   aR;P  e"! 0 QI000U1 $1O(P0 0 1 1:0.S 0S* .S0S% 0.S"?P f0@  cRڇ;P  }!00C0 X 00!P*P 'X 10H(Ka\M -0LM<`,0 ( p B@ ,T @@0 4K$K4 0 $ @0( PhcEQ@e Ka -LP`@pP0Q :x0 @`DA A0@0 @x@0dC1` Ach=a\ -L$M< 8 P`@P  0  0{S0 R  {R0 }R0C ,RS  RS0S0Z0S" < <08 +(Ko@0T :1 @`DA eA0@08@ `@JQ 8Pj `p @ DP 0p , H 90S5 0{R,0GHl4 , ( }R,00S,0  ,,R\ @ 8@P`x0 t D p40D<0  c0 p W(Ka -pp`0@Lp)@@PP4, P0p0maxaa -LMP HK U   XP?0 /0S 0S0S @O0  00 , 00( 0 `Kpp P  80 4 L   80  cR 8K9 Rkj y 0z 8z ,{ y y 00 \ ]k ,k @k `k m k Xj n u y y x d p 00 C   ; 0$  (00 80 cR8K§9ː0 00S0 p)0-P]/)0@00` Ot͟pW`R 0S*00S&0@T" 0S 00S 0 ,V  00PG`Pp tp3@ K 7G`v@|P  | 2l ! 0D` 0   p p 5@ 0$     80 cR8K9ː0 0 0S0 )0p00,;0 ?C|0 d@K 0K>PK]@ 80  cR 8K8000SPp0 P 0˟`Vd #V Q@pTM 0SY[㹟P 0@S*S0]SWY: 0@S@0P@T*T)@00Y\9@P@vpɟ00S0Q0S T`  n8|)00 F= p  Q0 0 0 0 :S  0  0S   ~ 0 00     @ 000 0S  00R   R 0SQ@V*V#0 #0CS #70S0 0SAY@Vp@@V0@V```  @0p D0 s[P_ 0@S*S Y0]SV0#0CS # 70S8'P WY@p`0 V :6@e DA A`P@[pWe0S Ɵ0@S@@3 %V:\6AA  hPap DP 0@@S000 0=S%00 5Xp[@ 0ş 00@ 00s03ş P00S -R=R ?R+R@  0S 0\ş SQP+R QPHQ @0P@ $TP 0  SC0S   00\0 40 0c0ᴐp 0 0 %S #S=S ?S 00?0 0 pA.0 ( SpP(  0  x0 t x0`0 @ 0 | 0  cRڀK040`00S0/S T :S000SS@/|P0Sd +S0Sx -S0SUX I J0@ ?P@ 80 00 @(T@|tMT@  80  cR8K30TS00T@00TSV 0Z00 ` P 0 00 0 0S0000   ) 00 3  1(K 0-x0L M0@P- 0 K 0 0 Q 00`0S0@@K0a`3 0-0L M0@P  0 K0 0  - 00`C1@@ S@ @0K0a`3 -L M0@Sp; P P$ ( :  $ ( (0  (`K(0 PU @(@ 0T :h0$ @`DA A0@ @ $ (0 (,0P$ ` ( @Ka p-PLM`@PT@^0 P3Kp_ -@LMp`@V`1S0PCP0 S ,$ (0K(p $` P f3K_T -@ L1 >@ -LM@0 ,@K p-LlMPK@`_RP@@P(U  : SI  S @PV 0SKp -SL0M@< /0\P < PR7D1  000 , 00P080 4 ::=pP4@pW `e80  cR8K=2@ 30/  @80  cR8K,2@ "4< |P4 `,  PP PU4,x(Ka p-LM @KPlG`  U 00/S 00 (Z000G@PKpaDa p-L@`P0=S\ *SZ +SZ@G [H000 `0pa -0L0p@`GPT 0r03X0S  0D00 @80000`_aaa 0-@LPOF $F@P  0ha0PR000AS `3 0-PLM0( 0 , mAF/$ 0 0 0S  * 0S$0 Ph1RdA@%5^0 D 0SF ==C(100 *h@P  0  *0, R ( 0P( 0 0! P0 0P Q9p* =p $0@i%] 04hK0aHAMxaa, -0LM  00  P,0 W 0P,K  0 00S  0.B*?0S2H00SF? PPx?  AA4 0 4K?#0S# 400S PS! O 4;o 404 0S00%;P400S7400S 400;0 0 0S00S 00S LN@P 0 @ 0 0S 0\ K 0 0 0pX` \>$Q `X(#0SX0 @R_T 00 00#T0S쀟PA f ~.@0<0 000 @ KP C`'0T  P㚕% P0`  0S`)0= ba 0-L$M@8 0 0K, 4 $@ @ @ "0@P  R050" T40S* "0PK?(0(S'0(0  j(0(S 8 0   [_KK4 8I!K0a`3 -0LS@P 00S  `@KP0u @050VK0 050p@ -`Lp@T @P00D 00    K JX @ - QL MP4 O@T``!0DS00ST4!T 00 "T 00s03V$ 00c 0 #T  0$S 0%T 0&0DS4  Q0 0s(40p0C00 `fY @  H@ I R,   5 YY Y 01`0IYSY  0S 0S0 0# 0ISꜹ 4 и  , ȹ ع  , T < l L и ȹ ع 4 0 P 0sq  P 0sp 场p 0p 0pc 0s 0Rs~ 0Rppx 0Rppr 0Rppl 0Rppf 0Rpp` 0pRp[ 0pW 0p"S 0pO 0S 00 00` P 0p^ 0pSp: 0S 00 00 0`S 0pI 0Spp$ 0SX 0 0 0X 0@0C 00%S zX 00 0 X`@ 0! p,  R 0 p   I H@Y p0IS < 0##4 0S 0C 0 (K -L0 M@0 00K, $00K0@=-<0<80 0aC!P00? 10a@=Ha - @LI9008= -L PT3 -LMP* 4 7P0A0PUU # 0!`p P' EP 0@0pP8 d!0 R /DA i0 0C0N 01`@H̠H0-K HT-0K,K+K*PK)K唶4о4 厶 00~0@P 01Q:HD00 010CQ:4 0 (KDa8=<=L=aHaa -LM@ `, E\ @x ̿ 0TS60Tl20Th.0Td*0T`,@ %TX"0P0U: 0FS 0aC1BVV0bqPP,D<)``, !J@ZaHaDa -GMLM3 0S 3 |3|uEfHpCP d)KJX JD3L-7@PqP&0 3PP  0@P0pp 0S0S 2l291P dXx `P@RH p X ` h @  0S     0S @P1\NP PEU0SU8  RU2PEU.`<T!0 J1 @-㰲`PbP@g@d QP  0KpP|  0 #2P00P0q,FX0 H\0fD@o0 Z(0(KPaH=L=D=Da8= <=aa -8@L0S (0}/ }0 @ HaaDaa p-0L0S `P лP hPP !X0@T@@媼D0@ <0 B40 @$0phpH=D=8=<=DaHaL=a -PPL\0U PpP`0`CAU!b@ 弼1P0aaHaDa 0-L0LPD0@ B P 0dCRB0R00aHa -LMQP,0 ``pḼ @gDAU00?PAa,0S PP 0gC@T : TaHa -<0L 400R:PR B| aHa p-LMPK`@2'P,  1R 1000c00PU QV0xP U xIxV P@x0hP?SX0 b@@0 @k P0$ &xxaL=Ha - @ 0LSp:P`0 S 0B00坻0 0C000吀`P@P  P0S@0P\T 0`0DV ,P@@HaaL=X3Daxa -d8LM$0 SP HxH`     CgP- 0P>9P2?P eP8nP 2 lP/rP ) sP'PMP ᠻ @ M( x 弈  000 `  </Z Y'o#p00 VaP 0^S   z0@T 0S =wpP |6P=&00c  㰀 ZZPY0SZ   P@r XU&h* ' 0 00 , ܺ004 080 pP8  bR:!P@ / + 0 PpSP`g 0  )8K ^00SY)80@  cR8K !P 4`, 娺Q 0 dZZPYYP0S ,Z^  8P p @Q@Y %P Y   R Pp X0~3p Q5 D#D3^4Q``$#$0 0 fB!C O,@L,@ ႇPP0 d >,0S00`V@3@#V@T(H2F/PU@pN L7z^@@ ,Q00@T`3`#T`Vh-pPNA B ARP>PPL 0i.PPx@K P`0,10 0(08`K,0 尹00@080 4 8 @0dS 400c0bS  @8d ,P $@N -  -004`` 4(KPaaa (Dld aL=_xa 0     ,a$PQ00,a@ -0L`0V`Pp~@@8P,@ p0PP -! P x-$00000|aRPa -@@L c-0 _- [-0 __P= P-L h 0S0S L@P300P-00@P&00,a -$@L0SP00,a -4@ LP0SR00,a -,@L0SP00,a -@Lh p-L`00L S@$ R!P@PTP0$%0&P00S 0P0&10P0` T \ \0PP0 p\0SphT 0P0Pp`t -LlMxKPx0: S K --80LM0S 0 0 e( & KP=_ -@PL 0P P 0P l0l0h -R  D*T <@Q R 0$S0 5* 00xaa_| --LM4@0 0 ( '&K_ --LM@DD *0 00 ($ '&T>K_ --80LM0S$ 0 0 ' Ka_ --0L M 0@0S u0 R)0 h0 ' X|'PO&P0  D00S   0  Kap``_|aPa --`0L M P0@0S <0 (0 ' I'&ap`_ P-L@  P L0 S  -LM@KⱪP@0P0P|K 0-LP@P0 S U 0 P0-L@P4% UT  0hT0_0  RRR00Q QD 0000  R 0S X= -LM@K 8㳵00 R000 㩵 0$a`=d= -LM K4囵00@  @RK㐵$aX= -QL\M`p  R<P  (0@003 Q3# V+x p  0V 0-0p0 l 8@hK0St  0"#402 @ 㼃 P'X PhK; 0#40 H@ 㮃 @4"T* 3P00X00S 0 SShK 02 @ 㒃X 80T p0f(x a(X [( X h0[S tUp1p0 M(L!UPD1@\04 0P<(l  t PX\ 0x P%( X 0S0 (@T 0t S0S T]l0S `( P(K$@X=<HP dX`lx`3Ed3h3-0  0\0\^S  0008 0 Rp00  ` 0 ST 00C0H0H P4 000P00X==ah==\=`= 0-LM KQ0P@0S 0@|  00CS0<0@TH0@0P 8@T $ K)8$aX=Pa_ -1@LP 0= Sw 0mG Ԡ@<0̀ p0`P#@ Q 0  T  0R@QT 0  P L00@4A0P`=|h=l=X=d=$ -X"00L0p g:<2 <0S 0S R0S Sx PWs n%^ Q0ij0`9S 0S*+S S %S;-S8?S5`1T1PI PME#:,1 0SC P81P`8@ 4P V` W-@TPUV ɴ0@P 81PU W 0 P@T U W 00 bX= -LM`Pp4$ K*V`U (KN@P  $K( 0!20@Wp Wpp,40#00 V  @ o 00CS0<0U@TP0@0P <I@T$K  K$axX=_, 0-0 0P0 @L R 0S^ UPR 0SQ\ 0@@<00\, (0X=PaaLa4D<L -LM`00002p0嬢SpPA0S @ 0020@00U 0P0@`00 8Q X Q  00[ 0010S+ 10S' 0S$ Q14P0p;0QhP P@^G 0|\ 0S0D 00H1P 0S0S0  ! 0S0;0 <0 R 0SPP 020d2,0 0P@ d00S 0S l dd! 0S $00S U DPaaax=4|=ddh d<`,`_ -LM0@K 4 p4ʱ4,KPP  , 34! R㵱@W`8@Ē S2 `R 0 @To!V @W g= 0S1H20S 0 42D 20S" 0 2pP0 1!0K d0 1p@`@yF0 0!0000U00 0S6㐪P1_W`" 00 10S 1!00S @PKP @PAF 0?0K F4 }^W@ h00S0p >0i@0K (K$ax`3h3_x=4dh`=|= -LM$PK@p ߰`T`00 0S 0S# P $K  KP 0 S  㺰 㵰 RX0!P@ @ $K@ 㤰T0d0K$aX=ax$ -LM K␰x0P 00 XLK }}@, K@ s$a\=0H` p-8@L`P P .PP@Tp -LM$pK` PN Kx@P  E 0!@ R 0SUUy vP@D E (@$K K$ax-08 00\ $< 0S0p=a -LM@K 400 R000 $a\= -LMp0  @7, Kׯ$`V00@`0 0000 D0S4  $P0``:x$PU00tHݰPT4 R 0S A0@ 0$@,00@ 34 (  0000003@ 8`P3`0#004눣@0@S ᇨ눀XP 0#ST ,,K ZH23 0S 0S 00 20SX 2\  Y0$'33 TR  Y,K )T20S  HBHHb -@DT 20S   10S - -O ၥ`P  eR1@p!@l1 @@@4. 0dl5+   P\P Ο0S00 1 P P #Pp000. P\P TΟ0S00 P P00C0x,> $0 0$0=0S     K D0  cRDK p" R$ T @, ' ' * ,( h+ ) , - p. * * P=0S \=!Z  $01x P\P ͟0S0@0 @ TTc Ta !TPG00D-T S tV x,0 00Nt L,0 00CKR AK`h, P\P 4̟0S0@0 @T T T T@UYCKC/K0)P;0QU 00!S 0(000 0 0< 9[Z9"`6 @+P ,KP  0 ,@pP D0  cRDK p0P  p0S:,: ʟ0(i,00 000<0@Z*Z ?Z+Z !ZH* P\P ʟ0S00 (P@ 00 j'Z \ZG "Z' 50 Q0S009 00xɟ X 4K0p2 0000 X4K0\Z `Z $Zz>  P\P ȟ0S0@0 @$T "T  \T `T0  @p   0@0p~D0 cRDK@ pTt  \00p@j$( P\P ǟ0S0P0 P(U3 P\P ǟ0S00 n(P @00T4K0 @00c0000T4K0 000 00" ${U0  `PPp @T\T Ɵ0S00 /@VK # # H# $ 0$ #T`R D00 `L `I900A[T2,KQP @,@ D0  cRDK P000S%,5 @T\T ş0S00 @L00V 00AP%p P\P D0  cRDKm P@ğ0S00 :P@00 P\P ğ0S00 p%P#P  00 X4K 0 @ PP00T4K 0T4K0000@. 0  Q  @D0  cRDK @#P P\P hß0S0P0 ]P0$00 0   P p   D0 cRDK p 000XPp@00$0000p00 X4KT000000D20S4  0S0 0 BR CC'Z40 HX4K  R" u 000p0C00  <"Z40 HX4K0 0S6P( ( ( ( ( (Z "Z 'Z*)Z \Z%0000C00 0 000000C"Z00 \Z0 'Z0d 000C0@T40 HX4KG02 @p=Ha b=a`Pa=a `t`xaaa(Z000 )Z00CS0D P\P x0S00 f)P 40 HX4K 0 @`P@ d{00%000 0p00 " g}Z!40 HX4K  }Z40 HX4K0 2 00p|Z (Z 0@00000 X4KC 0p,`Z 0040 HX4K \Z" P\P P0S00 $P "P \P `P0S P 0\ 6)Z0S0C P\P 0S00 )P00 '(Z000d\Z< P\P p0S00 P 0  'Z00 X4K 0 00" 00i"Z 0 0p" _00pZ"Z0 0" R\Z D$ P\P x0S00 e$Z "Z\Z `Z Z 0  [  p0  p))Z  0040 HX4K p|Z 00(Z 0@00000 X4KZp 00 % P\P 0S00 Z P P0 00 D0  cRDKp =KX `"<Z>Z R " @@i Rg`W Vc0S`0&00Z 6V0P00C >Z0006 P\P 70S00 Z >P00 S>ZP$L7 P\P 70S00 -P0 0 &PY000 |P00X  S @0000 0@8咡7EP[WP008兡(Z  Z &Z;Z |ZGh8 P\P 80S00 ] P ;ZȠ1 |Zㆠ. 8&ZK)|Z&PF% "p F, 0 4,0! 000B01 o1 0 1 P0,` 1cX T 0T 1  cRCKP@`9 P\P 0S0@0 @T0S TT 0`!E0. 1Y T, } 1  cRCKP@  P\P 0S0@0 @ T 1  cRCKmP@( 00C0<+ 0\m:T;0 Gd;0SX; P\P ;0S00 (P㨫w u0@8 `K0ASb  @00P  PU LA  `ϠU000SI " F 2P l  6@P  <R }R<<f 1&  @P 0 ,  0S < 0S ( 0  @000 <08 8= ;`Y0S (K0= -\1LlMP`@T< 0PUAPh `9:mpP0T\Sq %m@PPD 0S?ym@P xK@`P?&P0: Sh0K 0@  `00PV(K=DaPa 0-LlMP@PŸPpd 0T K&P0: ST0K 0@  0@ 0@K0=Da -LlMxP ` `d PRN0SJ41`PU$3'PA 0Q= 唠KpP1 %`P-0: S)P L0 0hKS0S p0St0S& @g(P X$n%h0K 0@ pPU(K==== 0-,PL@ 0R @T0a - 0L@@Ta p-l0L@` 0S P 0P@Pt@U  `@T00@pa -(@L0 01h a p-L1L@`0S  0R+ 0S P 0QAP U 00S 0S$PU0 0S0 00@CTT 00Px fpVQ@05VJ0   ph萞a_Pap`La d -P`LpG㮞P@pPx0 P000Q0@a P-@L 00S PP@ P 00S|00SvB;@lpl`P0S 03n+T000S00Pa daaxa -LM< @ <0$ 2   0Q, 00   @0 S 204 80 40S2  2@P1 T&04J40S TT <2 0S <00S,0S< 00<0"< 8 1 R8 1  aQđġp!0S<0<0S0S< < $0$000$040S l1b<<@P5 0S4,0S 0S 000C00 00S ~<0 ,0S 0SP <0p@P <0$0  M 40S 0S000S0S80 0$0(KPaxaaah3`3p`a_ 0-00P0@L@PP0ha 0-L M, 0 40  00 ( P$ k 0Q10 0   00 0 0 x1@P) P0 =0S < 00 0 0 T4E  1;  40S 00S2 60Q 000, 0 P% 0$( @= 0@ 0S 0 0 0 0 K0ap` -/L@3P@PۛP @֛P 0ћP  ̛p3$ -LM0S8 8  OK嗜G/ۜ8(K K⍜x8xX@d))R\H P8 D( 4@ #PP X@PTg7 0qP @ᅜP fP$ b%`'7@   |\P lWP ᪜P0 DDLP(7  ,',7  7 @6T! P 0P'@PƟƟ@0 @'<#`&0@/SKW"P|KR"P 0R 0R 0R 4V 0S 0S6T  $U@#e%# $P0S0SEl#0 0S V&ꏟt5P\U `iX5QT% P5P Q#0@ 0S;&#iP40S1&NiP4 $240Ps@_T0 0@Dp  0pb`P20S 31PS00P `!RI  2V @T3P  00P  3p @Z/ 3` $ 30s@@b3P 0  㪕P 㦕P @$@$0 0$00000 0KgP1: S|2 0ShBP 0S&2 I1@P "0Fpc0 000Q 01@ 0f0@ 1 0`p00P 0ShA 0S  0g@T 0]1@T 0  0S T"E%0S  0FPDD"5%PV (0  Wx0  l 0S00 C(KX4aDa aa`aalatPa3,x3$ Laa\Ma`38(a@L* P`H`txLp`dl -@L:P@M.  -LM0@0cSz bSz+ PK  0`R R   0R PU  40$Ă,40S,((0 "4S \W P@~. E&&'4' T 000  R0000000S  b -L4<0<Q808 R` `;0;LD<4 ,@$h b0@LTX`dP 0-0@pL@`PX00ec@P >x 0 0     p-0`@R0 000 LP☙0Pf 00 p p-`PL@l0lq@2VPP8` ᧙  phs.pa - L@ P   P -LPpZ #0#S@P@ O`P -@QL  ồPp``V 0S  f㫓@P@Pf p`V:00@j -LM\p8 < @0 @,14 8 ᲓPPPHᬓTX` UU0PP``ї `PUp0 ,p W4 80<@ |0,  0S `0 \0 @pT Z p@04(Konat3`3 -L 0  P`@p!0 Sm'S ePUpPH0S CTTCH  T@0 @0@0TSU m b__ -L@p`P0S)QPU:|Q00V0S U ePP@T: -pLMP`, G0SC@*T< ?T: [TV:0S 0!RP0S.0 ]S `P) ']TV% X/`! ReP Vp|T0V0X0S )T V X*WpG  `P,0U:V P w3 -LM@Q` 010PU40!0R-P00-S Q  0 0, 0 R -P 000#0+P0SPU , e0 -P0 0:U?Upp ,U;U #U ,P dP0:S0?, 0Pz 01  1PT 0k h:P ;P- 00 0R0! R0 0;P :P,000, H 0,1  $1,P& 0= i?, :007,P0100+#P- 00`pV 0 0PPPpPU 0h 00TP0`P000? , ,(K訙PH`3 b͕ p-<`LP@1S •P @%T@p0 -PLM8 pR  R< l8< 0Q858 5#4 %4 5 S8 \0S8 ?S *SR[S SMSJ:S0CSE4QM 0SM0!SI , 000 0S0[S0 D[SB0:S?0:S@@`cP 0S *Tf dP  0S4P P@T  0S  r R0  r 0S0[S0:S 0S0]S= 0S Q  Q Q4[\1 (0S0-S R0]S R  R Q 40Q 400\00S 0 0Sw0]St0 ,0R pW4\ W 8@A< 0P< T@*  P 0W8S`L< 0PGP@   r@p@P < 0P<@  0qV Pl@< T 0WP_   K`PX 0W8SA< 0PNP  8<@ Vp@@ P < 0P9@< T 0WP,   P% 8`AP  @ 0DPPT `< V 0W4\ W:8< Q  0,0 < 0nP (K`4 -pP00`Q0L@MS@%hPeT@P0f@@T\PKT0P ܾp3 05Ka 0-LM@P Kl0S  P00 R0Sp008 0-L@PP 0 p-`PPLP @ʔ P bp -\L(MT2K R 0S %Q$02K00 KPaa p-LMD`@4 P0^0 ~KpPa\9t -PLM`U0p`QR: UU UR0000` USQ R*@K$ l0 U00R0S80   U 0GS 0 00R0$`Pa(aaLa -LMhT0Sp! P( nakK=0S QP%Ut- P@Ÿ0U% 10<<}WsP00x   0P0  %Q  DK|!p40D !R 0-S+S00S 0SQ ,!0S#0D0 !R t1S0P0D010S00tQ 0S l0S x!R D  0Sb ]t1S D  !lD0 D0!0RD(K=0=Pa_e h3\ 0-@QLP0 00h艽0@-0PSH /S``V@@ /p/\ \R.00.\!/\\ .\0/SS0&R00S Rp0 R  BR0/SRp0L0 S/S -Q4LM0 /Qp@0`0g.Q0.S0S/S00#0 `V Y ,  0S:S00SQ000 f0, , RY 0/S Z 0S ᥒ 0 bRP@  ἐ 00S@/S/00,0YQ 0c0` , 0 bR@, 坐, 00S@/S/00`n P0 bR@ ᅐY00(K`3 -LM00lSp@ upPUP@/T TQ /X_P `e:`V.T@V .T 0.S  0w/S4 W1@/000 0 bRB@ 8  BKA| P@0Spp( K0 $C(4[/S0jB.K BpP PU(K -LM@0 0 0  0 嚑00 K 0  yP 0Q/0000 `Ka -pPLP0PPPᶑp`0V`@X `}D0 ʏU 0U $0h+`3aaDaa 0-0L @ 0  # 0SK0[ ,$0 0 :Q0a/0 o0 0 P  0h 0 -0L Pp 0S0+ $00j  d0:00  X = SU, @0  d0d0 0 8 @0`d!. ڈP0S0 0;0 0T$000  ᰏ000``@ V 0 90 0 0 090 -P Ll X`  R 0PXX@@ 0 0 d@d0 @T8Np4 T$Qp p`` dPK0S0 0;0A 00$ `` V @gT  娎 0 0d0  0-@PLP p 0h0 p-LM @P% u8 0& 0PKS0 `K $0P0&P0S0 0P;00$0 P0SpP 0 0C0P x -QL0MP T H H D P %PP0pL0 q  R 0 B 0H@PP @H@ .X *X  X #X7 +X -X2 hX- lX# 0X+pGpEpCpA p>|;TT0  D T 2D@TDpaT L@ T L (0lSP @p  pP  pDF00! 0H 00L 0 RF00 <SL0  AD L P @PPPP XP cA0H0S 0c0HT|ΟS񟗦} { ~ ~ ~ ~ { ~ ~ ~ ~ ~ { { ~ ~ } ~ { ~ ~ { pp{@T  T `T0 T P`oX: dX iXuX xXA pX? (KVV@D@ (KPu`D  0X V{X0l 0X | P`XuX5 D0S-0+0, 00l)(K1A> `0 @P l 0R0l# (K%2> &B P0` l P Lx0X00@0L@BB(K l YрpL T 43\ X T X T@0@|?KT@ ?0K?K?K'40#0 P0SL Q`qL `i l= S`fH-P+P P0S X PX0C0 0 0H00IH0 20P00S X :X0C0 0 0H@I@YH@  0xS0S X !X0C0 0 0HIH  00V 0pP0S C X X0 0PUH  fH `Y P0S C X X 0 0PU*H0 0H0 VP0S C 0 0PUH@@H@ PP0H   H H(K bx --LM0 0 K 0- L@P u  50 + 0R 0S$  p  0R00 0  0QS 0*A0 0  : A0 PA 00 0P0$ -0L @; 0S0   3 l$00/  Tp' 0 :0  'P T0S0 0S0:0 ;0C0 00$ 0< - L@LG 0Sp 0S 0 0C 0 P -P L@( T0pD ` 0S p' 0S V0`!  嬇P0 00c0S@@ dpW0 X0 dP0 ``h -P Lp W`  0S?p 0S @V@@ *0 `d0 dV0 W0;f| 0-0L@P  Pw0  00 ,g0 0- 0LS@P 6P ɲ 0P 0P 0 0- 0LS@PP 岲PP0 ,  ,60 -L^\Pp`@ZT00\I@|0W0,B0BSV@`;[p0 F 00p $0(`pp ```a --L4MD@K0B 0 0 7dK -p-`P00PQ0 L4MSP 0 L@K0 0 0 PCKp -l`L@pP  ㊮PP@ P P@@ U 0S (0S`0< `0``0$ p   Z -l`LPp@  HPPP P PPP T V` 0[⃋00\{00@0d00 0,0$ (` p ` P  a -@`lL0pM00 0,0< (`0P ᘀ@P T00ӧ2  `vV@,0 Q00 o0a -<0@L   @     a p-LP`@@P`p p- @0`SL0@0? P p 00P@0T:h0 @`DA  A000 000 0 00 p,>0>aa`3 -H"p0LS82@Q00@A2 P 20 S T1 T1P``BTR5 1倉6T(P``2T)P``,0DSTEP`100LS P1\H1H5 `R`>  b`P0  R`0H`p`3V( 0 T # X00 P@0T:t0 @`DA Q A000 000 00,>0>t`aa -1LM0 PPP0@  Q EQ Q P0PZ0 0 0 0K 0R S P0AS@KKK0@  050><$>,>xaHTat$tx -0Q0L0 80 00  0 0bC1!0 ,>0>a 0-< <@0PS0L0P0,>0> p- L0@S 0ES00EPPP `0P@ @T@@T000 0H 0D00S000 ,0RP4 5 %+p,>0>aat`` -L(@P) P㤀p` P/ U0B@0<PP 0`|S00|P00S 0 ,>0> -LM`ءp, PP  P 1T0 PP1@Zl1@\1T 0T P<100H$1 P,0S1  $0 < R 0S UU* &P00FP  R S0P;P@ @V` W0 `p 0pT 0  ,>0>xa 0- LPsP @0S00,t0P 0P\@P dg@T0 @@0,>0> 0-l l@0LS00 D0P {P}P :^, @0,>0> -\0\@00Lp`0 P 0m,xa$> -LPM@NP)t @$0@ @, 00 40 -0S@0h P0,^P=U0CUAU {U  U. (U=U 0UREU! \=U 0UD=U 0U) M= t⮇0⪇ ⦇x /\@@0> xat`PaH(0a|  H о$>  -LP{@t 00 =RP RK41@P0U0`0 { 1  岠00Pp+/@F0@?0P00P00 :00000p00p@(00p0P 000 bxa,>a 0-0L0@  PP x0R00HPH@0S PP00`a$>xa,>0> > p-hLd \P`0US  ,0`000U 0P@TpaDa !2"0S0000 00 0P0 000CS0 p-0`LᑃP @1S0 0 R@00 Q@eDA 01pa X -0LPpP `0@0A 0RBP0T@@DPU -@LP p@0` !0S0P ~W `#QU 0 e0 C!R  B0SP00C0   Xm܂ -LM0pS, ,  @0H0a  0R ؁P' V ``FPU0Sxh @Ԃ000 @0 0P  .00C0PHR    m<  0S 0  0 R dX0S R 0S0  R P d 0-0L @PX  00 Q  Q Q  000 000000X p-L M@`!PPP- 0  $ Kی$ 0R   0 00  p0 0S 00 `0D`S 0` $K$` 0 0 峌Kp4>PaH P e -P@L1 11!R  d 0-4@L]0!  @T0 d1 0) 1 d -qaQAL!Q0 0 $T(D"Q @ TtPa4p唂000㜠0P@`| 0  T@tPa4p唂I  `E  A  o< d\/<x|4>H @> 0-@ LPPj0Ũ  0R 00Q00S   D0 0S 00Q00 000 0h0DaH Pa l0p- `0`@ \0LPm 0P 0S 0S @Tpaa da - pWL`   @# 0 0S !RR `@<0X0 PXP 0  p0 00p``Da p- L@PT00]Px0@l0l@ d0m 0S U 0 0S @Tpl3aa da00S a |0p-LBP0`@ P0 L00  0S40(00S`p daaa -LM0!00Pap8 (KP6 (P3 P10b/@T( X D8P% ŀP R8P58_P ᲀP D NPPP ` V` b d p-LD8`P@TׄP000@ф6Ppl3a -`PLP= P@T 0S@@T0S@ pWP PP@Ti -L0ML@K` B 0p`0P S    D  7$(P0S$((P0S))${P @0TPS@}Py(|LKK `0-L@P^$d?@0S^$Y?0hU p-L`P0@ S*ꄻ H H  0 D P P 0P@S 0P@SPVU@ P@0TVU SPE TKp p-L`P@e3 ph} -LM`Pp,`  %, 0,  S> ,R  0Sb@, @P0 SP@0 R,0  0Sb@~,@P0 SP@0 X/ @Th@~~ P000S z 0S t 0S @T @ , p, k,00, -L M`p, 9,%P, 0TP, RP# @;P NP"dP cPsP uP@=0S@@0P ST \ h ܿ ( < P  Z@ `T"T $T\P$ ( 0S<$((0S))""${P @l0TPS@}P (|) ?dPPPUb,U@-00d0S@PU} 8C80CS! L \ p 0  < < \ D @T0\t%@`%@T0\0%@(%P%0%0$v4R0 0 $h$cP$]@Z00\x$@p$d$0K0 SL$0D 0S 0$=@:0\#@$1$0 f#0'p#!@\)|0\#0 #pW#nl#0@pP0S(#  00#@T" 0S"0" "0"= R20"""0 "& x"0p"d"X" 0D0R<20 0 "0 " @TL0 S@ P00S0S dS M!0v @PTR'  O#0  ;PH  C@@@DT 9T @D W+ p,0P(K840$08<@P\`ht| H -- LP4MD@KB  0 0 x]K -- LM 0  j K -pL@TTP` T TT  T30# 0R 0 P00DS0@ P !   !  @     T 0S d  \ 0H  <0  0i\[ $4 -@LP004 -@pLP00`P Pp@P@@P PuPPPuP@xhC  L0P4D 4W0uU hz4`h|(Ppdh0S0 00 R000QR0[S 0S0 [S ]SQ b -L@P0s3 -L@P 0S0=S0 [P 0P]P Ra -@PL 0T 00  R0 0Q [RP@ b -PL pz0W:0000`$`V 0S0P@  z@  G0 A?V0@0 p`P -[L@GP 0 d hba -L@ $P 0 l> -L@@P> ( T   ( ( T T T T T T ( ( @P z0[h茮(0 x@P Xy00h!h@U ,P hWL`DaaTp3|al> -0LPp y 0w03&@  0` yy@T@ $0W<0 0 h! -@`L zP z0p0y @&x=00 0@@0c0  xZ  oy -L M`@y0P  0SP2y p A 1 00"@P0Ps 0d^0a@ 0t!00h!d!d0n@V@0s 0@00S  0 @? w7 r 000 R00ӑ R \t r 000 R00ӑ R Ka= b`3;= -LM@ p0 0P`+ 0[S(P% PP @  @x g p0 ,Kⷹ,  R(R00 x(Ka -LM4Q0( K!Kp@`0 !00 0P02 WP 0T@T  5P\ 0 0 0 0000!0[S (P000P0<0 Ka bL> -LMHR0!K( Kp^`(2 00@Y!@[T Q 00 @ D@ @=0S0T0 -ې!0p;2100Sp1$Q0 !Q #Q!-Q ?Q 81p =P  p=0p?08p100p 000p0M * 0p0%P pP !0[S (GpT R@ !0[pS (7p000P0<0 Ka b|L>Lap` p-LlM`h@P񟗪 d  , H   hBP`w-P%@ $2 0<0xy wQP hw000@/Si PeKP`0: S\tW0<0볺M~LD0GݐC! P 0,;b730<0)0<0"0<0傽@P}T/@ 00  0d ?0 0<0iD00c<0@0<0KpL`Dap3|a2t3|>H``> -"1L0#0,uP`@  4TG$x / @Q: -L@@P> x D ` 0<0 㓼00c0<0 0<0l00<0X00<00<0,0 (00<0|>ab>` -LM0@ `Pg   Ra 000p1U 00S0 S XSxS   00S  p p00 0@  ,0 *-R& #R \00S&$\$ pP00 00B S r ,P0W B 7 BR00?,, R^l`3= b 0-LM@ K|pP@ L00S00 iu 0S0P 00? 08 -L(M0P  0I    0D !1 `o oF@T @ T$T @0!0K!pKp00gp`P T #00G p 0G T CpC p00g0 0S-00g0   0[ K`3(a -L MA #u0pPA040 000 740`V0 0 0 S, M, T@P000T@T , 0  q0<0 U :0@g DA tAPp 0040040 000S00 ZTX U :H0@g DA tpQ 0 g (Kota -LMK @p-( -LM`p, 00 P@ 0[SP  ß @000  R@0=S3g  zPP`30S PbsP @]sP 0XsP$  &0e k 0  , RZ0S ἼZ|2t,00u ,p 4@ ,0D0 )< @4 80 < ` ! 0T0Z0S 40S  <\80S   P 0 PP000P0,8\0 0D 0\  R@ 000 0T0Z0S 000Q  P0|0p0 s0p00pUs@TW= Z 0   \  ?S 0S<  (K baPaP`3 p-LLH @P` 0`0@PTpl>Da p-0L @T0`0PP 0  0 `PUZ 0 40Ps0ph)sab 0-@LXLs0 0Ps00S0000L00@0 0L@P@u q 00T00P0aP0 0 .PP 0@-0P0 0@$ R& q 000  RJ0q00  R J\L00q 0  RP*0> b=G-PW\@ B\D ,\ $\ \ \ %\0\ ;\F\ T\ E\h\ e\M ^\ b\f\t\ l\w\ |\77 0 BqR700S GzRt700S `7\70P: 0s 0 PJ0 Bs 0 P@T*R6 0 0S6f6 0pL'P$ r 000   P000  P  00r 0 @ P.@T*+R5 0 0Sj55 0`LP 0s 0  P0 s 0 @P@T*UI PG>$5 5 5 ^9 4a^  ,\ 4 "\` +R  P%P#J00S@T*F^f^ R@PU00S UD400S 04000dU4 0 0S30 P 00SR3 0 0S3s`30 P4 00  0 00 Pr0  00r 0P 0 s 0 PP@T*R2 0 0St2p20 P0 s 0P 0 s 0 PP|@Tz: Pt00sp 010 0PPe @10 |1 P00[S (S )S {S }SG ]S     P5 p`@bRP(P&J00[S0 (S0 )S {S 0 }S 0 ]S 000S SAQUR >= b4N (0 0S00PP0Pa P-L@0 p-@`L0@ PR apo e 00b 0p> p-PQL`pR@ 0 Q" 0Q   0S0 aGo 00 08@ 0 ;o 000pp> p-p`pPL@ R  P pT8@D00 0S0C0 0 pF,O>> 0000 o>|W|O 0-4@4P0L n0 00 0 0>|O|W `$0R 00nN>F 0P000 0a\OXO -`L PP@ `0S@ ؉0p00Tω0@S00lj0S0C0 <000c@T幉0@S000PPOTO -PL3M8 0880 3`@Yt3@0P?0p40 ,@ 0@ T(30P4 S,P,p 0p@ W0h0P40j S P2 0b2!p20 @2 PG -< 708P00\0S00 S Q   U MQQ0SS0… Q^@0# 0´08P\<Q 0P0PQ 0 0S0a 0C ,a 0P00 0R 0S 000pP@T*000S00 ,@S<@Z @>@P0S x0`00ЈX @000D00 S  00c0(KxO>`OpOdOTOPaPOtO -`0@ X0LP0  nT 㦈 㤈$0 0 0 pOdOlOTOPOtO -0@L0S Rn hnDODa -L|h 0- P@L:n0h6nDa -H0L 0@S  ,H@TT^[@@$hWPa 0-@P Ll 0 00h p-X`@L0nP,n l0 0 pDa -LM@Pq0S aQ 1P@@]QP 00hA 0K 0$0K0p(0K0 p0 `PwPB1 $W 0P0(0APn ἃP U VPUPP|00  $0c0u03Q0SP0 000H0 @0 <08040K4>> d38O0O,O> d38O0O,O4O -L M`Pp0/00#30#`0/00  PK? 0P00P0S@Jd?0SPOT_0 Fk0 0 0? `:k0@yS l       l    $  l                 @          $  \              l  @ x    8       d  4   0     x X         \ \   (    $   d   \    X   \      A0L0 LPP00U0S0 <@T S 9P 0S kTL<` 0 bbPp@k  @i00Q  iSk0p;p@@@; ;< < 0S000;/; ;@ ;@D; 000;L @t 0{P0 S cRP cP:0 @80*0  UP 0cS0WSwSx:0  r: 0t:000 0R@s B 0:0@PP@0P%S@0cSU0yS h90P0cSn9 9I9 9 0S000  cP`FVL9 9Ly 9P@ 0 OP`FV@T 8 0S0C0V 8@8 99@ 8@qtH0 0 @0S0C0bVP8`V T8 4800fcpX@@P]00T87 @8 (8(8?7P88P7 @7P.GWP00 3GWfP+00f 07 P  7 T7 T70S00S 0 0 \0@ 006 6 6 mP6 Q \6@ 6 6@0S```6 0 V\6 Ɵ0S 0 `0000 05 60 c`bEV0%5` 5@ j DE \ P5 5 50 S ``08T0P4 85V@@ ,5d0d 00d0rx|4  kTPw DPr 0 $0\<$0 S00L$00D484 Q[ T4?Q@@NP@$04< 300CP00S43T PP@^\``00 جpP U00S @hP7p.X@72Pci@0 P0C 0 /h 00Z  P V20@P90 R r 0 R  R r 0 R R r 0 R 0S `V@r 0 R Q@ R`1 T11 1 0`R00 R r 000 R DJ PEPV 0 0S0Cg1 w0 0S 0Аp0P@0D r8 h000 0( R|@00 ӑ (>DO>ON4`Da8O=NFxaF4O|Od3=;Pa,O>LP MPD H DΟD>8> 0>P (>(N$>$n > > k.>Ο >HD0 ^#PP@ P PPP,K⌽= ,0 LP0b-Pմ]0 a0bM 0R 0LR |M0Lt-0g\-g@MD]  g g = =0  c= B = <唬<匜<̟Q  P 0 S<  pP Ro L 0P 0P  U0P  Rl ;0 0SP Rt@ ! h! " $ $ $ H 8" ˟^ P+000^PP``0^HKH; 0Q0AS0C0 0Q0 0 0ӷ0C 00· R 0S0C0 0BL c0  f0P|J0Q `  ae0 ` a |:`0P @0S 0 p ae 0 g0b 00S0b`0pt0 S P00Sl9` P7 P/ P6 Pl 7 P.  P2*P P-|9R` `P800O T)a0Pɟ000<)0cSsS CS@9@<B8=8!0S 5H0 0CR,8` ^` 0  cje 00 0ȟ0 `0S 0P0 0 8 "P P pr0S7 00C0t'P P P@@ 10@'S7@@ǟ00@007`` P#7/U0 X P @@P}0 S56@0 @@Xf &00xF  0y0 PX]0000@ Sl6hƟ 000C00D&00<6P>10@<&S0000@000?&0 0P0R %00( $00@ S 0 00C005 5R00tşp%000d% 0P0, Xş00 y0#P0%005 P P``s4@T0S  @ğ0 ( 0200h$0PP@T |4 D3 @ 00`0 0E@s0U3 4 0UxCp@0KS`0>4>t3XO\OlOTOdODa`OtO|WpOxODO_4NOPa>>>>r >FO>MЍ$ -MQL Mp  S㽆W l 0S\2 P HR8 <PP0 ,20SKEp  `V0: SMK@D @D 4Pq=dP 0@(K l4R SldB Kt1A A0+㲋P X. "MK@D<1 @D04+㤋]KPEP PE+c d`dVbP +c+cz cMK@D @Dc 0p^EPXe+c(Ki,lt <4P4h 0-LP M@P \|0ShP\  R*D00 0 0K0 -L<<0P>$ R0 0 0X5h -|0LRM~Kl TpX `@P@  0@ K4td@A -PL M咅,S 0,SS0 afS nS 0@K 90  x0PS K8L -FML MP KHp H@`㔐K1,,,Sp* 0,SS& g  0 0CpP 3 p@0 ʂx01` Vڀ.@0TS1!S00Q0S<QP (K\p p-L M`Ph 0(0PX0,P04@000000A00$0(00 Kp4 -0LSd0@``PpH  %P U0SR˄ m4 -LMMOKMH@/pKJb` ^KDb @b KK1 01 01 0W00 S+  0ApP  KTp@d0 4]@t0^K 1 *a0 1 0! Q A 1 ! A t0J^KPEh gR@ KatTk $K,Dh4i44&B°p -VML MPp/Vp` E OK/` $P -R@P t0G]K PE-KZ/`\0 KT0P ᳀ r RP4E K8BiF$B -LMM/NKp/``0 2 Q@PK ^^KPEPE2~K`,`0x 5 @C QP `߆X O_P @00T(Ki4 B"B -LM@/Kb` 0 d0C" S7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 0 0 000 d婂0 \0\/KQPHK0gS ,0R((Ki 4#B<H -LM;NKe /U`0 3 WQ@P ܻ0S T`(K'KjKAJAJ ?I  I ) 9 =, _ğe06 9(K4 0)P0K_L&Q@P / VQ >K^P)Rğ4$|09 (K02PK8C8sf@K2K T$|?K?QSfK<$u?3St: |: : : d: : d ddddccQs #3QppK2KKfK0K >K2K fKK0K pp/ 9_8"8Ÿ09 9  7 |PPU' K@ 7S< < < < < < x< a a aa$babbK "7> 3CS '7 K@!1>1 K0GWS y;0@l!P>!(K1 0|!BK>6[ SXRK,6[ S@K+BK0K RK KP10S K 0s3Yt) ) 0\(Ki4 B,"B`xi 0T!Bx i p-L\Ml@KP P+:+P) @@.`+P @K< !\@K< @\`p0S.S0 C.SP @0S0 C R000C 㓕)&U TP R0@S0 CX0W0Y0 4K4p 0 , eP $(K訙M :MЍ 0-,@,PL(  E<| -LM  \P A!1^ K p" 0$#4 ';P @ 0?^L K p\d^ 0 DHd#4 ,$\Kl,4 -L M`P H OPH-OPpf^= jPD  0D0 0r 0ST00d2P@ G^@uQP  q1 @P H/^P)^ TD0S 0  H 0;0010S $  7P ^100X ӛP )0-SX0S ]( 0@0 <@ S,08 440 0@ S@K, ^Pp] \P ,HP H](Kii8Dit -rMLMpCKsP 2Qbn{P^20S  e{P _%20SL W{PG KPB3`K᪂* [P2 RDB@Pn 0Pp820S 00CS00@Ӥ0N*@aQ0S 00CS00Ӥ0: PpyTYTN sPI s0S  @@]1 1: SsNK@D @D P ! KPKPWPKrP0: SmPP  ] 1: S C/K %$KiiH<i\P <\00S \ 0   \PPmJ40[S  5[0Se|t `@L0VU D00S8 P $(K@,T\t <x<MЍ -0L J< -LMP`p@sPp p0@0dSAT VaP\G_KC@P < }W .#P@GK⣳묙: -@LM `PV V00 Q03*,  0,, pW00P0 U 00 @ep 0 #P02@0P5 :0#P *0@@,0 PdW p5 0-LOM@P& @\@0P00 K.D10@1P0  :=K0T*ij -LOM@&/\@0P00 SK~.@10<1P0  :nKT*ij -Lp`-P*+@P04`0K*K0C8M4>K0C4A=K(0C4$QK 0B*K44(I C:K$$P0B*Kp(I4 0 SKc h 8d h h h h h h h h f h h 40S 0000 0 0;0S000S00 01 )p 0+  (00?0bS fS)0S00 R< 4<̠Č8#Č:K"̌,K$D4, -*K 0%880SҰ0 0000 0 0 :K P$ Z0`<`:KdK 2)p0`06PZ@`0  0K.P T d Km P @T`P d p@ d0Kp @T `ȓ `z*K@ uV@8ap0SD h8,P 080(x0 0S$o $`@PO dK -dK<K./3[0C3K:K3[dKS3dK -/ R)0S S S"Z  wZ:Kp0S   p ,<4("4!< 03[0C3Ka3[S>@$;T0 0000*0S<0 00S 0S 0S8A"000 00 000 00S081 0-0 000 000 0(K 1 p-PPL@00+`)@P L00040P0 ((@+p c -L@M` PS S0 \13000 55:W00000 0 S,0 ,, pW0000P U>*0  0 @ep 0  P02@0P5 :*0  P $*0 @@00 PdW p0@ TP3 : 0S 0>R0@ 0@,0qU dP"(K5 p-LOMP@`#0 >|P0P00 UK+H10 D1P0 @@ :f@ ;T  00@KpT*zz 0-LOMP@#uO P@Kn+߮D10@!\0P PP :1@T (0 ʮ@00SK0T*zz -L@y#000  PhX*G-M T 0 $0@(@ P,P`0`p 4p@0Tp  <0P<` 0Ԣ($ 0,($0P00P4@ h ! @(`$, <@0g\ P. 0@!g.,P(@T<@`0$ 04@, p$0( 04$(0Dp4pHXLP @ @0 ! 0@!0@ Q18 P!@`!@08P! LPpHI$PDHpf.. 0 p 8D0#Hpj!E$ 0#j 0P%@@X@ 0H @^LP@D PpX  `DHL@PPT@00P0 00 pD0 00H000000000 L@000 PP`000ЍG-M0@ P0@0@0@0@0@0@0@0@0@0@|0@t0x@l0p@408@,00@$0(@`@p@P `(p08!AQ aq$(\,00P 4!81@0  0p^P0Qp nt ^Q nt OtP@ t ~ NtPp t Nt0P0L0#,0 #(8 , 4 #@ H0 < D H #",#,L P H .(#T X H "D0\ #<`0 D d "(h D0l #4p0 @Dp.\..40[8[T@[?  08^P0Q8 n< ?^Q@ n< QN<P@ < u8 GN<P8 < AN<0P0D0#<00 , D04 #880 @0D#\#.pT.l0[#4<8[0@0 @P劐pP0(KoA 0-PL@ 0#<00#800#400 R00h- -pRLPw D@A1>0O `cWP: 5L@1@ T@D SH0 0@H0L@pf.L@1 0S@DBR@H0 0@H0L@@00 @TpG†@0D@ S H00 @H0L@`W W  PK@1 0S@D RH0 0@H0L@ \00-PLP gM@0@0D@H0L@0x -RL`? D@A1>?0( @PcXPp: K@0!0@@0D@ehK@0!0@@0D@\@00 @@0D@@H@?X X  PnK@0!0@@0D@ D00-PLP M@0@0D@0 -LOMP`@Ϩp 0+PŨ0 S 0 0p WKI%H1 s000P10H1 KQ`0 S0$00DS$0 0!$0D -MLM`p$!PP) 0V0 BNK@D@D 0 PYP0 Z RP4 W\  qK L@0`p\0~!{!P$$K脉  -L0M`PpP) K.0 P4 0S B0"S UD@K bL00 KP(@Pu("(04"48#K -鈑LM`, W0RSd0 S SMZK hP0U UP SBU U8p UpK0C*KPX>\00SYP  0`P@>KpD<@ p-LL>@`P 80R@P Pޢ@ph>\` 0-0@LP> 0 0P>0\ p-LM⽢P  0@P t0P 0PL`PU0 8@( ܌뗢0@00xT`dX -LM\P`( Kp 0 @P F$0(S`Pr"0 0;0S0P0S0 @BB  >B :BP0P@S0P0S0 P0S0$P0S0 (B(0$ 0cR00 B  K` -LM@Pp,@ >!0@0SVPp% 05@KU`300K ,`K50K0 A0 @K`@@ < t0P`ppV \@P0`P0SpW@@ =(K\`d 0-LMKP0P,, ;@P P ̡@K0d -LM=00SP x@K0 00 200KA H KD+@0 @ P,@@ =K\`d -L4M@p8`,@ q=눡X 兡1@0SPp, 0V쀟,KEPP@1@#TPK 10T0K@KA  4K04P 0@ Ppp0`V X`@P0`PP0SpW@H@FX00 -=(K\`d 0-LMKP0P,, ;@P P *@K0d000 0 000ᰣ -LnQS(0  h,00 -0LM0@` @0s 0P$pK p$ P00R0SP :R Ur 000RPU$ @= 0-LP@P 0 S Sp00@ r 0R <P  0蠠000=T -L0P蠕 -MLMxPP"0, 00S S0B,0 , 0RB,0(K0  CCP  dC@PRnK`F`FKK,KPT00(Kp 1 -ML Mp4PP#1, 00S S0B,0 , 0RB,0(K0   C CbP @P[BnK`F `F2K,KPM00(Kp 1 -LM@`p@P0 P@ Pp#K 5| -LSMP`p@  0 Pԟ0 S 0 ϟ 0WKXH1 sƟP10H1 K -LPp` @P d000S@  S@ B@p080400<0 0\0ت -LM@A0p8`PDH 0xP' A0S#XPU H 0-0KR0,0KI00SR I0P P,K⒇P0,K V# -KKC -L$MP` LK 0 Sh S S A 0R0R0TS@0SQ@0S  4K*K0C M8>K0C8a=K(0C8Q=K(0C8(P 0B*K88 C:K((40B*K88( C:K( 0 Sx ( H h 40P0 P 0000 SL0SRL0S 000 00S00S00  0 .V S:V` 00FV08 KPy40p@P  Zp 8K p4Aj0 00lsp 0y (00?0bS fS0S4 0R  0 :K(45<*K 0F880S 0SP\):K P(n 0S<`:K(0 5Z`P0`0*K84pL*KpK p0`0?P:K8S@p KP@pH K9P T pH K0PHK VP|`P l p@p0Kp @ T HK -p `Ԝ*K@ ϜV@4aʜ0S 8>P 080(pw0 0S$0P04 $`:@P  pK_pKHKnK`F4[0C4K4[pKS:K" r_*KpK{:K8"`VR0S SL- S SG6Z:K <*K@P8*K$" 2Z0*K2P**K @p#:K ZY:K /*K Z Y :K !*K p 4[0C4K4[Sc@$`T'0 000090S <L mp`K0 0+0S00S 0S4A:000 00 0P0S00 00S041 0 -0 000 000 0 `(K 1 -L@`pP 0A@ -`PL@›P00pPP d0T04@0 T0L0P0 P蠰   -LMB^KM`PE@p x0P 0 @@P <00SPP<4p8@ KȺ -L@'P 0@0B -LMBKMH@`H p 0 S񟗹L l 4 D <00S00D00 pS06Kp@ `@ >,0 pK\ L0 ,P l  K0d -L1M`0pPKA4 8 0 p 1S01 R rP 8 00000C00SP0 r [000%R@QgQP'eQG*GQEQC*9Q0Qk*%QA *QP Q7 AQ6 DQd[Qq OQf XQj LQBcQLP aQ!pQ jQ3 hQ4 iQKnQ LlQ1tQ6 qQ1 sQ xQD zQ. uQ=PP0SP 0S0 0C rK@@0hS@@0lS@@L@@ 000C @0 w 0# t@K0lKl"K60^S  0J_C0 S RJ!- JK0P-S ]S S@Q00]Q0SJ_K0 RLP8"K @0 2  0p0p@  0p p @p p 0Oq '000 @ 003  P0S P0SP  00CS0P0 r T000U񟗶 $ < T X  PT0*0PdP # 0hP P 0P 4p4 X P0P0CU  SP U/0(K 01SSU$@P0X0C000  0ShP Ti (K001SSPTd 43p043 HX @ 0@ B0T0  R?P 0 r U000 'P@ 0C00X0  0S!P 0 r 000 4 0d p4 dT0HʏKS8SJS0 9R 8R%*0R +R+ -RH(XR+ A0BSAaR>:fRxR:0PI0 J"00003 J000S03 03 S  :J   60K0UI0 0 0CS0000PU  ?K0CUUUXPxPPE ;-0 80#J80#   0p@  0p 0p @pp4# 4# 8 0`_ H?K8RPPJ,0 9R 0RJ#*-R .R +R!ER eR  J  J9S:J0 0CS00005PX   _K@PEt唸T-xePEP ኸxᇸ;0 8w0p@ 8㒱0p8C0p4# 4# 8S 0e4P4 4(K= -DpL0`S@Pz 0@Sx < -L M0`Ⴠp6X60S 0@P0Xp 6@ d0P0 Xp@  9(m@  b:$K -L  -0LS@0V0000 -vMLMx 0pP|  p 1S01x0 0S x1P : 0h 0x'00 S80S5@?KC/K 1 4C 0C N8xt0 0(pK|rK0pT?P,`LOK(K Lp Q a , ( $A < 4 Ph  1hPh (K0@x0@00@PK "K@@ Hp dP \@ `@ 8XK|'0hG pW  @' dG PG 7 p@G"nK00@%S@D L0K 0PP@ T `TKJh10`VFp`` \0 R0\0 ` p xdKNP. Kp' h70h7 U0@@KDPK<7 @G l7 8 )0K*0K@@  '05 5P10h  Ill l l  @0S1 `B `>l'l7 l  @0S1&*l@ @0S 18#X `!0 8#X`l @ PQ`P`  P 1P` 0 P` @0S10P`P`x0   H *0K@P㊡ D D' Dw  28Wp\Dw  _.PD8WPaD3P"P0L7 )0Kl' l' l7 l  @0S1 `B `>ll l  @0S1&*l'@ @0S 18#X `!0 8#X`l7@  PQ`P`  P 1P` 0 P` ZH l l  @0S1 `B `>l'l7 l  @0S1&*l@ @0S 18#X `!0 8#X`l@  PQ`P`  P 1P` 0 P`lw 0  *K 0)0K88Yl0̣l 0Q0O/KD' I R OK2D 5 :R3 58wPD7 Lw NOOK!1 D>A0  `P`D l+ 0R000`D & 00 0d P`V U00 DD' 0DO?KD7 Hw %2 D>&B lP`D DO?KP`dU8L T1Y 0.K⠑K)0KL7 D' P)0[LYS*0[Sl70t7 1K000` \0 R0\0 ` PxdKPPKDT'0B0` \0 0R\0 ` PxdKPPKTw87@gTr`2H` \0 R0\0 ` PxdKPPK@DT0p@` \0 0R\0 ` P pD0 `  \0R0\0 ` PxdKPiPKXK\' ` \0 \wR0P\0 ` pW xdKtPTKp l. <@iTaP'p'(` \0 0R\0 p7` 0p7 xdKVP6pKpw @DT0p`@` \0 0R\0 ` xdK@P <'h1 R 0`R\0Sh  xdK.PK0p `0 \0S xdK!P0`0 x'0@0h7 }p 00hw PY H$@P 0KP Dah(K 505 -DpL0`S@Pu 0@Su <QRP000S0 -LS`P' @ 0S\00R001S @ | T0p@ 0\ -T0Wp@d 000X&T00S <0@@ \ 0 0XU/<X* < -LMGPPX 00z`10>CNKTa@D @D 0P3KHH h p* T0S \PT3 4`K Xp.K0D@K0@3[<3K03K\ Ti  (0!"(80S 00 @3[P3<8ԼxP@<0X0P(K  0- L@f_pP  >Qp  8Qp  QKp s0$S o@TkP@0 p-`PLU@`HP`0h`  h0S0#*ƿP0h``0p -AMLM8pK`d P(K},0SF"[3RB2[S?2[p< : 8 CNK"[ @D0@DD0H  ,0S+#[<0R'#[80R#@P2[  W0 02["[[AmK0`F@`FT@D,Pd 00S  00 K -L0MP`XKS-!@ T @!  8 F$8 d, X100,0 00`VZY`w 0S0%5,0 r<040R(0 0ZY (Kt -LMkP"{`@p{xb"Kq 0Sn"[0hS*1 0Q Q Q QD1Q Q6 Q=  O4!Y;   !O! J&" 00S   0S   [`0 $000 0S 0"[0hS,0 0 0Sh  0-< LP@ P0 -0L.S@P#P*QR00)P00X0`dS F>R`V@1@! I#WP P0@0S.pJU000U -h3LM00< 00 0s 00 S P R P u@0+S  -S00  ` Pp8 4 !R ZZZ Z5@ I$`V"0I845@A$  8 4  0L.\  0 S00S@ P 8 0O4S "8S 8P 4` `4` \<@8 K  V d1d0@0\ 0 R \Ap 0P0 00<110 0g`pcJ W  0Vd9#Zp N`p X 04085# <0 @TV00 (K== -?@p##pWL$MX< 0O?   BE!5;t l@*"0 01`V#U!42T100  8 4   08 4  0 T 18K1  8 4 @T0 8 40 000 8 24|A$p0OT?@ 00@@#U[ UDe VZ00@@P` @ <  30 0r03Z cY 0zdyVUZ00@@l 0@ 0<X  D 0 0<4 `  (K p-H<`LMP@1Px0Sx -LMP@ R@00 00嚰 -LM@HpMЍⅰ- 800Ms00Ѝ p-(LM"X`  p@xx -LM   P~@"00S0  @0 $ !K00 @P $K p@K$ -LMP p@ 0^ Ƞ,Ƞ0@P` ("(p V`00 K p-LM ` Ƞ,H@PP  p 00jKp -1LM`PV@7  0pA("S*}"0 0(Q% 00P  000 `0 P*@`  $0@0    ? - 2L}#00p d L cpd 6/}0(S> +}0S '}0#S 50 !S0S0` 0C# @U  000PP P^G@` T0L 00P00 R p LX0 Q dp  PpWU  ,0 dSf(K  H5   0-@LMP$0  (0P0CP<0@008 $0 R0MЍMЍ0McЍ 0M 0 Ѝ000M00000ЍMЍ -LM@Įh 0-LM R00 0P0@pF00C08h -LM@0S -LM `@p 0QP@150` !!@c + RT -LM0MJK1@D00@D`* 0 i LK e P Q  0000 0b00@sPU:K0C00CUD0 @ 0s 00K<0 0 ,0 00 (0 8 0$0 LpK  bp@ |0S |07S{#00P{@ U p DF00 0 SeK , -LJKM@DM@D`*p  W@  0p000 0b0QZKPEPE p@ {0S {07S {#0 0 P{ @3 K 0-LM 0PQ@{"0 0P0 0 0 8 0-LM0 0S@Pp80  8 p-LM0P 0S@`p 0 000x p-LM` X0PP P*P@oP0 `0`x -QLM@*P T@ -L$M`p@0 { 1! /< |P +^p@,ZP@& +Oap@ 8PK  00 000 Z00000 ,1080 4@ XpP0Ez@Yt2z0S. a< 0p P*(@z?00tz0S<`l d0p P*8@z?00@ R00(K訙l<wd LX -LpM`10@W,0   @K}@PK yp@K@  P`P060#0P@U@K| \  X à ~ 2P0\0#0P@U@K| ?  ; ᦃ0, 0R (K ` -L\M` @ V^PP, p t x a 0Cs^0l0 PX   hKTpK| :(< 0|0(((  lp t0@iD0@00 hKp t0\X0D0 @0A 0@A0#Q 0@ T:V@1@# x@KMx `d x V@@PKl hK@K ,0 S 7(K l -LM@i"P p WHTHQHTCat -0LMM0 ,0 PPWoKJ%T1[S   <@P UK,MK c0 d" y.㚣Pp C ,0 S(K | -LAM0 , 4$ 84 `@ P;y?0004A.pP 0NP )y0Sdd!0fc48$kCPD y0S@ 40B^KPE@DPE (0K@tD*pP?p%0 Bc%@P P 0+4Jf Pxhpl 0'c04$84nrPmo ,0 S0T(K \MH\ -LM< @ Pg `0pKV8 D0 S ◯`PT 8  80@#P0S> 4 |PP8 $ WP@ q@P8 00S4 KP 4 R ;;S \@P"0 b<iP 4l FQ@  0 8K@PV $@(KlTRMA Q:0S Ѝ -LŸMS 04 < `0 80 @ D Y00K00@PPU 004SQ@04 S  P<0eS\00 @000T:0 R 00S S0B00 08 QR 0E 80R P000C00 0<pqp3\pW  I@P<<@ Q 0 C00<@  pX00V00S< < R9 #P4 0<pP@"0B 0S S 0S 4S8  S4 S S 8S S R`00 0S 00<D R<(K -aMLM20$0 pP" p` ]KPE[NK@D + 0K 0 E 5 U\e pTAcK℡PXGk06: S  S [NK@D+ K@@}P[NK@Dp1l!p 0K@@X@9@UTSaD[NK@Dt`Pw0S V K0UCf`PX% !n/Kh PX[KA* )8HR@J*RJ@@b+P 8#8R0PE*RPE80 U$:4U00<P"ࠃࠓ0^, # WY0!#k*hpSD @rPD  D V 00qU00<!ࠃ ࠓ0^, ,0,P# 0c6%7C93( 00  @ x@ 'x0,8H,PRU@@A@ 9:@b  `0@8#8R`F#:@ b .Ƞ%8 8"H 8R:,00T00S N04T00R`FRA@@ RPE;RPE@x'x ()8HX@*X@@h ,  8#88V0*V08P0f35`H0 D` SH D HK(KSy:4\00<#ࠃࠓ0^x VY:0Y `H D` R PUP:4U005#0\@e(8 %x) *Z 0j6C93%x40 8 ( 4!8HV@:@f  4 8#8V:@f  )8HV@*V@@f tU 00R 00CS00<!ࠃ ࠓ0^ 8 h5p8, , 6@92'00 < { <@ g @ *0`&8HRX@@@@ 9:@b<c <`O 08#8R`F#:@b@ 8#%Ƞ ( Ȍ"!Ȭ T:00 ^00S 0^,P0Y %138D H0 R`FR@@@ VmV@Za 0- L0@PP0hp0 - LL0@P#`l 00 0xpp`= -`EL MpS@`Hp D P>R[R0:4R005%0\, 0l\9c%  x'x )8HR@J*RJ@@b `  8#8R0`F*R`F 0SS:4\00< $ࠃࠓ0^,  VY0!#*0H D0 HK(KR PU:4U005|#0\@e(%x8 2 *Z 0j6C93%x40 ` < L < (4!8HR<0@0C<0 :@bJ `6 48#8R`F:@b< h8` 4   )8HR@J*RJ@@b! `  8#8R0`F*R`F80 S00<!ࠃ ࠓ0^, q ,0,p# 0c5'6C93( 00  @  x@ 'x0!8H,0RS@@A@ >:@b   ` 0p8#8R`F(:@ b.Ƞ%8 8"H 8R:,00T00S+ N0(U 006R 00R`FRA@@ R`F]R0C@<0 F8[R0@-@P l^0,00 nSBS\N_0 0- L@0@P<P $0C0>0A -@`p0 0V@TL  0w@P 0sP 0@0 <0@ `P @0`p?A -Q؅L@P,MT@ PP @PL S0 KUH `pJTzT:4T006X%0\, 0ll9s& <  X%X  )8HX@*X@@h     8#88U0*U0H0eP < 31P T0 T0KL0PS0KUT P TK0 , L0S 0Kp0 , (KU:4U00<#ࠃࠓ0^ WY:Y pH R T Pp PT0KT `VW:4V006T#0\@f< (&x( <0 0& @-1@d4xB 02d @-M+Ѝ@4=> 0 M Ѝl' -LM K K -L MK  K P K -L MK  K P K -QLM@ K0 0#0  E0p03T0S00#0K -@@L0MP  0 0 D 03000  K, K%P,Ki00<,88L* -LMR p@@@pT `v%  P DP00MЍ@-@TM   000Ѝ0MS  Ѝ0P0MS  Ѝ0 RR00ӡ? 2 -LMp0 S( @0 ( 0R$KP !ᥠ ZP2`P8@KE X`PEu |' -LMPR@`p|P@  00PPPPPPTTL*MPp x ȅ Ѕ ؅ |Ѝtplhd`\XTPLHD@<''8) )HE)((((`(4( ('''K*0@-\QPM0@  % = ^:P p p p p p p ؉   p p p p p p p p p p p p p p p p p p 4 ^@8!10# ^00S10# ^00S4 @\^^ 00Ѝ0  RE C ;@\00M00q 2  0  ^0^0@0C@0@000*^?^4 4!20# ^00S  0D ^Sp 1  0} ?^*^ #^[^\00! 0!00 00@ 0@@[^#^ s @1  0~0\  @  0\  @  \00 L0 R,0C@000ĕ@u0\  @  n0\  @  g0\  @  `0\  @  Y0\  @  R0\  @  K0-  @E= p-LM0`QP @0 Qf`00x -RLMp`P@@D 0T 0G 000jR -LMp@P  `P@  @/gP᠜P `$gP -LM<  Bp`8 1PK 0e@YX: p`WGQ@ L VJ*\Q  Q *Q?Q< [Q#Q9 q! X1  0 *10# Q00S10# Q00S @\Q @Y7@*20# Q00S  0A QSq 0  0  @<0S00Y*@Q @1PK0 0eS`80c(K@=I* -LM@P 00 p-LpMP@T { KpdKⳐ`P D @0  0: S gfO0 0R P  1 -AMLM0唣,0  吐@P |}`PW B^KPE PE` #XsP 0#S 8 (  P @ @@P BnK`F`F0 P0DT P 0 P04SBNK@D@D +OD @P F PO B^KPE PE  qP 0#S   P@ P~  @1P Po BnK`F`F0 `壾0DT`  PZ 0 P蔾04SQ%`P& `P `P `P `PX `@P00, 0R(KT` < 0Tl@d)h)\/4X) 0-LM@P8PP HP8 0-LM@P8PP 2P8 -<0LM R PP @-PM ^ 0S^@0 S 0SS00@0DЍP0 MЍ  -QLM@@0 zR| ʛP<  h4 p 4Q `pY:%o$@0P  0Q0` pY*4@4 4Q"0h 8 00 D 8 0<0 RD8 0 R0PI@Y :&D! 0 R0P@Y*U p P< @@0P  0 R0U p <00 R80 Y8 <垖 (Kcd0 0@@ PpPp@ P@`G* p-LM`AdPP2p@ @ eP T  0Rx)d0S xcG*yy^G*QQZG*MЍMЍMЍvvLG* M0Ѝ&o 0-PLMK0@P0$K0K$@ P 0 P0@00 ,@ 0(G*(MЍ MЍtx<==G*iiG* -PLM `hzpc00G*::F*$MЍ -LpMK@M"P : Sl0S  K PM <M (M M* *8*) -LMP : ^P -LM@P P㦕P㣕P㠕h蝕 -LM`V< @0  R 4 8 Yp!*\V P L$VE @X`P\V0@S G@PP  0/S7S@XppPD Y0 `!O*0` @$Q P pG@XC\Qa ^QV ~QZ @0S T 0T:S  PZ4 0Bp^V" ~VZ @Q U-0@/SS80Ap 4 P4 0/SS8 40B0a p@0SpG@0D0 < @0(K0U:Sy0@/SS80Apr 0PS P 0PS 0 CDRcꐟ 0 0 0 0 0 0 0 0 0 0 x 0 l ` 0 0 0 0 0 0 0 T 0 0 0 H 0 < 0 0 0 0 0 0 0 0 0 0 0 0 0 x 0 l ` 0 0 0 0 0 0 0 T 0 0 0 H 0 < ZP$ D  40@pc`>0P/SS;  8 @pb`0 0 u P&P #P P P P P: P 0/S7S 0 C/Q17Q00A!0 P P4 P40/SS4 0P ~ -L$MD @0 D0@@   0000 P`DP @` DK(KP6 D`V6 x0S@00pN90 `2!^:1Q:@P`  DPL50@` `2!\61Q6@P`  0N 0Wa "0D @ 0Z @QD @ @i0DK aSG P ` @LP H` DPK`DpKP 0 8H p<0`#/,LAL00 4@  9 0@@DKP P` `4 K P`SDP @` mRkYa"00@0D0 @@ c Pa0 D @0 "00Z<TL5 -LMPp`@;a00$0 P $ K*]p p$0 P$@0S TZK0 ,`K$0@0 XK$0@T*t* -L M`pa00 ,K@P`0S],0SZ 0B0C2Siꀦ     p    `  P                        p    `  P       ,0*S xS 0K`0S00,0 (, 00 S< 0 , @P`0SW,00$K&0&0,0@0P,0 `0S W,0@0`P"00&+!,W  -LMP```@@pP0@ 4 0 KN\p8 p1 PAO`@0pP xPPPa8P 4` , , R R 0S, 0S) 0pnJ0^'``"00$K0P R0PN  0WJ``"000PA  00A8KPq 2p_0"S0p0p ,K0pP`8P 4` **T*t* -LMpP@_00`P40  4 K[p p P!_`4@PᓻP!@Q(K4P 4P 0I_0"004Pۑ 0 0K00S 4`S 0S0A0Y@t ῑ @ Ps_0"S4`4` 00`I4嬑u_0"00*T*t** -LMp@Pd_``4` P 4 KS[p p P!T_`4 P! ၑ@Q(K4P w4Ps 0|I7_0"004Pf |00S 0< 80 0K  vP0`P 40P 0A0U@t 00 yS񟗍 H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H | H H H H H H H H H H H H H H H H H H H H H H H H H H | H H H H H H H H H 1 P`4 0<K S< 8 ` ᷐<@K04 0H ᬐu^0"00'!%/B!N2P`PU`d0>X0@0 sIZ^0"S 0C < 8 *T*t*3*: Q -LM`Q@ ;1P`P m00T\ 0pPU 0,T@0T4PPV 0S !  \ ,\00S 0 S ,S00SR00@\000S!00V@@`T P @T PὶP WZ  P0pP@4 H, H**++P5 + + p-QL M@P 0 $P $0 PPR 0T`00 0S zP@J $0S $Kg]P 0 0R` t 0 @ G崏᲏`Kp G G$P '@ G| G@TVPPP _0G`@8 j0G~`,+T+++++<+P+t+ -LMǟP ,    0S( x7`V$ p`dG` pV 0S @ LK ('0PlK '0PHG` pV  @0 P p KX0P(p0pP@!*P`U` =JP`T 0nPP]@PW 0,S \SJ S @Wp4 0p0 P9 p KvXP4⠓PP p R R \R8 R  R R R R R|00 0L,@pƎĎt! ğ, 0R (KP0,S@KvP FO0 S S  = WPP = WU5lKLK5= WU5lK5T T T/@K0 00@K0   00@K0   0 0@K0 |  0lK0x t KP 0 bF:00 i@P 0T0- r]P 0 KF   *P P 0 7Fwe@P 00hegP0 F_M P X0 FO=@K0 00@K0   00@K0   0 0@K0 |  0lK0x t u@K0 00,@K0   00"@K0   0 0@K0 |  0lK0x t Lp婍uEEQ P@ '0|  0E |),,D,L,0-|tp,,Ƚ,,,,-8-\-l), 0-LM@rPP@ <0 @8 -LHMX@K 0K [APK -LMpP0p :`p@P> p00K 00US2` 0S(K\)0S%1S  R0 S0 0W 0S `,>pP0@0 P0 贳0 R\ -ML M|8 0ßt8 0t@\,0 x 0H 4H x(0 08 ~KpG pG{P' 4\'Px8U 0hV 1U  R 0P @P {Pt\^0Q08 SP4\ \0p48 WZ P㪵08|0Ÿ, 0Rt(KKB.KA B A B;8 常PP00Sc K@@h(0B<Z hx,@PnK`F`F<  uP0  P PP 0P P PP PP00 P p 00CS0¶>Kt0C0C PP 9u U GP P<'8%P<!|P@g DPyKt0C8h 0CpP $-- 1-. p-0LM@P 0 ( 0S% =S# 0 S =S00SRPd `K P X0 ! 0S0 P Y0 0Kp$ -LM0@=SS00S (  0=SS00SP%Pd(`K nP" q(0 A(  bP (0 1 0S0 TP  K=Y0 0p0SP  0S0aCQX {`P  0SQ Q ``@0 0 $( -0LM`Pp00 P" 0S =S 0 S =S00SR@fI0 KPH 00U04PK40  X0 0(K P 40 1 0S0 PP0@小P 1 00Q! =Q =S 0S0=000S0 ꜀0S80 P  0S0aC180 P\  jzP D 0SQ Q 0 8000 00$( -LM@$[@P0 @W0X5 -LMpPG@Tx` RP00 @ƥT R<7",3GX +X504 0-LM\! 0T P0X!@PP@T 8"XP004, -R00LM?@ D _$R]ʘ"@p0 @t 0-T^ +T@< <  x 3X00S 0T| Rp8 4 08 K K0 P` 00D S tD 000> W070c X8R V)& U0- 0\00S4080 Po P` @DPP@`W00(K@0<0 UW"00@P` V0<0R00S Pu`DQ RpG@p @0D 00T /8 4 0 0XSxS~@0 8 40 p000 = -0L4M`p8KP K@P8@ 4P ,` (p 00 $0 P<0SDKD0K 0@D0 @@ :*EE{:* -LM KP Kwt@ --LM00  K p-LM@PWX0` PPnT  44 0ሏ xhn<|PHLL::* 0-LM@P PU0. @ 89 @T *0P/S 0/S BT:R T*0RB/S T*0p/S0Pa U*T@ 9008/U$0 @P V@?00X -LM0 09 K -LDM\\`, 0 \ V/00@, 0R(K^PK2 1PY~V@(00P0Qp I00A SFs@g P!00@T8Q 00A S`V:/QQ@ .Q(%00A S"P00A S  Z R r@g P!00@ TQy 00A SP)V@00/@P00 QPT@ 0@dK d0S@} V@00x0XSxS r 00 D~ V pp QP. ,q* !000D$  Qx!00ӑhADdPG0W02p0 `VI:00pEv ! 1DW`F/Qm Q@Z t 0h1 T!V00h!( 0T 0Q 0S SS 0h1P@@8e4 80$ 0 <.==H..\.(... -L M 0m9.< -LM0 l-<.oo8*M Ѝ⫮ 0-LM4P [[@[0[ P@8K0X/""~8*jjz8*++v8*MMr8* -L$Mp0PQ` 0  @@K30#" 00 Q 0@0 0RKAP P H/ / -LMX0@K`P$0 p ᶫ$ 0R Kd ,/ -MLMK@ , l p`6PB@F XM 0QLOKHHV !+ ~pP#  yV'0OPU`T@ T@ ln, 0R$(K U ~pPʎT@ TW@UVKAp X$U eʷW$   8/ 0-@ MPL 00~K0MЍ 0-@+LcM0@0 P' l X  p p p x h      h t   h                8         x   x                x               $ $ D#K0 DKL PE #0 40 0 K4K0K=p  ! ++0 40 0 "$R0 0r.A/DK PDKp Q~RW0 0 DK PDKpj Qp 0 40 0 d 4K K0K$@4 0@ p P 0 40 0 0 40 0  ~P@f/KU4K0K0  @4P @p!mvQ @& Q@ P _  \,Z@4 4K( K0K0  @@pT (@K0 ?w @q <p}QS PQ: 2qr . i - LMK0 @ @ spK..4* -p-L MP0U 0  @ 0 L0Q a 0Q`PU 0  Kp` 0Pd 2 0K$ K(0K@, (@ P0 P2P$00l|l\577c4*[[_4* [4*W4*;S4*;))N4*pM h 000 P Ѝ P4 00ӑ 00=;=0 S0M00Ѝp p-LM`P^%*00@ S!@ T  00@ S00S !000V0@CT  \00S x@ x@-0M@pT` P 0 0  00a^0200C S  00C 0Ѝ0S M1>3 01Ѝ p-LM0@SPx  Fr`P P `x zx p-LM0@S`P\ 0  !x0P  -LM@ X 1:%\" \0PS0]S0phPU ` P0S PUW ,'5 0-LM @\*0S:80[S.QPQ*0R0.S 8 \:80]S -LM@ 0S-: @0 0 T8 `8\ P| ?>   cP"T001 X   R!*0^SF ]S7 -S000 -00-0 -  R%*0]S PU-S [SY p PR*0-S( @ 000 T   R: t0Sm 8 0w 80@^Zs9  0%@ThJP0` t8 _080 8@l @0g0 @(KoA-S < P0:S% =S0S0* 0-S]S =  000  R*0S*0=S  0S0*p0-S]S P r hǟ00   r 00  PPg7@T ` P0S? @T  R*0S*0:S  L0]S -00-0 -  S0҅>]S00:<4 ZP   TP  (000(K0P  000   P`0S  @  e0 `R P Ѓ@P@ P㉀ @ f bpZ ]Q Y 0-S]S* Q& M R|*u E R,*%PP oP 0Q  oP 0T ^001  ^0 f (080 <00  0 R (Ko? & 000W 8 Y& ^J 0@ @ 000`000^Z080 80 0 0  0 0C0 8 80^ @ 0@QT 8 0@2040  T0 /*00S  T R" ^w p0`P  00 2 0 00QP ^V 4 @R8   bB"(Ko 8 #00 ]00]0 ]   R !*0P0]S Q*-P0@0 -@P#:T0]S.00 0]SoP 000   PC l080 $=`500 p-LM 0K KP` 0 ^0 0K K0C B@0K K!P`Kp -LM0` @8P pw 0  0 v0S04  4KpP #0KP0!0K@ 0]0#pK"0K! K@P= -LM`R@Pp/P  0!000 p-LM`\P x@-  A$0S0$0L0U0L0 P  1 e! Bz 0Ax -LMP`@p0 S#T TW0 W000SH X X X 8 8 8 8 8 4 x 8 8 8 8 8 8 hU0f0c0  f00   f  f"  B a  h@0 fu  f  f"  B ax   =pG`@  f0P  fh*@DpG`s#@D`m -LMP\P0 *0^S: `*TI<0pC!`H0S  X H  O 0H0Q*0*S  ^\S $T`\;* R@%*@ T1 \T 4T4TG OT> ^0 L0[T, ;*T# .T 0  ed4T 0Tz0 SP00X (K kV dw&   JT 3TK0D  D D` V1 0  R *0Q0\S \) ; V1 0H  @R*0^0\S0)SP K t  0 hP  h   h0D  hy@80{S2 `R*0,Sb @ 0O@QP* ^D0\SA0}S; NH B (00(00000000X>(Ko0)Svy ( (00(0,00,0P0}S ^  R*0R\S ^  @Q*000C SL}V@ k9>{) - L MP0  ` R*@|T T  $0D XSa4D0hD R*000C S  R*@*0D0?TS{T `| R :` Vg Rl*0|Si00 0RC  iC04 aC0" 40 7P 2(00(0 ,00,0  R*0D  D D@ T1 0   R*0)S ) T1 0H   R*0)S m (00(0 00000uop 0@ 0g R*0<Q0 >Q :Y\c000C S_^g+Tj 7*T  R\**0A0?QS{QJ0\G000C SC  ` 0  fZ  f   f0N  f?T= {T @Q*0,S p 0\ Rr:   000C S|Tp  +T   f0  fC 0  f  f5  f " , B a  #j    & ~1 0  j 04 00 0}S00;0}S  \ ~` R:0 R (K4  a  i (Ko -0LMS@ `  PPa : P  0  iP   Ez (K\P00   倐 @ 0KtK H 0S0\P@40  ( , 0 < @ D P `8H@ K}00C 0 0R*K 0R: Kf8 0A $00S0 00 )  iPP QP: (@#L D0 03 0Q  Rʤ    0S 00B\p0S?0 0S7 Q^`L0>#Re ]R R @0^@@R@P(@c I~P<@ @\ >3S R 0L00QP(@F40 00 4 Q 0砀MQ @00BaVP 0R 0R0\000XwR R RL>310>#R R "R (@@(@0>3S  S S 0>3S )R@(@5\ BK6KK K 0SK PP Ee -LM l0R  @T P0R000PxPxPx<PxhxeE)*)*)* -Q0L M4 0R00000 0K0呢PP, P0S p`@nP `@ gP$ pW21C0 R4Q  000W 0K|dPP(KZ  0W0021C0 R 4 R 4 0W00`65 p-LMP ;{@P` x`P T,03040S000 R   R0 \00x5C)*?)*;)* -L Mpx5`P 0SLXQ0LL!PP00P00@$K,K \oP ,0 RP@Pʐ Th.LP0SMR kR mR gRPAxQ.GR KR R PF.L(P8PK,PF7zd7D7(77|8E-p0 @  RM`'@P0 L 0@B?AsP00 R00S 0/S9ST00T0S@Ѝgfff -LMP( <3aL1aa Q -LMPR0 `VP `ZpA~  P p WVP(K00p -SLM` . > N >  0 Q qI ͟0 C 0P0s 0 00  P0P r`Ql=q\M P=H-0S0v>C 0C0 0M000 0v^ PV 0S p ` 0 > 0 00 %Q`p 0P0S0P (KWp%0AUS|0<,(L(lH$0Tth00~˟P0P ~ 00 +0N0 /S  ,WU0P4p  1 0@Lp ڟP ABp ПP Q4 4W20P4p \ !0h@)p ᷟP 8@p ᭟P Q4  0K4K8.P 4 8v.BH B 000 0K;0PW0l0 PP0  0K =0PW00 0K4K50Py0K4K 50Pq00 W000P P0P 000C SZ0K 0PQ0K 0PGW0 0Wp  0K4Kc0P 4010!00+0K 0Pz 0tFC000Wp0P r HƟP0P r 00 W]&@Y0P PT0 SM Pp0P WG00SA0K4K 0_P: 45hE B`10`c000 )0K0HP# E0000ş0 ' 0Kc04P0K4K c0,PW0K 4"P 0DC000WB WI 0T 00K  0P D000꯲0@$ EPP 0P v1 V R`c #Ϡ2l10!0U3l20!0UQ Px#? 2c10!0 c;Q4 0 0D0MS0 0P0TS0P DQd00d 0C\4  1 0\04 00_0 P@4@K0p"0P p0P00 0p"pPy 0 0X] B0P000P ZS A0P000P  㸳Pr 4K!0P< 400 04 4P0P 4 Qy0P!000 A RPPp:Q}40P Hr@Eo{EA!/0C!b10bcd0 B!a10b cR0 0@p ᇝP0 S S 0P00P 00L CA0C0  RSP0P l=7<'8,8 88 8$In8Q7x779=M0ЍW$*$*$*(($*kk$*G-QM 0ࠑ@90PP@e1A 00 q$b%(?P @RJ: 02!!b?P J$0  ^0 @Z) 0 0 0 0 00 R0P P:02.2"!0Z  01%3 0 =00@T* 00Ѝ =00ꫪX8 -LMPp@Q qP l2  0=QV Pb+P T%%%l%WAQ@T W"@W @W@ X*0f1@0Z0 fB200Z 0ÅP@Z0 fB100Z 0ÅP@Z0 f00T񟗹%%4'&=QQ q 0  0s 0 0SW X*0S Q q D0  0q 0 0PS=X8i#*WWe#*0MS 0 0S0 00Q:Ѝ PM Q 10C0Ѝ -QLM@pRPPX`VP V  P `0 B  d00PP00 -QLMPpR`@@ P 0S @V000 B  e00 0-LMP @8 0-PLM @8 -LR0L0M@@PT@ lR0  0 R B0 0  -LMXpP`@@ R0D0TST0S: 0 P` @UTW YPP Y I00 [ P0 0 0g"*bbc"* --LM0 0  K -WMLMԀP` N?K C/K$ `5 8 4 *0  `K 0K``Y~K|0SNKYK@DN[E E |U t d5 U 只@P)P@$ 0R K[ ,8MЍ 0-LM 0@0 @P!K0!*!*0@-0MgSP7 -SA XS5 +S7 Ѝ0oS6 uS= # @ @030 010 000 T 0301000gS80 400S 0 00 I@@-gQM@  oQ uQ Ѝ=Q -+Q -Q!\00  00  00 0 +T -T =T000\0R0- 0+\ 00XQ000000 -L(M@pT >00(K8@K04K 40 GP}G sP> `00H S0PL D =X D 0H0 @0X0C S񟗠 511111111111111x31111111x311l3D3$3x31`33I@Y  @Y  @꒠@I@Z L V:@00 @0 _pPr @0eG!0L `P< 0 `=XD & H +X00R0S L0V:@  @ ^pPH @0eG!0L `P<H0X `H L V:@00 @0 ^pP) @0eG!0L `P< 0i@`WI@H S'Cߞpn 0K'&00P R>0SK n<"00p0+S -SXS S P0p+S @ 0 -S0 @ +S0 @ XS00PT -0 0 @p\ +0 0 p^ X0 0 pL V@1 :  &^@P`}n;<0=0 000nn7<00) -L8M4\( p& < R R S @iWP  c( 0R'$KR Z@K2 U|PU`@ PU PZ@K024 ޿Z@K2 ؿ@b 9x9`/899* -- LM 0  -`LMdPp XX@RSU  8R8 $0z4t  ASv<|PH MR  #R - R R R  R "R, \\R0 0 R00AЍ0"S0 0<0  0 S S S 0 | -LM(@P 00耯 -LM0@P P:P耯 1; -LMT0S D xeP  㜬P q 3  00 qQ#Q cs0 0k0@S0000 0PU L ŬP q 3  0 00 0y 㳬P q 2  0 00 0g 㡬P q 2  0 00 0U ㏬P q H2  0 00 0C< }P q 2  0 00 01 kP q 1  0 00 0 YP q p1  0 0 0 0 p GP =Q PP@Um0#S+ #U) @0PS0 ӫP  000 0 R r 00CS0 Q#Q 0P  0 S S 0@S0+ @(ꀯ=d|t\9;u;; ; 0-LMP@P P8 -LIM0TK(0 p@P4KD@P/0j V`W"( 0R^$K k 0@ҘPP 0l Kh0 0d `0 l` 0dK\ K @P X 0GR@"90@P Z3P$ 0R 0R 0GR .QKcPP @1R <1R 81R804000,\  ;; 0-LMPLLA/0oP@ @A/bPP8t9@Pꈯ*!!* --LM0 0 -L0LM@`P8 4PT   "t<|\\*@-0@, 0@$0 0 0M Ѝ#EgvT2ܺ -LDM@ lK pl( 0 @ 00# h ,0*0 0#da0"00# `@dȟ0! 00#\@Dlŀ0 0 0#X@$(0, 00# T@ b* 0.0 0#P@0"00# L@ǟ`0! 00#H@̀0 0 0#D0n)+C0,0O B0#  @`G' 0.@0 0#@<@@dE0"00# 8 0$00#4`ǟ` 0! 00#0 ǀ0 0 0#nh@& 0. 0 0#  -T@0" 00#@@|0!00# ` l@\Ɵ0 00#lƀX@<0,00#D@& 0. 0 0#  +0@0" 00#a\@0!00# `H@ş0 00#̀0,00#`@% 0. 0 0#  b)L`E0"@ 00#@@dF8@0$00# d ş0! 00#ˁP0,00#n$ P.0 0#  X0b&P"L@`0"0# ğ@0 0 0#lȁ0! 0#h@d$0, 0#  H\0b. 0.0#P@, 0"0# ğD0a 0 0#8@ā0! 0##l0n 0,0#`@  * 0.0#T0`0"0#H@ ß0 0#ll΁0! 0#P#00 0,0#d@ 4 b( 0.0#l@000# P@Ÿa0 00#lˁ000#X@"0 0 0#  % 000#`@|` 000# D@\Ÿa0 00#h@<ȁ000#L@"0 0 0#  0Ab- 0@00#@@TQdK0P00# PP8aX0`00#``\e000#@|` 0 00#d \lˀ000#H@? A10N@b@P0 P0@ R?W@pG 4 _?W@P4 W(K (Ko@0  I00!pc?WP -L(M< 1>?0@0c@ S80 D ,K0C*KCK<0< 40K0 *KU@< ?U@B [U4 *U00! PU 6P(K R*K0 Q 0 ` I6*K0 0b5 6%(K*K 0< <R 0 X5R 50PP!U00S !U[00@DP 0D%< 0 P`]#P 5!Up0:0C0Pp00-S@3 ]S> P`[U8#80@0:S0@ :P 0]Sğ0i@T lQ:0 RR0S= ^ @]Q 4 00p]S@ 0#< 0 P_K< KK.K(@AK@A8 0 Pj*K0 QS 0 :KK4 8 0Z08#0a1 0 0P[Up`m0:S 8#80 @v 0  >K0CC*K<0K0A< [4Q@*0S /S  .K/S 0 R@ 0S00:K<0 R P0 9P K4P 0*K<ыP' K<U Qa K<0.K S C 0Q0S0 U00d1(KKP<0t*P:K40P]U@R< Ss *K0 0pb@aP@ W*Q@00 \  0# 0 0P@P^K< |K<  D0# 0Klz**?[:-]:@Xz -MLM0@{SD {P TႎKHHp KHH0pPC0 P\ @ `{Q` }Q Q [Q]QQ 0  0]SSS@Q  (KV `F0}S0SU0[\ 7,\ T:P[\0]SS   0]SSST0*VU  S:0S0  tP  000{\ }\V`F`  -LMx@0K`pP P K0 000  <R 0p Qr q 10bQ KK 0 S L \S0N @9R8#HA@L20K^: X0 Q  R00   8H<\@MЍrMЍmH0M R 00CS000ЍЍЍ <RR*:*:RM 0S0  RЍR  B0 0Q{*__w*MЍdn*Ah*//d*aa`*P 0MЍx:MЍ -LM$0!  0-LM$@P5]P2]$0]P-]8h*] p-LM$`4PK@.0yyP yP 8<000SKp00|< -L@M$@ 0PR 0`00dpKH` 8` 0LKy :P 0 d0 :`00S$K4K*40L0 d` `0 :P  -LMpPW $K$`@K 0jyP \00 @ *yP w @p y -LwM p(, 2  ?aPS ;aPP `U 1 0$P@ 0@rK~K 0 oK . q ԑ yK!:P 1pp@ aP oK  ", 0R"(K 0ѧ10S8\ 6\`P @0 ` (0(幧 &\`o |:.<<T< -LbM@0J_K(0 啅p( 0R%$Kp)pKzZoK)Pd0 P\jK jK0 Q0   0K/ x:d<II *G-QMp$(P 0A`>3S Si 4S] S S WЍS= S S S00> QS0PW @ SO V&Sv S1X 0PS DS S>400 2Qa A0B !>3 S >3 !>3 SQ!1XX 0PX >320  0P0PS "S>0!># R0\PSt0S pXm 0PQ>30Q0  0P0  000 ES @J`@` 0P  T00S0 R@ 0 \ (K>3!>3 S0  0`0  000 FS0H P0>3@ P 1>3 @!>#"R@D0  @V 0 @_ywQ& .Qr0  0@0  0}00 DSP`J  0`qP 0 `4N 0>#" 0c OEQ QA 0>#" 0c O0 @6G-QM`$(P @>3 S Sw 1S S S @XЍSN ;S S S0>#00 00@0S0   @XS xS S 0>00l0 S00Sl@@ S G&Sr S1Z0   @\ p!>3 S >3 !>3 S 0@00Z >320  0   @!1ZZv0   @"Sl 0>00 1>3 S`  00@0Sw @USQ0 S @MZI0   @i80Z @=3S`" Sb JSl >3Sc Sq S S `(KS{ S0^zQ>3S V >320  `0^d&SC S0S00S* Vr 0_R0^JS S V `0Sz 0 S0 0^30S0 0S0V S V 0R` RQ Q0V SG R* Vr 0_R V* r!>3!>3 S0^~S S; Sj @>32@d40 _ 0 0 .P `RP R r 0H_RsE00 090^B0^>30 @C  1>3 S% 1>3@!>#"R@D 0  @P `0 V0C 0 >3 a 0c  P A> 2< 0qL H c D @ L  R8 V 8 0lS:D   ZP<0P 1 0P 8 @>32@d00 _ @ P 0 PU00`0  0pPA>3q 10 `g 0dS0 0r~04`0y` Vuu= -L0Mp P@6Q >3S`" Sb JSl >3Sc Sq S S `(KS{ S0^zQ>3S V >320  `0^d&SC S0S00S* Vr 0_R0^JS S V `0Sz 0 S0 0^30S0 0S0V S V 0R` RQ Q0V SG R* Vr 0_R V* r!>3!>3 S0^~S S; Sj @>32@d40 _ 0 0 .P `RP R r 0H_RsE00 090^B0^>30 @C  1>3 S% 1>3@!>#"R@D 0  @P `0 V0C 0 >3 a 0c  P A> 2< 0qL H c D @ L  R8 V 8 0lS:D   ᧠P<0P 1 0P 8 @>32@d00 _ @ P 0 PU00`0  0pPA>3q 10 `g 0dS0 0r~04`0y` Vuu= -L M`@ 004 (@80 0P< Q p0 0 AϠ0 @0 S4 0,0 00  XPy  X| 0 p R@ 00 S T  0  Ppl@TP2W  X* x| p00 00_X00So 000_X0S 2WX 00 S sS 0 0 00_R00SHA?G0CSE@ 04S <4 @ ZP]  80 <0 80 P0 S00,0 00  XP000 ,@ Rp0 0 0Wpp@vp 0  PpP0  R r h  00 00_R0P Sp X x $v0O4(K= -L Mp S0 WQU Q0 Q Q Q Q  \A0A >Q>30Q0  0P0  000 ES @J`@` 0P  T00S0 R@ 0 \ (K>3!>3 S0  0`0  000 FS0H P0>3@ P 1>3 @!>#"R@D0  @wV 0 @_ywQ& .Qr0  0_@0  0W00 DSP`J  0`KP 0 `4N 0>#" 0c OEQ QA 0>#" 0c O0 @6 -LM d0 \  H?R(00 Sl 0 000 $   0  XH L0SbP`\NO@Pd0 D>Pp\ # \>OHK\@0C\\4HH _P`0#h@h@TCKHpH$4 P*dp@h@ Wp0#SCKKFKLIA0CL IA`4 l h d L`4h$0PT *hDC>K0C< 8 ;KL 0C<KK@L0C0Cl"P= tx0\0Q0S:0t$0 t$ h0s K@"(K(0K!04!48#88#R[:SY 0H L T P IH0A 0hL0p它&0Tp$P)l\GP8 0 `\0h x \ p x$R00`U`x4S ]D x$R VD#0x$R x\   A@A.A:d,:A$A0ALHPA<AMЍS0(0MЍ -LM0P0 MЍ0@-QM@ Q Q0PPЍ00PP 0-LM@P0S pT00SPC8hC -LLMP pHP hH`Pl p 0S, R00U@ @@8KbPPh 04 ` \ X d@ f`hK_P0S CC0l0 *0  -\@P04,"40ClCl@ T0T L0S00A0@%1H_P! l(K faP P00  0@ 0000@ 0000d@ 0000p 000@0ʎ 000l 0:<.A -L\Mx ` | 0 Q h d0 40l P`0 h K  00Sp 0t0 @p@ ( P 00C,̠Č 0("ČT@L # P_ T0`KPX x0  0PO |@PH t"PP tP h d0 l@TB 0A嬡P0PPK0@0 < >$\pKP _P(P (K\0Y(z^(P( p00Csp0 x@  0 P(h@d@l  R t (0S0(0"(0(00(0x 0P0 (0,  L0S 0P0^( P(0S0(0.i -LMRp`PU /p@`P` 0(0,  -RL0MX T X(K0 @1@K0/L#b40 0@3Kz 4K0P LKo@pKL0K8D pWQHJ0P`PU`SNJP1N?L3c@TY0X (0Y y TX 9p@ P"06 X (0, 2[  000S 0P@X0 0,@(0 00 0(0, X@ 0p=@0 P`PU`SZ0=@P` Mb 0-LMP@ P 0S S 88h8h_ 0-LM @P*aP8 8h"aMЍa 0-LM@P P8 P 8hM@ ЍaM@ Ѝa 0-LM@P&P8P  8h M;Ѝb 0-LM@P P88h M;ЍaMЍ`M PxlЍ   @@* -RLM$  00 -PLM @@T p-LM@PT 0@T@@<0S@$0``PP@@@vP 2P@@x -LM$0PpP`CP@ 0(`004$0@L000H0L  0-LM @<R P@00^?0 08CPPP P@ P -LpM$s@Pc@CLP0`KH` p  0㚲P0  P' P 0  P00K 0ㆲP 00l C 0 P0t@P  0@PL 4@0,@0P0.R80M0S L040. S  <0S <0S ,0S00S40Q0 00 p-LpM$P@PR`&K PP T@ @Kp4 0R P00, 0R0 |0RDP`PP -LM0@SP`#V0 P 0U`   L0\01000( H/pPpP?pp -L4M \ T p~P \0Sd $ 0S \ 0R  X @0 < @ T 0dP=0$H D0 T0$00 S/RL 0/  4 T 0<yZL 0 b 0 `hP L 8 PP3 $0 0.S  |@P V<  00X$0H0Sv @ R 04H  04 T 000 00RP0 @L 0@  L P@ yPP x80S  R L0Q00c 00 R0  Q00c 000S0 <0LS$0 0L RS400C40 4 00D0S \ L0SR L0S 0L SR0(KT0 8 00 R@ \ @@R  0D0 H0 0X <0 N  < >@0SS < R P PK$0 o 0( 0 L4v 00 @ Rsڰ$0B8RS@00C@0 j`P R $0 04  80 8 0< `h 00X$0@v>0q T0 $$0 :0 $03 ?00$00L00 0440S 040. S  @P  P0I T0 $$0 :0 $0 PfL000X ,T 404 H $D D @ $H X T <0S$$08yP4 T 04$0 :0 $030(Ko/ T 00X R000 # P=T0 P0P \0ST 04 T 00 0 00 T0 $H\ -`Q00 V@@LMTP 0 0p @$0 D T  T P V$0@:$0<0S0 /R $0`  LӤpPP  \M 0-LM0SP@ ៯0T@1S88 -LM`pV$0*-0Q4Y Q$( R? 0`VT [=<0Sg 4S S 0$  0R/S@/00(  L`$0  `$ 0B8S 0P$0\P 404Q $@P 4 0RL 4P 040P=<0s 0$ `<QC$0 0`S004P$0@MP( L$  尭/EP XX @P ⡭(P04 00 `ZP  & :$0"Pz `c45 $0 PY  0C"P6 04K 0P ` 4 04 P 0  Q lM0S  0dP| $0P:$0Ps $0㙣P 404$0`:$0W< `` @ n @$0P:$0 0 $0 0 $0\MH\ -0L M@p` 04 04(K(?PP4P  4P `40$@4 0$0 P bnPX EPP 0<0@T / AT&  P6 /@P0L2 < $  gP04VY`0 @0 0@ ATVX# P 0 $$  X ; 00 ;;;040 $  ۢP$00$0ꨙ\M -LMP0@S 0` 0;0S;h$ 0` 0;0S $p 0S  <MЍ -LpMKps`P 0: S - 0P0KP(@P P80@0@P 0@p$`0 @``0@>;P 0-LM@pP  00R00SPP 0>  8P 00 0-LM@p@P PP 8 8 -L4M"pX \0 0 geX0WSD dX0P㗣$X0C(P@◩% ` \ P\\ P`@D\ 00 嗩( 4 H @@ 4 @0PTm*HX` 0jlS0S㗦& DQc B 0\0 0h@dgQ!Q D aR; 0Q0 W:WA*,dX X0 SD # RT0 @10.* Tg`g " 00 `0Z*@P\ PD\ DP 0P0 `0Z: T 0g\@(K \ Pg`g4 \0PDQ 00 g `0S @s: \0PD0S2@40 0 @gD R; 0\0  D0SAH@4 00 HH @@ .00La L Q A0LRW0LQ70LT8X\x\@@8 -LMp= x@P@d ;P`d 0@:SS   P0Pfd9P `d P@f 9P` D`V ?6 -LMp= =@P@d:P`dP 0:SSo ^S \S0@ PUPfdZ9Pl `dP0S:SX 00@\:\O 0L0S 0/R@ 7R 0 B1/P07P0 @10@0B0L@2SD00U@f 8P`VD`0T0 00} 00z 00w:00t00q 00n00k5 -LM4@P _000 0 0-LM@PpPPh5d0@@8耧LP00:40P (0@ @啥88 -MLM@d  ^, ` h8 l p( @0S`WP lfPm  9P 0pS LH T hL(Q\(  h 3T80T8 X 傎KHH`YP 0 S 0Z@PY+h8]P `0 SU0U@E\S 00 HX #RR lPp^ 0:SP P0:S0@0pᘥP@ P( = @Pr P0S :SP:0C0EK0@ @A\(h8@c`P vV v:0P E0E 4 0S :S00i c 00 4  S`D:R:0 00H0f c a0 X0;0g@7P H0g gg0 0H( `pPH @ e940(5 e4HDH ;Pg7P: 0g@pPPX(RhV^H8dg S0A0:P`@^@pß, 0R(K3 Rfh(02@X8S\T 0h8 0L0SL $4T(R@@W4X\K@ 00BNK@D@D"ʅ P)*2 R% h 0`P l^K< PE@8 PE @D 0 p& P$ D0Sh@8 0C<( 88 L \Ph TT X h]h[@h]@ 00TT a n80P  p000\H H8 X Ph HX\!3@Z3@WW3X(R2 3\@ 00J6Pp@Wn 3k3@DQ? `P0`?SP``0@p go]@pb@ X z?0YP@p r?0Y@P0 -L M⼀0`P$0 ,pK  !62 b1 R<0Q0^ph ~?@ Q R $ 0R K  PBDBHB 0-LMP@ 1  !1P\8hdz<<*-M 0BSRЍ0S񟗸NOP QN(Q`Q?Q00 000000\Q0000 0AlS񟗠QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ RQQRRRRRRRRQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQPQQRRQQQRQQQQQQQRQQQ|RdRLRQ4R-Q00f ^Q,00` 000Y0A0S0Е 100ࠓࠃ00 K0A0 S 0Еࠃ10ࠓ0?00;007003\0 0 -0 0 '0 0 !0 A0 0000 0 0  0 0 0 0  0 0 0 0 0 0 0 0 0 0 -0LM`P(pK(0 @T  0PStSlSS00 KP@PT 0PPh@ -0LR M 4 `pC CP-K4K@T  0PSTT@TSW0#3#0%(KU-0[505PW-0[0Ņ@PT  0uP U0h0ŕW-0[0ŅPcc"*(MЍ *=*=UU*M 0ЍQ0M  Ѝ -RL M@po쑟0Shố0 P @0P &0000 R r0 11P```J^XP+ 0K4 KYWP0p0 Z. <1 R6 00W[XP0Pp0  g00 p0S (K00W`'0C0 0 00S D+P` ZP `0 RX=&?R0S` p(+` <d2-M  S 0S@nЍhhh* -LDMp0PQ` 0  `@KI0#" 00 @Q 00w 0RK*P Py |BTB -LMX0@K`P$0 pJ J$ 0R KZ `B -MLMK@ , l p`tJ,PB@F XM 0 QLOKHHV !+ pP#  IV'0OPU`@ @ ln, 0R$(K U pPʄ@ ֽW@UVKA⳾p X$U eʷW$ ỽ ᷽ lB 0-@ MPL 00~K0$MЍ%%* p-LM a0PS.@T 0S10S @ R0S*KpT! 00@0S^O `K pP 0S I%D B% ( @00 <; -L M8 04 rSwS0S0 eS 0p0K8 0S )$ $Pp ,K?PZp2 Rq.p@J P6 Hb0S|8 wRPP1 K0PppU00K $0p$ @0SR$00$  0 0eS 1K@Xp  Qp1@T0@T @1 R ,$1 R!,Ѽ(ϼ$p$80rS!0K@P# p. 40 㐉  @ x$ 00$0Q0  X p   ph < 3d:; -0LM $ -BML Mß0P,0 T$  0S 00ß, 0R(K/xcPP0P4 L 04  T$L00C=Shb_____La____a______hbhb________________________________________hbhb R  1!S  b-1A L401!0↑T$唻BNK@D@DP  p0 SP&1KH4 1D A  @d < 84 4 cXM`P 0SDa ̕BNK@D@DPQ n 00UBNK@D@D F(0K@/04L  =(K 04BPU0S<8o0@P@ផ00 c-!!R0$ 0  bBKA@@DAPT L 4嶏2 00  3BB\MtB 0M Ѝ$ -0-LMP0 S  @     0S0! b-1 00   0S0 0  Q 0RK0c 00 B --LM@0 S       0S0! b-1! 00   0S0   0S000 嗺 0RK 00 B -0-LMP0 S  @     0S0! b-1! 00   0S0 0  QL0 O 0RK0ԎP 00 $B -LMPQ`P!ڈp0S0 R r A0t03U0SQ0@S0 R@P <M0Ѝ< --LM0  0 d Kx< 0-L M@P@PK0 BP U@P  P@P $@ 0@Pi -LMRp` @PU  PP@ -LM@pP<@P `V0S p ၎VU Vp @0pP00@V00S P0S!00@T TpV n&PP  㦓 0=mpB<` `      P0MЍBTC p-L MP` P P |P0l 2s`0 0 Kp@'4P0( @s@.4pC -LMh< -LM  h꬗< 0-LM0@$K$Q0!rp@\ Pڔ!r|K0@\`$0S-mmm0m0mmlpmmlmmmmmmmm 0!rpP,A`P E'0 rpP 0  rp0 P0 R@` p01S ` rpT0< rpT`CDCCC4CC -LMqh< p-LM$ Pǒ|` 0 S$0K00 , ( 0 R r 1S0C10KX0@SKp < -LIM0 P$0  0SQKO_K`ANK@D ?'@ጒ gl0! $ 0R  KD! z,0 MoKK_KQK@ <1 8! 垌 DPHF-0MS  0Q ЍS0 Q(,0^ 0a(00 0Q<M@\Ѝ 0-LM 0Q0l0CP< (4"4!<0 @@b T 0 0 8@-QM @0S 00Ѝ@  0S* n B!< 4!4"<0 0 0 Ѝ 0-LM @P  0S 0  <4("4!<080 0P 0 0 0-LM@0@S 8, $ 0 P bp 0,0(P8 p-LMPQ@U  0(0PbU (,0`SPxxcP0MÃЍ -LM @`DPpU$P  bLP"W000H$P1 H04 X0T  cP@ X0T PX> 00࠱PP L0 R0L00P ࠑ0H<,$!$ H \ QT0PR<0TPU$\"P $(0lH0 (0, P$P 00`e0eV00p -LM @00(S,00aSK P< 4("4!<0K <(4"4!<00 (0 B0(00 -LM`Rp P`V 00bV@1@! ' 0 0S 0p00P -LM @$h -LM0`Pp00 o"@P. 58`h"P- -<P`"P$. 0 @0 X 00`H 00`(40L P,0 D P @ T (Khh0 (Koi H0@i(Koy $0ir(Kon;F< 0-LM @P 0}p 0S S 8 00b8q( ,00bc8 p-LM@` Pp 0fS  0 `P0P3 5: xS0( P,0 `R$0R0` #00%( %*P 0M0ӑЍ; -LM(0PS< 0S2ه0 ! P` 00/`VpP <0O`Vp0S% R 00cO`p 0(p`p 0q 00`p0 < -LMQڈ W00 p -LM @<0 R0`00k00e00 < 0-LMDP0@S0`0080`00 R 8h < -LMPD \l (Q  &0SfXF X X7 `p@R, 50 S g5QR ;0$PK0@p 0P @0P =0000 0@8 0@0S E0S0 0(K0  P` 0S  0bO`p0K0@0 @ @2208CJKP0: S0D ;L 0XoKT  P`0 0`VpS < 0O `Vp08  c0 0@P@ 60# Q0`ʜ ` 0@0@ Tmj L00cO` p  0@p 0@0P @0P 0@0@Y 00Ÿ0Sd  j00/`VpP <0 O`Vpr XKℴP&TK K q* Ÿ0SK D X00SG <@0@ 0 @p`p" 04# S@ 0` c00 P @0P >000 0D0 R q0S ^ Pa_U 00   a0@ P0 Bq_ 0@p`pq EP T0 d00 S0 0d2 <0M/Ѝ^MP  0S SLЍ --LM0 0  K p-h0LM@`PT PT  4]4 0>f  xh<|PH --LM0 0 \ K *MЍMЍMЍ -2MLMx$@0TP,0  D<S   0/Sk @P B.K B B, 僌+ Y X030#` V0#ScVH < VD / YP< PP#@aTQ~KpGpG ႊ(K0YC`d   ,@B0 /S (3X5/00,8[S P PP0XP /",0VbPX A0/S/0C0@0@0S^\, 0 Rz(K?00,R,  0<  +(YrPK ACPPh<: S Qk®KJJ  փpP( K`\F,<[/SD XP /"P0aY 00q \MH\H 0-@P00QLMPTP p 8@00 P @P:@A*||=* --LM0 0 O K 0-LM 0KK x#0PS @ AK0"000@@@  0$0%K; -R00L MH /@ D vH$PsʔC@0 Pu 0-Ut +U P< < H0 s 3S00S 0U RH /8 4 < R 8 K #z8 K _uX`p0`H0@pch0 0E Qࠑ ur |B000l W070cHPeR<Q, WFC X0W 0 ^00S<481 ,/@X PDQ@  600 (KP< Y# < X0& 0@^00S4080 ȟ P V"00P X"00P Y0Y0DQ RJ@ @0D 08 K y8 K 0 t`pk0U 00H0 8 4 H0XSxS=P@H@ 8 4 ;=MЍ -LM@*T`p@P  @00#:k0cS:UV@ 0|`p -L|M`OP0 U<0   0@H0 D@ 8 80 -SX4||||||||̕̕̕̕̕||||||||||||||||||̕||||||||||ؕ|\p@`PM  EPeP Y0|@0`V pxp 8 @T800x`VHK(KD0H`x` 00Sp|p | /Q9Qp@`9Qʇ!000T0pCچ!000T0`C@8 /QP R 0S J0SG0 RT8  t 0@ Q  0800 R" 0S  P 0BSpچ0R`ЀPU 0A R;ʇ!00 p00 08 0x0 8 0Sn 00Sp|p 0XS xS 08 00S S_  | r8 @x@ | 0 N 88 0+Q -Q,A    00@ S8 20P808 0P 10@S%80P@t t 8 /P 08 0@!00/PP9PtL*0aUS RaY T @l@ T y Z@PH@ DP D:H A +{@Psy 0yH D YQT` 0j@T 9 HK{H D 07 MSpdp hp `p \p )0D H0 d\ <}h}`}d}\}"00 8 sH+PHP` @ =UP9x8L d8 0*Pd h ` \  \ ` d }Ph d0  ! ;HK0 K40K}P< P` T@0 TT`PPf40ࠡ࠱Rbp t B gR 6cX PbP @0"00C`X0 X @0` @T00 S 0S p pc@c`cU `P` c <S~PP_ < }~xn'H$0c6-H%bGm.L/7i*^LаsyyQPل"ɷ-R=}E.*0xRϵtt"ݠ~,ǭh\ ЗP<1'Smfs&:Mdtb-֑s;yӑD=![?qvF֔T "3mP8DN>y@OjtJa JNeQPy9G_0vv\<u&doC%6J ظ$RL#!\OG#1C} =p šbE|u:pXifX-M0|j0>) +Ìq0kd0"maDqAC 8^yAbvƷdک%c*Q@LA(?L)ORzxmQNC &2J.r()1 ᕳ&$VUۉCeX"vg)$]w_}ܶSD//l׭VGwGbqDAJ#|ݢs[xM,舒s=~& Sx%1u1#p4y(fOVNhZC<? QYTVj"7M_~7:Zb76SUH[eۦ.ҾjUZpyST|O P =Yۛ-C|\0l KD -A_LU-Ȣ9S"P%ꋑcŧ_|ϻHLi#DR@@w@gmf]jIףgc?Yj_ lrd[oYVhz,-WNV-WuW . ..archJ catdateJchmodJchgrpJ cp dd df edhostname< ksh sh ln ls mtsha256sha512mkdirJejectJ mv pax tar rmsleepJsttyJsyncJ ... print -r -- "$userkey" >> $_home/.ssh/authorized_keys fi if [[ -n "$_rootpass" ]]; then _encr=$(encr_pwd "$_rootpass") echo "1,s@^root::@root:${_encr}:@ w q" | ed /mnt/etc/master.passwd 2>/dev/null fi /mnt/usr/sbin/pwd_mkdb -p -d /mnt/etc /etc/master.passwd [[ -n "$rootkey" ]] && ( umask 077 mkdir /mnt/root/.ssh print -r -- "$rootkey" >> /mnt/root/.ssh/authorized_keys ) finish_up  . .. dbemptyi tmp runtzlist ... ... ... bytes: \(.*\)/{s//(\1)/;H;}' \ -e '$!d;x;s/\n/ /' rm -f /dev/{r,}$_d? done } while :; do echo "Available disks are: $(get_dkdevs | sed 's/^$/none/')." _ask "Which disk is the root disk? ('?' for details)" \ $(get_dkdevs | sed 's/ .*//') || continue case $resp in "?") diskinfo $(get_dkdevs);; '') ;; *) isin "$resp" $(get_dkdevs) && break echo "no such disk";; esac done makedev $resp || exit ROOTDISK=$resp ROOTDEV=${ROOTDISK}a SWAPDEV=${ROOTDISK}b LU(P 80C48 M(P80\!08 D H0 Qx<0K8K@ K%0S@x 8  S S < RP`K P`K=(<|{0HK@ gPT\ ~\cʄ0 HKxH D N?A x|IdI;|?5?55HP9?px;5&HHK@PH`KD ` p  0x 0HKwH D Dh0 0S56D0 0pW D0 0H0 pK&qq 0pKvY@PH0S46S !(1lPu<{h{`{dz\zh!h1 lP|!p1kP\p`lp0A;h@d 1 HKvH D DBZ T30j0T0 HPK`2 @ xP`THP D` `V D820#:kcQ Q4Q0 AH0 0"7&D D HK 0kP&pdp hp `p \p 0@H0 D@ Ry|nY| D#46S XpW  Y HKH@K0 0UvH D <uzhsz`qzdoz\mzQ #0 0 K HKwH D 3D 0S}YH0SD 46S30kS\ 0S0S\?{0P\0 `yPD ڐ`V L40kS7S<.zh,z`*zd(z\&zY0ц!0Р `0Ӏ ŀ0 տD0p0 l@ D0D 46SH0SPiT0Q; E HKSwT e MwH D H0y jT0s$|HKL uH D HKH@K0| 0u @P0H@ DP jP2 XP K'PL0$P0&D H0 @HT (60jS#:k0c&B# P)X6Q `60&0D H0 2|606C#**0D H0 )H0 1H0 p 0-LMP0@S ,Ĩ, 000 0108"000 00 1 080 0  010800 00108C.0 6:0 0108 -RtL(MDK@P`p0D 0D K0@K(0K8P @1P( 0 K; `0M0 5CSЍ0cC*R7S0BS c020 -R00LM?@ D _$R]ʘ"@p0 @t 0-T^ +T@< <  x 3X00S 0T| Rp8 4 0%q8 K o0 P` 00D S tD 000> W070c X8R V)& U0- 0\00S4080 Po P` @DPP@`00(K@0<0 U"00@P` V0<0R00S Pu`DQ RpG@p @0D 00T /8 4 0 0XSxS~@0 8 40 p000 = -pLMP? @2 R^ 40SW0 R r 1S0C10C =000PE `0S@0PM  jpP. @ 00@p0 000CC000 R0@ <08 000B 0C B0S k{P, 0S0_'0 0R0 R*0\SL .P 00π0;0B #A03@ #0000d2 < p-RQ3LMP@`:Q |Uxh 00x -@QL@Mp `OPP @|P 0(K 6(0S  0  K0 0$I0I -LM@0 Q0  0S0S  K0 00 0R K$S02S0P/| IG-pQMP:*0#!`W 30lJ 000^##?0LLPL 0#!W0 Lp JB0X@  0^ 0L `0PL0LЍ 00P0J -LBMğ$MTpK @P`쓟<U0,0 0$S C00, 0R(K0@2SPaU bUႁHPH#:K0$S000C S000C S0$S 0B0KS d00?S;@K) \  20  ;K <0 #T( 0^ t0 80K0@T` 000S P 10 ,K"2T0D:*K 0bBK(LL:K KK K 8#K*K<K 0jV@ :KK K<K@ TK@VKp`K @T@DK@ @T@@D0# #$# 0@TK0 f`<K  KdM`J`<KG`D`ᭀ K *zLI ItJH0aP0 U^00U#3   0 P$] p-LM0@,  0$RP`@  &3 >@0b0N!QR P00S\Pxl90\] -LM 0`^?~Rr@P @10鎠p@PJ  uQ 1p\ ,&3,>0b0A!0 S00QP 0 @0 0 (6#(. cN 0B 0S   00C 0(K ] -LPMܤ0d (0 @0 (0  PU  U UVh@K? mP$ K0DPCK0SH @<0C<S񟗳\xlL@4(thD8,0 0t 0SPUSP, Pp 3P9P@  u  ui1':@< 00 2PP 00 0 0R@Q,0Z0$%Z Ul)0@ Zu( 0R|$K0000:$00 00(00(000(00 S(01,( 1 l0 00 0 @0$ (0 x00u00r00o00l0$0i0 00e00b0 0_0 0 : B$0( V00S00P0PPUPPJNx^00h0 R 0SU 00t4K(n ]]$.]^ <w] -LM@, 0$P0  ->0>0S $p(Kl90\>0>0S1(VUED)R`0D9 (H9^ 4 `N 01qW  A?PM U0\Z 0 0e6Rpa_0SW 00 e S10e1I0S 0S  s1Slda0SX1 @P00pS St !000 !00C0LtD)`aa1张0e1 R%0S00S0Ss 0Sp  sj  t s[  t] ^,^ < ->0LMYP8  x(Ko]h2)&(4 R{14 0cR4 cD9S{ 0H9ZD)00 - Q& `0 Q1!1 0a10 a01Z` 1(Q0A0q@1S zP |p\!(Q 0 A0A01S` 00` 1S 0`AV0 0( 1S(K 0pS( 0S 8 0!4 !101( V S(Ko 8/P 8L(Ko40(D9~ 8 Vs8  T<^]L^d^|^ -LM⠃`PpP *"*R@ R@  B0B TN0ST83 R UC rpP  @p6    108#(R!T 1S$\000!R 0S r*1S1100S00@@$ 0b SP1:U mHR Tm: ZV >0N@ R 0SR$0+ cZr mDQI0D91 S1H1011@ @ \0@@m vp DQ, H9010)DUYPXm rK. `0N$@a nrP DD,D^^^^^ -LM`Vp P0S0 @0T  @00S0 h0 0CR0Arp:r<0< @80T 0S$h.r <^^ -L,M P@ P/$0:CZ*`>0N@@ 3ppj 0 yPP$Q0VSY $ a RU*0SA @:b0QpP 0SM, 0(R> (G0JS~pP@D P0H)  D !@0`0V80 0R *1%S@D P0H D)@T0N@$20!0RPp@^@l90Q0%So (K058#Ƞ@^@0000!1 B("(0,R1!Q00000c02!0QB-  @p00\00S Z pZ p P @~ #2y p0pD PPAvD r >p 00!R pa *qP5 p1D o@0S $0c fp$  bp @p< pw W:370#200Q0<00 0 HP D `00V40 p Q0000 p0V 0\ WD< !q11<< pPx^  ,20 B0R ^ ,"   0 ^8 @Q0`<08`< 0 ( a>p$0 c:37 '8#8!1q1<p 00<<*p@ 0P0p@ 0 jP  4 00S040R00 H0`h<*[Q0``D `Y]d]h ^_ -LM@< pD``TPPU8 @"0S@"0S2 f 00S0 @8  (K0 T00 K$0:CW#*p>04p  T~p8:V60TEP4 00~@P\$Qb0S 1$  boo] 001 0R0C0U Q8 @ <0P 0S TDD 00<=o W!1PP0 pP 0dX ``vP$PfpPXPP 000 P 00a oP @4$ <_w0_^] -LMP`Lq0S<<.0 N. @T@ x*Qd(0@S< 8@ } @4 (04@Su48 4 P!10b1PpW(  K@P PUX0 0CR0T D  (KWn?@ 00 R !,l0S@qD$ V @@ L@P0 em@W P (Q@P4@p  g0L@@8< 1p@m8X? 8T. t <P <eP R*q0S# 0L@Una mP% @0$PH `mP HA0S L@Pj@ a e^m< h0p@[@DH%< Km <d_w^^]^ -LMP`p0SԀ @0T ) @00S0 l0 0CRP0U pm 0S T 00ym/PPPP <p_wPRM  Ѝ0M0Ѝ -- LM 0  ( K -LMH@L,  P, PP, L$\4#0$@K$K 0 S2, 0R(KH 0KN@N0#T oL3PTL,0p0RD< k` VF``p 00^@< #0KLVF``p0S V`FV:000C0`F RBKII ! BKII KT @D R %RP0mSd %S00T0S0 @D P R00 P<VFT@lT 0P S 0P@ S0@T0@0  T@@0aS00cKA8< p1< A 4< 0 cT ZlpR0O 4 GaPPIDTaP0`0KD8< A0A < 4< 0 c3L<S H C0 KPD@`Pꈇ0 KVF``pX` 0S0EPD H<K8f ___DL9__|_ 0-LM@00 PPK0 -@LM x -LM@TP`pL 0 T0#03/70! 8W8?XQd@@0 1T  R#*0B0L!000c00R0nT-0 0@ L 1[ q8W@ <"@_ 0-LMP40@ L0 @K0|j_ -LM`p@P0PP@0  ps@TPPK<|`_ -pLM@ P  $  0 0 -pLMpd ` <4("4!<SVJ@L@TP0? " !BP <4("4!<0cS ,  < @4( "4 ,\,.<4("4A$<U@%LPU!0? " !Bp <4("4!< 0cS<,$ 00 q 0 @ DpD 0+Q> -Q  9 00@ SDp 0PD0D 0P 10@SD0P@ 0D /P 0D 0@!00/PP9Pڐ*0aUS RaH080 Dp 1 D l 0` P0`80  P  p3 Y ppT @@ bW W@PT@ PP 9H A Y@PPW 0WT P 5RYO`0So `\NT 89R QL  LKZ5@``L9 TKX@T P 5T@@8K 0TK@@@P 80S H0XS xS 0D 00S S  @ DKH0K@P8 { PH Dp ` 0g@T 48 TKXT P 0 TK@ K<0K[PH W <0@@cT@ @< @  0 @n0TlT @  07  01P + *[P $ 0  ! cH0[P  H  ! c!0L0P800 Sa 0  8 0P040 0Cp00 p00 @040 @e #P D21 0 " \  Pppp 0  0 < 00 R2 (T닺@"00 000 8 R <  0S S2 R/ 5TP000.@r`^SPPPF ^ +P>W 00S `P T@ 0VP @F R 000D0b@< 0@ 09"00:1 0`S 0eP ,< 00  R0 @"0S@ 0bVUE P0S < 00CS"@21 0 02@"@<  0S: S4 Sh < 0`BPP0 0SD0Pr TP0 0Q0 0U f R!10 < @0@ 00S{J R20S. (.0M\  0@RZR R Ѝ000A10  RM*0\0Q00QЍ- 2RM  101.Q Ѝ 10 P *0 BSP*02SP: -L M@,KPRp`0KR0, c00 c R0b::p  0N$K -L` B/ bMR@pP00RRP 0 WP0 0@ P VU  0 BlTPP P 0 BcT0PP0 U @98p@-0"`RM1Q0@  0 ^2$ Pd050 ^2$R  0fC1S00Ѝp^0^0 -LM0 10R@# *P0@ @0S Q @KK0 Q@M0S. !0      $ ( ) * + , !-" . #/$ 0 %1& 2 '3( 4 ) 5H0S <0 00 00 Ѝ< <<<@- bAM d0.3Ġ QЍ -LM8 4@00S 0"! 040 008 APP@Q Q00S p 0  QP- 2`VM Qn0X W0#03R0ST WՕ@ `' 0 P@ Q0Q0XSxS0 S@QPX\ W0#03R0SgZ1* 0Y0*00Y*0S  Z QZO 0AS (K R WՕ@00' 020@ < ]<40S 4 `0320)QX00S800Q" 0R )RP  R0)O0 XSxSa0 S҅@\00 $Z*8 00(.0MS  0 S Ѝ -8@LM,    h(.02k -LME` -LM0 `R0`QP: 0P10p@ 8!#800"( (!( 0( W"H0 0b1 P 0("( #8!80 P#HT 0Q 10  P@P  ! sYP -LMpppR0S \hRTPT@]n`00@XPC/00[UEOm00d2DxMMЍ2Tl -\1LM R/ HRDQ SZ RX@J0S R00 D0 HC/ZPUR`P@0@7~ 0PPlX X00P100X@C/ZTV \R$ 0``@d2(=GH4= -LMpHVP`0S<@T@0S ZP 0S$K$KmZ 0@P0jwp t0 F00!0C 0@000 pZ,0 0S Z <h2 -LMU!< 0S`!0001!p0W0 P 21CPU@ J 0S X 0S `D@PUZpW@!X00C0; $!0S2(K `D 8KSX< 48aZP 0S  0 R 0S@  <IZ 0S YZ  `0 R NZ(KoMZIZS40P @<T 00 <h2 -LMtUP`@C00 K }I@ 0D=<.k~f M0-LM@,PP0 PDK0`" 0-LM@P0S p/~D00S@8h -LME Pp , 0  | 0  ' (0 @P @ DKH0 P 0@0XD0`0K00D P 0  0P  @P D0P P ` 0-OP 0S6 @KD4@ PTKP O$$ QNa HKtP&$00K3 P0= @@ @Q Y0ʗ 0S 040\S, 0R(KP p$ <`Kh@@PK0@0 d 0C`PHPF0S 0#S 0 8 404[ n 000S`K⊙`PK`T0KXL PU`QQJd2 K P0= @@ @Q6 Y0  0S  uX0Po`0h QjxPK 0@K]P[ 44P? Q 0  0 P2 @@D@  RPP00Xe0c0=@P` Ꜳ 00 RR@P00R0 0 ꌲ0 8 40N040JQ4FK 0P0 408 0S 0@0K"40@xPx@ xP 4@& .Mb?Bk -80LMQ < 0( MЍMЍMЍMЍ p-LM@PU% <\ Kp04`K0 @ 0 0( 00<000S @P P.\=0MS\ \ 5aa`taha\a 0000  ЍS 00  0S S S00  \00 \ 000 S0000000 0 00 00 000000 0-0LM 0 0@SP 8P _P xP  sP 8hm 0-LMP@HP 0S^P8S8h68hP 0-LMP@IPK0#P 0S 0Np=M Ѝ 0-LMP@ P8 >K0h 0-LMP@P8 P 0S S 88P 8h-$$ M @ Ѝ==MЍ@-0MS@ 0C0@ <(4"4!<0  Ѝ-0SM0C0 <4("4!<0  Ѝ0 McЍ0 Q0aM0 Ѝ MR %3 a 0 0% % ЍMЍ 0-LM0@SP*80b0 S 00 08 0-LM0@SP*80b0 R 00 08 -LM0@S0C0 <( 4"4!< K0 R 00 0K 0-LM0@SP0C0  KR <(4"4!<0  K0 -LPQFM0`,0 @] TC TR0 41 8! 0)p@S810(KOK 0< L@P! M?KAL@P8!@TK?KS N/K^zP8!һ@, 0R(K081 4A 0p 0LP@.00<^NK_K<N/K81 .zp 8!+A[S kMЍ 0-LM@PuP8nP iP  8hc -0LM (0 (K KMЍ 0-LM@PT *0 K0 K0T 0KP 00 0-LM@PT *0 K0 K0T 0KP 00 -LM R *0R0 -LM R *0R0 0-LM@PT *0 K0 K0T 0KP 00 0-LM@PT *0 K0 K0T 0KP 00 0-LM@PT *0 K0 K0T 0KP 1[0 0-LM@PT *0 K0 K0T 0KP 1[0 0-LM@PT *0 K0 K0T 0KP 1[0 0-LM@PT *0 K0 K0T 0KP 1[0 -LM0@K0 P00K -LM0@K0 P00K 0-LM@PT *0 0S00 KK0T 0KP 00S00MЍ 0-0RLM@ P0PeS S S80P U80 P U  0, 88 0 8= -LMp@`PP \ 0S 0S \0S 0  -L MpPW *0(0 ,  ,KP KW0,KP 0(KP ,0(@ @0P``0(K -L MpPW *0(0 ,  ,KP KW0,KP 0(KP ,0(@ @0P``0(K -LM0@Sp`P S $KP $ R `V *V KU Q$ n00 U 00$ PP$  0*l<M Ѝ -LM@P`pP @T PU * iU 0SW )00T WPp 0*l< M;ЍG-MP$0@Spp` R> %Q Q*.000W ^*0`0S&J.\ \\00W\00^: Ѝ\Z0h0? 4 3 #^ #R0fY0Zh PM *0S  0 Q0 SPlЍS Pl0Mp 4 00  P 00ӑЍ== -SL0M L P0 @ D0 H0 <0  P RP < H D  P0SD H  P H H0SH D 0S Lp< R P0D IS0 *40 400`080  XT 0BT + SE Q H 0AS00H .W Z@0SappW .WQ \WpW0l SWw 0B>SlW a `T00bS:P.U \UPX p@mP X 4D R4 0<? 4 X0S8 <0cQ@0S?#<  cAL0!c  p0S .S` <Q (K0S 4D R4 o|D 00L@ P*00L b<0S D00@ MR$ .0A Aa0ARS00A-Q S_Q\0 .Q .S \.\A Aa0ARS00A SЍ0M*S Ѝ0.S SЍЍ MR !0B]S,.R00S \\R RЍ.RЍM0S! C ]RЍ0 M Ѝ0 <8MЍ <M 0Ѝ <0 Ƞ 4M0ЍP 0M0ӑЍ= -!LM( "x@P`I H I hP -LM8K0P00ı@ S0h h0, $0` `0`(0 @ 0  0 C00/o٤@00H -RQ3LM@`:QCXF !0SK0 R r 1S0C10PS000 @ p@W 6G000hPPpd 0S! g _C $PP@T 0S" d KCtW 0@00؎Ύ F  0g $ 00S ƎÎ < 0-LM@PPU@8 -LM@   K0K  @@6DpKp@-P`MP@0 RPЍp0Q ao@-pRM`@ PP0 R^ \Ѝ0Q ao-M S 0 S@nЍ@-@MP  S 0 SS00NЍ -L MJ9 K -L Mx? K p-LM0@S< a0S60 R r0 110) 0PS PP೼00 P @0P 0 00DP 0D00000 Rx@|P 00 <0M0CS 000ЍЍ! p-LMl`0@S 00CS00P00Sx跍00CS0P < -LM0 @R r 1S0C1P0 0C0  0-1LM @R7 0 P00O U000SE 00 $0D!8#8 P 80 P @0P /0 P<0S0 800880 0@0 00 890E@ ("(((8#8 0 S ?@ˢ 0@008?P0P00 Pd2h0M 0 S ЍЍ? - PLM@0P0K$K=`PP OipP R $00S#PP 8#$  <0$  `0` $0, X0X @(0 P)i #ieP00ꤡH -LM0rS' wS! aS Q00? R eR8 xR +R R 00 ;< 0QM *0S00S0 QЍ -LMTp,@KP` 0  %  0RK@ p -8LobfrgRBQ Alnn  `` @`MVäp"d@`FT00æ?d@D`R ?V00S \ W  80W  $@0 KiQlqI -LMp \, ` *: 0 0 tpl*h: 0 | x 0 V 00\ %\z^444444444444444444444444444444444444444444 4444444444444444444440TxX4444X44 ,8x444444(D4(4ЩTx440Hp|t, 0R(K 0So$@ T@d Ϡ0l% 0Sl l  0K0 ?S   p尀`/` p p  K   KpKE_K`P` 00b  `X  @ < ;8  Q  @K  KqP K P] @ K RE pW/ `pV% P@K  00K\0 cP0} :FPl;0 l0 WK@ < @K 관 XꨀX PK`0 0VʥU@ <0 0  SPP``VP ` ʒU`K@` P* -RL\M`@0<S x@ @dp@ 0S(K@>0 >S dx@ p j86P01x@ p0 @0 p pP00PUa <Uy t@ d0S,Sn00>C40 0q03W0Sj;Q,Qg QX5%0  00@T 50%  00Q ^ Xpş @0M͆0@p00 4P(5 a %0` B00 P Y00 P 0 0 St x Y m p  td;S 4K{P\HK PV 0,SS\KPN pWKğ @0M͆0@=`0 34 l0 3p0 b 0#P0l0 B3P ppp` ` h d (@l  0hK4pl hK\0KXʲ p ` 00B00B0l0l"Ϡ12l10!l0Q0 3l20!0l R001$#Bb20a/0 hK 0S |0 NRL`0KS` @El 0 Kl h d 0!0Ta !0!100QP0P`0Xq"10 d1  PR000jO  1 0RcX0K@Pz͆@ 00pa  tP  P0 P@>0 >St@ dU}WJ ` 00B0C0BI8rDr%L*H*P*\*`*QqX* -LM@ pP  hr -LMpP`0. 0S@ t,.@ 0|V X0(0T=H00(0(0000=@P 4,$=rB MЍ8 -LM@  -L$M@0 <@ L4D H Y@0K00 ,@ 0S 0<@S2 0S&\- 0 S 0QM@  H00K @H 0 #0 1H ($K<1 0 R@ K 8 40 Qsp 0@PK`1 00PU`@"0 pp  1A0N@bR#n1A$@KP8 4 08KS#ʀ 01 0 R D8KH qHQ0, S}x P` 0OHST 0<Sr[ \  0! 0<@S<7  QA! 01eP@0KP0@4!0 pp  1A0N@bR#n>@KN$0@80 4@ /0@S+*X0@S0@SN"1)<0S{70@ S0Sx*- 00R Q =Y`X% -@1LM`44!V C 0S͆]P !0"100 !0S X @pP0P_0@0XZ]PpZ0=0 @4PpD3P00Z$000 ==%H>Trrr -xLM0Sd@0 0R  Ph,0P( B -@LMN,hM,0 0-LM4@PA (Q0SO3P2 4PP+P0S. \0   B,8hA BPxP 0:S  P 8,0m8h,%P(( P*L*rB p-@`LM@+  @P+x0 P0M 0Ѝ p-<`LMP@+~ @+x0 -@LM+lh+0 -LM< 8 <K< K @_@4KP 4@ 0P <`K0@0S@W!C T9 4@K00@P 4@ 0P <`K0@0S@T* S1 04K@V4@K0@ P 4@ 0P t<`K0@0S@W S 4KP  4K(KSVTTS 0-L M  ~ @K0 KDTK0 -L0M@@KZK -LM(@, 0%+P h8 -LM(@, 0+P h58 -LMhT -L,M0PPp,0 `1  9@KR0! 蠟 R0!  0Ā"K3 0P0 0    0@pV@@, 0R(K؎00 <'ЎpW00 M-  srqDsls(sr -LM,@H $0*P H hhdM ЍRM0Sa@Ѝ R 0S0000MS0S SЍ -RLM" 0S B@ 0S \ @`0d S:^ 0R B^a00@2 -LMP@U`2p@P P P@DR B 0\R#R! B -LM@ ,0( P00 -LMP(0`6s!(`W0 W#AP. 1!0 (1! 0P10D! D , V00  ,0o6ꂁAP  0 d2ء -PLM@ 0At ƍ00 -LiM41S(K4 0   @0 D @ LA \ @   pP`H! 0 P1 @0TA @AX 0AKA` /AK.QK-aKDA)K*AKHLA'K&AKPTA%K$AKX\A,qK"AK+K(K#K`A< !AKd @hA  p @A @Pp`l 0( t1 0,x1 |  004 AKhdAKAKtlAKpAKKxA|K1 QKaKqKKKAKKKA儡AKK$0 @A 吡  `@0 P$p(1 41 ,8  041 AKA AK KAK KAK唡AKKAK堡A QK aK qKKKKK@K40@4<A @ @A  0@A @`04P 8p<K嬡KK@K0K1A弡PK`KK0KpK KK@KKKKK@0P0KnK1D0 8  @8 @0P0 U0<A/ Wp AP @P 0TP 8@Q , 0 m1P ꋌO00刌0,1as -QLMP @4P q 00 sPP 0 -LM4!PaPp4P 1!0C110Cs1x|P W 1S @`8`P@ g1SPaP^pzVYWppp 0-LMP@P TA08P T0!3101Q@0@ 0-LM@PP P8 -`LFMV@8 P<1 e wP 08!0 101RA(  8@ '%0!p@U K@ VP@ 0 1P0  @0 @, @' Y$0 S ಐR 0'P |0Px  p7' Pg  /'1S0C10 0R00001p0q =W0 pU <0x03 (PJXG@8 401A  0 <30 BQ 1 11  00q ͆0! q0pq5 !D00^ 0 'P QԴR B 0\R! BQM  0R $PЍ0 0" 00" 00" 00" 00" 00"0Q2 00" 00" PM  00P Ѝ -RQ3LM@P`p:Q* T($ ̠ 00` S00K<0 8 , 4 &0 R r 1S0C1<K 0`SV 4` @$K@W 0@@00alWl <@-PPM@pЍ0`V 010P T \ 0 S  ^ 0^\0=S P0fC10$ -LM0 S=S  0S=S` K K -LM,@ ? kK`, $ %?P0Sl0@Ti0PdYe*0UXSbp0WXSpGY:0gSW80SS l `K@ T 0T1(K""30Cc!8C S  U \00SRZ! Z Z K?P+XC00@, 0R%(K :P 20S @ -p@%0S @00@0S@@  0C!s -LM 0@`PM 0ЍW0M ЍQM 0ЍK0M ЍF -LM 0@=pMЍG-@0 084 0<0   0 0 84 0M<0   R0 P ` p@  l0 P ` p08 40< 00 (0$ ,$  084 0<(00 ( 0$0 ,, 08 40<0 (0$ , 0 8 40<0  (0$ , Ѝss 4 0 0-8 40<80 (0 $ ,M< Ѝ -LMlIS@1 08 ,0 < 9 P8$Q `8! a p81q 8A 8Q 8a    $ ! (00 ,@@ 0PP 4`` 8q88pp < @?\\lK lK<00@ R < 0!@0 0 @ 1 $0 Q! BK@p0 0041 ( 40@,001 0#1 1 c81 `0*dH,a n`0lȠp (q p,(1P,&4 #'a01 ` 0eZ0 0 ( @#1b*,1 c̠1 c<1 ,1*00 (1n00 1dLp0'P#0  #0\00 0,00 10(1 0`#0&@#1nc81 `0dH00 000 0 &#0` P#0eZ00 0 00 b*1 *lȠ0(1 p0'a#0 @# *1l̠c<p`p 1 p0` ndL`p0& #0P'#p0,0Sp0  \U00 0 $ 1 t x 倀1  1|   !P `pP  ` `p Pp Pp @ P p @ tx |0!",#<  D H! L1 @P`p娀嬠 0$L%\&l'|(*,̠. !",#0A?@P$P`(`p,pԀ0ؠ48<@q@@pG@q @?P P8A4P`0``, 0R(KP p  00@1Qp P8A4P`0`; s -("L8M0TK(,0 <"p{ `V? q;@ 00@  "(P@ aPI ,0@`U 0d0@0D0H0L0P0T0X0\0`0?0(]0+@! 10!,0Q<(K@ 0P0>p@)  "p! p 0,@n4K@x t0P0m>p@  L!p40  @(S   jHs -LM⸑0SQa RE 0SB0C0 儡0S|q tq;@ P: ,0@` 0d0@0D0H0L0P0T0X0\0`0?00@ M@b 0KY 0 0  00C0 Rz!0(K 0S00k!@\ X0P0=p@ 4 a!p0@0Sy <H -"LM0@Spw1 RK 0WH*0g0WЁ#`;@ q`PA ,0@`L 0d0@0D0H0L0P0T0X0\0`0H1?0W= 0!00S @WP1P!M@c    0pe0e0 0S0 0W:00@ 0P0l=p@ h p P0 @4 0S(K(Ko wR <HMЍ 0-@LM P9 8h -- L^M⼠0Q`(0 qOoK`FppA@O?KC/MKl1 ;8#8?C0C0V`p VppH@P 0C P00@PP00T0#S 00@ P00T0#""S T % * 00@ T46"*C2&b& :460V0+ Vp0pS0Z0p0GT0  AT0K 10 , 0 #2>;8#8 (K,?P046S  -  '4 K00K5Pl $:**Rc 460B Jp x>t.t> p.p>@ Pk \.\> 0@P  0P-\ࠃ  >  P0L࠳0 0jS SaB0Cx U U Ex0 E\x x t   Q00 @  | Ps \00S ^$-01NB0L H    ̟ 30`p@0 T P< LKP L H  @L K \ X ^ \K4< /P00Q00S RO\K; b0\ X 0L0 < 8  \ K S; 80@S UA ;\K 0`pP 1P d `   ph `d0S h\\dl 0S00 p` p04S  0?o \00ӄ!  \ `:  0P d ` p100 h Q @ B¨ Ũ0@SAA$EEDD | | 0Z J⌠ ӈ 匠  | 0S00 0 0 | | 040 0C Q 0A63@ a 0aCA J Ap  8 < D|\@d 0xS\x0xS0cx @cc R|0S d#Pd [ lgPPW l!lP P` O tQ|P R00Sp Vn46Sj70Sf x0@0x0 t\0\x00x 0 x @Tx0Sʀ\6 R`U XYd d @P d0  ! P d` ph ` d P <loP Q U00S 0S X^00S \W UbP 0`R l  _Pl hd\u h  TPh d  MPd PP `lhl.d`-@P 00`S yP Q  0 cc t (0 P00C0 |\ 8@5 (E  0 D @ \KW@  0\K 0@ pP`@DK 0DP< 0 0DK8Pv8Q i D K 98 P 0jW_ DK 04r $4D @ k`P@ 0 0@@D K `PP 0< ,P0@ pT0 J@P 0 ` 0= 0 000 0@PP 3 T\T  0 @P  0P  0P <  w9R W<00<  000<00 lPl 80 820  \K`N 0\KS 0@PPP 800 p\00W 1 P@z`. 03 0P@~8P00 000 <1K5  0hP K   0SP0w0S <p t80<d0 `0 @nT/\ X   2` 0cS0Cx @4S2+  Pd S h `/' tt?aCoc?`(?yPD??$@@@?px x0  W Db 0@P0 pH0 p G @P `\@ XP p@Pl  `lZ0`l`l0  \0Sڌ T@h lPl `mP0w9S{ W p100  l`\Pl  hPl UvN  `010- 0`p^00CN@6@cAPd x @x E0SS` <P` \l`!PʔlP` W`iP` xzlaPl mrdYPd rjl0S0SU%`qh o9V00k90000ez0w0S p] \ X pd  Pd ;l"Pl U `P `:V `>9V X1``8`3 -LMjp3 0-LM@P0 @80-@PM 0Ѝ0 -LM` -LMCp3QM Q0!0a0ЍP-RM \1,0l00 ?\0 00Ѝ-RM 0bR R ?R0̑030Ѝ12<0Q@-S@M  \0l 1<0̠ \ L ?\0 0@@\ P T  0  0Ѝ-MR ,0l0>Ѝ-S0c012M0 0Ѝ0M S 200 ЍM0 3# R02 P0 0ЍM bQ B2c0 Ѝ@-M @0cR#3n\0CQ0C2 d  l0Ѝp@- HXH$H%X!! a. $.ȌT2Vh`M@ЍpP1#3P1 <2MЍ tPQMЍPM3:00QЍPM3:00Q#2ЍQPMЍMPЍ ;; ;SMЍqM0 ЍP0-9`p\P@ UM` ЍV( 0@0000# p-LM`P@@@`@x -LMPP@`pn P B`B0Q40A"A`R0E0U0@ EPU0_ @0P 00`04S0`P0000 M ЍЍx== -\1LM0ps3X@@`S P S `8?SPQ QU 000@U000#? 0S`Z?45VCq00ࡣ0aS S4#0C@@PUQ @T@P== p-LM`P@@!axh -LM@P%! 7 `p  P  0G`p^ -LM@pPe P eD -;PpLg4M5^@càU WN^a lAi^<.0n0ðVU, UPp V* f(\\0"?DE iW U0naS S6#0c``< 0S00O@`V`=A-;P`f45^M@s à U VNŒ^ 2 0N0AA ЍA^<.0n0ðWЍU U ?1"C 0\ ЍA6V U0nrS S 7#0spp\?DE pWp/RM ЍЍ-/RM Ѝ'Ѝ -p!   LMPP` &:::S@ W 0@ 460@ P ?460 PXP -p!   LMPP` &:::S@ ?P @ P0@ 000#460@ 460 W V  RXU -p!   LMPP` &:::S@ ?S@ S 0@ 460@ 460 W V0 PXU0 p-;@LMTTUo Z~T 000x54 "d a3000V `xT00U0SxP eVx= -;0LMS@ ;0S P 0045S P C45S PP -;0LMS  ;0S P P0045S 45S  R 0#03P -;0LMS  ;0S P P 0045S 45S R 0#03PPM PO ? ` Ѝ1Ѝ 0-!:LʠʠAL@NM$^?&P@)0\^.0n04.U`U00P00S R 00080\ U8 8H0\6n "30  0008= -;L4M^P, ( 堏' ^ ,P=O*1@@^ `0OO0   K\0O/ (K, K (N( \0O/@0 P0@40 0@ $p8 @ 4B0 ^0 ?^4@^ @T@0X0@@`"Ѝ) Z 030#0Z& ` 0 `0O PO ` P`` ЍG"04C0X0 Y ZnfQ&030#Q0516!P&030#0O/@0  Q ?Q 063UP030#&@Q `V`UP&0 A030#& -顏OLMX`p P $K -顏OLMX`p P $K -L\Mx t t` |0 |&Jᄪ.J`tDE媪ZoO`&p` x@`<@ 8 0 D` @ 4 P d^ ^P 0 0(p(K DK4 K@0Ku0Z8<p p0O჏003<0MS0 0S0Ѝ 0-LM@P  QXP0SL 10A88h腘4}(10 AR 8h} <> -LMp0PS U AT01 0S0 00} U e10P@ @T}0eD!<0 0c1S10@0` <>> -L M@Pp`P# 46 Z,0 6,0 T(@ ,K,0 0 @UC>E0C05 `0  C>@0C!0 B@`@ K(KP,0(  `!30(0 0,0 ,0S@@0@ -LMP`pP@ 0`PfP5 p0!1 0 P`0@ Q Q @P` XP` P *0 @0S@P`YP`00S 0pGS B p +P0 0p -LM0 0BPU`pڂ UP# T  0R010C 0@10 d 040 \2.R P0E00\00\0 -L MH PpU0H0 H 0Pp0 RH0@ PD O @ 100Q<0 * 00<0S10040 !PH0  8 "*0 0S H 0pP`5 J$80  Sp 4 R00000 @ R < 0S 0 BS@00S@0 @0D 0D(K -LM@l P00@ -L M4 0pǏ00 ɯ0@*"P0` QPp 40 0R 04 10p40  4(K8PP4P  40  ! 44P -0LM@ODa TAPU/ ` @T P -@P/ `p0S {@T 0S {PP@ 00p0S |{PU 0S \{LePP 00, 10 dP$ <>q(y -L M4 0pSV  0S 4 0P6000 K U& 0 R  Z `1`!@P00V0S V ,@PZ 4 00dS0 PdUP000 PU  U 1+#,PP`4 00`S0 (KPU B<B S@ <  ) U@1  `!`1!10 0f @`0 4 00jS0 PdUPPx mc 0 00PUb UR:,PG @ `@U0@`` 0@T:⾘P3  00b0 @@0 0 @0f Z0 c6P0 ]  P0h000 8 000PF 0 @00j 0 0e `@0  w0 00P `t p-LMP `V 0@f00T`0T  ,P`@`ʼ0@00xx p-LM8`0PS0@S+Mx!M < p-LM@P ``0S0 P0SMxbP 00Mxh < -LMLp`PS J0SX@`PUZX(= 0-1LM @R P Q. 0 0 0c0 8008h  0 P @0P 0 P$000 08#8("(08B< S 0 d2 p-LpM0@8CP`Z0+0 KpKa-P04: S  Q;  0  SL ( 0R   p-L M0@C 00   Kp K$ K` ޘP $0 S P000QPP0C0  0MЍ(, -LM@ p 0PT:0q0:0 p-LM0@ `P 0  0: 0xh 0-LMP܋P/P00@P0T@80:08 -L0M4@0@K0 7 0RK 4y -0LDMP`@K>`Kpt  P  0DK D0 I0 㡘0 PKL0 H0 P0 ,!n Tydy MЍt,@RM 0S  RЍ@@-M Ѝ@-MЍ! !P: ZŒŒ#! !P: `B!,aB 0>ZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0 ! !  0-LMTP@T K0$ L$K 0K  @@p$MЍf 0-LM@P8P(008P008yJyJQM R P000SЍMЍ p-LM`PP . US@  0PP@ @00\ \ @UR!000x0_@T00x00xU  RR@PP @T@@-@PM RS 0P 0 R! Q\000Ѝ00Ѝ@ -PLM QP_ T00 QM 0S0S QbЍPM 0s3Ѝ -LM0S #_0 0P  0  >0S@  ?0< B<R0LA0 0!88S@  ::S ^T0 0@ -LM`\@^0P0Q`l PP \  P p|3U1P 0 S 0 S?0 ^#^/0nP   V PRP^PT00p0 P 0S 0Sp0CP 0Sp0CP p0　PX6;B S:0V RP0ꨙ -LMPp SR 0S40S1g^`T000` 00R` 0SJ0S`@S @Z`0 d 0Np> p P` P@ 0 0R @`ZWP0  d 0-p p P @`ZW0P  0 0`` -LM`P8 <  ]0P0(KZA <\S00P4P 3 P S0M <0P SV#8pe04 0@SW p@84 0P000K@p0K W:& 4 84 000< RP P @Q <0@TP 8 0Q0K apP8 0 p-PR00P0LMS@ 0T1:<0 0!00U0S0cPlP 00 R0L  %a 0Q010C   0Q0Kp0Q*,,K {0T*yy -LM@K 0 0 y  L100V@*2 -LM@hi+F@*+ 0RR! B@-Q:@- R (2 R R -PPPP RrPP B PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R@- RP1P P1P RrP1P  B P1P B@  R010 1  B R0q0`0q0`0q0`\0q0`0q0`0q0` R 0\6 R B0@-81, Ġ%̌T$\D#L0P  R0@ Ġ01#̌  R R B0@-81, Ƞ%ȌX$XH#H0P  R0@ Ƞ01#Ȍ  R R B0@-81, ̠%Č\$TL#D0P  R0@ ̠01#Č  R-R0 0c BSR48 R p-@P`x BRpR0 BRRR MP 0SbЍ22>***>*ee>*>*xx>*SS>* 0-LM 0 @0 @P>K0JJ>*>*>>>*MЍMЍMЍMЍMЍMЍ>* -LM` 1pP @H1B@A01 d P d^ 020 0 0 崜8q -LBMbP< , @$ D4 y8 &!Pt BNK@D@D0" P]*BnK`FBK `FA0A 04 pr yj  02R Pe 0CZBNK@D@D<p`004 0 ^ 0D\1 @<@PZ@$00@_S c4R SQQC 0<8$P%p. 8\ ZO00Z?00, 0R:(KP@4<`%0BTD F@ F@d : :<0@JBKNN``0( K` 0T 0@ @ Ryry -L Mp`xQ@ 00 0 0C0``(KSL R ..., where is one of: instbin%s: %s not compiled in newfs_ext2fsmount_cd9660md5sha256sha512dfmountmount_ext2fsarchsyncnewfs_msdossttylndisklabelpaxtarfsck_ext2fscatifconfigsysctlping6datelessmoremount_nfsfdiskgrepfgrepegrepumountmount_msdosfscksignifymknodmkubootreboothaltmount_ffsdhclientcpgzipgunzipgzcatchmodchgrpchownfsck_ffsnewfsrmmtejectmkdirksh-shbioctlencryptsleepmvdmesghostname%s partition type is not `%s' (or use -I) -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `ext2fs' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file ilog2SSSWTWTbrdfsfsinitinit_resizeinoallociputwtfsioctl (GDINFO)%s: can't read disk label; disk type must be specified%s: block device%s: not a character-special device%s: can't figure out file system partition%s: `%c' partition is unavailable%s: `%c' partition overlaps boot program%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device where fsoptions are: Bad inode size %d (only 128 and 256 supported)sector sizesector size `%s' is not a power of 2.verbosefragment sizebytes per inodefree space %number of inodesVolume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:qs:t:v:can't open file %scan't fstat opened %s%sr%s/dev/%s: open for read%s: open for write%s: getmntinfo%s is mounted on %sext2fsUnable to determine file system sizecan't ftruncate %s to %lldcan't fstatvfs `%s'can't allocate buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing image%s: %u is not a power of 2 %s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode %s: no free inode %llu in block group %u %s: inode %llu already in use %s: inode value out of range (%llu). %s: inconsistent bitmap block size must be a power of 2, not %u fragment size must be a power of 2, not %u fragment size %u is too small, minimum is %u block size %u is too small, minimum is %u block size %u is too large, maximum is %u block size (%u) can't be different from fragment size (%u) GOOD_OLD_REV file system format doesn't support %d byte inode Filesystem size %lld < minimum size of %lld Volume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Cannot allocate I/O buffer Preposterous size %lld super-block backups (for fsck_ext2fs -b #) at: %*llu, ...%s: large_file rocompat feature is required to enable resize feature for this filesystem %s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir Error making filesystemx xPXT,- @@\ؽ`dh Hdл@@lt |unknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs cannot be zerocbs meaningless if not doing record operationsbuffer sizes cannot be zerobuffer sizes cannot be greater than %zdseek offsets cannot be larger than %qdnonenoxferunknown status %s%s: illegal numeric valueunknown conversion %s%s: illegal conversion combinationcbsconvibsifobsofskipstatusnoerrornotrunc%s: end of device%s: short write on character device%s: short write on tape devicefiles is not supported for non-tape devicesstdoutinput bufferoutput buffercase conv and -DNO_CONV%zu+%zu records in %zu+%zu records out blockblocks%zu odd length swab %s %zu truncated %s %qd bytes transferred in %lld.%03ld secs (%0.0f bytes/sec) skip reached end of inputht4usage: mount_cd9660 [-egjR] [-o options] [-s offset] special node session number is %s: %segjo:Rs:realpath %scd9660%s: Filesystem not supported by kernel%s on %suserquotagroupquotarwnetautoaccesstimeatimeexecsuidrdonlyupdateneedsdoes not need-o %s: option %s a value-o %s: option not supported%s: illegal value '%s'%s (%s) = %s usage: %s [-bcpqrtx] [-C checklist] [-h hashfile] [-s string] [file ...] error encoding base64cannot open %sstdout: write error%s: read errorbC:ch:pqrs:txbase64hex%s doesn't support %s ,unknown algorithm "%s"SHA256SHA512usage: %s [-hiklnP] [-t type] [[file | file_system] ...] df: %qd: %s 1024-blocks 512-blocks%-*.*s %s Used Available Capacity Mounted on Filesystem%-*.*s %*lld %10lld %11lld %5.0f%% %s %7s%-*.*s %*llu %9llu %9lld %5.0f%% %7llu %7llu %5.0f%% %s %-*.*s %s Used Avail Capacity Size1K-blocks%-*.*s %s Used Avail Capacity iused ifree %%iused Mounted onempty type listonly one -t option may be specified.hiklnPt:-h and -i are incompatible with -Pretrieving information on mounted file systems%s is not a local file system%s mounted as a %s file systemffsnfs:@ufs%s: fstab uses outdated type 'ufs' -- fix pleasemfs%s: fstab type %s != disklabel type %susage: mount [-AadfNruvw] [-t type] mount [-dfrsuvw] special | node mount [-dfruvw] [-o options] [-t type] special node -o%s,%s on %s type %.*s (%sunknown flag%s %#x, ctime=%sv3v2udptcpsofthardintrnoconnrdirplus%s%s=%dwsizersizerdirsizetimeoretransmaxgrouplistreadaheadacregmin, %s=%dacregmaxacdirminacdirmax%s%s=%lu %smsdos%s%s=%u, %s=%uuidgid%s%s=0%onowin95direxecnorripgensextattstatfs %s on %s type %.*s: %s already mountedexec: mount_%sfork%s/mount_%sexec %s for %sno mount helper program found for %sforceAadfNo:rswt:uvrqnoautounknown special file or file system %s.root_devicecan't find fstab entry for %s.%s has unknown file system type./var/run/mountd.pidsignal mountdasynchronousasyncexported to the worldkerberos uid mappingNFS exportedanon uid mappingexported read-onlynoatimenodevnoexecnosuidwith quotasread-onlyroot file systemsynchronoussoftdep/usr/sbinht4usage: mount_ext2fs [-o options] special node o:specified device does not match mounted devicefilesystem not supported by kernelmount table full%s on %s: %susage: machine [-a] usage: arch [-ks] machinearmv7armOpenBSD@@@h p p $p (` 0@ 8 $%s: no default %s%s: illegal %s%s: bad %susage: %s [-N] [-a FAT-size] [-B boot] [-b block-size] [-c cluster-size] [-e dirents] [-F FAT-type] [-f format] [-h heads] [-I volid] [-i info] [-k backup] [-L label] [-m media] [-n FATs] [-O OEM] [-o hidden] [-r reserved] [-S sector-size] [-s total] [-u track-size] special [disktype] %s: bad FAT typevolume ID"*+,./:;<=>?[\]|%s: bad volume label%s: bad OEM stringbytes/sectorsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorssectors/trackwarning: %s is not a character device%s: unknown standard format%s: can't figure out partition info%s: unknown disk type%s: partition is unavailablebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %u-%c is not a legal FAT%s optionblock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectorstoo many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs= bkbs=%s: can't read sector %uNO NAMEFAT%uBSD 4.4%s: can't write sector %u160180320360720120014402880T\ d hd  px|  t   8 :PTX\`hpx  #3#3233#@@ @@    $ , 4 < D L T \ d l t |   @ @        4a         (  0   < D L T ` l t |             @ @ @ @    $  0  < D L T \ d l @t @|     C$ C C$ C            $  ,  4 < D L T @\ @d l t |   option requires an argument -- %sundefmaximum option value is %d -- %soption requires a numeric argument -- %sdiscarddsuspeofeol2lnextminquitreprintstartstopsusptimeflushrprntillegal gfmt1 option -- %sillegal gfmt1 option%lxcflagiflagispeedlflagoflagospeedgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d TIOCSTOPTIOCSTARTTIOCSETD%d %d rows %scols %sospeed %sispeed %sillegal option -- -%scbreakcolscookeddecekeverythingextproclcasenewoldostartostoprawrowssanespeedttycs5cs6cs7cs8cstopb-cstopbcread-creadparenb-parenbparodd-paroddparity-parityevenp-evenpoddp-oddppass8-pass8hupcl-hupcl-hupclocal-clocalcrtscts-crtsctsmdmbuf-mdmbufignbrk-ignbrkbrkint-brkintignpar-ignparparmrk-parmrkinpck-inpckistrip-istripinlcr-inlcrigncr-igncricrnl-icrnliuclc-iuclcixon-ixon-flowixoff-ixofftandem-tandemixany-ixanydecctlq-decctlqimaxbel-imaxbel-echoechoe-echoecrterase-crterasecrtbs-crtbsechok-echokechoke-echokecrtkill-crtkillaltwerase-altweraseiexten-iextenechonl-echonlechoctl-echoctlctlecho-ctlechoechoprt-echoprtprterase-prteraseisig-isigicanon-icanonnoflsh-noflshtostop-tostopflusho-flushopendin-pendin-crtnewcrt-newcrtnokerninfo-nokerninfokerninfo-kerninfoxcase-xcaseopost-opostlitout-litoutocrnl-ocrnlolcuc-olcuconlcr-onlcronlret-onlretonocr-onocrtabs-tabsoxtabs-oxtabsonoeot-onoeot tablet disc; slip disc; ppp disc; strip disc; nmea disc; #%d disc; ispeed %d baud; ospeed %d baud;speed %d baud; %d rows; %d columns;lflags-extprociflagsoflagscflagscchars%s = %s;%-8susage: %s [-a | -e | -g] [-f file] [operands] -aefgaef:gnot a terminalTIOCGETDTIOCGWINSZgfmt1illegal option -- %stcsetattrTIOCSWINSZusage: %s [-fhLnPs] source [target] %s [-fLPs] source ... [directory] %s/%s%s: disappeared%s and %s are identical (nothing done).fhLnPsd: r \/R R @R R@@ R @S(@S %( S@r \/ `NR@ S_r\/@dr @9\/999: ::$:,:04:<:D:L:P:99X:`:(S,,S4S}N.{ɋFsUw-kUٻ4.yw'篒W;}ER$7eRD͒N4OZ^%7}UIE0UJWNU7pKˣ}%اqJxuó0cSbQ} y/`l(ψ S>CcGueScT}ƻdT$9i:^L>qt^ǥ޺)ʢ٤ҙN[1iQF4jUTz:]of6ٖTbŭ< 13U0zR*kt]ئl:0zY_dO`)H6@e:gjpqft֤Eh!YfR-RfoMaav-Mk\WM8GmkS76=|V2Xj֦],.IV9̙v.JmV3miJ0ˍ-2>8)pi1#M xtJ, @N*Ӡ4plxK|v0՗\-TSH.ީcH;fjIaᩁ;g#(@R ,5@zm"׹$gtK`)Ksg;q08@[0+k]2h_ju'e:;ڝj5o]j]ʠMzvJB>@VtJOĸѕʧ/&Q8SHAS[LsW U7d?@7 K8TyAx ^DDMOD׬BpNz조X?1Ts"˜[KAV:), =VqIF $kGr(6wr S85.+)sAgp ;lFa4t|qJz`^Z!jA8 hL)mp,xfn4U>nrY q6!p,Z)l";.A+bGlH*ik118ƫ.r`MTC%o psXjD*%# a^vCr^6-Mij-[~k y9$Qpr8D!VQHp_! =J~d@9ciE0"ks ˶XɈj9%ʂe9А eI6FauqñڈKD"lF+`u#ǤjjD9Q+],̤F$Gdn<hS y(@ ]ER 6h yA+4g*49ZH9%!Yl]: uftWq|nuCÝ8ΣSaԒոs(w$&')OW ﻲ< M "Mh1ņkR)ޯsM ySȃ0ݨtpY&U/f$HH}d|*`5fԃ0QI 1̚J ;Օ-P3x$0cel3 #rZ3ڇqJTW^ sӺLIКD 7V~[_M1Yx09&D]m貴Jp> c:|c 7چeAZB$s <WƧRɩE68G),G'm'r}} aP]pc\O0۱yAnswIkUKu\vI E|b2vuݮ u2FF m%[UdC<FƄ\%W=!,vP9j<+!v 8򀖸A@O^oh L'cnp kh\JSP VYDQ򾏒c-=+vř]S0*Dwa 9: -M~oրDh͞H 4]aBNj<9|$9 >&o_2ԗ+KwIPwjŠ.$U˸ҏYH) ]^"N Cv%{|/>DMdJOzYHƍRtŢvCN"3 \aK=o?R2nJUɍ0Q0)5EQ=dQr[嚴C@1]mL={88O7t3O#gؕ^::YT^TѸO/_Z%jim=`"oO<7r!ѐAA8Q O u/E/|W#O,1cҽ~6ru)rb}hm j+_GϾnնa=8ż6߮sN^oo?ӝQmfEy4ƤXN)ͰFVFnGE}٪ϐ#$J )@`l;Ot16ܣC.дk\T0|쌔 X=se0,Pxf'ٍh&[,2 0Uz;5#yͲ"wt4 'Fwˋ]7b<; RE#=b'K͜ru]R%#M%n;LVO 咯' c/p >%&AhLUWsb'~H~*uKFx-/ҕi`F7_OeݥLDv53mϞ< 2^Y"f?z1M]:MRusage: disklabel [-Acdtv] [-h | -p unit] disk (read) disklabel -w [-Acdnv] disk disktype [packid] (write) disklabel -e [-Acdnv] disk (edit) disklabel -E [-Acdnv] [-F|-f file] disk (simple editor) disklabel -R [-nv] [-F|-f file] disk protofile (restore) `disk' may be of the form: sd0 or /dev/rsd0%c. `disktype' is an entry from %s, see disktab(5) for more info. /etc/disktab`packid' is an identification string for the device. `protofile' is the output from the read cmd form; -R is powerful. sector size %dsectors/track %dtracks/cylinder %dcylinders/unit %dboot block size %dwarning, boot block size %% sector-size != 0super block size %dwarning, super block size %% sector-size != 0warning, number of partitions (%d) > MAXPARTITIONS (%d)warning, partition %c: size 0, but offset %llupartition %c: offset past end of unitpartition %c: partition extends past end of unitwarning, unused partition %c: size %llu offset %lluBootstrap doesn't leave room for disk label line %d: syntax errorunknownIDEESDIline %d: warning, unknown disk type: %sbadsectvendorline %d: bad flag: %sdrivedataline %d: bad drivedata %s%d partitionsline %d: bad # of partitionsduidline %d: bad %s: %ssectors/cylindertracks/cylindercylindersrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seektotal sectorsboundstartboundendline %d: bad partition name: %sline %d: too few fieldsline %d: bad partition size: %sline %d: bad partition offset: %sline %d: warning, unknown filesystem type: %sline %d: unknown field: %sVISUALEDITOR/usr/bin/vi%s %s/bin/sh%s: No disk label on disk%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of disk %c: %16llu %16llu %c: %15.*f%c %16llu %7.7s%7d %5u %5u %4hu %19.19s# %s# %s: type: %s type: %d disk: %.*s label: %.*s duid: %02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx flags: badsect vendorbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %llu # total bytes: %.*f%cboundstart: %llu boundend: %llu drivedata: %d %hu partitions: # %16.16s %16.16s fstype [fsize bsize cpg] offset%.*s|Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:nc#%u:sc#%u:su#%llu:d%d#%u\ :p%c#%llu:o%c#%llu:t%c=%s:t%c=unknown%d:b%c#%u:f%c#%u:ioctl DIOCRLDINFOioctl DIOCGPDINFOioctl DIOCGDINFO/dev/%s%c%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx.aioctl DIOCWDINFO # Notes: # Up to 16 partitions are valid, named from 'a' to 'p'. Partition 'a' is # your root filesystem, 'b' is your swap, and 'c' should cover your whole # disk. Any other partition is free for any use. 'size' and 'offset' are # in 512-byte blocks. fstype should be '4.2BSD', 'swap', or 'none' or some # other values. fsize/bsize/cpg should typically be '2048 16384 16' for a # 4.2BSD filesystem (or '512 4096 16' except on alpha, sun4, ...) No changes.re-edit the label? [y]: unknown disk type: %sbckmgtBCKMGTValid units are bckmgt ABEf:F:hRb:cdenp:tvwSMDMSCPold DECSCSIST506HP-IBHP-FLtype 9floppyccdvndATAPIRAIDunusedVersion6Version7SystemV4.1BSDEighth-Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSHFSADFSNTFSUDF-cTreating sectors %llu-%llu as the OpenBSD portion of the disk. You can use the 'b' command to change this. OpenBSD area: ; size: ; free: # %16.16s %16.16s fstype [fsize bsize cpg] Can't stat deviceAvailable commands: ? | h - show help n [part] - set mount point A - auto partition all space p [unit] - print partitions a [part] - add partition q - quit & save changes b - set OpenBSD boundaries R [part] - resize auto allocated partition c [part] - change partition size r - display free space D - reset label to default s [path] - save label to file d [part] - delete partition U - undo all changes e - edit drive parameters u - undo last change g [d|u] - [d]isk or [u]ser geometry w - write label to disk i - modify disklabel UID X - toggle expert mode l [unit] - print disk label header x - exit & lose changes M - disklabel(8) man page z - delete all partitions m [part] - modify partition Suffixes can be used to indicate units other than sectors: 'b' (bytes), 'k' (kilobytes), 'm' (megabytes), 'g' (gigabytes) 't' (terabytes) 'c' (cylinders), '%' (% of total disk), '&' (% of free space). Values in non-sector units are truncated to the nearest cylinder boundary.%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx.%c%s%c none swap sw %s%c %s %s rw 1 %d failed to sort partition table Error, partitions %c and %c overlap: Disable which one? (^D to abort) [%c %c] %s: [%llu] %lldRounding size to cylinder (%d sectors): %llu Size of ffs block fragments. A multiple of the disk sector-size.Command aborted Invalid entry Error: fragment size must be a multiple of the disk sector size (%d) Zero fragment size implies zero block sizeSize of the partition. You may also say +/- amount for a relative change.The size must be > 0 sectors The size can't be more than %llu sectors, or the partition would extend beyond the last sector (%llu) of the OpenBSD portion of the disk. The 'b' command can change this limit. Sorry, there are only %llu sectors left Starting sector for this partition.The offset must be >= %llu and < %llu, the limits of the OpenBSD portion of the disk. The 'b' command can change these limits. The offset must be in a free area. Starting sectorThe start of the OpenBSD portion of the disk.Size ('*' for entire disk)The size of the OpenBSD portion of the disk ('*' for the entire disk).%s: [%s] [d]isk or [u]ser geometryEnter 'd' to use the geometry based on what the disk itself thinks it is, or 'u' to use the geometry that was found in the label.BIOS geometry not defined. Note: user geometry is the same as disk geometry. You must enter either 'd' or 'u'. Where to mount this filesystem (ie: / /var /usr)'%c' already being mounted at '%s' Mount points must start with '/' FS typeFilesystem type (usually 4.2BSD or swap)FS type (decimal)Filesystem type as a decimal number; usually 7 (4.2BSD) or 1 (swap).Unrecognized filesystem type '%s', treating as 'unknown' Size of ffs blocks. 1, 2, 4 or 8 times ffs fragment size.Error: block size must be at least as big as page size (%d). Error: block size must be 1, 2, 4 or 8 times fragment size (%llu). Align partition to block sizeRound the partition offset and size to multiples of bsize?Rounding offset to bsize (%llu sectors): %llu Rounding size to bsize (%llu sectors): %llu The disklabel UID is currently: %02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx The disklabel UID, given as a 16 character hexadecimal string.Invalid UID entered. Possible values are:"IDE", "%s"Disk typeWhat kind of disk is this? Usually SCSI, IDE, ESDI, ST506, or floppy."%s" is not a valid disk type. Valid types are: Changing device parameters for %s: What kind of disk is this? Usually SCSI, ESDI, ST506, or floppy (use ESDI for IDE).label name15 char string that describes this label, usually the disk name.The Number of sectors per track.The number of tracks per cylinder.The number of sectors per cylinder (Usually sectors/track * tracks/cylinder).number of cylindersThe total number of cylinders on the disk.The total number of sectors on the disk.You may want to increase the size of the 'c' partition.Not enough free space to shrink by %llu sectors (only %llu sectors left) partition to change sizeThe letter of the partition to change size, a - p.Partition must be between 'a' and '%c' (excluding 'c'). Partition '%c' is not in use. Partition %c is currently %llu sectors in size, and can have a maximum size of %llu sectors. partition to deleteThe letter of the partition to delete, a - p, or '*'.partition to modifyThe letter of the partition to modify, a - p.partition to nameThe letter of the partition to name, a - p.You cannot name a filesystem of type %s. No space left, you need to shrink a partition The letter of the new partition, a - p.Partition '%c' exists. Delete it first. partition to resizeNo such partition Cannot resize spoofed partition [+|-]new size (with unit)new size or amount to grow (+) or shrink (-) partition including unitAmount too big Partition %c shrunk to make room No room left for all partitions can't get mem sizeYou need to specify a type for this disk.can't run when there is partition overlap.No 'c' partition found, adding one that spans the disk.Label editor (enter '?' for help at any prompt) unable to get default partition tableThis option is not valid when run without the -f flag. PAGER/usr/bin/lessgunzip -qc|%sunable to execute %sIn no change mode, not writing label.No label changes.Write new label?Write the modified label to disk?unable to write labelResize only implemented for auto allocated labels Free sectors: %16llu - %16llu (%16llu) Total free sectors: %llu. FilenameName of the file to save label into.Original label and mount points restored.Last change undone.EnteringExiting%s expert mode Unknown option: %c ('?' for help) /tmp/var/usr/usr/X11R6/usr/local/usr/src/usr/obj/homelfsadosntfsudfsdFLOPPYxdhdVNDsvndabcdfiklnoprstuvwxBDEGHLPTUXYZ0Cannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specForward positioning operation on archive failedCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Reverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %d pad blocksUnable to backspace tape %d blocks.Failed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDUnable to truncate archive file%s%s: Waiting for tape drive close to complete...done. %s: unknown format, %llu bytes skipped. %s: %s vol %d, %lu files, %llu bytes read, %llu bytes written. could not pipecould not fork-dccould not exec %sFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed chdir to %sFailed stat on %sCannot write an archive on top of a directory %sUnable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Ready for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again ..Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sUnable to open %s to readCannot identify format. Searching...Sorry, unable to determine archive format.Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot mix current archive format %s with %s%s: Reading archive to position at the end...Cannot chdir to %sCan't fchdir to starting directoryUser specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUnable to append when there are archive read errors.Archive read error limit (%d) reachedCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Write block size %d too large, maximium is: %dWrite block size %d is not a %d byte multipleWrite block size of %d too large, maximium is: %dWrite block size of %d is not a %d byte multipleWrite block size of %d larger than POSIX max %d, archive may not be portableUnable to allocate memory for group name cache tableUnable to allocate memory for user name cache tableUnable to allocate memory for group id cache tableUnable to allocate memory for user id cache tableFile changed size %sFile %s was modified during readFile rewind failed on: %sFailed seek on file %sFailed write to file %sFile seek on %sWARNING! Major Internal Error! GNU hack Failing!Out of memoryCould not set permissions on %sUnable to set file uid/gid of %sAccess/modification time set failed on: %sUnable to close file descriptor on %sUnable to copy %s, file would overwrite itselfUnable to remove directory %sCould not unlink %scannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCould not create: %scpioCould not access %s (stat)Unable to link file %s to itselfUnable to remove %sCould not link to %s from %sUnable to link to %s from %sA hard link to the directory %s is not allowedUnable to create %sIgnoring unterminated pathname at EOFIgnoring too-long pathname: %sCan't chdir to %snext_fileFile system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %sWARNING! These file names were not selected:Invalid file name argumentUnable to allocate memory for filenameUnable to allocate memory for file name buffer%b %e %H:%M%b %e %Y%s%s %s %s%2u %-*.*s %-*.*s %4lu, %4lu %9llu == -> %s: unknown option %c %s: %c argument missing Invalid option nameUnable to allocate space for option listInvalid options formatusage: tar {crtux}[014578befHhjLmNOoPpqsvwXZz] [blocking-factor | archive | replstr] [-C directory] [-I file] [file ...] tar {-crtux} [-014578eHhjLmNOoPpqvwXZz] [-b blocking-factor] [-C directory] [-f archive] [-I file] [-s replstr] [file ...] usage: pax [-0cdjnOvz] [-E limit] [-f archive] [-G group] [-s replstr] [-T range] [-U user] [pattern ...] pax -r [-0cDdijknOuvYZz] [-E limit] [-f archive] [-G group] [-o options] [-p string] [-s replstr] [-T range] [-U user] [pattern ...] pax -w [-0adHijLOPtuvXz] [-B bytes] [-b blocksize] [-f archive] [-G group] [-o options] [-s replstr] [-T range] [-U user] [-x format] [file ...] pax -rw [-0DdHikLlnOPtuvXYZ] [-G group] [-p string] [-s replstr] [-T range] [-U user] [file ...] directory Invalid block size %sbzip2compress/dev/rst0/dev/rst1/dev/rst4/dev/rst5/dev/rst7/dev/rst8b:cef:hjmopqruts:vwxzBC:HI:LNOPXZ014578-IUnable to open file '%s' for readProblem with file '%s'-Cwrite_opt=nodirTAPEInvalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multipleError count value must be positiveab:cdf:ijklno:p:rs:tuvwx:zB:DE:G:HLOPT:U:XYZ0%s: Invalid combination of options: -%cDestination directory was not suppliedThese format options are not supported %s = %s ustarFile name %s/%s, too longWARNING! These patterns were not matched:Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Removing leading / from absolute path names in the archive ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Pattern select out of memoryPattern list inconsistentEmpty pattern stringUnable to allocate memory for pattern stringEmpty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %s CPU time limit reached, cleaning up. Signal caught, cleaning up. Can't open current working directory.TMPDIR/tmp/Cannot allocate memory for temp file name.Unable to set up signal handlercan not gzip while appendingEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [[[[[cc]yy]mm]dd]HH]MM[.SS][/[c][m]]Unable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory for directory timesCannot canonicalize %sUnable to store mode and times for created directory: %sDirectory access time reset table ran out of memoryDevice map table out of memoryUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableCannot allocate memory for device mapping tableCannot allocate memory for interactive rename tableCannot allocate memory for hard link tableNo interactive rename table, links may failCannot update rename tableInteractive rename table out of memoryHard link table out of memoryFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sUstar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sFile is too long for ustar %snobodyUstar header field is too small for uid %lu, using nobodyUstar header field is too small for gid %lu, using nobodyUstar header field is too small for %sTar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sInvalid extended header lengthInvalid extended header recordInvalid extended header record lengthExtended header record length %lld is out of rangeMalformed extended header recordlinkpathwrite_optnodirUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.%s: /dev/ttyFatal error, cannot open %susage: ping [-DdEefLnqRv] [-c count] [-I ifaddr] [-i wait] [-l preload] [-p pattern] [-s packetsize] [-t ttl] [-V rtable] [-w maxwait] host patterns must be specified as hex digits%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0x%02xVr HL TOS Len ID Flg off TTL Pro cks Src Dst Data %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %s TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Echo ReplyDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set (MTU %d) frag needed and DF setSource Route FailedNetwork UnknownHost UnknownSource IsolatedDest. Net Administratively ProhibitedDest. Host Administratively ProhibitedDestination Net Unreachable for TOSDestination Host Unreachable for TOSRoute administratively prohibitedHost Precedence ViolationPrecedence CutoffDest Unreachable, Unknown Code: %d Source QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect, Unknown Code: %d(New addr: %s) Echo RequestRouter Discovery Advertisement(%d entries, lifetime %d seconds) Router Discovery SolicitationTime to live exceededFrag reassembly time exceededTime exceeded, Unknown Code: %d Parameter problem, required option absent: pointer = 0x%02x Parameter problem: pointer = 0x%02x TimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask Reply (Mask 0x%08x) Unknown ICMP type: %d --- %s ping statistics --- %ld packets transmitted, %ld packets received, %ld duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/std-dev = %d.%03d/%d.%03d/%d.%03d/%d.%03d ms packet too short (%d bytes) from %s%d bytes from %s: icmp_seq=%u ttl=%d time=%d.%03d ms (DUP!) (TRUNC!) wrong data byte #%d should be 0x%x but was 0x%x%x %d bytes from %s: LSRR: 0.0.0.0 %s (truncated route) (same route) RR: NOP unknown option %xping: sendtoping: wrote %s %d chars, ret=%d setresuidnumber of packets to transmit is %s: %sbad interface address: %sbad timing interval: %s%s: only root may use interval < 1spreload value is %s: %spacket size is %s: %sttl value is %s: %srtable value is %s: %ssetsockopt SO_RTABLEmaxwait value is %s: %sDEI:LRS:c:defi:l:np:qs:T:t:V:vw:unknown host: %s-f and -i options are incompatibleNo audible output for flood pingsbind-R option and -D or -T, or -t to unicast destinations are incompatiblerecord route not valid to multicast destinationsping: record routesetsockopt IP_MULTICAST_LOOPsetsockopt IP_MULTICAST_TTLsetsockopt IP_MULTICAST_IFgetsockoptsetsockoptCannot set the receive buffer sizeCould only allocate a receive buffer of %d bytes (default %d)PING %s (%s): %d data bytes PING %s: %d data bytes ping: recvfrom9\/999: ::$:,:04:<:D:L:P:99X:`:NO SPACE LEFT IN %s (EXPANDED)EXPANDUNREFDIRLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTUNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORYlost+found IS NOT A DIRECTORYREALLOCATESORRY. CANNOT CREATE lost+found DIRECTORY SORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu NAME=%s %s=%s DIRECTORY CORRUPTEDwrong type to dirscan %d lost+found%d %s I=%lluBAD STATE %d TO BLKERR cannot find inode %llu bad inode number %llu to nextinode Cannot allocate space for inode buffer bad inode number %llu to ginode blk %d < cgdmin %d; blk + cnt %d > cgsbase %d blk %d >= cgdmin %d; blk + cnt %d > cgdmax %d LARGE FILES UNSUPPORTED ON REVISION 0 FILESYSTEMSSETTING LARGE FILE INDICATOR SET LARGE FILE INDICATORTRYING TO SET FILESIZE TO %llu ON MODE %x FILE I=%llu OWNER=%u MODE=%o SIZE=%llu MTIME=%12.12s %4.4s cannot increase directory list PARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDSCLEAR (CLEARED)-%c flag requires a %s usage: %s [-dfnpy] [-b block#] [-m mode] filesystem ... Alternate super block location: %d bad mode to -m: %o ** lost+found creation mode %o b:dfm:npystarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system** Phase 1 - Check Blocks and SizesINTERNAL ERROR: dups with -p** Phase 1b - Rescan For More DUPS** Phase 2 - Check Pathnames** Phase 3 - Check Connectivity** Phase 4 - Check Reference Counts** Phase 5 - Check Cyl groups%d files, %d used, %d free %d files missing %d blocks missing The following duplicate blocks remain: %d,The following zero link count inodes remain: %llu, ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW *****EXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEEXCESSIVE DUP BLKS I=%lluuDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%lluINODE I=%llu HAS DTIME=%12.12s %4.4s (CORRECTED)bad size %llu:HOLD BAD BLOCKbad size %llu ndb %d:bad direct addr: %d bad indirect addr: %d LINK COUNT TABLE OVERFLOWINCORRECT BLOCK COUNT I=%llu (%d should be %d)UNKNOWN FILE TYPE I=%lluROOT INODE UNALLOCATEDALLOCATECANNOT ALLOCATE ROOT INODE DUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYFIXBAD STATE %d FOR ROOT INODE DIRECTORY TOO SHORTDIRECTORY %s: LENGTH %lu NOT MULTIPLE OF %dMISSING '..'BAD INODE NUMBER FOR '..'BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' BAD TYPE VALUE FOR '..'CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '..' EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEUNALLOCATEDDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORY (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%llu ZERO LENGTHBAD/DUP%u: %2x summary info for cg %d is %d, %d, %d,should be %d, %d, %d SUMMARY INFORMATIONS WRONG FOR CG #%dblk_bitmap:bbmap:BLK(S) MISSING IN BIT MAPS #%dino_bitmap:ibmap:INODE(S) MISSING IN BIT MAPS #%dsummary info bad in superblock: %d, %d should be %d, %d SUPERBLK SUMMARY INFORMATION BADstrdup failedrealloc failedmalloc failed/r%s (%s): UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat rootCan't stat %s %s is not a character device ioctl (GCINFO): %s %s: can't read disk label %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A EXT2 FILE SYSTEM (%s) BAD SUPER BLOCK: %s MAGIC NUMBER WRONGBAD LOG_BSIZEBAD BLOCKS PER GROUPcompat 0x%08x, incompat 0x%08x, compat_ro 0x%08x INCOMPATIBLE FEATURE BITS IN SUPER BLOCKsuperblock mismatchesoffset %ld, original %ld, alternate %ld VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATECan't stat %s: %s %s is not a character deviceCan't open %s: %s ** %sNO WRITE ACCESS (NO WRITE)cannot allocate space for superblock LOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO FSCK_FFS TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ext2fs(8).USING ALTERNATE SUPERBLOCK AT %d state = %d ** F%sile system is clean; not checking ** File system is already clean IMPOSSIBLE RESERVED BLOCK COUNT=%d IN SUPERBLOCKSET TO DEFAULTWRONG FPG=%d (BPG=%d) IN SUPERBLOCKBAD SUMMARY INFORMATIONcannot alloc %u bytes for blockmap cannot alloc %u bytes for statemap cannot alloc %u bytes for typemap cannot alloc %u bytes for lncntp cannot alloc %u bytes for inphead returning to single-user after filesystem check bad file type 0%o cannot allocate buffer pool INTERNAL ERROR: GOT TO reply()%s? no %s? yes %s? [Fyn?] (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %d CANNOT %s: BLK %dProgram terminated WRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN: %lld (%lld), %lld,PARTIALLY WRITING %sZERO'ED BLOCK %d TO DISK UPDATE STANDARD SUPERBLOCKSPanic: lost %d buffers MARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEANcache missed %ld of %ld (%d%%) READTHE FOLLOWING DISK SECTORS COULD NOT BE READ:deadlocked buffer pool %6d usage: %s [-benstuv] [file ...] benstuv|dg|d,|d0|d8|d@|dH|sP|sX|s`]h olrtr|rrcc̼<ؼdd|j|jP0j]`^({ |z (o4o@yLtyXpxd^l^x^^ذЄ XbXb`Ƚ`Խ`/`ܽ```aa````ػTe$|d,|d4 |d<|dD@|dL|dT\|ht8n8n`]]4~li i@ؼltxki i  `ľ̾ؾ####$$$ $%% %(%,&4&@'H'T(\(h)p)|**++,,,-Ŀ-п-Կ.ܿ.//0000$1,182@2L2T3`3l3t4445566677ccddee (,4<DLT\dlt|    (08DP  X ``h`tx G0:g(4@HT(4@HT\hpxrandommalformed link-level addressSIOCSIFLLADDRSIOCIFAFDETACHSIOCIFAFATTACHSIOCGIFXFLAGSSIOCSIFXFLAGS[#%d]SIOCG80211WPAPARMSSIOCS80211WPAPARMSSIOCGIFFLAGSSIOCSIFFLAGSSIOCIFDESTROYmedia mode %smediaopt instance %d"%.*s"0xSIOCGIFGROUPgetifgroups groups:usage: ifconfig [-AaC] [interface] [address_family] [address [dest_address]] [parameters] invalid channel %s: %sSIOCS80211CHANNELprefix %s: %sSIOCGIFMEDIA%s: no link type?only one `instance' command may be issuedmust specify `media' before `instance'media instance %s: %smtu %s: %sSIOCSIFMTUinet6autoconf not allowed for this AFbad hexadecimal digitshexadecimal digits too longstrings too longSIOCS80211NWIDmalformed BSSID: %sSIOCS80211BSSID%s: bad value%s=%o%s=%xInvalid trunk protocol: %sSIOCSTRUNKSIOCSTRUNKDELPORTSIOCSTRUNKPORTSIOCGETVLANSIOCSETVLANvlan tag %s: %s vlan: %d parent interface: %s SIOCG80211ALLCHANS %4s %-8s %s chanfreqproperties %4d %4d MHz passive scan%d: bad prefixlen trunk: trunkproto %s trunkdev %sstrdup trunk id: [(%04X,%s,%04X,%04X,%04X), (%04X,%s,%04X,%04X,%04X)] trunkport %s MASTERSTACKACTIVECOLLECTINGDISTRIBUTINGDISABLED supported trunk protocols: trunkproto %s trunk: trunkdev %s invalid vlan tag and device specificationinvalid %s %s: %s%s not allowed for the AFvltimepltimeunknown %s media mode: %sonly one `mode' command may be issuedinvalid media mode: %sunknown %s media subtype: %sonly one `media' command may be issuedmay not issue `media' after `mode' commandsmay not issue `media' after `mediaopt' commandswpagroupcipher: unknown cipher: %sunknown %s media option: %sonly one `-mediaopt' command may be issuedmay not issue both `media' and `-mediaopt'only one `mediaopt' command may be issuedmay not issue `mediaopt' after `instance'wpaciphers: unknown cipher: %spsk802.1xwpaakms: unknown akm: %swpa1wpa2wpaprotos: unknown protocol: %snwid chan %u bssid %s lladdr %s %u%% %ddBm powersave %uMESSIBSSCF_POLLABLECF_POLLREQPRIVACYSHORT_PREAMBLEPBCCCHNL_AGILITY SPECTRUM_MGMT QOS SHORT_SLOTTIME APSDDSSSOFDMDELAYED_B_ACKIMMEDIATE_B_ACK,wpa2,wpa1,wep,802.1xCACHEBSSAUTHASSOCCOLLECT no permission to scanSIOCG80211ALLNODES none restore ieee80211: nwid chan %u bssid %s %u%% %ddBm nwkey persist%d: wpakey wpaprotos %swpa2 wpaakms %s802.1x wpaciphers wpagroupcipher powersave on (%dms sleep) (auto) %ddBm%sHIDENWIDNOBRIDGEUPBROADCASTDEBUGLOOPBACKPOINTOPOINTNOTRAILERSRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTTXREADYNOINET6INET6_NOPRIVACYMPLSWOLAUTOCONF6 rdomain %d metric %lu mtu %lu lladdr %s status: %s %s: no media types? media: supported media: tunnel: inet%s %s -> %s:%u vnetid %d ttl %dunsetifgroup: group names may not end in a digitunsetifgroup: group name too longSIOCDIFGROUPsetifgroup: group names may not end in a digitsetifgroup: group name too long SIOCAIFGROUPSIOCG80211NWIDwpakey: invalid pre-shared keywpakey: passphrase must be between 8 and 63 characterswpakey: nwid not setwpakey: passphrase hashing failedSIOCS80211WPAPSKpersist:SIOCS80211NWKEY: too many keys.0x%sInvalid WEP key lengthSIOCS80211NWKEYinterface index is already filledgetifaddrscould not determine link local address inet6 %sSIOCGIFDSTADDR_IN6 -> %sSIOCGIFNETMASK_IN6 prefixlen %dSIOCGIFAFLAG_IN6 anycast tentative duplicated detached deprecated autoconf autoconfprivacy scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime inet %sSIOCGIFNETMASKSIOCGIFDSTADDR --> %s netmask 0x%xSIOCGIFBRDADDR broadcast %sSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesSIOCIFCREATEinvalid carp demotion: %scarpdemoteSIOCSIFGATTRSIOCGIFGATTR carp demote count %d%s: no such interface SIOCGIFGMEMBprintgroupinterface name '%s' too longdestroy'%s' requires argument'%s' requires 2 argumentsSIOCDIFADDRSIOCAIFADDRarp-arpdebug-debugalias-aliasdeletenetmaskmtunwid-nwidbssid-bssidnwkey-nwkeywpa-wpawpaakmswpacipherswpagroupcipherwpaprotoswpakey-wpakey-chanbroadcastvlanvlandev-vlandevgroup-groupautoconf-autoconftrunkport-trunkporttrunkprotoanycast-anycasttentative-tentativeeui64autoconfprivacy-autoconfprivacypowersavepriorityrtlabeltxpowernwflagrdomain-inet-inet6descriptiondescrwol-wollink0-link0link1-link1link2-link2mediamediaopt-mediaoptinstanceinstlladdrinetEthernetetherFDDIIEEE802.11TDMCARPautoselectmanual10baseT10baseT/UTP10UTP10base210base2/BNC10BNC10base510base5/AUI10AUI100baseTX100TX100baseFX100FX100baseT4100T4100baseVG100VG100baseT2100T21000baseSX1000SX10baseSTPSTP10STP10baseFLFL10FL1000baseLX1000LX1000baseCX1000CX1000baseT1000T1000baseTX1000TXHomePNA1HPNA110GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10GbaseCX410GCX410GBASE-CX42500baseSX2500SX10GbaseT10GT10GBASE-T10GSFP+Cu10GCuSingle-modeSMFMulti-modeMMFCDDIFH1FH2DS2DS5DS11DS1DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72t1t1-amie1e1-g.704e1-amie1-ami-g.704t3t3-m13e3e3-g.751e3-g.832e1-g.704-crc411a11b11gfhmasterfull-duplexfdxhalf-duplexhdxflag0flag1flag2loopbackhw-loopbacklooprxpausetxpausedual-attachdasadhochostapibssibss-mastermonitorturbohdlc-crc16pppframerelay-ansiframerelay-ciscoframerelay-ituno carrierno networkbackupactivekeepalive downroundrobinfailoverlacploadbalancedefaultusegroupwep40tkipccmpwep104 %s: %s: %s: directory causes a cyclefts_readCOLUMNS1ACFHLRSTacdfghiklmnopqrstux%*llu %*qd total %llu %b %e %H:%M:%S %Y%s %*u %-*s %-*s %3d, %3d %*s%*qd %*s ls: %s: %s usage: %s [-1AaCcdFfgHhikLlmnopqRrSsTtux] [file ...] usage: sysctl [-n] name %s=kern.osreleasehw.machinehw.modelhw.producthw.disknameshw.ncpufound usage: ping6 [-dEefHmNnqtvWw] [-a addrtype] [-b bufsiz] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-V rtable] [hops ...] host ff02::2:0000:0000-%uVr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->IP6HBH DSTOPT FRAG RTHDR AH ICMP6: type = %d, code = %d ESPUnknown Header(%d) ...refusedunknown qtype truncated no address %s(TTL=infty)(TTL=%u)\%03oNo Route to DestinationDestination Administratively UnreachableDestination Unreachable Beyond ScopeDestination Unreachable, Bad Code: %d Packet too big mtu = %d Time exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option Bad code(%d) pointer = 0x%02x Listener QueryListener ReportListener DoneRouter SolicitationRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sNode Information QueryNOOPSupported qtypesDNS namenodeaddrIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subject, subject=%sDNS label(invalid), invalidNode Information Reply, %sBad ICMP type: %d --- %s ping6 statistics --- +%ld duplicates, %.1lf%% packet lossround-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms path MTU for %s is notified. (ignored) NodeInfo Supported Qtypes, compressed bitmap, raw bitmap???nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu HbH Options: Dst Options: Routing: invalid peernamefailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!)extra (%d bytes %s)refused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%lusendmsgping6: wrote %s %d chars, ret=%d invalid socket buffer sizeMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %stoo small interval, raised to 0.01Must be superuser to preloadillegal preload value -- %sinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %da:b:c:dEefHg:h:I:i:l:mnNp:qS:s:tvV:wWtoo many intermediate hopsgetaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface namecan't initialize rthdrbad addr family of an intermediate addrcan't add an intermediate nodeUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP setsockopt(IPV6_RTHDR)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> recvmsgnew path MTU (%d) is notified IPv6 addressIPv4 addressSuccessRefusedusage: %s [-aju] [-d dst] [-r seconds] [-t minutes_west] [-z output_zone] %-*s[+format] [[[[[[cc]yy]mm]dd]HH]MM[.SS]] illegal time formatUTCcannot unsetenv TZad:jr:ut:z:settimeofday%a %b %e %H:%M:%S %Z %Yspecified date is outside allowed rangeCould not get local time of dayadjtimedate set by %stoo many argumentsconversion error?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for data?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?m(%T %i of %m) .?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%tCannot allocate memoryLESSSECURE-G-L-XLESS--WARNING: terminal is not fully functionalLESS_TERMCAP_DEBUG<%s>LESS_TERMCAP_krklkukdkPkNkh@7kDLINESlicoTERMhcxndadbsgpcticdcmsomdmbvbbc|^srNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketseek error to 0ch_ungetchar overrunseek errorESC^%c*s<%X>less %s(P)+Non-match First-file EOF-ignore Keep-pos Regex-off &/Pattern not found& There is no %s optionCommand not available(N-th) No %snext fileNo %sprevious fileNo such filemark: goto mark: Brackets: Warning: some edit commands disabledWarning: some commands disabled@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETAESCAPELESSMETACHARS; *? '"()<>[]|&^`#\$%=~%c%s%c%s %s %sLESSCLOSEInvalid LESSCLOSE variableLESSOPENInvalid LESSOPEN variable...skipping... Cannot seek to that file positionDetermining length of fileDon't know length of fileCannot seek to end of fileCannot seek to beginning of fileCannot seek to line number %nLESSANSIENDCHARSLESSANSIMIDCHARS0123456789;[?!"'#%()*+ Line numbers turned offCalculating line numbersInvalid mark letterMark not setUse "h" for help-" must be followed by 1 or 2 charsquotes %sTab stops and then every %d spacesless POSIX regular expressions) Copyright (C) 1984-2012 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less #Invalid column fractionInvalid column numberHorizontal shift %d columns.%06dHorizontal shift %s of screen widthjInvalid line fractionInvalid line numberPosition target at screen line %dPosition target at screen position %sNumber is required after %sValue is required after %s--%s-%c (--%s)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric option-%sThere is no %s option ("less --help" for help)LESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numbersprompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linesDisplay underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersfakeInvalid patternNo previous regular expressionPlease re-enter search patternNothing to searchht4PT\h (@px| @usage: %s [-23bcdilsTU] [-a maxreadahead] [-g maxgroups] [-I readdirsize] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-w writesize] [-x retrans] rhost:path node hostname too longno : or @ speccan't resolve address for host %sNFS PortmapCannot MNT RPCbad MNT RPCcan't access %s-2 and -3 are mutually exclusiveillegal -a value %s: %sillegal -g value %s: %sillegal -I value %s: %sconflicting version optionsillegal -R value %s: %sillegal -r value %s: %sillegal -t value %s: %sillegal -w value %s: %sillegal -x value %s: %s23a:bcdD:g:I:iL:lo:PR:r:sTt:w:x:Ubgconndumbtimernfsv3mntudpresvportnfsv2acunused DOS FAT-12 XENIX / XENIX /usr DOS FAT-16 Extended DOSDOS > 32MB NTFS AIX fs AIX/Coherent OS/2 Bootmgr Win95 FAT-32 Win95 FAT32LDOS FAT-16 Extended LBAOPUS OS/2 hidden Compaq Diag.OS/2 hidden OS/2 hidden OS/2 hidden AST swap Willowtech ThinkPad Rec Willowsoft $NEC DOS 'Win Recovery8Theos 9Plan 9 @VENIX 286 ALin/Minux DRBLinuxSwap DRCLinux DR MQNX 4.2 Pri NQNX 4.2 Sec OQNX 4.2 Ter PDM QDM RCP/M or SysVSDM TOntrack UEZ-Drive VGolden Bow \Priam aSpeedStor cISC, HURD, *dNetWare 2.xxeNetWare 3.xxfNetWare 386 gNovell hNovell iNovell pDiskSecure uPCIX Minix (old) Minix (new) Linux swap Linux files*OS/2 hidden Linux ext. NT FAT VS NTFS VS Linux LVM Amoeba FS Amoeba BBT Mylex BSDI NotebookSaveFreeBSD OpenBSD NEXTSTEP MacOS X NetBSD MacOS X bootMacOS X HFS+BSDI filesy*BSDI swap Solaris CTOS DRDOSs FAT12DRDOSs < 32MDRDOSs >=32MHPFS DisbledCPM/C.DOS/C*Dell Maint SpeedStor SpeedStor SpeedStor BeOS/i386 EFI GPT EFI Sys SpeedStor DOS 3.3+ SecSpeedStor Xenix BBT [[s7~EWI)ڼH(=,ٱvmc)MR 5F(w/Л9=ۭJWZU=#8(B\_~7P0A_}kQ\(u@u.2tno77G^k|x^؊0`*SOE4TS" #1d)g_c@cÏ1?α^bO +;5XĒ  /ΕKqI|f;q Pt`o/'cPˤʂe /2m*d_s,Ms5\,ad,UarI3Gh`K4yd!Q'inY G8wRf@tq1pD%X`v-@ afѣy*gP`Y$F>$&8 i^vvHgwVƩ MbHaWUVzf[GaNL^DIEN*gN \msa p#qef ^9hupz%amA< ,A7aEs& Ev+4x,]\ XeLXA,`Rs6]}R.)$"+ 0xFJId?Cή}*Rqe閎*1]Kuk<2g~ԡ|xKpt$4'& Q!Qe['_ģ:ڽnj5B#{McLC܆5S E k%c ~ C SzbbrJ"x4/b"\lu!>ԏnڛCڰ}KJ[&k. &3O^s7tٚ[DTqfm7ym%DDi_mC=WEw`$xE\E}qLfEMHK]d(0Vl /-WoΌ@AJ`U\q{ڔrp@hi.-RmaM9 T2ka#220owT ^7Պ!diht8bF lmc<䚊˩s1J ^Mk迆v+/?pynjtz6.%LV$%URY[Vd|[B$A;퐶\I'~xW&р$bÁZ5(_Җn:yu{$K4`E QhP 5Yh܉G UL@ؕGEXWF+2kMs z\ J:V ׄJA>oU<1ؿ=yH E5- ,mB c8z\:ic/M ^#)1ϲx$TIeBuS9_ho.&<~I4;zj-6hRtw낑aƻWR) @gס:U#c#- Э5ևѹ?}Bb5黆R* ^&Xe |zI+CgE0ؚ Ud.T7A=8Q`&~WT`V4KCJm P4XQlw>>Yp|ؖ5؊siDJ@o%d݆0 I2+gѪ-؍wk GO"uAoet άQl`_L%B,C$|u "~m, ܒ !C6mCCLk\rJvl!RY޴c ukkPSykx ?tw_N&~(>^Kqy!.މw‹q,TPODCzhv0l?—rDPJvwO5;\qF<8xT7lmΥqj) A#$td+ ?K}.[y+_Hw#q|Mc?WJ ǃdpv2}5JF݋㡇6F_Auk@+g/nCvw,}9ݹM0r0:>韝M2u+~~uTa\o}7RIJYu.淺S?RrB'C&AZhzheje͡;|Q"c8s_*uSz^k/ C ,[ ɶv*\6԰9 VEfB:6{+\FB ]\pM᳁v"Q6Zsw]-a߱>2p0KwTqV-V)$ z;* 3* vwXQ1\cQArF0Lmflâ=28iB%iS3;d,*[b)/{o{G$9SGX[?~pxx׺.: \ L90Ͳv|Xh.zdjJf6oˊ[3*ڬ]HX*I҄c|K˰4QUERǕ(jFIL,3oE1]̋$im4qZ[lu)3 =쮗! &M>םf <^]w}qub3:I{Y0Fg;,P*.NP;D-+[$?BxeWL v`xx6 i?cu,V-65Pl]m2gmq^s2SXS%{z+Mפ\  =cUL\u םfJO+eT t.OrFIQVN'Gї OrO)Xi:QžmĄ^6Ӭ&P-m /jx$E{LBP K81Kmܢ3 6F5*uZmIdZ:/|k8 ^y¤jq/?2I`kQ`X%p HBb[vK7Q[`W2DY,2X*'O5h,pIi,ZP=X;M+b iEk?U:rO<&k-+%T"BDWWZ-9Ȁ04|"Jj+zݯAiNer^"QNSm%rEQZּ8jh^,ȱ斖4j ŐDže*q< "(P.$=I=U̇mCe_MH.YŔI;gȕkuŁ[U\_s3ΞPW>Dq.Wz%-"wȜpضpϔkitje^)RBI*-'}j&^>ΈRCWֺST@]&,>e(N#PN8Fw-$ jNۗ:p ɣ05E`йush͓6L`Y5Ca}` ,􁏕6-pSeWͫy뽴=@jYk@N[=_Ɖ7HG*ۡW[nǸ-I[(8s&b|ɖnQO=zO2#JtU:VcRն bR] {1jh"3+U•Ѽe>R{9QfXF'w}&tZ*Q1:.:e@*- MluWci vXz -[$S+V'#ۧS ͙Z+鮲)DuVLzHg#'#sO&ev~`>Ն''*g-w‰y;TK6})$(>e5R7͵~'ٿ/Yv_g~mɮ )GG]T ״-,{:_!!O/e|}jΙ80ŝ+7 nyyhq7f2Z,!:Xffhސu]s-DsSpRIdɷAxYTg:w 2>Lr lOSd2c|K'?M Invalid command '%s'. Try 'help'. Aborting changes to current MBR.Do you wish to write new MBR?Do you wish to write new MBR and partition table?Command help listShow entire OpenBSD man page for fdiskreinitRe-initialize loaded MBR (to defaults)setpidSet the identifier of a given table entryEdit current drive statseditEdit given table entryflagFlag given table entry as bootableUpdate machine code in loaded MBRSelect extended partition table entry MBRSwap two partition entriesPrint loaded MBR partition tablewriteWrite loaded MBR to diskexitExit edit of current MBR, without saving changesQuit edit of current MBR, saving current changesabortAbort program without saving current changes%s: [%u] %s is out of range: %c%s%c %s is invalid: %c%s%c %s [n] Partition id ('0' to disable) [%X - %X]: [%X] (? for help) '%s' is not a valid number. '%x' is out of range. %s [%d - %d]: [%d] %s is %s: %s. BytesSectorsKilobytesMegabytesGigabytesDisk: %s geometry: %d/%d/%d [%.0f %d-byte %s] geometry: %s is not a character device or a regular fileDIOCGPDINFOdisk too large (%llu sectors). size truncated.Signature: 0x%X Start of partition #%d after end! Starting Ending LBA Info: #: id C H S - C H S [ start: size ]-------------------------------------------------------------------------------%c%1d: %.2X %6u %3u %3u - %6u %3u %3u [%12u:%12.0f%s] %s Warning CHS values out of bounds only saving LBA valuesChoose from the following Partition id values:%02X %s %02X %s %02X %s %02X %s partition number is %s: %s. flag value is %s: %s. Partition %d marked active. Partition %d flag value set to 0x%x. %s %s Machine code updated.partition number is invalid:partition number is %s: %s %d same partition as %d, doing nothing. MBR contains more than one OpenBSD partition!Write MBR anyway?Writing MBR at offset %d. error writing MBROffset: %d Partition %d is not an extended partition. Loop to offset 0! Not selected.Selected extended partition %d New MBR at offset %d. Change disk geometry?BIOS CylindersBIOS HeadsBIOS SectorsPartition %d is disabled. Do you wish to edit in CHS mode?BIOS Starting cylinderBIOS Starting headBIOS Starting sectorBIOS Ending cylinderBIOS Ending headBIOS Ending sectorPartition offsetPartition sizeIn memory copy is initialized to:Use 'write' to update disk.0123456789A:B:CEFGHILRUVabce:f:hilnoqrsuvwxyABDzCDEFG HLUtVda0bc<efDhPi\Lplnqqrsvwxuinvalid file type(standard input)(fd %d)usage: %s [-abcEFGHhIiLlnoqRsUVvwx] [-A num] [-B num] [-C[num]] [-e pattern] [-f file] [--binary-files=value] [--context[=num]] [--line-buffered] [pattern] [file ...] ^\((%s[[:<:]]%s%.*s%s[[:>:]]%scontext out of rangegrep version %u.%u binarywithout-matchtextUnknown binary-files optionCan't use small fgrep with -wbinary-filesmmapline-bufferedafter-contextbefore-contextextended-regexpfixed-stringsbasic-regexpwith-filenamebyte-offsetregexpno-filenameignore-casefiles-without-matchfiles-with-matchesline-numberquietsilentrecursiveno-messagesrevert-matchword-regexpline-regexpunix-byte-offsetsreallocarrayreallocLine is too big to processBinary file %s matches usage: %s %s umount [-fv] special | nodeumount -a [-fv] [-h host] [-t type]%s: not currently mounted%s: not a directory or special device%s: unmount from %s afh:t:vht4|@usage: mount_msdos [-9lsx] [-g gid] [-m mask] [-o options] [-u uid] special node invalid file mode: %sunknown user id: %sunknown group id: %ssl9xu:g:m:o:stat %snot an MSDOS filesystemfsck_%snostart %s %swait %s%s/fsck_%sexec %sCan't get resource limit to max data sizeCan't get resource limit for data size-b %sInvalid option stringusage: %s [-dfNnpvy] [-b block#] [-l maxparallel] [-T fstype:fsoptions] [-t fstype] [special | node ...] b:dfl:nNpT:t:vy%s: unknown special file or file system.Can't open checklist file: %s/etc/fstabpass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s: Unknown pid %lddone %s: %s (%s) = %x %s: %s (%s): EXITED WITH SIGNAL %d THE FOLLOWING FILE SYSTEM%s HAD AN %s UNEXPECTED INCONSISTENCY:%s: %s (%s)%s, )c]!!\cX%`-V%`,i\1Sn6i!XfffffffffffffffffffffffffffffffmRQw }dNfev_gY&V0V$xYMuAAM pywy@so+lRJ'x/C/=M+ O$+malloc %zuuntrusted comment: invalid comment in %s; must start with '%s'comment too longmissing new line after base64 in %sinvalid base64 encoding in %sEdunsupported file %sverification failed: checked against wrong keysignature verification failedSignature Verifieddup failedcan't open %s for %snot a valid file: %smsg too large in %sread from %susage: %1$s -V [-eq] [-x sigfile] -p pubkey -m message verify with /etc/signify//../untrusted path %smust specify pubkeyCGSVc:em:np:qs:x:must specify sigfile with - message%s.sigpath too longmust specify messagewrite to %susage: %s [-m mode] fifo_name ... usage: %s [-m mode] name b|c major minor %s [-m mode] name p node must be type 'b' or 'c'.non-numeric major number.non-numeric minor number.major or minor number too largemkfifoinvalid file mode.m:G0:g0123456789abcdefUGHRBD M@dmCXLS1@2 3cPT l@bconnectedstaticospfis-isbgpbad label: %s is %sinvalid table id: %slabel too longprefixlen is not supported with af %dprefixlen %s is %s%s: link %s; %s: inet %s; %s: inet6 %s; sockaddrs: locks: inits: set_metric mtu: %s is %sset_metric expire: %s is %sking bula sez: set_metric with invalid key route to: %s routing message version %d not understoodmessage length mismatch, in packet %d, returned %dRTM_GET: %s (errno %d)destination: %s mask: %s gateway: %s interface: %.*s if address: %s mpls label: %s %s priority: %u (%s) flags: label: %s use mtu expire%8llu %8u%c %8lld%c sockaddrs: [rtm_type %d out of range]: len %d, if# %d, name: %s, link: %s, flags:, metric %d, flags:, if# %d, name %s, what: arrivaldeparture, priority %d, table %u, pid: %ld, seq %d, errno %d flags: use: %8llu mtu: %8u%c expire: %8lld%cso_dstso_gateso_maskso_ifpso_ifaso_labelso_srcwriting to routing socketread from routing socketroute-sysctl-estimateactual retrieval of interface table128internal error%s: resolved to multiple valuesmpls labels require -in or -out switch%s: not a network%s: bad address%d: bad address familybotched keyword: %susage: %s [-dnqtv] [-T tableid] command [[modifiers] args] commands: add, change, delete, exec, flush, get, monitor, show setrtablesetsockopt(ROUTE_MSGFILTER)setsockopt(ROUTE_TABLEFILTER)got message of size %d on %smust be root to alter routing table-mplslabel requires -inet or -inet6-in requires -mpls-out requires -mpls-out requires -push, -pop, -swap-pop requires -mpls-push requires -mpls-swap requires -mplspriority is %s: %snetmask missing: gateway %sentry in userouting table overflownot in tableno such interface %sactual retrieval of routing tableExamining routing table from sysctl(address family %s) write to routing socketgot only %d for rlen %-20.20s donednqtT:vrouting table %d/dev/nulladdblackholechangecloningdstexpiregatewaygethopcountifaifpinterfacejumbolinkllinfolockrestmpathmplslabelnojumbonostaticpopproto1proto2pushrecvpiperejectrttrttvarsasendpipeshowssthreshxresolveRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics or flagsRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_RESOLVE: Route created by cloningRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_IFINFO: iface status changeRTM_IFANNOUNCE: iface arrival/departureRTM_DESYNC: route socket overflowPUSHLOCALPOPSWAPlink#%dillegal prefixlen%s/%d%u/%d%u.%u/%d%u.%u.%u/%d%u.%u.%u.%u/%daf %d: %s(%d) %s%-6s %-*.*s InternetInternet6Encap Protocol Family %d: MPLS%-18s %-5s %-18s %-5s %-5s %-22s SourcePortProtoSA(Address/Proto/Type/Direction)%-9s %-9s %-6s %-18s %-6.6s %5.5s %8.8s %5.5s %4.4s %s In labelOut labelOpGatewayFlagsRefsUseMtuPrioInterface%-*.*s %-*.*s %-6.6s %5.5s %8.8s %5.5s %4.4s %sIfaceLabel%-6.6s %5u %8llu %5u %5s %2d %-5.16ssysctl of routing tableRouting tablesExtra `@' characters in usernames and passwords should be encoded as %%40 KMGTPftp://http://file::/Can't allocate memory for URL decodingerror in base64 encoding <>"#{}|\^~[]`receivedCan't allocate memory to parse URLurl_get: Invalid URL '%s'No `/' after host (use -o): %sNo filename after host (use -o): %sNo filename after directory (use -o): %sCan't allocate memory for proxy host.Can't allocate memory for proxy URL.Malformed proxy URL: %sCan't open file %sCan't open %sCan't allocate memory for transfer bufferWriting %sReading from file(unknown)Trying %s... r+Requesting %sCan't allocate memory for URL encoding%%%02x (via %s) GET %s HTTP/1.0 Proxy-Authorization: Basic %s Host: %s %s%s GET %s HTTP/1.0 Host: %s %s%s GET /%s %s Host: HTTP/1.0Can't allocate memory.[%s]:%sWriting HTTP requestReceiving HTTP replyError retrieving file: %sToo many redirections requestedContent-Length: Location: Relative redirect not supportedCannot allocate memory for URLRedirected to %s Reading from socketRead short file. Auto-login using ftp URLs isn't supported when using $ftp_proxyImproper response from %sftp_proxyhttp_proxyCan't allocate memory for auto-fetch.Invalid URL: %sCan't connect or login to host `%s'*?[]{}NLSTRetrieving %s/%s mget file fetch aborted. http fetch aborted. Forced abort. The connection will be closed. local: %srunique: can't find unique file name. receive aborted waiting for remote to finish abort. acceptsetsockopt TOS (ignored)%c%c%c421 Service not available, remote server has closed connection. Lost control connection for abort.%cABOR No control connection for command.QUITRETRSTOUSTORPASVproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s use of scoped address can be troublesomeEPSVwrong server: return code must be 229 LPSVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uBad family! %c%c%c%d%cparse error! setsockopt (reuse address)setsockopt IP_PORTRANGE (ignored)setsockopt IPV6_PORTRANGE (ignored)listenEPRT |%d|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dlocal: %s remote: %s REST %lldnetin%s: short writeWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sftpgatehttp%s: bad port number `%s'connect to address %sfdopen failed.Connected to %s. usage: %1$s [-o output] ftp://[user:password@]host[:port]/file[/] ... %1$s [-o output] http://host[:port]/file ... %1$s [-o output] file:file ... %1$s [-o output] host:/file[/] ... FTPSERVERPORTFTPMODEpassivegateunknown FTPMODE: %s. Using defaultsgate-ftpFTPSERVERNeither $FTPSERVER nor $GATE_SERVER is defined; disabling gate-ftpdumbemacssukeep alive amount is %s: %sretry amount is %s: %s46AaCc:dD:Eegik:Mmno:pP:r:S:s:tU:vVUser-Agent: OpenBSD ftpnmap: unbalanced brackets. CWD %sCWD command not recognized, trying XCWD. XCWD %scan't get cwdSkipping non-relative filename `%s' a+winternal error: unknown type %d.TYPE %s %sTYPE %susage: %s [ | Using %s mode to transfer files. %s: unknown mode. ascii%lld byte%s %s in %.2f seconds (%.2f %sB/s) ETA: %02d:%02d:%02d %-*.*s%s %-*.*s%s %3d%% %3d%% |%.*s%*s|************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************* %5lld %c%c %2d:%02d:%02d --:-- ETA - stalled -%02d:%02d ETAUnable to determine real path of `%s'%s: not foundunable to create temporary file: %sftpXXXXXXXXXXLISTcan't find list of remote files, oops. can't find list of remote files, oops.anonymous%s@Name (%s:%s): Name (%s): USER %sPassword:PASS %sAccount:ACCT %sLogin %s failed.Already connected to %s, use close first. gateserver not defined (shouldn't happen)PASSERVE %sConnected via pass-through server %s non-printstreamSYSTRemote system type is %s. 215 UNIX Type: L8SIZE %sMDTM %s191Y2K warning! Fixed incorrect time-val received from server. %*s %04d%02d%02d%02d%02d%02dCan't convert %s to a time. KKK KKKK K K KKKTKusage: %s [-a arch] [-e entry] [-l loadaddr] [-n name] [-o os] [-t type] infile outfile arch is one of:os is one of:%s: invalid elf, not 32 or 64 bita:e:l:n:o:t:unknown arch '%s' unknown OS '%s' unknown type '%s' alphaamd64i386m68kmipsmips64powerpcsparcsparc64superhLinuxstandalonescript%s unable to seek to section header%s: read section headersunexpected segment type %#xesymval and vaddr mismatch %lx %lx usage: %s [-dn%sq] dlnpqhalted (with powerdown) by %shalted by %srebooted by %s~SIGTSTP init/etc/rc/dev/consolerevokesetsidopenSIGTERM processesWARNING: some process(es) wouldn't die(can't restart init): ht4|@NDusage: mount_ffs [-o options] special node filesystem must be mounted read-only; you may need to run fsckreload.@'5Hn"noToo1,$o4o@o'Ho D1h \o&Tloto o#o|1$o?oooo o o!o0t4t9@tLtTtXtTthtTt|tTttTttTttTttTttTttdttdudu9 ud,ud n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O @@ !1Aa  0@` #+3;CScs$0<LXl|Vusage: %s [-123456789cdf%sh%slNnOqrt%sv] [-b bits] [-o filename] [-S suffix] %*s [file ...] usage: %s [-cfh%slNnqrt%sv] [-o filename] [file ...] usage: %s [-f%shqr] [file ...] OK %4.1f%% -- replaced with %s %lld bytes in, %lld bytes out method crc date time compressed uncompressed ratio uncompressed_name%-7.7s %08x %s %10lld %10lld %4.1f%% %s %10lld %10lld %4.1f%% (totals) .-_tgztazfchown: %sfchmod: %sfchflags: %sfutimes: %scompression not supported%s: won't read compressed data from terminal%s: unrecognized file formatcrc errorzcatzipunknown program nameGZIPoption -a is ignored on this systemillegal bit count -- %s-o argument is too long-o option may only be used with a single input filemay not mix -o, -c, or -t options%s is a directory: ignored: unchanged%s not a regular file%s%s already has %s suffix -- unchanged%s: unknown suffix: ignored%s%s: name too long%s: input: %sdeflate.gz123456789ab:cdfhLlNnOo:qrS:tVvcfhLlNno:qrtVvfhqrZgzz1.2.3need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionusage: %s [-R [-H | -L | -P]] %s file ... owner[:group]usage: %s [-h] [-R [-H | -L | -P]] %s file ... %s [-h] [-R [-H | -L | -P]] :group file ... group is %s: %suser is %s: %sHLPRXfghorstuwxthe -R and -h options may not be specified together.invalid flags: %sinvalid flag: %s9\/999: ::$:,:04:<:D:L:P:99X:`: @ ?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@%lld %s I=%llubad size: blk %lld, offset %lld, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock.fs_fpg %d cannot allocate memory for inode cache cannot increase directory listbad inode number %llu to nextinode %llu cannot alloc %zu bytes to extend inoinfo CG %d: BAD MAGIC NUMBER %lld files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %lld files missing %lld blocks missing conversion levelcannot do level %d conversion usage: %s [-fnpy] [-b block#] [-c level] [-m mode] filesystem ... dfpnNyYb:c:m:EXCESSIVE DUP BLKS I=%llucannot alloc %zu bytes for inoinfobad direct addr: %lld bad indirect addr: %lld INCORRECT BLOCK COUNT I=%llu (%lld should be %lld)too many inodes %llu, or out of memory phase 1, inode %llu/%lluphase 1b, inode %llu/%llu%s %s: LENGTH %zu NOT MULTIPLE of %d%s %s: LENGTH %zu NOT MULTIPLE OF %dphase 2, directory %d/%dphase 2, parent directory %d/%d (REMOVED)phase 3, directory %d/%ldphase 4, inode %llu/%lluDELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS UNKNOWN ROTATIONAL TABLE FORMAT %d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %lld MARKED FREE ALLOCATED FRAG %lld MARKED FREE BLK(S) MISSING IN BIT MAPSphase 5, cg %d/%d%s: NOT LABELED AS A BSD FILE SYSTEM (%s) NCG OUT OF RANGECPG OUT OF RANGENCYL LESS THAN NCG*CPGSBSIZE PREPOSTEROUSLY LARGEILLEGAL BLOCK SIZE IN SUPERBLOCKILLEGAL FRAGMENT SIZE IN SUPERBLOCKoffset %d, original %ld, alternate %ld VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN LAST ALTERNATEINFORMATION; SEE fsck_ffs(8).clean = %d UNDEFINED OPTIMIZATION IN SUPERBLOCKIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE NPSECT=%d IN SUPERBLOCK (FIXED)INCORRECT BMASK=%x IN SUPERBLOCKINCORRECT FMASK=%x IN SUPERBLOCKINCORRECT BSHIFT=%d IN SUPERBLOCKINCORRECT FSHIFT=%d IN SUPERBLOCKFormat of filesystem is too old. Must update to modern format using a version of fsck from before release 5.0 with the command ``fsck -c 2'' INCORRECT MAXFILESIZE=%llu IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%lx IN SUPERBLOCKINCORRECT QFMASK=%lx IN SUPERBLOCKINCONSISTENT CGSIZE=%d INCONSISTENT INOPB=%d INCONSISTENT NINDIR=%d cannot alloc %u bytes for cylinder group summary area cannot alloc %zu bytes for blockmap cannot alloc %zu bytes for inostathead cannot alloc %zu bytes for inpsort cannot alloc %zu bytes for inphead inoinfo: inumber %llu out of rangeCANNOT %s: BLK %lldWRITING %sZERO'ED BLOCK %lld TO DISK UPDATE STANDARD SUPERBLOCK   delete %d: %sinsert %d: %ssession database close: %ssession database open: %scannot get kernel security level: %scannot change kernel security level from %d to %d: %sfatal signal: %scan't parse getty for port %scan't allocate windowcan't parse window for port %sport %s changed utmp index from %d to %dcan't fork for window system on port %s: %msetsid failed (window) %mcan't exec window system '%s' for port %s: %mcan't fork for getty on port %s: %mgetty repeating too quickly on port %s, sleepingcan't exec getty '%s' for port %s: %msome processes would not die; ps axl advisedcan't open %s: %mcan't get %s for controlling terminal: %mcannot disable lid suspendcan't exec %s for %s %s: %mautobootcan't exec %s for %s: %mcan't fork for %s on %s: %mwait for %s on %s failed: %m; going to single user modeinit: %s on %s stopped, restarting %s on %s terminated abnormally, going to single user mode/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bincan't exec %s for single user: %mcan't fork single-user shell, trying againwait for single-user shell failed: %m; restartinginit: shell stopped, restarting single user shell terminated.single user shell terminated, restartinginit: %s init: already running initial setsid() failed: %msetlogin() failed: %munrecognized flag '-%c'sfignoring excess argumentsusage: %s [-b block-size] [-c fragments-per-cylinder-group] [-e maxbpg] [-f frag-size] [-i bytes] [-m free-space] [-o options] [-P file] [-s size] special node usage: %s [-Nq] [-b block-size] [-c fragments-per-cylinder-group] [-e maxbpg] [-f frag-size] [-g avgfilesize] [-h avgfpdir] [-i bytes] [-m free-space] [-O filesystem-format] [-o optimization] [-S sector-size] [-s size] [-T disktype] [-t fstype] special ioctl (WDINFO)%s: can't rewrite disk labelinsane maxpartitions value %dP:T:b:c:e:f:i:m:o:s:NO:S:T:b:c:e:f:g:h:i:m:o:qs:t:%s: invalid ffs versionsector size invalid: %sblock size is %s: %sfragments per cylinder group is %s: %sblocks per file in a cylinder group is %s: %sfragment size is %s: %saverage file size is %s: %saverage files per dir is %s: %sbytes per inode is %s: %sfree space %% is %s: %s%s: unknown optimization preference: use `space' or `time'.file system size invalid: %snewfs_%s%s/newfs_%s%s not found%s: getmntinfo: %s%s: no default sector size%s: maximum file system size on the `%c' partition is %llu sectorswarning: changing optimization to space because minfree is less than %d%% setblock bad fs_frag %dclrblock bad fs_frag %disblock bad fs_frag %dwtfs: write error on block %lldrdfs: read error on block %lldcg 0: bad magic numberfirst cylinder group ran out of spaceinternal error: can't find block in cyl 0ilog2: %d is not a power of 2 fsinit: inode value %llu out of rangeinode table does not fit in cylinder grouppanic: cylinder group too big: %d > %dpreposterous size %lld, max is %dpreposterous size %lld, max is %lldblock size must be a power of 2, not %dfragment size must be a power of 2, not %dfragment size %d is too small, minimum is %lldblock size %d is too small, minimum is %dblock size %d is too large, maximum is %dblock size (%d) cannot be smaller than fragment size (%d)fragment size %d is too small, minimum with block size %d is %ddensity reduced from %d to %d bytes per inodecan't honour -c: minimum is %dfile system size %jd < minimum size of %d fragmentsreduced number of fragments per cylinder group from %d to %d to enlarge last cylinder groupcalloc failed%s: %.1fMB in %jd sectors of %lld bytes %d cylinder groups of %.2fMB, %d blocks, %d inodes each can't get physmemcan't get rlimitwarning: fsck_ffs will need %lluMB; min(ulimit -dH,physmem) is %lluMBsuper-block backups (for fsck -b #) at:cannot allocate I/O bufferfsinit1 failedfsinit2 failed%s: initializing cg %ld/%d usage: %s [-dfiPRr] file ... "." and ".." may not be removedremove %s? override %s%s%s/%s for %s? %s (inode %llu): not overwritten due to multiple links%s: malloc%s: is a directorydfiPRrusage: %s [-t] device usage: %s [-f device] command [count] %d: unknown tape drive type %s tape drive, residual=%d erblocksize: %d (%d) density: %d (%d) ioctl MTIOCGETf:no remote support%s: unknown command%s: illegal countbsfbsrdensityeomfsffsrofflinerewindrewofflretensionweofWriteProtectMounted76543210usage: %s [-p] [-m mode] directory ... m:p\ can not be used as a string delimiternewline can not be used as a string delimiterwhitespace after %sundefined label '%s'RE error: %sunterminated regular expressionexpected context addressunexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandfilename expectedw commandread commandbranchempty labelduplicate label '%s'substitute pattern can not be delimited by newline or backslashunterminated substitute pattern123456789\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expressionmore than one number or 'g' in substitute flagsnumber in substitute flags out of rangewfile too longno wfile specifiedbad flag in substitute command: '%c'transform pattern can not be delimited by newline or backslashunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthextra text at the end of a transform commandunused label '%s' ..."usage: sed [-aEnru] command [file ...] sed [-aEnru] [-e command] [-f command_file] [file ...] Eae:f:nrustdout: %ssed: %lu: %s: first RE may not be empty\ %03o\%d not defined in the RE\abfrtv t P    $P 0$ 40 @ H P 4I T XP dP p |   4D l4 p| t xl  l    |  h d  \  (  |   | l,  -a-b-c-d -e-f-G-g-h -H -k-L -n-O-o-p -r-s-S -t-u-w-x-z===!=<>-eq-ne-gt-ge-lt -le!-ef"-nt#-ot$|tfcdslmn(Mp% 8 $tG <F P4G `D lC D C >  6 7 - G tD , , 7 X> = @C A $TG 0F @% L\B T4 `\3 pT5 3 3 l5 4, t7 8- & 7 ; H p9 ,d] H& X% l5 t`2 l8 t2 h= hF @ 2 2 2 8_ t, c\n++--==!== *= /= %= += -= <<= >>= &= ^= |= <<>><=>=<>&& || */%+-&^|? , ~!():`3 ,IFS= ${PS2=> } ${PS3=#? } ${PS4=+ }(a4@cHCTdeltiklXmCnfbupr(shv8$4x`   о   (0X,{(}048<@D  ]]<>!let||&&() PXr h 2 2 t`3@(#)PD KSH v5.2.14 99/07/13.2 AAA  Q AA A QBafree: %p not present in area %punable to allocate memorylmmissing options argumentmissing name argument%s: is not an identifierc_getopts: no argvarguments changed since last callOPTARGbad signal `%s'usage: kill [-s signame | -signum | -signame] { job | pid | pgrp } ... kill -l [exit_status ...] %s: arguments must be jobs or process IDs%*d %*s %s%*d %*d %sjob control not enabled%%lpnzno argumentsadtdprtUxalias: -r flag can only be used with -t and without arguments alias %s alias not found L#R#UZ#fi#lprtuxonly -t, -u and -x options may be used with -ffunction %s %T %s() %T %s: not identifiertypeset -i -x -r -t -L%d -R%d -Z -l -u -U exportreadonly%s[%d]pvpvV is a reserved wordexported is an %salias for alias %s= is an exported traced undefined (autoload from %s) function special is a%s shell builtin is a tracked %salias for not found%s is *GOK*Rnprsu,-n-p: %s-u: %s: %sLPcan't get current directory - %srestricted shell - can't cdPWDOLDPWDno home directory (HOME not set)no OLDPWDdon't know current directoryCDPATH%s: bad directory+alias+cd+command*=export+fc+getopts+jobs+killletpwd*=readonly=typeset+unaliaswhence+bg+fgunalias-tacan't suspend a login shellinvalid file modeusage: mknod [-m mode] name b|c major minorusage: mknod [-m mode] name ptime: -%s unknown optiontime: -%s requires an argument:p%s%*lld.%02ld%s%s%*lldm%lld.%02lds%sreal real user sys user system fv%s is read only%s: cannot %s%s: can only %s %d level(s)%s: bad numberugorwx%#3.3o augo=+-rwxugoXsbad masktrap -- bad signal %sprsu,nothing to shift*=.*=:[*=break=builtin*=continue*=eval*=exec*=exit+false*=return*=set*=shift*=times*=trap+=wait+readtest+trueulimit+umask*=unsetsuspendmissing closing parenmissing argumentexpression expectedmissing second argumentmissing expression operatorunexpected operator/operandinternal error: unknown opmissing ]-t-aunlimited unlimitedinvalid limit: %s-%c exceeds allowable limitbad -%c limit: %susage: ulimit [-acdfHlmnpSst] [value]ulimit: %c%-20s time(cpu-seconds)file(blocks)coredump(blocks)data(kbytes)stack(kbytes)lockedmem(kbytes)memory(kbytes)nofiles(descriptors)IFS"#$&'()*:;<=>?[\]`{|};|&()`+@!fileglob: substitute errorFPATH nothing to yank yank something firstduplicate binding for %sPOSIX%s = %s %s = '%s' cannot bind, not a ttyauto-insert%s: no such functioninvalid return code I-search: beginning-of-historycomplete-commandcomplete-filecompletedelete-char-backwarddelete-word-backwarddelete-char-forwarddelete-word-forwardkill-lineredrawend-of-historyeot-or-deletegoto-historymacro-stringkill-to-eolkill-regionlist-commandlist-filequoteyank-popbackward-charbeginning-of-linebackward-wordend-of-lineforward-charforward-wordnewlinedown-historynewline-and-nextno-opup-historyprev-hist-wordsearch-character-forwardsearch-character-backwardsearch-historyset-mark-commandstuffstuff-resettranspose-charsexchange-point-and-markcomplete-listexpand-filecapitalize-worddowncase-wordupcase-wordset-argcomment*+?@! substituteexpand(NULL)%Rfunny $() command: %s%s: cannot open $(<) input%s: parameter not set%S%s: bad substitutionparameter null or not set%*d) %sdbteste_error: %s (offset %d)shcomexec: %shere document missingcan't %s temporary file %s: %sherein: yylexerror writing %s: %sPS4%s%s %s: restricteddupcannot %s %s: %scould not finish (dup) redirection %s: %scoprocess already existsPS3EXECSHELL%s: %s: %sbuiltin: %s: not a builtincommand -p: restricted%s: can't find function definition file - %s%s: can't find function definition file%s: can't open function definition file %s - %s%s: function not defined by %sCFUNC %d%s: cannot execute - %s-rend of expression%s: unexpected `%s'%s: bad number `%s'%s: expression recurses on parameter `%s'%s: %s requires lvalue%s: %s applied to read only variablemissing )zero divisormissing :HISTFILE%s.%dno history (yet)%s: not in history%s: invalid rangehistory functions not available-%c%se:glnrs0,1,2,3,4,5,6,7,8,9,can't use -e, -l, -n, -r with -s (-e -)substitution failedcan't use -l, -n with -e-16%.*s cannot create temp file %s - %serror writing temporary file - %s${FCEDIT:-/bin/ed} $_cannot open temp file %serror reading temp file %s - %sno coprocess%s/shXXXXXXXXbad file descriptorfd not open for readingfd not open for writingillegal file descriptor name%s[%d]: internal error: shl_stdout not validtoo many files open in shellcan't create pipe - try again RunningDoneDone (%d)[%d] %c %5d (core dumped)%s%s %-20s %s%s%s%s%5d %-20s %s%s %s%sremove_job: job not found (%s)notifyj_async: job not startedj_async: bad nzombie (%d)zombiejobsstopped and runningYou have %s%s%s jobs j_waitj: tcsetpgrp(%d, %d) failed: %sjob not job-controlled[%d] | 1st tcsetpgrp(%d, %d) failed: %sfg: 2nd tcsetpgrp(%d, %d) failed: %scannot continue job %s: %sjw:resumejw:waitforwaitlast: no last jobwaitlast: not startedjw:waitlastexchild: XPIPEI and no last_job - pid %dfork failedcannot fork - try againchildexchild: execute() returned[%d]jw:last procj_init: getpgrp() failed: %sj_init: tcgetpgrp() failed: %sj_init: setpgid() failed: %sj_init: tcsetpgrp() failed: %swarning: won't have full job controlj_suspend: tcsetpgrp() failed: %sj_suspend: setpgid() failed: %scheck_job: job started (flags 0x%x)checkjobno such jobambiguousargument must be %job or process id%a %b %d%l:%M:%S%r~/%sPS1\$PS2missing ] no closing quote here document `%s' unclosed MAILyou have mail in $_shell: %dUse `exit' to leave ksh include: %drshrkshrpdkshpdrkshSH_VERSIONPPIDUSER$ -c requires an argumentCannot determine current working directory/etc/profile$HOME/.profile/etc/suid_profileENVtypesetKSH_VERSION-xOPTIND=1evaltypeset -i RANDOM MAILCHECK="${MAILCHECK-600}" SECONDS="${SECONDS-0}" TMOUT="${TMOUT-0}"hash=alias -ttype=whence -vstop=kill -STOPautoload=typeset -fufunctions=typeset -fhistory=fc -linteger=typeset -inohup=nohup local=typesetr=fc -e -login=exec login-tUccmailmakeprviwho |&;<>()*@#!$-? =-+?#% "#$&'()*;<>?[\`|0123456789ABCDEF%-*s%*s'\'%s%s-%c: unknown option%s%s-`%c' requires argument%-*s %sA:o;sCurrent option settings -o %s%s: bad optionparse_args: `%c'allexportbraceexpandbgnicecsh-historyemacs-usemetaerrexitgmacsignoreeofinteractivekeywordloginmarkdirsnoclobbernoglobnohupnolognounsetphysicalposixprivilegedtrackallvirawvi-show8vi-tabcompletevi-esccompletextracealnumblankcntrldigitgraphlowerpunctupperxdigitshf_flush: no fdshf_emptybuf: no fdshf_write: flags %xshf_write: nbytes %dshf_putchar: flags %xshf_putchar: no fd0123456789abcdef(null %s)shf_ungetc: flags %xshf_fillbuf: no fdshf_getchar: flags %xshf_getse: flags %xshf_read: flags %xshf_read: bsize %dshf_sopen: flags 0x%xshf_snprintf: buf %lx, bsize %dshf_reopen: missing read/writeshf_reopen: bad shf/buf/bsizeshf_fdopen: missing read/writeunexpectedunmatchedsyntax error: unexpected EOF ?%dsyntax error: `%s' %s too many <<'s too many redirections for%s: bad identifier %s: invalid function name thenelseelifficaseesacwhileuntildo{[[&&||;;((|&too many varssetexecsig: unset signal %d(%s)ERRError handlerEXITtimed out waiting for inputSIGwdscan: unknown char 0x%x (carrying on)%S #no-vars# #no-args# ( %T) %T| %T%;%T%s %T %S ]] select %s for %s in %;do%N%T%;done case %S in%N(%S%c%;%T%N;;%Nesac if %Tthen%N%Telif %Telse%;%T%;fi %s %T%;do{%;%T%;} %T|& %T& function %s %T%s() %Ttime %T< <<- << >> >| <> <&>&No controlling tty (open /dev/tty: %s)Can't find tty file descriptorj_ttyinit: dup of tty fd failed: %s%0*s%.*s%*s%.*s%s: subscript %ld out of range%s: is read onlysetstr: %s=%s: assigning to self0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789abcdefghijklmnopqrstuvwxyzOPTINDPOSIXLY_CORRECTHISTSIZEMAILCHECKMAILPATHRANDOMSECONDSTMOUTLINENOM-grabhist: bad history arrayy$%s %dfc -e ${VISUAL:-${EDITOR:-vi}} --Invalid keyInvalid saltToo few rounds: %dcan't specify passphrase file during initial creation of crypto volumeinvalid passphrase filecan't stat passphrase filepassphrase file must be owned by rootpassphrase file has the wrong permissionscan't read passphrase fileinvalid passphrase lengthunable to read passphraseRe-type passphrase: Passphrases did not matchpbkdf2 failedinvalid KDF infoinvalid KDF hintKDF hint has invalid sizeunknown KDF type %dnumber of KDF rounds too low: %dDIOCINQ%s: <%s, %s, %s>, serial %s invalid flags listinvalid flag %sinvalid device listcould not open %scould not stat %stoo many devices on device listduplicate device in listNew passphrase: unknown errorBIOCDISCIPLINEOld passphrase: BIOCDELETERAIDno devices specifiednot enough memory for dev_t listunsupported raid levelnot enough disksnot exactly one partitionioctlPassphrase: BIOCCREATERAID/dev/bioCan't locate %s device via %sBIOCBLINKBIOCINQBIOCVOLinvalid alarm function: %sBIOCALARMalarm is currently %s %-11s %-10s %14s %-8s VolumeStatusSizeDevice %d%% done %u secondsScrubbingInvalidOnlineOfflineDegradedBuildingRebuildWTWB%s %u%14llu%11s %-10s %14s %-7s CRYPTO%s%s %11s %-10s %14s %-7s CONCAT%s%s %11s %-10s %14s %-7s RAID%u%s%s %s BIOCDISKFailedHot spareUnused %3u%14skey disk%u:%u.%unoenclunknown serial%11s %-10s %14s %-7s %-6s <%s> %11s %-10s %14s %-7s %-6s '%s' target not specifiedTarget %s: %sDisk %s is not in an enclosureDisk %s does not existinvalid device %sBIOCSETSTATEusage: %s [-hiqv] [-a alarm-function] [-b channel:target[.lun]] [-H channel:target[.lun]] [-R device | channel:target[.lun]] [-u channel:target[.lun]] device %s [-dhiPqsv] [-C flag[,flag,...]] [-c raidlevel] [-k keydisk] [-l special[,special,...]] [-O device | channel:target[.lun]] [-p passfile] [-R device | channel:target[.lun]] [-r rounds] device Invalid RAID levelNumber of rounds is %s: %sa:b:C:c:dH:hik:l:O:Pp:qr:R:svu:need deviceneed -c parameterneed -l parametermust use bio deviceblowfish,%spref too longunable to get login class `%s'localciphercan't generate hashusage: %s [-b rounds] [-c class] [-p | string] rounds is %s: %spb:c:Enter string: getpassusage: %s seconds usage: %s [-fi] source target %s [-fi] source ... directory /bin/cp-PRp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status/bin/rm-rf%s: remove%s: set owner/group; not setting setuid/setgid%s: set owner/group%s: set mode%s: set flags%s: set timesrename %s to %scannot resolve %scannot rename a mount pointcan't remove %s%s: destination pathname too longusage: %s [-s] [-M core] [-N system] sM:N:sysctl: KERN_MSGBUFSIZEcouldn't allocate space for buffer datasysctl: KERN_MSGBUFusage: %s [-s] [name-of-host] sethostnamegethostname/etc/networks"(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDlɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~[/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxqg jgrn<:ORQhك[0.0.0.0127.0.0.1::::1/etc/group/etc/spwd.db/etc/pwd.db/etc/ethers%02x:%02x:%02x:%02x:%02x:%02x  0123456789ABCDEF0123456789abcdefnanNANinfINF(null)bug in vfprintf: bad base HOSTALIASES/etc/hosts;#nameserverlookupypsearchinet4ndots:RES_OPTIONSoptions LOCALDOMAINsearch lookup bind filenameserver 127.0.0.1ASR_CONFIGlookup file %d.%d.%d.%d.in-addr.arpa.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.ip6.arpa.no spacetoo shortbad domain namedomain name too longbad dlen@BKMGTPE0B%lld%c%lld.%1lld%cimsg_readmsgbuf_write/dev/diskmap%s%s%s%c%s%s%shmac_sha1pkcs5_pbkdf2logout/var/run/utmplogin_protect%s: %s: %m/etc/fbtab/*%s: chmod(%s): %m%s: chown(%s): %m%s: opendir(%s): %m%o%s: bad entry: %s\\#readlabelfs(S,,S4Sjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-A1b62S-+ldEw}ZVǖAOIъ OM~-QJ#SpxAaU׮.7׵Y-6]]wll?AԞZ͢$ Faw$eڪ]]FD(koipvk19Z* ,  m86F߲]qTp0ek*1u4yީ%8S1bSWĔՖk1**ykʬHpo].*F6fcTT"eM©g0&):{ϼkZ> 8$,52F*sw1pHkQ6Fzw]cN̵J #pAF]#l8?1(BOgT~yUbL8^#ܖTZ1ObbSyOIV~P-{b-R4٠~^eGnHl/Su6: #jT$+e?yHf'*b#ٽЧ ?&~?$pi;FBzw[keZ~7 Sv8H 3?r$7jnԄYFܨ |OQ;օ U d S - =G\ p&Gw)` /a߫i5&LsZ<#0zMzFM8,9; :R:(q-v,.7/pXqYs3r%w+OQvrtEux܉~OK }!b|tyBxʠz{.lD~m8onlk[wjR1h58ib?mcf+aQ`צedd"fig HINSKyuJcO NZLݘMFGN@E$DD2AsX@*IBCPhTg3U>uW ַVS:R|P~Q9ZS [fYX4])\ZEo^m/_5qϱ٥s\ۼqދ!K7 kfֶԁ-b3Πjp]$^'~*I@VW<âM˟ŏ{ tDCm-@wm.B+(铜>Td"ŀǼϭ~8y$owJ1}05_K^ iϏ은BI#ƈdX܁T̓cQ: rՆ⩗ fn|xK)o%ƭ/3vUuA?)C:|sĵ@͂ Ͳ;bIUeh"׻_HS1޼^Z4eg Wb27_k%8ם(ŊO}do׸Jj3wVcXWP0qB{߭gCru&op-?'Bs ưGz>2[Ȏg; i8P/ _Y=чe:ZO?(3wwXR @hQ+ğH*0"ZOWoI}@mNП5+#*'G| AH=XX?#1jvʬ`p^Y<L~i/{kHwâ hs)aLoD~Pf7VM'(@ﰤ ہg9x+n&;f?/X)T`D1 ߨMߒ.FgTp'Hq/L0UEc?kǃh6ry7]P\@TN%s7@'>$!AxUʰ\3;Y^U~PGl!;b F2ȂpԞ(Q_V:1X: n3 m:@/)IJNv"2x+ٗ Kx.HҥfAj^y9*O]#kM`~b_R 7zFh!1߈Vc0a"j6nS Nr)Υ{t*F8#vufz`rs"WG9^EMvc΍&DAdQy/4Aڱ&S֚E biLQ<6'5P..T&q]w4.6IE? v\[YI>U!lDa>Ԫ΋ϩ7~8A]&nv|oY yKiw\¹9~$ 66nQfq>,o,IӔ 渱{I .H>C-Yn馑gQz tafw0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-1A26b+-Sdl}wEVZOAي»IˬO ~M-JQS#xpaA.U7Y-۩6˚w]]llA?Z$㧲F waރ$Ųe]]DFok(vpi91k *Z  ,8mF6]pTqke0*1¶u4%y<8syjHA}X*ݹ1SbSW§ٖծ1k**kypH]oF*.f6TTcMe"¤0g)&Ůޟ:{kZ >8,$5*F21wsHpQkzF6c]wN̵ׄJ# pȄA#]F8l1?(gOB~TUyLbˁ8#^TO1ZbbySIOP~V{-b-4R^~Ge­lHnuS/:6# $Tj?e+y䏼Hf*'˼Ѝb# &??~p$iBF;[wzek~ZS 7H8v ?3$rj7nFY |OQ; U dؓS - \G=&pGw`)/ ai5&sL <:R=Pe6^X7}o5641W0ճ2k3$k%'1&-[#bML"'{ "!$*x(+)`F(> q-q,v.Ț/7pqXsYr3w%vQO+tru՛E~xKO} |b!ytxBz{l.m~Do8nkljw[h1Ri85bcm?a+f`Qeddf"giH IKSNJuyOcN LZMݥFĚGE@ND$A2D@XsBI*CThPU3gWu>V SR:P|Q~Z9[ SYfX]4\)^oEZ_/m5qs<\kg2z &J8 좞V`a/6i\lU,zB\uHƒ=&FW A+Ox]`غ7W>9q߳!7Kk ֩fض-bѠ3pj$]^Ĝ'*~@IWVÕ<ӂMʏş{ Dt͆mC-@mw+B.(>dT"ş~Ϝ8yo$w1J}50K_ ^ϋiBۉI#dXфTQc:r Р fΫnx|)Ko%3/uUv?A)ġ:C|sд@͉ ;IbeU"hH_S1ފZ^ھ4ge ȋbW72%k_ܝ8Ŵ(}OodJֿjw3XcVPW0Bq{gǧurCo&p-?О'sB zGɠ2>[ ;g/P8i_ Y=嗇e:ϏOZw3(?RXw@ Qh+HZ"0*WOIo@}m5N#+'*GA |􏒨HX=#?X1vjʨ`^pYL'!$UxAׯ3\Y;U^GP~b;!lڇF 2p(ԐQV_:X1: 3n :m@I)/NJ2"v+x xKH.jAf^O*9y]#Mk~`bю_޶ Rz7hFм!10cV"ajحn6 SrN){t*8Fv#fu`zrϮsɛW"G9E^vMcD&dA/yQA4S&ֿ EbLil!>aDƋΪ~7A8n&]|vYoᡱ Kyi׫w¡\~9$66 Qnf>q,o,ӹI 散 I{.C>HnY-Qg̰t zfalongjmp botch. inet6_rth_reverseargument buffer overflowunknown/invalid errorno errorinvalid value for ai_flagsname or service is not knowntemporary failure in name resolutionnon-recoverable failure in name resolutionno address associated with nameai_family not supportedai_socktype not supportedservice not supported for ai_socktypeaddress family for name not supportedmemory allocation failureinvalid value for hintsresolved protocol is unknownfstabscanxxswsetusercontextt-|--------cannot stat %s: %m%s: not a regular file%s: not owned by root%s: writable by non-root%s: getting capability %s: %m%s: unexpected error with capability %sinfinity%s:%s=%s: invalid size%s:%s=%s: invalid number%s:%s=%s: invalid times/keyskeyauthmalloc: %mpasswdstrdup: %m/etc/login.conf%s:%d malloc: %m/usr/src/lib/libc/gen/login_cap.c%s:%d strdup: %m%s: couldn't resolve 'tc'%s: unknown class%s: getting class information: %m%s: 'tc' reference loop%s: unexpected cgetent error%s-curcurrent resource limit name too large%s-maxmax resource limit name too largegetting resource limit: %m%s: setting resource limit %s: %m%s: setpriority: %mumasksetresgid(%u,%u,%u): %minitgroups(%s,%u): %msetlogin(%s) failure: %msetresuid(%u,%u,%u): %msetenvcould not set user environment: %mcould not set PATH: %mcputimefilesizedatasizestacksizememoryusememorylockedmaxprocopenfilescoredumpsizegetgrouplistunix.%u@%s/etc/netidnetid.bynameinet_net_ptoninet_net_pton_ipv401234567890123456789abcdef/usr/src/lib/libc/net/inet_net_pton.cn >= 0 && n <= 15n >= 0 && n <= 9assertion "%s" failed: file "%s", line %d, function "%s" assertion "%s" failed: file "%s", line %d %u.%u.%u.%uSHA256EndSHA256DataSHA256FileChunk0123456789abcdef///=//00 0000$0(00080t<0D0L0T0\0d0h0p0x0006000Signal 0HUPINTILLTRAPABRTEMTFPEKILLBUSSEGVSYSPIPEALRMURGTSTPCONTCHLDTTINTTOUIOXCPUXFSZVTALRMPROFWINCHUSR1USR2THR[:<:]][:>:]]ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ !"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789ABCDEFabcdefNULSOHSTXETXEOTENQBELalertBSbackspaceHTtabLFVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBIS4IS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stopzeroonetwothreefourfivesixseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDELd6p6|666666666666 ,nosappndnosappendnoarchnoarchivednoschgnoschangenosimmutablenouappndnouappendnouchgnouchangenouimmutablenodumpnoopaqueBLOCKSIZE%s: unknown blocksizemaximum blocksize is %dG%s: minimum blocksize is 512%ld%s-blocks88<8@8D8t7H8L8P8T8t7%m/%d/%y%Y-%m-%d%H:%M%I:%M:%S %p%H:%M:%SESTCSTMSTPSTEDTCDTMDTPDTABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/vdprintfregerrorREG_0x%xREG_NOMATCHregexec() failed to matchREG_BADPATinvalid regular expressionREG_ECOLLATEinvalid collating elementREG_ECTYPEinvalid character classREG_EESCAPEREG_ESUBREGinvalid backreference numberREG_EBRACKbrackets ([ ]) not balancedREG_EPARENparentheses not balancedREG_EBRACEbraces not balancedREG_BADBRinvalid repetition count(s)REG_ERANGEinvalid character rangeREG_ESPACEREG_BADRPTrepetition-operator operand invalidREG_EMPTYempty (sub)expressionREG_ASSERT"can't happen" -- you found a bugREG_INVARGinvalid argument to regex routine*** unknown regexp error code ***/etc/ttyssecurertsctssoftcarwindowttyname_r/var/run/dev.dbMD5PadPOSIX_V6_ILP32_OFFBIGPOSIX_V7_ILP32_OFFBIG-lpthreadreadpassphrasetcsetattrd:glob2authunix_createauthunix_create_defaultauth_none.c - Fatal marshalling problemauthunix_create: out of memory /===== >>$>@>H>T>h>x>>>>>>>>>??,?D?\?t??????/===== >>$>@>H>T>h>x>>>>>>>>>??,?D?\?t??????HangupInterruptQuitIllegal instructionTrace/BPT trapAbort trapEMT trapFloating point exceptionKilledBus errorSegmentation faultBad system callBroken pipeAlarm clockTerminatedUrgent I/O conditionSuspended (signal)SuspendedContinuedChild exitedStopped (tty input)Stopped (tty output)I/O possibleCputime limit exceededFilesize limit exceededVirtual timer expiredProfiling timer expiredWindow size changesInformation requestUser defined signal 1User defined signal 2Thread ASTunknown option -- %coption requires an argument -- %cambiguous option -- %.*soption doesn't take an argument -- %.*soption requires an argument -- %sunknown option -- %s/etc/services,/asprintf%h %e %T yp_next: clnt_callyp_match: clnt_call_yp_dobind/var/run/ypbind.lock%s/%s.%d/var/yp/bindingclnttcp_createYP server for domain %s not responding, still trying clntudp_createfcntl: F_SETFDclnttcp_create: out of memory .b0b1ncdtscsbpxbxfxoxtxdxgetentcgetnext%s.dbtc|:/etc/protocolsSHA1TransformSHA1PadSHA512EndSHA512DataSHA512FileChunk0123456789abcdefexecvpeexeclpexecleexeclexecvp: : path too long xdr_array: out of memory C D(DDDXDpDDDDDDE?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~realpathؗҜ<3#I9=D2[%Cod(hinityancrypt_checkpassblowfish,8blowfish,bcrypt_hashpassOrpheanBeholderScryDoubtbcrypt_initsaltbcrypt_newhashbcrypt_autoroundsbcrypt_checkpass6789:;<=>?  !"#$%&'()*+,-./012345./ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789$2%c$%2.2u$$2b$%2.2u$testpassword 1Ѭߘr/Ḗ~&jE|,G$l iciNWqX~=t XrX͋qJT{YZ90`*#`(yA8۸y:`l>w'K1/x`\`U%U攫UbHW@cj9U*4\̴ATr|*oc]ũ+1t>\3֯\$lS2zw(H;Kkē!(f a!`|H2]]]u#&܈e>#Ŭom9BD . Ji^Bh!la gӫҠQjh/T(3Ql n;zP;*~ev9>YfCoEå}^;uos D@jVbNw?6r=B$7H ۛIrS{y%P;LylO`@ž\^c$johSl>9oR;Qm,0DE ^J3(fK.WtE9_ ӹyU 2`yr,@%g̣饎"2u<kaP/R=2`#H{1S>W\o.ViB~(2gsUO'[iXʻ]=!lJ[-ySeEIҐK3~ˤAb Lw6~д+MەqՓkю%ǯ/[{AI~-%^q h"W6d$ cUYCxSZ٢[} Źv&ϕbhAJsN-GJ{RQ)S?Wƛv`+t恵oWk *!ec.4dV]-SGjnpzKD). u#&İn}ߧI`fqilRdVឱ¥6)L u@Y>:䚘T?eB[k?ҡ08-M]% L&pc^?kh >\D}W7: P tAu8/;21>8TNmO Bo ,y|$ryVw.?rU$qk.P̈́GXzt}K:zfC cdG27;C$CMQe*P:qUN1w_V5kǣ;< $Y,n<pEㆱo ^*>Zw=Ne)։>%fRxL.jxS<- N=+6&9`y#RnfE{7(2åZl!Xeh;/ۭ}*/n[(!pa)uGa0a4c\s9pL ު˼,b`\ndi#PZe2Zh@*<1! T_~}=b7w-_h)5ǡޖXxWcr"ÃF T0.SHُ(1mX4a(s<|J]d]B> EꫪOlOBBǵj;Oe!AyMjGKPb=bF&[$ti GV[ Htb#*BXU >ap?#r3A~_;"lY7|`t˧@n2w΄PU5ai Z .zD4Egɞs͈Uy_g@Cge48>q(= m!>J=+hZ=@&L4)i Av.khq$j 3ԷCaP.9FE$tO!@MpE/f m1'A9UG%ښ ʫ%xP()Sچ, mbhiHפh'?Oz|Ϊ_7әxB*k@5 ٫9N;VmK1f&tn:2C[Ah xN جV@E'H::SU kKмgUXc)3VJ*%1?~^|1)p/'\,(H"m?H܆AyG@n]Q_2Տd5A4x{%`*`lc´2Of#k>3b $;" r(-Exb}doITH}'>AcG t.no:7`L knU{7,gm;e' )̒9 i{f} ϑ^و/$[Qy{;v.97yY̗&-1.Bh;+jLu.x7BjQ满PcKkؽ%=YBD n *Ngd_ڈ鿾dW{x`M``FѰ8Ew63kBqA_^;Z4ٷ,Q+:Ֆ}}>(-}|%rZLZq)GW;()f(.y_xU`uD^mm%adâW<'*:m?!cf&(3uU4V<wQ( gQ̫_QM08bX7 z{>d!Q2Ow~㶨F=)iSHd$m-if! FEdlX [@X̻k~jEY:D 5>ʹrdfGof,ҏ"W##v215VbuZ6ns҈bIPLVq z2E{Sb%ҽ5iq"|˶+v>S@`8G% 8vFšw``u N˅؍芰z~L\HjiԐ\-% ?2aN[wߏWr:j?$.Dsp"8 1).lN!(Ew8fTl 4)P|ɵՄ? Gyinet_ntop4inet_ntop0123456789abcdef [([0[^[Yy]^[Nn]yes[[[[[[[\\\\$\0\8\D\H\L\P\T\X\\\`\d\h\l\p\t\|\\\T\\\\\\\\\\\8,8 8SunMonTueWedThuFriSatSundayMondayTuesdayWednesdayThursdayFridaySaturdayJanFebMarAprMayJunJulAugSepOctNovDecJanuaryFebruaryMarchAprilJuneJulyAugustSeptemberOctoberNovemberDecemberAMPM%a %b %e %H:%M:%S %Ywrterrormalloc_initmalloc() warning: unknown char in MALLOC_OPTIONS (%d) in recursive callchunk info corruptedmodified chunk-pointerchunk is already freeregions_total not 2^xinternal struct corruptmunmap/etc/malloc.confMALLOC_OPTIONSmalloc init mmap failedmap roundmalloc cachemunmap roundmalloc cache underflowmalloc free slot lostmalloc cache overflowbogus pointer (double free?)bogus pointerguard sizemprotectdouble freefree():free() called before allocationpp & bitsposix_memalign():mapalign bad alignmentmapalign roundcalloc():realloc():malloc():__vsyslog_r_rsyslog%s: unknown facility/priority: %x<%d>[%ld]Error %dlibcUnknown signal: Unknown error: _catopenNLSPATH/usr/share/nls/%L/%N.cat:/usr/share/nls/%l.%c/%N.cat:/usr/share/nls/%l/%N.catLC_ALLLC_MESSAGESLANGabb4bDb\bpbbbbbb4b cc0cxddddde0ePedeeeeeef8fPfpffffffg4gLgpgggggghh,h@hPhdh|hhhhhhi$i@idi|iiiiiii(j>$>@>H>T>h>x>>>>>>>>>??,?D?\?t??????vsnprintf !#&(*-/14\MABCDEF<clntudp_callclntudp_create: out of memory bindresvport_saxdr_string: out of memory xdr_bytes: out of memory   !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ inet_pton01234567890123456789ABCDEF0123456789abcdef:n"8,"too small ((((( AAAAAABBBBBB   !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~_conv_fmtD\H\L\P\T\X\\\`\d\h\l\p\t\|\\\T\\\\\\\\[[[[[[[\\\\$\0\8\,88q\\-0%2d%03d%e-%b-%Y%04d%a %b %e %T %YtzloadmnGMT/etc/localtime/usr/share/zoneinfoposixrules,M4.1.0,M10.5.0abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789 :+-._Local time zone must be set--see zic manual pageasctime3JanFebMarAprMayJunJulAugSepOctNovDecSunMonTueWedThuFriSat??? ??? ?? ??:??:?? ???? %.3s %.3s%3d %2.2d:%2.2d:%2.2d %-4s %.3s %.3s%3d %2.2d:%2.2d:%2.2d %s %$sniglet^&mktemp_internalchacha_encrypt_bytes_rs_stirexpand 32-byte kexpand 16-byte ksnprintfInfinityNaN7yACnF?O8M20HwZP5133d100851402 012X4 2(L204483<d1L 3D2L2/tmp/EdDk.aXXXXXXXXXX0999909999999999\/999: ::$:,:04:<:D:L:P:99X:`: (|AD|A,n(tĢ,<8H.? ɚ;` ...̾| ؿPd .`````.dA"" e j    ky ( JKYdu f    bv z!w" (F2F8R r u'g <<p%[)]*())* * ){{}}{}(())()[[]][]#$G>> P30123456789.=:f/?/*?*n+n,N-N.&7m'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !+ Hh VqQ:q:QZZ    l h b  w  i x X      0  $  k  j  is not a regular file (use -f to see it) is a directoryal tb@$ B4  Hc, tdAX e ,fL LdF gD h Pli xj\J! 0K` HpL8 m@ n"(   pHP@q Ltr"\ s! <TS!T tu"t Vw"P Lx(XAh y0 zd  8"4X~! d?# AH  < 8\| x... (interrupt to abort) (press RETURN)X8458 Ȏмظ11"t €u6Uu|agPtPS[X!Using drive X, partition YMBR on floppy or old BIOS Read error No O/S No active partition OxUJT ؾGh  R  N  |O  P 0 H8 PJ\ оM \/J 4IpM  L  G |GL  L ]PL0011X11 $1 ,1 01 h <13@1XD1P1X1`1Ah1t1/|1h `!1"1#g$1%`&Ƚ'1(1)1*1+1,1-1.1/101112(3\/4152282\2t2222343T3|3333 4 priorityrttvarrttssthreshsendpiperecvpipeexpirehopcountmtuUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CLONING XRESOLVE LLINFO STATIC BLACKHOLEPROTO3PROTO2PROTO1CLONEDMPATHMPLSLOCALBROADCASTUPBROADCASTDEBUGLOOPBACKPTPNOTRAILERSRUNNINGNOARP PPROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD SRC SRCMASK LABEL<NOOP rElGL99td( 0(EHC P E(  0(EHDHC;H&` ... ...  ht4|@@@@......7 d d   $,4t<H9Ph{}abcdDgGhHilnNpPqrs tw xy !:#=++H3 P@8HXhxH @?C00B$,$4$8<<p*K*D*L*T+\L+d|+4I+l+ ,t<,|l,W _ xx:xx:xx:xx:xx:xx0000000000000000 +l<0K0D0L,1T0\P1d14I1l,2P2tX2|t22222224?4@4[4\4\4]5^ 5^45_@5_L5`\5{h5{|5|5}5}5~5GMTUTC9989D9`9p9999Ȉ9999:: 8:D: X:d: :: :w ::::;;4;@;d;<p*K*D*L*T+\L+d|+4I+l+ ,t<,|l,{{~ }$|? htD0999909999999999\/999: ::$:,:04:<:D:L:P:99X:`:xxqw4yl{{oyFkh455[4[\hkk <H(/x<H<0 <HP18= <8=YTTTXU(_^4_D_T_hc,bf@feee ee4d@ddeee e\e4d6ln== RuneCT10NONEBBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~yJ<KDLT\d4Il @t|>J K<ܪ pHT$$l& .shstrtab.init.text.fini.rodata.openbsd.randomdata.data.eh_frame.jcr.gotpad0.got.ctors.dtors.gotpad1.bss.stack.arm.atpcs.note.openbsd.ident ppRRST%  9Q? K KI$K$KN(PW((K(\PPKcXXKj`PsPPlxPPTTP . ..chownJdhclient< disklabel<dmesgJfdiskJfsckJ fsck_ext2fsfsck_ffs<ifconfig<initJmknodJmountJ mount_cd9660M mount_ext2fsM mount_ffs< mount_msdos mount_nfs<newfsJ newfs_msdos newfs_ext2fsMpingJping6JreboothaltJrouteJsysctlumountbioctlartition on the disk. $(fdisk ${_disk}) __EOT fdisk -e ${_disk} [[ -n $(fdisk $_disk | grep ' A6 ') ]] && return echo No OpenBSD partition in MBR, try again. ;; o*|O*) return ;; esac done } md_prep_disklabel() { local _disk=$1 _f _op md_prep_fdisk $_disk _f=/tmp/fstab.$_disk if [[ $_disk == $ROOTDISK ]]; then while :; do echo "The auto-allocated layout for $_disk is:" disklabel -h -A $_disk | egrep "^# |^ [a-p]:" ask "Use (A)uto layout, (E)dit auto layout, or create (C)ustom layout?" a case $resp in a*|A*) _op=-w ;; e*|E*) _op=-E ;; c*|C*) break ;; *) continue ;; esac disklabel $FSTABFLAG $_f $_op -A $_disk return done fi cat <<__EOT You will now create an OpenBSD disklabel inside the OpenBSD MBR partition. The disklabel defines how OpenBSD splits up the MBR partition into OpenBSD partitions in which filesystems and swap space are created. You must provide each filesystem's mountpoint in this program. The offsets used in the disklabel are ABSOLUTE, i.e. relative to the start of the disk, NOT the start of the OpenBSD MBR partition. __EOT disklabel $FSTABFLAG $_f -E $_disk } md_congrats() { } md_consoleinfo() { } dmesg | grep "^omap0 at mainbus0:" >/dev/null if [[ $? == 0 ]]; then MDPLAT=OMAP LOADADDR=0x82800000 fi dmesg | grep "^imx0 at mainbus0:" >/dev/null if [[ $? == 0 ]]; then MDPLAT=IMX LOADADDR=0x18800000 fi dmesg | grep "^sunxi0 at mainbus0:" >/dev/null if [[ $? == 0 ]]; then MDPLAT=SUNXI LOADADDR=0x40200000 fi MDSETS="bsd.${MDPLAT} bsd.rd.${MDPLAT} bsd.${MDPLAT}.umg bsd.rd.${MDPLAT}.umg" SANESETS="bsd.${MDPLAT}" DEFAULTSETS=${MDSETS} NEWFSARGS_msdos="-F 16 -L boot" NEWFSARGS_ext2fs="-v boot" md_installboot() { local _disk=$1 mount /dev/${_disk}i /mnt/mnt BEAGLE=$(scan_dmesg '/^omap0 at mainbus0: \(BeagleBoard\).*/s//\1/p') BEAGLEBONE=$(scan_dmesg '/^omap0 at mainbus0: \(BeagleBone\).*/s//\1/p') PANDA=$(scan_dmesg '/^omap0 at mainbus0: \(PandaBoard\)/s//\1/p') IMX=$(scan_dmesg '/^imx0 at mainbus0: \(i.MX6.*\)/s//IMX/p') SUNXI=$(scan_dmesg '/^sunxi0 at mainbus0: \(A.*\)/s//SUNXI/p') if [[ -f /mnt/bsd.${MDPLAT} ]]; then mv /mnt/bsd.${MDPLAT} /mnt/bsd fi if [[ -f /mnt/bsd.${MDPLAT}.umg ]]; then mv /mnt/bsd.${MDPLAT}.umg /mnt/mnt/bsd.umg fi if [[ -f /mnt/bsd.mp.${MDPLAT} ]]; then mv /mnt/bsd.mp.${MDPLAT} /mnt/bsd.mp fi if [[ -f /mnt/bsd.rd.${MDPLAT} ]]; then mv /mnt/bsd.rd.${MDPLAT} /mnt/bsd.rd fi if [[ -f /mnt/bsd.rd.${MDPLAT}.umg ]]; then mv /mnt/bsd.rd.${MDPLAT}.umg /mnt/mnt/bsdrd.umg fi tar -C /mnt/ -xf /usr/mdec/u-boots.tgz if [[ ${MDPLAT} == "OMAP" ]]; then if [[ -n $BEAGLE ]]; then cp /mnt/usr/mdec/beagle/{mlo,u-boot.bin} /mnt/mnt/ elif [[ -n $BEAGLEBONE ]]; then cp /mnt/usr/mdec/am335x/{mlo,u-boot.img} /mnt/mnt/ elif [[ -n $PANDA ]]; then cp /mnt/usr/mdec/panda/{mlo,u-boot.bin} /mnt/mnt/ fi cat > /mnt/mnt/uenv.txt<<__EOT bootcmd=mmc rescan ; setenv loadaddr ${LOADADDR}; setenv bootargs sd0i:/bsd.umg ; fatload mmc \${mmcdev} \${loadaddr} bsd.umg ; bootm \${loadaddr} ; uenvcmd=boot __EOT elif [[ ${MDPLAT} == "IMX" ]]; then cat > /tmp/6x_bootscript.scr<<__EOT ; setenv loadaddr ${LOADADDR} ; setenv bootargs sd0i:/bsd.umg ; for dtype in sata mmc ; do for disk in 0 1 ; do \${dtype} dev \${disk} ; for fs in fat ext2 ; do if \${fs}load \${dtype} \${disk}:1 \${loadaddr} bsd.umg ; then bootm \${loadaddr} ; fi ; done; done; done; echo; echo failed to load bsd.umg __EOT mkuboot -t script -a arm -o linux /tmp/6x_bootscript.scr /mnt/mnt/6x_bootscript elif [[ ${MDPLAT} == "SUNXI" ]]; then cat > /mnt/mnt/uenv.txt<<__EOT bootargs=sd0i:/bsd mmcboot=mmc rescan ; fatload mmc 0 ${LOADADDR} bsd.umg && bootm ${LOADADDR}; uenvcmd=run mmcboot; __EOT cp /mnt/usr/mdec/cubie/u-boot-sunxi-with-spl.bin /mnt/mnt/ fi } md_prep_fdisk() { local _disk=$1 _q _d local bootparttype="C" local bootfstype="msdos" local newfs_args=${NEWFSARGS_msdos} IMX=$(scan_dmesg '/^imx0 at mainbus0: \(i.MX6.*\)/s//IMX/p') if [[ -n $IMX ]]; then bootparttype="83" bootfstype="ext2fs" newfs_args=${NEWFSARGS_ext2fs} fi while :; do _d=whole if [[ -n $(fdisk $_disk | grep 'Signature: 0xAA55') ]]; then fdisk $_disk else echo "MBR has invalid signature; not showing it." fi ask "Use (W)hole disk$_q or (E)dit the MBR?" "$_d" case $resp in w*|W*) echo -n "Creating a ${bootfstype} partition and an OpenBSD partition for rest of $_disk..." fdisk -e ${_disk} <<__EOT >/dev/null reinit e 0 ${bootparttype} n 64 32768 f 0 e 3 A6 n 32832 write quit __EOT echo "done." disklabel $_disk 2>/dev/null | grep -q "^ i:" || disklabel -w -d $_disk newfs -t ${bootfstype} ${newfs_args} ${_disk}i return ;; e*|E*) cat <<__EOT You will now create one MBR partition to contain your OpenBSD data and one MBR partition on which kernels are located which are loaded by U-Boot. Neither partition will overlap any other partition. The OpenBSD MBR partition will have an id of 'A6' and the boot MBR partition will have an id of '${bootparttype}' (${bootfstype}). The boot partition will be at least 16MB and be the first 'MSDOS' p#!/bin/ksh MODE=install . install.sub DISK= DISKS_DONE= _DKDEVS=$(get_dkdevs) _fsent= rm -f /tmp/fstab* ask_yn "Use DUIDs rather than device names in fstab?" yes && FSTABFLAG=-F while :; do DISKS_DONE=$(addel "$DISK" $DISKS_DONE) _DKDEVS=$(rmel "$DISK" $_DKDEVS) if isin $ROOTDISK $_DKDEVS; then resp=$ROOTDISK rm -f /tmp/fstab else ask_which "disk" "do you wish to initialize" \ '$(l=$(get_dkdevs); for a in $DISKS_DONE; do l=$(rmel $a $l); done; bsort $l)' \ done [[ $resp == done ]] && break fi DISK=$resp makedev $DISK || continue rm -f /tmp/*.$DISK md_prep_disklabel $DISK || { DISK=; continue; } grep -qs " / ffs " /tmp/fstab.$ROOTDISK || { DISK=; echo "'/' must be configured!"; continue; } if [[ -f /tmp/fstab.$DISK ]]; then while read _pp _mp _rest; do if [[ $_mp == none ]]; then echo "$_pp $_mp $_rest" >>/tmp/fstab continue fi [[ /tmp/fstab.$DISK == $(grep -l " $_mp " /tmp/fstab.*) ]] || { _rest=$DISK; DISK=; break; } done /etc/fstab rm /tmp/fstab.$_rest set -- $(grep -h " $_mp " /tmp/fstab.*[0-9]) echo "$_pp and $1 can't both be mounted at $_mp." continue fi while read _pp _mp _fstype _rest; do [[ $_fstype == ffs ]] || continue _OPT= [[ $_mp == / ]] && _OPT=$MDROOTFSOPT newfs -q $_OPT ${_pp##/dev/} _fsent="$_fsent $_mp!$_pp" done >/tmp/fstab munge_fstab mount_fs "-o async" feed_random install_sets if [[ -z $TZ ]]; then (cd /mnt/usr/share/zoneinfo ls -1dF $(tar cvf /dev/null [A-Za-y]*) >/mnt/tmp/tzlist ) echo set_timezone /mnt/tmp/tzlist rm -f /mnt/tmp/tzlist fi if _time=$(http_time) && _now=$(date +%s) && (( _now - _time > 120 || _time - _now > 120 )); then _tz=/mnt/usr/share/zoneinfo/$TZ if ask_yn "Time appears wrong. Set to '$(TZ=$_tz date -r "$(http_time)")'?" yes; then date $(date -r "$(http_time)" "+%Y%m%d%H%M.%S") >/dev/null fi fi if [[ -s $HTTP_LIST ]]; then _i= [[ -n $INSTALL ]] && _i="install=$INSTALL" [[ -n $TZ ]] && _i="$_i&TZ=$TZ" [[ -n $METHOD ]] && _i="$_i&method=$METHOD" [[ -n $_i ]] && ftp -Vao - \ "http://129.128.5.191/cgi-bin/ftpinstall.cgi?$_i" >/dev/null 2>&1 & fi sed "/^console.*on.*secure.*$/s/std\.[0-9]*/std.$(stty speed /tmp/ttys mv /tmp/ttys /mnt/etc/ttys echo -n "Saving configuration files..." (cd /var/db; for _f in dhclient.leases.*; do [[ -f $_f ]] && mv $_f /mnt/var/db/. done) hostname >/tmp/myname echo "127.0.0.1\tlocalhost" >/mnt/etc/hosts echo "::1\t\tlocalhost" >>/mnt/etc/hosts if [[ -f /tmp/hosts ]]; then _dn=$(get_fqdn) while read _addr _hn _aliases; do if [[ -n $_aliases || $_hn != ${_hn%%.*} || -z $_dn ]]; then echo "$_addr\t$_hn $_aliases" else echo "$_addr\t$_hn.$_dn $_hn" fi done >/mnt/etc/hosts rm /tmp/hosts fi _f=dhclient.conf [[ -f /tmp/$_f ]] && { cat /tmp/$_f >>/mnt/etc/$_f; rm /tmp/$_f; } (cd /tmp; for _f in fstab hostname* kbdtype my* ttys *.conf *.tail; do [[ -f $_f && -s $_f ]] && mv $_f /mnt/etc/. done) echo "done." apply if [[ -n $user ]]; then _encr=$(encr_pwd "$userpass") _home=/home/$user uline="${user}:${_encr}:1000:1000:staff:0:0:${username}:$_home:/bin/ksh" echo "$uline" >> /mnt/etc/master.passwd echo "${user}:*:1000:" >> /mnt/etc/group echo ${user} > /mnt/root/.forward _home=/mnt$_home mkdir -p $_home (cd /mnt/etc/skel; cp -pR . $_home) (umask 077 && sed "s,^To: root\$,To: ${username} <${user}>," \ /mnt/var/mail/root > /mnt/var/mail/$user ) chown -R 1000:1000 $_home /mnt/var/mail/$user echo "1,s@wheel:.:0:root\$@wheel:\*:0:root,${user}@ w q" | ed /mnt/etc/group 2>/dev/null [[ -n "$userkey" ]] && usage() { echo "usage: ${0##*/} [-a] [-f filename]" >&2 exit 1 } AUTO=false RESPFILE= while getopts "af:" opt; do case $opt in a) AUTO=true;; f) RESPFILE=$OPTARG;; *) usage;; esac done shift $((OPTIND-1)) [ $# = 0 ] || usage . install.md set_term() { local _layouts export TERM=${TERM:-${MDTERM:-vt220}} if [[ -n $CONSOLE ]]; then ask "Terminal type?" $TERM export TERM=$resp else [[ -x /sbin/kbd ]] || return _layouts=$(bsort $(kbd -l | egrep -v "^(user|tables|encoding)")) while :; do ask "Choose your keyboard layout ('?' or 'L' for list)" "default" case $resp in "?"|L|l) echo "Available layouts: $_layouts";; default) return;; *) kbd $resp && { echo $resp >/tmp/kbdtype; return; };; esac done fi } stripcom () { local _l [[ -f $1 ]] || return set -o noglob while read _l; do [[ -n ${_l%%#*} ]] && echo $_l done <$1 set +o noglob } quote() ( for a; do alias Q=$a; a=$(alias Q); print -rn -- " ${a#Q=}" done | sed '1s/ //' echo ) tmpdir() { local _i=1 _dir until _dir="${1?}.$_i.$RANDOM" && mkdir -- "$_dir" 2>/dev/null; do ((++_i < 10000)) || return 1 done echo "$_dir" } scan_dmesg() { bsort $(sed -n "$1" /var/run/dmesg.boot) } scan_disknames() { local IFS=, bsort $(for _n in $(sysctl -n hw.disknames); do echo "${_n%%:*} "; done | sed -n "$1") } get_dkdevs () { echo $(scan_disknames "${MDDKDEVS:-/^[sw]d[0-9][0-9]* /s/ .*//p}") } get_cddevs () { echo $(scan_disknames "${MDCDDEVS:-/^cd[0-9][0-9]* /s/ .*//p}") } get_ifdevs() { local _if _iflist=$(rmel vlan $(ifconfig -C)) for _if in $(ifconfig "$@" 2>/dev/null | sed -n 's/^\([^[:space:]]*\):.*/\1/p'); do isin ${_if%%+([0-9])} $_iflist || echo $_if done } get_drive() { ask_which "$1" "contains the $MODE media" "$2" "$3" [[ $resp == done ]] && return 1 makedev $resp || return 1 return 0 } mount_mnt2() { local _dev=$1 _opts _file=/tmp/parts.$1 _parts disklabel $_dev 2>/dev/null | sed -En '/swap|unused/d;/^ [a-p]: /p' >$_file _parts=$(sed 's/^ \(.\): .*/\1/' $_file) set -- $_parts (($# == 0)) && { echo "No filesystems found on $_dev."; return 1; } if isin "c" $_parts; then resp=c elif (($# == 1)); then resp=$1 else cat $_file ask_which "$_dev partition" "has the $MODE sets" \ '$(disklabel '$_dev' 2>/dev/null | sed -En '\''/swap|unused/d;/^ ([a-p]): .*/s//\1/p'\'')' [[ $resp == done ]] && return 1 fi grep -q "^ $resp: .*MSDOS" $_file && _opts="-s" mount -o ro,$_opts /dev/$_dev$resp /mnt2 } askpass() { stty -echo IFS= read -r resp?"$1 " stty echo echo } rm -df /tmp/lock lock() { while ! mkdir /tmp/lock 2>/dev/null && sleep .1; do done } unlock() { rm -d /tmp/lock 2>/dev/null } retrap() { trap 'kill -KILL $cppid 2>/dev/null; echo; stty echo; exit 0' \ INT EXIT TERM } rm -f /tmp/update if ! $AUTO; then ( while :; do lock if test -e /tmp/update && [[ "`dmesg`" != "`cat /tmp/update`" ]]; then dmesg >/tmp/update kill -TERM 2>/dev/null $$ || exit 1 fi unlock sleep .5 done ) |& cppid=$! retrap fi _ask() { local _q=$1 _def=$2 _int _redo=0 _pid lock; dmesg >/tmp/update; unlock echo -n "${_q:+$_q }${_def:+[$_def] }" _autorespond "$_q" "$_def" && echo "$resp" && return trap "_int=1" INT trap "_redo=1" TERM read resp lock; rm /tmp/update; unlock if ((_redo)); then stty raw stty -raw else case $resp in !) echo "Type 'exit' to return to install." sh _redo=1 ;; !*) eval "${resp#?}" _redo=1 ;; esac fi retrap ((_int)) && kill -INT $$ : ${resp:=$_def} return $_redo } _autorespond() { typeset -l _q=$1 _key local _def=$2 _l _val [[ -f $RESPFILE ]] || return mv /ai.conf /ai.conf.tmp while IFS=' ' read -r _l; do [[ $_l == [!#=]*=?* ]] || continue _key=${_l%%*([[:blank:]])=*} _val=${_l##*([!=])=*([[:blank:]])} [[ $_q == @(|*[[:blank:]])"$_key"@([[:blank:]?]*|) ]] && resp=$_val && cat && return print -r " $_l" done /ai.conf [[ -n $_def ]] && resp=$_def && return echo "\nQuestion has no answer in response file." exit 1 } ask() { while ! _ask "$1" "$2"; do done } askpassword() { local _q=$1 if $AUTO; then echo -n "$_q " _autorespond "$_q" echo '' _password=$resp return fi while :; do askpass "$_q (will not echo)" _password=$resp askpass "$_q (again)" [[ $resp == "$_password" ]] && break echo "Passwords do not match, try again." done } encr_pwd() { local _p=$1 if [[ -z $_p ]]; then echo '*' elif [[ $_p == \$2?\$[0-9][0-9]\$* && ${#_p} > 40 || $_p == '*************' ]]; then echo "$_p" else encrypt -b a -- "$_p" fi } user_setup() { local _q="Setup a user? (enter a lower-case loginname, or 'no')" while :; do ask "$_q" no case $resp in n|no) return;; y|yes) _q="No really, what is the lower-case loginname, or 'no'?" continue;; root|daemon|operator|bin|smmsp|popa3d) ;; sshd|uucp|www|named|proxy|nobody|ftp) ;; [a-z]*([a-z0-9_])) ((${#resp} <= 31)) && break;; esac echo "$resp is not a useable loginname." done user=$resp while :; do ask "Full name for user $user?" $user case $resp in *[:\&,]*) echo "':', '&' or ',' are not allowed.";; *) ((${#resp} <= 100)) && break echo "Too long.";; esac done username=$resp askpassword "Password for user $user?" userpass=$_password userkey= $AUTO && ask "Public ssh key for user $user" none && [[ $resp != none ]] && userkey=$resp if [[ $sshd == y ]]; then ask_yn "Since you set up a user, disable sshd(8) logins to root?" yes sshd_disableroot=$resp fi } function ask_until { resp= while true; do ask "$1" "$2" [[ -n $resp ]] && break echo "A response is required." $AUTO && exit 1 done } ask_yn() { local _q=$1 _a=${2:-no} typeset -l _resp while :; do ask "$_q" "$_a" _resp=$resp case $_resp in y|yes) resp=y; return 0;; n|no) resp=n; return 1;; esac echo "'$resp' is not a valid choice." $AUTO && exit 1 done } ask_which() { local _name=$1 _query=$2 _list=$3 _def=$4 _dynlist _dyndef _key _q _key=$(echo "$_name" | sed 's/[^[:alnum:]]/_/g') while :; do eval "_dynlist=\"$_list\"" eval "_dyndef=\"$_def\"" set -o noglob set -- $_dyndef; _dyndef="$1" set -- $_dynlist; _dynlist="$*" set +o noglob (($# < 1)) && resp=done && return : ${_dyndef:=$1} echo "Available ${_name}s are: $_dynlist." _q="Which $_name $_query?" echo -n "$_q (or 'done') ${_dyndef:+[$_dyndef] }" _autorespond "$_q" "${_dyndef-done}" && echo "$resp" \ || _ask || continue [[ -z $resp ]] && resp="$_dyndef" isin "$resp" $_dynlist done && break echo "'$resp' is not a valid choice." $AUTO && [[ -n $RESPFILE ]] && exit 1 done } isin() { local _a=$1 _b shift for _b; do [[ $_a == $_b ]] && return 0 done return 1 } addel() { local _a=$1 shift echo -n "$*" isin "$_a" $* || echo -n " $_a" } rmel() { local _a=$1 _b shift for _b; do [[ $_a != $_b ]] && echo -n "$_b " done } bsort() { local _l _a=$1 _b (($# > 0)) || return shift for _b; do if [[ $_a != $_b ]]; then if [[ $_a > $_b ]]; then _l="$_a $_l"; _a=$_b else _l="$_b $_l" fi fi done echo -n "$_a " bsort $_l } showcols() { local _l _cdir=/tmp/cdir set -A _clist mkdir -p $_cdir rm -rf -- $_cdir/* while read _l; do [[ -n $_l ]] || continue mkdir -p /tmp/cdir/"$_l" _clist[${#_clist[*]}]="$_l" done (cd $_cdir; ls -Cdf "${_clist[@]}") rm -rf -- $_cdir } makedev() { [[ -z $(cd /dev && sh MAKEDEV "$@" 2>&1) ]] } addhostent() { local _addr=$1 _name=$2 _delim="." [[ -z $_addr || -z $_name ]] && return [[ $_addr == *:* ]] && _delim=":" sed "/^[0-9a-fA-F]*[$_delim].*[ ]$_name\$/d" /tmp/hosts \ >/tmp/hosts.new 2>/dev/null mv /tmp/hosts.new /tmp/hosts echo "$_addr $_name" >>/tmp/hosts } select_sets() { local _avail=$1 _selected=$2 _f _action _col=$COLUMNS let COLUMNS=_col-8 cat <<__EOT Select sets by entering a set name, a file name pattern or 'all'. De-select sets by prepending a '-' to the set name, file name pattern or 'all'. Selected sets are labelled '[X]'. __EOT while :; do for _f in $_avail; do isin $_f $_selected && echo "[X] $_f" || echo "[ ] $_f" done | showcols | sed 's/^/ /' ask "Set name(s)? (or 'abort' or 'done')" done set -o noglob for resp in $resp; do case $resp in abort) _selected=; break 2;; done) break 2;; -*) _action=rmel;; *) _action=addel;; esac resp=${resp#[+-]} [[ $resp = all ]] && resp=* for _f in $_avail; do [[ $_f = $resp ]] && _selected=$($_action $_f $_selected) done done done set +o noglob COLUMNS=$_col resp=$_selected } configure_ifs() { local _first _ifdevs _ifs _name _hn _vl=0 _vd _vi _p _tags while :; do _vd=$(ifconfig vlan$_vl 2>&1) [[ $_vd == @(*no such interface*) ]] && break [[ $_vd == @(*vlan: +([[:digit:]]) parent interface:*) ]] || break ((_vl++)) done _vd= ifconfig lo0 inet 127.0.0.1/8 rm -f /tmp/mygate while :; do ifconfig vlan$_vl create >/dev/null 2>&1 ask_which "network interface" "do you wish to configure" \ '$(get_ifdevs)' \ ${_p:-'$( (get_ifdevs netboot; get_ifdevs) | sed q )'} [[ $resp == done ]] && break _ifs=$resp _hn=/tmp/hostname.$_ifs rm -f $_hn if [[ $_ifs == vlan+([0-9]) ]]; then _vi=$(ifconfig $_ifs 2>/dev/null | sed -n 's/vlan: \([0-9]*\).*/\1/p') _tags=$(ifconfig vlan 2>/dev/null | sed -n 's/vlan: \([0-9]*\).*/\1/p') [[ -n $_tags ]] && _tags=$(rmel "$_vi" $_tags) if [[ -z $_vi ]]; then _vi=0 while ((++_vi < 4096)); do ! isin "$_vi" $_tags && break done fi _ifdevs=$(get_ifdevs) set -- $_ifdevs while [[ $1 == vlan+([0-9]) ]]; do shift done ask "Which interface:tag should $_ifs be on?" "${_vd:=$1}:$_vi" _vd=${resp%%:*} _vi=${resp##*:} if ! (isin "$_vd" $_ifdevs && [[ $_vd != vlan+([0-9]) ]]); then echo "Invalid interface choice '$_vd'" _vd= continue fi if ((_vi < 1 || _vi > 4095)) || isin "$_vi" $_tags; then echo "Invalid or in-use vlan tag '$_vi'" continue fi grep -qs "^up" /tmp/hostname.$_vd || echo "up" >>/tmp/hostname.$_vd chmod 640 /tmp/hostname.$_vd ifconfig $_vd up ifconfig $_ifs destroy >/dev/null 2>&1 ifconfig $_ifs vlan $_vi vlandev $_vd echo "vlan $_vi vlandev $_vd" >>$_hn [[ ${_ifs##vlan} == $_vl ]] && ((_vl++)) fi ifconfig $_ifs 2>/dev/null | grep -q "^[[:space:]]*ieee80211:" && ieee80211_config $_ifs $_hn resp=$(hostname -s) [[ -n $_first && $_first != $_ifs ]] && ask "Symbolic (host) name for $_ifs?" $resp _name=$resp v4_config $_ifs $_name $_hn v6_config $_ifs $_name $_hn if [[ -f $_hn ]]; then chmod 640 $_hn : ${_first:=$_ifs} fi NIFS=$(ls -1 /tmp/hostname.* 2>/dev/null | grep -c ^) _p=done done } v4_info() { ifconfig $1 inet | sed -n ' 1s/.*/dev/null /sbin/dhclient "$@" } dhcp_request() { local _ifs=$1 _hn=$2 echo "lookup file bind" >/etc/resolv.conf.tail echo "send host-name \"$_hn\";" >/etc/dhclient.conf ifconfig $_ifs group dhcp >/dev/null 2>&1 dhclient -c /dev/stdin $_ifs << __EOT initial-interval 1; backoff-cutoff 2; reboot 5; timeout 10; send host-name "$_hn"; __EOT mv /etc/dhclient.conf /tmp/dhclient.conf mv /etc/resolv.conf.tail /tmp/resolv.conf.tail } hextodec() { local _d _b for _b in $(echo ${1#0x} | sed 's/\(..\)/\1 /g'); do _d=$_d.$((0x$_b)) done echo ${_d#.} } ieee80211_scan() { [[ -f $WLANLIST ]] || ifconfig $1 scan | sed -n 's/^ nwid \([^"]\)/\1/p' >$WLANLIST cat $WLANLIST } ieee80211_config() { local _ifs=$1 _hn=$2 _prompt _nwid _haswpa=0 _err ifconfig $_ifs -nwid -nwkey ifconfig $_ifs -wpa 2>/dev/null && _haswpa=1 rm -f $WLANLIST while [[ -z $_nwid ]]; do ask_until "Access point? (ESSID, 'any', list# or '?')" "any" case "$resp" in +([0-9])) _nwid=$(ieee80211_scan $_ifs | sed -n "${resp}s/ .*//p") [[ -z $_nwid ]] && echo "There is no line $resp." ;; \?) ieee80211_scan $_ifs | sed -n 's/^\([^ ]*\) chan .* bssid \([^ ]*\) .*$/ \1 (\2)/p' | less -XEN ;; *) _nwid=$resp;; esac done if [[ $_nwid != any ]]; then ifconfig $_ifs nwid "$_nwid" quote nwid "$_nwid" >>$_hn _prompt="Security protocol? (O)pen, (W)EP" ((_haswpa == 1)) && _prompt="$_prompt, WPA-(P)SK" while :; do ask_until "$_prompt" "O" case "$_haswpa-$resp" in ?-[Oo]) break ;; ?-[Ww]) ask_until "WEP key? (will echo)" if _err=$(ifconfig $_ifs nwkey "$resp" 2>&1) && [[ -z $_err ]]; then quote nwkey "$resp" >>$_hn break fi echo "$_err" ;; 1-[Pp]) ask_until "WPA passphrase? (will echo)" if ifconfig $_ifs wpakey "$resp"; then quote wpakey "$resp" >>$_hn break fi ;; *) echo "'$resp' is not a valid choice." ;; esac done fi } v4_config() { local _ifs=$1 _name=$2 _hn=$3 _prompt _addr _mask if ifconfig $_ifs | grep -q 'groups:.* dhcp'; then _addr=dhcp else set -- $(v4_info $_ifs) if [[ -n $2 ]]; then _addr=$2; _mask=$(hextodec $3) ifconfig $_ifs inet $_addr delete fi fi if [[ -x /sbin/dhclient ]]; then _prompt="or 'dhcp' " ifconfig dhcp >/dev/null 2>&1 || _addr=dhcp fi _prompt="IPv4 address for $_ifs? (${_prompt}or 'none')" ask_until "$_prompt" "$_addr" case $resp in none) ;; dhcp) if [[ ! -x /sbin/dhclient ]]; then echo "DHCP not possible - no /sbin/dhclient." else dhcp_request $_ifs "$_name" echo "dhcp" >>$_hn fi ;; *) _addr=$resp ask_until "Netmask for $_ifs?" "${_mask:=255.255.255.0}" ifconfig $_ifs -group dhcp >/dev/null 2>&1 if ifconfig $_ifs inet $_addr netmask $resp up; then addhostent "$_addr" "$_name" echo "inet $_addr $resp" >>$_hn fi ;; esac } v6_config() { local _ifs=$1 _name=$2 _hn=$3 _addr _prefixlen _prompt ifconfig lo0 inet6 >/dev/null 2>&1 || return set -- $(v6_info $_ifs) [[ -n $2 ]] && { _addr=$2; _prefixlen=$3; } ifconfig $_ifs inet6 >/dev/null 2>&1 && _prompt="or 'rtsol' " _prompt="IPv6 address for $_ifs? (${_prompt}or 'none')" ask_until "$_prompt" "${_addr:-none}" case $resp in none) return ;; rtsol) ifconfig $_ifs inet6 >/dev/null 2>&1 || { echo "No INET6 support."; return; } ifconfig $_ifs up ifconfig $_ifs inet6 autoconf && echo "up\nrtsol" >>$_hn return ;; esac _addr=$resp ask_until "IPv6 prefix length for $_ifs?" "${_prefixlen:=64}" ifconfig $_ifs inet6 $_addr prefixlen $resp up || return echo "inet6 $_addr $resp" >>$_hn addhostent "$_addr" "$_name" v6_defroute $_ifs } v4_defroute() { local _dr _prompt=" or 'none'" [[ -n $(ifconfig | sed -n '/[ ]inet .* broadcast /p') ]] || return [[ -f /tmp/dhclient.conf && $NIFS == 1 ]] && return [[ -x /sbin/dhclient ]] && _prompt=", 'dhcp'$_prompt" _prompt="Default IPv4 route? (IPv4 address$_prompt)" _dr=$(route -n show -inet | sed -n '/^default */{s///; s/ .*//; p;}') [[ -f /tmp/dhclient.conf ]] && _dr=dhcp while :; do ask_until "$_prompt" "$_dr" [[ $resp == @(none|dhcp) ]] && break route delete -inet default >/dev/null 2>&1 route -n add -inet -host default "$resp" && { echo "$resp" >>/tmp/mygate; break; } route -n add -inet -host default $_dr >/dev/null 2>&1 done } v6_defroute() { local _if=$1 _prompt _resp _routers route -n show -inet6 | egrep -q '^default[[:space:]]' && return _routers=$(bsort $(ping6 -n -c 2 ff02::2%$_if 2>/dev/null | sed -n '/bytes from/{s/^.*from //;s/,.*$//;p;}' | sed -n 'G;s/\n/&&/;/^\(.*\n\).*\n\1/d;h;P')) _prompt="IPv6 default router?" if $AUTO; then _autorespond "$_prompt" && _resp=$resp && echo "$_prompt $_resp" else local PS3="$_prompt (${_routers:+list #, }IPv6 address or 'none'): " select _resp in $_routers; do [[ ${_resp:=$REPLY} == *:* ]] && break [[ $_resp == none ]] && return done fi route -n add -inet6 -host default "$_resp" && echo "$_resp" >>/tmp/mygate } ifstart () { local _hn=$1 if=${1#/mnt/etc/hostname.} ((NIFS++)) while :; do if [ "$cmd2" ]; then set -- $cmd2 af=$1 name=$2 mask=$3 bcaddr=$4 ext1=$5 cmd2= i=1 while [ i -lt 6 -a -n "$1" ]; do shift; let i=i+1; done ext2="$@" else read af name mask bcaddr ext1 ext2 || break fi case "$af" in "#"*|"!"*|"bridge"|"") continue ;; "dhcp") [ "$name" = "NONE" ] && name= [ "$mask" = "NONE" ] && mask= [ "$bcaddr" = "NONE" ] && bcaddr= dhcpif="$dhcpif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 down" if [[ -x /sbin/dhclient ]]; then cmd="$cmd; dhclient $if" else cmd="$cmd; echo /sbin/dhclient missing - skipping dhcp request." fi ;; "rtsol") if ifconfig $if inet6 >/dev/null 2>&1; then rtsolif="$rtsolif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" else cmd="$cmd; echo no INET6 support - skipping rtsol request." fi ;; *) read dt dtaddr if [ "$name" = "alias" ]; then alias=$name name=$mask mask=$bcaddr bcaddr=$ext1 ext1=$ext2 ext2= else alias= fi cmd="ifconfig $if $af $alias $name" case "$dt" in dest) cmd="$cmd $dtaddr" ;; *) cmd2="$dt $dtaddr" ;; esac case $af in inet) if [ ! -n "$name" ]; then echo "/etc/hostname.$if: inet alone is invalid" return fi [ "$mask" ] && cmd="$cmd netmask $mask" if [ "$bcaddr" -a X"$bcaddr" != "XNONE" ]; then cmd="$cmd broadcast $bcaddr" fi [ "$alias" ] && rtcmd=";route -qn add -host $name 127.0.0.1" ;; inet6) if [ ! -n "$name" ]; then echo "/etc/hostname.$if: inet6 alone is invalid" return fi [ "$mask" ] && cmd="$cmd prefixlen $mask" cmd="$cmd $bcaddr" ;; *) cmd="$cmd $mask $bcaddr" ;; esac cmd="$cmd $ext1 $ext2$rtcmd" rtcmd= ;; esac eval "$cmd" done <$_hn } enable_network() { local _f _gw _trunks _svlans _vlans for _f in dhclient.conf resolv.conf resolv.conf.tail; do if [ -f /mnt/etc/$_f ]; then cp /mnt/etc/$_f /etc/$_f fi done ifconfig lo0 inet 127.0.0.1/8 for hn in /mnt/etc/hostname.*; do if=${hn#/mnt/etc/hostname.} if isin ${if%%+([0-9])} $(ifconfig -C); then case ${if%%+([0-9])} in trunk) _trunks="$_trunks $hn" ;; svlan) _svlans="$_svlans $hn" ;; vlan) _vlans="$_vlans $hn" ;; esac else ifconfig $if >/dev/null 2>&1 && ifstart $hn fi done for hn in $_trunks $_svlans $_vlans; do ifstart $hn done [[ -n $rtsolif ]] && ifconfig $rtsolif inet6 autoconf [[ -z $dhcpif ]] && stripcom /mnt/etc/mygate | while read _gw; do [[ $_gw == @(*:*) ]] && continue route -qn delete default >/dev/null 2>&1 route -qn add -host default $_gw && break done [[ -z $rtsolif ]] && stripcom /mnt/etc/mygate | while read _gw; do [[ $_gw == !(*:*) ]] && continue route -qn delete -inet6 default >/dev/null 2>&1 route -qn add -host -inet6 default $_gw && break done route -qn add -net 127 127.0.0.1 -reject >/dev/null } install_files() { local _src=$1 _files=$2 _f _sets _get_sets _n _col=$COLUMNS \ _tmpfs _tmpsrc _cfile _fsrc _unver _t _issue _srclocal for _f in $THESETS; do isin $_f $_files || continue; _sets=$(addel $_f $_sets) [[ -z $DISPLAY && ! -d /mnt/etc/X11 ]] && isin ${_f%${VERSION}.tgz} xbase xshare xfont xserv && continue isin $_f $DEFAULTSETS "site$VERSION-$(hostname -s).tgz" && _get_sets=$(addel $_f $_get_sets) done if [[ -z $_sets ]]; then echo -n "Looked at $_src " echo "and found no $OBSD sets. The set names looked for were:" let COLUMNS=_col-8 for _n in $THESETS; do echo $_n; done | showcols | sed 's/^/ /' COLUMNS=$_col $AUTO && exit 1 echo return fi isin INSTALL.$ARCH $_files || ask_yn "INSTALL.$ARCH not found. Use sets found here anyway?" || return select_sets "$_sets" "$_get_sets" [[ -n $resp ]] || return _get_sets=$resp _get_sets=$(for s in $THESETS; do isin $s $_get_sets && echo $s; done) _unver=$_get_sets for _issue in ''; do ! isin SHA256.sig $_files && _issue="Directory does not contain SHA256.sig" && break _tmpfs=$( ( for fs in /mnt/{{,var/}tmp,home,usr{/local,}}; do df -k $fs 2>/dev/null | grep " $fs\$" done df -k ) | ( while read a a a a m m; do [[ $m == /mnt/@(@(|var/)tmp|home|usr/@(src,obj,xobj))@(|/*) ]] && ((a > 524288)) && echo $m && exit [[ $m == /mnt@(|/*) ]] && ((a > 524288 * 4)) && echo $m && exit done ) ) if [[ -d $_tmpfs ]]; then ! _tmpsrc=$(tmpdir "$_tmpfs/sets") && _issue="Cannot create prefetch area" && break else _issue="Cannot determine prefetch area" && break fi _cfile=$_tmpsrc/SHA256 _srclocal=false _t=Get/Verify [[ $_src == file://* ]] && _srclocal=true _t='Verifying ' ! ftp -D "$_t" -Vmo "$_cfile.sig" "$_src/SHA256.sig" && _issue="Cannot fetch SHA256.sig" && break ! signify -Vep /etc/signify/openbsd-${VERSION}-base.pub \ -x "$_cfile.sig" -m "$_cfile" && _issue="Signature check of SHA256.sig failed" && break for _f in $_get_sets; do rm -f "$_tmpsrc/h" "$_tmpsrc/fail" ( ftp -D "$_t" -Vmo - "$_src/$_f" || >"$_tmpsrc/fail" ) | ( $_srclocal && sha256 >$_tmpsrc/h || sha256 -ph "$_tmpsrc/h" >"$_tmpsrc/$_f" ) if [[ -f $_tmpsrc/fail ]]; then rm -f "$_tmpsrc/$_f" if ! ask_yn "Fetching of $_f failed. Continue anyway?"; then [[ -d $_tmpsrc ]] && rm -rf "$_tmpsrc" $AUTO && exit 1 return fi continue fi if fgrep -qx "SHA256 ($_f) = $(<$_tmpsrc/h)" "$_cfile"; then _unver=$(rmel $_f $_unver) else if ! ask_yn "Checksum test for $_f failed. Continue anyway?"; then [[ -d $_tmpsrc ]] && rm -rf "$_tmpsrc" $AUTO && exit 1 return fi fi done done [[ -n $_unver ]] && : ${_issue:="Unverified sets:" ${_unver% }} if [[ -n $_issue ]] && ! ask_yn "$_issue. Continue without verification?"; then [[ -d $_tmpsrc ]] && rm -rf "$_tmpsrc" $AUTO && exit 1 return fi [[ $MODE == upgrade ]] && rm -rf /mnt/var/tmp for _f in $_get_sets; do _fsrc="$_src/$_f" [[ -f $_tmpsrc/$_f ]] && _fsrc="file://$_tmpsrc/$_f" case $_fsrc in *.tgz) ftp -D Installing -Vmo - "$_fsrc" | tar -zxphf - -C /mnt if [[ $_f == ?(x)base*.tgz && $MODE == install ]]; then ftp -D Extracting -Vmo - \ file:///mnt/usr/share/sysmerge/${_f%%base*}etc.tgz | tar -zxphf - -C /mnt fi;; *) ftp -D Installing -Vmo "/mnt/$_f" "$_fsrc";; esac if (($?)); then if ! ask_yn "Installation of $_f failed. Continue anyway?"; then [[ -d $_tmpsrc ]] && rm -rf "$_tmpsrc" $AUTO && exit 1 return fi else DEFAULTSETS=$(rmel $_f $DEFAULTSETS) GOTSETS="$GOTSETS $_f" fi [[ -d $_tmpsrc ]] && rm -f "$_tmpsrc/$_f" done [[ -d $_tmpsrc ]] && rm -rf "$_tmpsrc" } startcgiinfo() { ((NIFS < 1)) && return set -m ( ftp -Vao - "http://129.128.5.191/cgi-bin/ftplist.cgi?path=$HTTP_SETDIR" \ 2>/dev/null >$CGI_INFO echo -n $SECONDS >$HTTP_SEC feed_random ) & CGIPID=$! set +m (sleep 12; kill -INT -$CGIPID >/dev/null 2>&1) & } waitcgiinfo() { wait "$CGIPID" 2>/dev/null [[ -s $CGI_INFO ]] || return sed -n "s,^http://"'\([[A-Za-z0-9\:_][]A-Za-z0-9:._-]*\),\1,p' \ $CGI_INFO >$HTTP_LIST 2>/dev/null set -- $(sed q $HTTP_LIST) : ${HTTP_SERVER:=${1%%/*}} CGI_METHOD=$(sed -n '/^method=/s///p' $CGI_INFO 2>/dev/null) CGI_TZ=$(sed -n '/^TZ=/s///p' $CGI_INFO 2>/dev/null) CGI_TIME=$(sed -n '/^TIME=/s///p' $CGI_INFO 2>/dev/null) } http_time() { local _sec=$(cat $HTTP_SEC 2>/dev/null) [[ -n $_sec && -n $CGI_TIME ]] && echo $((CGI_TIME + SECONDS - _sec)) } install_http() { local _file_list _prompt _mirror _url_base waitcgiinfo ask "HTTP proxy URL? (e.g. 'http://proxy:8080', or 'none')" \ "${http_proxy:-none}" unset http_proxy [[ $resp == none ]] || export http_proxy=$resp if [[ -s $HTTP_LIST ]]; then _prompt="HTTP Server? (hostname, list#, 'done' or '?')" else echo "(Unable to get list from ftp.openbsd.org, but that is OK)" _prompt="HTTP Server? (hostname or 'done')" fi while :; do ask_until "$_prompt" "$HTTP_SERVER" case $resp in done) return;; "?") [[ -s $HTTP_LIST ]] || continue less -XEN < $HTTP_LIST ;; +([0-9])) [[ -s $HTTP_LIST ]] || continue set -- $(sed -n "${resp}p" $HTTP_LIST) (($# < 1)) && { echo "There is no line $resp."; continue; } HTTP_SERVER=${1%%/*} ;; +([A-Za-z0-9\:.\[\]_-])) HTTP_SERVER=$resp break ;; *) echo "'$resp' is not a valid hostname." ;; esac done set -- $(sed "/^$HTTP_SERVER/x;\$!d;x" $HTTP_LIST 2>/dev/null) resp=${1#*/} [[ $resp == "$1" ]] && resp= if (($# > 1)); then resp=$resp/$HTTP_SETDIR _mirror=yes fi : ${HTTP_DIR:=pub/OpenBSD/$HTTP_SETDIR} ask_until "Server directory?" "${resp:-$HTTP_DIR}" HTTP_DIR=$resp _url_base="http://$HTTP_SERVER/$HTTP_DIR" _file_list=$(ftp -Vo - "$_url_base/index.txt" | sed 's/^.* //' | sed 's/ //') install_files "$_url_base" "$_file_list" INSTALL=$_url_base PACKAGE_PATH= if [[ -n $_mirror ]]; then PACKAGE_PATH=$(print -r -- "$_url_base" | sed -E "/\/(snapshots|[0-9]\.[0-9])\/($ARCH)\/*$/!d s!!/\1/packages/$(arch -s)/!;q") fi } install_mounted_fs() { local _dir while :; do ask_until "Pathname to the sets? (or 'done')" "$SETDIR" [[ $resp == done ]] && return [[ -d /mnt2/$resp ]] && { _dir=/mnt2/$resp; break; } [[ -d /mnt/$resp ]] && { _dir=/mnt/$resp; break; } [[ -d /$resp ]] && { _dir=/$resp; break; } echo "The directory '$resp' does not exist." $AUTO && exit 1 done install_files "file://$_dir" "$(ls $_dir/)" } install_cdrom() { get_drive "CD-ROM" '$(get_cddevs)' || return mount_mnt2 $resp || return install_mounted_fs } install_disk() { if ! ask_yn "Is the disk partition already mounted?"; then get_drive "disk" '$(bsort $(get_dkdevs))' \ '$(bsort $(rmel $ROOTDISK $(get_dkdevs)))' || return mount_mnt2 $resp || return fi install_mounted_fs } install_nfs() { local _tcp ask_until "Server IP address or hostname?" "$NFS_ADDR" NFS_ADDR=$resp ask_until "Filesystem on server to mount?" "$NFS_PATH" NFS_PATH=$resp ask_yn "Use TCP transport? (requires TCP-capable NFS server)" && _tcp=-T mount_nfs $_tcp -o ro -R 5 $NFS_ADDR:$NFS_PATH /mnt2 || return install_mounted_fs } set_timezone() { local _zonefile=$1 _zonepath _zsed _tz _zoneroot=/usr/share/zoneinfo [[ ! -f $_zonefile ]] && return [[ -n $TZ ]] && return if [[ -h /mnt/etc/localtime ]]; then TZ=$(ls -l /mnt/etc/localtime 2>/dev/null) TZ=${TZ#*${_zoneroot#/mnt}/} fi waitcgiinfo if [[ -n $CGI_TZ ]]; then _tz=$CGI_TZ [[ -n $_tz ]] && isin "$_tz" `cat $_zonefile` && TZ=$_tz fi [[ $_zonefile = /var/tzlist && -z $TZ ]] && return while :; do ask "What timezone are you in? ('?' for list)" "$TZ" _zonepath=${resp%%*(/)} case $_zonepath in "") continue;; "?") grep -v /. $_zonefile | showcols continue;; esac while isin "$_zonepath/" $(cat $_zonefile); do ask "What sub-timezone of '$_zonepath' are you in? ('?' for list)" _zsed=$(echo $_zonepath/ | sed 's,/,\\/,g') resp=${resp%%*(/)} case $resp in "") ;; "?") sed -n "/^$_zsed/{s/$_zsed//;/\/./!p;}" $_zonefile | showcols;; *) _zonepath=$_zonepath/$resp;; esac done if isin "$_zonepath" $(cat $_zonefile); then TZ=${_zonepath#$_zoneroot} return fi echo -n "'${_zonepath}'" echo " is not a valid timezone on this system." done } sane_install() { local _q=$1 _s for _s in $SANESETS; do isin $_s $DEFAULTSETS || continue [[ -n $_q ]] && return 1 if ! ask_yn "Are you *SURE* your $MODE is complete without '$_s'?"; then $AUTO && exit 1 || return 1 fi done } install_sets() { local _d _locs="disk http" echo _d=$CGI_METHOD ifconfig netboot >/dev/null 2>&1 && : ${_d:=http} [[ -n $(get_cddevs) ]] && { _locs="cd $_locs"; : ${_d:=cd}; } [[ -x /sbin/mount_nfs ]] && _locs="$_locs nfs" : ${_d:=http} if ! isin "$_d" $_locs; then for a in http cd nfs disk; do isin $a $_locs && _d=$a && break done fi echo "Let's $MODE the sets!" while :; do umount -f /mnt2 >/dev/null 2>&1 ask "Location of sets? ($_locs or 'done')" "$_d" case $resp in done) sane_install && return;; c*|C*) isin cd $_locs && install_cdrom && METHOD=cd;; d*|D*) install_disk && METHOD=disk;; h*|H*) isin http $_locs && install_http && METHOD=http;; n*|N*) isin nfs $_locs && install_nfs && METHOD=nfs;; *) $AUTO && echo "'$resp' is not a valid choice." && exit 1;; esac [[ -n $METHOD ]] && _d=$METHOD sane_install quiet || $AUTO && _d=done done } update_firmware() { echo "/usr/sbin/fw_update -v" >>/mnt/etc/rc.firsttime } munge_fstab() { local _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do [[ $_dev == @(/dev/vnd*|\#*) || $_fstype == nfs || ! -f /sbin/mount_$_fstype || $_opt == *noauto* || $_opt == *xx* ]] && continue _opt=$(echo $_opt | sed 's/softdep//') [[ $_fstype == ffs ]] && _opt=$(echo $_opt | sed 's/[[:<:]]ro[[:>:]]/rw/') [[ $_fstype == ffs ]] || _opt=$(echo $_opt | sed 's/[[:<:]]rw[[:>:]]/ro/') echo $_dev /mnt${_mp%/} $_fstype $_opt $_rest done /etc/fstab if [[ ! -s /etc/fstab ]]; then echo "Unable to create valid /etc/fstab." exit fi } mount_fs() { local _async=$1 _dev _mp _fstype _opt _rest _msg _fail while read _dev _mp _fstype _opt _rest; do [[ $_mp == /mnt ]] || mkdir -p $_mp _msg=$(mount -v -t $_fstype $_async -o $_opt $_dev $_mp) || _fail="$_fail\n$_mp ($_dev)" echo $_msg | sed 's/, ctime=[^,)]*//' done 0)) || continue echo -n "fsck -${_f}p $_dev..." if ! fsck -${_f}p $_dev >/dev/null 2>&1; then echo "FAILED. You must fsck $_dev manually." _fail=y else echo "OK." fi done /tmp/resolv.conf for _ns in $resp; do echo "nameserver $_ns" >>/tmp/resolv.conf done cp /tmp/resolv.conf /tmp/resolv.conf.shadow fi } apply() { [[ $sshd == n ]] && echo "sshd_flags=NO" >>/mnt/etc/rc.conf.local if [[ $sshd_disableroot == y ]]; then sed "/^#\(PermitRootLogin\) yes/s//\1 no/" \ < /mnt/etc/ssh/sshd_config >/tmp/sshd_config cp /tmp/sshd_config /mnt/etc/ssh/sshd_config fi if [[ $ntpd == y ]]; then echo "ntpd_flags=" >>/mnt/etc/rc.conf.local [[ $ntpd_server == default ]] && ntpd_server=pool.ntp.org echo "servers ${ntpd_server%% *}" >>/mnt/etc/ntpd.conf fi [[ -n $aperture ]] && echo "machdep.allowaperture=$aperture # See xf86(4)" \ >>/mnt/etc/sysctl.conf [[ $xdm == y && -x /mnt/usr/X11R6/bin/xdm ]] && echo "xdm_flags=" >>/mnt/etc/rc.conf.local if [[ $defcons == y ]]; then cp /mnt/etc/ttys /tmp/ttys sed -e "/^$CTTY/s/std.9600/std.${CSPEED}/" \ -e "/^$CTTY/s/unknown/vt220 /" \ -e "/$CTTY/s/off.*/on secure/" /tmp/ttys >/mnt/etc/ttys [[ -n $CPROM ]] && echo "stty $CPROM $CSPEED\nset tty $CPROM" >>/mnt/etc/boot.conf fi ln -sf /usr/share/zoneinfo/$TZ /mnt/etc/localtime } questions() { local _d _cdef=no ask_yn "Start sshd(8) by default?" yes sshd=$resp ask_yn "Start ntpd(8) by default?" ntpd=$resp if [[ $resp == y ]]; then ask "NTP server? (hostname or 'default')" default ntpd_server=$resp fi aperture= xdm= if [[ -n $DISPLAY ]]; then if [[ -n $(scan_dmesg '/^[a-z]*[01]: aperture needed/p') ]]; then ask_yn "Do you expect to run the X Window System?" yes && aperture=$MDXAPERTURE fi if [[ -n $MDXDM ]]; then ask_yn "Do you want the X Window System to be started by xdm(1)?" xdm=$resp fi fi if [[ -n $CDEV ]]; then _d=${CPROM:-$CDEV} [[ -n $CONSOLE ]] && _cdef=yes ask_yn "Change the default console to $_d?" $_cdef defcons=$resp if [[ $resp == y ]]; then ask_which "speed" "should $_d use" \ "9600 19200 38400 57600 115200" $CSPEED case $resp in done) defcons=n;; *) CSPEED=$resp;; esac fi fi } feed_random() { (dmesg; cat $CGI_INFO /*.conf; sysctl; route -n show; df; ifconfig -A; hostname) >/dev/random 2>&1 if [[ -e /mnt/var/db/host.random ]]; then dd if=/mnt/var/db/host.random of=/dev/random bs=65536 count=1 \ status=none fi } store_random() { dd if=/dev/random of=/mnt/var/db/host.random bs=65536 count=1 \ status=none dd if=/dev/random of=/mnt/etc/random.seed bs=512 count=1 status=none chmod 600 /mnt/var/db/host.random /mnt/etc/random.seed } finish_up() { local _dev _mp _fstype _rest if [[ -x /mnt/sbin/swapctl ]]; then /mnt/sbin/swapctl -a /dev/$SWAPDEV >/dev/null 2>&1 while read _dev _mp _fstype _rest; do [[ $_fstype == swap ]] && /mnt/sbin/swapctl -a $_dev >/dev/null 2>&1 done $/\1/p') md_installboot $ROOTDISK if [[ -f /mnt/bsd.mp ]] && ((NCPU > 1)); then echo "Multiprocessor machine; using bsd.mp instead of bsd." mv /mnt/bsd /mnt/bsd.sp 2>/dev/null mv /mnt/bsd.mp /mnt/bsd fi update_firmware store_random cat <<__EOT CONGRATULATIONS! Your OpenBSD $MODE has been successfully completed! To boot the new system, enter 'reboot' at the command prompt. __EOT [[ $MODE == install ]] && cat <<__EOT When you login to your new system the first time, please read your mail using the 'mail' command. __EOT md_congrats [[ $MODE == upgrade ]] && \ echo "After rebooting, run sysmerge(8) to update your system configuration." $AUTO && >/ai.done } ROOTDISK= ROOTDEV= PACKAGE_PATH= SETDIR="$VNAME/$ARCH" CGI_INFO=/tmp/cgiinfo CGI_TZ= CGI_TIME= CGI_METHOD= INSTALL= METHOD= HTTP_DIR= HTTP_SEC=/tmp/httpsec HTTP_LIST=/tmp/httplist WLANLIST=/tmp/wlanlist FSTABFLAG=-f for _opt in d f l m n p s; do ulimit -$_opt unlimited done dmesg | sed -n '/^OpenBSD /h;/^OpenBSD /!H;${g;p;}' >/var/run/dmesg.boot HTTP_SETDIR=$SETDIR set -- $(scan_dmesg "/^OpenBSD $VNAME\([^ ]*\).*$/s//\1/p") [[ $1 == -!(stable) ]] && HTTP_SETDIR=snapshots/$ARCH MTDEVS=$(scan_dmesg "${MDMTDEVS:-/^[cms]t[0-9][0-9]* /s/ .*//p}") NIFS=0 DISPLAY=$(scan_dmesg '/^wsdisplay[0-9]* /s/ .*//p') CONSOLE=$(scan_dmesg '/^\([^ ]*\).*: console$/s//\1/p') CONSOLE=${CONSOLE% } [[ -n $CONSOLE ]] && CSPEED=$(stty speed /dev/null 2>&1 for _ifs in $(get_ifdevs dhcp); do set -- $(v4_info $_ifs) [[ $1 == UP && -n $2 ]] && continue ifconfig $_ifs delete down -group dhcp 2>/dev/null done get_responsefile() { local _rf _ifdev _mac _mode _server _lf action= [[ -f /auto_upgrade.conf ]] && _rf=/auto_upgrade.conf _mode=upgrade [[ -f /auto_install.conf ]] && _rf=/auto_install.conf _mode=install [[ -f $_rf ]] && cp $_rf /ai.$_mode.conf && action=$_mode && return for _ifdev in ''; do [[ -x /sbin/dhclient ]] || break set -- $(get_ifdevs netboot) (($# == 0)) && set -- $(get_ifdevs) (($# == 1)) && _ifdev=$1 while (($# > 1)); do ask_which "network interface" \ "should be used for the initial DHCP request" "$*" isin "$resp" $* && _ifdev=$resp && break done [[ -n $_ifdev ]] && dhclient $_ifdev || break _lf=/var/db/dhclient.leases.$_ifdev _server=$(sed "/^ *next-server /!d;s///;s/;$//;q" $_lf) _mode=$(sed -E '/^ *filename "auto_(install|upgrade)";$/!d;s//\1/;q' $_lf) hostname "$(sed -E '/^ *option host-name "(.*)";$/!d;s//\1/;q' $_lf)" done if [[ -n $_server && -n $_mode ]]; then _mac=$(ifconfig $_ifdev | sed 's/.*lladdr \(.*\)/\1/p;d') for _rf in {$_mac-,}$_mode; do _url=http://$_server/$_rf.conf echo "Fetching $_url" if ftp -Vo "/ai.$_mode.conf" "$_url" 2>/dev/null; then action=$_mode ifconfig $_ifdev delete down 2>/dev/null return 0 fi done else [[ -z $_server ]] && echo "Could not determine next-server." [[ -z $_mode ]] && echo "Could not determine auto mode." fi while :; do ask "Response file location?" \ "${_server:+http://$_server/install.conf}" [[ -n $resp ]] && _rf=$resp && break done _mode=$(echo "$_rf" | sed -En 's/^.*(install|upgrade).conf$/\1/p') while [[ -z $_mode ]]; do ask "(I)nstall or (U)pgrade?" [[ $resp == [iI]* ]] && _mode=install [[ $resp == [uU]* ]] && _mode=upgrade done echo "Fetching $_rf" [[ -f $_rf ]] && _rf="file://$_rf" ftp -Vo "/ai.$_mode.conf" "$_rf" 2>/dev/null && action=$_mode ifconfig $_ifdev delete down 2>/dev/null [[ -n $action ]] } if ! $AUTO; then cat <<__EOT At any prompt except password prompts you can escape to a shell by typing '!'. Default answers are shown in []'s and are selected by pressing RETURN. You can exit this program at any time by pressing Control-C, but this can leave your system in an inconsistent state. __EOT elif [[ -z $RESPFILE ]]; then if ! get_responsefile; then echo "No response file found; non-interactive mode aborted." exit 1 fi rm -f /ai.done echo "Performing non-interactive $action..." /$action -af /ai.$action.conf 2>&1 >/mnt/etc/rc.firsttime ( /usr/bin/mail -s '$(hostname) $action log' root < $_lf && rm $_lf ) >/dev/null 2>&1 & __EOT exec reboot else echo "failed; check /ai.log" exit 1 fi else cp $RESPFILE /ai.conf || exit fi set_term if [[ $MODE == install ]]; then ask_until "System hostname? (short form, e.g. 'foo')" "$(hostname -s)" [[ ${resp%%.*} != $(hostname -s) ]] && hostname $resp THESETS="$THESETS site$VERSION-$(hostname -s).tgz" echo donetconfig ((NIFS != 0)) && startcgiinfo echo while :; do askpassword "Password for root account?" _rootpass="$_password" [[ -n "$_password" ]] && break echo "The root password must be set." done rootkey= $AUTO && ask "Public ssh key for root account?" none && [[ $resp != none ]] && rootkey=$resp questions user_setup set_timezone /var/tzlist echo fi diskinfo() { local _d for _d; do makedev $_d echo -n "$_d: " disklabel -dpg $_d 2>/dev/null | sed -e '/^label: /{s,,,;s/ *$//;s/^$//;H;d;}' \ -e '/.*# totalAfrica/ Africa/Abidjan Africa/Accra Africa/Addis_Ababa Africa/Algiers Africa/Asmara Africa/Asmera Africa/Bamako Africa/Bangui Africa/Banjul Africa/Bissau Africa/Blantyre Africa/Brazzaville Africa/Bujumbura Africa/Cairo Africa/Casablanca Africa/Ceuta Africa/Conakry Africa/Dakar Africa/Dar_es_Salaam Africa/Djibouti Africa/Douala Africa/El_Aaiun Africa/Freetown Africa/Gaborone Africa/Harare Africa/Johannesburg Africa/Juba Africa/Kampala Africa/Khartoum Africa/Kigali Africa/Kinshasa Africa/Lagos Africa/Libreville Africa/Lome Africa/Luanda Africa/Lubumbashi Africa/Lusaka Africa/Malabo Africa/Maputo Africa/Maseru Africa/Mbabane Africa/Mogadishu Africa/Monrovia Africa/Nairobi Africa/Ndjamena Africa/Niamey Africa/Nouakchott Africa/Ouagadougou Africa/Porto-Novo Africa/Sao_Tome Africa/Timbuktu Africa/Tripoli Africa/Tunis Africa/Windhoek America/ America/Adak America/Anchorage America/Anguilla America/Antigua America/Araguaina America/Argentina/ America/Argentina/Buenos_Aires America/Argentina/Catamarca America/Argentina/ComodRivadavia America/Argentina/Cordoba America/Argentina/Jujuy America/Argentina/La_Rioja America/Argentina/Mendoza America/Argentina/Rio_Gallegos America/Argentina/Salta America/Argentina/San_Juan America/Argentina/San_Luis America/Argentina/Tucuman America/Argentina/Ushuaia America/Aruba America/Asuncion America/Atikokan America/Atka America/Bahia America/Bahia_Banderas America/Barbados America/Belem America/Belize America/Blanc-Sablon America/Boa_Vista America/Bogota America/Boise America/Buenos_Aires America/Cambridge_Bay America/Campo_Grande America/Cancun America/Caracas America/Catamarca America/Cayenne America/Cayman America/Chicago America/Chihuahua America/Coral_Harbour America/Cordoba America/Costa_Rica America/Creston America/Cuiaba America/Curacao America/Danmarkshavn America/Dawson America/Dawson_Creek America/Denver America/Detroit America/Dominica America/Edmonton America/Eirunepe America/El_Salvador America/Ensenada America/Fort_Wayne America/Fortaleza America/Glace_Bay America/Godthab America/Goose_Bay America/Grand_Turk America/Grenada America/Guadeloupe America/Guatemala America/Guayaquil America/Guyana America/Halifax America/Havana America/Hermosillo America/Indiana/ America/Indiana/Indianapolis America/Indiana/Knox America/Indiana/Marengo America/Indiana/Petersburg America/Indiana/Tell_City America/Indiana/Vevay America/Indiana/Vincennes America/Indiana/Winamac America/Indianapolis America/Inuvik America/Iqaluit America/Jamaica America/Jujuy America/Juneau America/Kentucky/ America/Kentucky/Louisville America/Kentucky/Monticello America/Knox_IN America/Kralendijk America/La_Paz America/Lima America/Los_Angeles America/Louisville America/Lower_Princes America/Maceio America/Managua America/Manaus America/Marigot America/Martinique America/Matamoros America/Mazatlan America/Mendoza America/Menominee America/Merida America/Metlakatla America/Mexico_City America/Miquelon America/Moncton America/Monterrey America/Montevideo America/Montreal America/Montserrat America/Nassau America/New_York America/Nipigon America/Nome America/Noronha America/North_Dakota/ America/North_Dakota/Beulah America/North_Dakota/Center America/North_Dakota/New_Salem America/Ojinaga America/Panama America/Pangnirtung America/Paramaribo America/Phoenix America/Port-au-Prince America/Port_of_Spain America/Porto_Acre America/Porto_Velho America/Puerto_Rico America/Rainy_River America/Rankin_Inlet America/Recife America/Regina America/Resolute America/Rio_Branco America/Rosario America/Santa_Isabel America/Santarem America/Santiago America/Santo_Domingo America/Sao_Paulo America/Scoresbysund America/Shiprock America/Sitka America/St_Barthelemy America/St_Johns America/St_Kitts America/St_Lucia America/St_Thomas America/St_Vincent America/Swift_Current America/Tegucigalpa America/Thule America/Thunder_Bay America/Tijuana America/Toronto America/Tortola America/Vancouver America/Virgin America/Whitehorse America/Winnipeg America/Yakutat America/Yellowknife Antarctica/ Antarctica/Casey Antarctica/Davis Antarctica/DumontDUrville Antarctica/Macquarie Antarctica/Mawson Antarctica/McMurdo Antarctica/Palmer Antarctica/Rothera Antarctica/South_Pole Antarctica/Syowa Antarctica/Troll Antarctica/Vostok Arctic/ Arctic/Longyearbyen Asia/ Asia/Aden Asia/Almaty Asia/Amman Asia/Anadyr Asia/Aqtau Asia/Aqtobe Asia/Ashgabat Asia/Ashkhabad Asia/Baghdad Asia/Bahrain Asia/Baku Asia/Bangkok Asia/Beirut Asia/Bishkek Asia/Brunei Asia/Calcutta Asia/Chita Asia/Choibalsan Asia/Chongqing Asia/Chungking Asia/Colombo Asia/Dacca Asia/Damascus Asia/Dhaka Asia/Dili Asia/Dubai Asia/Dushanbe Asia/Gaza Asia/Harbin Asia/Hebron Asia/Ho_Chi_Minh Asia/Hong_Kong Asia/Hovd Asia/Irkutsk Asia/Istanbul Asia/Jakarta Asia/Jayapura Asia/Jerusalem Asia/Kabul Asia/Kamchatka Asia/Karachi Asia/Kashgar Asia/Kathmandu Asia/Katmandu Asia/Khandyga Asia/Kolkata Asia/Krasnoyarsk Asia/Kuala_Lumpur Asia/Kuching Asia/Kuwait Asia/Macao Asia/Macau Asia/Magadan Asia/Makassar Asia/Manila Asia/Muscat Asia/Nicosia Asia/Novokuznetsk Asia/Novosibirsk Asia/Omsk Asia/Oral Asia/Phnom_Penh Asia/Pontianak Asia/Pyongyang Asia/Qatar Asia/Qyzylorda Asia/Rangoon Asia/Riyadh Asia/Riyadh87 Asia/Riyadh88 Asia/Riyadh89 Asia/Saigon Asia/Sakhalin Asia/Samarkand Asia/Seoul Asia/Shanghai Asia/Singapore Asia/Srednekolymsk Asia/Taipei Asia/Tashkent Asia/Tbilisi Asia/Tehran Asia/Tel_Aviv Asia/Thimbu Asia/Thimphu Asia/Tokyo Asia/Ujung_Pandang Asia/Ulaanbaatar Asia/Ulan_Bator Asia/Urumqi Asia/Ust-Nera Asia/Vientiane Asia/Vladivostok Asia/Yakutsk Asia/Yekaterinburg Asia/Yerevan Atlantic/ Atlantic/Azores Atlantic/Bermuda Atlantic/Canary Atlantic/Cape_Verde Atlantic/Faeroe Atlantic/Faroe Atlantic/Jan_Mayen Atlantic/Madeira Atlantic/Reykjavik Atlantic/South_Georgia Atlantic/St_Helena Atlantic/Stanley Australia/ Australia/ACT Australia/Adelaide Australia/Brisbane Australia/Broken_Hill Australia/Canberra Australia/Currie Australia/Darwin Australia/Eucla Australia/Hobart Australia/LHI Australia/Lindeman Australia/Lord_Howe Australia/Melbourne Australia/NSW Australia/North Australia/Perth Australia/Queensland Australia/South Australia/Sydney Australia/Tasmania Australia/Victoria Australia/West Australia/Yancowinna Brazil/ Brazil/Acre Brazil/DeNoronha Brazil/East Brazil/West CET CST6CDT Canada/ Canada/Atlantic Canada/Central Canada/East-Saskatchewan Canada/Eastern Canada/Mountain Canada/Newfoundland Canada/Pacific Canada/Saskatchewan Canada/Yukon Chile/ Chile/Continental Chile/EasterIsland Cuba EET EST EST5EDT Egypt Eire Etc/ Etc/GMT Etc/GMT+0 Etc/GMT+1 Etc/GMT+10 Etc/GMT+11 Etc/GMT+12 Etc/GMT+2 Etc/GMT+3 Etc/GMT+4 Etc/GMT+5 Etc/GMT+6 Etc/GMT+7 Etc/GMT+8 Etc/GMT+9 Etc/GMT-0 Etc/GMT-1 Etc/GMT-10 Etc/GMT-11 Etc/GMT-12 Etc/GMT-13 Etc/GMT-14 Etc/GMT-2 Etc/GMT-3 Etc/GMT-4 Etc/GMT-5 Etc/GMT-6 Etc/GMT-7 Etc/GMT-8 Etc/GMT-9 Etc/GMT0 Etc/Greenwich Etc/UCT Etc/UTC Etc/Universal Etc/Zulu Europe/ Europe/Amsterdam Europe/Andorra Europe/Athens Europe/Belfast Europe/Belgrade Europe/Berlin Europe/Bratislava Europe/Brussels Europe/Bucharest Europe/Budapest Europe/Busingen Europe/Chisinau Europe/Copenhagen Europe/Dublin Europe/Gibraltar Europe/Guernsey Europe/Helsinki Europe/Isle_of_Man Europe/Istanbul Europe/Jersey Europe/Kaliningrad Europe/Kiev Europe/Lisbon Europe/Ljubljana Europe/London Europe/Luxembourg Europe/Madrid Europe/Malta Europe/Mariehamn Europe/Minsk Europe/Monaco Europe/Moscow Europe/Nicosia Europe/Oslo Europe/Paris Europe/Podgorica Europe/Prague Europe/Riga Europe/Rome Europe/Samara Europe/San_Marino Europe/Sarajevo Europe/Simferopol Europe/Skopje Europe/Sofia Europe/Stockholm Europe/Tallinn Europe/Tirane Europe/Tiraspol Europe/Uzhgorod Europe/Vaduz Europe/Vatican Europe/Vienna Europe/Vilnius Europe/Volgograd Europe/Warsaw Europe/Zagreb Europe/Zaporozhye Europe/Zurich Factory GB GB-Eire GMT GMT+0 GMT-0 GMT0 Greenwich HST Hongkong Iceland Indian/ Indian/Antananarivo Indian/Chagos Indian/Christmas Indian/Cocos Indian/Comoro Indian/Kerguelen Indian/Mahe Indian/Maldives Indian/Mauritius Indian/Mayotte Indian/Reunion Iran Israel Jamaica Japan Kwajalein Libya MET MST MST7MDT Mexico/ Mexico/BajaNorte Mexico/BajaSur Mexico/General Mideast/ Mideast/Riyadh87 Mideast/Riyadh88 Mideast/Riyadh89 NZ NZ-CHAT Navajo PRC PST8PDT Pacific/ Pacific/Apia Pacific/Auckland Pacific/Bougainville Pacific/Chatham Pacific/Chuuk Pacific/Easter Pacific/Efate Pacific/Enderbury Pacific/Fakaofo Pacific/Fiji Pacific/Funafuti Pacific/Galapagos Pacific/Gambier Pacific/Guadalcanal Pacific/Guam Pacific/Honolulu Pacific/Johnston Pacific/Kiritimati Pacific/Kosrae Pacific/Kwajalein Pacific/Majuro Pacific/Marquesas Pacific/Midway Pacific/Nauru Pacific/Niue Pacific/Norfolk Pacific/Noumea Pacific/Pago_Pago Pacific/Palau Pacific/Pitcairn Pacific/Pohnpei Pacific/Ponape Pacific/Port_Moresby Pacific/Rarotonga Pacific/Saipan Pacific/Samoa Pacific/Tahiti Pacific/Tarawa Pacific/Tongatapu Pacific/Truk Pacific/Wake Pacific/Wallis Pacific/Yap Poland Portugal ROC ROK Singapore Turkey UCT US/ US/Alaska US/Aleutian US/Arizona US/Central US/East-Indiana US/Eastern US/Hawaii US/Indiana-Starke US/Michigan US/Mountain US/Pacific US/Pacific-New US/Samoa UTC Universal W-SU WET Zulu posix/ posix/Africa/ posix/Africa/Abidjan posix/Africa/Accra posix/Africa/Addis_Ababa posix/Africa/Algiers posix/Africa/Asmara posix/Africa/Asmera posix/Africa/Bamako posix/Africa/Bangui posix/Africa/Banjul posix/Africa/Bissau posix/Africa/Blantyre posix/Africa/Brazzaville posix/Africa/Bujumbura posix/Africa/Cairo posix/Africa/Casablanca posix/Africa/Ceuta posix/Africa/Conakry posix/Africa/Dakar posix/Africa/Dar_es_Salaam posix/Africa/Djibouti posix/Africa/Douala posix/Africa/El_Aaiun posix/Africa/Freetown posix/Africa/Gaborone posix/Africa/Harare posix/Africa/Johannesburg posix/Africa/Juba posix/Africa/Kampala posix/Africa/Khartoum posix/Africa/Kigali posix/Africa/Kinshasa posix/Africa/Lagos posix/Africa/Libreville posix/Africa/Lome posix/Africa/Luanda posix/Africa/Lubumbashi posix/Africa/Lusaka posix/Africa/Malabo posix/Africa/Maputo posix/Africa/Maseru posix/Africa/Mbabane posix/Africa/Mogadishu posix/Africa/Monrovia posix/Africa/Nairobi posix/Africa/Ndjamena posix/Africa/Niamey posix/Africa/Nouakchott posix/Africa/Ouagadougou posix/Africa/Porto-Novo posix/Africa/Sao_Tome posix/Africa/Timbuktu posix/Africa/Tripoli posix/Africa/Tunis posix/Africa/Windhoek posix/America/ posix/America/Adak posix/America/Anchorage posix/America/Anguilla posix/America/Antigua posix/America/Araguaina posix/America/Argentina/ posix/America/Argentina/Buenos_Aires posix/America/Argentina/Catamarca posix/America/Argentina/ComodRivadavia posix/America/Argentina/Cordoba posix/America/Argentina/Jujuy posix/America/Argentina/La_Rioja posix/America/Argentina/Mendoza posix/America/Argentina/Rio_Gallegos posix/America/Argentina/Salta posix/America/Argentina/San_Juan posix/America/Argentina/San_Luis posix/America/Argentina/Tucuman posix/America/Argentina/Ushuaia posix/America/Aruba posix/America/Asuncion posix/America/Atikokan posix/America/Atka posix/America/Bahia posix/America/Bahia_Banderas posix/America/Barbados posix/America/Belem posix/America/Belize posix/America/Blanc-Sablon posix/America/Boa_Vista posix/America/Bogota posix/America/Boise posix/America/Buenos_Aires posix/America/Cambridge_Bay posix/America/Campo_Grande posix/America/Cancun posix/America/Caracas posix/America/Catamarca posix/America/Cayenne posix/America/Cayman posix/America/Chicago posix/America/Chihuahua posix/America/Coral_Harbour posix/America/Cordoba posix/America/Costa_Rica posix/America/Creston posix/America/Cuiaba posix/America/Curacao posix/America/Danmarkshavn posix/America/Dawson posix/America/Dawson_Creek posix/America/Denver posix/America/Detroit posix/America/Dominica posix/America/Edmonton posix/America/Eirunepe posix/America/El_Salvador posix/America/Ensenada posix/America/Fort_Wayne posix/America/Fortaleza posix/America/Glace_Bay posix/America/Godthab posix/America/Goose_Bay posix/America/Grand_Turk posix/America/Grenada posix/America/Guadeloupe posix/America/Guatemala posix/America/Guayaquil posix/America/Guyana posix/America/Halifax posix/America/Havana posix/America/Hermosillo posix/America/Indiana/ posix/America/Indiana/Indianapolis posix/America/Indiana/Knox posix/America/Indiana/Marengo posix/America/Indiana/Petersburg posix/America/Indiana/Tell_City posix/America/Indiana/Vevay posix/America/Indiana/Vincennes posix/America/Indiana/Winamac posix/America/Indianapolis posix/America/Inuvik posix/America/Iqaluit posix/America/Jamaica posix/America/Jujuy posix/America/Juneau posix/America/Kentucky/ posix/America/Kentucky/Louisville posix/America/Kentucky/Monticello posix/America/Knox_IN posix/America/Kralendijk posix/America/La_Paz posix/America/Lima posix/America/Los_Angeles posix/America/Louisville posix/America/Lower_Princes posix/America/Maceio posix/America/Managua posix/America/Manaus posix/America/Marigot posix/America/Martinique posix/America/Matamoros posix/America/Mazatlan posix/America/Mendoza posix/America/Menominee posix/America/Merida posix/America/Metlakatla posix/America/Mexico_City posix/America/Miquelon posix/America/Moncton posix/America/Monterrey posix/America/Montevideo posix/America/Montreal posix/America/Montserrat posix/America/Nassau posix/America/New_York posix/America/Nipigon posix/America/Nome posix/America/Noronha posix/America/North_Dakota/ posix/America/North_Dakota/Beulah posix/America/North_Dakota/Center posix/America/North_Dakota/New_Salem posix/America/Ojinaga posix/America/Panama posix/America/Pangnirtung posix/America/Paramaribo posix/America/Phoenix posix/America/Port-au-Prince posix/America/Port_of_Spain posix/America/Porto_Acre posix/America/Porto_Velho posix/America/Puerto_Rico posix/America/Rainy_River posix/America/Rankin_Inlet posix/America/Recife posix/America/Regina posix/America/Resolute posix/America/Rio_Branco posix/America/Rosario posix/America/Santa_Isabel posix/America/Santarem posix/America/Santiago posix/America/Santo_Domingo posix/America/Sao_Paulo posix/America/Scoresbysund posix/America/Shiprock posix/America/Sitka posix/America/St_Barthelemy posix/America/St_Johns posix/America/St_Kitts posix/America/St_Lucia posix/America/St_Thomas posix/America/St_Vincent posix/America/Swift_Current posix/America/Tegucigalpa posix/America/Thule posix/America/Thunder_Bay posix/America/Tijuana posix/America/Toronto posix/America/Tortola posix/America/Vancouver posix/America/Virgin posix/America/Whitehorse posix/America/Winnipeg posix/America/Yakutat posix/America/Yellowknife posix/Antarctica/ posix/Antarctica/Casey posix/Antarctica/Davis posix/Antarctica/DumontDUrville posix/Antarctica/Macquarie posix/Antarctica/Mawson posix/Antarctica/McMurdo posix/Antarctica/Palmer posix/Antarctica/Rothera posix/Antarctica/South_Pole posix/Antarctica/Syowa posix/Antarctica/Troll posix/Antarctica/Vostok posix/Arctic/ posix/Arctic/Longyearbyen posix/Asia/ posix/Asia/Aden posix/Asia/Almaty posix/Asia/Amman posix/Asia/Anadyr posix/Asia/Aqtau posix/Asia/Aqtobe posix/Asia/Ashgabat posix/Asia/Ashkhabad posix/Asia/Baghdad posix/Asia/Bahrain posix/Asia/Baku posix/Asia/Bangkok posix/Asia/Beirut posix/Asia/Bishkek posix/Asia/Brunei posix/Asia/Calcutta posix/Asia/Chita posix/Asia/Choibalsan posix/Asia/Chongqing posix/Asia/Chungking posix/Asia/Colombo posix/Asia/Dacca posix/Asia/Damascus posix/Asia/Dhaka posix/Asia/Dili posix/Asia/Dubai posix/Asia/Dushanbe posix/Asia/Gaza posix/Asia/Harbin posix/Asia/Hebron posix/Asia/Ho_Chi_Minh posix/Asia/Hong_Kong posix/Asia/Hovd posix/Asia/Irkutsk posix/Asia/Istanbul posix/Asia/Jakarta posix/Asia/Jayapura posix/Asia/Jerusalem posix/Asia/Kabul posix/Asia/Kamchatka posix/Asia/Karachi posix/Asia/Kashgar posix/Asia/Kathmandu posix/Asia/Katmandu posix/Asia/Khandyga posix/Asia/Kolkata posix/Asia/Krasnoyarsk posix/Asia/Kuala_Lumpur posix/Asia/Kuching posix/Asia/Kuwait posix/Asia/Macao posix/Asia/Macau posix/Asia/Magadan posix/Asia/Makassar posix/Asia/Manila posix/Asia/Muscat posix/Asia/Nicosia posix/Asia/Novokuznetsk posix/Asia/Novosibirsk posix/Asia/Omsk posix/Asia/Oral posix/Asia/Phnom_Penh posix/Asia/Pontianak posix/Asia/Pyongyang posix/Asia/Qatar posix/Asia/Qyzylorda posix/Asia/Rangoon posix/Asia/Riyadh posix/Asia/Riyadh87 posix/Asia/Riyadh88 posix/Asia/Riyadh89 posix/Asia/Saigon posix/Asia/Sakhalin posix/Asia/Samarkand posix/Asia/Seoul posix/Asia/Shanghai posix/Asia/Singapore posix/Asia/Srednekolymsk posix/Asia/Taipei posix/Asia/Tashkent posix/Asia/Tbilisi posix/Asia/Tehran posix/Asia/Tel_Aviv posix/Asia/Thimbu posix/Asia/Thimphu posix/Asia/Tokyo posix/Asia/Ujung_Pandang posix/Asia/Ulaanbaatar posix/Asia/Ulan_Bator posix/Asia/Urumqi posix/Asia/Ust-Nera posix/Asia/Vientiane posix/Asia/Vladivostok posix/Asia/Yakutsk posix/Asia/Yekaterinburg posix/Asia/Yerevan posix/Atlantic/ posix/Atlantic/Azores posix/Atlantic/Bermuda posix/Atlantic/Canary posix/Atlantic/Cape_Verde posix/Atlantic/Faeroe posix/Atlantic/Faroe posix/Atlantic/Jan_Mayen posix/Atlantic/Madeira posix/Atlantic/Reykjavik posix/Atlantic/South_Georgia posix/Atlantic/St_Helena posix/Atlantic/Stanley posix/Australia/ posix/Australia/ACT posix/Australia/Adelaide posix/Australia/Brisbane posix/Australia/Broken_Hill posix/Australia/Canberra posix/Australia/Currie posix/Australia/Darwin posix/Australia/Eucla posix/Australia/Hobart posix/Australia/LHI posix/Australia/Lindeman posix/Australia/Lord_Howe posix/Australia/Melbourne posix/Australia/NSW posix/Australia/North posix/Australia/Perth posix/Australia/Queensland posix/Australia/South posix/Australia/Sydney posix/Australia/Tasmania posix/Australia/Victoria posix/Australia/West posix/Australia/Yancowinna posix/Brazil/ posix/Brazil/Acre posix/Brazil/DeNoronha posix/Brazil/East posix/Brazil/West posix/CET posix/CST6CDT posix/Canada/ posix/Canada/Atlantic posix/Canada/Central posix/Canada/East-Saskatchewan posix/Canada/Eastern posix/Canada/Mountain posix/Canada/Newfoundland posix/Canada/Pacific posix/Canada/Saskatchewan posix/Canada/Yukon posix/Chile/ posix/Chile/Continental posix/Chile/EasterIsland posix/Cuba posix/EET posix/EST posix/EST5EDT posix/Egypt posix/Eire posix/Etc/ posix/Etc/GMT posix/Etc/GMT+0 posix/Etc/GMT+1 posix/Etc/GMT+10 posix/Etc/GMT+11 posix/Etc/GMT+12 posix/Etc/GMT+2 posix/Etc/GMT+3 posix/Etc/GMT+4 posix/Etc/GMT+5 posix/Etc/GMT+6 posix/Etc/GMT+7 posix/Etc/GMT+8 posix/Etc/GMT+9 posix/Etc/GMT-0 posix/Etc/GMT-1 posix/Etc/GMT-10 posix/Etc/GMT-11 posix/Etc/GMT-12 posix/Etc/GMT-13 posix/Etc/GMT-14 posix/Etc/GMT-2 posix/Etc/GMT-3 posix/Etc/GMT-4 posix/Etc/GMT-5 posix/Etc/GMT-6 posix/Etc/GMT-7 posix/Etc/GMT-8 posix/Etc/GMT-9 posix/Etc/GMT0 posix/Etc/Greenwich posix/Etc/UCT posix/Etc/UTC posix/Etc/Universal posix/Etc/Zulu posix/Europe/ posix/Europe/Amsterdam posix/Europe/Andorra posix/Europe/Athens posix/Europe/Belfast posix/Europe/Belgrade posix/Europe/Berlin posix/Europe/Bratislava posix/Europe/Brussels posix/Europe/Bucharest posix/Europe/Budapest posix/Europe/Busingen posix/Europe/Chisinau posix/Europe/Copenhagen posix/Europe/Dublin posix/Europe/Gibraltar posix/Europe/Guernsey posix/Europe/Helsinki posix/Europe/Isle_of_Man posix/Europe/Istanbul posix/Europe/Jersey posix/Europe/Kaliningrad posix/Europe/Kiev posix/Europe/Lisbon posix/Europe/Ljubljana posix/Europe/London posix/Europe/Luxembourg posix/Europe/Madrid posix/Europe/Malta posix/Europe/Mariehamn posix/Europe/Minsk posix/Europe/Monaco posix/Europe/Moscow posix/Europe/Nicosia posix/Europe/Oslo posix/Europe/Paris posix/Europe/Podgorica posix/Europe/Prague posix/Europe/Riga posix/Europe/Rome posix/Europe/Samara posix/Europe/San_Marino posix/Europe/Sarajevo posix/Europe/Simferopol posix/Europe/Skopje posix/Europe/Sofia posix/Europe/Stockholm posix/Europe/Tallinn posix/Europe/Tirane posix/Europe/Tiraspol posix/Europe/Uzhgorod posix/Europe/Vaduz posix/Europe/Vatican posix/Europe/Vienna posix/Europe/Vilnius posix/Europe/Volgograd posix/Europe/Warsaw posix/Europe/Zagreb posix/Europe/Zaporozhye posix/Europe/Zurich posix/Factory posix/GB posix/GB-Eire posix/GMT posix/GMT+0 posix/GMT-0 posix/GMT0 posix/Greenwich posix/HST posix/Hongkong posix/Iceland posix/Indian/ posix/Indian/Antananarivo posix/Indian/Chagos posix/Indian/Christmas posix/Indian/Cocos posix/Indian/Comoro posix/Indian/Kerguelen posix/Indian/Mahe posix/Indian/Maldives posix/Indian/Mauritius posix/Indian/Mayotte posix/Indian/Reunion posix/Iran posix/Israel posix/Jamaica posix/Japan posix/Kwajalein posix/Libya posix/MET posix/MST posix/MST7MDT posix/Mexico/ posix/Mexico/BajaNorte posix/Mexico/BajaSur posix/Mexico/General posix/Mideast/ posix/Mideast/Riyadh87 posix/Mideast/Riyadh88 posix/Mideast/Riyadh89 posix/NZ posix/NZ-CHAT posix/Navajo posix/PRC posix/PST8PDT posix/Pacific/ posix/Pacific/Apia posix/Pacific/Auckland posix/Pacific/Bougainville posix/Pacific/Chatham posix/Pacific/Chuuk posix/Pacific/Easter posix/Pacific/Efate posix/Pacific/Enderbury posix/Pacific/Fakaofo posix/Pacific/Fiji posix/Pacific/Funafuti posix/Pacific/Galapagos posix/Pacific/Gambier posix/Pacific/Guadalcanal posix/Pacific/Guam posix/Pacific/Honolulu posix/Pacific/Johnston posix/Pacific/Kiritimati posix/Pacific/Kosrae posix/Pacific/Kwajalein posix/Pacific/Majuro posix/Pacific/Marquesas posix/Pacific/Midway posix/Pacific/Nauru posix/Pacific/Niue posix/Pacific/Norfolk posix/Pacific/Noumea posix/Pacific/Pago_Pago posix/Pacific/Palau posix/Pacific/Pitcairn posix/Pacific/Pohnpei posix/Pacific/Ponape posix/Pacific/Port_Moresby posix/Pacific/Rarotonga posix/Pacific/Saipan posix/Pacific/Samoa posix/Pacific/Tahiti posix/Pacific/Tarawa posix/Pacific/Tongatapu posix/Pacific/Truk posix/Pacific/Wake posix/Pacific/Wallis posix/Pacific/Yap posix/Poland posix/Portugal posix/ROC posix/ROK posix/Singapore posix/Turkey posix/UCT posix/US/ posix/US/Alaska posix/US/Aleutian posix/US/Arizona posix/US/Central posix/US/East-Indiana posix/US/Eastern posix/US/Hawaii posix/US/Indiana-Starke posix/US/Michigan posix/US/Mountain posix/US/Pacific posix/US/Pacific-New posix/US/Samoa posix/UTC posix/Universal posix/W-SU posix/WET posix/Zulu posixrules right/ right/Africa/ right/Africa/Abidjan right/Africa/Accra right/Africa/Addis_Ababa right/Africa/Algiers right/Africa/Asmara right/Africa/Asmera right/Africa/Bamako right/Africa/Bangui right/Africa/Banjul right/Africa/Bissau right/Africa/Blantyre right/Africa/Brazzaville right/Africa/Bujumbura right/Africa/Cairo right/Africa/Casablanca right/Africa/Ceuta right/Africa/Conakry right/Africa/Dakar right/Africa/Dar_es_Salaam right/Africa/Djibouti right/Africa/Douala right/Africa/El_Aaiun right/Africa/Freetown right/Africa/Gaborone right/Africa/Harare right/Africa/Johannesburg right/Africa/Juba right/Africa/Kampala right/Africa/Khartoum right/Africa/Kigali right/Africa/Kinshasa right/Africa/Lagos right/Africa/Libreville right/Africa/Lome right/Africa/Luanda right/Africa/Lubumbashi right/Africa/Lusaka right/Africa/Malabo right/Africa/Maputo right/Africa/Maseru right/Africa/Mbabane right/Africa/Mogadishu right/Africa/Monrovia right/Africa/Nairobi right/Africa/Ndjamena right/Africa/Niamey right/Africa/Nouakchott right/Africa/Ouagadougou right/Africa/Porto-Novo right/Africa/Sao_Tome right/Africa/Timbuktu right/Africa/Tripoli right/Africa/Tunis right/Africa/Windhoek right/America/ right/America/Adak right/America/Anchorage right/America/Anguilla right/America/Antigua right/America/Araguaina right/America/Argentina/ right/America/Argentina/Buenos_Aires right/America/Argentina/Catamarca right/America/Argentina/ComodRivadavia right/America/Argentina/Cordoba right/America/Argentina/Jujuy right/America/Argentina/La_Rioja right/America/Argentina/Mendoza right/America/Argentina/Rio_Gallegos right/America/Argentina/Salta right/America/Argentina/San_Juan right/America/Argentina/San_Luis right/America/Argentina/Tucuman right/America/Argentina/Ushuaia right/America/Aruba right/America/Asuncion right/America/Atikokan right/America/Atka right/America/Bahia right/America/Bahia_Banderas right/America/Barbados right/America/Belem right/America/Belize right/America/Blanc-Sablon right/America/Boa_Vista right/America/Bogota right/America/Boise right/America/Buenos_Aires right/America/Cambridge_Bay right/America/Campo_Grande right/America/Cancun right/America/Caracas right/America/Catamarca right/America/Cayenne right/America/Cayman right/America/Chicago right/America/Chihuahua right/America/Coral_Harbour right/America/Cordoba right/America/Costa_Rica right/America/Creston right/America/Cuiaba right/America/Curacao right/America/Danmarkshavn right/America/Dawson right/America/Dawson_Creek right/America/Denver right/America/Detroit right/America/Dominica right/America/Edmonton right/America/Eirunepe right/America/El_Salvador right/America/Ensenada right/America/Fort_Wayne right/America/Fortaleza right/America/Glace_Bay right/America/Godthab right/America/Goose_Bay right/America/Grand_Turk right/America/Grenada right/America/Guadeloupe right/America/Guatemala right/America/Guayaquil right/America/Guyana right/America/Halifax right/America/Havana right/America/Hermosillo right/America/Indiana/ right/America/Indiana/Indianapolis right/America/Indiana/Knox right/America/Indiana/Marengo right/America/Indiana/Petersburg right/America/Indiana/Tell_City right/America/Indiana/Vevay right/America/Indiana/Vincennes right/America/Indiana/Winamac right/America/Indianapolis right/America/Inuvik right/America/Iqaluit right/America/Jamaica right/America/Jujuy right/America/Juneau right/America/Kentucky/ right/America/Kentucky/Louisville right/America/Kentucky/Monticello right/America/Knox_IN right/America/Kralendijk right/America/La_Paz right/America/Lima right/America/Los_Angeles right/America/Louisville right/America/Lower_Princes right/America/Maceio right/America/Managua right/America/Manaus right/America/Marigot right/America/Martinique right/America/Matamoros right/America/Mazatlan right/America/Mendoza right/America/Menominee right/America/Merida right/America/Metlakatla right/America/Mexico_City right/America/Miquelon right/America/Moncton right/America/Monterrey right/America/Montevideo right/America/Montreal right/America/Montserrat right/America/Nassau right/America/New_York right/America/Nipigon right/America/Nome right/America/Noronha right/America/North_Dakota/ right/America/North_Dakota/Beulah right/America/North_Dakota/Center right/America/North_Dakota/New_Salem right/America/Ojinaga right/America/Panama right/America/Pangnirtung right/America/Paramaribo right/America/Phoenix right/America/Port-au-Prince right/America/Port_of_Spain right/America/Porto_Acre right/America/Porto_Velho right/America/Puerto_Rico right/America/Rainy_River right/America/Rankin_Inlet right/America/Recife right/America/Regina right/America/Resolute right/America/Rio_Branco right/America/Rosario right/America/Santa_Isabel right/America/Santarem right/America/Santiago right/America/Santo_Domingo right/America/Sao_Paulo right/America/Scoresbysund right/America/Shiprock right/America/Sitka right/America/St_Barthelemy right/America/St_Johns right/America/St_Kitts right/America/St_Lucia right/America/St_Thomas right/America/St_Vincent right/America/Swift_Current right/America/Tegucigalpa right/America/Thule right/America/Thunder_Bay right/America/Tijuana right/America/Toronto right/America/Tortola right/America/Vancouver right/America/Virgin right/America/Whitehorse right/America/Winnipeg right/America/Yakutat right/America/Yellowknife right/Antarctica/ right/Antarctica/Casey right/Antarctica/Davis right/Antarctica/DumontDUrville right/Antarctica/Macquarie right/Antarctica/Mawson right/Antarctica/McMurdo right/Antarctica/Palmer right/Antarctica/Rothera right/Antarctica/South_Pole right/Antarctica/Syowa right/Antarctica/Troll right/Antarctica/Vostok right/Arctic/ right/Arctic/Longyearbyen right/Asia/ right/Asia/Aden right/Asia/Almaty right/Asia/Amman right/Asia/Anadyr right/Asia/Aqtau right/Asia/Aqtobe right/Asia/Ashgabat right/Asia/Ashkhabad right/Asia/Baghdad right/Asia/Bahrain right/Asia/Baku right/Asia/Bangkok right/Asia/Beirut right/Asia/Bishkek right/Asia/Brunei right/Asia/Calcutta right/Asia/Chita right/Asia/Choibalsan right/Asia/Chongqing right/Asia/Chungking right/Asia/Colombo right/Asia/Dacca right/Asia/Damascus right/Asia/Dhaka right/Asia/Dili right/Asia/Dubai right/Asia/Dushanbe right/Asia/Gaza right/Asia/Harbin right/Asia/Hebron right/Asia/Ho_Chi_Minh right/Asia/Hong_Kong right/Asia/Hovd right/Asia/Irkutsk right/Asia/Istanbul right/Asia/Jakarta right/Asia/Jayapura right/Asia/Jerusalem right/Asia/Kabul right/Asia/Kamchatka right/Asia/Karachi right/Asia/Kashgar right/Asia/Kathmandu right/Asia/Katmandu right/Asia/Khandyga right/Asia/Kolkata right/Asia/Krasnoyarsk right/Asia/Kuala_Lumpur right/Asia/Kuching right/Asia/Kuwait right/Asia/Macao right/Asia/Macau right/Asia/Magadan right/Asia/Makassar right/Asia/Manila right/Asia/Muscat right/Asia/Nicosia right/Asia/Novokuznetsk right/Asia/Novosibirsk right/Asia/Omsk right/Asia/Oral right/Asia/Phnom_Penh right/Asia/Pontianak right/Asia/Pyongyang right/Asia/Qatar right/Asia/Qyzylorda right/Asia/Rangoon right/Asia/Riyadh right/Asia/Riyadh87 right/Asia/Riyadh88 right/Asia/Riyadh89 right/Asia/Saigon right/Asia/Sakhalin right/Asia/Samarkand right/Asia/Seoul right/Asia/Shanghai right/Asia/Singapore right/Asia/Srednekolymsk right/Asia/Taipei right/Asia/Tashkent right/Asia/Tbilisi right/Asia/Tehran right/Asia/Tel_Aviv right/Asia/Thimbu right/Asia/Thimphu right/Asia/Tokyo right/Asia/Ujung_Pandang right/Asia/Ulaanbaatar right/Asia/Ulan_Bator right/Asia/Urumqi right/Asia/Ust-Nera right/Asia/Vientiane right/Asia/Vladivostok right/Asia/Yakutsk right/Asia/Yekaterinburg right/Asia/Yerevan right/Atlantic/ right/Atlantic/Azores right/Atlantic/Bermuda right/Atlantic/Canary right/Atlantic/Cape_Verde right/Atlantic/Faeroe right/Atlantic/Faroe right/Atlantic/Jan_Mayen right/Atlantic/Madeira right/Atlantic/Reykjavik right/Atlantic/South_Georgia right/Atlantic/St_Helena right/Atlantic/Stanley right/Australia/ right/Australia/ACT right/Australia/Adelaide right/Australia/Brisbane right/Australia/Broken_Hill right/Australia/Canberra right/Australia/Currie right/Australia/Darwin right/Australia/Eucla right/Australia/Hobart right/Australia/LHI right/Australia/Lindeman right/Australia/Lord_Howe right/Australia/Melbourne right/Australia/NSW right/Australia/North right/Australia/Perth right/Australia/Queensland right/Australia/South right/Australia/Sydney right/Australia/Tasmania right/Australia/Victoria right/Australia/West right/Australia/Yancowinna right/Brazil/ right/Brazil/Acre right/Brazil/DeNoronha right/Brazil/East right/Brazil/West right/CET right/CST6CDT right/Canada/ right/Canada/Atlantic right/Canada/Central right/Canada/East-Saskatchewan right/Canada/Eastern right/Canada/Mountain right/Canada/Newfoundland right/Canada/Pacific right/Canada/Saskatchewan right/Canada/Yukon right/Chile/ right/Chile/Continental right/Chile/EasterIsland right/Cuba right/EET right/EST right/EST5EDT right/Egypt right/Eire right/Etc/ right/Etc/GMT right/Etc/GMT+0 right/Etc/GMT+1 right/Etc/GMT+10 right/Etc/GMT+11 right/Etc/GMT+12 right/Etc/GMT+2 right/Etc/GMT+3 right/Etc/GMT+4 right/Etc/GMT+5 right/Etc/GMT+6 right/Etc/GMT+7 right/Etc/GMT+8 right/Etc/GMT+9 right/Etc/GMT-0 right/Etc/GMT-1 right/Etc/GMT-10 right/Etc/GMT-11 right/Etc/GMT-12 right/Etc/GMT-13 right/Etc/GMT-14 right/Etc/GMT-2 right/Etc/GMT-3 right/Etc/GMT-4 right/Etc/GMT-5 right/Etc/GMT-6 right/Etc/GMT-7 right/Etc/GMT-8 right/Etc/GMT-9 right/Etc/GMT0 right/Etc/Greenwich right/Etc/UCT right/Etc/UTC right/Etc/Universal right/Etc/Zulu right/Europe/ right/Europe/Amsterdam right/Europe/Andorra right/Europe/Athens right/Europe/Belfast right/Europe/Belgrade right/Europe/Berlin right/Europe/Bratislava right/Europe/Brussels right/Europe/Bucharest right/Europe/Budapest right/Europe/Busingen right/Europe/Chisinau right/Europe/Copenhagen right/Europe/Dublin right/Europe/Gibraltar right/Europe/Guernsey right/Europe/Helsinki right/Europe/Isle_of_Man right/Europe/Istanbul right/Europe/Jersey right/Europe/Kaliningrad right/Europe/Kiev right/Europe/Lisbon right/Europe/Ljubljana right/Europe/London right/Europe/Luxembourg right/Europe/Madrid right/Europe/Malta right/Europe/Mariehamn right/Europe/Minsk right/Europe/Monaco right/Europe/Moscow right/Europe/Nicosia right/Europe/Oslo right/Europe/Paris right/Europe/Podgorica right/Europe/Prague right/Europe/Riga right/Europe/Rome right/Europe/Samara right/Europe/San_Marino right/Europe/Sarajevo right/Europe/Simferopol right/Europe/Skopje right/Europe/Sofia right/Europe/Stockholm right/Europe/Tallinn right/Europe/Tirane right/Europe/Tiraspol right/Europe/Uzhgorod right/Europe/Vaduz right/Europe/Vatican right/Europe/Vienna right/Europe/Vilnius right/Europe/Volgograd right/Europe/Warsaw right/Europe/Zagreb right/Europe/Zaporozhye right/Europe/Zurich right/Factory right/GB right/GB-Eire right/GMT right/GMT+0 right/GMT-0 right/GMT0 right/Greenwich right/HST right/Hongkong right/Iceland right/Indian/ right/Indian/Antananarivo right/Indian/Chagos right/Indian/Christmas right/Indian/Cocos right/Indian/Comoro right/Indian/Kerguelen right/Indian/Mahe right/Indian/Maldives right/Indian/Mauritius right/Indian/Mayotte right/Indian/Reunion right/Iran right/Israel right/Jamaica right/Japan right/Kwajalein right/Libya right/MET right/MST right/MST7MDT right/Mexico/ right/Mexico/BajaNorte right/Mexico/BajaSur right/Mexico/General right/Mideast/ right/Mideast/Riyadh87 right/Mideast/Riyadh88 right/Mideast/Riyadh89 right/NZ right/NZ-CHAT right/Navajo right/PRC right/PST8PDT right/Pacific/ right/Pacific/Apia right/Pacific/Auckland right/Pacific/Bougainville right/Pacific/Chatham right/Pacific/Chuuk right/Pacific/Easter right/Pacific/Efate right/Pacific/Enderbury right/Pacific/Fakaofo right/Pacific/Fiji right/Pacific/Funafuti right/Pacific/Galapagos right/Pacific/Gambier right/Pacific/Guadalcanal right/Pacific/Guam right/Pacific/Honolulu right/Pacific/Johnston right/Pacific/Kiritimati right/Pacific/Kosrae right/Pacific/Kwajalein right/Pacific/Majuro right/Pacific/Marquesas right/Pacific/Midway right/Pacific/Nauru right/Pacific/Niue right/Pacific/Norfolk right/Pacific/Noumea right/Pacific/Pago_Pago right/Pacific/Palau right/Pacific/Pitcairn right/Pacific/Pohnpei right/Pacific/Ponape right/Pacific/Port_Moresby right/Pacific/Rarotonga right/Pacific/Saipan right/Pacific/Samoa right/Pacific/Tahiti right/Pacific/Tarawa right/Pacific/Tongatapu right/Pacific/Truk right/Pacific/Wake right/Pacific/Wallis right/Pacific/Yap right/Poland right/Portugal right/ROC right/ROK right/Singapore right/Turkey right/UCT right/US/ right/US/Alaska right/US/Aleutian right/US/Arizona right/US/Central right/US/East-Indiana right/US/Eastern right/US/Hawaii right/US/Indiana-Starke right/US/Michigan right/US/Mountain right/US/Pacific right/US/Pacific-New right/US/Samoa right/UTC right/Universal right/W-SU right/WET right/Zulu 08xT <  T0.x T x@@<@TU T((TAT?^Q2TB0_TB0_xXaHATM5TTy*CT^J;T^J;TvzKATlTT{V9AT9T}TH |nTAT*T*T}}ʅ:ATw Tw T~MtTc T#m!T#m!hTT6T6蹶T;:TO"ZT# PĹAT<3T2 T2  PT)eT2 T `)T 3!T"T"_T"(T'R)T'R)Tu/Tu/Tu//tmp/fstab.shadowSTY:8TY:8TY:8/tmp/resolv.conf.shadowΨU TB0_TB0_TB0_/tmp/hostss}ACӶ=><% W4_:W&@hS<A6of)=, gWk,IV5яi*m])\_a_dYH qL:]Te}\ܔvv7O;J:3x h<7DĘ A9,>抆tp> p[q(seG|Ų'-~@Gu1XcdTf6(6 [{Vv!+4y7:`4]rݴ4kMPQE۟![Tzy>Wp_Fy᥂=Z{H) ':PLy;r; fϮʽt\91{+]P~7)m+VN A. $\j/EGSkFzg֡UR.}D0YU.b &aՀ./Q.qaa#f_I[ =.-gPm [n8/eT4-Ҹ,d4N[~?d2f 0 D]5@2+KtC|X#k8],F49^mvhYrs/{v%.%s.ۡUU [*s9]qCCD2856Pf>Kpq/$09B5lPT>tBXĺ}|=$7Xg]@l~pu)-kh$Oģ&L=;˴Nb)1#l|nnldC&ӇnPa X7{K{0R%o &]AKv . ..firmwareJsignifygroupK  protocolsHd passwdtmp spwd.db  servicesHasswd.orig pwd.db fstab< resolv.conf$ hosts< . ..openbsd-57-base.pub ... . ..mkuboot . ..keymapsmisci ... ...untrusted comment: openbsd 5.7 base public key RWSvUZXnw9gUb70PdeSNnpSmodCyIPJEGN1wWr+6Time1eP7KiWJ5eAM wheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root bin:*:7: news:*:8: wsrc:*:9: users:*:10: auth:*:11: games:*:13: staff:*:20:root sshd:*:27: _portmap:*:28: _identd:*:29: _rstatd:*:30: guest:*:31:root _rusersd:*:32: _fingerd:*:33: _sshagnt:*:34: _x11:*:35: utmp:*:45: _unbound:*:53: _spamd:*:62: _radius:*:63: _token:*:64: _shadow:*:65: crontab:*:66: www:*:67: _isakmpd:*:68: network:*:69: proxy:*:71: authpf:*:72: _syslogd:*:73: _pflogd:*:74: _bgpd:*:75: _tcpdump:*:76: _dhcp:*:77: _mopd:*:78: _tftpd:*:79: _rbootd:*:80: _ppp:*:82: _ntp:*:83: _ftp:*:84: _ospfd:*:85: _hostapd:*:86: _dvmrpd:*:87: _ripd:*:88: _relayd:*:89: _ospf6d:*:90: _snmpd:*:91: _rtadvd:*:92: _ypldap:*:93: _smtpd:*:95: _rwalld:*:96: _nsd:*:97: _ldpd:*:98: _sndio:*:99: _ldapd:*:100: _iked:*:101: _iscsid:*:102: _smtpq:*:103: dialer:*:117: nogroup:*:32766: nobody:*:32767: root:*:0:0:Charlie &:/root:/bin/ksh daemon:*:1:1:The devil himself:/root:/sbin/nologin operator:*:2:5:System &:/operator:/sbin/nologin bin:*:3:7:Binaries Commands and Source:/:/sbin/nologin uucp:*:66:1:UNIX-to-UNIX Copy:/var/spool/uucppublic:/usr/libexec/uucp/uucico _dhcp:*:77:77:DHCP programs:/var/empty:/sbin/nologin nobody:*:32767:32767:Unprivileged user for NFS:/nonexistent:/sbin/nologin ip 0 IP icmp 1 ICMP tcp 6 TCP udp 17 UDP ftp-data 20/tcp ftp 21/tcp domain 53/tcp nameserver domain 53/udp nameserver www 80/tcp http nfsd 2049/udp nfs nfsd 2049/tcp nfs bin*Binaries Commands and Source//sbin/nologin1binrdrrootdaemonCharlie &/root/bin/ksh2rootdaemonCharlie &/root/bin/ksh3MHdaemon*The devil himself/root/sbin/nologin2daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user for NFS/nonexistent/sbin/nologin1nobody f]\W operator*System &/operator/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Boperator*System &/operator/sbin/nologin3operator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/ksh1rootA<bin*Binaries Commands and Source//sbin/nologin2bin*Binaries Commands and Source//sbin/nologin3uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucpD6Duucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2_dhcp*MMDHCP programs/var/empty/sbin/nologin1_dhcp^P^_dhcp*MMDHCP programs/var/empty/sbin/nologin2_dhcp*MMDHCP programs/var/empty/sbin/nologin3M@2@nobody*Unprivileged user for NFS/nonexistent/sbin/nologin2nobody*Unprivileged user for NFS/nonexistent/sbin/nologin3a  n}bin*Binaries Commands and Source//sbin/nologin1binpbprootdaemonCharlie &/root/bin/kshs2rootdaemonCharlie &/root/bin/kshs3MHdaemon*The devil himself/root/sbin/nologin2daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user for NFS/nonexistent/sbin/nologin1nobody e\[V  operator*System &/operator/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Boperator*System &/operator/sbin/nologin3operator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/ksh1rootA<bin*Binaries Commands and Source//sbin/nologin2bin*Binaries Commands and Source//sbin/nologin3uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucpD6Duucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2_dhcp*MMDHCP programs/var/empty/sbin/nologin1_dhcp^P^_dhcp*MMDHCP programs/var/empty/sbin/nologin2_dhcp*MMDHCP programs/var/empty/sbin/nologin3M@2@nobody*Unprivileged user for NFS/nonexistent/sbin/nologin2nobody*Unprivileged user for NFS/nonexistent/sbin/nologin3a  n}X`P)IѲ!@`hCa`h````Q )ؑ 81)[1T) n1  w1@TPB ~!|1 MhB"@ih CFj` FHh B҉hBh````˂ςK-Mh#Kh ( M.&&hB@iBChhh#D``,3:s +س 83+[3T+3 n3 w3 @TRBس |3?#~#h , hh``ZhBZ`hBBh",;3oJ(iBFpDh$ ݃FF`SaaN``Z`CfWaaDchCc`['QhOCW`h````;b *آ 82*[2T*" n2  w2@TWB ~"|2 pgE $@"C :FhgEzh"Bh````"@hhBbB#R3BFF @E,Dh$ hFF`PO``Lka+a Z`C  ZhBZ`hP/``h7љkh#k`;EkhRBjB7R;F˂hTh$+OKhNK4Dh 1T44$d$ Fv?FmиB ҪBg@HEhF!D`ѫhDDD\`Nh3 6K`DTD?t$c#D8FAC:0B;DDG0pи!K"hZ`!Sh (!HS`Y``J0hB`JhB`h[h#+$hFCDB``s`0ςt˂phFKHChuh/F1ېP,B"%B(*F:$***O!`a` $*``!aaa#F"`Z`` F! F˂-MF $M T .̿(OEEOK WhhB'Dvh#ԊB' B `GG` FT<HDFhV``*$*'*!h*`ah`4h$*9ah4ya"ia ai4a2F!h`ahQ`h`0F!F; `JS`{hH{`E7h8Fh``hP/``*$*%*#h*`ch`4h$* ;ah4{a#iaci4a#h`chC`h`!FUF0FE48FhP/``*$*'*#h*`ch`4h$* ;ah4{a#iaci4a#h`chC`h`5FFQ!FF(?߮T<#[DBP<#D8*$***#h*`chC`h$*`h`#iaaiAaF"Fh`QhY`h`!Ft F0F)˂0* H0BDC`0ShCS` +C0ShCS` -AF /ؽA /'-̿%%(D F(9F5 ~{BFD@F@>3+X<4#C3Dr`ZhBZ`X<#CH<54Fch#[+ `C0@*h9K`B7HQo (F583HGo 'R #(F~-H8(F4(*H1o (H+ ++k[Eѫ+)XFF H*o H$ sl"0+ 1hH0h!jF #@h Fb]dx'V))0)N)\)xxx-AF*H FFFx"!CBF %`@F;`)F2F b "hH2D:`!h h)F2FO3'H % `8`[-O3@F1FOR @F1FOR `#h+HO0yCy\)'yopG0oF(Fn0nxan(FtRx(FlH@* Fn+FF0FHC F@H@;}}FF F F(F FB(F!F h#H##)8F 4}-MFhFFh,f0F F2HPP1H@X=б"!FnFZ8F1FBF AFOR+ F$H GAFORD8F FxH?R?2s`1F2DH?R9F?2H:D0F9FBF w Ha$ H>F`0F F}~~=~]~~~\)-E )O3`;` F(QO!"@FF((0!FIHr7!FGHm F$EHU F<CH FKAHAHF+?H  >H@ PF 8;HB:H0>%ih-BUEB!F4H5(clc"0+*!h0H* h!jF++H!F F (HchB%HO# ch 4`;`FF#"2`:`у  BҫBH(FQF,F|~0)~\)*>S@}bl pGFF FFY(H F(HO5$ F/bh!F8F Fso3o#c`*F!F8F % Fqoo F H(F yÀ$"FKP# M$ C4@# [h `hFL ##`B:]"@#[ :P#p]"`@#`CBOCѫB B:]"@#[ FF!0pGػFFHpGF NV4OBФ,9F47(F$h8FP 6 A2F!D D|.H1F"D  3F>+rB#$H$J ;BBH"D 3 ;)?HJh };B\=T=X=ς`=@#)?ѮH Dv!D2F  RH1F"D4 I F3F>+;Kh)(J`2Jh`JhhBѕK`Jh+ۓI hBАH3`hBĿ#`hBЍJR#P5M 3 ;)F F F8BFhwH"DzHxJ ;BB K"@FT !FD@FB=(?8D/OsQF%!+2h!FXKS"SJ3h3h+ȿ#3`Bȿ`SJh3`2h(FJK`0F@FdF4%FƲ ...8.A. .;..+6#Hvh)$!AzEzZ6H3H3HZE /HP/HN/HpL-H#{,Hz)  &H&H%H%H%H$H&ieik $sC #aCcC"K""OAHpHpLɄ΃냂,?JT[jo/&xF0###rFz+*HV#h;+ HH H HHHHHH8ahHJE F@H@)؄섂+]X*.$P@z+ @BO0-MFFF.!F MFH0F h"4FTFFFXF" ^xFHAFZFd" F PxF#HAF"F "F@F)Fz+ HAF2FO58F(FJp-M FIFFF F8`I ````d,  I P` MHFxH.F(F ((FI ((F:! FX(F !  FTFFFPFAF:Fa(ՀЛ XFrI XF" xFP(CkHQF*Fo O;8hz@i/cHQFBF?( _HBi?!!?##? D%%/+D!!D %B#+F DFIa,`d  II PPл?O YF"FFp?HYFFZO%8h)F"Fhl FE!Fx" 5-Ѹ Fx"F w+H2F,4I " F !F&H#=hji?$$?!!?!D$$/OB D!OB!*!D DaO;0F^Fu0F :ȅӅb]󅂀;]hF1U+O01+ѐ1F60I" 8RI" ( چ-MFCiEnF3`#@h 3" F 7$#FG(\H2F F8YH!v1!c!#!D;cDzu#` )V+ <+EJ)<, c,#,D<2Dc # D({`0H)`F.KAFcF+HF;k{h.*+ѻh5Bt0*+  E 0XF c #DhD;kh. FFCF4.7F䆂ꆂ@-MDnFF;`Ciz`"3@h#j 3 /&3FG(yHBF!U)Ѫ*sH;O4і1!c!#!D;csqF@4њ *𵀸jE@(*К :(*   Ey(n*RkOs` 0 c # DCD+`0 c # Dk`0 ;+  5I5I5I5I5Ija2 ,2I 0P0ISBSA:kdj @3B0F((Z0$,,`dk`Os I` P@&zXFzbYz"z{hDDj(;k{h FFcFF ?e]?`` F7Fdkr{:Ci!3# 3En @h "$#FG( F0 @BO0FFH! F F##! F](FHO0 h@h( ss"@`pGHr"I䇂 (  pGF(KbhS20Jh* "4@ B shB O0sdF( JchR3Ch+ #4!@C41O0 d-AFF(KgBFh!F(FkhV7+ #4!@"41O0 d[ pGF L K JZCB HQ( q, @ F0قق.F(@փ"L #<0 F\0*F#&(@h F"DJ0\0 #<0#\0OzqF Fe-@h?c#dbdde-   MMMO5M`MhU&PNXPV!6&cE!fO\@fiefHf9? !B@" !2C0AO3DO #"#$#&#(#*#ĿOscfnOsfjX" F< "uyHD#<0#\0 F"c(@#f#^0h & F_F(؀? F1FP(-#ٖ0! O`C# C CcO{OK"BR[O[OZYEJ:PED(O4 F ]-MFF>F ]n#(h iFE(FF EQF'H( i. ##0n  "(F #8F H$. (F"F #0#$H(FOzqw(4FBѫnWFo$"!H -"F4!"!-H "F*$# 0!"!H -"F"F !H !BH - "FkiGk[iGkF[jGkFjGkiGkjG00H Kh(GpGKh`bpGGKphMNԱ<"! !F D# K  K K K fjpGekqy8FKhL F)F QjK`8o8GG}{ywusqomkigca_][YWUSQOM@0Cs0*@iG#@iG*8F#*8F "! 0FB.а_аOаOаaOа? ЫH!Fz 8HuH!FmLP0 @LP0 8 (M@iG@jGFCj F@GFj F@GL I FPF FT HlLI F>F F@_HlH~HHkH (FH !Y!FH@SHDHpGςHqςRF g}۲[#q$ @"spq#strLsʲp!qs# 0#q"spq#st$rsʲp!qs}۲ppGF#}۲ x}pGp$FF(F B+]&04p8$K"M`\"!FHR4,8GIG9)   ""K`pG׿pGG FCx ++ !+"+ i"I ##b  lЂ5K-M\#4M{CPX@3X+D\k(FBF3FM(FBF#FMN(F2F#FM FO0ǒ(-M=H lpG@Shl!(/!hlBRt($hl!(hl8!Ch+ OCOS0%"0"W(hl8!(ORhll!E(hll!(hl!y(!hl"bB"((؀hl!d(Ѐhl!O2(ǀhl!S(hl$!"J(hlOq"(J,!hl(hlOq/(hlOqOB(hlOq(Oqhl"t ?B0F,x*m(F)lSh#B#S`"FOCZ@S(F)l"S)l"(F-P#(F)l"H"F(F)l"F(F)l"FCs9hlh!(;h!hlBB(1+mOqhl&ZhBZ`t!"hlo+mhlOqZhBZ`e(F)l"CHHLP026kA3B H<F.H5O4 F꓂㓂K"`pGT8KpFFF3,*OеBѵ B3!T" F#H` eds)D+DzL zM F#+1+ ё*1I0J0+10 1+!1K0%1N0zBۑy(F" pI0+ДJ0+ДK0+I ! A e0 p8 FF J FhY` I J Kc #b Kcb Kb Kb K#c8F8TE/,-,-KhBKhS pGtЂT@hpGCiB҃i 0@hpG pGjCXBXApGi2CjB#jD!biHOr I#j"##b#cb HOrIH@sI@hHf`@`pG8Bi0hZ`Bh`pG8h#BF pGFpG8F F81Ji1Ch`B`K``pGpF@,@FF@I@"@,C H!@,Bl,&`aOce`a FpzpFXlMBmm)jD"BCee 8*bBe(F0F)F0 dP#m;#e#lShh!F dp0F dpFi8@I"IHl1H(&! %%%!#  a $  j(  j( b   ah,F#F@G8Fqj, ݔBiFD"F*jD,b8-AF(Fh.zi` +܀h)FAG++ЀSjz *!@AB @*@Ājz *#i{+{$iC!#B+b|pF(Txx(FC" 8F"F 9F'HvD x(FCF>#H#Hj8"H"H%b% ' #+bip * **+zzC#Bц$ z%0#'0&0+{ H&0z'01O0ėݗJ{-AFFFF4h dc<@DE=-O0 pFhCh[hFO@AK%0@+"FȹphOQ%1 FClCCdlCdlCd@[OSF0Hop Fpݘp FF!D F!F!6SBO#cQa#B ҲBF)FHO0p p$9Zh*Fh 9CC hC `pG-MF _# H98 F+@݁$+OAOA ]0 D FFH!`"XF! F0F ##  n3 3C0sh+%m On  ph(<E %8(!AAAAA!OCA0BB5P0F ]8%PP;  @8K F%`"e``8{HF@+^ݨF(OqAHa G8'w'BF#P08AB+ O@ +BOq! CPF :F8YH8F 5 < @ I<(:D+8s"c bP5Z`FIGJ( F`0Kb` FQF; `XFF4 F#DF-OAXh FaCh?C`hC @;0K"(.HF e=A8+Ozx QFXF Fh @ED!H9F-OA"Xhh# @; K( H FV0Hfę0. *R*P*Р*@*"  n @C f""ZT """)C# F9 OO0 O0 /0OAh"#@;Kf(Hom 噂OAh FC@;KL(HomOzp 2 )D0 pG-MF0FB2H@0pC$Bд#OB3ByFHBр ,hB),@𐁚 0C#0X OPHB}JB7д#O@v%HHB'њ 0C# ***@bL _7L4%xcz+D|D/۲+&+@N*%L$%L!@=JBњ0)+@=L%x#O д O@3#%0# 0"!d+hB B ]B B B B B B B B B B  B B B B B B 0C 0 0;A@񨀝 0C 0%*h"*A!) )@CH))@XF60"p"BC6 RhlCS.@A@@@BCS$".Br(FA-*`(FOq#s"+`Oc8# @C 0?y@H":7%)h!* B"** *WC  * **NC!.C0[h !S# # @" 0+`0h%,F%L%  0C#EFEEEF4-!F*Fn Y B3BB3B?8#9#9O0xЂJFH m F@dU-MjLFFg;:FDF(@ŀxh!h#C`^K-(]Hn@cY  !`"hD{haPFJD 0O0C00O D8PF `@"Pc ![h5 Q``"PFbPF `DD T :OPF.JB6X(NqJB?BQYhXKaYXh"KpyxB"Bp qyxB"Bp q h #C ` lC d h Y6HhB#Q `O0o U`xЂt,$O0-AOxF FFFHy'GE #C`(F!FsFbFA AκO0-MFFFHiBݏIHiOs+@O  F(`#` YF``(``DO` F a(ހ!ZF`h i!3"O B#Os#CCE`!`h$ `ON#i D@>EO@QFa[h+ O@@@9NO@0CP`9)FI`FDKA?!  FNY```Q!a!aQ!a!Ya@Q!a!aA!a!ae/Dz1!DC`h > iDF80+h5F0FA`;chCE?&(F!ph( 0 F30ph( i>`h: F7 p@@p Fh pNhKv^C i@0Fh*h!hXh!X`3`(mD(mp-EFHYhhZ(40 ;0xz0#{hBhAF@FhA`; F`PEH FO40+hh?FO48ixh8F FÚ-AF"F FGF0 -,A4OztD0F)FjFHB Hom$E 0F)F 8 FO0o𚂀8 F K" L`#h(Fzo.8 8 J JKphL+O"`Nf%3h =IH^O0p # #`p f%w h= nK"`p@J@J@Ja I! I> !> (O0'6' FF9FFy(\I 9F pYI> 9F> h (b(@PKOr`S"`#<CJKh+#h+ #Cch+ #cCch+ #SCS7;JB#C#p#CC#h+C@3ch+#C@#0JB#C#|CC#h+C@3ch+C@#h+C@ K< I`ST/* hB2B`3B  I  F I> !> K "; 3`3+`'6 J@JpPpP@@JL JLJJh1C@h1pGVKh "`Kh$ KhpKh "`pGVVVVJh1C h1pGV)L#h(F%N%M7h)hzm jB#Kh+:!K"`+ݿlBFi9FD/1hJm*hKejB#h1C "h'1 CO`7 /#h12h+hRmjB /VVVV-MtL#h+sM+h1X #*h1"h ""` C*h1#heK"`#hcN+w*h!o )h)[clF F2p8FF?B3h+H##`E01C 10[z +BK!:Fh0[z+#h+'9K"`# *8FF(4K hd_e3h+# -Jha;b3h+#3`#h+#h"I+?%KhЉjBF+h1C(h1 h # `hM#KhAKhձijiМB,2DO(F!F-(F!F"McVVVVViK-Mh+ɀgN3hz䲣eK !"hg`K!"hg [M!"(h](h!"+RK !"hNK !"hLKh*j3h3h+yP$F.F FD 3"# #: F  EAF@@ ZE*"FFF# \YA#C!F "!F#\B BO  7?B FDwFHBD5XFQF2F+FJO0L FFF$HF;D? $!@O7^@ XFQF2F+F@"@($ FcD$ #2C #Z?% XFQF2F+F(ѯWбL#!h11( H ! F Fj!h1 dWXiF2@ ]*0F KFFhcKhP"E#F0dWW F|`h7 O0 CFF EH3( H9F)O0 TE 0F"F+FwFKh(h0"M O0dW-MFFF >OjCl0FiFi|i 5DD[ FPFsRlFi DPF " FI% ( i 4QFUjF0F ~F)FL)FD0F " F[F 0 -MFKFh#i 5Bli p!F !"FF !( $hi 3O 3 B@ӈ#UO4 'O3X`EZ. EF&BF1F[h[F@(ZFXEFcBc `C X EXF h"XFT wHXFM  X*,&FnO SE]>hƹ!F j1F"FO6FcH0FobK`bK``N2hB8h!F "O3:`02`@F"F[;`+SHO0G4`X0@B!"F;hJHX0EJ@` J;h S*(c 3SEۀ, F;h ù!F "FFF/K2H-KO2`,K` B8h\&KO1 ":``!F F"F;`+@K\h@B !"F;hH\0J@`JhF!F "FFF HfdWlWĜxW<т-ZtWKO2`K` BKO1 " `!F fF"F0+@PF1F;hFS nK@hB!"F04gHgKdJhS,0@`PF1F09#FsCH3,"F[B:h ;D¹!F F"FF4QJOHOKO2`NK`0 B8hxHIO0":``!F F"F ;`+@`0@B !"F;h5H`0@03KhF!F F"FF*H KO2`K`t B#IO0" `!F F"F0+@PF;h OFS ;h@B$!"F0i H?pW@тlW$xW<тZtWi`Ci" 2 h A .D(B^FGI*FGHzzh; AD "dCF@h)DG(l 0FFF xAF ;FxS ! *ш*" @F|"Nf d@F1F FD^^F 6B3x+X0F <, 0,lf 6d0 JKCB3 XXW$XWWvBWH1F ".5e + к  خKh +FOq@r+ FJEӧK`A> ++OsOcKE0t*F +aDD;F!FF(@opH!FFH((EH9!F"BEOsETFN!FOO 0hFR1h"l0h}KF "!y"B2Hpp0*!2*1 )@Fw2!w R *D 2wHw*Ё2QB)܂1 "B2BЂ"!r  _Ys  FK@ ,耻 :IfQd BCBF "0h 2h < 2_2` ;0,Jfd0KCBO YF  "HYQF*F;FF(*F;FH/P!F +OCa #rm1h$ H,Fȱ H%W XWWWŠf0d@JcChJF(HO:PFഛ1Fmdh{ ,} XWޠCix"M3# 3(` H U$ !"F(#O6+`pI"F(6 I"v8RI"o(0FF(XW9چ-MmF#,(^ ` +`p 7 p 5  $| &J h`BЮH1F;O0 +ѤG#" 1F0G @D "! O3#qC()F;/+\+||=| :+K# :"/)\)F)| !T2Dx3/*\*# :3#{K&#Or FF5F * K tKsHDFjpK +&#  ! F(6#0 < <+ 73 0  SӍ(FM,<,*[< +F8 :8+(<  BHaF40+  ?HWbF5[ **@ہQFZF9HH :+ B7(F$ :+<0 +(H  $/"'+$H  W$ #~|$>0|<9(sCz@Os gO p6 +'ѽ0B#(N J@&B"##$WgW 4 .&B4##+ :+@NQFZFH Fz+@ FD+@ (@/$!F "(FG-x+@I$"83F+$ĕ F+*l/*gi"p3DxF3/*\* :*O ##'P +F#0DOs 0@)FnJcCckL 0SC Sҁ"x #*0āzq#x+n#[HYF:F" :++@"##\*єO3 :+O VF$:i+@04F l )O 01 !PEq  !(q %gyAPEq FFSC !DFFF F#BA1F(F@ ++OsOcKB#kAFF#ekaF FCX#FFBA O1FSF:FxHsO4๡WWҡ# e  kFF;DF# C #T:1FSD:(Fx ++OsOcyKBk7FE{N1FCB([ ++OsOcjKBN# C FF.9F*SF(#1F Cs#: e SD:F(F! ++OsOcB8FF9F*#F(X#]AEDKDH$ Fx+JPHc{)F;J #F44+?wz73HaF0c  0HibF BݭOs 4 z'H7/"D0{#H  i #u<(?ʭ 4 3 #)F(FH^: ++OsOc KBz׮ :& mBW#" # # ]%L#h %H.%H#hh;+ H H HHHHHH#hHYh h F H$  "H &@+@ F(X顂섂+]X  8#!"#z]!"#!#$@ ]$"#$#еF!F HFF} F###2F;FнM𵇰F ggFH)FV FpGC-AF Fg !F H@ F)F2F;FAH3O0YFhCh-M:\i+CC`;ou~khi;8a,DY l%jDEp BكLBDҤFEE 6B" D6BeFF+  FE3DB$ϳBBDҤFEE 3D,3F kxD .P"LFa$<`l < D.P $<` La$BBU`]`$@2< B`acc !-M!'F%1)BB 0A1@\5!@\&%h1=fB(Fh@$ `p!PQph`&pQpP`T!6`1)BF&7F 8>F87/6.0-@-&'m& 8> X>6.D'&B7p_ xG7  ' $`6*N OrO2 J2FN J2F " " 2 *ѺoAO2"FFL,g:@"DA7@L<'@L,B8 E2.F$ FB8@ q$F@D,Ѻo hO .phdD`phD @4{ B @ 4@$$`$'o  "dD .b9D)A 3D DD%DD%D D%D D%D D%D D%D D%D D%D D%D D%D D%D D%DD!D%DL D D%D&D>DB;D%D FOq(F FOq FD@ -MF (i,Ch+@|#hk +k ##` 00##h+gS $(_vHXjhS #:/+?@6D.ٚH2B &FF "#,0#-0a##`a2""a"jO1c(! T)K0##`+(- bj3B>K"Faca4  # ##`5F}/?;?@6D.%a+~K`O}K#j"` ՠi ",P- -Pa&##`5F/;?@6D.#j]`#iՠi "+ ,P-0+ -.0/Pa&##`5F/;?@6D.#j겚`* `#i ՠi ",P- -Pia&##`5F#ib. /„+?@6D"j%dUasРi ",P- -PC%a#jaF.F##`#i[,!lFB(F #jsi`ZiiR DBAFZFX#iՠiAFZFa#lD#d#l+@o##d##`#ic5/d0O !j  ?a"l jB>Q!d0 E"iՠiAFZFaDc9=oT"ja##d##`#iS,/#0O !j  ?a$"ljB>Q!d0 E"iՠiAFZFaD"jSb##`#i. /+?@6D"BиKz&5F"j"@#b#c FFka4x/˃;?@6D.+b+ CED%a4P% ##`.Fhs p 00ccN#a40 ##` +ch{&@#*/;?@6D.mc`+++ #Kd #ceK#e#e##}K0##`>&@. /U;?@6D+ CBnK&#"d5F#`#l+B(FBF(F/AFZFD[D#l#dV/;?@6D .D!"fcfO5e+HK#f##`mnB. /+?@6DZf=J>2083$ "n+Yf4I1083$ c fpd"#ceTCx@B /;?@6D($؞B /?6uD@S82f$眣R ãࣂ(vE /X ?@6D@*>704>1(vE /7 ?@6D@o0/% ?@6DvE@o 0 vDODBٶK0##` 0^nZ83f$#h+?5cfd #ceF2F :Fhk/cjb +kjj3D+cB/cB<b`P]03D00+D0i+Dah{u#i*F iIua4bhk*@""D#h + ##D,0 + + oFoo i~hJB Ci+كi+4 o pG JB Cj+ opGo pGopG /Ci+ٌ CjB؃h*DD  -AoF`"FFho 3`<k+*))))!F@F"4x!F+ @F!F"h# D@F9F04(F$4` o(] o(]#BsFF((0F!F( ((ѽ+h3+`-+h;+`+( -O0 FO0pFF FFF%DB F9F2Ft4 FFFF F8khB0F)FC Fo7F F(F!F-( (,o F(O0 F0hDDpG-AFFFFh\a1arah7`B<`` O0`hD`,F# `E"i  `bi``X#"`` eeeCepGo#m FDFFFBF Xp\`B>DرB3  B(ЯBOюBD (O4B 5tB,P%Fc]EX\0SDB E ]E - 5P5@Bd5SRB DP0!F@( F <>pFFF H1F*F Fp#pGsF&% F "UòC%#x4>(p)-MFF>*<LJE$jD4BtCJFUF ]D )F@FG(ܲDE YDE ѤEeFElh hh hhhp FFhFc`h`#``#)hO3Ph;`p-A$FF%FB V)@F$0`5 Fs@+ Ѐ+FFA0 FFk@ FH; *p F!K"F`p h @&B(F1FI5(F1F)6#e``h! `0 p p,XFK"`%'chB"hX+phh5 h##`,X-E FFFF.4%eCF{hB;hZ[Y+ Qh@FRF0;h FD55`45K" `0`,X-MF E=ah&X#h)FO  Y-i#SFUEGXFQhF(@+5Ѹ2  hAF"0D0G(K`#h3D AF"G(`#h3Dh3#h@F #h3Dh+c#hjD>`@߀ahPFVF9KBchVE[##h S 0SEIQh@F(B+8Ѹ5  hAF"XD0G UK`=`#h[DhUAF"G NK"`##h[Dh#h@F K#h[D`h#CJ !`;`|#h5F[D3;`sv#hS 0+VF+dѢhchB "_%+3F]CF#h C#h@F  h(DCh+Ѓh+Уh03`. h(D0  hAF"(D0GH!h2F F)D1K#h+D AF"G@!h2F F)D1"!h D5=`%"K`%=`%(F,X-A$ FFFF" !F";FG" 3h!1hT@F!";FG "K `0F*F ,X-MFBhFaKO. FPXE    DD HZ(O0 FXKD孂JjL;:۲T#0 Ћ9KFFƱW_>h@ŲS%P ŲS%P ŲS%P ŲS%P l2DJ?<۲R#0 CC-MFEF'B (F" Fe "#O O .w ۯBBҶA K BBӤe C _[ O: O6Z  F#H,o RIFF3x\pGFxpCH#DBF#Spx;A\ FB;?+pG DDB;?+FFx2,;+/*pF#F4x-F[&F[%]uppp8/;*XpG8 DB O;,#XɲF;B+FpGFpGFF3x)pGDFBFx2,8FP0F )F{8 F80F;CJO,УB(F0F00F$Ͳ<E#FTD,E;"DDB0B0@ F D+T;E?"!DF; DBKO0BЈBBBKOBMM DDB?x1 -EFFFWF0FRFFB4D FQF:F=( F DɲBFKBF pFNB%F(5F(FdpF,Ozp<-AFF"FhFI]I"FmFVO, ,FFo<?0F I\-U-"p5 -F$4K& %"D '"O.01pDB'JC F0Ap  !YC !30p #SC "02p B03qF-M'8NF##BBPFF%FTF,I##R # F$I}+ D#  # O.01 D DD O!K ! 0  SC0  "0302 , <Z| pFMF) FF(F  ">sB+b+FYB($ !#F"DBFp|-MF!x@ к O  H&ɲ*sRB4cCO- qHѲ  A\CFFJ F FR8F B;F $F)F:K r8DЅ5 кO0*p5BXjp5F0$ $)F:K r8D0";B+j;F;Y\/ !F*F;(((-MFF3x+ %+$+p-+ D?++ + #+ D@0+DDD0 )'O 1FF;0 (70?*+h6/BDO7F3x.+ sxp0 )#O F1x0F60  0;F*+ h+ F0FO3 F#xh)L.Z.t) l) ѐlцL!O1F0xn($c( %($X($'d("i( s(%o('p((u(x(@D   #?/;h5, "?/@+(Fh:F6rxa* I*>  L)2"&l)hF! hZђFO t)ђF h)F)O{RF(F[FFBF6+pxN0+DxCx,фx4]DЃ""*"* "F 'F;\Dy0;D ;۲7;B0`F#`FFFFo F:FBx*3B *(` x-,н@0@B-MFx0+AxCx)сxDЃ"4*"0* "F! 'FFKPDѾѽ0<D <7<BBҠ E F,R$]pGQ % H FFF# LF O4cp(F !o&F014F F0XJ#`J`J`J`JK#`pG^HXPXTX\XX-MFF@I'`0FN"OsI43RF&〠b:F'qfq 2FAQF:F2FA=Lт^\XpKNHhF1hhJ@ LB Kh H3h#`!`(h"hIp@ _HX_PXL_^Kh yJA1hB L#h3#`+ H##`@=@`HXLXXXը*-MF FFFFH" [+K[oyy/vMy-s0+m*FAF`0Ba[++*Y PF@Or1F:F4?*F@F!F::F0F!I5YF F*F0PF/O;hc" KhE M(hAF")!RFN FF FLGAF"0h0h!h#;`#`+`^HXPX^_TX _-E xFFDEt!x)qfx)5Fj) ))_4H)^)' )W;) :)U5)S6)03)L+HB)KC)*E)H)H"@.&H2F&I #% ?. H2F!I@#?%PF*F# 0 H.H2FI#%l}H*F=DlrlH64DL_^__LV^`nT_&~D)-MF@jC+@g+@cx#;+\Cx+@Xx+@T"AF(KHh#BEP#@B3KhF*f9FKBF@.3Fx*'5*ћx+@!Zx2D9F"CE0F)F"1F#H1F"KlH"h10F{ H1F"I xH"}H##`|KhyIFzH ?*Ѐ*@ƀ"`gKB)FkOA0kIO !&KhFHjFk(iF"mk3hB%h N h9FjG(K" ha 3hBO0^^O;h LM#hF+hBHA.` `#h@?>hM8h!h%(+h[kB+`^^^CKhK(FpG^_K"`pG^pGKJ`J`"K`pGف^^_HK"` @$g^8&H%LF%I(F#I(1(F!IX!(F F&#h3#`Kh@ 0Khұ `KhJK`KBr`K`JK  #hB""K`8p _) /y^t__ف___ف^^KJ`pG`pG^فKhpG^F K` `K`OzsKK `__Mb_#)0+9D  pGOs0B  ZK )F`XK`@WK@uWJOs@R@BFFB/F[Bܳ[O)} By3[m  @qBЍB Bbѳo@B[0F!FV*TemBO#x@*J+F F !(@"+"JhB32" [ 3cz+#}+c}+H_0F!F*F+ @I[8 HhG^x_RтDт _~^K@pOrF B   pGRтFK@w"FOsdBJ0`?H^`0 B^;J>;I1O` ":K:L`:Kh.K88JhY.Kh3h)2FD#hCE8;B6-M(h(`h"H)h hOzs!&JXCE%H"j)"HRk[;+ HZ"K`HMD~~~dтۭ|~x~ t~㭂筂$聀Tт_`тςp~b&-E^Jh3`JhBHI@ H K Ihw Kh+н@#t~TтVk`т聀~-AfH(! "OcKcHcN ! "D0`1hz^Hw\KOzr`\K\Mh/x[L0ϹZKZI[HhBڲ#} FTI"N!FSHpP(F:!F8 F)F"<p (FJy" F/#0FBM>OFBH,AI;FAH*F&@I h[@KhD8h+h @#@B HIBJHCBB@B#OF@(s@(sA@(As@(so@(co@(cAo@(Aco@(c_@(S_@(SA_@(AS_@(SO@(CO@(CAO@(ACO@(C?@(3?@(3A?@(A3?@(3/@(#/@(#A/@(A#/@(#@(@(A@(A@(@(@(A@(A@(H@BpGH@BpG8 Op@pG#H@BpG(ȿo@O@&)-@@pG@ @F :@CRBcF@CpG@@F :@CRBcF@CpGOCxGF################$ $$$$%$,$3$:$A$H$O$V$^$f$n$bX]bX]brʂꂂ^]V%9FGEiEE  k }  } { {}   k }  }0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z- dH2 Ph"R 5 C2 PhXb 7 ?ñ2 PhXb 7 ?ñ2 Гh8(HDH'@BEVeu˥ޥ󥂀1JPHpHHHH   # Tdd2X }, } } ^ ~"  k }  } #(-27<FP"J"J`"J #J$#J(#J<#JJ8J<J@JDJHJLJPJTJJJJ1JAJAJAJ AJ$AJ(AJ,AJ0AJ4AJHAJLAJPAJ`AJdAJhAJlAJpAJAJAJAJAJAJAJAJAJAJAJAJAJAJAJAJAJBJ BJ BJ$BJ(BJ,BJ0BJHBJ`BJ CJDJ DJEJ EJ(EJ0EJ8EJ@EJHEJPEJXEJ`EJhEJpEJxEJEJEJJJJJJJJ$J(J,J0J8J@JDJHJLJPJTJhJlJpJJJJJJJJJJāJȁJ́JЁJJJJJ JJJ J(J0JJJJ JJJJ JJ J(J0J8J@JPJXJ`JJJJ J(J0JJJ J(J0J8JJ J(JJ J(JJ J(JJ JJ JJ(J0J8JXJ`JhJxJГJJJ J(J0J8J@JHJPJXJ`JhJpJxJJJJJJJJJJДJؔJJJJJJ J(J0J8J@JHJPJXJ`JhJJJJJJJJJȕJؕJ a0Ja0Jx0J x0J(x0J0x0J8x0J@x0JHx0JPx0JXx0J`x0Jxx0Jx0Jx0J{0J{0J{0J8AJ2.Qp:Yxʱ -No0 P%@Fpg`ڳ=^"25BRwbVr˥nO, 4$ftGd$TDۧ_~<&6WfvvF4VLm/ș鉊DXeHx'h8(}\?؛uJTZ7jz *:.lMͪɍ&|ld\EL<, >]|ߛُn6~UNt^.> !1Aa  0@`@@A@!  @a`10  @ #+3;CScs`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O      $$$0$$JL^XZ*EHCI Host Controlleru-boot  usbd_rcv_completeusbd_alloc_urbusbd_device_event_irqfdt_fixup_memory_banksv7_dcache_inval_rangeset_default_envv7_outer_cache_inval_rangeext4fs_devreaddo_env_exportdo_env_importusb_get_configuration_nodo_bootvx_fdtfdt_find_or_add_subnodeomap_uhh_resetcreate_int_queuemmc_init_streamomap_hsmmc_init_setupmmc_reset_controller_fsmomap_hsmmc_send_cmdmmc_read_datammc_write_dataomap_hsmmc_set_ios(((((AAAAAABBBBBBbootcmd=run findfdt; mmc dev ${mmcdev}; if mmc rescan; then echo SD/MMC found on device ${mmcdev};if run loadbootscript; then run bootscript; else if run loadbootenv; then run importbootenv; fi;if test -n ${uenvcmd}; then echo Running uenvcmd ...;run uenvcmd;fi;fi;if run loadimage; then run loadfdt;run mmcboot; fi; if run loaduimage; then run uimageboot;fi; fibootdelay=1baudrate=115200arch=armcpu=armv7board=pandaboard_name=pandavendor=tisoc=omap4loadaddr=0x82000000kernel_addr_r=0x82000000fdtaddr=0x88000000fdt_addr_r=0x88000000rdaddr=0x88080000ramdisk_addr_r=0x88080000bootm_size=0x10000000console=ttyO2,115200n8fdtfile=undefinedbootpart=0:2bootdir=/bootbootfile=zImageusbtty=cdc_acmvram=16Mmmcdev=0mmcroot=/dev/mmcblk0p2 rwmmcrootfstype=ext3 rootwaitmmcargs=setenv bootargs console=${console} vram=${vram} root=${mmcroot} rootfstype=${mmcrootfstype}loadbootscript=load mmc ${mmcdev} ${loadaddr} boot.scrbootscript=echo Running bootscript from mmc${mmcdev} ...; source ${loadaddr}loadbootenv=load mmc ${mmcdev} ${loadaddr} uEnv.txtimportbootenv=echo Importing environment from mmc${mmcdev} ...; env import -t ${loadaddr} ${filesize}loadimage=load mmc ${bootpart} ${loadaddr} ${bootdir}/${bootfile}loaduimage=load mmc ${mmcdev} ${loadaddr} uImagemmcboot=echo Booting from mmc${mmcdev} ...; run mmcargs; bootz ${loadaddr} - ${fdtaddr}uimageboot=echo Booting from mmc${mmcdev} ...; run mmcargs; bootm ${loadaddr}findfdt=if test $board_name = sdp4430; then setenv fdtfile omap4-sdp.dtb; fi; if test $board_name = panda; then setenv fdtfile omap4-panda.dtb; fi;if test $board_name = panda-a4; then setenv fdtfile omap4-panda-a4.dtb; fi;if test $board_name = panda-es; then setenv fdtfile omap4-panda-es.dtb; fi;if test $board_name = duovero; then setenv fdtfile omap4-duovero-parlor.dtb; fi;if test $fdtfile = undefined; then echo WARNING: Could not determine device tree to use; fi; loadfdt=load mmc ${bootpart} ${fdtaddr} ${bootdir}/${fdtfile}, 0123456789ABCDEFarocsdxbim 0123456789abcdef#EPTGMKERROR: %s - start address is not aligned - 0x%08x ERROR: %s - stop address is not aligned - 0x%08x usbethaddrCPU : OMAPDRA%x ES%x.%x PMIC_GPIOSDRAM: identified size not same as expected size identified: %x expected: %x Error: ABB txdone is not set INVALID OMAP REVISION (fake run for tracing)machidUsing machid 0x%lx from environment Starting kernel ...%s bootargsFDT creation failed! hanging...Bad Linux ARM zImage magic! Kernel image @ %#08lx [ %#08lx - %#08lx ] /memory## WARNING: fixup memory failed! Resetting CPU ... pc : [<%08lx>] lr : [<%08lx>] sp : %08lx ip : %08lx fp : %08lx r10: %08lx r9 : %08lx r8 : %08lx r7 : %08lx r6 : %08lx r5 : %08lx r4 : %08lx r3 : %08lx r2 : %08lx r1 : %08lx r0 : %08lx Flags: %c%c%c%c IRQs %s FIQs %s Mode %s%s undefined instruction software interrupt prefetch abort data abort not used fast interrupt request USER_26FIQ_26IRQ_26SVC_26UK4_26UK5_26UK6_26UK7_26UK8_26UK9_26UK10_26UK11_26UK12_26UK13_26UK14_26UK15_26USER_32FIQ_32IRQ_32SVC_32UK4_32UK5_32UK6_32ABT_32UK8_32UK9_32HYP_32UND_32UK12_32UK13_32UK14_32SYS_32resetting ... WARNING: Caches not enabled panda-esboard_name-a4Board: OMAP4 Panda ver%s for %08lx ... %08lx ==> CRC32 for %08lx ... %08lx ==> %08lx crc32syntax error ERROR : memory not allocated %s=%s ** Abort ## Error: "%s" not defined U-Boot# *?[\%uERROR: There is a global environment variable with the same name. %s: readonly variable%s=%sHUSH_NO_EVALUnknown command '%s' - try 'help' or use 'run' command IFS \$'";&|#;$&|exit not allowed from main input shell. HUSH_VERSION0.01showvarprint local hushshell variables - print values of all hushshell variables showvar name ... - print value of hushshell variable 'name'thenelifelsefiforwhileuntildodonebootdelaybootcmdHit any key to stop autoboot: %2d %2d DRAM: I2C: baudrateNet: loadaddrMMC: ## Starting application at 0x%08lX ... ## Application terminated, rc = 0x%lX Perform RESET of the CPUgostart application at address 'addr'addr [arg ...] - start application at address 'addr' passing 'arg' as argumentsTrying to execute a command out of order ## Checking Image at %08lx ... Legacy image found Bad Magic Number Bad Header Checksum Verifying Checksum ... Bad Data CRC OK Unknown image format! autostartyesAutomatic boot of image at addr 0x%08lX ... Your platform's zImage format isn't supported yet! bootzboot Linux zImage image from memoryiminfoprint header information for application imageaddr [addr ...] - print header information for application image starting at address 'addr' in memory; this includes verification of the image contents (magic number, header and payload checksums)bootdboot default, i.e., run 'bootcmd'boot application image from memoryloadosramdiskcmdlinebdtprepfakeRamdisk image is corrupt or invalid Could not find a valid device tree verify## Booting kernel from Legacy Image at %08lx ... Unsupported Architecture 0x%x Wrong Image Type for %s command Wrong Image Format for %s command ERROR: can't get kernel image! ERROR: unknown image format type! Could not find a valid setup.bin for x86 Could not find kernel entry point! XIP %s ... Loading %s ... Uncompressing %s ... GUNZIP: uncompress, out-of-mem or overwrite error - must RESET board to recover Unimplemented compression type %d WARNING: legacy format multi component image overwritten ERROR: new format image overwritten - must RESET the board to recover initrd_startinitrd_endERROR: booting os '%s' (%d) is not supported subcommand not supported ## Transferring control to RTEMS (at address %08lx) ... confaddr## Transferring control to Plan 9 (at address %08lx) ... nofilesize## Transferring control to NetBSD stage-2 loader (at address %08lx) ... /chosen## ERROR: %s : %s ## Starting vxWorks at 0x%08lx, device tree at 0x%08lx ... ## vxWorks terminated ?alias for 'help'helpprint command description/usage - print brief description of all commands help command ... - print detailed usage of 'command' %s arm-linux-gnueabihf-gcc ( 4.9.2-10) 4.9.2 GNU ld (GNU Binutils for Debian) 2.25 print monitor, compiler and linker version.callbacks:callbacks,.flags:flags,baudrate:baudrate,bootfile:bootfile,loadaddr:loadaddr,stdin:console,stdout:console,stderr:console,.callbacksethaddr:ma,## Warning: Unknown environment variable type '%c' ## Warning: Unknown environment variable access method '%c' .flags## Error: flags type check failure for "%s" <= "%s" (type: %c) ## Error: Can't delete "%s" ## Error: Can't overwrite "%s" oldval: %s defval: %s ## Error: Can't create "%s" Bad magic number Bad header crc Bad data crc Bad image type Empty Script Wrong image format for "source" command ## Executing script at %08lx sourcerun script from memory%-12s= 0x%08lX (not set)arch_numberboot_paramsDRAM bank-> start-> sizeeth%dname = %s eth%iaddr%-12s= %s current eth = %s ipaddrip_addr = %s baudrate = %u bps TLB addrrelocaddrreloc offirq_spsp start bdinfoprint Board Info structureList of available devices: %-8s %08x %c%c%c coninfoprint console devices and information\cecho args to console[args..] - echo args to console; \c suppresses newlineexitexit scriptext4loadload binary file from a Ext4 filesystem [ [addr [filename [bytes [pos]]]]] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from ext4 filesystemext4lslist files in a directory (default /) [directory] - list files from 'dev' on 'interface' in a 'directory'ext4sizedetermine a file's size - Find file 'filename' from 'dev' on 'interface' and determine its size.ext2loadload binary file from a Ext2 filesystem [ [addr [filename [bytes [pos]]]]] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from ext2 filesystem.ext2lsusage: fatinfo [] ** Unable to use %s %d:%d for fatinfo ** ** Unable to use %s %d:%d for fatwrite ** ** Unable to write "%s" from %s %d:%d ** %llu bytes written fatwritewrite file into a dos filesystem - write file 'filename' from the address 'addr' in RAM to 'dev' on 'interface'fatinfoprint information about filesystem [] - print information about filesystem from 'dev' on 'interface'fatls [] [directory] - list files from 'dev' on 'interface' in a 'directory'fatloadload binary file from a dos filesystem [ [ [ [bytes [pos]]]]] - Load binary file 'filename' from 'dev' on 'interface' to address 'addr' from dos filesystem. 'pos' gives the file position to start loading from. If 'pos' is omitted, 0 is used. 'pos' requires 'bytes'. 'bytes' gives the size to load. If 'bytes' is 0 or omitted, the load stops on end of file. If either 'pos' or 'bytes' are not aligned to ARCH_DMA_MINALIGN then a misaligned buffer warning will be printed and performance will suffer for the load.fatsizeThe address of the fdt is invalid (NULL). libfdt fdt_check_header(): %s - too old, fdt %d < %d - too new, fdt %d > %d", "* 0x%p [0x%08x]<0x%08x%s[%02x%sfdtaddr/* NULL pointer error */The address of the fdt is %#08lx New length %d < existing length %d, ignoring. libfdt fdt_open_into(): %s No FDT memory address configured. Please configure the FDT address via "fdt addr
" command. Aborting! moNew length 0x%X < existing length 0x%X, aborting. mklibfdt fdt_path_offset() returned %s libfdt fdt_add_subnode(): %s Sorry, I could not convert "%s" Unexpected character '%c' libfdt fdt_setprop(): %s libfdt node not found 0x%08Xerror: unprintable value 0x%plibfdt fdt_getprop(): %s %s%s { Nested too deep, aborting. %s}; %s%s; %s%s = %s/* NOP */ Unknown tag 0x%08X libfdt fdt_delprop(): %s libfdt fdt_del_node(): %s magic: 0x%x totalsize: 0x%x (%d) off_dt_struct: 0x%x off_dt_strings: 0x%x off_mem_rsvmap: 0x%x version: %d last_comp_version: %d boot_cpuid_phys: 0x%x size_dt_strings: 0x%x size_dt_struct: 0x%x number mem_rsv: 0x%x boorsindex start size ------------------------------------------------ libfdt fdt_get_mem_rsv(): %s %x %08x%08x %08x%08x libfdt fdt_add_mem_rsv(): %s libfdt fdt_del_mem_rsv(): %s flattened device tree utility commands#size-cells%s: %s: %s fdt_initrd: %s linux,initrd-startWARNING: could not set linux,initrd-start %s. WARNING: could not set linux,initrd-end %s. linux,initrd-endfdt_chosen: %s WARNING: could not set bootargs %s. Unable to update property %s:%s, err=%s %s: num banks %d exceeds hardcoded limit %d. Recompile with higher MEMORY_BANKS_MAX? device_typeWARNING: could not set %s %s. reg/aliasesethernet%deth%daddrlocal-mac-address%s: Bad cell count for %s rangeslinux,phandleCan't set phandle %u: %s okaystatusdisabledfailfail-%dInvalid fdt status: %x Warning: device tree alias '%s' points to invalid node %s. Warning: device tree node '%s' has no address. Warning: U-Boot configured device %s at address %llx, but the device tree has it address %llx. #address-cellsframebuffer@%llxwidthheightstrideformatdefault [ [directory]] - List files in directory 'directory' of partition 'part' on device type 'interface' instance 'dev'.savesave file to a filesystem bytes [pos] - Save binary file 'filename' to partition 'part' on device type 'interface' instance 'dev' from addr 'addr' in memory. 'bytes' gives the size to save in bytes and is mandatory. 'pos' gives the file byte position to start writing to. If 'pos' is 0 or omitted, the file is written from the start.load binary file from a filesystem [ [ [ [bytes [pos]]]]] - Load binary file 'filename' from partition 'part' on device type 'interface' instance 'dev' to address 'addr' in memory. 'bytes' gives the size to load in bytes. If 'bytes' is 0 or omitted, the file is read until the end. 'pos' gives the file byte position to start reading from. If 'pos' is 0 or omitted, the file is read from the start.cmd_gpiogpio: requesting pin %u failed gpio: pin %s (gpio %i) value is %lu query and control gpio pins - input/set/clear/toggle the specified pin gpio status [-a] [ | ] - show [all/claimed] GPIOsValid chip addresses: %02XCurrent bus is %d Invalid bus %d Setting bus to %d Failure changing bus number (%d) Current bus speed=%d Setting bus speed to %d Hz Failure changing bus speed (%d) Bus %d: %sError %s the chip: %d writingreading%08lx: %02lx %04lx %08lx ? %04x: %02xCRC32 for %08lx ... %08lx ==> i2cI2C sub-systembusdevloopmmmwnmprobereadspeedUnknown operator '%s' Invalid data width specifier itestreturn true/false on integer compare[.b, .w, .l, .s] [*]value1 [*]value2-lt-gt-eq==-ne!=<>-ge>=-le<=## Total Size = 0x%08x = %d Bytes ## First Load Addr = 0x%08lX ## Last Load Addr = 0x%08lX ## Total Size = 0x%08lX = %ld Bytes loads_echo## Ready for S-Record download ... ## S-Record download aborted ## Start Addr = 0x%08lX ## Switch baudrate to %d bps and press ENTER ... loady## Ready for binary (ymodem) download to 0x%08lX at %d bps... loadx## Ready for binary (xmodem) download to 0x%08lX at %d bps... ## Ready for binary (kermit) download to 0x%08lX at %d bps... ## Binary (kermit) download aborted ## Switch baudrate to %d bps and press ESC ... load binary file over serial line (ymodem mode)[ off ] [ baud ] - load binary file over serial line with offset 'off' and baudrate 'baud'load binary file over serial line (xmodem mode)loadbload binary file over serial line (kermit mode)loadsload S-Record file over serial line[ off ] - load S-Record file over serial line with offset 'off'double wordbytehalfword%s at 0x%08lx (%#0*lx) != %s at 0x%08lx (%#0*lx) Total of %ld %s(s) were the same Base Address: 0x%08lx Zero length ??? %08x %04xinfinite loop on address range[.b, .w, .l] address number_of_objectsbaseprint or set address offset - print address offset for memory commands base off - set address offset for memory commands to 'off'checksum calculationaddress count [addr] - compute CRC32 checksum [save at addr]cmpmemory compare[.b, .w, .l] addr1 addr2 countmemory copy[.b, .w, .l] source target countmemory write (fill)[.b, .w, .l] address value [count]memory modify (constant address)[.b, .w, .l] addressmemory modify (auto-incrementing address)memory display[.b, .w, .l] address [# of objects]sleepdelay execution for some timeN - delay execution for N seconds (N is _decimal_ !!!)No MMC device available no mmc device at slot %x ERROR#part_num shouldn't be larger than %d switch to partitions #%d, %s mmc%d is current device mmc%d(part %d) is current device get mmc type error! MMC erase: dev # %d, block # %d, count %d ... Error: card is write protected! %d blocks erased: %s MMC write: dev # %d, block # %d, count %d ... %d blocks written: %s MMC read: dev # %d, block # %d, count %d ... %d blocks read: %s YesNo DDRDevice: %s Manufacturer ID: %x OEM: %x Name: %c%c%c%c%c Tran Speed: %d Rd Block Len: %d %s version %d.%d High Capacity: %s Capacity: Bus Width: %d-bit%s OK, force rescanset dsr %s mmcinfodisplay MMC info- display info of the current MMC devicemmcMMC sub systeminfo - display info of the current MMC device mmc read addr blk# cnt mmc write addr blk# cnt mmc erase blk# cnt mmc rescan mmc part - lists available partition on current mmc device mmc dev [dev] [part] - show or set current mmc device [partition] mmc list - lists available devices mmc setdsr - set DSR register value eraselistsetdsrgatewayipnetmaskhostnamerootpathserveripdnsipdomainping failed; host %s is not alive host %s is alive pingsend ICMP ECHO_REQUEST to network hostpingAddressdhcpboot image via network using DHCP/TFTP protocol[loadAddress] [[hostIPaddr:]bootfilename]tftpbootboot image via network using TFTP protocolbootpboot image via network using BOOTP/TFTP protocoluuiddisk partition related commandspart uuid : - print partition UUID part uuid : - set environment variable to partition UUID part list - print a device's partition tableHex conversion error on %c Invalid bitlen %d Invalid device %d:%d Error %d during SPI transaction sspiSPI utility command[:][.] - Send and receive bits - Identifies the SPI bus - Identifies the chip select - Identifies the SPI mode to use - Number of bits to send (base 10) - Hexadecimal string that gets senttruedo nothing, successfullyfalsedo nothing, unsuccessfullyminimal test like /bin/sh[args..]-o-a-z-n-eSee InterfaceAudioCommunicationHuman InterfacePrinterMass StorageHubCDC DataVendor specificHuman Interface, Subclass: NoneBoot KeyboardMousereservedMass Storage, RBC SFF-8020i (ATAPI)QIC-157 (Tape)UFISFF-8070Transp. SCSICommand/BulkCommand/Bulk/IntBulk only12 Mb/s+-%d %s (%s, %dmA) %s %s %s %s String: "%s"Self Powered Bus Powered Remote Wakeup InOut Configuration: %d - Interfaces: %d %s%s%dmA Interface: %d - Alternate Setting %d, Endpoints: %d - Class - - Endpoint %d %s ControlIsochronousInterrupt MaxPacket %d Interval %dmsusb%d: %s, USB Revision %x.%x - %s %s %s - Class: - Class: (from Interface) %s - PacketSize: %d Configurations: %d - Vendor: 0x%04x Product 0x%04x Version %d.%d (Re)start USB... stopserialstopping USB.. USB is stopped. Please issue 'usb start' first. treeUSB device tree: infconfig for device %d *** No device available *** Device %d does not exist. Device is no hub or does not have %d ports. Setting Test_J modeSetting Test_K modeSetting Test_SE0_NAK modeSetting Test_Packet modeSetting Test_Force_Enable modeUnrecognized test mode: %s Available modes: J, K, S[E0_NAK], P[acket], F[orce_Enable] on downstream facing port %d... on upstream facing port... Error during SET_FEATURE. Test mode successfully set. Use 'usb start' to return to normal operation. stor no USB devices available no current device selected USB read: device %d block # %ld, count %ld ... %ld blocks read: %s USB write: device %d block # %ld, count %ld ... %ld blocks write: %s USB device %d: unknown device Device %d: ... is now current device 1.5 Mb/s480 Mb/s5 Gb/susbbootboot from USB deviceloadAddr dev:partUSB sub-systemstart - start (scan) USB controller usb reset - reset (rescan) USB controller usb stop [f] - stop USB [f]=force stop usb tree - show USB device tree usb info [dev] - show available USB devices usb test [dev] [port] [mode] - set USB 2.0 test mode (specify port 0 to indicate the device's upstream port) Available modes: J, K, S[E0_NAK], P[acket], F[orce_Enable] usb storage - show details of USB storage devices usb dev [dev] - show or set current USB storage device usb part [dev] - print partition table of one or all USB storage devices usb read addr blk# cnt - read `cnt' blocks starting at block `blk#' to memory address `addr' usb write addr blk# cnt - write `cnt' blocks starting at block `blk#' from memory address `addr'failed to stop USB controller %d unable to get descriptor, error %lX config descriptor too short (expected %i, got %i) %s: failed to get descriptor - too long: %d selecting invalid interface %dERROR, too many USB Devices, max=%d Cannot allocate device context to get SLOT_ID Couldn't reset port %i USB device not accepting new address (error=%lX) unable to get device descriptor (error=%d) USB device descriptor short read (expected %i, got %i) usb_new_device: Cannot read configuration, skipping device %04x:%04x ERROR: NOT USB_CONFIG_DESC %x ERROR: Invalid USB CFG length (%d) ERROR: Invalid USB IF length (%d) USB IF descriptor overflowed buffer! Too many USB interfaces! ERROR: Invalid USB EP length (%d) USB EP descriptor overflowed buffer! Endpoint descriptor out of order! Interface %d has too many endpoints! ERROR: Invalid USB EPC length (%d) USB EPC descriptor overflowed buffer! EPC descriptor out of order! failed to set default configuration len %d, status %lX USB%d: scanning bus %d for devices... %d USB Device(s) found No USB Device found lowlevel init failed Port not available. USB error: all controllers failed lowlevel init cannot reset port %i!? ERROR: USB_MAX_HUB (%d) reached Did not get interrupt on CBI cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X (NOT READY) cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X No storage devices, perhaps not 'usb start'ed..? USB Storage Transport unknown / not yet implemented Sorry, protocol %d not yet supported. error in inquiry Device NOT ready Request Sense returned %02X %02X %02X READ_CAP ERROR scanning usb for storage devices... max USB Storage Device reached: %d stopping %d Storage Device(s) found ## Copying part %d from legacy image at %08lx ... Must specify load address for %s command with compressed image Bad Image Part Invalid image type for imxtract Loading part %d ... Uncompressing part %d ... GUNZIP ERROR - image not loaded fileaddrimxtractextract a part of a multi-imagedo_bootmERROR prep subcommand failed! Subcommand failed Argument image is now in RAM: 0x%p Argument image is now in RAM at: 0x%p splSPL configurationexport [kernel_addr] [initrd_addr] [fdt_addr] img "atags" or "fdt" kernel_addr address where a kernel image is stored. kernel is loaded as part of the boot process, but it is not started. initrd_addr address of initial ramdisk can be set to "-" if fdt_addr without initrd_addr is used. fdt_addr in case of fdt, the address of the device tree. exportatags## Error: cannot export environment Environment size: %d/%ld bytes ## Warning: defaulting to text format ## Error: external checksum format must pass size ## Info: input data size = %zu = 0x%zX ## Error: bad CRC, import failed ERROR: Environment import failed: errno = %d at %s:%d/%s() /home/jsg/u-boot-2015.01/common/cmd_nvedit.c## %s: only one of "-b", "-c" or "-t" allowed ## Warning: Input data exceeds %d bytes - truncated ## Resetting to default environment ## Error: illegal character '='in variable name "%s" ## Can't malloc %d bytes ## Error inserting "%s" variable, errno=%d Please enter '%s': setenv%lxERROR: Cannot export environment: errno = %d at %s:%d/%s() %zXenv_buf [%d bytes] too small for value of "%s" edit: runrun commands in an environment variablevar [...] - run the commands in the environment variable(s) 'var'askenvget environment variables from stdinname [message] [size] - get environment variable 'name' from stdin (max 'size' chars)set environment variables[-f] name value ... - [forcibly] set environment variable 'name' to 'value ...' setenv [-f] name - [forcibly] delete environment variable 'name'printenvprint environment variables[-a] - print [all] values of all environment variables printenv name ... - print value of environment variable 'name'editenvedit environment variablename - edit environment variable 'name'environment handling commandsdeleteeditimportprint*** Warning - %s, using default environment Using default environment /home/jsg/u-boot-2015.01/common/env_common.c!bad CRCERROR: Cannot import environment: errno = %d at %s:%d/%s() !import failedy Y yes YES stdoutstderrIn: No input devices available! Out: No output devices available! Err: No error devices available! bootm_lowbootm_sizebootm_mapsize%d Bytes = Unknown OSUnknown ArchitectureUnknown ImageUnknown Compression%sImage Name: %.*s %sImage Type: %s %s %s (%s) %sData Size: %sLoad Address: %08x %sEntry Point: %08x %sContents: %s Image %d: %s Offset = 0x%08lx ## Loading init Ramdisk from Legacy Image at %08lx ... No Linux %s Ramdisk Image Wrong Ramdisk Image Format ## Loading init Ramdisk from multi component Legacy Image at %08lx ... initrd_highramdisk - allocation error Loading Ramdisk to %08lx, end %08lx ... noneuncompressedbzip2bzip2 compressedgzipgzip compressedlzmalzma compressedlzolzo compressedaisimageDavinci AIS imageFilesystem ImagefirmwareFirmwareflat_dtFlat Device TreegpimageTI Keystone SPL ImagekernelKernel Imagekernel_noloadKernel Image (no loading done)kwbimageKirkwood Boot ImageimximageFreescale i.MX Boot ImageInvalid ImagemultiMulti-File ImageomapimageTI OMAP SPL With GP CHpblimageFreescale PBL Boot ImageRAMDisk ImageScriptsocfpgaimageAltera SOCFPGA preloaderstandaloneStandalone ProgramublimageDavinci UBL imagemxsimageFreescale MXS Boot ImageatmelimageATMEL ROM-Boot Imagex86_setupx86 setup.binInvalid OSlinuxLinuxnetbsdNetBSDoseEnea OSEplan9Plan 9rtemsRTEMSu-bootvxworksVxWorksInvalid ARCHalphaAlphaarmARMIntel x86ia64IA64m68kM68KmicroblazeMicroBlazemipsMIPSmips64MIPS 64 Bitnios2NIOS IIpowerpcPowerPCppcs390IBM S390SuperHsparcSPARCsparc64SPARC 64 BitblackfinBlackfinavr32AVR32nds32NDS32or1kOpenRISC 1000sandboxSandboxarm64AArch64AMD x86_64ERROR: - must RESET the board to recover. reserving fdt memory region: addr=%llx size=%llx image is not a fdtfdt_highFailed using fdt_high value for Device Treedevice tree - allocation error Using Device Tree in place at %p, end %p Loading Device Tree to %p, end %p ... fdt move failed## Flattened Device Tree from Legacy Image at %08lx fdt header checksum invalidfdt checksum invaliduImage is not a fdtuImage is compresseduImage data is not a fdtfdt overwritten## Flattened Device Tree blob at %08lx ERROR: Did not find a cmdline Flattened Device Tree Booting using the fdt blob at %#08lx ## Flattened Device Tree from multi component Image at %08lX Booting using the fdt at 0x%p fdt size != image sizeERROR: /chosen node create failed ERROR: arch-specific fdt fixup failed - must RESET the board to recover. ** Too many args (max. %d) ** ## Command too long! %.*s%*s %s - %s Usage: %s - No additional help available. %-*s- %s Unknown command '%s' - try 'help' without arguments for list of all known commands Unknown command '%s' - try 'help' 'bootd' recursion detected Command '%s' failed: Error %d CksumxyzModem - %s mode, %d(SOH)/%d(STX)/%d(CAN) packets, %d retries Unknown errorBlock sequence errorCRC/checksum errorInvalid framingCancelledEnd of fileTimed outSorry, zModem not available yetCan't access file Loading from %s device %d, partition %d: Name: %.32s Type: %.32s ** Read error on %d:%d ** Bad Header Checksum ** ** Unknown image type (%d:%d) Vendor: %s Prod.: %s Rev: %s Model: %s Firm: %s Ser#: %s Vendor: %s Rev: %s Prod: %s device type DOC device type unknown Unhandled device type: %i Type: Removable Hard DiskCD ROMOptical DeviceTape# %02X # Capacity: %ld.%ld MB = %ld.%ld GB (%ld x %ld) Capacity: not available Partition Map for IDESATAATAPIDOCHOST device %d -- Partition Type: %s DOS## Unknown partition table ** Bad device specification %s %s ** ** Bad HW partition specification %s %s ** ** Bad device %s %s ** hostfsSandbox hostbootdevice** No device specified ** auto** Bad partition specification %s %s ** ** Bad device size - %s %s ** ** No partition table - %s %s ** Whole Disk** Invalid partition %d ** ** No valid partitions found ** ** Invalid partition type "%.32s" (expect "U-Boot") FAT32FAT Extd Boot** Can't read partition table on %d:%d ** bad MBR sector signature 0x%02x%02x %3d %-10d %-10d %08x-%02x %02x%s%s hd%c%dsd%c%dusbd%c%ddocd%c%dxx%c%d%08x-%02xPart Start Sector Num Sectors UUID Type ERROR : check_gpio: invalid GPIO %d omap3-gpio unknown bank method %s %d /home/jsg/u-boot-2015.01/drivers/gpio/omap_gpio.cError, wrong i2c adapter %d max %d possible wrong hwadapnr: %d Error : I2C initializing first phase clock Error : I2C initializing clock Timed out in wait_for_bb: status=%04x Timed out in wait_for_event: status=%04x Check if pads/pull-ups of bus %d are properly configured I2C write: addr len < 0 I2C write: data len < 0 I2C write: NULL pointer passed I2C write: addr len %d not supported I2C write: address 0x%x + 0x%x out of range i2c_write: pads on bus %d probably not configured (status=0x%x) i2c_write: error waiting for addr ACK (status=0x%x) i2c_write: bus not ready for addr Tx (status=0x%x) i2c_write: error waiting for data ACK (status=0x%x) i2c_write: bus not ready for data Tx (i=%d) i2c_write: timed out writig last byte! I2C read: addr len < 0 I2C read: data len < 0 I2C read: NULL pointer passed I2C read: addr len %d not supported I2C read: address out of range i2c_read (addr phase): pads on bus %d probably not configured (status=0x%x) i2c_read: error waiting for addr ACK (status=0x%x) i2c_read (data phase): pads on bus %d probably not configured (status=0x%x) i2c_probe: pads on bus %d probably not configured (status=0x%x) ERROR: Timeout in soft-reset ERROR: failed to setup I2C bus-speed! omap24_3omap24_2omap24_1omap24_0Status Error: 0x%08X Timeout waiting card ready MMC Device %d not found MMC: block number 0x%lx exceeds max(0x%lx) mmc fail to send stop cmd Card doesn't support part_switch MMC: SET_DSR failed Man %06x Snr %04x%04x%c%c%c%c%c%c%s is deprecated! use mmc_create() instead. MMC: no card present Card did not respond to voltage select! %s: %d%s: timedout waiting for ics! %s: timedout waiting for sysctl %x to clear %s: timedout waiting on cmd inhibit to clear %s: timedout waiting for STAT (%x) to clear %s : timeout: No status update %s: timedout waiting for status! %s: timedout waiting for cc! %s: timedout waiting for cc2! %s: timedout waiting for softresetall! mmc_cdmmc_wpOMAP SD/MMC Caution! Your devices Erase group is 0x%x The erase range would be change to 0x%lx~0x%lx mmc erase failed mmc write failed Cannot find console ## Baudrate %d bps not supported ## Baudrate may not be deleted 000000000000genericserial#Warning: serial number %s is too long (%d > %lu) usbttycdc_acmDas U-BootU-Boot 2015.01TTY via USBBulk Data InterfaceControl InterfaceSPI error: unsupported bus %i. Supported busses 0 - 3 SPI error: unsupported chip select %i on bus %i SPI error: unsupported frequency %i Hz. Max frequency is 48 Mhz SPI error: unsupported SPI mode %i SPI error: malloc of SPI structure failed SPI TXS timed out, status=0x%08x SPI RXS timed out, status=0x%08x omap3_spi: invalid wordlen %d scanning usb for ethernet devices... usbethWarning: failed to set MAC address max USB Ethernet Device reached: %d stopping %d Ethernet Device(s) found Error: SMSC95xx: No MAC address set - set usbethaddr Waiting for Ethernet connection... done. unable to connect. %s%dsmsERROR: %s(), %d: RECV_ERROR actual: %d buffer: %d urb_bad: %d ERROR: %s(), %d: no rcv_urb! ERROR: %s(), %d: no endpoint! ERROR: %s(), %d: F A T A L: malloc(%zu) FAILED!!!! ERROR: %s(), %d: (%p,%d) NULL device or device->bus USBD_OPENINGUSBD_OKUSBD_SUSPENDEDUSBD_CLOSINGDEVICECONFIGSTRINGENDPOINTDEVICE QUALIFIEROTHER SPEEDINTERFACE POWERGET STATUSCLEAR FEATURERESERVEDSET FEATURESET ADDRESSGET DESCRIPTORSET DESCRIPTORGET CONFIGURATIONSET CONFIGURATIONGET INTERFACESET INTERFACESYNC FRAMESTATE_INITSTATE_CREATEDSTATE_ATTACHEDSTATE_POWEREDSTATE_DEFAULTSTATE_ADDRESSEDSTATE_CONFIGUREDSTATE_UNKNOWNDEVICE_UNKNOWNDEVICE_INITDEVICE_CREATEDEVICE_HUB_CONFIGUREDDEVICE_RESETDEVICE_ADDRESS_ASSIGNEDDEVICE_CONFIGUREDDEVICE_SET_INTERFACEDEVICE_SET_FEATUREDEVICE_CLEAR_FEATUREDEVICE_DE_CONFIGUREDDEVICE_BUS_INACTIVEDEVICE_BUS_ACTIVITYDEVICE_POWER_INTERRUPTIONDEVICE_HUB_RESETDEVICE_DESTROYDEVICE_FUNCTION_PRIVATEInvalid string index %d USB_DESCRIPTOR_TYPE_INTERFACE - error not implemented USB_DESCRIPTOR_TYPE_ENDPOINT - error not implemented USB_DESCRIPTOR_TYPE_HID - error not implemented USB_DESCRIPTOR_TYPE_REPORT - error not implemented get config %d DEVICE_SET_INTERFACE.. event? EHCI failed to shut down host controller. out of buffer pointers (%u bytes left) unable to allocate TDs unable to construct SETUP TD unable to construct DATA TD EHCI fail timeout STS_ASS set EHCI timed out on TD - token=%#x EHCI fail timeout STS_ASS reset EHCI failed: timeout when disabling periodic list EHCI failed: timeout when enabling periodic list port(%d) reset error EHCI fail to reset USB EHCI %x.%02x %s: xfers requiring several transactions are not supported. Timeout destroying interrupt endpoint queue Timeout poll on interrupt endpoint %s: RESET timeout USB PHY1 resetUSB PHY2 resetERROR : Unsupport USB mode Check that mini-B USB cable is attached to the device ** Unrecognized filesystem type ** ** Unable to read file %s ** ** Unable to write file %s ** bootfile** No boot file defined ** %llu bytes read in %lu ms (%llu bytes written in %lu ms** Can not find directory. ** ** Cannot support non-zero offset ** ** File not found %s ** Extent Error ** SI ext2fs read block (indir 1)malloc failed. ** ** SI ext2fs read block (indir 1):malloc failed. ** ** SI ext2fs read block (indir 1)failed. ** ** DI ext2fs read block (indir 2 1)malloc failed. ** ** DI ext2fs read block (indir 2 1)failed. ** ** DI ext2fs read block (indir 2 2)malloc failed. ** ** DI ext2fs read block (indir 2 2)failed. ** ** TI ext2fs read block (indir 2 1)malloc failed. ** ** TI ext2fs read block (indir 2 1)failed. ** ** TI ext2fs read block (indir 2 2)malloc failed. ** ** TI ext2fs read block (indir 2 2)failed. ** invalid extent block < ? > %10u %s Failed to mount ext2 filesystem... %s read outside partition %lu ** ext2fs_devread() read error ** ** %s read error - block * %s read error - last part error: overflow occurs Error: Invalid FAT entry: 0x%08x FAT: Misaligned buffer address (%p) FAT32 FAT12 FAT16 Invalid FAT entry error: wrinting directory entry Error: reading directory block Error: %llu overflow Error: writing contents Error: flush fat buffer Error: writing directory entry Error: finding empty cluster Error: clearing FAT entries U** Partition %d not valid on device %d ** Error: FAT sector size mismatch (fs=%hu, dev=%lu) %s%c %8u %s%c %d file(s), %d dir(s) Error reading cluster No current device Interface: Unknown Device %d: No valid FAT fs found Filesystem: %s "%s" reading %s Error: non zero offset is currently not suported. writing %s Can't list files without a filesystem! %s/%sCan't load file without a filesystem! invalid distance too far backinvalid distance codeinvalid literal/length codeincorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid literal/lengths setinvalid distances setincorrect data checkincorrect length checkneed dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versioncompatibleFDT_ERR_NOTFOUNDFDT_ERR_EXISTSFDT_ERR_NOSPACEFDT_ERR_BADOFFSETFDT_ERR_BADPATHFDT_ERR_BADSTATEFDT_ERR_TRUNCATEDFDT_ERR_BADMAGICFDT_ERR_BADVERSIONFDT_ERR_BADSTRUCTUREFDT_ERR_BADLAYOUT1.2.3Error: inflateInit2() returned %d Error: inflate() returned %d Error: Bad gzipped data Error: gunzip out of data in header initcall sequence %p failed at call %p (err=%d) ERROR: Failed to allocate 0x%lx bytes below 0x%lx. .%03ldlist passed to list_sort() too long for efficiency ## ERROR: unsupported match method: 0x%02x Env export buffer too small: %zu, but need %zu himport_r: can't insert "%s=%s" into hash table WARNING: '%s' neither in running nor in imported env! WARNING: '%s' not in imported env, deleting it! %s %llu Bytes%s%lu.%ld %ciB%s %0*x %s ### ERROR ### Please RESET the board ### %s:%u: %s: Assertion `%s' failed.%*llu## Warning: gatewayip needed but not set ARP Retry count exceeded; starting again bad length %d < %d *** WARNING: %s is too long (%d - max: %d) - truncated Host NameRoot PathOpt Boot File*** WARNING: using vendor optional boot file *** Unhandled DHCP Option in OFFER/ACK: %d DHCP client bound to address %pI4 (%lu ms) DHCP: INVALID STATE BOOTP broadcast %d Retry time exceeded; starting again ethact%pM%s%daddr%saddrBUG: failure at %s:%d/%s()! /home/jsg/u-boot-2015.01/net/eth.cBUG!eth%dmacskipethmacskip Warning: %s MAC addresses don't match: Address in SROM is %pM Address in environment is %pM Warning: %s using MAC address from net device Error: %s address not set. Warning: %s failed to set MAC address Error: %s address %pM illegal value Board Net Initialization Failed CPU Net Initialization Failed Net Initialization Skipped ethprime [PRIME] Warning: eth device name has a space! ethrotateunknownautoloadnetretryonce ICMP Host Redirect to %pI4 %d.%d.%d.%dnvlan*** ERROR: ping address not given *** ERROR: `serverip' not set *** ERROR: `ipaddr' not set *** ERROR: No ethernet found. *** ERROR: `ethaddr' not set *** ERROR: `eth%daddr' not set Abort Bytes transferred = %ld (%lx hex) Using %s device octetblksize%c%d%cFile too largeFile has bad magicblksize TFTP error: First block is not block 1 (%ld) Starting again done TFTP error: '%s' (%d) Not retrying... %s; starting again Retry count exceededT tftpblocksizetftptimeoutTFTP timeout (%ld ms) too low, set minimum = 1000 ms %02X%02X%02X%02X.img*** Warning: no boot file name; using '%s' TFTP %s server %pI4; our IP address is %pI4from; sending through gateway %pI4Filename '%s'. Size is 0x%x Bytes = Load address: 0x%lx Loading: *raise: Signal # %d caught ( w U-Boot 2015.01 (Jan 24 2015 - 09:42:21)<t-Udad[d0@`U[E t1}!T|t<|t-Ua[<t0@'}!|t t1}! 0@0@Uf[sI&''8$')' .'1'5' ;' X A' D' 8 9:::O:'q͹8q]q:a:I9;9%9S9W99:9999);::;::;g<]<;;G<; Հ=<;;%<<<Հ;}!m;;;;[addr [arg ...]] - boot application image stored in memory passing arguments 'arg ...'; when booting a Linux kernel, 'arg' can be the address of an initrd image When booting a Linux kernel which requires a flat device-tree a third argument is required which is the address of the device-tree blob. To boot that kernel without an initrd image, use a '-' for the second argument. If you do not pass a third a bd_info struct will be passed instead Sub-commands to do part of the bootm sequence. The sub-commands must be issued in the order below (it's ok to not issue all sub-commands): start [addr [arg ...]] loados - load OS image ramdisk - relocate initrd, set env initrd_start/initrd_end fdt - relocate flat device tree cmdline - OS specific command line processing/setup bdt - OS specific bd_t processing prep - OS specific prep before relocation or go go - start OS3f+m+h u+@}+++ ([addr [initrd[:size]] [fdt]] - boot Linux zImage stored in memory The argument 'initrd' is optional and specifies the address of the initrd in memory. The optional argument ':size' allows specifying the size of RAW initrd. When booting a Linux kernel which requires a flat device-tree a third argument is required which is the address of the device-tree blob. To boot that kernel without an initrd image, use a '-' for the second argument. If you do not pass a third a bd_info struct will be passed instead [addr] - run script starting at addr - A valid image header must be present/ addr [-c] [] - Set the [control] fdt location to fdt move - Copy the fdt to and make it active fdt resize - Resize fdt to size + padding to 4k addr fdt print [] - Recursive print starting at fdt list [] - Print one level starting at fdt get value - Get and store in fdt get name - Get name of node and store in fdt get addr - Get start address of and store in fdt get size [] - Get size of [] or num nodes and store in fdt set [] - Set [to ] fdt mknode - Create a new node after fdt rm [] - Delete the node or fdt header - Display header info fdt bootcpu - Set boot cpuid fdt memory - Add/Update memory node fdt rsvmem print - Show current mem reserves fdt rsvmem add - Add a mem reserve fdt rsvmem delete - Delete a mem reserves fdt chosen [ ] - Add/update the /chosen branch in the tree / - initrd start/end addr NOTE: Dereference aliases by omiting the leading '/', e.g. fdt print ethernet0.bus [muxtype:muxaddr:muxchannel] - show I2C bus info crc32 chip address[.0, .1, .2] count - compute CRC32 checksum i2c dev [dev] - show or set current I2C bus i2c loop chip address[.0, .1, .2] [# of objects] - looping read of device i2c md chip address[.0, .1, .2] [# of objects] - read from I2C device i2c mm chip address[.0, .1, .2] - write to I2C device (auto-incrementing) i2c mw chip address[.0, .1, .2] value [count] - write to I2C device (fill) i2c nm chip address[.0, .1, .2] - write to I2C device (constant address) i2c probe [address] - test for and show device(s) on the I2C bus i2c read chip address[.0, .1, .2] length memaddress - read to memory i2c write memaddress chip address[.0, .1, .2] length - write memory to i2c i2c reset - re-init the I2C Controller i2c speed [speed] - show or set I2C bus speedKf%-lKeKUhX'jKjKhKjKqeKg89g0MeKEf@/VK8e~W}V|c}K|W|WՀaddr part [dest] - extract from legacy image at and copy to h(p3f+m+hu+}++3f+m+u+}++!pask name [message] [size] - ask for environment variable env default [-f] -a - [forcibly] reset default environment env default [-f] var [...] - [forcibly] reset variable(s) to their default values env delete [-f] var [...] - [forcibly] delete variable(s) env edit name - edit environment variable env export [-t | -b | -c] [-s size] addr [var ...] - export environment env import [-d] [-t [-r] | -b | -c] addr [size] - import environment env print [-a | name ...] - print environment env run var [...] - run commands in an environment variable env set [-f] name [arg ...] W@YWEɴu@u!pu9u@Ųs@րe@EM˂˂˂˂˂˂˂˂˂˂˂˂˂˂˂˂˂˂˂˂˂˂˂˂˂˂˂˂̂̂ ̂ ̂̂̂̂̂$̂$̂,̂,̂4̂4̂<̂<̂D̂D̂L̂L̂T̂T̂\̂\̂d̂d̂l̂l̂t̂t̂|̂|̂̂̂̂̂̂̂̂̂̂̂̂̂̂̂̂̂̂̂̂̂̂̂̂̂̂̂̂̂̂̂̂̂͂͂ ͂ ͂͂͂͂͂$͂$͂,͂,͂4͂4͂<͂<͂D͂D͂L͂L͂T͂T͂\͂\͂d͂d͂l͂l͂t͂t͂|͂|͂͂͂͂͂͂͂͂͂͂͂͂͂͂͂͂͂͂͂͂͂͂͂͂͂͂͂͂͂͂͂͂͂΂΂ ΂ ΂΂΂΂΂$΂$΂,΂,΂4΂4΂<΂<΂D΂D΂L΂L΂T΂T΂\΂\΂d΂d΂l΂l΂t΂t΂|΂|΂΂΂΂΂΂΂΂΂΂΂΂΂΂΂΂΂΂΂΂΂΂΂΂΂΂΂΂΂΂΂΂΂ςς ς ςςςςς$ς$ς,ς,ς4ς4ς<ς<ςDςDςLςLςTςTς\ς\ςdςdςlςlςtςtς|ς|ςςςςςsvveserial2-Qu @% C $n$$$@  @@ ' @@@)  @ @   J|!;e񆁀RZ]ZZZ[R%ci[RRRRRRRR |Cs@Yss!Qy&QBQI4OP4N|=!++=!+n@)DRx RR4Q4sXz9RER%zQQqXvXX!M@Q44lutuu߀s@uDȂ5R5&7aR/7W77oR6-6+5ER45\56SR6-667R66[@[z9R99l:Rt:::R6 :<}R668S88hUAŻ (@<#(G(mIEdII/@G/0KeK*@9>*F*mm\ǂLunL=L*7dGGOrOOOqOOMreOOMrNOKwPP8/d6_EX'ExR SK{RR]V{aVpVV#V4VKAwfRzRK{RRcy@Y`Y9X->XeXt@Ųtt߀/@G/0(s@ր"sJs߀E!dEFr@Et0t߀&@(&&3d660S{6STSG3ON3TnnnZZZL@ \&\XXX[@[^qc+cbb c!H0'Q߁r15J41}K'!ˀm!90m!9'm!m! $(,048l  ( L         L$Hxt<HD  $(,048<@DHLPtxX\`|HLPTX\`dhl@ !! !!!L!T!!!!!!!!!!t"""""",#\#`#X$\$`$d$h$l$p$t$x$|$$$$$$$$$$$$$$$$$$0%p%|%8&h&(0)4)8)<)h)|******+P+T+X+\+\,`,d,h,(....H1L1P1333333`6d6h6l6p6t6x6|67777788,80848`8d8h888899l:::: ;;;;;;;< <8<<<<====>> >$>(>,>0>4>t>>>>>X?\????BBBCC CCCCC C$C(C,C0C4C8C>3+X<4#C3Dr`ZhBZ`X<#CH<4Fch#[+ `C0@F.F FD 3"# #: F  EAF@0@ ZE*"FFF# \YA#C!F"!F}#\B BO  7?B FDwFHBD5XFQF2F+FxO0L FFF$HF;D? $!@O7@ XFQF2F+F@P@($ FcD$ #2C #Z?% XFQF2F+F)(ѯ0F KFFhcKhP"E#F0Lh-MFFF>OjCl0FiFi|i 5DD[ FPFRlFi DPF " FI ( i 4QFjF0FF)F)FD0F" F[F 0 -MFKFh#i 50Bli p!F u!"FF!( $hi 3O 3 B@ӈ#UO4 'O3X`EZ. EF&BF1F[h[F@H(ZFXEFcBc `C X EXF. h"XFT& wHXFM  X*,&FnO SE]>hƹ!F 1F"FO6FycHg0FobK`bK``N2hB8h!F "O3:`02`F"FP;`+SH@O0G4`X0@B!"F;hJH,X0EJ@` J;h S*(c 3SEۀ, F;h ù!F "FFF /K2H-KO2`,K` B8hz&KO1 ":``!F YF"F;`+@K\h@B !"F;hSH\0J@`JhF!F 0"FFF HfLێ0@T0@`0@0@R0@0@0@\0@KO2`K` BKO1 " `!F F"Fv0+@PF1F ;hFS nK@hB!"F0gHgKdJhS,0@`PF1F409#FsCH3,"F[B:h ;D¹!F F"FF)QJOHOKO2`NK`0 B8hHIO0":``!F uF"F;`+@`0@B !"F;hm5H`0@03KhF!F JF"FF*H KO2`K`t BAIO0" `!F F"F0+@PF>;h OFS ;h@B$!"F0 H?X0@0@TI0@`0@0@\0@0@0@E0@-MFF``0 (F #;a)FB F#FF+/*"{ih )FT m0F"F(C;i+$0FAF0+UF(F/!F80/+# ;;i+xiAF o:Jh3`+xiAF[}i0{h 2z`F !zhF (h*(% h<*XF,2#(F"# x`XFh]F"  xiAF+x/+0FAF}Kh6"F(F1FAF(F,t0F{ih`;ih ` 7FdL7F# K%` (,CXBXA,+ 0dJ#s FhFL1#`#03 hh`*`#`h2s(1h1O0pLhpOaF M!ObF F\M"NSsBl #X0`!&@ FTXa 4,`0FpH F0 (`ppLN0@Kp FF` K"h` K`EdbhhEF)FCl Fipplt-MFxFpF>i`Ci" 2 h A .D(B^FGI*FGHFzh; AD "dCF@h)DG(sB+b+FYB($ !#F"DBFp0@-MF!x@ к O  H&ɲ*sRB4cCO- qHѲ  A\CFF4 F FR8F B;F $F)F:K r8DЅ5 кO0*p5BXjp5F0$ $)F:K r8D0";B+j;F;Y\/ !F*F;(((-0@-MFF3x+ %+$+p-+ D?++ + #+ D@0+DDD0 )'O 1FF;0 (70?*+h6/BDO7F3x.+ sxp0 )#O F1x0F60  0;F*+ h+ F0FO3 F#xh)L.Z.t) l) ѐlцL!O1F0xn($c( %($X($'d("i( s(%o('p((u(x(@D   #?/;h5, "?/@+(Fh:F6rxa* I*>  L)2"&l)hF! hZђFO t)ђF h)F)O{RF(F[FFBF6+p=0@-0@R]pG pGJpG$B@BOFB(pB(pAB(ApB(poB(`oB(`AoB(A`oB(`_B(P_B(PA_B(AP_B(POB(@OB(@AOB(A@OB(@?B(0?B(0A?B(A0?B(0/B( /B( A/B(A /B( B(B(AB(AB(B(B(AB(AB(FpG  pG pGO0~)-@@pG)> HIBJHCBB@B#OF@(s@(sA@(As@(so@(co@(cAo@(Aco@(c_@(S_@(SA_@(AS_@(SO@(CO@(CAO@(ACO@(C?@(3?@(3A?@(A3?@(3/@(#/@(#A/@(A#/@(#@(@(A@(A@(@(@(A@(A@(H@BpGH@BpG8 Op@pG#H@BpG(ȿo@O@&)-@@pG@ @F :@CRBcF@CpG@@F :@CRBcF@CpGOLxGFU-1Y$ITdb 7 ?ñ2 Гhd dH2 Phb 7 ?ñ2 PhX"R 5 C2 PhX1JPHpHHHHq0@0@AJAJAJ AJ$AJ(AJ,AJ0AJ4AJHAJLAJPAJ`AJdAJhAJlAJpAJAJAJAJAJAJAJAJAJAJAJAJAJAJAJAJAJBJ BJ BJ$BJ(BJ,BJ0BJHBJ`BJ CJDJ DJEJ EJ(EJ0EJ8EJ@EJHEJPEJXEJ`EJhEJpEJxEJEJEJJJJJJJJ$J(J,J0J8J@JDJHJLJPJTJhJlJpJJJJJJJJJJāJȁJ́JЁJJJJJ JJJ J(J0JJJJ JJJJ JJ J(J0J8J@JPJXJ`JJJJ J(J0JJJ J(J0J8JJ J(JJ J(JJ J(JJ JJ JJ(J0J8JXJ`JhJxJГJJJ J(J0J8J@JHJPJXJ`JhJpJxJJJJJJJJJJДJؔJJJJJJ J(J0J8J@JHJPJXJ`JhJJJJJJJJJȕJؕJ a0Ja0Jx0J x0J(x0J0x0J8x0J@x0JHx0JPx0JXx0J`x0Jxx0Jx0Jx0J{0J{0J{0J8AJ < ? > %10u %s Failed to mount ext2 filesystem... %s read outside partition %lu ** ext2fs_devread() read error ** ** %s read error - block * %s read error - last part ext4fs_devreadhimport_r: can't insert "%s=%s" into hash table WARNING: '%s' neither in running nor in imported env! WARNING: '%s' not in imported env, deleting it! %s %llu Bytes%s%lu.%ld %ciB%s%08lx: %0*x %s ### ERROR ### Please RESET the board ### %s:%u: %s: Assertion `%s' failed.%*llu%.*s(((((AAAAAABBBBBB0123456789ABCDEF0123456789abcdef(x0@y0@Xz0@{0@x0@p{0@-U(0@a(0@[(0@0@$0@Ud0@[d0@E t1M0@0@z0@@y0@Xz0@{0@x0@p{0@(x0@@y0@Xz0@{0@x0@p{0@-Ud0@ad0@[d0@(x0@|0@Xz0@{0@x0@p{0@0@'M0@0@|0@@y0@Xz0@{0@x0@p{0@ t1M0@0@ 0@0@Ud0@f[d0@sId0@T0@T0@\0@\0@d0@d0@l0@l0@t0@t0@|0@|0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@Ę0@Ę0@̘0@̘0@Ԙ0@Ԙ0@ܘ0@ܘ0@0@0@0@0@0@0@0@0@0@0@ 0@ 0@0@0@0@0@$0@$0@,0@,0@40@40@<0@<0@D0@D0@L0@L0@T0@T0@\0@\0@d0@d0@l0@l0@t0@t0@|0@|0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@ę0@ę0@̙0@̙0@ԙ0@ԙ0@ܙ0@ܙ0@0@0@0@0@0@0@0@0@0@0@ 0@ 0@0@0@0@0@$0@$0@,0@,0@40@40@<0@<0@D0@D0@L0@L0@T0@T0@\0@\0@d0@d0@l0@l0@t0@t0@|0@|0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@Ě0@Ě0@̚0@̚0@Ԛ0@Ԛ0@ܚ0@ܚ0@0@0@0@0@0@0@0@0@0@0@ 0@ 0@0@0@0@0@$0@$0@,0@,0@40@40@<0@<0@D0@D0@L0@L0@T0@T0@\0@\0@d0@d0@l0@l0@t0@t0@|0@|0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@0@ě0@ě0@̛0@̛0@ԛ0@ԛ0@ܛ0@ܛ0@0@0@0@0@0@0@0@0@0@0@ 0@ 0@0@0@0@0@$0@$0@,0@,0@40@40@<0@<0@D0@D0@L0@L0@eserial2?0@?0@@0@?0@C@0@1@0@usr/mdec/cubie004075500000000000000000000000001246133515300124755ustar00rootwheelusr/mdec/cubie/u-boot-sunxi-with-spl.bin010064400000000000000000012356701246044453100173770ustar00rootwheeleGON.BT07왠R```````ﾭ 1) \ //    П P-?P0L8pGKO2Za" apG KiCJ#X 0B;@ .3+0CsD0 vF J#XCiCF( ݊iCBDF !OzppG pG pG6 !G7 !C!7 { K"Z`AA`Z` H!@0Lu 0$P!P@@%"C@! 00D ,O$F FcCH\C)Fp`0@ٿt*0$"D  , KO@sc"@ \i$CYa0t*0$"D  , KO@sc"@ i$Ca0t* L K#` JOs ` K#` K J I` hBr `hBB`TP(`K"`JhC3`pGXl( J#)h@ C` h@$O0l)J-A&]hB6%J(F%K'*D # !F!K!J)FeD H#"FOhCFRظE $$$FF|HOw \a;n#C;fq;n CC;fjrNsK<202#C#CCC|021#C1iK 23h#CCS3`b2?#|cC22#@CCC252 #@C2,2 #@CCC2!ciZ#iггoгoг_ г_ &&&&&&&h;B#iC@SC:CC̀OrOA3H01CC1$ F'j% #"B #CS0 ?GGOApH FK "B Br`O0oSCoCC0K"F H) 7 $H8@H8@)FF8i(C@p$ C KJ`x`FʿQ J8 Fx@%%C@C`pJ`( F)F8@ۿ8Q8FKxP X L`h+p8QF K@6P"F`/i/ 8>Kh/4DtD FI -AFF,F?,((!<3+D+ (!|(нA-EN FFO t =( (!=]F ɲb,M4ȿ J&F¿xCp3;DXb *x"*pF.O0F"iahh(hjhFO O h* DCC `Oc#ikoP屫hy%+OJO 08=Ks+Ozpshsh#ij`#ij3a#i[jsa#ija@u#i<=Ozpj`%#iO2chC"i(F`O5#i"8i`*FOzp" F FO` F8#F K` F#`h(!h KB @Ch`DCC`(F!F"h(18Or#0### ]p #%0#F\0 F0F"R`oJ @:Ho=Ozp+4 Ho,o p@8HNHB@rBA"#F0#G FOzq,!J#0#1 ] JFhBBhH FpOjH-MFFFZF8 B*Hw MAn(ѨFhiiCE(CF+"F #rn0 !"0F F " 0F""F H5\F$\Esn'D(F HHF(ڣh[hh F@G hciB(F#i@B,bb-Mm"#F<0#zF(@փ"L#<0 F\0*F#b(@h F"DJ0\0 #<0#\0JOzqF F-@h?c#dbdde-   MMMO5M`MhU&PNXPV!6&cE!fO\@fiefHf9? !B@" !2C0A|O3DO #"#$#&#(#*#ĿOscfnOsfjX" F< "yH$#<0#\0 F"(@#f#^0h O&? F_UF(؀? F1FP(-#ٖ0! O`C# C CcO{OK"BR[O[OZYEJ:PELf D0F :KO@08K0#D 5%D`"Z`Or3Kbk`2K` /K#a/Kc`.Kcd.Kc.Kg.Kf -K0-K0AF+H54#@FDrC&Oq# n@C f K JD#YJBB4#DD[h`41F``8FEI~( xOIBu I;UI0@HkKh(IHO0Cs0@iGFCj F@GFj F@G (pFM6U& !U&!Fp@B!8D F)F8!K8S @I F3F F@OB6n L I FF F 6nHJHJHpGQRF_}۲[#q"spq#st$rLsʲp!qs#q"spq#st$rsʲp!qs}۲ppG}۲xpG}pG-MFEF'B (F" Fe "#O O .w ۯBBҶA K BBӤe C _[ O: O6Z  F#HFJDFBFx2,0F$Ͳ<E#FTD,E;"DDB0B0@ F D+T;E?"!DF; DBKO0 DDB?x1 Ozvs%/F#4&F#F#FVFU!hF1NOzt#3FFpFNB%F(5F(F dp& %"D '"O.01pDB'JC F0Ap  !YC !30p #SC "02p B03qF-M'8NF##BBPFF%FTF,I##R # F$I+ D#  # O.01 D DD O!K ! 0  SC0  "0302 , <Z| pFMF) FF(F ">sB+b+FYB($ !#F"DBFpJ-MF!x@ к O  H&ɲ*sRB4cCO- qHѲ  A\CFF` F FR8F B;F $F)F:K r8DЅ5 кO0*p5BXjp5F0$ $)F:K r8D0";B+j;F;Y\/ !F*F;(((L-MFF3x+ %+$+p-+ D?++ + #+ D@0+DDD0 )'O 1FF;0 (70?*+h6/BDO7F3x.+ sxp0 )#O F1x0F60  0;F*+ h+ F0FO3 F#xh)L.Z.t) l) ѐlцL!O1F0xn($c( %($X($'d("i( s(%o('p((u(x(@D   #?/;h5, "?/@+(Fh:F6rxa* I*>  L)2"&l)hF! hZђFO t)ђF h)F)O{RF(F[FFBF6+pLKxN0+DxCx,фx4]DЃ""*"* "F 'F;\Dy0;D ;۲7;B0`FKx-,н@0@BR]pGQ ~ EH FFFF"4 !FF F"!F4 h/@BFO/p/p!IJ# 0B 433# 0(/@SBFO/p!/p@' o@CBFFOd( d!`A( Cа/@BFO/p!/p{!) @eK$S$ B<( aH( !!CIB K@0O0] pGJpG$B@BOFB(pB(pAB(ApB(poB(`oB(`AoB(A`oB(`_B(P_B(PA_B(AP_B(POB(@OB(@AOB(A@OB(@?B(0?B(0A?B(A0?B(0/B( /B( A/B(A /B( B(B(AB(AB(B(B(AB(AB(FpG  pG pGO0~)-@@pG)> HIBJHCBB@B#OF@(s@(sA@(As@(so@(co@(cAo@(Aco@(c_@(S_@(SA_@(AS_@(SO@(CO@(CAO@(ACO@(C?@(3?@(3A?@(A3?@(3/@(#/@(#A/@(A#/@(#@(@(A@(A@(@(@(A@(A@(H@BpGH@BpG8 Op@pG#H@BpG(ȿo@O@&)-@@pG@ @F :@CRBcF@CpG@@F :@CRBcF@CpGOLP`P-Tp89U<VH>WAX DYGZbJ[d?M\P]] lr : [<%08lx>] sp : %08lx ip : %08lx fp : %08lx r10: %08lx r9 : %08lx r8 : %08lx r7 : %08lx r6 : %08lx r5 : %08lx r4 : %08lx r3 : %08lx r2 : %08lx r1 : %08lx r0 : %08lx Flags: %c%c%c%c IRQs %s FIQs %s Mode %s%s undefined instruction software interrupt prefetch abort data abort not used fast interrupt request USER_26FIQ_26IRQ_26SVC_26UK4_26UK5_26UK6_26UK7_26UK8_26UK9_26UK10_26UK11_26UK12_26UK13_26UK14_26UK15_26USER_32FIQ_32IRQ_32SVC_32UK4_32UK5_32UK6_32ABT_32UK8_32UK9_32HYP_32UND_32UK12_32UK13_32UK14_32SYS_32resetting ... WARNING: Caches not enabled DRAM: %lu MiB Failed to set core voltage! Can't set CPU frequency ethaddrSUNXI SCSI INIT satapwrAHCI PHY power up failed. AHCI PHY calibration failed. U-BootSPL: Unsupported Boot Device %d U-Boot SPL 2015.01 (Jan 24 2015 - 09:46:38) spl: mmc device not found!! spl: mmc init failed: err - %d spl: mmc blk read err - %lu spl: wrong MMC boot mode Error, wrong i2c adapter %d max %d possible twsi0Status Error: 0x%08X Timeout waiting card ready MMC Device %d not found MMC: block number 0x%lx exceeds max(0x%lx) mmc fail to send stop cmd Card doesn't support part_switch MMC: SET_DSR failed Man %06x Snr %04x%04x%c%c%c%c%c%c%d.%d%s is deprecated! use mmc_create() instead. MMC: no card present Card did not respond to voltage select! %s: %d SUNXI SD/MMCWrong mmc number %d mmc_cdCannot find console himport_r: can't insert "%s=%s" into hash table WARNING: '%s' neither in running nor in imported env! WARNING: '%s' not in imported env, deleting it! %s %llu Bytes%s%lu.%ld %ciB%s%08lx: %0*x %s ### ERROR ### Please RESET the board ### %s:%u: %s: Assertion `%s' failed.%*llu%.*s(((((AAAAAABBBBBB0123456789abcdef0123456789ABCDEF {f0ȠMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMNNNNNNNN N N(N(N0N0N8N8N@N@NHNHNPNPNXNXN`N`NhNhNpNpNxNxNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNOOOOOOOO O O(O(O0O0O8O8O@O@OHOHOPOPOXOXO`O`OhOhOpOpOxOxOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOPPPPPPPP P P(P(P0P0P8P8P@P@PHPHPPPPPXPXP`P`PhPhPpPpPxPxPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQQQQQQQQ Q Q(Q(Q0Q0Q8Q8Q@Q@QHQHQPQPQXQXQ`Q`QhQhQpQpQxQxQQQeserial0....e..@a 2H'V.TaxJ;zU-Boot 2015.01 for sunxi board`JJ JJJ@JJﾭ (OР iHMP  H4P  OР iHM  H4P  OР iHM! H4P  HOР iHMp! H4P  OР iHM! H4P  OР iHM0" H4P  hOР iHM" H4P ~ 1) \ //   JПM P-PE-0O004300CS$@_01``V pp  P bpVpW*0S* Pp^pW*0S*Q0????////@-@/@-@@-0?????/?00 0#0b0S*>?00?/A-p`_0P0PSE@ @Gdd P0@e@0 D 8P0e0T*6O@0?ALJBJLJ/@-:0 , ,/L0 0D "0P5 5 %;20%?20b 0l000/ v@-@d@ 000P  Rb0b00/ @-/@-6/7,7N0 ,,@-@@-'~@P.PMJ@-E-0>.! $0 \ -   t* $ \ 80-P50;1  t* $ \ 80-P50;1  t*0 X l (l /P$0Ql l//( P01 0Q9190/^$0 S8CRNJ0@-M@ K00<8 0,0@P040BN($ 0=N0 006N0  00/NUNnZ z C0c0Vv\ N@0T P @0 1400NЍ0l%JQNJNJNJNJOJ!J`JTJ*OJ@-@ NIOJ@-@ M`OJ@-@ MtOJ@-@ MOJ@-@ MOJ@-@ M}OJ@-@ MzuOJ/@- MP 0k~PJM000cS00Ѝ//0/8@-PQH@$JH0L #:":T*@8@-OJO@-O@@ T0?0?O@OO@O@-OO@OP/0 D 1? 0?/@6n@- @V4@-@7Y@@T&yo`@- $!!@_@-\>KPP0(R   8, #,0 #( #$ ö Ѝ?sJ0}op@-PML(o(o}㇮0A0P0偮0700575700;=; =0029007006600>>2>0a0700 "R PUx H dP@$ L`0 PU<p@L7@00p@'iPJPJPJPJ/@-W$JP  WM`@WQJ//@-p @ O4!4XX0 (!X0 !X0 !X0 !X0 !X0 1X 0X 0X X $X (X ,X 0X 4X 8X <X @X DX HX LX PX TX X0X \0X `0X d0X h0X l0JQJtIJGJHJ0HJXHJJOJJJJJ(Jx@J4<J(JJXJdJJ4JE- p$`W"W@@T * %8P   B4 0$LW  ?QJ 000R0/0 P/0/0/ @0S/DJKjQJM-P@`T1 P0p000W 0 P \ M  MM` ` P PpMp``M@Ѝ@-NPKxQJ@-    @-OPKxQJ0p@-S` R0S 000P@U!0 0    0 p8@-@P0 PP 0P80A-S`0S 0@PS bv0S 0^0 dr儀ҫPI0   ` VV``DM`` ``` 0S 0 S2& 0 00 000 ` 0 L @o pW: R \R00SVMP Pp0p0qOPNP 0GpG 0 0 00S `` 0SaVAZ R \R0  JRM-`00@ T. J(KP J%@ꐰ@PU0qZ PTJ KPx(J@PЍEJQJQJQJP/H 000 0   _S R=Co//ZCJ0A-S@f/PV000`QS000/) 0  a0 00#88000 //80  a0 00>0000 @ /@0B8C@0/0 @ /@00C@0@ H /L0S L003?:00T0T@  a@ @ TP /@00C@0@00@0@ < @00C@0////@- 00 4D0H孤P @-R PLT 壤P L @-CSJ@-Cf CSJJ@-  @ASJ@-@-Q@ P B@ @ P \///0@-@L i PCTJ0!@-H @LL@-,/40!@-5C40, L,0 @,8,, 0 @-  ƜPbLJ// 00b 0/JxJEJ///@-a@-CSJ@- CSJ@-0喬?sJ@-@-V@-6B@ /A JSJ@-BxnTJ@-q0B@-B@yD@-@-0<00/@-@-XJ0/Rp@-@@P 㱧`0BE @@Bp TJ5TJE-BXMp`P@) 㒧0:PP#PQ P E0P | \ PdB 70(0 000 0ЍJEJTJ@-@ l@@2MSJ8@-@[B IPP|JB t0RpGP\?BHL:BGP< 8P2B,P.B8#UJDUJ'V[UJpUJUJUJUJUJR@-H0@p@`P PP`U Js@-PX`@P@卢@P404`@B 0PЍpUJUJ JUJE-PB@M` 0@0p00^U00`0  Ӧ`` xHP0 ` c* P :0 ^0< 0005ЍEJ J@-M@p`d00Ph0 00kHPX l0 0p0@00IPP $Al ЍEJWJXJ@-3@-M-(M`L@HP 000 $w._?RG\G ₛY00 V $ $G딆pHTPpGP2lIA `6到R T8A#}FP0.AstG[ $AFP(A AaQH AZp 0 pAoQT0xS# GP0]00\00^0 03/@00L003?X00SS_08 $0 ` H00? @D0S03?`0 ] 4RHpP` X ` '0S@0P0 03?T0S$0F넴@ ١0p D0SS 0D@ #]0A00Q0S ^0SS00 P`c H0\Xp0L00P00T0$0]F[ [ 50Wlz@dw@8$ F Ho@ $0ǙP (p[@0$   U@ g0 W0#03[W ppRS} F@pD0S "0S2@ /@svXH p>pw8 h x00dt0 aGPot 5=x2=  pᐰl G p HP\^ 00P00S*@: @ F  +0jpX w.w   01@ 0;/pP ?&X |^E^ ?`5X a  0;/pP   0;/pP Xp(ЍEJ2XJ9XJ'V^UJsUJUJUJUJkXJXJXJXJYJ;YJEJEJXJ_YJnYJYJYJYJZJHZJZJZJZJZJA-`B@pPU U@P؟*@ P @-`@$y?4//ZJ P!@-P`@p=P  WTp 0@a=P ᨟`@(Q?4//([JMJ1[Jp@-`HP@I=P 4PT$M<`03/pUJk[Jn[J P0@-MP@8` ᦤ0 ( 0EЍ0/w[J PE-4@"0pS 0  D0S X`PP⢟U`VA 0`[D<@`P``@4>#  04/ ЍMJTJ{[J@-@ll`p0PQ 0$ F FP(l pP<PP l`c0x00h  PaP L> 0`l ,>< >Ѝp[JMJ[JCJ[J[J\J P@-//@-@p`P0 P>N>\J\J\J\JA-`P ,@P P @PP ᐞpT @PP  ጞ00 P`?T:㿞`P 00X`Up῞P 8/`P ?R; P; E-p0P`S @B0P @@T% ᜞0 s R @0 S T ,R:S,S S 0S P T"!* @//p R :R@0P0 R 8咞P@e[@ ᮞ00cLJ00/E-PP`P@pP@fA P PUᅁ@J4@J8@-P(@((i 0-8lRJQJJL]J@-(M 0 @p 00 0(0 +0S T  P P  0 (ЍJA-@㤀M`P @20pS xL;@P` -P 'P ؝P P00܍JFJ]JL]JP- 0\ X\<0Q P DRZCJ0 0/8@-P(@(( 84UJ4TJJ]Jp@-PᖝPp,`ᅝ@P fp <p{LJ]Jp@-PႝP 4`q@P fp<ppvLJ'^Jp@-(M 0 @ 00 0(0 y0S T0 UP P`01 (ЍpJ*J0A-@0Pᨀ`00@S@p :@Pt vP pP!P @$010 0Ѝ^AJJFJd^J]J*JM-R0@2Q`P@X  0JS|WJppppg;p 0  0\- W  .RR&pW,p0  0W  S 0R XR \  :RRp\ pw0 0;.0p p)X :X # 0 ;p 0 @ \@F: P@X ; 6P < 0 ,p;ЍTJ{LJk^J^J^J^J_JP@- fP ;_J0_J"90/ $  ( /ZDJE-MLMbpP'G`?`:P@$ @P m;hP|e RA K 0P @8 t8l8w4/\8Ѝp JmbJrbJbJbJMJbJbJbJbJbJ`JcJ cJcJcJ%cJ,cJRcJscJ\JR@-0 0c@-o Ѝ@-o Ѝ@-zp Ѝ@-o Ѝ@-np Ѝ@-o Ѝ@-o Ѝ@-\p ЍR@-dMp8P@ @0uM`P p~P  0~8ׁdЍhgJgJE-RtMP00ʓF@2`` 0PMP) pd~@P  0Y8 H C0 0 0IP0 (?8!;8@tЍgJgJhJp@-P@T,8჋`Pאl#8 v1QP 803?S 018(@8@pp=lJhlJlJlJRJQ 00S SSt 0S   QS //QQ/QA R/ZCJE-@QP`P $`7VV 7`7p`mPE7p@T E7`70Tp堠@DADVV`1 7l@T`7HpHV DV@`  7,E7lJlJlJlJJTJlJG|JlJlJJ 04FJlJRM-PM#p0aS6`R=0S 06 3P2 t 5l  OP00##P" VC  A 03?R*  C74኏P0  :7+\0@S (7`& 㺗`P.X P  X003?    2/P0*( 7 NP;   兗PX @YP P 0sSX 0X 0o 0PH 0 <R(T˟ `P0p0 # >Q_ WQp!   0尛 ` h0R0 z  Q [R) ʟP0`p0 # ]R R  Rp!   D  0~`0HW 0]Qs`  0 0Ɩ0X`10 0` ϋPLp9` 9PN | !gSX00`FX0sS `宋0P+PnU sUXPP9 0 0P`0&  nRp0   0pP R R PUnR Պ A 0P0sS4 3'0 C`Vp 2a0vS#P V  e00V00S @ 0 |@UT  2\eaS P  sSq0  B `2lPCPlS ``X X PP pPU |6 0 `V@  55 Ft 0@SYhrJrJrJsJsJsJsJsJkJ 8U0 &P e0&\ i5PU?d50pEWP7!eZ5WP0  Ɉp1梉0 3P h U eT<5U e<55 S(05 e+5U up 㬕P僊PǍX ߌ`P9`P0hSA0lcP140T5_1 40<140, 14014 4014U014U 0 14U0$14344 E`P 㦙00 `7PP    0;o  `PL00pS!Pp44Uy 0؈P,`w4l$0P 0 000l4aS 寙 ᩙ 0國`PJ  dS B尋`P;E4: ͔P P+ 54 彔P`H`XP   P  ,埔`P` PЍFJlJmJ"mJQmJmmJmJmJnJpJUpJlpJRJpJJpJpJpJpJpJqJ/qJNqJRqJ|J|J{nJ@-pR`P@ T0 P003?0qJM-p` $P@PU  0M; 0ɈP@-p`PCp@ ᭋ@T3 0 }3BJqJQM-(M@d`!PpP@[@ه T 0 嶇! S RṊ@0h 0ጊ@P0 8P $ 0 ӊ@P  0 Ȋ@P׋l6? $0P 0⸊@TƋ036o `(Ѝ[JqJqJqJ?rJrJs@-P\@Pth d@P\0`Pꖓ< 0ᆊ@P2ЍpPrJ[JMJ`rJ7@-P@#P  0 Ѝ0@2 Ѝ0rJSM-` M hh02SPp@Pd8 4F(!@PA00 !1@PP 2 2n} ! 0 QZ1>P>1  cD @P, g2 ЍrJBJqJaVJsJsJ/sJ@- a 0 ЍM-8M,pṇPET0P( N0P; (┒`(PFE0@P2  ⹗  0zPP T  pT @0S@PU00 X 0P:0P0 8 02 ((`⋗8Ѝ3sJ?sJ0@d4?00@0PЍE-LM@Plpp`埇 0 0HS <, *<04( "4008/0  RH  0 H !3?000!8P@ 0(( P5h0H3?40(0 P( 07pP 06o` Pt\ t0P @8 00LЍ/sJuJuJuJ uJ'uJsJȊJ@-ch Ѝ@-uh Ѝ@-"i Ѝ@-h ЍRKA-R@$ppᮑWP< 0iS cSP 4sS tSP .PPS`S@@  1USS@ U U@SOoBS@ 00x S/ȊJ@yJIyJiyJRA-P`@B 8p>P  0A//J@-|S@|S0yTR@-` `hP0V@ppT00StTP,0P@T 0o6zJLzJR@-S0 |d d00b` C1P@:H|08w0S@P  p0RzJ4@J`@J.ezJuzJzJR@-T@H_0 N@,V0S@P O0zJzJzJR@-@pP@gDAPU! 5SP0( 60x40 @g"DAP`:D&0S0 ( 00`@J4@J.zJRJezJ0 .R0@/R 0S/RE- P ` p @ P ЍE > `dהwpPQ0  @@aS P ((/ 8  Ѝ{J{JRA- % @᱔ pp嬔`PP 墔 坔 0S P /Ѝ{J'{JR2E-MP @႔ p}qP`  sP1#UO  i@ w0R P $$i/ѐЍ/{J'{JA-BQ3P @G pB`6Pp  8U@ 0@00aS0 00PR P */ 㒐Ѝ{J{JRnM-p1!M⬁`P@ ` 0> @ pPP`H4. @ 0iR P . T1! T!.<P[pP ȓT  T0p3?00pW  @ 0KR P Pd.[PW0P 0`Ѝ/JJJJJJ/{J'{J{J6{J={JD{JK{JJ{J~|M-R(MaP@ Zp` y ptPhP@[  h`V ppp 0Q P c.# ^. R W.  WPF.0S 0 A^R|<.tC.00 *.`gV0 0P0@0(ЍJJJJJJJ'{J{JO{JU{J/JJ'OJRM-< P p @Pp  P D` . 0dS0 00oQ @PP`Z , (-- Ѝ[{J{J'{JOJ@-@ *R ȒT T T 㸒A00*S 㭒$S/0{S 0 }P P/00+/M-PFaph[ 00U  !@PM7WI0UpP W@pJ|JJJJJOoB7@@4O2PP!@O+` W"JJJJ$J4J@`OoB@V@V@@V@@ V@@ V@@@>-ЍH-J{JR @-@= 0R̓JJJJJJJ 0 w-o/{J0 0 0 /PP@  > P @PÍ@?H, y?8? ,)AލpJ̔JW|Jn[J00S 0/Q-( $ŸR 2  0c%40SQ 00S! S!  0SQ00S! S!  =% Q6%x3%$0lS -%+%00&%Xg!%0sBH  㧅@PVg\0H I  B D0 C <0 D 40 E ,0 $$0 XЍ/KJKJKJKJKJKJJPzJJJJfJJJRJJJJ(J-J*JRJJJJeJJJJJJ JJφJJJJ$uJp@-`@_V pP 㸉ORP*:%Pd#pM-P@p 2@D`P 0TWPT0S!PP004$  0M/JJJp@-`P"K@P,$pU00OPp蝌J@-0oJ@- OR@-1P R@ NP`R2 E P@P`F$pPRKl0l P@` 3$T<0P^0S8)$0_ $$JJJJJJJ@-D@P dO0P 0S 8 #J@JRA-@- @ `pPeP@  0h#IP@P#1 3/404 @T( #@T@JUJJJJJRE-@3 @᳈ `孈 p 娈P&P@  0l#HP@T# 0} 9}0S00' 0} +}0S00 "} }0S00 0O0R R Rp' W?o2U000 USX00PPp`j AVB0oЍH,JP P :P Pd/ P : P P D/@/</8/4/0/,/(/$/JMJJ J+J3J@JDJTJJP8@-@P P P9 pT T0jU *8@cU #@D\TJJJ J(J0J |xEtCUl h5:PU` H8@H4J]J~JJyJJJJJžJўJ՞JޞJJJJJ J{J8@-P@MP80S8@ T8M-@Pw~p` 0S0P$Q 0 S/ \!0C\\ 08Z0  C (X 000`|    H`!00CS !10 bwP ` 0 WwPSwPl9S` 9VP `Ѝ JJJJ%JJ#J3JhJQ/@-M?@`%1X#*  1+10S S S%-,1 +10S.D `p@$ЍM ꀟJ]JOJTJJjJJRJyJJȟJJJ|J JJ5J!J)J?JMJ(\J@-@!PC10(pH`s#4 vP  0vP|vP1S |!Lh!T!HC?B/0 ! s#4  Ѝ`J}JJRJJJ۠JRA-8M@` P+vP@P  vP  vP V l(m@PX|L60S@t@ ,u@P `PP@u$Q FvH@ T u@P$V ~PP 1SQ@ T 1zPh9PPT+ 1S9= (u@PkV} z`pP  z9P`0SS JS FS" %KS PS kS fS jS pS sS TPHP <P 0P$PV h0Vd1  v` #0 0 d `  EpD CuP @ t:u@P$V@P `P 0S U@ 0)P y 0P 0S )T u@P&r0SV iy dy `_y @p0e  0d00pP0`0` S< (y&=P>0%=0OJUJ@OJp@-&M0P ,`@` wr000pOJ@OJ/M-Mg@?@PP l|U@0`1 |0 h 0 00P$y#P>0W101 & $ AP 71S|00 S0 S @S0 00h0d0`v```0`` ` 0PT pr p 0P P"  r  PB? 1 `Q! Rqa `p"Qlsvdp 0PI0<@m R Q6 0QN Q 0pE? 0R R)QG0 S aVڰ0 1F?00 q0    v0#&! &!R 80>00q0 $ "$ RQ00Zu0 nuq@1T '` 1V `1dh !0000 0 @P+(p l@p@H`4q 0q ,qQ  0.Q  0'Q  0 P`)%PߍzJJǨJJ,JdJJʩJtJJJJJ7JQJJJ.JLJs@- 1@P` @&-p00&M T@ ZCp P ` P \Vldf\0 T@D00S4Ѝp@JOJ@OJJJJJ٫JJDJJ@-r qh0 1  #0d   4Ѝp@-@ `P9T@ p@q@-h0q10 0 d  Ѝ@-r qh0 1  #0d   Ѝ@-)h0r 10  0d   Ѝ/0 /HJE-M?@P?@`p p P 가ppW 㰀Ѝ@-MGp`?pP@ P90 0  ?01S ) p PpH C , R   R   R  Q ( $I iqP Z0(9 fЍ7J"M-.M0`?`S ʨr @ePPx Z UP o 0 4 0#40o  o0 p01 S00   R0p 9h0 d 1 0pp` 0P9Wp&꒎p9W5_0?00` P%0尰Რ 0* 7P .      p  0 S0S .ލHJLJOJ0F?0 \ \ 0S 0S 00S2/9 R  /@-@M h01  }/ !0 P09poh0104 =eoh014 3[oЍp@-(M`@ Pn 0000h01DP  !0}/  L:oh0104 h0104 (Ѝp@- h01 }/0  'ЍM-FM0WD"P`@??Pq0 RW3p$ h014 7 0  sn 0}/  0PPZ0n h$P0 PW000S}W  }/ lP9 W  P9 P 0p N ,?P `0R0 0CS 0S C/o0"S00SFߍJJUSBCUSBSM-0M0!P!0R3 h0h@@100A 4 @4 @G0000S0_ h01 !0 }Ϡ\ P II h01 0 I?`V< ሠ  V 0 0p 0,0 0}?00$$ 9S  $0 $0 9,W ,W [K , pW `V0ЍJs@-0% @0`$0S  APU0 S mS `i 00 R RR 100c!R RЍppJM-MMG`@?`Pp = 0Sq  p 1#4L01M01PS_ R09,03/Y 0S m000რ20000@00 R0   00SS0S09 B0S$R#S! S X L@ Mpd Wm  pW L@ M( PK菬J̬Jp@- \@P`l00020000@00 00003/`pJM-PR Miq@`p00P  t0r# 0R X!t0p!"H1 0*@ T A00 `l 0* 0 0" 00 `000 02/0P pW0 W(,w`6 o#X(lt X$ &$    + 00S00Pg000 ЍPJJM-PR Miq@`p00YP  t0r# 0R X!t0p!"H1 0*@ T A00 k 0( 0 0" 00 `000 02/0P pW0 W(,w`6 o#X(lt X$ &$    + 00S00Pg000E ЍPJJ00P0t 0 /ᔃJPJ\0p@- RL`P@0T4 td @p p蔃JPJ-JJA-`QU Psp'F 0S 00CS@4 lkP`P 0 0 0S 0 :PS\100X1T100P1,000F0f D+! R*!   +! 0 R!!  %!%  P PP 0S 0S 0S 0S 0ASx7  P % R % h0104 j,0$9PIJJJJ/JdJJM-M0pB?p`Pp 0 00 j00020$000 00003/P Xx  0S S 0 0j Ej Z j0 p$0U0^0 j 儰 " 0 2/P ?p ?p   pjt1B0Sd1L0:SK d kpWF 8j%000 2000 00003/P Z --< 0 0002/ 3?0  0R   Q Q( #8R8  S <BL M0[ Pm ܍JJحJ̪JPM-MH Aȡȁ`pt P$jt0 t@ 0p``VlPDk0Di0D pAPYPF X14` 02"0PQ6( 6 _?` h`0 0 0}?00P0`0t Rʜ 0 ` 0`P   VP U[8P`ЍJPJ|JJJLJJAJM-p$2 `@=V{ mV@t  mVP  m[Pp6  1R5P|U0Sl00V0S L80S 8.P( $}5U%* 04V#pc*Z Z d zi\ 0aP I O `Bpl]h ZPЍ J2XJ]J'V^UJsUJXJJUJUJUJЮJJJJ7JYJXJn[JM-hpPb P,h@PP{ PP `p,h@P `P 5X X  )1@0  P0 S R 0  P!@0Z  T TpQ P  h 0A Ѝ蜄JJ/P A-`0P@pS TC PTX &hP0p/QPb 0S0S^ 00/E-MMp`@00P w k0PS  Rj ^2/0P0S }  P0S+ PCP gPU'00S0!!3/P0 S PCP gPU 0//, -0000ۍЍ芯JJP$ M-@Pp`U VE PV[  gP P 0  P 0 /X @P gP A-P$p`F @P 000U p00`0 gPPP00 0P @-P0@`S pCP 0`P /A\@-H]| "   @AT"   RO AR  ORT AR  TRA|S SQ. 9Q. GQ.H\  0RS000CR   0AJ&JJJM-PIM<00SH00H0`pSSH00 <0Qp`W 0<@Q ogXB hgH0S<0 0{<0 RBQ  00 S0 000g`V)W0?0 H   h !I00 !0@< fЍ07@-0@S0PI :P  ;<0 00: eP*0S Ѝ0JJJs@-\0PI0 Ri :P T :<0 009 S0000@Ѝp觯J)R 9S7/A-HMPq`@Pm0sO 1SL!1SI"1SF#1SC 1S@J?00S;+10S7LPDh0L Kf@ h0104<*y P.10 0"<0 00l9P B? 6P U<  f\~e1 0 H0<@80@0400PPHЍ讯J1JJܯJJ<1J0J@-pH@P 0`Y@P@ ':<觯J@-PpU`t @000  -RPE R fRp PEU aP@JJ@-0GJJRA-P`@B 8pP  0A//J0@-@P,M0 0 00000@ 0(0^`@T X@ @0@4aPP_,Ѝ0JQJ-JR@-@  -Q  aR@D0T P`pP L LcP,`XpWRJQJM-@MP pPEU* 0-S(0S dS bS cS rS tS PP pP p@][Pl W00S @hU` hPUPP U#&0PfQQ SVP Z PE` d c0P @(@@ @ `0aPP0P P0L0*4000Ѝ聱JsJJJͰJJJBJTJJ$J@- BR -^ ^ a^ f^ R Q <' ,R \ M@JE-,MpXP`=dPh, 0 -RH R fRp H(!X0000S@ L`o6 cZ@@PD& Q0  R QS C00`0@`0(0@ p^0S(0$ ,Ѝ JJJ@J$JZJR/0/J@-H000 00 Q 0S sЍ䆲J@-@h@@-M @ehЍw[JM-P @@M p EZ6` -R3 R& cR bR (sR tR #T TpEZ _ `gT p@0 P<IG gX  vcWPE` P `0_ P0 003 g j!p[@`P 0p 0 0h @_PPX0XX 0T03[[  Db,e@Ѝ聱JJBJJTJ$JʲJn[J@-PP@p`W0@=S0S=PM-pᰠ`PP@P T@PPfPwP U@fT 00EβJ0@-@(M   P 000 0(0 ]P\ P\(ЍJ7@-P@P f0S Ѝ08@-P@P  8@f8R@-M@ P  <3g8  ) P /ۍ{JJ$0/( 0R$00/ZDJ@- (0S 0/ZDJ@-P 0TSYS001P8@-(P@  ( t(P@8@-@P 0!S|`@S@dO0@0 (0 0HHA_P<0<< 080{0F000Ѝ蒵JJJZDJBJJܵJ$J@-0 (00 0  _ЍZDJJQ0@-@M  b a0P |@0000 0XL ^@P0@00 8088 0400(Ѝ JJBJJܵJ$JOJ@-M|`0@pPp#h` @@^P H0HH 0D00 `ЍJBJJܵJ$J@-(0S; @U@t JM-0P@ p 0E\ `pP 0Na K0X R  Q0 a0Pc40  `[W`0 101ЍJpJMJE-ph@Pd0`01U1a(0S 3/P, ` P蘄JJJJA-P<`p8@1T1 0S 3/@舄JJA-P<`p8@1T1$0S 3/@舄JJ-@-MMA.  e@[/ۍЍ@Ѝ/@-@,03/00p蔄J P/0 6/ R/0 1/ R/0 ./-@-M @MT A.  se@ۍЍ@Ѝ/@-`@Ppe`P  _`P  pY`P  T :T 讯J^JeJ^J P/0 @-@P @$.ꔄJP/U-0@-MMPA.  e@ۍЍ0@ Ѝ/@-M0  e@ {ۍH0@-@T @ 0S ZP P0@@蘄JJ0/ᄄJ0 /ᄄJ@-@P 8@-@P )T%PP! T0S 3/P8`0TQ T 8X D@ X0 8X 0 ,X $ X0 88$JtIJGJHJ0HJXHJ /@-@Qt ldQT@@Q0@@$J|JJJJJǶJ϶JX E-|X xtX lX d!X0 pTLs `oPk@ ppw+ VX`URTPLU@ ~T yV t P T@3@t000JJJJJpGJ^JeJ:J\0Pp@-@P`  bb_000V:$00V`pp謄JJ܄J H_J܄JJp@-`0PP`N@N@JD T00Pdp 0bSH00a8p0Pd PP0@d@pJ JJP/0@-0@Ÿ @PTQ 0a   010R0810@Q P0` P P PQ  8PP00  Q 0 R *!B  0 00Q"8Q[ TQ"nUQwTQ"|~\ P  A Q R: 0 00J JJ5M-0S50SlP `UV`~V*`1! P P06 0 00  4?0 S&380S[0 TS&6n0US7w0T%S&9|0~0 \ 0 00   ) P   f\0C0$PS  @fT 0``00  @ T 000 \ *@pL!  ,$R,#8 R[ TR,&n UR'w TR,)| ~ As^ B!@"  ^   \:  C!"RJ0 0 @ P  pfW 0``  00  pW 0   0 0 @000 N0C^ 0 RRP @  0pp0fSg1@1@ 0rJ@@N@pP  [0 [XI:tXP1@@0@40 s`01a0@c>0>0@p' 0 00R0h000 W0 0 0 pGp 0W000  t 0S0d S00000fS 0` `0ЍJ܄JJJ JJJJ@-P0p `uPQ$ @0pb@0oSrpW` F$RR0 R0$R00    \JM-@Q&TЍM= XpDPUd0 S  S  `\ h00\ P0 0 0`S`fm S:0 Sgp   E$RR R @  $R  @   @0q\0 h  00[- 0 0 0 0  E$RR0R00@ 0 0$R 0 0@0000@00000006\ P'Z* 0 0  E$RR0R00@ 0 0$R 0 0@0000@0000000 Pp7\h`P! 0 F00R00P(  E$RR0 0R 0000 0$R  0 0 00000  [ h0R 00 0000 000000ЍJA-pQWAW PpUPPP @H"qQ `G0g```F0dS0`@d00d 0    00@@Z@000eS00PPKR@- R __0 J@-@M@@  y[ @ JZ03?co@Ѝ 8@-2/@@@Z03?co<0 R/@-P`p@V # % %(@<A!<@2/ ^ 03?00 @- #P  @ _J@-H@P  T_,0P  K_0L0`JJ@- P  =_@JQ/[@-@ @XJRJ0SS/ / J2J &J0J ;J2J IJ1J@- M@400$(`pP0  0 2/ 2/00S PDx`U 0 @ Hd{ 0 0R0S < nPЍ0J]JsJJJJJзJݷJJP  O^0/ J@-  000 Ѝ@- 0R LP'V//M-,P(0p`ppfXc YP  ^@PP :YPJ  ^@PUa (0P0PPPZp F `1`R T P8 5C 23V P 0S0 S0S!  PD0S "0S  x 0~000@00 03?ЍJJ'V^UJsUJUJUJUJ=JXJtJA-P`@pP)  ]p0U P00 R ƫ   8pUS U 0*S*S0SS輸JJUJȸJ/0@-Pp0@Ml 0$h x0d0t0 aP l 8P R l0@Ѝ0@-@$"@2J:J@-pMP{K@PL`T 0oLP!(  cR@Ѝ_JM-P`UT pUKPP@B<@P  \0s ARVS* RpPR0*0xRPp -8?? 0 |-? h  PP HP<``)Ѝ蔽JJJܽJJ)JSJUJM-(@Q000`VRP= ` \I@:P P&)~pP P d0S 0S@ JPC ,7R4 rX @dT#D0S& "0S%@J 0P @>JP0 3?S `0 0@3?0!``0 V   :Z Z2/PP 0 S@@Z@#T L0ЍJcJUJJJUJɾJݾJJCJxJJ߿JJJ J/@-`@pPᜧPP)P O 2/PPPt0S x0S 2?0 Qtx BPJ;JbJJ0@-1M!S  ! ! !0@0A0S00 S B27701: BQAA@U0S:S B27701: Ѝ04////%%%%/JP @-p@`4@T,DV4PDP@/JP/8@-<P+@P < BW8@-@P 004 T40 408 JM-0M԰@ P` p縀QZ' mV W`PV804 p`0 040804@T 4D,DP VPPU@0Ѝ$JJJ04 4 8 /J@-@MLAS< V /V|0@$0p0(0l000h0,0< VP VH0@$0<0(08000,0%$@Ѝ:JnJnJnJnJJnJnJnJM-MMPkSV0 VP S@p@W \D\RoQ W@V`E00^S@ S# p\ S S \0R0'T  R?$T00S0@4p(T{T004 V$ @`F `PP0p)T}T j B0%Sڷ0+ 0C[P@ 0S V0`F0'D\RoQ@`FP000'@ ۍЍ qp@-P@U `P  PV00p@袬pRA-@P`p@P4 PpW/QJ@-gvA-p0Q@`A SP0Sڐ00C0|U0*0P S0000 U 00C000C0LJJQ@-Pp` @P" BT@Q@@ @aT DU0\p  000@T }0p  000J0M-0(M@ d)0ST)P0H)0D)@)0<)PQ0S00X S000TPP`p ?P )V ;@0 0$P* pp P P``( UC P yP jPn0 S*000P[00S ǣp`ȣ +`1#p꽣QP: gP000!SS\ 7RTx'00S0S0h'0000IU [P!P ; 0 @ 0%A0@S{J |JwJzJxJxJxJyJ(00PC 0P`V ;@ 0 0P, )PY:Pz P P] P* P PP P PM Pb P` PUy 00C0PPUn |00Cg`Pe*`F`V  T  | fdV`FL0SL*XcT%lV0 0C0S? R;*b  [0040S ?00C0Q( $I30 0C0SQ `A`a OT \ . V`F00Cr4Q& A r#  #0 S3#0SS 00S000S #QUS0S 00C0Q:SS R*b 0#0 0C0S0 S*  jS0( 00"0tP 0 c000;@0  0 2 P0p DSpP pp` V V V5 V =V  V 7V V( 200rdW00S 0Stg 00C 00P00S p 0nP0S0 S0S p 0]P 3R# V00  0PPP . 000 0 0`0 000!`P000(Ѝ者JJ0JJ JJJJJTJJJLJJ ꐅJE-P@.`RPPhRPpF'`T  RPRU `@V 0 0aC17J@Jm۶@-@ 84P  JJJM-MpPZ@`G1 ` 00M0 Ss"!0EZ@%p@0 0(0 $ R(0Pp $  SW JpP W | 0@TР gP @` V@iK3J=J Lo- P  ^<<,P P<JTJM-M`|00$ 000 0Q@P Q0P 000@S}Q$$P0  P P P ,0P!0S S S00U 00 1Up  3[@ T03@0p 0 1TP PLU0000S T,P \0p05p0 0,0JJ00@s R/a0@SW@/A0@S7@/8@-@PPP88M-pP0S SS[ P00Kp@` SvXJhJxJJ JJ JJJȊJ@@@@  @@ @s0 S H 3#" RA > P@`t@P@0`t@40P@t@ P@` t@ 0eSrPp0`@0t@iP@pt@P  p@-PH`@ToP @lPPpDp蠆@-P Ѝs@-B*4S 0*4P`P 0PS S404S S`$4V0$4\UV\-P 40 4HP <P 0PS0;41`C44UP 5P  0P 0(4S $4P0#S |P(4S  G $ 44P R 0s0 $s0RЍpJJJJJJE-0 R@@#00(40CD)D4*DDD D$D0D,D<4S 4n ` pPPUf Q@PQ4SI4 $0S0  Q  Q5 0Q  R  ABQ r xR0P0@AA At PR00 a0AS P0 a ARW0AS 70AS>, 0Q 0S,Ć0*40 4t PpGW(SO(4SC404t@ ЍJJ M-D`pP @V)  Q*$RjZ` PP: $Q.  *$Q ,$R ,$RT 00Q  a$K$ R\ QBR\ RR$R \\ B$ Br QPru" uk$R ($RCc$ $P\U )$ ($RCR$ $U0 Pd0$)$R$V `jMN$ p j$$ uЍJ<0@-$$(0 \$$ $ 42 ЍJJJJP@-@ t@40CS   0)44/P@sNJP0/&J7JM-hM@)p6T)@1w*.TBT QP+$T @@ 0P+0,` $0l0 D0000 d0 CP0T D @DC P 00! "# )( $*(+ ` l K,\K 00@ 9GoL KJDBJJJJ{JJ J0H-P@ [d D ?@?@@@M?0?@0P KN ,@E  @<00<0 =0@0000p0<;p0000JJ-CJJM-pPM0PP ,P 0儀E$0(@3?$00 DE'0(00)00S50%0*0Tf T1#z004 0S|$0(4#$,0- #(#<000+00500. @ / 00 PP A0S1 1`< 0` 00  GE0 " P 8 8 c8  U PE3U 0 000b@c$0t@ $PЍJJ8@-0!@ P(00S E@T888@-P0000OnE@T 88J@-@%Q QA QEG*Q Q (Q<4< 0P s QP0!D8 0! 0PY 01 D 8 a D ,0$oЍJ4JJ JM-`PM; P ;.tDX)c# # #@qP!  # #  # P 㨣##UV*pu P  LJ @@  Q )   $Dp ,+p     u'P C+0 R 0  L  HD(  HR L Q(  RPE t%0 0  R  pT20(  R#psP0000 0C$PT*R" R! R   s!T S(#S4簱!1  0㘡 㐁 q |a  p hhd P D  8   ,   $ p@ ` ( ,p 8 P PT<0` 4@P4003 P PЍJJPCJ JJ@x@J$JJOJvJJVJTJKJPJ`J\JJJeJJjJJJnJtJyJJJJJDJCJ)J//6  L-9 S,@<p㺬Xl 0 0 h0 p   '7(0 0//ğM-8 $! P4JJJпJJ4J0c 0@P0ࠣ0唃@xx0|sPl`MX0\dsPL`"80T1TA0S0S y003$!0000! 8 S):k' 00C0S!008010C0 00S0C00 P`b0@0P#0@@080T:Ed0 d00S vtH00S ,008< ${ЍpJ JJJJJA-d@P`@00pU V(0`A08< $VJJ/hM-PPA p## `$@V$ `444(((1  0`V00$0@P@ QP 0S  p B00  pWhJ J J<JPJJ 0 1"# 1 5,1 5! ĠȌ 0 JJ4J3J JR ,0@-0 8 0 ЍJJ@0Q/40 8<0$  #10S $*/JJJ/A-MP RP@ 0bH L0@S3#S3P0TrTB 0LSJJJ JJJ 0D0 ?211111000 0@0#!00 @80$aP)!D`10$@80?@P@DAP P 00 X0d? 0P 8@$0 P@#$1`@0@`T0` 0@8< $8!tPQk< ?C?0 0 10x0(0t0,0orkЍJJJJJRRJ J\JJJJ&JJpJM- ,DM$T?,  P14P1d0;d0P11P1s1032@ `` 010P11P1d0;d0Ў00d0|:d01T31`3`#SL#8083!!!d  d 9CD "D p !.     ! ! "@ 0P80`8   p" l" `20\" X"Pb P= T @vQ ;T `P`P 00 pT @vQ p7T `P`P 00X <0|SxE,as>$VAD@ " RR"@ "  ! ! ! ppD? ! ?? ! :?  00S0b0(00 00$0;80<<0ЍJUJ`JJJ'?"L- N'"|J@-@0S` 3PP 0 30P l8 <$D 姫@P $ЍpJJJJ>JeJ J"$0 R(05;0 Q/t*"$0 R05;003/t*//@-@@8@-P@8@s@-P00PSP0@SN`aSP @aA`` YB R  RP@@àOV@T Ѝp@-H0H@H 0dC1P0P ,@ `@J4@J.~J||00lxC1P/!p@-@|P`| 6/ p|0 0|P|@p4@J`@J.|/| p@-P@ 00b C1T :|P| 0SP|@| PU|`|0 p4@J`@J.~J@-Q@p@-P|@|0p@/A-p|`Pz@|w 0 004/ЍA-p|`Pg @|d 0 004/Ѝ8@-P|W@T |R@|O4/ @ |GTPP8@-|?0 |QM-@D`p PPRP00 P0SaPpX@T 0l6nA-Ptclp @ P uPp v=`VuPpHH0  ,5JD 8@-@0@PP@`0 <P88@5J80@-@0PX <P0005J@-@\0cXpP ,PU *=`V00 0PUPTPUHHD@A-@Pq`P @TpG 8(@Dp0d0S(P AE-`P p兡$@P UJ 8 (PEp{qTTP@DL `000P0d0 t T@D   E5J@-q`@Pq@ЍH0A-`@ p 0P@ L<lLAj5J000S//A-` pPW 0S 00@H0@PQ@@0@P H0@P S0   00@-Q#JJJJJJJJ'(( @'t0pd 0P :00Ѝ/@-@P000S @//000/M-P@T0 S| S2@1@00<R`   "<&<R:     T 0V 0A q0d ; <SV p Wv08pWP ? 0SL; T 0y@S08p@T< ? 0S8; 03009 ,0 00(000$000 00@0 8 00 0. 0 0 0p   }080@ G0PP 0R P 0R 0R 0R 7P$0 11U [`0`,1!PStp<d0h0d1 P0PS00R0! R  0( R  0!((R  0 000LP 60O 05;P0L SSsW#< ;T0BS*S8y;eYލЍ,J,+JeJ) *J+J@x}5JuzJJJP/8@-0S1 0S. 0S+ 0S( 0S% @PP8| 0000,0000@P000H01@01<0100,0 0 885JJ<JJLJ/A- M@P 000S0@0~0S0003/P~,PP5d Pq000_ 10S10 000P0S1 0xo7p 0p0 PP))00000 10 0R 1 0oPP60S`V* V (0S?Q0,B0 5%P#u`$a PP (1S  PP(1SPPUu ,u0%1 ЍJJ0S80@-@$Mu%1SOpP,$1SP0 $`P PWP d+6(1S8 00(0S?005000%1/$Ѝ0@-F@PP,//@-`\P@pT 0H 0S 0 V {@@LJ J'OJJRJ0/5J8@- \@PX0@@ P,PU &1S P8LJ5J@-00  5P,J,J,J,J/TJ@-0p o8@-@L W0 00SPU 508 08 88 4 E-A` p4h1&`0\1000 PP/@1, X\JtJJJ10:001D080800x0:0l0 00:00%40p0` 3`0"0 0" A$400@0 IEDzP TJJ0Ju J;U2JM-(MDPP@X l@ #JQJQ 0 d 000 0CpW8*l0`g V`!0S0B00h Q # !$00@P  0@P   &001000@P 8KT @pP (Ѝ9JJM-0M`@PIhPp0 0WP1P! X+U U  0010 Sh0 P 000TP U  0100CPHAP\h0 pWᓬ*0ЍJJ(J/000C1 $0S 00 0/@-pP`<T@PG4`@-pP`<T@P8400E-@P<<00<04\09\0`P`4p`1<0 0\00 0S420`00d0<h07l0ЍMACJJp@-@h@P6 d`P/@ 2 2%0P00PҁUx t`08`0*B|0<040|0T0 <` 0H0,0D0$0@0(0)2Z<,, p pJ`JJJHJ JJ000/000/00$0/00(0/000/00 0/@-0P370PJ(J/ 0 , /$J0p@-@M@tPt`T < u2 100D04@P$080 `(00000,0,0M,@@Ѝp$JDJPJ\JlJ|JJ8@-P40@T 1P,@0@88$J(J@-@0@-<0s@0/@-n@0/R8@-@ P:R 60@S P K P P P t0P d8T8P <P X2@P T2U . P1JSJO}J@-.@0/@-)@ 0/@-@#$0@/@-@(0@/ Pp@-@ P`A p@h0J8@-@@PP 8@-((0@@-A @h0J6n@- @ nq6n@- @ ad6n@- @ TW6n@- @ GJ6n@- @ :=(6nn(@-cf@-[^@-SV@-K/5J@-$v trp@m5J5J6J46Jd6J"@-E0s0@ 00| 000 00q/ q Q 0/00| 000 00 q Q 0/0s0  /0s0 p/p/A-`pP@)1t @T PEU0P P p@-P` 000T0@P 1P D00D0P}=@P /p蠆sJp@-@?`?P~ `:@>0@dT*RPd@sppJ$9S/ R0  90;8 00/M-MP  ?H) 0 !R  @@pSpW$  0 S0SE@3@0@P5-` 0 0000000(01 0l`0700@00000S0oW=Q1P ,(0P @@o P Ƃ 1S060 a 3 0 SPx0`@W9    <0/02- 8Sp0zg30p00 W4 pSW$0('   *8<0Pw,`8D8@0 g0040(\ !R #(p\``  0@00倠 }0 0}000}0 000?000 001P3cF}0c#?S$ } }}p00 $}P:0? 0?}0S 8H0 0 001wP;100%  R R R PR R @R  l l  @ " )S8 0c9 P܍JJJJ8JZJ@-0 00 0)Pm蠆{J@-0 00(0PmA/蠆J2G/QD/M-0`pHY 04#S S #S@K00@P #Sz S #S S 040 Se  S:  SW S {.0 0                             00 00PS 00 0 04#$R R RB PB@ P00PPs0S :S*PtBPlB}0)STBPx 0P00 0p *0 0Q Q01 xQ Qtn0  088$  :IQ: . , ! 5 0< 0}>9P0 . KL* 0'*0 0 $R R R 0 6R R R00.00 0 00:*00 ἰ 0000P@P@@7. 04V`V`TV -i 0909Ѝ6JaAJAJJAJ0@-@ 4 @@JM-]pB p`0 7 PZ 0000(2P}0]0` @ 0 U-0 0 :0P0 X0 @  {0 0P ` 9-   t{ R $!=G# P @ > @ 0R]{= .0  0    $  "$   $  "$ 0000@00@00-=L0p "R(000`Ѝ@JJ6J J!Ϡ\@- ЍA-!X@HYQTUU`00@0A@AuM-(M`HyV V*_00UPPU@P ``@0P 0`0C3 @0P  , ,7Z$40=080H0 RPà  $0P`H R P嶸0 $0QAAo Q $0 p1 0$0    0P00H??]z0??Wz0Sz$1S P00000GzDz/P$10$1PP P (ЍCJJ@p@-PUp0@\`0c20c@(z00 ?0?`00PzPp諪E-pHYP%$10C$1_z}0@`0V 000y Nz PP @$1S@@}{YJA-p  `@PP $O(zTCO@PzP4m@@XPЍJx@-` @^Tp\TT TTTPTTPPTTPTTPT0E-ppA0P`@#0S SLH0UE#0! 0<0p1  `  `  00* 0S P p8<08 0E$0S !0 s0D 0000080006JJJJ &JJ0p@-P@` p 0S& !8<08 0`  @ `  pP0 R@P p B p086J &JJ@-J///////(0 P  (PP//6J@-@ 03/00Js@-0P0 0lPt@h`U 0SU P0S 043/P ,0  $0(@TЍpJJ6JJt7J8@-P(@ 03/00P8J(0@-@03/@J8@-P(0@03/@8JM-0P@c8 0` $p  T( ?$ !P X'LKHI@e`P(ЍSJbJJ9JSJtJJRJn[JBQR8@-P @PU 8/8lJ@-@ P@BQM-@(MR`H P@P @I  , p,VP ,Pw 000` ywVP!U |p0$0`0 =$p  ' ?$ !$ & (ЍVJSJtJJRJ/ J000SP/lJM-hMp 3D00(00( @ 0@ b4  C0R ͱ P0` 0ds=``x'`0000D00H00`00d00000!0Z=0d0``]'`0P `,00,P@00, 2c 00"0L0 0, 00Xq*L8E408s00 CX\%\XD0`0H0d0!0= Xd \``'\X#SR0@ b hW ~ 0S( `p\20#  0P5(0 `P\30~ hp'  0kpP0h00" 0"00d0~0  0NpPhЍ J0P@- X@ 0P <  0IЍlJsJ@- o Ѝ0@-PL0M0S 80P 0 0  00Ѝ0lJJ@-@P@-0MB Xs`pyP8i0@00 00ЍJJ@-(00S  hX(lJM-0Mp``F (D000)<P@ P5@20 < 0D @PdU < 0 P @ @ <(P<;00@cD8=  00ЍM-x P> PED  Pb Z @5 `&V  0( @0 0 3 Q0S@ " 0Qsꔁ Z:0## 0  0=P Z:@0St 0 `Zx0@qTk= Z T`,w`Fa 0 SI[@  `g&V``y6@6`fĶ T A@ 0  0  F&\@dWX0P  0@P,HX0U6P03J xf# 0 S0f 0C00Z@y  &[5 @5 儥儵 T @ [  %\ @\0P  0P \0$50Z@:  %[4 @4 娤娴 T @   %\ @Q;00P  0=P^ 30 1U3P;0 0C P @1CR0@   %[t9@3 @83 , T \ @  `%\ @Ȳ`0P  0P `050圂 R@   >%[x\2 @T2 H T 4 @  %\ @ :0q 1P  0Pl10 150q0S@0Z0 $[ `1 @X1 L T 81@   =  $\ @ r:0 R ; 0[P l00 1U0P :0lЍlJJtJJJx7JJHJuJJ|JJxJ|7JJ?JuJJJhJpJt7J J@-@P || 000 l0 h@P pX 000 H0 D@Pd4 000 $0 tJJx7J|JxJ|7JhJpJt7J8@-LPL@P Q 00P B0 8@JlJM-0M<0 `04 S8  p P@ 0,PK $0K P0 0P0[S2[p0W: 0  M 00 PPg@r P$U^ 0$00[@0[S S@@S@S @PB@00J T T  T@@80< SR4 00R00S p#P!<0@80P ꈠZ  $P00TP TH T@@< 00 KJ&J4J-J;JM-0MP`0 40 Z#(P 0M0,0 R#@ "0` /R R(00  /6#pP 0/S00 ,0S (tK,0K @8 Pk pi ,0SV!000S(J(`0S  @ 8 8 M#Z P` <R ," 0 $0K 000P 80 0 `  (V 0/S~0@@ ,0KqXlW 0S`(00 0,04 0KJlJ@-\P@0IP T@o T0SЍJ s@-0 S @P0 `  P  0S 0  0  PЍplJJp@- `@ +@"T! PP #S?RL0 S50 0`@TXa YP @pspplJDJX0p@-@PD0 @<0 DP B`D0 8pJJJM-P Mp@0? ? @ M!?`?`  BR*R!$ : _c0CQZ0 0   d0T* 0  Z0  0wP A  0 # R 0 0 0eP  0 0SO SB  0LP 0 # R 0V#0 000 S2 S?>V*ؠ` Ѝ@- 10SP@@p,`P  P@*@ 1 S@@$@ 0000P Sl P@`P HP 0 8 AP0@0Ⴟ JBJKJTJQ/A-@M`FPPA   p 0gS0 0Cs00.&P0gPc``EPU |0  S U r o~00100V  `` @a 00V Z܍ZCJ@-Q`1 @Q!$ 00@@3p/3 4p0W, 0 00S ЍJJ0- ^0 S0 ^ 0 S0 ^ 0SE-Q@@ T(p`."PU *T 00S @D Pt@Q 3P ټB` PE P0@ 0  0S  S00 %0 S2 S?>Q1l h`P `T 00S@D `t@@ T @D g Ѝ]JJp@-@1` PP p@聼PP v0 S" S/jPGPp1P!G0PpJJpJJM-+MpP2 @4p9 T WP 7 `8R| (  T R08 RX0X0*0{0`}0x洆6ᖣ#h0 ᖣ&0 2h@0l0^PP T0 ( S<PP`` +>`02Fh0`c26P 'P p7g&0S*X `H7 0 07z @x Z㿀$  X<"0tS *X@ QlH 0xZe 6PPT0 S2 S?>Q姻Rd6Px&6TdƟP 0FX R@H 0x X H$ 0X0 K$ 0 N0P @ $ + B!R R !00X` lt& Z0`h` `0cS0S7 $_$P P  `6$ bR 000Q 2V&HT0 S ZZ2h4PgT0 S" S/ Z:P4`-Z+ S2 S?>Z:"T0PA SP1H0PP=PPPP @zZc8 5P3 00  P% R P  QQ Q   /o" R B Q   R  R|  0 @ A[ !b&Q\ 0l K0 | 0C0p! b6RLP P[L0 P 0P  0$H'T0 S㺱+8P1 0 02P0 PPP 6Pt | bP !P 2P0P00P}+ލJJJJJJJ]JJJ7JJJJJJxH-0P P?0?0@0M?@?@ P 0`0T `P6< P R( PKx JJTJJJM-MMPL!l 0P00l0 S`p +w p  0 p  p@+!$' d+v`x@ gV ឹ SpD0p(0 0pD{/p(p@00ξPh 0P/U\UPP zzP:S" :00:zP>00XCz?0/S\S :\:0`0P/$ l R0S(: 0': 0 0=l0 0C?o2V  Rb p0,07 PG, Rt*00 0WS40f G W40  R\@Z 0Wh$00 4:4S0W4  (0SC   )S*R 0:S$0pP* :S0W0 S / ܸS t 0ӸzRP zMP[ 0t ?$0,0 p0,000l0` S7V 0bh'G`0@S 00 $x0V@( 0c`S030#S :SC T厸<:SPp l0`Z S908P?(07h&'PF'7Z* 00R 0R0SW  W:+SP  0 WX<UW[<PiP 6U [{$P0 Q00[v l0P$0 0000 00/R\R :SL 0R00G0S<@: 0h(%(00,W, 0` 0S$  (0pP @?(0 0 `</ ݷ<0S t< 0ӷRP @\hPP0·il0 S2 S?>U?:0d:@S :l Q'a70P P@ P 0`@P!R0hP`l0 S2 S>0V*  0@P  T0@ZPP 006 R0ؠͱrh 0 P hN@u! @T P  Z00@ :  0 0a :h 0:P`Xl0 S2 S?>VO*ؠpZh0:t0@SPBl0 S2 S?>P9* 0"h* 0P :h  ? : @T P 0:KPpl0 S2 S?>W*ؠ`*0P : @P :@׶@h婸S P{ P00 0p>ލЍJJTJJJJJJ]JJJ-$M (0000,000$Ѝ@-pMA0S, 囶000CS nJ0nJ8nJ@nJHnJPnJXnJ(nJ }0yf0 @P lo@  hP& @+@cpЍ JJJrJvJJ{JJJJ$J,J;JSJ@-00 000Ѝ-,M 0  qo,Ѝ-$M 0 a$Ѝ@-@ MD`p 000# 00 0@000J ЍЀhJ@-MPc8`@P ЍJ/0A-a @P0 0A JtJE᷷ 0L BM-08MP00#03\00ST000C a00 04@0C8$LLA(P , (N0,X<ND0 4Q@ Ġ , A @^;l@    Q5 20 2nΠL : Q`@ 0@ aA粀:n @pQ *`pW "`5 20p2 >dd`F`$`@nV\(@dT,ßpW  Tpd'* dp^.pW*4ppdp@h T!* dW0@ T* d@ppSf@ Tpd* dp^0\00L00000\_ `\0`X ,fL0V@CHp`0`d0`0S00 SVp0.0``V00, 0(@  d`F ``qA粀I @  N @a@  | SR1: l A b   0c<008<8ЍJ&J<JM-M`@ Q@\ QA@@Q^'\^ @ 0Q @@P@T \*P@@ppp@wJPUT OoB^@T@F`Pp@PP@ⲀTPPP@PDU @T p@rTⰢDpPPP PTC, , H# DC( @# $  (`$`, P e/oE"4 Z  R J`0 P <@TPD   @PDU@Dt@DET: Q@@`t@@@P@,@U(@P@@$@P@P`@@@``Fp@H@@` `8@@2@@gA@`P`D``8`@ ``V `P@AD @Q5 @0@P @U @P` @`t@` `V*``pfW`J7J6J7J P 0S 4) S. (,08<l P L //R6 <S1R  0P8@-@. 0P S(0 $0 S0%0$0 0(3/P UPe00/UE2P000ES$0 (3/000$P408@/88pJpJP  R $0S 4@-Q@ ( 3/( $03//RM-` Mp Xp@ ?@TLD@DPU\EPEQ Rp]V0@P?TLD@D)\0\\ \00 0 \  0 \  0 \ 0 \\   0\ 0\ \0\\  \@\ @0 0 \  P(Vm0`@(P5WV}GW=0pG0W F 0b0S1R 0RR@0@0RPP@R0RP0RP0RP0RP0RP0RP0RP0P0@RP0@RP0@RP0@RP@P0p`pV0@Pp(@l(P ЍP6 M-0M@T3 0[0S,08P S<`p 00 0 00 00000S꼁JJJJxJJJtJ$JJJ<JHJJXJ܉J<J,JJJlJHJJxJJJXJPJJ R 01 VW` 0pGV`0U00S ` }, 0,0t0-0u00'0 0S0 p%'Q ?0000S%R$ 00S`Fh?  `3 0 04 00PW 0pGV`Vu0PS ? > 0SU$   , ,P%T-P)`0P0W 0pGV`V 0SP0  , %4,P-0%8%\.0/P `0P0W 0pGV`V 0Su  %$ 0  , ,P%T-P`0P00+ VW  pGV` @PRP<P , ,P%T-PP 0S `000 % @ W1!Z 0S P 0 bQ  b 0    @0pj j@@0Sl0@0000;# Wc K R P @0 S 2@ 57\Z:0    $v$\pj  A R00@0000:# W5 K R $P @0( S 2@ 57\Z:0    $H$\pj   R$0000  VW  pGV`!U:`P R4,0000 4W 0pGV`V%<,%4<\0TP4PP` 00 0S 0p 0 008P<`c0040 00 0S 0S 0`5S0W 0pGV`V0P00S0 S S9 0L0 0T0x9P00X00d9000%Q`F0`5SVW 0pGV`%8u <#0#R9Q`0P@ 0@0Sc R!1Z!Zv  pj 0 0j 00 00@0j@Wd 0pGV` V0"0U% \ !QSd0%W0``F0 8h000\ h0S*VW@ pGV`h0`F0Q800 h0Sh00800 S>l0pL0 0T0T00/>0l00P0<70h000`dh Rq*TL0A$0$0 0SW 0pGV`\V*W pGV`5S`c08 h0 \V*W pGV`R5S`c- 70%Q0`F"\V*W pGV`5SQ W pGV`V:5S S c ` R|5000Q:h0 80h 00S l/΄S>l0pL0 0T0T0 0$@$0P04G`l08P00X0X0 0d .0P04600 1WR0p 0 8P<` 0p008P<` 0T0L 01 岠RWC 0pGV`S  03$0$00311 \W) 0pGV`5Q`aS5R`b@0  0@`30H000H0S V*W   pGV` `c@ 5S @ 00X0P01 RW 0pGV` 03$0$00311 ^W 0pGV`5Q`a@5R`b820DH000H0S V*W  pGV` `cD 5S D  ,00 0bD R1t00 0S 0  bD0S  c@0 00b4 S0a(c @S0! S0!c @c@AR 00@0S0G 0Sv  @00 00C 000000SJ VWd 0pGV`0  b0R00000 0S0b { XJJoJJJ8J<8JJJJ8AJJ8JRJnJ<J&JJJJ40S%<,%4<00,4 S P0000 00 0`P0000S 0S VW 0pGV`0U0`P000000p 0 00(08PS<`0SI0 SE P40S (0S$ 00!,0( $ 0(3/P400h`0( `f V:4b00000f4 cVp1p! `V  4f 0`(0,0 00( 000S,00`Sp0,p5`0P`f0Pe0000000000US 0 Se 40< S@000 R  0,00 0SQ 0S/0Ѝ0` 3?S 03?S 03?S3 #/, S$0S/ // /03?S *$03?\0R3?//A-0`0 pP2 00@0_0ES)JHJ JHJtJtJtJtJHJ @P 0S  P @4? @@ gP @@@ 0Q@- P Ѝ0Q@- P Ѝ0Qs@-`P0P @ P P PU000U 00C0SPUpЍp@-@Pp `PfPT  P @@-P`p(@P03/R 7@-P@ DP P@T P  Ѝ0 03?/@-`pP@P<Ͽ013?0 2/100@-1"  <_2O 00E-P`@pP'0TSS P  P 0S @ P0@S  :@S Ѝp@-`P@  0p@@-P`p@6oPP `TPP  T@-@P@W@-@P@Op@-@`PPUpU0p03?0pM-p`(@PU P 1=  0P  P P PTPЍ@-`pP@n p 0 Ѝ@-P  Ѝ@-`pP@W p 0 Ѝs@-P4`@ P  0Ѝp3sJA-pP8 `P0`/S /! P eP P@@0S 0/S S /  PPP0h@PE-`PpP#U @*P00P0S 0S@QW0U  pq  Ѝ@- 0P Ѝp@-P@ Pp B0p@A-@Pp `U  5 P  a P@d@P@A-p0<@PP  @U* 0P` P `@PЍ@-@0( P  oЍ$J@-Pp` PP@  pP  -<'^T a b 888p@-`@"2PPp 0f 22/1 02/3? 0pp@-@`PPp$0f11$ 103? 0pA-@P(p(1`V  3 10N  172/p6o$`8B 0 3?,#,8$#4 0M-@P`P@= : 1  P@jp  10; nP@  0  3? @03? 0 T 0 100 0P 0$4O6o0 @`@8@-@,P8P5_U $ 2/PU408 8 8M-`(p,@P#P 05_R 6P:;78 pЍ0A-`p3_@P W0 A@-@P`P 9pP    0P0@P c  ЍA-Pp`(@P' 0 P   0  0P04/  p00 0P 0 Ѝ@-Pp`S@P 0R P   0 ЍM-@Pp`9P1 0P)p'  @PP 5_ P0 P 40@   40Ѝp@-`P@z 0p@p@-P@`P  P  d0>p@^ppM-`Pp 8@PY03?S$03?0 @+ $ PPC  P  P6$  7p2/$ . @4?(@ @@W&0VU1*0 S 0 ! P07p0402003?,#,8$#40Ѝ P p ,0`$0P////<+JPJ/JEJ7@-@P00$0QS  Ѝ0@-08 kP 0S 00@S # ЍtJ@-04 XP 0S 0P # ЍqJ-00 `R #$" 4"s05JNE-@1DMp$00 ``(0<0dPP ֦0p0e00F?o2P0S 0 0R0S \度 q0 l  e gDЍ萬JJ J&JIJ7@-\    @ Č @PU @PU\:$t Ѝ0gJJ@-`Pp0S @ @D@ 3/0P  d`JM-PU 0S \ `p^ @ 0ST6 T8 @pQ@A006 0@E^*` p` `W( `pZ$ S/U1t  Q5@D2 55:A 0PPQ5 51`b ` 0 ` `X*   @Ѝ0 0 0 X0\0P T0/A-0PPp@S` XpT@@Q\0S) npaoo1 r 0 E V0*X`P\TP \0XW 0\ b\  aPX0c\ALPHM-b pNW9@PT::S@ U5*@@#T@a@a\ AT):@a@UT\ P` \ X\  T* [* \: P0B b0  P`pGNЍp@-`P@P NpJ0/s@-@P `PT  1 Tp0T @0S@`V5ЍpRQ/M-@A⼰K@@@ T:` PdP  03/ P R: Z\ P*@fK@Ѝ諪y 0tp@-@P`徦00 000000C0pA-@`BpPU Q SP@P@-=@S S =o崤EJQ0  /0Sp@-@`PS: Q@Q P0@0op/$JP@-@PpT0  `0SHFP0U@00$JE-@`p@P0T*0 0S  P0PPP@P0 $JM- M D` 0H@p000[0{0Q  PU u 00 U0E P@@0W0C?o20S2 \  L0p|pppT0K|ppp4A0ߍ0$ۍ 100p|pppύ/000 +0 (|ppp P0`0`0@0 P}Uh 0PP 0S0U80  00p@Bp J JJJJJ JJ7J JJ J JJ@-H@000S4倍@p(|}>@\ J'JNJJA- 1Qq 0Aa0100S10S( #, s S4Z :P Dq`0`a0@= 9 0S 1P 0 0R )@ $Q  0}ZL0 0 /0  ЍA JJ J JJ J8JQJ  JoJ JJJ`J,JJJ JJTJ J4JJJ\ JJ J J@- 0 J@-pP@֌ 0 +@0P @``"; p0  00P0QQ?1 H0`D0p6<00@` J0JJJ@JJ8Jd JLJPJDJE-@0S$ S-`+p P PP x{ FPQ   f 0 0R0   Ѝ8J` JJ|1s@-`fp100CPSH4JJJJJJ4J@<00 @@1!0"##0 0 @e;00 "440<0<0d  l0 dM x J J J7JJt J  Jp J Jl JJJ(J7J7J J Jh JtJJJJJJ` @-000P SDD@8404?,00S@l J7JJJNJ7J(J JA-P  !2|xbP  Q*TъH2/ DRD2Dp0W8B002000S( #, s S4< p岊:JpP p[ 00PAQ嗊0 ᒊ0S t1\ 0 0P P傊LA k@|Q ,v !r @Z 1 j^1 900 0 0E  0@90 0@.0, ЍA%J7J3J7J?JJJ| J J8JZJL JoJJJuJ`J,JJJJJTJ JJIJ Jh J(J7J7JJ Jl Jx JJt J7J @-JJpG$B@BOFB(pB(pAB(ApB(poB(`oB(`AoB(A`oB(`_B(P_B(PA_B(AP_B(POB(@OB(@AOB(A@OB(@?B(0?B(0A?B(A0?B(0/B( /B( A/B(A /B( B(B(AB(AB(B(B(AB(AB(FpG  pG pGO0~)-@@pG)> HIBJHCBB@B#OF@(s@(sA@(As@(so@(co@(cAo@(Aco@(c_@(S_@(SA_@(AS_@(SO@(CO@(CAO@(ACO@(C?@(3?@(3A?@(A3?@(3/@(#/@(#A/@(A#/@(#@(@(A@(A@(@(@(A@(A@(H@BpGH@BpG8 Op@pG#H@BpG(ȿo@O@&)-@@pG@ @F :@CRBcF@CpG@@F :@CRBcF@CpGOBOJOJOJOJOJOJOJOJOJOJOJPJ PJPJPJ!PJ)PJ1PJ8PJ?PJFPJMPJTPJ[PJbPJiPJpPJwPJ~PJPJPJPJ^JJgJJpJEJZJmJ}JJJJJ0@{JJ\JLJUJJJKJ JMJKJ8KJTJJJJ0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z--J X.J/J$/JH/J /J 8(HDH'@B`JqJJJJJJJJJJJJLJ.uJ J JJ JJ VJ J "J*JJ5JCJJJTJ #(-27<FPD|JC|JlJG|J 8|J ?|J 0|J P|J 4|JI|JYJJJJJJ0|JlJ4|JG|J8|J<|J?|JC|JF|JI|JM|JP|JT|JJJJJӋJJ\TJ-J 6J FJ QJ \J dJJpJ?JJJ 3J OJ kJ J JJJϊJJ؈JJJ JJىJ ?ىJ ?JJJJ ؈J J sJ J JJ1JJɉJiJJ̈J ؈J J J J JJ1JAJ[JiJ(hJJJ@JJJJwJJ)J#J-J2J 7J<JAJLJWJ\JaJhJtJzJJJJJJJ ޝJJ JJ JJ̼JռJ޼JJJJJJ JJJJJJ+J'JTJTJJJ"J(J9J>JNJSJcJgJTJTJJ JJJJJJǻJͻJԻJڻJJJJJJJTJTJ vJJfJJJJJJ͹JչJJJJJ %J.J BJKJeJsJyJ JJJJWJͺJdJۺJJJJJ &J/JAJJJcJnJJJTJTJ!B c0@P`p)Jk1s2R"RBrb9{ZӜb$C4 dtDTjK( ōS6r&0vfVF[z8׼HXhx@a(#8َHi +ZJzjqP 3:*˿yX;l|L\",<` A* hI~n^N>2.Qp:Yxʱ -No0 P%@Fpg`ڳ=^"25BRwbVr˥nO, 4$ftGd$TDۧ_~<&6WfvvF4VLm/ș鉊DXeHx'h8(}\?؛uJTZ7jz *:.lMͪɍ&|ld\EL<, >]|ߛُn6~UNt^.> !1Aa  0@`@@A@!  @a`10  @ #+3;CScs`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O      *EHCI Host Controlleru-boot  eth_get_dev_by_namemiiphy_registerfdt_fixup_memory_banksv7_dcache_inval_rangeprint_part_efiget_partition_info_efiext4fs_devreadis_gpt_validalloc_read_gpt_entriesis_pte_validset_default_envenv_importenv_exportdo_env_exportusb_get_configuration_nodo_env_importfdt_find_or_add_subnodedo_bootvx_fdtcreate_int_queueahci_port_startata_scsiop_inquiryahci_init(((((AAAAAABBBBBBbootdelay=2baudrate=115200preboot=preboot=usb startstdin=serial,usbkbdstdout=serial,vgastderr=serial,vgabootm_size=0x10000000kernel_addr_r=0x42000000fdt_addr_r=0x43000000scriptaddr=0x43100000pxefile_addr_r=0x43200000ramdisk_addr_r=0x43300000fdtfile=sun4i-a10-cubieboard.dtbconsole=ttyS0,115200mmc_boot=if mmc dev ${devnum}; then setenv devtype mmc; run scan_dev_for_boot; fiusb_init=if ${usb_need_init}; then setenv usb_need_init false; usb start 0; fiusb_boot=run usb_init; if usb dev ${devnum}; then setenv devtype usb; run scan_dev_for_boot; fiscsi_init=if ${scsi_need_init}; then setenv scsi_need_init false; scsi scan; fiscsi_boot=run scsi_init; if scsi dev ${devnum}; then setenv devtype scsi; run scan_dev_for_boot; fiboot_prefixes=/ /boot/boot_scripts=boot.scr.uimg boot.scrboot_targets=mmc0 scsi0 usb0 pxe dhcp bootpart=1boot_extlinux=sysboot ${devtype} ${devnum}:${bootpart} any ${scriptaddr} ${prefix}extlinux/extlinux.confscan_dev_for_extlinux=if test -e ${devtype} ${devnum}:${bootpart} ${prefix}extlinux/extlinux.conf; then echo Found ${prefix}extlinux/extlinux.conf; run boot_extlinux; echo SCRIPT FAILED: continuing...; fiboot_a_script=load ${devtype} ${devnum}:${bootpart} ${scriptaddr} ${prefix}${script}; source ${scriptaddr}scan_dev_for_scripts=for script in ${boot_scripts}; do if test -e ${devtype} ${devnum}:${bootpart} ${prefix}${script}; then echo Found U-Boot script ${prefix}${script}; run boot_a_script; echo SCRIPT FAILED: continuing...; fi; donescan_dev_for_boot=echo Scanning ${devtype} ${devnum}...; for prefix in ${boot_prefixes}; do run scan_dev_for_extlinux; run scan_dev_for_scripts; donebootcmd_mmc0=setenv devnum 0; run mmc_bootbootcmd_scsi0=setenv devnum 0; run scsi_bootbootcmd_usb0=setenv devnum 0; run usb_bootbootcmd_pxe=run usb_init; dhcp; if pxe get; then pxe boot; fibootcmd_dhcp=run usb_init; if dhcp ${scriptaddr} boot.scr.uimg; then source ${scriptaddr}; fibootcmd=setenv usb_need_init; setenv scsi_need_init; for target in ${boot_targets}; do run bootcmd_${target}; done, 0123456789ABCDEFarocsdxbim [0123456789abcdefEPTGMKERROR: %s - start address is not aligned - 0x%08x ERROR: %s - stop address is not aligned - 0x%08x sunxi: failed to initialize emac CPU: Allwinner A10 (SUN4I) (fake run for tracing)machidUsing machid 0x%lx from environment Starting kernel ...%s bootargsFDT creation failed! hanging...Bad Linux ARM zImage magic! Kernel image @ %#08lx [ %#08lx - %#08lx ] /memory## WARNING: fixup memory failed! Resetting CPU ... pc : [<%08lx>] lr : [<%08lx>] sp : %08lx ip : %08lx fp : %08lx r10: %08lx r9 : %08lx r8 : %08lx r7 : %08lx r6 : %08lx r5 : %08lx r4 : %08lx r3 : %08lx r2 : %08lx r1 : %08lx r0 : %08lx Flags: %c%c%c%c IRQs %s FIQs %s Mode %s%s undefined instruction software interrupt prefetch abort data abort not used fast interrupt request USER_26FIQ_26IRQ_26SVC_26UK4_26UK5_26UK6_26UK7_26UK8_26UK9_26UK10_26UK11_26UK12_26UK13_26UK14_26UK15_26USER_32FIQ_32IRQ_32SVC_32UK4_32UK5_32UK6_32ABT_32UK8_32UK9_32HYP_32UND_32UK12_32UK13_32UK14_32SYS_32resetting ... WARNING: Caches not enabled SUNXI SCSI INIT satapwrAHCI PHY power up failed. AHCI PHY calibration failed. preboot%s for %08lx ... %08lx ==> CRC32 for %08lx ... %08lx ==> %08lx crc32syntax error ERROR : memory not allocated %s=%s ** Abort ## Error: "%s" not defined sun4i# *?[\%uERROR: There is a global environment variable with the same name. %s: readonly variable%s=%sHUSH_NO_EVALUnknown command '%s' - try 'help' or use 'run' command IFS \$'";&|#;$&|exit not allowed from main input shell. HUSH_VERSION0.01showvarprint local hushshell variables - print values of all hushshell variables showvar name ... - print value of hushshell variable 'name'thenelifelsefiforwhileuntildonebootdelaybootcmdHit any key to stop autoboot: %2d %2d DRAM: I2C: baudrateNet: SCSI: loadaddrMMC: ## Starting application at 0x%08lX ... ## Application terminated, rc = 0x%lX resetPerform RESET of the CPUstart application at address 'addr'addr [arg ...] - start application at address 'addr' passing 'arg' as argumentsTrying to execute a command out of order ## Checking Image at %08lx ... Legacy image found Bad Magic Number Bad Header Checksum Verifying Checksum ... Bad Data CRC OK Unknown image format! autostartyesAutomatic boot of image at addr 0x%08lX ... Your platform's zImage format isn't supported yet! bootzboot Linux zImage image from memoryiminfoprint header information for application imageaddr [addr ...] - print header information for application image starting at address 'addr' in memory; this includes verification of the image contents (magic number, header and payload checksums)bootdboot default, i.e., run 'bootcmd'bootmboot application image from memoryloadosramdiskcmdlinebdtprepfakeRamdisk image is corrupt or invalid Could not find a valid device tree verify## Booting kernel from Legacy Image at %08lx ... Unsupported Architecture 0x%x Wrong Image Type for %s command Wrong Image Format for %s command ERROR: can't get kernel image! ERROR: unknown image format type! Could not find a valid setup.bin for x86 Could not find kernel entry point! XIP %s ... Loading %s ... Uncompressing %s ... GUNZIP: uncompress, out-of-mem or overwrite error - must RESET board to recover Unimplemented compression type %d WARNING: legacy format multi component image overwritten ERROR: new format image overwritten - must RESET the board to recover initrd_startinitrd_endERROR: booting os '%s' (%d) is not supported subcommand not supported ## Transferring control to RTEMS (at address %08lx) ... confaddr## Transferring control to Plan 9 (at address %08lx) ... nofilesize%lx## Transferring control to NetBSD stage-2 loader (at address %08lx) ... /chosen## ERROR: %s : %s ## Starting vxWorks at 0x%08lx, device tree at 0x%08lx ... ## vxWorks terminated alias for 'help'helpprint command description/usage - print brief description of all commands help command ... - print detailed usage of 'command' %s arm-linux-gnueabihf-gcc ( 4.9.2-10) 4.9.2 GNU ld (GNU Binutils for Debian) 2.25 print monitor, compiler and linker version.callbacks:callbacks,.flags:flags,baudrate:baudrate,bootfile:bootfile,loadaddr:loadaddr,stdin:console,stdout:console,stderr:console,.callbacksethaddr:mo,serial#:so,## Warning: Unknown environment variable type '%c' ## Warning: Unknown environment variable access method '%c' .flags## Error: flags type check failure for "%s" <= "%s" (type: %c) ## Error: Can't delete "%s" ## Error: Can't overwrite "%s" oldval: %s defval: %s ## Error: Can't create "%s" No MMC card found MMC init failed Writing to %sMMC(%d)... Bad magic number Bad header crc Bad data crc Bad image type Empty Script Wrong image format for "source" command ## Executing script at %08lx sourcerun script from memory%-12s= 0x%08lX (not set)arch_numberboot_paramsDRAM bank-> start-> sizeeth%dname = %s eth%iaddr%-12s= %s current eth = %s ipaddrip_addr = %s baudrate = %u bps TLB addrrelocaddrreloc offirq_spsp start FB base bdinfoprint Board Info structureList of available devices: %-8s %08x %c%c%c coninfoprint console devices and information\cecho args to console[args..] - echo args to console; \c suppresses newline## No elf image at address 0x%08lx ## Not a 32-bit elf image at address 0x%08lx ## Starting application at 0x%08lx ... ## Application terminated, rc = 0x%lx tftpAutomatic boot of VxWorks image at address 0x%08lx ... ## Ethernet MAC address not copied to NV RAM bootaddreth(0,0)bootfile%s:%s srv%s:file e=%s serveriph=%s hostnametn=%s ## Not an ELF image, assuming binary ## Using bootline (@ 0x%lx): %s ## Starting vxWorks at 0x%08lx ... bootvxBoot vxWorks from an ELF image [address] - load address of vxWorks ELF image.bootelfBoot from an ELF image in memory[-p|-s] [address] - load ELF image at [address] via program headers (-p) or via section headers (-s)exitexit scriptext4loadload binary file from a Ext4 filesystem [ [addr [filename [bytes [pos]]]]] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from ext4 filesystemext4lslist files in a directory (default /) [directory] - list files from 'dev' on 'interface' in a 'directory'ext4sizedetermine a file's size - Find file 'filename' from 'dev' on 'interface' and determine its size.ext2loadload binary file from a Ext2 filesystem [ [addr [filename [bytes [pos]]]]] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from ext2 filesystem.ext2lsusage: fatinfo [] ** Unable to use %s %d:%d for fatinfo ** ** Unable to use %s %d:%d for fatwrite ** ** Unable to write "%s" from %s %d:%d ** %llu bytes written fatwritewrite file into a dos filesystem - write file 'filename' from the address 'addr' in RAM to 'dev' on 'interface'fatinfoprint information about filesystem [] - print information about filesystem from 'dev' on 'interface'fatls [] [directory] - list files from 'dev' on 'interface' in a 'directory'fatloadload binary file from a dos filesystem [ [ [ [bytes [pos]]]]] - Load binary file 'filename' from 'dev' on 'interface' to address 'addr' from dos filesystem. 'pos' gives the file position to start loading from. If 'pos' is omitted, 0 is used. 'pos' requires 'bytes'. 'bytes' gives the size to load. If 'bytes' is 0 or omitted, the load stops on end of file. If either 'pos' or 'bytes' are not aligned to ARCH_DMA_MINALIGN then a misaligned buffer warning will be printed and performance will suffer for the load.fatsizeThe address of the fdt is invalid (NULL). libfdt fdt_check_header(): %s - too old, fdt %d < %d - too new, fdt %d > %d", "* 0x%p [0x%08x]<0x%08x%s[%02x%sfdtaddr/* NULL pointer error */The address of the fdt is %#08lx New length %d < existing length %d, ignoring. libfdt fdt_open_into(): %s No FDT memory address configured. Please configure the FDT address via "fdt addr
" command. Aborting! moNew length 0x%X < existing length 0x%X, aborting. mklibfdt fdt_path_offset() returned %s libfdt fdt_add_subnode(): %s Sorry, I could not convert "%s" Unexpected character '%c' libfdt fdt_setprop(): %s libfdt node not found 0x%08Xerror: unprintable value 0x%plibfdt fdt_getprop(): %s %s%s { Nested too deep, aborting. %s}; %s%s; %s%s = %s/* NOP */ Unknown tag 0x%08X libfdt fdt_delprop(): %s libfdt fdt_del_node(): %s magic: 0x%x totalsize: 0x%x (%d) off_dt_struct: 0x%x off_dt_strings: 0x%x off_mem_rsvmap: 0x%x version: %d last_comp_version: %d boot_cpuid_phys: 0x%x size_dt_strings: 0x%x size_dt_struct: 0x%x number mem_rsv: 0x%x boorsindex start size ------------------------------------------------ libfdt fdt_get_mem_rsv(): %s %x %08x%08x %08x%08x libfdt fdt_add_mem_rsv(): %s libfdt fdt_del_mem_rsv(): %s boaFailed to update board information in FDT: %s flattened device tree utility commands#size-cells%s: %s: %s fdt_initrd: %s linux,initrd-startWARNING: could not set linux,initrd-start %s. WARNING: could not set linux,initrd-end %s. linux,initrd-endfdt_chosen: %s WARNING: could not set bootargs %s. Unable to update property %s:%s, err=%s %s: num banks %d exceeds hardcoded limit %d. Recompile with higher MEMORY_BANKS_MAX? device_typeWARNING: could not set %s %s. reg/aliasesusbethaddrethernet%deth%daddrlocal-mac-address%s: Bad cell count for %s rangeslinux,phandleCan't set phandle %u: %s okaydisabledfailfail-%dInvalid fdt status: %x edidCan't add property: %s Can't increase blob size: %s Warning: device tree alias '%s' points to invalid node %s. Warning: device tree node '%s' has no address. Warning: U-Boot configured device %s at address %llx, but the device tree has it address %llx. #address-cellsframebuffer@%llxwidthheightstrideformatdefault [ [directory]] - List files in directory 'directory' of partition 'part' on device type 'interface' instance 'dev'.savesave file to a filesystem bytes [pos] - Save binary file 'filename' to partition 'part' on device type 'interface' instance 'dev' from addr 'addr' in memory. 'bytes' gives the size to save in bytes and is mandatory. 'pos' gives the file byte position to start writing to. If 'pos' is 0 or omitted, the file is written from the start.load binary file from a filesystem [ [ [ [bytes [pos]]]]] - Load binary file 'filename' from partition 'part' on device type 'interface' instance 'dev' to address 'addr' in memory. 'bytes' gives the size to load in bytes. If 'bytes' is 0 or omitted, the file is read until the end. 'pos' gives the file byte position to start reading from. If 'pos' is 0 or omitted, the file is read from the start.cmd_gpiogpio: requesting pin %u failed gpio: pin %s (gpio %i) value is %lu query and control gpio pins - input/set/clear/toggle the specified pin gpio status [-a] [ | ] - show [all/claimed] GPIOsValid chip addresses: %02XCurrent bus is %d Invalid bus %d Setting bus to %d Failure changing bus number (%d) Current bus speed=%d Setting bus speed to %d Hz Failure changing bus speed (%d) Bus %d: %sError %s the chip: %d writingreading%08lx: %02lx %04lx %08lx ? %04x: %02xCRC32 for %08lx ... %08lx ==> i2cI2C sub-systemloopmmmwnmprobereadUnknown operator '%s' Invalid data width specifier itestreturn true/false on integer compare[.b, .w, .l, .s] [*]value1 [*]value2-lt-gt-eq==-ne!=<>-ge>=-le<=## Total Size = 0x%08x = %d Bytes ## First Load Addr = 0x%08lX ## Last Load Addr = 0x%08lX ## Total Size = 0x%08lX = %ld Bytes loads_echo## Ready for S-Record download ... ## S-Record download aborted ## Start Addr = 0x%08lX ## Switch baudrate to %d bps and press ENTER ... loady## Ready for binary (ymodem) download to 0x%08lX at %d bps... loadx## Ready for binary (xmodem) download to 0x%08lX at %d bps... ## Ready for binary (kermit) download to 0x%08lX at %d bps... ## Binary (kermit) download aborted ## Switch baudrate to %d bps and press ESC ... load binary file over serial line (ymodem mode)[ off ] [ baud ] - load binary file over serial line with offset 'off' and baudrate 'baud'load binary file over serial line (xmodem mode)loadbload binary file over serial line (kermit mode)loadsload S-Record file over serial line[ off ] - load S-Record file over serial line with offset 'off'double wordbytehalfword%s at 0x%08lx (%#0*lx) != %s at 0x%08lx (%#0*lx) Total of %ld %s(s) were the same Base Address: 0x%08lx Zero length ??? %08x %04xinfinite loop on address range[.b, .w, .l] address number_of_objectsbaseprint or set address offset - print address offset for memory commands base off - set address offset for memory commands to 'off'checksum calculationaddress count [addr] - compute CRC32 checksum [save at addr]cmpmemory compare[.b, .w, .l] addr1 addr2 countmemory copy[.b, .w, .l] source target countmemory write (fill)[.b, .w, .l] address value [count]memory modify (constant address)[.b, .w, .l] addressmemory modify (auto-incrementing address)memory display[.b, .w, .l] address [# of objects]NULL device name! BUG: failure at %s:%d/%s()! /home/jsg/u-boot-2015.01/common/miiphyutil.cBUG!miiphy_register: non unique device name '%s' miiphy_register: cannot allocate memory for '%s' mdio_register: non unique device name '%s' %s: %d - %s <--> %s No such device: %s %s is not a known ethernet MII devices: '%s' Current device: '%s' PHY reset timed out PHY speedPHY AN speed read failed, assuming 10BASE-T PHY duplexPHY AN duplex read failed, assuming half duplex FDXHDX10100fullhalfIEEE 802.3???IEEE 802.9 ISLAN-16TPHY 0x%02X: OUI = 0x%04X, Model = 0x%02X, Rev = 0x%02X, %3dbase%s, %s Error reading from the PHY addr=%02x reg=%02x addr=%02x reg=%02x data=%04X Error writing to the PHY addr=%02x reg=%02x duThe MII dump command only formats the standard MII registers, 0-5. %u. (%04hx) -- %s -- (%04hx:%04x) %u.%2u,%2u = b%u%u speed selection = %s Mbps%2u = %5u duplex = %s%2u-%2u = %5u selector = %s%2u-%2u = %u selector = %s%2u %2u-%2u = %5u %smiiMII utility commandsdevice - list available devices mii device - set current device mii info - display MII PHY info mii read - read MII PHY register mii write - write MII PHY register mii dump - pretty-print (0-5 only) Addr and/or reg may be ranges, e.g. 2-7.next page ableacknowledgeremote fault(reserved)asymmetric pause able100BASE-T4 able100BASE-X full duplex able100BASE-TX able10BASE-T full duplex able10BASE-T ablexxx to doasymmetric pausepause enable100BASE-TX full duplex able10BASE-T full duplex able10BASE-T ableOUI portionmanufacturer part numbermanufacturer rev. number100BASE-X full duplex able100BASE-X half duplex able10 Mbps full duplex able10 Mbps half duplex able100BASE-T2 full duplex able100BASE-T2 half duplex ableextended statusMF preamble suppressionA/N completeA/N ablelink statusjabber detectextended capabilitiesloopbackspeed selectionA/N enablepower-downisolaterestart A/Ncollision test enablePHY control registerPHY status registerPHY ID 1 registerPHY ID 2 registerAutonegotiation advertisement registerAutonegotiation partner abilities registersleepdelay execution for some timeN - delay execution for N seconds (N is _decimal_ !!!)No MMC device available no mmc device at slot %x OKERROR#part_num shouldn't be larger than %d switch to partitions #%d, %s mmc%d is current device mmc%d(part %d) is current device get mmc type error! MMC erase: dev # %d, block # %d, count %d ... Error: card is write protected! %d blocks erased: %s MMC write: dev # %d, block # %d, count %d ... %d blocks written: %s MMC read: dev # %d, block # %d, count %d ... %d blocks read: %s YesNo DDRDevice: %s Manufacturer ID: %x OEM: %x Name: %c%c%c%c%c Tran Speed: %d Rd Block Len: %d %s version %d.%d High Capacity: %s Capacity: Bus Width: %d-bit%s OK, force rescanset dsr %s mmcinfodisplay MMC info- display info of the current MMC devicemmcMMC sub systeminfo - display info of the current MMC device mmc read addr blk# cnt mmc write addr blk# cnt mmc erase blk# cnt mmc rescan mmc part - lists available partition on current mmc device mmc dev [dev] [part] - show or set current mmc device [partition] mmc list - lists available devices mmc setdsr - set DSR register value eraselistsetdsrgatewayipnetmaskrootpathdnsipdomainping failed; host %s is not alive host %s is alive pingsend ICMP ECHO_REQUEST to network hostpingAddressnfsboot image via network using NFS protocol[loadAddress] [[hostIPaddr:]bootfilename]dhcpboot image via network using DHCP/TFTP protocoltftpbootboot image via network using TFTP protocolbootpboot image via network using BOOTP/TFTP protocol%s: %s missing environment variable: %s Expected string literal: %.*s Expected string: %.*s eth01-%02x-%02x-%02x-%02x-%02x-%02xbootfile_path too small. (%zd < %zd) Base path too long (%s%s) Retrieving file: %s Expected include path: %.*s Couldn't retrieve %s Maximum nesting (%d) exceeded Ignoring malformed menu command: %.*s Expected label name: %.*s initrd=Ignoring unknown command: %.*s pxelinux.cfg/path (%s%s) too long, skipping pxelinux.cfg/%spxefile_addr_rpxeuuidConfig file found Config file not found .dtb./localcmdNo kernel given, skipping %s ramdisk_addr_rSkipping %s for failure retrieving initrd kernel_addr_rSkipping %s for failure retrieving kernel ip=%s:%s:%s:%s BOOTIF=bootarg overflow %zd+%zd+%zd+1 > %zd append: %s fdt_addr_rfdtfilesocmalloc fail (FDT filename) %s%s%s%s%s%sSkipping %s for failure retrieving fdt fdt_addrMissing default: %s Invalid pxefile address: %s Error parsing config file -pext2fatanyInvalid filesystem: %s Error reading config file sysbootcommand to get and boot from syslinux files[-p] [addr] [filename] - load and parse syslinux menu file 'filename' from ext2, fat or any filesystem on 'dev' on 'interface' to address 'addr'pxecommands to get and boot from pxe filesget - try to retrieve a pxe file using tftp pxe boot [pxefile_addr_r] - boot from the pxe file at pxefile_addr_r getmenutitlepromptlabelkernellinuxlocalbootinitrdincludedevicetreedevicetreedirfdtdirontimeoutipappenddefault-arm-sunxidefault-armscsiscanning bus for devices... Found %d device(s). scsidevsres Reset SCSI infSCSI dev. %d: no SCSI devices available Device %d: SCSI device %d: unknown device ... is now current device SCSI device %d not available SCSI read: device %d block # %ld, count %ld ... %ld blocks read: %s SCSI write: device %d block # %ld, count %ld ... %ld blocks written: %s scsibootboot from SCSI deviceloadAddr dev:partSCSI sub-systemreset - reset SCSI controller scsi info - show available SCSI devices scsi scan - (re-)scan SCSI bus scsi device [dev] - show or set current device scsi part [dev] - print partition table of one or all SCSI devices scsi read addr blk# cnt - read `cnt' blocks starting at block `blk#' to memory address `addr' scsi write addr blk# cnt - write `cnt' blocks starting at block `blk#' from memory address `addr'invalid op setexprset environment variable as the result of eval expression[.b, .w, .l] name [*]value1 [*]value2 - set environment variable 'name' to the result of the evaluated expression specified by . can be &, |, ^, +, -, *, /, % size argument is only meaningful if value1 and/or value2 are memory addresses (*) setexpr[.b, .w, .l] name [*]value - load a value into a variabletruedo nothing, successfullyfalsedo nothing, unsuccessfullyminimal test like /bin/sh[args..]-o-a-z-n-eSee InterfaceAudioCommunicationHuman InterfacePrinterMass StorageHubCDC DataVendor specificHuman Interface, Subclass: NoneBoot KeyboardMousereservedMass Storage, RBC SFF-8020i (ATAPI)QIC-157 (Tape)UFISFF-8070Transp. SCSICommand/BulkCommand/Bulk/IntBulk only12 Mb/s+-%d %s (%s, %dmA) %s %s %s %s String: "%s"Self Powered Bus Powered Remote Wakeup InOut Configuration: %d - Interfaces: %d %s%s%dmA Interface: %d - Alternate Setting %d, Endpoints: %d - Class - - Endpoint %d %s ControlIsochronousInterrupt MaxPacket %d Interval %dmsusb%d: %s, USB Revision %x.%x - %s %s %s - Class: - Class: (from Interface) %s - PacketSize: %d Configurations: %d - Vendor: 0x%04x Product 0x%04x Version %d.%d USB not stopped: usbkbd still using USB stopserialUSB is stopped. Please issue 'usb start' first. USB device tree: config for device %d *** No device available *** Device %d does not exist. Device is no hub or does not have %d ports. Setting Test_J modeSetting Test_K modeSetting Test_SE0_NAK modeSetting Test_Packet modeSetting Test_Force_Enable modeUnrecognized test mode: %s Available modes: J, K, S[E0_NAK], P[acket], F[orce_Enable] on downstream facing port %d... on upstream facing port... Error during SET_FEATURE. Test mode successfully set. Use 'usb start' to return to normal operation. stor no USB devices available no current device selected USB read: device %d block # %ld, count %ld ... USB write: device %d block # %ld, count %ld ... %ld blocks write: %s USB device %d: (Re)start USB... stopping USB.. 1.5 Mb/s480 Mb/s5 Gb/susbbootboot from USB deviceUSB sub-systemstart - start (scan) USB controller usb reset - reset (rescan) USB controller usb stop [f] - stop USB [f]=force stop usb tree - show USB device tree usb info [dev] - show available USB devices usb test [dev] [port] [mode] - set USB 2.0 test mode (specify port 0 to indicate the device's upstream port) Available modes: J, K, S[E0_NAK], P[acket], F[orce_Enable] usb storage - show details of USB storage devices usb dev [dev] - show or set current USB storage device usb part [dev] - print partition table of one or all USB storage devices usb read addr blk# cnt - read `cnt' blocks starting at block `blk#' to memory address `addr' usb write addr blk# cnt - write `cnt' blocks starting at block `blk#' from memory address `addr'failed to stop USB controller %d unable to get descriptor, error %lX config descriptor too short (expected %i, got %i) %s: failed to get descriptor - too long: %d selecting invalid interface %dERROR, too many USB Devices, max=%d Cannot allocate device context to get SLOT_ID Couldn't reset port %i USB device not accepting new address (error=%lX) unable to get device descriptor (error=%d) USB device descriptor short read (expected %i, got %i) usb_new_device: Cannot read configuration, skipping device %04x:%04x ERROR: NOT USB_CONFIG_DESC %x ERROR: Invalid USB CFG length (%d) ERROR: Invalid USB IF length (%d) USB IF descriptor overflowed buffer! Too many USB interfaces! ERROR: Invalid USB EP length (%d) USB EP descriptor overflowed buffer! Endpoint descriptor out of order! Interface %d has too many endpoints! ERROR: Invalid USB EPC length (%d) USB EPC descriptor overflowed buffer! EPC descriptor out of order! failed to set default configuration len %d, status %lX USB%d: Port not available. lowlevel init failed scanning bus %d for devices... No USB Device found %d USB Device(s) found USB error: all controllers failed lowlevel init cannot reset port %i!? ERROR: USB_MAX_HUB (%d) reached Did not get interrupt on CBI cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X (NOT READY) cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X No storage devices, perhaps not 'usb start'ed..? USB Storage Transport unknown / not yet implemented Sorry, protocol %d not yet supported. error in inquiry Device NOT ready Request Sense returned %02X %02X %02X READ_CAP ERROR scanning usb for storage devices... max USB Storage Device reached: %d stopping %d Storage Device(s) found ## Copying part %d from legacy image at %08lx ... Must specify load address for %s command with compressed image Bad Image Part Invalid image type for imxtract Loading part %d ... Uncompressing part %d ... GUNZIP ERROR - image not loaded fileaddrimxtractextract a part of a multi-imageEnter choice: %s not found usbkbdstdinUSB KBD: Error allocating private data Failed to get keyboard state from device %04x:%04x Saving Environment to %s... ## Error: cannot export environment Environment size: %d/%ld bytes ## Warning: defaulting to text format ## Error: external checksum format must pass size ## Info: input data size = %zu = 0x%zX ## Error: bad CRC, import failed ERROR: Environment import failed: errno = %d at %s:%d/%s() /home/jsg/u-boot-2015.01/common/cmd_nvedit.c## %s: only one of "-b", "-c" or "-t" allowed ## Warning: Input data exceeds %d bytes - truncated ## Resetting to default environment ## Error: illegal character '='in variable name "%s" ## Can't malloc %d bytes ## Error inserting "%s" variable, errno=%d setenvERROR: Cannot export environment: errno = %d at %s:%d/%s() %zXenv_buf [%d bytes] too small for value of "%s" edit: runrun commands in an environment variablevar [...] - run the commands in the environment variable(s) 'var'set environment variables[-f] name value ... - [forcibly] set environment variable 'name' to 'value ...' setenv [-f] name - [forcibly] delete environment variable 'name'printenvprint environment variables[-a] - print [all] values of all environment variables printenv name ... - print value of environment variable 'name'editenvedit environment variablename - edit environment variable 'name'environment handling commandsdeleteeditexportimportprintsaveenvsave environment variables to persistent storage*** Warning - %s, using default environment Using default environment /home/jsg/u-boot-2015.01/common/env_common.c!bad CRCERROR: Cannot import environment: errno = %d at %s:%d/%s() !import failedstdoutstderry Y yes YES In: No input devices available! Out: No output devices available! Err: No error devices available! bootm_lowbootm_sizebootm_mapsize%d Bytes = Unknown OSUnknown ArchitectureUnknown ImageUnknown Compression%sImage Name: %.*s %sImage Type: %s %s %s (%s) %sData Size: %sLoad Address: %08x %sEntry Point: %08x %sContents: %s Image %d: %s Offset = 0x%08lx ## Loading init Ramdisk from Legacy Image at %08lx ... No Linux %s Ramdisk Image Wrong Ramdisk Image Format ## Loading init Ramdisk from multi component Legacy Image at %08lx ... initrd_highramdisk - allocation error Loading Ramdisk to %08lx, end %08lx ... noneuncompressedbzip2bzip2 compressedgzipgzip compressedlzmalzma compressedlzolzo compressedaisimageDavinci AIS imageFilesystem ImagefirmwareFirmwareflat_dtFlat Device TreegpimageTI Keystone SPL ImageKernel Imagekernel_noloadKernel Image (no loading done)kwbimageKirkwood Boot ImageimximageFreescale i.MX Boot ImageInvalid ImagemultiMulti-File ImageomapimageTI OMAP SPL With GP CHpblimageFreescale PBL Boot ImageRAMDisk ImageScriptsocfpgaimageAltera SOCFPGA preloaderstandaloneStandalone ProgramublimageDavinci UBL imagemxsimageFreescale MXS Boot ImageatmelimageATMEL ROM-Boot Imagex86_setupx86 setup.binInvalid OSLinuxnetbsdNetBSDoseEnea OSEplan9Plan 9rtemsRTEMSu-bootU-BootvxworksVxWorksqnxQNXInvalid ARCHalphaAlphaARMIntel x86ia64IA64m68kM68KmicroblazeMicroBlazemipsMIPSmips64MIPS 64 Bitnios2NIOS IIpowerpcPowerPCppcs390IBM S390SuperHsparcSPARCsparc64SPARC 64 BitblackfinBlackfinavr32AVR32nds32NDS32or1kOpenRISC 1000sandboxSandboxarm64AArch64AMD x86_64ERROR: - must RESET the board to recover. reserving fdt memory region: addr=%llx size=%llx image is not a fdtfdt_highFailed using fdt_high value for Device Treedevice tree - allocation error Using Device Tree in place at %p, end %p Loading Device Tree to %p, end %p ... fdt move failed## Flattened Device Tree from Legacy Image at %08lx fdt header checksum invalidfdt checksum invaliduImage is not a fdtuImage is compresseduImage data is not a fdtfdt overwritten## Flattened Device Tree blob at %08lx ERROR: Did not find a cmdline Flattened Device Tree Booting using the fdt blob at %#08lx ## Flattened Device Tree from multi component Image at %08lX Booting using the fdt at 0x%p fdt size != image sizeERROR: /chosen node create failed ERROR: arch-specific fdt fixup failed ERROR: board-specific fdt fixup failed: %s - must RESET the board to recover. nulldev** Too many args (max. %d) ** ## Command too long! %.*s%*s %s - %s Usage: %s - No additional help available. %-*s- %s Unknown command '%s' - try 'help' without arguments for list of all known commands Unknown command '%s' - try 'help' 'bootd' recursion detected Command '%s' failed: Error %d CksumxyzModem - %s mode, %d(SOH)/%d(STX)/%d(CAN) packets, %d retries Unknown errorBlock sequence errorCRC/checksum errorInvalid framingCancelledEnd of fileTimed outSorry, zModem not available yetCan't access file Loading from %s device %d, partition %d: Name: %.32s Type: %.32s ** Read error on %d:%d ** Bad Header Checksum ** ** Unknown image type Partition Map for IDESATAATAPIUSBDOCHOSTUNKNOWN device %d -- Partition Type: %s (%d:%d) Vendor: %s Prod.: %s Rev: %s Model: %s Firm: %s Ser#: %s Vendor: %s Rev: %s Prod: %s device type DOC device type unknown Unhandled device type: %i Type: Removable Hard DiskCD ROMOptical DeviceTape# %02X # Capacity: %ld.%ld MB = %ld.%ld GB (%ld x %ld) Capacity: not available DOSEFI## Unknown partition table ** Bad device specification %s %s ** ** Bad HW partition specification %s %s ** ** Bad device %s %s ** hostfsSandbox hostbootdevice** No device specified ** auto** Bad partition specification %s %s ** ** Bad device size - %s %s ** ** No partition table - %s %s ** Whole Disk** Invalid partition %d ** ** No valid partitions found ** ** Invalid partition type "%.32s" (expect "U-Boot") FAT32FAT Extd Boot** Can't read partition table on %d:%d ** bad MBR sector signature 0x%02x%02x %3d %-10d %-10d %08x-%02x %02x%s%s hd%c%dsd%c%dusbd%c%ddocd%c%dxx%c%dPart Start Sector Num Sectors UUID Type %s: calloc failed! ** Can't write to device %d ** %s: 0x%x != 0x%x GUID Partition Table Entry Array CRC is wrong%s signature is wrong: 0x%llX != 0x%llX GUID Partition Table Header%s CRC is wrong: 0x%x != 0x%x GPT: my_lba incorrect: %llX != %lx GPT: first_usable_lba incorrect: %llX > %lx GPT: last_usable_lba incorrect: %llX > %lx %s: Invalid Argument(s) *** ERROR: Can't read GPT header *** %s: ERROR: Can't allocate 0x%zX bytes for GPT Entries *** ERROR: Can't read GPT Entries *** GPT: Failed to allocate memory for PTE %s: *** ERROR: Invalid GPT *** %s: *** ERROR: Invalid Backup GPT *** %s: *** Using Backup GPT *** Part Start LBA End LBA Name Attributes Type GUID Partition GUID %3d 0x%08llx 0x%08llx "%s" attrs: 0x%016llx type: %s guid: %s Partition overlap Partitions layout exceds disk size %s: failed writing '%s' (%d blks at 0x%lx) MBRPrimary GPT HeaderPrimary GPT EntriesBackup GPT EntriesBackup GPT HeaderInvalid port number %d Error:Too much sg! timeout exit! %s: No memory for ataid[port] ATA No Link on this port! %s: No mem for table! scsi_ahci: Error: buffer too small. controller reset failed (0x%x) scsi_ahci: SCSI READ CAPACITY10 command failure. No ATA info! Please run SCSI commmand INQUIRY firstly! scsi_ahci: SCSI READ CAPACITY16 command failure. No ATA info! Please run SCSI commmand INQUIRY firstly! Unsupport SCSI command 0x%02x Can not start port %d 1.564bit ncq ilck stag pm led clo nz only pmp fbss pio slum part ccc ems sxs apst nvmp boh %s: No memory for probe_ent SATA link %d timeout. Target spinup took %d ms. AHCI %02x%02x.%02x%02x %u slots %u ports %s Gbps 0x%x impl %s mode flags: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s S/N: %s Firmware version: %s Product model number: %s Capablity: %lld sectors id[49]: capabilities = 0x%04x id[53]: field valid = 0x%04x id[63]: mwdma = 0x%04x id[64]: pio = 0x%04x id[75]: queue depth = 0x%04x id[76]: sata capablity = 0x%04x id[78]: sata features supported = 0x%04x id[79]: sata features enable = 0x%04x id[80]: major version = 0x%04x id[81]: minor version = 0x%04x id[82]: command set supported 1 = 0x%04x id[83]: command set supported 2 = 0x%04x id[84]: command set extension = 0x%04x id[85]: command set enable 1 = 0x%04x id[86]: command set enable 2 = 0x%04x id[87]: command set default = 0x%04x id[88]: udma = 0x%04x id[93]: hardware reset result = 0x%04x vgaclrlogofill the boot logo area with blackReserved %dkB of RAM for Framebuffer. HDMI fifo under or overrun HDMI connected. Setting up a %s console. 1024x768allwinner,simple-framebufferallwinner,pipelinede_be0-lcd0-hdmiCannot setup simplefb: Error setting properties Cannot setup simplefb: node not found x8r8g8b8Error, wrong i2c adapter %d max %d possible twsi0Status Error: 0x%08X Timeout waiting card ready MMC Device %d not found MMC: block number 0x%lx exceeds max(0x%lx) mmc fail to send stop cmd Card doesn't support part_switch MMC: SET_DSR failed Man %06x Snr %04x%04x%c%c%c%c%c%c%s is deprecated! use mmc_create() instead. MMC: no card present Card did not respond to voltage select! %s: %dSUNXI SD/MMCWrong mmc number %d mmc_cd Caution! Your devices Erase group is 0x%x The erase range would be change to 0x%lx~0x%lx mmc erase failed mmc write failed HALFFULLENET Speed is %d Mbps - %s duplex connection Received packet is too big (len=%d) emacCannot find console ## Baudrate %d bps not supported ## Baudrate may not be deleted EHCI failed to shut down host controller. out of buffer pointers (%u bytes left) unable to allocate TDs unable to construct SETUP TD unable to construct DATA TD EHCI fail timeout STS_ASS set EHCI timed out on TD - token=%#x EHCI fail timeout STS_ASS reset EHCI failed: timeout when disabling periodic list EHCI failed: timeout when enabling periodic list port(%d) reset error EHCI fail to reset USB EHCI %x.%02x %s: xfers requiring several transactions are not supported. Timeout destroying interrupt endpoint queue Timeout poll on interrupt endpoint PH6PH3ehci_vbus** Unrecognized filesystem type ** ** Unable to read file %s ** ** Unable to write file %s ** ** No boot file defined ** %llu bytes read in %lu ms (%llu bytes written in %lu ms** Can not find directory. ** ** Cannot support non-zero offset ** ** File not found %s ** Extent Error ** SI ext2fs read block (indir 1)malloc failed. ** ** SI ext2fs read block (indir 1):malloc failed. ** ** SI ext2fs read block (indir 1)failed. ** ** DI ext2fs read block (indir 2 1)malloc failed. ** ** DI ext2fs read block (indir 2 1)failed. ** ** DI ext2fs read block (indir 2 2)malloc failed. ** ** DI ext2fs read block (indir 2 2)failed. ** ** TI ext2fs read block (indir 2 1)malloc failed. ** ** TI ext2fs read block (indir 2 1)failed. ** ** TI ext2fs read block (indir 2 2)malloc failed. ** ** TI ext2fs read block (indir 2 2)failed. ** invalid extent block < ? > %10u %s Failed to mount ext2 filesystem... %s read outside partition %lu ** ext2fs_devread() read error ** ** %s read error - block * %s read error - last part error: overflow occurs Error: Invalid FAT entry: 0x%08x FAT: Misaligned buffer address (%p) FAT32 FAT12 FAT16 Invalid FAT entry error: wrinting directory entry Error: reading directory block Error: %llu overflow Error: writing contents Error: flush fat buffer Error: writing directory entry Error: finding empty cluster Error: clearing FAT entries U** Partition %d not valid on device %d ** Error: FAT sector size mismatch (fs=%hu, dev=%lu) %s%c %8u %s%c %d file(s), %d dir(s) Error reading cluster No current device Interface: Unknown Device %d: No valid FAT fs found Filesystem: %s "%s" reading %s Error: non zero offset is currently not suported. writing %s Can't list files without a filesystem! %s/%sCan't load file without a filesystem! invalid distance too far backinvalid distance codeinvalid literal/length codeincorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid literal/lengths setinvalid distances setincorrect data checkincorrect length checkneed dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versioncompatibleFDT_ERR_NOTFOUNDFDT_ERR_EXISTSFDT_ERR_NOSPACEFDT_ERR_BADOFFSETFDT_ERR_BADPATHFDT_ERR_BADSTATEFDT_ERR_TRUNCATEDFDT_ERR_BADMAGICFDT_ERR_BADVERSIONFDT_ERR_BADSTRUCTUREFDT_ERR_BADLAYOUT1.2.3Error: inflateInit2() returned %d Error: inflate() returned %d Error: Bad gzipped data Error: gunzip out of data in header initcall sequence %p failed at call %p (err=%d) ERROR: Failed to allocate 0x%lx bytes below 0x%lx. .%03ldlist passed to list_sort() too long for efficiency ## ERROR: unsupported match method: 0x%02x Env export buffer too small: %zu, but need %zu himport_r: can't insert "%s=%s" into hash table WARNING: '%s' neither in running nor in imported env! WARNING: '%s' not in imported env, deleting it! %s %llu Bytes%s%lu.%ld %ciB%s %0*x %s ### ERROR ### Please RESET the board ### %s:%u: %s: Assertion `%s' failed.%*llu## Warning: gatewayip needed but not set ARP Retry count exceeded; starting again bad length %d < %d Invalid pxeuuid: %s U-boot.armv7*** WARNING: %s is too long (%d - max: %d) - truncated Host NameRoot PathOpt Boot File*** WARNING: using vendor optional boot file *** Unhandled DHCP Option in OFFER/ACK: %d DHCP client bound to address %pI4 (%lu ms) DHCP: INVALID STATE BOOTP broadcast %d Retry time exceeded; starting again ethact%pM%s%daddr%saddr/home/jsg/u-boot-2015.01/net/eth.ceth%dmacskipethmacskip Warning: %s MAC addresses don't match: Address in SROM is %pM Address in environment is %pM Warning: %s using MAC address from net device Error: %s address not set. Warning: %s failed to set MAC address Error: %s address %pM illegal value Board Net Initialization Failed CPU Net Initialization Failed Net Initialization Skipped ethprime [PRIME] Warning: eth device name has a space! ethrotateunknownautoloadNFSnetretryonce ICMP Host Redirect to %pI4 %d.%d.%d.%dnvlan*** ERROR: ping address not given *** ERROR: `serverip' not set *** ERROR: `ipaddr' not set *** ERROR: No ethernet found. *** ERROR: `ethaddr' not set *** ERROR: `eth%daddr' not set Abort Bytes transferred = %ld (%lx hex) *** ERROR: Cannot mount *** ERROR: Cannot umount done *** ERROR: File lookup fail *** ERROR: Symlink fail Retry count exceeded; starting again T /nfsroot/%02X%02X%02X%02X.img*** Warning: no boot file name; using '%s' Using %s device File transfer via NFS from server %pI4; our IP address is %pI4; sending through gateway %pI4 Filename '%s/%s'. Size is 0x%x Bytes = Load address: 0x%lx Loading: *octetblksize%c%d%cFile too largeFile has bad magicblksize TFTP error: First block is not block 1 (%ld) Starting again TFTP error: '%s' (%d) Not retrying... %s; starting again Retry count exceededtftpblocksizetftptimeoutTFTP timeout (%ld ms) too low, set minimum = 1000 ms TFTP %s server %pI4; our IP address is %pI4fromFilename '%s'.Load address: 0x%lx raise: Signal # %d caught ( w /*-+ 1234567890.=1234567890  -=[]\#;'`,./!@#$%^&*()  _+{}|~:"~<>?U-Boot 2015.01 (Jan 24 2015 - 09:46:38) Allwinner TechnologyvSJoSJ8tSJySJ ~SJSJSJ SJ J pJ SJ 7J8Jl9J8J@:Jt9J$J ZJ:JJKJ<J7J J9J9JJ;J8J08Jh8Jp8J8JT:J8J8J8J09J:J:Jd9J9J|9J;J<J<J;J;J<Jx;JJpJ<J;J;J<JP<J=JpJ@<JLJpJJ0<J<J;J;J;J[addr [arg ...]] - boot application image stored in memory passing arguments 'arg ...'; when booting a Linux kernel, 'arg' can be the address of an initrd image When booting a Linux kernel which requires a flat device-tree a third argument is required which is the address of the device-tree blob. To boot that kernel without an initrd image, use a '-' for the second argument. If you do not pass a third a bd_info struct will be passed instead Sub-commands to do part of the bootm sequence. The sub-commands must be issued in the order below (it's ok to not issue all sub-commands): start [addr [arg ...]] loados - load OS image ramdisk - relocate initrd, set env initrd_start/initrd_end fdt - relocate flat device tree cmdline - OS specific command line processing/setup bdt - OS specific bd_t processing prep - OS specific prep before relocation or go go - start OSL`JTJTJWJTJTJWJTJTJJ TJTJWJ@TJTJWJTJTJWJTJTJWJTJTJ/JTJTJ[addr [initrd[:size]] [fdt]] - boot Linux zImage stored in memory The argument 'initrd' is optional and specifies the address of the initrd in memory. The optional argument ':size' allows specifying the size of RAW initrd. When booting a Linux kernel which requires a flat device-tree a third argument is required which is the address of the device-tree blob. To boot that kernel without an initrd image, use a '-' for the second argument. If you do not pass a third a bd_info struct will be passed instead J[addr] - run script starting at addr - A valid image header must be present/addr [-c] [] - Set the [control] fdt location to fdt boardsetup - Do board-specific set up fdt move - Copy the fdt to and make it active fdt resize - Resize fdt to size + padding to 4k addr fdt print [] - Recursive print starting at fdt list [] - Print one level starting at fdt get value - Get and store in fdt get name - Get name of node and store in fdt get addr - Get start address of and store in fdt get size [] - Get size of [] or num nodes and store in fdt set [] - Set [to ] fdt mknode - Create a new node after fdt rm [] - Delete the node or fdt header - Display header info fdt bootcpu - Set boot cpuid fdt memory - Add/Update memory node fdt rsvmem print - Show current mem reserves fdt rsvmem add - Add a mem reserve fdt rsvmem delete - Delete a mem reserves fdt chosen [ ] - Add/update the /chosen branch in the tree / - initrd start/end addr NOTE: Dereference aliases by omiting the leading '/', e.g. fdt print ethernet0. bus [muxtype:muxaddr:muxchannel] - show I2C bus info crc32 chip address[.0, .1, .2] count - compute CRC32 checksum i2c dev [dev] - show or set current I2C bus i2c loop chip address[.0, .1, .2] [# of objects] - looping read of device i2c md chip address[.0, .1, .2] [# of objects] - read from I2C device i2c mm chip address[.0, .1, .2] - write to I2C device (auto-incrementing) i2c mw chip address[.0, .1, .2] value [count] - write to I2C device (fill) i2c nm chip address[.0, .1, .2] - write to I2C device (constant address) i2c probe [address] - test for and show device(s) on the I2C bus i2c read chip address[.0, .1, .2] length memaddress - read to memory i2c write memaddress chip address[.0, .1, .2] length - write memory to i2c i2c reset - re-init the I2C Controller i2c speed [speed] - show or set I2C bus speedJ,JTJTJdQJJTJTJJJTJTJ{JJTJTJsJ܍JTJTJ{JԍJTJTJ{J؊JTJTJ{J̍JTJTJ{JdJTJTJ{J8JTJTJ,hJ@JTJTJ\TJ4JTJTJ~JJTJTJ@'J JTJTJ{J4JTJTJ,hJ4JTJTJJLJTJTJJJTJTJ'JJTJTJJJTJTJJJTJTJJJTJTJJJTJTJJJTJTJ]JoJ.uJaddr part [dest] - extract from legacy image at and copy to default [-f] -a - [forcibly] reset default environment env default [-f] var [...] - [forcibly] reset variable(s) to their default values env delete [-f] var [...] - [forcibly] delete variable(s) env edit name - edit environment variable env export [-t | -b | -c] [-s size] addr [var ...] - export environment env import [-d] [-t [-r] | -b | -c] addr [size] - import environment env print [-a | name ...] - print environment env run var [...] - run commands in an environment variable env save - save environment env set [-f] name [arg ...] .uJ9JTJTJ9Jh4JTJTJ@J\AJTJTJEJ<JTJTJLJ7JTJTJSJT6JTJTJJtJTJTJuJ5JTJTJJ<JTJTJVJJJJJJJJJJJ J JJJJJ$J$J,J,J4J4J<J<JDJDJLJLJTJTJ\J\JdJdJlJlJtJtJ|J|JJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJ J JJJJJ$J$J,J,J4J4J<J<JDJDJLJLJTJTJ\J\JdJdJlJlJtJtJ|J|JJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJ J JJJJJ$J$J,J,J4J4J<J<JDJDJLJLJTJTJ\J\JdJdJlJlJtJtJ|J|JJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJ J J J J J J J J$ J$ J, J, J4 J4 J< J< JD JD JL JL JT JT J\ J\ Jd Jd Jl Jl Jt Jt J| J| J J J J J J J J J J J J J J J J J J J J J J J J JBJ^JeJ(s*K>;( td$   " @   V G Tt l   4 /( | d ,  <$,(\ "LE1T< <|| Mt H><~~<fffffffff{|`8ll8 |<~~<~<~~< 0``0(ll(88||||88<<<fff$lllllll||| 0`Ɔ8ll8vv000` 000000 0 0f<l8l||||`0||0xv`0v~ x|||||8ld`````ff<~~~p0`x |v 08<0`||0`vvffffffv~8ll8|0000`|`bfl0`܆ >`bfl0fΚ?<<<6ll6l6lDDDDDDDDUUUUUUUUwwwwwwww66666666666666666666666666666666666666666666666666666666666666666666666666666667666666666666670??07666666666666666666666666667076666666666666666666666666666666666666666666??66666666666666666666666vvxllllll`00`~pffffff|``v~ffff<~~~~`0``|```0|~~0  0~ 0`0 ~p~vv8ll8 ll<l66666>:%N4 CUpU,,mmUG((GpU,,U,UU,֡,mmp(pU, &vs"N5zN܎~= ,,UU,,,*m,p(pU,,֡,m֕(pU WP>"N5RRzNX ,U,֡,mmGpU,ҕUU,֡,,mUGU,Yv->"N5RR:M$ (U,֡֡,,mUpU֡ДU,U,,,ppU֡ֈw8>iN5500JH< ,U,֡,֡,,,GpU,֡(G,,U֡,,UpGp,,CTH>"5MEuJ{= (+ ,,UU,֡,,Upp,p(GU,,,UUppppUm֕, C6008Enux7? p,,U,U,UppppUmmUGp,,,,,֡,UUUUUUmKU gMbxx#gK+G C,,,,֡UUUUUUmUUUU,,,,,,,,,U,,,,m**UU m~dS66cmk} ɡ,,,U,,,,mmUU,,,,,,,UU,,mmU, Km٧lm*Be, ,,,,,,UU,,mmUUU,,,,,U,,֡,UU(C*mmmmmmBe ,,,U,,,UU,,UUUU,UC(emmm*B ,,,UUUU,UpppppUU,UUUUpppːp, BЃee} ,UUUUppppppppUUU,,UUUUUpUUp peG m,UUUUUppUUpppU,,,,,,,UUUUU˕,,UU ֈ +mUUUUU,,Uːp,,,,,,U ?B +֕,,UUUUU֡,,,,,,U,,,˔ eBkkBkkk U,,UUUmmm֡,,,,Upp, 2kBkп**m4 Uppp˕,m֡,,,,UUU,U˕ ,eeBk* 4+ UUUUUUU2,,UUU CGkB쿣 + ,˕,UUUUUUUmUUU,,UUUU4 壃m +4 UUUUU,UUUU,,,,,,U, peC}Ɉ C,,U,,,UUUUUUU,,,,,, B44+ ,,,,,,,,UU,,,UU,,,,,mC؀2 ֡,,,,UUUU֕,,,,,,,, B +C ,,,UUUUU,UU,,UUUpɀ+ B UːpUUU,,,UUUUGU +Cmk( (UGGpUUUU,,,,,,,Up++ekG 4 GpU,,U,m,,,,Upp } e ؈ ,GGmU,С,,,UUU,,˕ ( + UGU,֕Um,,,,Uː,p 4 ek + GU,Gpm*GGp,UUUUUG CBk 4 ,Gp,֡,U˕m֐GG,,UUUUUp ؕBG C}C ˔pU֡,,֡GU,֡UUUUUCCek?؀4+ U,֡,,,,p,֡,UUUUUUUD>]yeBe4 CpU֡,UUppU,֡UUU,,2]iIBkN! 4ػ,,UUU,,U˕,,UpUmHjIi]/Y}ek~f 4CZF',U,,,,,U,U,*r;V)]I]>if4eB>Zf f[sL,,,,pU,,pU`JHJ)s]IIII:WpBsPy f7>ο,UUU֡U`>---3]IIIIIY (J-Px.WQW1MP-],UUpUUUm,֡UpuP>III]IIIIIiO BJ:Pb#_)3]]sUUUUUU,,,,֡UpphuPIII]II]II]i]% *KPsvHuub3I]]UUUU,,,,,pp_-IIIIIIIIIII]I"Zy ec_)--))vP-II>I\UU,֡,,UppU,`v]IIIIIIIIIIII]܋ 2)-3---j-3]IIIs\,U,֡,,,Uː˕,mAo>IIIIIIIIIIII>N8 UeB)-]]IIIIII>III\V֡UUUUpp,,o3IIIIIIIIIII]]i"b4keekՈ[)]]]]]]]IIIIIIIqmmUUU,Uppp,Av]]IIIIIIIIIII]]^eee #)3I]IIIIIII]]]-\m,U˕UppU,_v3]IIIIIIIIIIIIII>/heek OP>IIIIIIIIIIiiI]-FUppUUpGpu-3IIIII]IIIIIIIII]-eeeeek+ )3IIIIIIIIIII>>^A'UGpUUppU,m9j]]IIIIIIIIIIIIII>0wɔ,֡UGC j-III]]II]]JAU(GpUGpp,9vPP-->>]>]]IIIIPuW yv3II]II>j)ߗmmUG((GpU,,U&E_0Hoo))j--]IIIII-vnw[f y9P]]]]>-)v7mm,(pU,U,އ@nxx9o--333v0dT[f f 4#oP--j)ox,,mm,GpU,ҕUU,֡mm6t6#xbJ)b#T1W+,,,,,,,}ʷuoovoxSm,mUpU֡Д,֡U,֡,hlww@Sn@T1׬UUU,,,m|T@nn6,,,֕GpU,֡(G,,U,,,,,Up,TT1*U,,,,,,,,m*O1.୷ȴ,,,pp,(G˕,U,֡,Uppp,cʳm,UU,,,,,,,,,,p蕕֡U,UppppUmmUpGp,,,,,֡UUUUUUUU,,UU,,Up,mmm,,֡,UUUUUUUmUUUU,,,,,,U,,,,mm,UUUUUU,,,,˕,,,,,,,,U,,,,mmUU,,,,,,,,U,,mmUUpː˕,,֡,,,,,,,,,UU,,mmUUąDe$bDҶs6Tu tڌB{T$e3nȽ쒼{Ĵl^ւL*zZ ̋j<DEۖފMjrbJk4vnbvӒ|~^Tc-;¦֎&\EnL֒cznƆۤVnPe%쐦j¸>T t^&8IƤ 쨼܄܋`*R̸zLDdoJyWJTJsWJ>JyWJTJcJ`JcJdJWJ=JWJ8JJJJJcJtbJcJcJ>VJx@JDVJJ*JtJ2JJЁJdJԁJJKaJ^JSaJTJJJJJdQJJzJJJJJJ|Jp_J|aJaJʹJ\AJմJJȂJ]J05JJJdJdJdJTJfJteJfJfJagJeJleJeJdJDeJdJdJeeJ\eJleJeJeJ,eJeJfJJXJJhJeJhJ iJiJeJiJjJhiJeJleJniJ5lJeJeJfJ)hJ|fJ2hJShJJljJqJ$J/J8=J{TJTJDyJJyJyJC\JNJH\Jh\Jz{JЄJ~{JgJhVJ?JoVJVJaJ(%JjJ`J{JpJ{J|JfJ8JfwJwJ^JJdJ~JJ@JJJ}JJ.J~J}JJ~J~J{JJJÀJegJhJleJ6uJsJxJƂJՂJ JhJJ&J{JJJJUJ|JYJhJJ JJ,J{J̠J/JCJWJJ[JJ{JJfJJJTJ$JKJ*JT6J3JOJȂJJJJNJvJJNJ2\JTJ\TJ(JbTJTJJtJ J1JȂJuJPJuJuJYJ5JaJTJ{JJ,J<JJDJJJJ<JwJJȂJJJJ-JRJtJRJSJU`J JeJfJ%J J+JIJ_J\J_JJSJdJ[JJ{JhJǝJJJJJJJ`JJ\JJJJwJtJJJJNJ!]JTJSJJbJ8J]J$RJaJHJe^JDTJSJ^J(JJ JJXJJ J$J(J,J0J4J8JJJJJJ J J J J J J J$ J J J J J J J J JlJpJJJJJJ J$J(J,J0J4J8J<J@J`JJJJJJ JTJJ@JDJLJPJJJJJJJJJ JJJJJ J$J(J,J0J4J8J<J@JJdJpJJJpJ`JdJhJlJJ J J J J J J|!J"J"J"J"J#J#J#J#J&Jd'Jh'Jl'J4/J8/JJ>J>J>J|?J?J?J?J?J?J?J?J?Jh@Jl@Jp@Jt@JhAJlAJ BJBJBJIJIJIJIJIJIJIJIJIJIJIJIJIJIJIJIJIJIJIJIJIJIJIJIJIJIJIJJJJJ,KJ0KJ4KJKJKJKJKJLJLJLJMJMJMJMJMJMJMJNJNJNJNJOJOJOJQJRJ RJ\RJ`RJdRJhRJRJSJSJSJSJ0TJ|TJTJTJTJTJTJ,UJ0UJUJUJVJVJVJVJVJVJWJWJ WJWJWJWJYJYJYJYJYJYJYJZJ ZJ8ZJ [J$[J,[J0[J\J\J\J\J\J\J\J ]J$]Jd^Jh^Jl^Jp^Jt^Jx^J|^J^J^J^J^J^J^J^J^J^J^J^J^J^J\_J`_Jd_Jh_Jl_J`J`J`JhbJlbJpbJdJdJdJdJdJdJdJdJdJdJdJdJdJdJdJdJdJdJdJdJdJtfJxfJ|gJgJgJ0hJ4hJ8hJJ>J >J>J>J >J$>J(>J4>J8>J<>JD>JP>JT>JX>J`>Jl>Jp>Jt>J|>J>J>J>J>J>J>J>J>J>J>J>J>J>J>J>J>J>J>J>J?J?J?J?J?J$?J0?J4?J8?J@?JL?JP?JT?J\?Jh?Jl?Jp?Jx?J?J?J?J?J?J?J?J?J?J?J?J?J?J?J?J?J?J?J@J@J @J@J@J@J@J @J$@J(@J,@J0@J4@J8@J<@J@@JD@J\@Jusr/mdec/cubie/sunxi-spl.bin010064400000000000000000000510001246133515300152010ustar00rootwheeleGON.BT07왠R```````ﾭ 1) \ //    П P-?P0L8pGKO2Za" apG KiCJ#X 0B;@ .3+0CsD0 vF J#XCiCF( ݊iCBDF !OzppG pG pG6 !G7 !C!7 { K"Z`AA`Z` H!@0Lu 0$P!P@@%"C@! 00D ,O$F FcCH\C)Fp`0@ٿt*0$"D  , KO@sc"@ \i$CYa0t*0$"D  , KO@sc"@ i$Ca0t* L K#` JOs ` K#` K J I` hBr `hBB`TP(`K"`JhC3`pGXl( J#)h@ C` h@$O0l)J-A&]hB6%J(F%K'*D # !F!K!J)FeD H#"FOhCFRظE $$$FF|HOw \a;n#C;fq;n CC;fjrNsK<202#C#CCC|021#C1iK 23h#CCS3`b2?#|cC22#@CCC252 #@C2,2 #@CCC2!ciZ#iггoгoг_ г_ &&&&&&&h;B#iC@SC:CC̀OrOA3H01CC1$ F'j% #"B #CS0 ?GGOApH FK "B Br`O0oSCoCC0K"F H) 7 $H8@H8@)FF8i(C@p$ C KJ`x`FʿQ J8 Fx@%%C@C`pJ`( F)F8@ۿ8Q8FKxP X L`h+p8QF K@6P"F`/i/ 8>Kh/4DtD FI -AFF,F?,((!<3+D+ (!|(нA-EN FFO t =( (!=]F ɲb,M4ȿ J&F¿xCp3;DXb *x"*pF.O0F"iahh(hjhFO O h* DCC `Oc#ikoP屫hy%+OJO 08=Ks+Ozpshsh#ij`#ij3a#i[jsa#ija@u#i<=Ozpj`%#iO2chC"i(F`O5#i"8i`*FOzp" F FO` F8#F K` F#`h(!h KB @Ch`DCC`(F!F"h(18Or#0### ]p #%0#F\0 F0F"R`oJ @:Ho=Ozp+4 Ho,o p@8HNHB@rBA"#F0#G FOzq,!J#0#1 ] JFhBBhH FpOjH-MFFFZF8 B*Hw MAn(ѨFhiiCE(CF+"F #rn0 !"0F F " 0F""F H5\F$\Esn'D(F HHF(ڣh[hh F@G hciB(F#i@B,bb-Mm"#F<0#zF(@փ"L#<0 F\0*F#b(@h F"DJ0\0 #<0#\0JOzqF F-@h?c#dbdde-   MMMO5M`MhU&PNXPV!6&cE!fO\@fiefHf9? !B@" !2C0A|O3DO #"#$#&#(#*#ĿOscfnOsfjX" F< "yH$#<0#\0 F"(@#f#^0h O&? F_UF(؀? F1FP(-#ٖ0! O`C# C CcO{OK"BR[O[OZYEJ:PELf D0F :KO@08K0#D 5%D`"Z`Or3Kbk`2K` /K#a/Kc`.Kcd.Kc.Kg.Kf -K0-K0AF+H54#@FDrC&Oq# n@C f K JD#YJBB4#DD[h`41F``8FEI~( xOIBu I;UI0@HkKh(IHO0Cs0@iGFCj F@GFj F@G (pFM6U& !U&!Fp@B!8D F)F8!K8S @I F3F F@OB6n L I FF F 6nHJHJHpGQRF_}۲[#q"spq#st$rLsʲp!qs#q"spq#st$rsʲp!qs}۲ppG}۲xpG}pG-MFEF'B (F" Fe "#O O .w ۯBBҶA K BBӤe C _[ O: O6Z  F#HFJDFBFx2,0F$Ͳ<E#FTD,E;"DDB0B0@ F D+T;E?"!DF; DBKO0 DDB?x1 Ozvs%/F#4&F#F#FVFU!hF1NOzt#3FFpFNB%F(5F(F dp& %"D '"O.01pDB'JC F0Ap  !YC !30p #SC "02p B03qF-M'8NF##BBPFF%FTF,I##R # F$I+ D#  # O.01 D DD O!K ! 0  SC0  "0302 , <Z| pFMF) FF(F ">sB+b+FYB($ !#F"DBFpJ-MF!x@ к O  H&ɲ*sRB4cCO- qHѲ  A\CFF` F FR8F B;F $F)F:K r8DЅ5 кO0*p5BXjp5F0$ $)F:K r8D0";B+j;F;Y\/ !F*F;(((L-MFF3x+ %+$+p-+ D?++ + #+ D@0+DDD0 )'O 1FF;0 (70?*+h6/BDO7F3x.+ sxp0 )#O F1x0F60  0;F*+ h+ F0FO3 F#xh)L.Z.t) l) ѐlцL!O1F0xn($c( %($X($'d("i( s(%o('p((u(x(@D   #?/;h5, "?/@+(Fh:F6rxa* I*>  L)2"&l)hF! hZђFO t)ђF h)F)O{RF(F[FFBF6+pLKxN0+DxCx,фx4]DЃ""*"* "F 'F;\Dy0;D ;۲7;B0`FKx-,н@0@BR]pGQ ~ EH FFFF"4 !FF F"!F4 h/@BFO/p/p!IJ# 0B 433# 0(/@SBFO/p!/p@' o@CBFFOd( d!`A( Cа/@BFO/p!/p{!) @eK$S$ B<( aH( !!CIB K@0O0] pGJpG$B@BOFB(pB(pAB(ApB(poB(`oB(`AoB(A`oB(`_B(P_B(PA_B(AP_B(POB(@OB(@AOB(A@OB(@?B(0?B(0A?B(A0?B(0/B( /B( A/B(A /B( B(B(AB(AB(B(B(AB(AB(FpG  pG pGO0~)-@@pG)> HIBJHCBB@B#OF@(s@(sA@(As@(so@(co@(cAo@(Aco@(c_@(S_@(SA_@(AS_@(SO@(CO@(CAO@(ACO@(C?@(3?@(3A?@(A3?@(3/@(#/@(#A/@(A#/@(#@(@(A@(A@(@(@(A@(A@(H@BpGH@BpG8 Op@pG#H@BpG(ȿo@O@&)-@@pG@ @F :@CRBcF@CpG@@F :@CRBcF@CpGOLP`P-Tp89U<VH>WAX DYGZbJ[d?M\P]] lr : [<%08lx>] sp : %08lx ip : %08lx fp : %08lx r10: %08lx r9 : %08lx r8 : %08lx r7 : %08lx r6 : %08lx r5 : %08lx r4 : %08lx r3 : %08lx r2 : %08lx r1 : %08lx r0 : %08lx Flags: %c%c%c%c IRQs %s FIQs %s Mode %s%s undefined instruction software interrupt prefetch abort data abort not used fast interrupt request USER_26FIQ_26IRQ_26SVC_26UK4_26UK5_26UK6_26UK7_26UK8_26UK9_26UK10_26UK11_26UK12_26UK13_26UK14_26UK15_26USER_32FIQ_32IRQ_32SVC_32UK4_32UK5_32UK6_32ABT_32UK8_32UK9_32HYP_32UND_32UK12_32UK13_32UK14_32SYS_32resetting ... WARNING: Caches not enabled DRAM: %lu MiB Failed to set core voltage! Can't set CPU frequency ethaddrSUNXI SCSI INIT satapwrAHCI PHY power up failed. AHCI PHY calibration failed. U-BootSPL: Unsupported Boot Device %d U-Boot SPL 2015.01 (Jan 24 2015 - 09:46:38) spl: mmc device not found!! spl: mmc init failed: err - %d spl: mmc blk read err - %lu spl: wrong MMC boot mode Error, wrong i2c adapter %d max %d possible twsi0Status Error: 0x%08X Timeout waiting card ready MMC Device %d not found MMC: block number 0x%lx exceeds max(0x%lx) mmc fail to send stop cmd Card doesn't support part_switch MMC: SET_DSR failed Man %06x Snr %04x%04x%c%c%c%c%c%c%d.%d%s is deprecated! use mmc_create() instead. MMC: no card present Card did not respond to voltage select! %s: %d SUNXI SD/MMCWrong mmc number %d mmc_cdCannot find console himport_r: can't insert "%s=%s" into hash table WARNING: '%s' neither in running nor in imported env! WARNING: '%s' not in imported env, deleting it! %s %llu Bytes%s%lu.%ld %ciB%s%08lx: %0*x %s ### ERROR ### Please RESET the board ### %s:%u: %s: Assertion `%s' failed.%*llu%.*s(((((AAAAAABBBBBB0123456789abcdef0123456789ABCDEF {f0ȠMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMNNNNNNNN N N(N(N0N0N8N8N@N@NHNHNPNPNXNXN`N`NhNhNpNpNxNxNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNOOOOOOOO O O(O(O0O0O8O8O@O@OHOHOPOPOXOXO`O`OhOhOpOpOxOxOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOPPPPPPPP P P(P(P0P0P8P8P@P@PHPHPPPPPXPXP`P`PhPhPpPpPxPxPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQQQQQQQQ Q Q(Q(Q0Q0Q8Q8Q@Q@QHQHQPQPQXQXQ`Q`QhQhQpQpQxQxQQQeserial0....e..@a 2Husr/mdec/cubie/u-boot.bin010075500000000000000000011355701246133515400144700ustar00rootwheel`JJ JJJ@JJﾭ (OР iHMP  H4P  OР iHM  H4P  OР iHM! H4P  HOР iHMp! H4P  OР iHM! H4P  OР iHM0" H4P  hOР iHM" H4P ~ 1) \ //   JПM P-PE-0O004300CS$@_01``V pp  P bpVpW*0S* Pp^pW*0S*Q0????////@-@/@-@@-0?????/?00 0#0b0S*>?00?/A-p`_0P0PSE@ @Gdd P0@e@0 D 8P0e0T*6O@0?ALJBJLJ/@-:0 , ,/L0 0D "0P5 5 %;20%?20b 0l000/ v@-@d@ 000P  Rb0b00/ @-/@-6/7,7N0 ,,@-@@-'~@P.PMJ@-E-0>.! $0 \ -   t* $ \ 80-P50;1  t* $ \ 80-P50;1  t*0 X l (l /P$0Ql l//( P01 0Q9190/^$0 S8CRNJ0@-M@ K00<8 0,0@P040BN($ 0=N0 006N0  00/NUNnZ z C0c0Vv\ N@0T P @0 1400NЍ0l%JQNJNJNJNJOJ!J`JTJ*OJ@-@ NIOJ@-@ M`OJ@-@ MtOJ@-@ MOJ@-@ MOJ@-@ M}OJ@-@ MzuOJ/@- MP 0k~PJM000cS00Ѝ//0/8@-PQH@$JH0L #:":T*@8@-OJO@-O@@ T0?0?O@OO@O@-OO@OP/0 D 1? 0?/@6n@- @V4@-@7Y@@T&yo`@- $!!@_@-\>KPP0(R   8, #,0 #( #$ ö Ѝ?sJ0}op@-PML(o(o}㇮0A0P0偮0700575700;=; =0029007006600>>2>0a0700 "R PUx H dP@$ L`0 PU<p@L7@00p@'iPJPJPJPJ/@-W$JP  WM`@WQJ//@-p @ O4!4XX0 (!X0 !X0 !X0 !X0 !X0 1X 0X 0X X $X (X ,X 0X 4X 8X <X @X DX HX LX PX TX X0X \0X `0X d0X h0X l0JQJtIJGJHJ0HJXHJJOJJJJJ(Jx@J4<J(JJXJdJJ4JE- p$`W"W@@T * %8P   B4 0$LW  ?QJ 000R0/0 P/0/0/ @0S/DJKjQJM-P@`T1 P0p000W 0 P \ M  MM` ` P PpMp``M@Ѝ@-NPKxQJ@-    @-OPKxQJ0p@-S` R0S 000P@U!0 0    0 p8@-@P0 PP 0P80A-S`0S 0@PS bv0S 0^0 dr儀ҫPI0   ` VV``DM`` ``` 0S 0 S2& 0 00 000 ` 0 L @o pW: R \R00SVMP Pp0p0qOPNP 0GpG 0 0 00S `` 0SaVAZ R \R0  JRM-`00@ T. J(KP J%@ꐰ@PU0qZ PTJ KPx(J@PЍEJQJQJQJP/H 000 0   _S R=Co//ZCJ0A-S@f/PV000`QS000/) 0  a0 00#88000 //80  a0 00>0000 @ /@0B8C@0/0 @ /@00C@0@ H /L0S L003?:00T0T@  a@ @ TP /@00C@0@00@0@ < @00C@0////@- 00 4D0H孤P @-R PLT 壤P L @-CSJ@-Cf CSJJ@-  @ASJ@-@-Q@ P B@ @ P \///0@-@L i PCTJ0!@-H @LL@-,/40!@-5C40, L,0 @,8,, 0 @-  ƜPbLJ// 00b 0/JxJEJ///@-a@-CSJ@- CSJ@-0喬?sJ@-@-V@-6B@ /A JSJ@-BxnTJ@-q0B@-B@yD@-@-0<00/@-@-XJ0/Rp@-@@P 㱧`0BE @@Bp TJ5TJE-BXMp`P@) 㒧0:PP#PQ P E0P | \ PdB 70(0 000 0ЍJEJTJ@-@ l@@2MSJ8@-@[B IPP|JB t0RpGP\?BHL:BGP< 8P2B,P.B8#UJDUJ'V[UJpUJUJUJUJUJR@-H0@p@`P PP`U Js@-PX`@P@卢@P404`@B 0PЍpUJUJ JUJE-PB@M` 0@0p00^U00`0  Ӧ`` xHP0 ` c* P :0 ^0< 0005ЍEJ J@-M@p`d00Ph0 00kHPX l0 0p0@00IPP $Al ЍEJWJXJ@-3@-M-(M`L@HP 000 $w._?RG\G ₛY00 V $ $G딆pHTPpGP2lIA `6到R T8A#}FP0.AstG[ $AFP(A AaQH AZp 0 pAoQT0xS# GP0]00\00^0 03/@00L003?X00SS_08 $0 ` H00? @D0S03?`0 ] 4RHpP` X ` '0S@0P0 03?T0S$0F넴@ ١0p D0SS 0D@ #]0A00Q0S ^0SS00 P`c H0\Xp0L00P00T0$0]F[ [ 50Wlz@dw@8$ F Ho@ $0ǙP (p[@0$   U@ g0 W0#03[W ppRS} F@pD0S "0S2@ /@svXH p>pw8 h x00dt0 aGPot 5=x2=  pᐰl G p HP\^ 00P00S*@: @ F  +0jpX w.w   01@ 0;/pP ?&X |^E^ ?`5X a  0;/pP   0;/pP Xp(ЍEJ2XJ9XJ'V^UJsUJUJUJUJkXJXJXJXJYJ;YJEJEJXJ_YJnYJYJYJYJZJHZJZJZJZJZJA-`B@pPU U@P؟*@ P @-`@$y?4//ZJ P!@-P`@p=P  WTp 0@a=P ᨟`@(Q?4//([JMJ1[Jp@-`HP@I=P 4PT$M<`03/pUJk[Jn[J P0@-MP@8` ᦤ0 ( 0EЍ0/w[J PE-4@"0pS 0  D0S X`PP⢟U`VA 0`[D<@`P``@4>#  04/ ЍMJTJ{[J@-@ll`p0PQ 0$ F FP(l pP<PP l`c0x00h  PaP L> 0`l ,>< >Ѝp[JMJ[JCJ[J[J\J P@-//@-@p`P0 P>N>\J\J\J\JA-`P ,@P P @PP ᐞpT @PP  ጞ00 P`?T:㿞`P 00X`Up῞P 8/`P ?R; P; E-p0P`S @B0P @@T% ᜞0 s R @0 S T ,R:S,S S 0S P T"!* @//p R :R@0P0 R 8咞P@e[@ ᮞ00cLJ00/E-PP`P@pP@fA P PUᅁ@J4@J8@-P(@((i 0-8lRJQJJL]J@-(M 0 @p 00 0(0 +0S T  P P  0 (ЍJA-@㤀M`P @20pS xL;@P` -P 'P ؝P P00܍JFJ]JL]JP- 0\ X\<0Q P DRZCJ0 0/8@-P(@(( 84UJ4TJJ]Jp@-PᖝPp,`ᅝ@P fp <p{LJ]Jp@-PႝP 4`q@P fp<ppvLJ'^Jp@-(M 0 @ 00 0(0 y0S T0 UP P`01 (ЍpJ*J0A-@0Pᨀ`00@S@p :@Pt vP pP!P @$010 0Ѝ^AJJFJd^J]J*JM-R0@2Q`P@X  0JS|WJppppg;p 0  0\- W  .RR&pW,p0  0W  S 0R XR \  :RRp\ pw0 0;.0p p)X :X # 0 ;p 0 @ \@F: P@X ; 6P < 0 ,p;ЍTJ{LJk^J^J^J^J_JP@- fP ;_J0_J"90/ $  ( /ZDJE-MLMbpP'G`?`:P@$ @P m;hP|e RA K 0P @8 t8l8w4/\8Ѝp JmbJrbJbJbJMJbJbJbJbJbJ`JcJ cJcJcJ%cJ,cJRcJscJ\JR@-0 0c@-o Ѝ@-o Ѝ@-zp Ѝ@-o Ѝ@-np Ѝ@-o Ѝ@-o Ѝ@-\p ЍR@-dMp8P@ @0uM`P p~P  0~8ׁdЍhgJgJE-RtMP00ʓF@2`` 0PMP) pd~@P  0Y8 H C0 0 0IP0 (?8!;8@tЍgJgJhJp@-P@T,8჋`Pאl#8 v1QP 803?S 018(@8@pp=lJhlJlJlJRJQ 00S SSt 0S   QS //QQ/QA R/ZCJE-@QP`P $`7VV 7`7p`mPE7p@T E7`70Tp堠@DADVV`1 7l@T`7HpHV DV@`  7,E7lJlJlJlJJTJlJG|JlJlJJ 04FJlJRM-PM#p0aS6`R=0S 06 3P2 t 5l  OP00##P" VC  A 03?R*  C74኏P0  :7+\0@S (7`& 㺗`P.X P  X003?    2/P0*( 7 NP;   兗PX @YP P 0sSX 0X 0o 0PH 0 <R(T˟ `P0p0 # >Q_ WQp!   0尛 ` h0R0 z  Q [R) ʟP0`p0 # ]R R  Rp!   D  0~`0HW 0]Qs`  0 0Ɩ0X`10 0` ϋPLp9` 9PN | !gSX00`FX0sS `宋0P+PnU sUXPP9 0 0P`0&  nRp0   0pP R R PUnR Պ A 0P0sS4 3'0 C`Vp 2a0vS#P V  e00V00S @ 0 |@UT  2\eaS P  sSq0  B `2lPCPlS ``X X PP pPU |6 0 `V@  55 Ft 0@SYhrJrJrJsJsJsJsJsJkJ 8U0 &P e0&\ i5PU?d50pEWP7!eZ5WP0  Ɉp1梉0 3P h U eT<5U e<55 S(05 e+5U up 㬕P僊PǍX ߌ`P9`P0hSA0lcP140T5_1 40<140, 14014 4014U014U 0 14U0$14344 E`P 㦙00 `7PP    0;o  `PL00pS!Pp44Uy 0؈P,`w4l$0P 0 000l4aS 寙 ᩙ 0國`PJ  dS B尋`P;E4: ͔P P+ 54 彔P`H`XP   P  ,埔`P` PЍFJlJmJ"mJQmJmmJmJmJnJpJUpJlpJRJpJJpJpJpJpJpJqJ/qJNqJRqJ|J|J{nJ@-pR`P@ T0 P003?0qJM-p` $P@PU  0M; 0ɈP@-p`PCp@ ᭋ@T3 0 }3BJqJQM-(M@d`!PpP@[@ه T 0 嶇! S RṊ@0h 0ጊ@P0 8P $ 0 ӊ@P  0 Ȋ@P׋l6? $0P 0⸊@TƋ036o `(Ѝ[JqJqJqJ?rJrJs@-P\@Pth d@P\0`Pꖓ< 0ᆊ@P2ЍpPrJ[JMJ`rJ7@-P@#P  0 Ѝ0@2 Ѝ0rJSM-` M hh02SPp@Pd8 4F(!@PA00 !1@PP 2 2n} ! 0 QZ1>P>1  cD @P, g2 ЍrJBJqJaVJsJsJ/sJ@- a 0 ЍM-8M,pṇPET0P( N0P; (┒`(PFE0@P2  ⹗  0zPP T  pT @0S@PU00 X 0P:0P0 8 02 ((`⋗8Ѝ3sJ?sJ0@d4?00@0PЍE-LM@Plpp`埇 0 0HS <, *<04( "4008/0  RH  0 H !3?000!8P@ 0(( P5h0H3?40(0 P( 07pP 06o` Pt\ t0P @8 00LЍ/sJuJuJuJ uJ'uJsJȊJ@-ch Ѝ@-uh Ѝ@-"i Ѝ@-h ЍRKA-R@$ppᮑWP< 0iS cSP 4sS tSP .PPS`S@@  1USS@ U U@SOoBS@ 00x S/ȊJ@yJIyJiyJRA-P`@B 8p>P  0A//J@-|S@|S0yTR@-` `hP0V@ppT00StTP,0P@T 0o6zJLzJR@-S0 |d d00b` C1P@:H|08w0S@P  p0RzJ4@J`@J.ezJuzJzJR@-T@H_0 N@,V0S@P O0zJzJzJR@-@pP@gDAPU! 5SP0( 60x40 @g"DAP`:D&0S0 ( 00`@J4@J.zJRJezJ0 .R0@/R 0S/RE- P ` p @ P ЍE > `dהwpPQ0  @@aS P ((/ 8  Ѝ{J{JRA- % @᱔ pp嬔`PP 墔 坔 0S P /Ѝ{J'{JR2E-MP @႔ p}qP`  sP1#UO  i@ w0R P $$i/ѐЍ/{J'{JA-BQ3P @G pB`6Pp  8U@ 0@00aS0 00PR P */ 㒐Ѝ{J{JRnM-p1!M⬁`P@ ` 0> @ pPP`H4. @ 0iR P . T1! T!.<P[pP ȓT  T0p3?00pW  @ 0KR P Pd.[PW0P 0`Ѝ/JJJJJJ/{J'{J{J6{J={JD{JK{JJ{J~|M-R(MaP@ Zp` y ptPhP@[  h`V ppp 0Q P c.# ^. R W.  WPF.0S 0 A^R|<.tC.00 *.`gV0 0P0@0(ЍJJJJJJJ'{J{JO{JU{J/JJ'OJRM-< P p @Pp  P D` . 0dS0 00oQ @PP`Z , (-- Ѝ[{J{J'{JOJ@-@ *R ȒT T T 㸒A00*S 㭒$S/0{S 0 }P P/00+/M-PFaph[ 00U  !@PM7WI0UpP W@pJ|JJJJJOoB7@@4O2PP!@O+` W"JJJJ$J4J@`OoB@V@V@@V@@ V@@ V@@@>-ЍH-J{JR @-@= 0R̓JJJJJJJ 0 w-o/{J0 0 0 /PP@  > P @PÍ@?H, y?8? ,)AލpJ̔JW|Jn[J00S 0/Q-( $ŸR 2  0c%40SQ 00S! S!  0SQ00S! S!  =% Q6%x3%$0lS -%+%00&%Xg!%0sBH  㧅@PVg\0H I  B D0 C <0 D 40 E ,0 $$0 XЍ/KJKJKJKJKJKJJPzJJJJfJJJRJJJJ(J-J*JRJJJJeJJJJJJ JJφJJJJ$uJp@-`@_V pP 㸉ORP*:%Pd#pM-P@p 2@D`P 0TWPT0S!PP004$  0M/JJJp@-`P"K@P,$pU00OPp蝌J@-0oJ@- OR@-1P R@ NP`R2 E P@P`F$pPRKl0l P@` 3$T<0P^0S8)$0_ $$JJJJJJJ@-D@P dO0P 0S 8 #J@JRA-@- @ `pPeP@  0h#IP@P#1 3/404 @T( #@T@JUJJJJJRE-@3 @᳈ `孈 p 娈P&P@  0l#HP@T# 0} 9}0S00' 0} +}0S00 "} }0S00 0O0R R Rp' W?o2U000 USX00PPp`j AVB0oЍH,JP P :P Pd/ P : P P D/@/</8/4/0/,/(/$/JMJJ J+J3J@JDJTJJP8@-@P P P9 pT T0jU *8@cU #@D\TJJJ J(J0J |xEtCUl h5:PU` H8@H4J]J~JJyJJJJJžJўJ՞JޞJJJJJ J{J8@-P@MP80S8@ T8M-@Pw~p` 0S0P$Q 0 S/ \!0C\\ 08Z0  C (X 000`|    H`!00CS !10 bwP ` 0 WwPSwPl9S` 9VP `Ѝ JJJJ%JJ#J3JhJQ/@-M?@`%1X#*  1+10S S S%-,1 +10S.D `p@$ЍM ꀟJ]JOJTJJjJJRJyJJȟJJJ|J JJ5J!J)J?JMJ(\J@-@!PC10(pH`s#4 vP  0vP|vP1S |!Lh!T!HC?B/0 ! s#4  Ѝ`J}JJRJJJ۠JRA-8M@` P+vP@P  vP  vP V l(m@PX|L60S@t@ ,u@P `PP@u$Q FvH@ T u@P$V ~PP 1SQ@ T 1zPh9PPT+ 1S9= (u@PkV} z`pP  z9P`0SS JS FS" %KS PS kS fS jS pS sS TPHP <P 0P$PV h0Vd1  v` #0 0 d `  EpD CuP @ t:u@P$V@P `P 0S U@ 0)P y 0P 0S )T u@P&r0SV iy dy `_y @p0e  0d00pP0`0` S< (y&=P>0%=0OJUJ@OJp@-&M0P ,`@` wr000pOJ@OJ/M-Mg@?@PP l|U@0`1 |0 h 0 00P$y#P>0W101 & $ AP 71S|00 S0 S @S0 00h0d0`v```0`` ` 0PT pr p 0P P"  r  PB? 1 `Q! Rqa `p"Qlsvdp 0PI0<@m R Q6 0QN Q 0pE? 0R R)QG0 S aVڰ0 1F?00 q0    v0#&! &!R 80>00q0 $ "$ RQ00Zu0 nuq@1T '` 1V `1dh !0000 0 @P+(p l@p@H`4q 0q ,qQ  0.Q  0'Q  0 P`)%PߍzJJǨJJ,JdJJʩJtJJJJJ7JQJJJ.JLJs@- 1@P` @&-p00&M T@ ZCp P ` P \Vldf\0 T@D00S4Ѝp@JOJ@OJJJJJ٫JJDJJ@-r qh0 1  #0d   4Ѝp@-@ `P9T@ p@q@-h0q10 0 d  Ѝ@-r qh0 1  #0d   Ѝ@-)h0r 10  0d   Ѝ/0 /HJE-M?@P?@`p p P 가ppW 㰀Ѝ@-MGp`?pP@ P90 0  ?01S ) p PpH C , R   R   R  Q ( $I iqP Z0(9 fЍ7J"M-.M0`?`S ʨr @ePPx Z UP o 0 4 0#40o  o0 p01 S00   R0p 9h0 d 1 0pp` 0P9Wp&꒎p9W5_0?00` P%0尰Რ 0* 7P .      p  0 S0S .ލHJLJOJ0F?0 \ \ 0S 0S 00S2/9 R  /@-@M h01  }/ !0 P09poh0104 =eoh014 3[oЍp@-(M`@ Pn 0000h01DP  !0}/  L:oh0104 h0104 (Ѝp@- h01 }/0  'ЍM-FM0WD"P`@??Pq0 RW3p$ h014 7 0  sn 0}/  0PPZ0n h$P0 PW000S}W  }/ lP9 W  P9 P 0p N ,?P `0R0 0CS 0S C/o0"S00SFߍJJUSBCUSBSM-0M0!P!0R3 h0h@@100A 4 @4 @G0000S0_ h01 !0 }Ϡ\ P II h01 0 I?`V< ሠ  V 0 0p 0,0 0}?00$$ 9S  $0 $0 9,W ,W [K , pW `V0ЍJs@-0% @0`$0S  APU0 S mS `i 00 R RR 100c!R RЍppJM-MMG`@?`Pp = 0Sq  p 1#4L01M01PS_ R09,03/Y 0S m000რ20000@00 R0   00SS0S09 B0S$R#S! S X L@ Mpd Wm  pW L@ M( PK菬J̬Jp@- \@P`l00020000@00 00003/`pJM-PR Miq@`p00P  t0r# 0R X!t0p!"H1 0*@ T A00 `l 0* 0 0" 00 `000 02/0P pW0 W(,w`6 o#X(lt X$ &$    + 00S00Pg000 ЍPJJM-PR Miq@`p00YP  t0r# 0R X!t0p!"H1 0*@ T A00 k 0( 0 0" 00 `000 02/0P pW0 W(,w`6 o#X(lt X$ &$    + 00S00Pg000E ЍPJJ00P0t 0 /ᔃJPJ\0p@- RL`P@0T4 td @p p蔃JPJ-JJA-`QU Psp'F 0S 00CS@4 lkP`P 0 0 0S 0 :PS\100X1T100P1,000F0f D+! R*!   +! 0 R!!  %!%  P PP 0S 0S 0S 0S 0ASx7  P % R % h0104 j,0$9PIJJJJ/JdJJM-M0pB?p`Pp 0 00 j00020$000 00003/P Xx  0S S 0 0j Ej Z j0 p$0U0^0 j 儰 " 0 2/P ?p ?p   pjt1B0Sd1L0:SK d kpWF 8j%000 2000 00003/P Z --< 0 0002/ 3?0  0R   Q Q( #8R8  S <BL M0[ Pm ܍JJحJ̪JPM-MH Aȡȁ`pt P$jt0 t@ 0p``VlPDk0Di0D pAPYPF X14` 02"0PQ6( 6 _?` h`0 0 0}?00P0`0t Rʜ 0 ` 0`P   VP U[8P`ЍJPJ|JJJLJJAJM-p$2 `@=V{ mV@t  mVP  m[Pp6  1R5P|U0Sl00V0S L80S 8.P( $}5U%* 04V#pc*Z Z d zi\ 0aP I O `Bpl]h ZPЍ J2XJ]J'V^UJsUJXJJUJUJUJЮJJJJ7JYJXJn[JM-hpPb P,h@PP{ PP `p,h@P `P 5X X  )1@0  P0 S R 0  P!@0Z  T TpQ P  h 0A Ѝ蜄JJ/P A-`0P@pS TC PTX &hP0p/QPb 0S0S^ 00/E-MMp`@00P w k0PS  Rj ^2/0P0S }  P0S+ PCP gPU'00S0!!3/P0 S PCP gPU 0//, -0000ۍЍ芯JJP$ M-@Pp`U VE PV[  gP P 0  P 0 /X @P gP A-P$p`F @P 000U p00`0 gPPP00 0P @-P0@`S pCP 0`P /A\@-H]| "   @AT"   RO AR  ORT AR  TRA|S SQ. 9Q. GQ.H\  0RS000CR   0AJ&JJJM-PIM<00SH00H0`pSSH00 <0Qp`W 0<@Q ogXB hgH0S<0 0{<0 RBQ  00 S0 000g`V)W0?0 H   h !I00 !0@< fЍ07@-0@S0PI :P  ;<0 00: eP*0S Ѝ0JJJs@-\0PI0 Ri :P T :<0 009 S0000@Ѝp觯J)R 9S7/A-HMPq`@Pm0sO 1SL!1SI"1SF#1SC 1S@J?00S;+10S7LPDh0L Kf@ h0104<*y P.10 0"<0 00l9P B? 6P U<  f\~e1 0 H0<@80@0400PPHЍ讯J1JJܯJJ<1J0J@-pH@P 0`Y@P@ ':<觯J@-PpU`t @000  -RPE R fRp PEU aP@JJ@-0GJJRA-P`@B 8pP  0A//J0@-@P,M0 0 00000@ 0(0^`@T X@ @0@4aPP_,Ѝ0JQJ-JR@-@  -Q  aR@D0T P`pP L LcP,`XpWRJQJM-@MP pPEU* 0-S(0S dS bS cS rS tS PP pP p@][Pl W00S @hU` hPUPP U#&0PfQQ SVP Z PE` d c0P @(@@ @ `0aPP0P P0L0*4000Ѝ聱JsJJJͰJJJBJTJJ$J@- BR -^ ^ a^ f^ R Q <' ,R \ M@JE-,MpXP`=dPh, 0 -RH R fRp H(!X0000S@ L`o6 cZ@@PD& Q0  R QS C00`0@`0(0@ p^0S(0$ ,Ѝ JJJ@J$JZJR/0/J@-H000 00 Q 0S sЍ䆲J@-@h@@-M @ehЍw[JM-P @@M p EZ6` -R3 R& cR bR (sR tR #T TpEZ _ `gT p@0 P<IG gX  vcWPE` P `0_ P0 003 g j!p[@`P 0p 0 0h @_PPX0XX 0T03[[  Db,e@Ѝ聱JJBJJTJ$JʲJn[J@-PP@p`W0@=S0S=PM-pᰠ`PP@P T@PPfPwP U@fT 00EβJ0@-@(M   P 000 0(0 ]P\ P\(ЍJ7@-P@P f0S Ѝ08@-P@P  8@f8R@-M@ P  <3g8  ) P /ۍ{JJ$0/( 0R$00/ZDJ@- (0S 0/ZDJ@-P 0TSYS001P8@-(P@  ( t(P@8@-@P 0!S|`@S@dO0@0 (0 0HHA_P<0<< 080{0F000Ѝ蒵JJJZDJBJJܵJ$J@-0 (00 0  _ЍZDJJQ0@-@M  b a0P |@0000 0XL ^@P0@00 8088 0400(Ѝ JJBJJܵJ$JOJ@-M|`0@pPp#h` @@^P H0HH 0D00 `ЍJBJJܵJ$J@-(0S; @U@t JM-0P@ p 0E\ `pP 0Na K0X R  Q0 a0Pc40  `[W`0 101ЍJpJMJE-ph@Pd0`01U1a(0S 3/P, ` P蘄JJJJA-P<`p8@1T1 0S 3/@舄JJA-P<`p8@1T1$0S 3/@舄JJ-@-MMA.  e@[/ۍЍ@Ѝ/@-@,03/00p蔄J P/0 6/ R/0 1/ R/0 ./-@-M @MT A.  se@ۍЍ@Ѝ/@-`@Ppe`P  _`P  pY`P  T :T 讯J^JeJ^J P/0 @-@P @$.ꔄJP/U-0@-MMPA.  e@ۍЍ0@ Ѝ/@-M0  e@ {ۍH0@-@T @ 0S ZP P0@@蘄JJ0/ᄄJ0 /ᄄJ@-@P 8@-@P )T%PP! T0S 3/P8`0TQ T 8X D@ X0 8X 0 ,X $ X0 88$JtIJGJHJ0HJXHJ /@-@Qt ldQT@@Q0@@$J|JJJJJǶJ϶JX E-|X xtX lX d!X0 pTLs `oPk@ ppw+ VX`URTPLU@ ~T yV t P T@3@t000JJJJJpGJ^JeJ:J\0Pp@-@P`  bb_000V:$00V`pp謄JJ܄J H_J܄JJp@-`0PP`N@N@JD T00Pdp 0bSH00a8p0Pd PP0@d@pJ JJP/0@-0@Ÿ @PTQ 0a   010R0810@Q P0` P P PQ  8PP00  Q 0 R *!B  0 00Q"8Q[ TQ"nUQwTQ"|~\ P  A Q R: 0 00J JJ5M-0S50SlP `UV`~V*`1! P P06 0 00  4?0 S&380S[0 TS&6n0US7w0T%S&9|0~0 \ 0 00   ) P   f\0C0$PS  @fT 0``00  @ T 000 \ *@pL!  ,$R,#8 R[ TR,&n UR'w TR,)| ~ As^ B!@"  ^   \:  C!"RJ0 0 @ P  pfW 0``  00  pW 0   0 0 @000 N0C^ 0 RRP @  0pp0fSg1@1@ 0rJ@@N@pP  [0 [XI:tXP1@@0@40 s`01a0@c>0>0@p' 0 00R0h000 W0 0 0 pGp 0W000  t 0S0d S00000fS 0` `0ЍJ܄JJJ JJJJ@-P0p `uPQ$ @0pb@0oSrpW` F$RR0 R0$R00    \JM-@Q&TЍM= XpDPUd0 S  S  `\ h00\ P0 0 0`S`fm S:0 Sgp   E$RR R @  $R  @   @0q\0 h  00[- 0 0 0 0  E$RR0R00@ 0 0$R 0 0@0000@00000006\ P'Z* 0 0  E$RR0R00@ 0 0$R 0 0@0000@0000000 Pp7\h`P! 0 F00R00P(  E$RR0 0R 0000 0$R  0 0 00000  [ h0R 00 0000 000000ЍJA-pQWAW PpUPPP @H"qQ `G0g```F0dS0`@d00d 0    00@@Z@000eS00PPKR@- R __0 J@-@M@@  y[ @ JZ03?co@Ѝ 8@-2/@@@Z03?co<0 R/@-P`p@V # % %(@<A!<@2/ ^ 03?00 @- #P  @ _J@-H@P  T_,0P  K_0L0`JJ@- P  =_@JQ/[@-@ @XJRJ0SS/ / J2J &J0J ;J2J IJ1J@- M@400$(`pP0  0 2/ 2/00S PDx`U 0 @ Hd{ 0 0R0S < nPЍ0J]JsJJJJJзJݷJJP  O^0/ J@-  000 Ѝ@- 0R LP'V//M-,P(0p`ppfXc YP  ^@PP :YPJ  ^@PUa (0P0PPPZp F `1`R T P8 5C 23V P 0S0 S0S!  PD0S "0S  x 0~000@00 03?ЍJJ'V^UJsUJUJUJUJ=JXJtJA-P`@pP)  ]p0U P00 R ƫ   8pUS U 0*S*S0SS輸JJUJȸJ/0@-Pp0@Ml 0$h x0d0t0 aP l 8P R l0@Ѝ0@-@$"@2J:J@-pMP{K@PL`T 0oLP!(  cR@Ѝ_JM-P`UT pUKPP@B<@P  \0s ARVS* RpPR0*0xRPp -8?? 0 |-? h  PP HP<``)Ѝ蔽JJJܽJJ)JSJUJM-(@Q000`VRP= ` \I@:P P&)~pP P d0S 0S@ JPC ,7R4 rX @dT#D0S& "0S%@J 0P @>JP0 3?S `0 0@3?0!``0 V   :Z Z2/PP 0 S@@Z@#T L0ЍJcJUJJJUJɾJݾJJCJxJJ߿JJJ J/@-`@pPᜧPP)P O 2/PPPt0S x0S 2?0 Qtx BPJ;JbJJ0@-1M!S  ! ! !0@0A0S00 S B27701: BQAA@U0S:S B27701: Ѝ04////%%%%/JP @-p@`4@T,DV4PDP@/JP/8@-<P+@P < BW8@-@P 004 T40 408 JM-0M԰@ P` p縀QZ' mV W`PV804 p`0 040804@T 4D,DP VPPU@0Ѝ$JJJ04 4 8 /J@-@MLAS< V /V|0@$0p0(0l000h0,0< VP VH0@$0<0(08000,0%$@Ѝ:JnJnJnJnJJnJnJnJM-MMPkSV0 VP S@p@W \D\RoQ W@V`E00^S@ S# p\ S S \0R0'T  R?$T00S0@4p(T{T004 V$ @`F `PP0p)T}T j B0%Sڷ0+ 0C[P@ 0S V0`F0'D\RoQ@`FP000'@ ۍЍ qp@-P@U `P  PV00p@袬pRA-@P`p@P4 PpW/QJ@-gvA-p0Q@`A SP0Sڐ00C0|U0*0P S0000 U 00C000C0LJJQ@-Pp` @P" BT@Q@@ @aT DU0\p  000@T }0p  000J0M-0(M@ d)0ST)P0H)0D)@)0<)PQ0S00X S000TPP`p ?P )V ;@0 0$P* pp P P``( UC P yP jPn0 S*000P[00S ǣp`ȣ +`1#p꽣QP: gP000!SS\ 7RTx'00S0S0h'0000IU [P!P ; 0 @ 0%A0@S{J |JwJzJxJxJxJyJ(00PC 0P`V ;@ 0 0P, )PY:Pz P P] P* P PP P PM Pb P` PUy 00C0PPUn |00Cg`Pe*`F`V  T  | fdV`FL0SL*XcT%lV0 0C0S? R;*b  [0040S ?00C0Q( $I30 0C0SQ `A`a OT \ . V`F00Cr4Q& A r#  #0 S3#0SS 00S000S #QUS0S 00C0Q:SS R*b 0#0 0C0S0 S*  jS0( 00"0tP 0 c000;@0  0 2 P0p DSpP pp` V V V5 V =V  V 7V V( 200rdW00S 0Stg 00C 00P00S p 0nP0S0 S0S p 0]P 3R# V00  0PPP . 000 0 0`0 000!`P000(Ѝ者JJ0JJ JJJJJTJJJLJJ ꐅJE-P@.`RPPhRPpF'`T  RPRU `@V 0 0aC17J@Jm۶@-@ 84P  JJJM-MpPZ@`G1 ` 00M0 Ss"!0EZ@%p@0 0(0 $ R(0Pp $  SW JpP W | 0@TР gP @` V@iK3J=J Lo- P  ^<<,P P<JTJM-M`|00$ 000 0Q@P Q0P 000@S}Q$$P0  P P P ,0P!0S S S00U 00 1Up  3[@ T03@0p 0 1TP PLU0000S T,P \0p05p0 0,0JJ00@s R/a0@SW@/A0@S7@/8@-@PPP88M-pP0S SS[ P00Kp@` SvXJhJxJJ JJ JJJȊJ@@@@  @@ @s0 S H 3#" RA > P@`t@P@0`t@40P@t@ P@` t@ 0eSrPp0`@0t@iP@pt@P  p@-PH`@ToP @lPPpDp蠆@-P Ѝs@-B*4S 0*4P`P 0PS S404S S`$4V0$4\UV\-P 40 4HP <P 0PS0;41`C44UP 5P  0P 0(4S $4P0#S |P(4S  G $ 44P R 0s0 $s0RЍpJJJJJJE-0 R@@#00(40CD)D4*DDD D$D0D,D<4S 4n ` pPPUf Q@PQ4SI4 $0S0  Q  Q5 0Q  R  ABQ r xR0P0@AA At PR00 a0AS P0 a ARW0AS 70AS>, 0Q 0S,Ć0*40 4t PpGW(SO(4SC404t@ ЍJJ M-D`pP @V)  Q*$RjZ` PP: $Q.  *$Q ,$R ,$RT 00Q  a$K$ R\ QBR\ RR$R \\ B$ Br QPru" uk$R ($RCc$ $P\U )$ ($RCR$ $U0 Pd0$)$R$V `jMN$ p j$$ uЍJ<0@-$$(0 \$$ $ 42 ЍJJJJP@-@ t@40CS   0)44/P@sNJP0/&J7JM-hM@)p6T)@1w*.TBT QP+$T @@ 0P+0,` $0l0 D0000 d0 CP0T D @DC P 00! "# )( $*(+ ` l K,\K 00@ 9GoL KJDBJJJJ{JJ J0H-P@ [d D ?@?@@@M?0?@0P KN ,@E  @<00<0 =0@0000p0<;p0000JJ-CJJM-pPM0PP ,P 0儀E$0(@3?$00 DE'0(00)00S50%0*0Tf T1#z004 0S|$0(4#$,0- #(#<000+00500. @ / 00 PP A0S1 1`< 0` 00  GE0 " P 8 8 c8  U PE3U 0 000b@c$0t@ $PЍJJ8@-0!@ P(00S E@T888@-P0000OnE@T 88J@-@%Q QA QEG*Q Q (Q<4< 0P s QP0!D8 0! 0PY 01 D 8 a D ,0$oЍJ4JJ JM-`PM; P ;.tDX)c# # #@qP!  # #  # P 㨣##UV*pu P  LJ @@  Q )   $Dp ,+p     u'P C+0 R 0  L  HD(  HR L Q(  RPE t%0 0  R  pT20(  R#psP0000 0C$PT*R" R! R   s!T S(#S4簱!1  0㘡 㐁 q |a  p hhd P D  8   ,   $ p@ ` ( ,p 8 P PT<0` 4@P4003 P PЍJJPCJ JJ@x@J$JJOJvJJVJTJKJPJ`J\JJJeJJjJJJnJtJyJJJJJDJCJ)J//6  L-9 S,@<p㺬Xl 0 0 h0 p   '7(0 0//ğM-8 $! P4JJJпJJ4J0c 0@P0ࠣ0唃@xx0|sPl`MX0\dsPL`"80T1TA0S0S y003$!0000! 8 S):k' 00C0S!008010C0 00S0C00 P`b0@0P#0@@080T:Ed0 d00S vtH00S ,008< ${ЍpJ JJJJJA-d@P`@00pU V(0`A08< $VJJ/hM-PPA p## `$@V$ `444(((1  0`V00$0@P@ QP 0S  p B00  pWhJ J J<JPJJ 0 1"# 1 5,1 5! ĠȌ 0 JJ4J3J JR ,0@-0 8 0 ЍJJ@0Q/40 8<0$  #10S $*/JJJ/A-MP RP@ 0bH L0@S3#S3P0TrTB 0LSJJJ JJJ 0D0 ?211111000 0@0#!00 @80$aP)!D`10$@80?@P@DAP P 00 X0d? 0P 8@$0 P@#$1`@0@`T0` 0@8< $8!tPQk< ?C?0 0 10x0(0t0,0orkЍJJJJJRRJ J\JJJJ&JJpJM- ,DM$T?,  P14P1d0;d0P11P1s1032@ `` 010P11P1d0;d0Ў00d0|:d01T31`3`#SL#8083!!!d  d 9CD "D p !.     ! ! "@ 0P80`8   p" l" `20\" X"Pb P= T @vQ ;T `P`P 00 pT @vQ p7T `P`P 00X <0|SxE,as>$VAD@ " RR"@ "  ! ! ! ppD? ! ?? ! :?  00S0b0(00 00$0;80<<0ЍJUJ`JJJ'?"L- N'"|J@-@0S` 3PP 0 30P l8 <$D 姫@P $ЍpJJJJ>JeJ J"$0 R(05;0 Q/t*"$0 R05;003/t*//@-@@8@-P@8@s@-P00PSP0@SN`aSP @aA`` YB R  RP@@àOV@T Ѝp@-H0H@H 0dC1P0P ,@ `@J4@J.~J||00lxC1P/!p@-@|P`| 6/ p|0 0|P|@p4@J`@J.|/| p@-P@ 00b C1T :|P| 0SP|@| PU|`|0 p4@J`@J.~J@-Q@p@-P|@|0p@/A-p|`Pz@|w 0 004/ЍA-p|`Pg @|d 0 004/Ѝ8@-P|W@T |R@|O4/ @ |GTPP8@-|?0 |QM-@D`p PPRP00 P0SaPpX@T 0l6nA-Ptclp @ P uPp v=`VuPpHH0  ,5JD 8@-@0@PP@`0 <P88@5J80@-@0PX <P0005J@-@\0cXpP ,PU *=`V00 0PUPTPUHHD@A-@Pq`P @TpG 8(@Dp0d0S(P AE-`P p兡$@P UJ 8 (PEp{qTTP@DL `000P0d0 t T@D   E5J@-q`@Pq@ЍH0A-`@ p 0P@ L<lLAj5J000S//A-` pPW 0S 00@H0@PQ@@0@P H0@P S0   00@-Q#JJJJJJJJ'(( @'t0pd 0P :00Ѝ/@-@P000S @//000/M-P@T0 S| S2@1@00<R`   "<&<R:     T 0V 0A q0d ; <SV p Wv08pWP ? 0SL; T 0y@S08p@T< ? 0S8; 03009 ,0 00(000$000 00@0 8 00 0. 0 0 0p   }080@ G0PP 0R P 0R 0R 0R 7P$0 11U [`0`,1!PStp<d0h0d1 P0PS00R0! R  0( R  0!((R  0 000LP 60O 05;P0L SSsW#< ;T0BS*S8y;eYލЍ,J,+JeJ) *J+J@x}5JuzJJJP/8@-0S1 0S. 0S+ 0S( 0S% @PP8| 0000,0000@P000H01@01<0100,0 0 885JJ<JJLJ/A- M@P 000S0@0~0S0003/P~,PP5d Pq000_ 10S10 000P0S1 0xo7p 0p0 PP))00000 10 0R 1 0oPP60S`V* V (0S?Q0,B0 5%P#u`$a PP (1S  PP(1SPPUu ,u0%1 ЍJJ0S80@-@$Mu%1SOpP,$1SP0 $`P PWP d+6(1S8 00(0S?005000%1/$Ѝ0@-F@PP,//@-`\P@pT 0H 0S 0 V {@@LJ J'OJJRJ0/5J8@- \@PX0@@ P,PU &1S P8LJ5J@-00  5P,J,J,J,J/TJ@-0p o8@-@L W0 00SPU 508 08 88 4 E-A` p4h1&`0\1000 PP/@1, X\JtJJJ10:001D080800x0:0l0 00:00%40p0` 3`0"0 0" A$400@0 IEDzP TJJ0Ju J;U2JM-(MDPP@X l@ #JQJQ 0 d 000 0CpW8*l0`g V`!0S0B00h Q # !$00@P  0@P   &001000@P 8KT @pP (Ѝ9JJM-0M`@PIhPp0 0WP1P! X+U U  0010 Sh0 P 000TP U  0100CPHAP\h0 pWᓬ*0ЍJJ(J/000C1 $0S 00 0/@-pP`<T@PG4`@-pP`<T@P8400E-@P<<00<04\09\0`P`4p`1<0 0\00 0S420`00d0<h07l0ЍMACJJp@-@h@P6 d`P/@ 2 2%0P00PҁUx t`08`0*B|0<040|0T0 <` 0H0,0D0$0@0(0)2Z<,, p pJ`JJJHJ JJ000/000/00$0/00(0/000/00 0/@-0P370PJ(J/ 0 , /$J0p@-@M@tPt`T < u2 100D04@P$080 `(00000,0,0M,@@Ѝp$JDJPJ\JlJ|JJ8@-P40@T 1P,@0@88$J(J@-@0@-<0s@0/@-n@0/R8@-@ P:R 60@S P K P P P t0P d8T8P <P X2@P T2U . P1JSJO}J@-.@0/@-)@ 0/@-@#$0@/@-@(0@/ Pp@-@ P`A p@h0J8@-@@PP 8@-((0@@-A @h0J6n@- @ nq6n@- @ ad6n@- @ TW6n@- @ GJ6n@- @ :=(6nn(@-cf@-[^@-SV@-K/5J@-$v trp@m5J5J6J46Jd6J"@-E0s0@ 00| 000 00q/ q Q 0/00| 000 00 q Q 0/0s0  /0s0 p/p/A-`pP@)1t @T PEU0P P p@-P` 000T0@P 1P D00D0P}=@P /p蠆sJp@-@?`?P~ `:@>0@dT*RPd@sppJ$9S/ R0  90;8 00/M-MP  ?H) 0 !R  @@pSpW$  0 S0SE@3@0@P5-` 0 0000000(01 0l`0700@00000S0oW=Q1P ,(0P @@o P Ƃ 1S060 a 3 0 SPx0`@W9    <0/02- 8Sp0zg30p00 W4 pSW$0('   *8<0Pw,`8D8@0 g0040(\ !R #(p\``  0@00倠 }0 0}000}0 000?000 001P3cF}0c#?S$ } }}p00 $}P:0? 0?}0S 8H0 0 001wP;100%  R R R PR R @R  l l  @ " )S8 0c9 P܍JJJJ8JZJ@-0 00 0)Pm蠆{J@-0 00(0PmA/蠆J2G/QD/M-0`pHY 04#S S #S@K00@P #Sz S #S S 040 Se  S:  SW S {.0 0                             00 00PS 00 0 04#$R R RB PB@ P00PPs0S :S*PtBPlB}0)STBPx 0P00 0p *0 0Q Q01 xQ Qtn0  088$  :IQ: . , ! 5 0< 0}>9P0 . KL* 0'*0 0 $R R R 0 6R R R00.00 0 00:*00 ἰ 0000P@P@@7. 04V`V`TV -i 0909Ѝ6JaAJAJJAJ0@-@ 4 @@JM-]pB p`0 7 PZ 0000(2P}0]0` @ 0 U-0 0 :0P0 X0 @  {0 0P ` 9-   t{ R $!=G# P @ > @ 0R]{= .0  0    $  "$   $  "$ 0000@00@00-=L0p "R(000`Ѝ@JJ6J J!Ϡ\@- ЍA-!X@HYQTUU`00@0A@AuM-(M`HyV V*_00UPPU@P ``@0P 0`0C3 @0P  , ,7Z$40=080H0 RPà  $0P`H R P嶸0 $0QAAo Q $0 p1 0$0    0P00H??]z0??Wz0Sz$1S P00000GzDz/P$10$1PP P (ЍCJJ@p@-PUp0@\`0c20c@(z00 ?0?`00PzPp諪E-pHYP%$10C$1_z}0@`0V 000y Nz PP @$1S@@}{YJA-p  `@PP $O(zTCO@PzP4m@@XPЍJx@-` @^Tp\TT TTTPTTPPTTPTTPT0E-ppA0P`@#0S SLH0UE#0! 0<0p1  `  `  00* 0S P p8<08 0E$0S !0 s0D 0000080006JJJJ &JJ0p@-P@` p 0S& !8<08 0`  @ `  pP0 R@P p B p086J &JJ@-J///////(0 P  (PP//6J@-@ 03/00Js@-0P0 0lPt@h`U 0SU P0S 043/P ,0  $0(@TЍpJJ6JJt7J8@-P(@ 03/00P8J(0@-@03/@J8@-P(0@03/@8JM-0P@c8 0` $p  T( ?$ !P X'LKHI@e`P(ЍSJbJJ9JSJtJJRJn[JBQR8@-P @PU 8/8lJ@-@ P@BQM-@(MR`H P@P @I  , p,VP ,Pw 000` ywVP!U |p0$0`0 =$p  ' ?$ !$ & (ЍVJSJtJJRJ/ J000SP/lJM-hMp 3D00(00( @ 0@ b4  C0R ͱ P0` 0ds=``x'`0000D00H00`00d00000!0Z=0d0``]'`0P `,00,P@00, 2c 00"0L0 0, 00Xq*L8E408s00 CX\%\XD0`0H0d0!0= Xd \``'\X#SR0@ b hW ~ 0S( `p\20#  0P5(0 `P\30~ hp'  0kpP0h00" 0"00d0~0  0NpPhЍ J0P@- X@ 0P <  0IЍlJsJ@- o Ѝ0@-PL0M0S 80P 0 0  00Ѝ0lJJ@-@P@-0MB Xs`pyP8i0@00 00ЍJJ@-(00S  hX(lJM-0Mp``F (D000)<P@ P5@20 < 0D @PdU < 0 P @ @ <(P<;00@cD8=  00ЍM-x P> PED  Pb Z @5 `&V  0( @0 0 3 Q0S@ " 0Qsꔁ Z:0## 0  0=P Z:@0St 0 `Zx0@qTk= Z T`,w`Fa 0 SI[@  `g&V``y6@6`fĶ T A@ 0  0  F&\@dWX0P  0@P,HX0U6P03J xf# 0 S0f 0C00Z@y  &[5 @5 儥儵 T @ [  %\ @\0P  0P \0$50Z@:  %[4 @4 娤娴 T @   %\ @Q;00P  0=P^ 30 1U3P;0 0C P @1CR0@   %[t9@3 @83 , T \ @  `%\ @Ȳ`0P  0P `050圂 R@   >%[x\2 @T2 H T 4 @  %\ @ :0q 1P  0Pl10 150q0S@0Z0 $[ `1 @X1 L T 81@   =  $\ @ r:0 R ; 0[P l00 1U0P :0lЍlJJtJJJx7JJHJuJJ|JJxJ|7JJ?JuJJJhJpJt7J J@-@P || 000 l0 h@P pX 000 H0 D@Pd4 000 $0 tJJx7J|JxJ|7JhJpJt7J8@-LPL@P Q 00P B0 8@JlJM-0M<0 `04 S8  p P@ 0,PK $0K P0 0P0[S2[p0W: 0  M 00 PPg@r P$U^ 0$00[@0[S S@@S@S @PB@00J T T  T@@80< SR4 00R00S p#P!<0@80P ꈠZ  $P00TP TH T@@< 00 KJ&J4J-J;JM-0MP`0 40 Z#(P 0M0,0 R#@ "0` /R R(00  /6#pP 0/S00 ,0S (tK,0K @8 Pk pi ,0SV!000S(J(`0S  @ 8 8 M#Z P` <R ," 0 $0K 000P 80 0 `  (V 0/S~0@@ ,0KqXlW 0S`(00 0,04 0KJlJ@-\P@0IP T@o T0SЍJ s@-0 S @P0 `  P  0S 0  0  PЍplJJp@- `@ +@"T! PP #S?RL0 S50 0`@TXa YP @pspplJDJX0p@-@PD0 @<0 DP B`D0 8pJJJM-P Mp@0? ? @ M!?`?`  BR*R!$ : _c0CQZ0 0   d0T* 0  Z0  0wP A  0 # R 0 0 0eP  0 0SO SB  0LP 0 # R 0V#0 000 S2 S?>V*ؠ` Ѝ@- 10SP@@p,`P  P@*@ 1 S@@$@ 0000P Sl P@`P HP 0 8 AP0@0Ⴟ JBJKJTJQ/A-@M`FPPA   p 0gS0 0Cs00.&P0gPc``EPU |0  S U r o~00100V  `` @a 00V Z܍ZCJ@-Q`1 @Q!$ 00@@3p/3 4p0W, 0 00S ЍJJ0- ^0 S0 ^ 0 S0 ^ 0SE-Q@@ T(p`."PU *T 00S @D Pt@Q 3P ټB` PE P0@ 0  0S  S00 %0 S2 S?>Q1l h`P `T 00S@D `t@@ T @D g Ѝ]JJp@-@1` PP p@聼PP v0 S" S/jPGPp1P!G0PpJJpJJM-+MpP2 @4p9 T WP 7 `8R| (  T R08 RX0X0*0{0`}0x洆6ᖣ#h0 ᖣ&0 2h@0l0^PP T0 ( S<PP`` +>`02Fh0`c26P 'P p7g&0S*X `H7 0 07z @x Z㿀$  X<"0tS *X@ QlH 0xZe 6PPT0 S2 S?>Q姻Rd6Px&6TdƟP 0FX R@H 0x X H$ 0X0 K$ 0 N0P @ $ + B!R R !00X` lt& Z0`h` `0cS0S7 $_$P P  `6$ bR 000Q 2V&HT0 S ZZ2h4PgT0 S" S/ Z:P4`-Z+ S2 S?>Z:"T0PA SP1H0PP=PPPP @zZc8 5P3 00  P% R P  QQ Q   /o" R B Q   R  R|  0 @ A[ !b&Q\ 0l K0 | 0C0p! b6RLP P[L0 P 0P  0$H'T0 S㺱+8P1 0 02P0 PPP 6Pt | bP !P 2P0P00P}+ލJJJJJJJ]JJJ7JJJJJJxH-0P P?0?0@0M?@?@ P 0`0T `P6< P R( PKx JJTJJJM-MMPL!l 0P00l0 S`p +w p  0 p  p@+!$' d+v`x@ gV ឹ SpD0p(0 0pD{/p(p@00ξPh 0P/U\UPP zzP:S" :00:zP>00XCz?0/S\S :\:0`0P/$ l R0S(: 0': 0 0=l0 0C?o2V  Rb p0,07 PG, Rt*00 0WS40f G W40  R\@Z 0Wh$00 4:4S0W4  (0SC   )S*R 0:S$0pP* :S0W0 S / ܸS t 0ӸzRP zMP[ 0t ?$0,0 p0,000l0` S7V 0bh'G`0@S 00 $x0V@( 0c`S030#S :SC T厸<:SPp l0`Z S908P?(07h&'PF'7Z* 00R 0R0SW  W:+SP  0 WX<UW[<PiP 6U [{$P0 Q00[v l0P$0 0000 00/R\R :SL 0R00G0S<@: 0h(%(00,W, 0` 0S$  (0pP @?(0 0 `</ ݷ<0S t< 0ӷRP @\hPP0·il0 S2 S?>U?:0d:@S :l Q'a70P P@ P 0`@P!R0hP`l0 S2 S>0V*  0@P  T0@ZPP 006 R0ؠͱrh 0 P hN@u! @T P  Z00@ :  0 0a :h 0:P`Xl0 S2 S?>VO*ؠpZh0:t0@SPBl0 S2 S?>P9* 0"h* 0P :h  ? : @T P 0:KPpl0 S2 S?>W*ؠ`*0P : @P :@׶@h婸S P{ P00 0p>ލЍJJTJJJJJJ]JJJ-$M (0000,000$Ѝ@-pMA0S, 囶000CS nJ0nJ8nJ@nJHnJPnJXnJ(nJ }0yf0 @P lo@  hP& @+@cpЍ JJJrJvJJ{JJJJ$J,J;JSJ@-00 000Ѝ-,M 0  qo,Ѝ-$M 0 a$Ѝ@-@ MD`p 000# 00 0@000J ЍЀhJ@-MPc8`@P ЍJ/0A-a @P0 0A JtJE᷷ 0L BM-08MP00#03\00ST000C a00 04@0C8$LLA(P , (N0,X<ND0 4Q@ Ġ , A @^;l@    Q5 20 2nΠL : Q`@ 0@ aA粀:n @pQ *`pW "`5 20p2 >dd`F`$`@nV\(@dT,ßpW  Tpd'* dp^.pW*4ppdp@h T!* dW0@ T* d@ppSf@ Tpd* dp^0\00L00000\_ `\0`X ,fL0V@CHp`0`d0`0S00 SVp0.0``V00, 0(@  d`F ``qA粀I @  N @a@  | SR1: l A b   0c<008<8ЍJ&J<JM-M`@ Q@\ QA@@Q^'\^ @ 0Q @@P@T \*P@@ppp@wJPUT OoB^@T@F`Pp@PP@ⲀTPPP@PDU @T p@rTⰢDpPPP PTC, , H# DC( @# $  (`$`, P e/oE"4 Z  R J`0 P <@TPD   @PDU@Dt@DET: Q@@`t@@@P@,@U(@P@@$@P@P`@@@``Fp@H@@` `8@@2@@gA@`P`D``8`@ ``V `P@AD @Q5 @0@P @U @P` @`t@` `V*``pfW`J7J6J7J P 0S 4) S. (,08<l P L //R6 <S1R  0P8@-@. 0P S(0 $0 S0%0$0 0(3/P UPe00/UE2P000ES$0 (3/000$P408@/88pJpJP  R $0S 4@-Q@ ( 3/( $03//RM-` Mp Xp@ ?@TLD@DPU\EPEQ Rp]V0@P?TLD@D)\0\\ \00 0 \  0 \  0 \ 0 \\   0\ 0\ \0\\  \@\ @0 0 \  P(Vm0`@(P5WV}GW=0pG0W F 0b0S1R 0RR@0@0RPP@R0RP0RP0RP0RP0RP0RP0RP0P0@RP0@RP0@RP0@RP@P0p`pV0@Pp(@l(P ЍP6 M-0M@T3 0[0S,08P S<`p 00 0 00 00000S꼁JJJJxJJJtJ$JJJ<JHJJXJ܉J<J,JJJlJHJJxJJJXJPJJ R 01 VW` 0pGV`0U00S ` }, 0,0t0-0u00'0 0S0 p%'Q ?0000S%R$ 00S`Fh?  `3 0 04 00PW 0pGV`Vu0PS ? > 0SU$   , ,P%T-P)`0P0W 0pGV`V 0SP0  , %4,P-0%8%\.0/P `0P0W 0pGV`V 0Su  %$ 0  , ,P%T-P`0P00+ VW  pGV` @PRP<P , ,P%T-PP 0S `000 % @ W1!Z 0S P 0 bQ  b 0    @0pj j@@0Sl0@0000;# Wc K R P @0 S 2@ 57\Z:0    $v$\pj  A R00@0000:# W5 K R $P @0( S 2@ 57\Z:0    $H$\pj   R$0000  VW  pGV`!U:`P R4,0000 4W 0pGV`V%<,%4<\0TP4PP` 00 0S 0p 0 008P<`c0040 00 0S 0S 0`5S0W 0pGV`V0P00S0 S S9 0L0 0T0x9P00X00d9000%Q`F0`5SVW 0pGV`%8u <#0#R9Q`0P@ 0@0Sc R!1Z!Zv  pj 0 0j 00 00@0j@Wd 0pGV` V0"0U% \ !QSd0%W0``F0 8h000\ h0S*VW@ pGV`h0`F0Q800 h0Sh00800 S>l0pL0 0T0T00/>0l00P0<70h000`dh Rq*TL0A$0$0 0SW 0pGV`\V*W pGV`5S`c08 h0 \V*W pGV`R5S`c- 70%Q0`F"\V*W pGV`5SQ W pGV`V:5S S c ` R|5000Q:h0 80h 00S l/΄S>l0pL0 0T0T0 0$@$0P04G`l08P00X0X0 0d .0P04600 1WR0p 0 8P<` 0p008P<` 0T0L 01 岠RWC 0pGV`S  03$0$00311 \W) 0pGV`5Q`aS5R`b@0  0@`30H000H0S V*W   pGV` `c@ 5S @ 00X0P01 RW 0pGV` 03$0$00311 ^W 0pGV`5Q`a@5R`b820DH000H0S V*W  pGV` `cD 5S D  ,00 0bD R1t00 0S 0  bD0S  c@0 00b4 S0a(c @S0! S0!c @c@AR 00@0S0G 0Sv  @00 00C 000000SJ VWd 0pGV`0  b0R00000 0S0b { XJJoJJJ8J<8JJJJ8AJJ8JRJnJ<J&JJJJ40S%<,%4<00,4 S P0000 00 0`P0000S 0S VW 0pGV`0U0`P000000p 0 00(08PS<`0SI0 SE P40S (0S$ 00!,0( $ 0(3/P400h`0( `f V:4b00000f4 cVp1p! `V  4f 0`(0,0 00( 000S,00`Sp0,p5`0P`f0Pe0000000000US 0 Se 40< S@000 R  0,00 0SQ 0S/0Ѝ0` 3?S 03?S 03?S3 #/, S$0S/ // /03?S *$03?\0R3?//A-0`0 pP2 00@0_0ES)JHJ JHJtJtJtJtJHJ @P 0S  P @4? @@ gP @@@ 0Q@- P Ѝ0Q@- P Ѝ0Qs@-`P0P @ P P PU000U 00C0SPUpЍp@-@Pp `PfPT  P @@-P`p(@P03/R 7@-P@ DP P@T P  Ѝ0 03?/@-`pP@P<Ͽ013?0 2/100@-1"  <_2O 00E-P`@pP'0TSS P  P 0S @ P0@S  :@S Ѝp@-`P@  0p@@-P`p@6oPP `TPP  T@-@P@W@-@P@Op@-@`PPUpU0p03?0pM-p`(@PU P 1=  0P  P P PTPЍ@-`pP@n p 0 Ѝ@-P  Ѝ@-`pP@W p 0 Ѝs@-P4`@ P  0Ѝp3sJA-pP8 `P0`/S /! P eP P@@0S 0/S S /  PPP0h@PE-`PpP#U @*P00P0S 0S@QW0U  pq  Ѝ@- 0P Ѝp@-P@ Pp B0p@A-@Pp `U  5 P  a P@d@P@A-p0<@PP  @U* 0P` P `@PЍ@-@0( P  oЍ$J@-Pp` PP@  pP  -<'^T a b 888p@-`@"2PPp 0f 22/1 02/3? 0pp@-@`PPp$0f11$ 103? 0pA-@P(p(1`V  3 10N  172/p6o$`8B 0 3?,#,8$#4 0M-@P`P@= : 1  P@jp  10; nP@  0  3? @03? 0 T 0 100 0P 0$4O6o0 @`@8@-@,P8P5_U $ 2/PU408 8 8M-`(p,@P#P 05_R 6P:;78 pЍ0A-`p3_@P W0 A@-@P`P 9pP    0P0@P c  ЍA-Pp`(@P' 0 P   0  0P04/  p00 0P 0 Ѝ@-Pp`S@P 0R P   0 ЍM-@Pp`9P1 0P)p'  @PP 5_ P0 P 40@   40Ѝp@-`P@z 0p@p@-P@`P  P  d0>p@^ppM-`Pp 8@PY03?S$03?0 @+ $ PPC  P  P6$  7p2/$ . @4?(@ @@W&0VU1*0 S 0 ! P07p0402003?,#,8$#40Ѝ P p ,0`$0P////<+JPJ/JEJ7@-@P00$0QS  Ѝ0@-08 kP 0S 00@S # ЍtJ@-04 XP 0S 0P # ЍqJ-00 `R #$" 4"s05JNE-@1DMp$00 ``(0<0dPP ֦0p0e00F?o2P0S 0 0R0S \度 q0 l  e gDЍ萬JJ J&JIJ7@-\    @ Č @PU @PU\:$t Ѝ0gJJ@-`Pp0S @ @D@ 3/0P  d`JM-PU 0S \ `p^ @ 0ST6 T8 @pQ@A006 0@E^*` p` `W( `pZ$ S/U1t  Q5@D2 55:A 0PPQ5 51`b ` 0 ` `X*   @Ѝ0 0 0 X0\0P T0/A-0PPp@S` XpT@@Q\0S) npaoo1 r 0 E V0*X`P\TP \0XW 0\ b\  aPX0c\ALPHM-b pNW9@PT::S@ U5*@@#T@a@a\ AT):@a@UT\ P` \ X\  T* [* \: P0B b0  P`pGNЍp@-`P@P NpJ0/s@-@P `PT  1 Tp0T @0S@`V5ЍpRQ/M-@A⼰K@@@ T:` PdP  03/ P R: Z\ P*@fK@Ѝ諪y 0tp@-@P`徦00 000000C0pA-@`BpPU Q SP@P@-=@S S =o崤EJQ0  /0Sp@-@`PS: Q@Q P0@0op/$JP@-@PpT0  `0SHFP0U@00$JE-@`p@P0T*0 0S  P0PPP@P0 $JM- M D` 0H@p000[0{0Q  PU u 00 U0E P@@0W0C?o20S2 \  L0p|pppT0K|ppp4A0ߍ0$ۍ 100p|pppύ/000 +0 (|ppp P0`0`0@0 P}Uh 0PP 0S0U80  00p@Bp J JJJJJ JJ7J JJ J JJ@-H@000S4倍@p(|}>@\ J'JNJJA- 1Qq 0Aa0100S10S( #, s S4Z :P Dq`0`a0@= 9 0S 1P 0 0R )@ $Q  0}ZL0 0 /0  ЍA JJ J JJ J8JQJ  JoJ JJJ`J,JJJ JJTJ J4JJJ\ JJ J J@- 0 J@-pP@֌ 0 +@0P @``"; p0  00P0QQ?1 H0`D0p6<00@` J0JJJ@JJ8Jd JLJPJDJE-@0S$ S-`+p P PP x{ FPQ   f 0 0R0   Ѝ8J` JJ|1s@-`fp100CPSH4JJJJJJ4J@<00 @@1!0"##0 0 @e;00 "440<0<0d  l0 dM x J J J7JJt J  Jp J Jl JJJ(J7J7J J Jh JtJJJJJJ` @-000P SDD@8404?,00S@l J7JJJNJ7J(J JA-P  !2|xbP  Q*TъH2/ DRD2Dp0W8B002000S( #, s S4< p岊:JpP p[ 00PAQ嗊0 ᒊ0S t1\ 0 0P P傊LA k@|Q ,v !r @Z 1 j^1 900 0 0E  0@90 0@.0, ЍA%J7J3J7J?JJJ| J J8JZJL JoJJJuJ`J,JJJJJTJ JJIJ Jh J(J7J7JJ Jl Jx JJt J7J @-JJpG$B@BOFB(pB(pAB(ApB(poB(`oB(`AoB(A`oB(`_B(P_B(PA_B(AP_B(POB(@OB(@AOB(A@OB(@?B(0?B(0A?B(A0?B(0/B( /B( A/B(A /B( B(B(AB(AB(B(B(AB(AB(FpG  pG pGO0~)-@@pG)> HIBJHCBB@B#OF@(s@(sA@(As@(so@(co@(cAo@(Aco@(c_@(S_@(SA_@(AS_@(SO@(CO@(CAO@(ACO@(C?@(3?@(3A?@(A3?@(3/@(#/@(#A/@(A#/@(#@(@(A@(A@(@(@(A@(A@(H@BpGH@BpG8 Op@pG#H@BpG(ȿo@O@&)-@@pG@ @F :@CRBcF@CpG@@F :@CRBcF@CpGOBOJOJOJOJOJOJOJOJOJOJOJPJ PJPJPJ!PJ)PJ1PJ8PJ?PJFPJMPJTPJ[PJbPJiPJpPJwPJ~PJPJPJPJ^JJgJJpJEJZJmJ}JJJJJ0@{JJ\JLJUJJJKJ JMJKJ8KJTJJJJ0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z--J X.J/J$/JH/J /J 8(HDH'@B`JqJJJJJJJJJJJJLJ.uJ J JJ JJ VJ J "J*JJ5JCJJJTJ #(-27<FPD|JC|JlJG|J 8|J ?|J 0|J P|J 4|JI|JYJJJJJJ0|JlJ4|JG|J8|J<|J?|JC|JF|JI|JM|JP|JT|JJJJJӋJJ\TJ-J 6J FJ QJ \J dJJpJ?JJJ 3J OJ kJ J JJJϊJJ؈JJJ JJىJ ?ىJ ?JJJJ ؈J J sJ J JJ1JJɉJiJJ̈J ؈J J J J JJ1JAJ[JiJ(hJJJ@JJJJwJJ)J#J-J2J 7J<JAJLJWJ\JaJhJtJzJJJJJJJ ޝJJ JJ JJ̼JռJ޼JJJJJJ JJJJJJ+J'JTJTJJJ"J(J9J>JNJSJcJgJTJTJJ JJJJJJǻJͻJԻJڻJJJJJJJTJTJ vJJfJJJJJJ͹JչJJJJJ %J.J BJKJeJsJyJ JJJJWJͺJdJۺJJJJJ &J/JAJJJcJnJJJTJTJ!B c0@P`p)Jk1s2R"RBrb9{ZӜb$C4 dtDTjK( ōS6r&0vfVF[z8׼HXhx@a(#8َHi +ZJzjqP 3:*˿yX;l|L\",<` A* hI~n^N>2.Qp:Yxʱ -No0 P%@Fpg`ڳ=^"25BRwbVr˥nO, 4$ftGd$TDۧ_~<&6WfvvF4VLm/ș鉊DXeHx'h8(}\?؛uJTZ7jz *:.lMͪɍ&|ld\EL<, >]|ߛُn6~UNt^.> !1Aa  0@`@@A@!  @a`10  @ #+3;CScs`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O      *EHCI Host Controlleru-boot  eth_get_dev_by_namemiiphy_registerfdt_fixup_memory_banksv7_dcache_inval_rangeprint_part_efiget_partition_info_efiext4fs_devreadis_gpt_validalloc_read_gpt_entriesis_pte_validset_default_envenv_importenv_exportdo_env_exportusb_get_configuration_nodo_env_importfdt_find_or_add_subnodedo_bootvx_fdtcreate_int_queueahci_port_startata_scsiop_inquiryahci_init(((((AAAAAABBBBBBbootdelay=2baudrate=115200preboot=preboot=usb startstdin=serial,usbkbdstdout=serial,vgastderr=serial,vgabootm_size=0x10000000kernel_addr_r=0x42000000fdt_addr_r=0x43000000scriptaddr=0x43100000pxefile_addr_r=0x43200000ramdisk_addr_r=0x43300000fdtfile=sun4i-a10-cubieboard.dtbconsole=ttyS0,115200mmc_boot=if mmc dev ${devnum}; then setenv devtype mmc; run scan_dev_for_boot; fiusb_init=if ${usb_need_init}; then setenv usb_need_init false; usb start 0; fiusb_boot=run usb_init; if usb dev ${devnum}; then setenv devtype usb; run scan_dev_for_boot; fiscsi_init=if ${scsi_need_init}; then setenv scsi_need_init false; scsi scan; fiscsi_boot=run scsi_init; if scsi dev ${devnum}; then setenv devtype scsi; run scan_dev_for_boot; fiboot_prefixes=/ /boot/boot_scripts=boot.scr.uimg boot.scrboot_targets=mmc0 scsi0 usb0 pxe dhcp bootpart=1boot_extlinux=sysboot ${devtype} ${devnum}:${bootpart} any ${scriptaddr} ${prefix}extlinux/extlinux.confscan_dev_for_extlinux=if test -e ${devtype} ${devnum}:${bootpart} ${prefix}extlinux/extlinux.conf; then echo Found ${prefix}extlinux/extlinux.conf; run boot_extlinux; echo SCRIPT FAILED: continuing...; fiboot_a_script=load ${devtype} ${devnum}:${bootpart} ${scriptaddr} ${prefix}${script}; source ${scriptaddr}scan_dev_for_scripts=for script in ${boot_scripts}; do if test -e ${devtype} ${devnum}:${bootpart} ${prefix}${script}; then echo Found U-Boot script ${prefix}${script}; run boot_a_script; echo SCRIPT FAILED: continuing...; fi; donescan_dev_for_boot=echo Scanning ${devtype} ${devnum}...; for prefix in ${boot_prefixes}; do run scan_dev_for_extlinux; run scan_dev_for_scripts; donebootcmd_mmc0=setenv devnum 0; run mmc_bootbootcmd_scsi0=setenv devnum 0; run scsi_bootbootcmd_usb0=setenv devnum 0; run usb_bootbootcmd_pxe=run usb_init; dhcp; if pxe get; then pxe boot; fibootcmd_dhcp=run usb_init; if dhcp ${scriptaddr} boot.scr.uimg; then source ${scriptaddr}; fibootcmd=setenv usb_need_init; setenv scsi_need_init; for target in ${boot_targets}; do run bootcmd_${target}; done, 0123456789ABCDEFarocsdxbim [0123456789abcdefEPTGMKERROR: %s - start address is not aligned - 0x%08x ERROR: %s - stop address is not aligned - 0x%08x sunxi: failed to initialize emac CPU: Allwinner A10 (SUN4I) (fake run for tracing)machidUsing machid 0x%lx from environment Starting kernel ...%s bootargsFDT creation failed! hanging...Bad Linux ARM zImage magic! Kernel image @ %#08lx [ %#08lx - %#08lx ] /memory## WARNING: fixup memory failed! Resetting CPU ... pc : [<%08lx>] lr : [<%08lx>] sp : %08lx ip : %08lx fp : %08lx r10: %08lx r9 : %08lx r8 : %08lx r7 : %08lx r6 : %08lx r5 : %08lx r4 : %08lx r3 : %08lx r2 : %08lx r1 : %08lx r0 : %08lx Flags: %c%c%c%c IRQs %s FIQs %s Mode %s%s undefined instruction software interrupt prefetch abort data abort not used fast interrupt request USER_26FIQ_26IRQ_26SVC_26UK4_26UK5_26UK6_26UK7_26UK8_26UK9_26UK10_26UK11_26UK12_26UK13_26UK14_26UK15_26USER_32FIQ_32IRQ_32SVC_32UK4_32UK5_32UK6_32ABT_32UK8_32UK9_32HYP_32UND_32UK12_32UK13_32UK14_32SYS_32resetting ... WARNING: Caches not enabled SUNXI SCSI INIT satapwrAHCI PHY power up failed. AHCI PHY calibration failed. preboot%s for %08lx ... %08lx ==> CRC32 for %08lx ... %08lx ==> %08lx crc32syntax error ERROR : memory not allocated %s=%s ** Abort ## Error: "%s" not defined sun4i# *?[\%uERROR: There is a global environment variable with the same name. %s: readonly variable%s=%sHUSH_NO_EVALUnknown command '%s' - try 'help' or use 'run' command IFS \$'";&|#;$&|exit not allowed from main input shell. HUSH_VERSION0.01showvarprint local hushshell variables - print values of all hushshell variables showvar name ... - print value of hushshell variable 'name'thenelifelsefiforwhileuntildonebootdelaybootcmdHit any key to stop autoboot: %2d %2d DRAM: I2C: baudrateNet: SCSI: loadaddrMMC: ## Starting application at 0x%08lX ... ## Application terminated, rc = 0x%lX resetPerform RESET of the CPUstart application at address 'addr'addr [arg ...] - start application at address 'addr' passing 'arg' as argumentsTrying to execute a command out of order ## Checking Image at %08lx ... Legacy image found Bad Magic Number Bad Header Checksum Verifying Checksum ... Bad Data CRC OK Unknown image format! autostartyesAutomatic boot of image at addr 0x%08lX ... Your platform's zImage format isn't supported yet! bootzboot Linux zImage image from memoryiminfoprint header information for application imageaddr [addr ...] - print header information for application image starting at address 'addr' in memory; this includes verification of the image contents (magic number, header and payload checksums)bootdboot default, i.e., run 'bootcmd'bootmboot application image from memoryloadosramdiskcmdlinebdtprepfakeRamdisk image is corrupt or invalid Could not find a valid device tree verify## Booting kernel from Legacy Image at %08lx ... Unsupported Architecture 0x%x Wrong Image Type for %s command Wrong Image Format for %s command ERROR: can't get kernel image! ERROR: unknown image format type! Could not find a valid setup.bin for x86 Could not find kernel entry point! XIP %s ... Loading %s ... Uncompressing %s ... GUNZIP: uncompress, out-of-mem or overwrite error - must RESET board to recover Unimplemented compression type %d WARNING: legacy format multi component image overwritten ERROR: new format image overwritten - must RESET the board to recover initrd_startinitrd_endERROR: booting os '%s' (%d) is not supported subcommand not supported ## Transferring control to RTEMS (at address %08lx) ... confaddr## Transferring control to Plan 9 (at address %08lx) ... nofilesize%lx## Transferring control to NetBSD stage-2 loader (at address %08lx) ... /chosen## ERROR: %s : %s ## Starting vxWorks at 0x%08lx, device tree at 0x%08lx ... ## vxWorks terminated alias for 'help'helpprint command description/usage - print brief description of all commands help command ... - print detailed usage of 'command' %s arm-linux-gnueabihf-gcc ( 4.9.2-10) 4.9.2 GNU ld (GNU Binutils for Debian) 2.25 print monitor, compiler and linker version.callbacks:callbacks,.flags:flags,baudrate:baudrate,bootfile:bootfile,loadaddr:loadaddr,stdin:console,stdout:console,stderr:console,.callbacksethaddr:mo,serial#:so,## Warning: Unknown environment variable type '%c' ## Warning: Unknown environment variable access method '%c' .flags## Error: flags type check failure for "%s" <= "%s" (type: %c) ## Error: Can't delete "%s" ## Error: Can't overwrite "%s" oldval: %s defval: %s ## Error: Can't create "%s" No MMC card found MMC init failed Writing to %sMMC(%d)... Bad magic number Bad header crc Bad data crc Bad image type Empty Script Wrong image format for "source" command ## Executing script at %08lx sourcerun script from memory%-12s= 0x%08lX (not set)arch_numberboot_paramsDRAM bank-> start-> sizeeth%dname = %s eth%iaddr%-12s= %s current eth = %s ipaddrip_addr = %s baudrate = %u bps TLB addrrelocaddrreloc offirq_spsp start FB base bdinfoprint Board Info structureList of available devices: %-8s %08x %c%c%c coninfoprint console devices and information\cecho args to console[args..] - echo args to console; \c suppresses newline## No elf image at address 0x%08lx ## Not a 32-bit elf image at address 0x%08lx ## Starting application at 0x%08lx ... ## Application terminated, rc = 0x%lx tftpAutomatic boot of VxWorks image at address 0x%08lx ... ## Ethernet MAC address not copied to NV RAM bootaddreth(0,0)bootfile%s:%s srv%s:file e=%s serveriph=%s hostnametn=%s ## Not an ELF image, assuming binary ## Using bootline (@ 0x%lx): %s ## Starting vxWorks at 0x%08lx ... bootvxBoot vxWorks from an ELF image [address] - load address of vxWorks ELF image.bootelfBoot from an ELF image in memory[-p|-s] [address] - load ELF image at [address] via program headers (-p) or via section headers (-s)exitexit scriptext4loadload binary file from a Ext4 filesystem [ [addr [filename [bytes [pos]]]]] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from ext4 filesystemext4lslist files in a directory (default /) [directory] - list files from 'dev' on 'interface' in a 'directory'ext4sizedetermine a file's size - Find file 'filename' from 'dev' on 'interface' and determine its size.ext2loadload binary file from a Ext2 filesystem [ [addr [filename [bytes [pos]]]]] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from ext2 filesystem.ext2lsusage: fatinfo [] ** Unable to use %s %d:%d for fatinfo ** ** Unable to use %s %d:%d for fatwrite ** ** Unable to write "%s" from %s %d:%d ** %llu bytes written fatwritewrite file into a dos filesystem - write file 'filename' from the address 'addr' in RAM to 'dev' on 'interface'fatinfoprint information about filesystem [] - print information about filesystem from 'dev' on 'interface'fatls [] [directory] - list files from 'dev' on 'interface' in a 'directory'fatloadload binary file from a dos filesystem [ [ [ [bytes [pos]]]]] - Load binary file 'filename' from 'dev' on 'interface' to address 'addr' from dos filesystem. 'pos' gives the file position to start loading from. If 'pos' is omitted, 0 is used. 'pos' requires 'bytes'. 'bytes' gives the size to load. If 'bytes' is 0 or omitted, the load stops on end of file. If either 'pos' or 'bytes' are not aligned to ARCH_DMA_MINALIGN then a misaligned buffer warning will be printed and performance will suffer for the load.fatsizeThe address of the fdt is invalid (NULL). libfdt fdt_check_header(): %s - too old, fdt %d < %d - too new, fdt %d > %d", "* 0x%p [0x%08x]<0x%08x%s[%02x%sfdtaddr/* NULL pointer error */The address of the fdt is %#08lx New length %d < existing length %d, ignoring. libfdt fdt_open_into(): %s No FDT memory address configured. Please configure the FDT address via "fdt addr
" command. Aborting! moNew length 0x%X < existing length 0x%X, aborting. mklibfdt fdt_path_offset() returned %s libfdt fdt_add_subnode(): %s Sorry, I could not convert "%s" Unexpected character '%c' libfdt fdt_setprop(): %s libfdt node not found 0x%08Xerror: unprintable value 0x%plibfdt fdt_getprop(): %s %s%s { Nested too deep, aborting. %s}; %s%s; %s%s = %s/* NOP */ Unknown tag 0x%08X libfdt fdt_delprop(): %s libfdt fdt_del_node(): %s magic: 0x%x totalsize: 0x%x (%d) off_dt_struct: 0x%x off_dt_strings: 0x%x off_mem_rsvmap: 0x%x version: %d last_comp_version: %d boot_cpuid_phys: 0x%x size_dt_strings: 0x%x size_dt_struct: 0x%x number mem_rsv: 0x%x boorsindex start size ------------------------------------------------ libfdt fdt_get_mem_rsv(): %s %x %08x%08x %08x%08x libfdt fdt_add_mem_rsv(): %s libfdt fdt_del_mem_rsv(): %s boaFailed to update board information in FDT: %s flattened device tree utility commands#size-cells%s: %s: %s fdt_initrd: %s linux,initrd-startWARNING: could not set linux,initrd-start %s. WARNING: could not set linux,initrd-end %s. linux,initrd-endfdt_chosen: %s WARNING: could not set bootargs %s. Unable to update property %s:%s, err=%s %s: num banks %d exceeds hardcoded limit %d. Recompile with higher MEMORY_BANKS_MAX? device_typeWARNING: could not set %s %s. reg/aliasesusbethaddrethernet%deth%daddrlocal-mac-address%s: Bad cell count for %s rangeslinux,phandleCan't set phandle %u: %s okaydisabledfailfail-%dInvalid fdt status: %x edidCan't add property: %s Can't increase blob size: %s Warning: device tree alias '%s' points to invalid node %s. Warning: device tree node '%s' has no address. Warning: U-Boot configured device %s at address %llx, but the device tree has it address %llx. #address-cellsframebuffer@%llxwidthheightstrideformatdefault [ [directory]] - List files in directory 'directory' of partition 'part' on device type 'interface' instance 'dev'.savesave file to a filesystem bytes [pos] - Save binary file 'filename' to partition 'part' on device type 'interface' instance 'dev' from addr 'addr' in memory. 'bytes' gives the size to save in bytes and is mandatory. 'pos' gives the file byte position to start writing to. If 'pos' is 0 or omitted, the file is written from the start.load binary file from a filesystem [ [ [ [bytes [pos]]]]] - Load binary file 'filename' from partition 'part' on device type 'interface' instance 'dev' to address 'addr' in memory. 'bytes' gives the size to load in bytes. If 'bytes' is 0 or omitted, the file is read until the end. 'pos' gives the file byte position to start reading from. If 'pos' is 0 or omitted, the file is read from the start.cmd_gpiogpio: requesting pin %u failed gpio: pin %s (gpio %i) value is %lu query and control gpio pins - input/set/clear/toggle the specified pin gpio status [-a] [ | ] - show [all/claimed] GPIOsValid chip addresses: %02XCurrent bus is %d Invalid bus %d Setting bus to %d Failure changing bus number (%d) Current bus speed=%d Setting bus speed to %d Hz Failure changing bus speed (%d) Bus %d: %sError %s the chip: %d writingreading%08lx: %02lx %04lx %08lx ? %04x: %02xCRC32 for %08lx ... %08lx ==> i2cI2C sub-systemloopmmmwnmprobereadUnknown operator '%s' Invalid data width specifier itestreturn true/false on integer compare[.b, .w, .l, .s] [*]value1 [*]value2-lt-gt-eq==-ne!=<>-ge>=-le<=## Total Size = 0x%08x = %d Bytes ## First Load Addr = 0x%08lX ## Last Load Addr = 0x%08lX ## Total Size = 0x%08lX = %ld Bytes loads_echo## Ready for S-Record download ... ## S-Record download aborted ## Start Addr = 0x%08lX ## Switch baudrate to %d bps and press ENTER ... loady## Ready for binary (ymodem) download to 0x%08lX at %d bps... loadx## Ready for binary (xmodem) download to 0x%08lX at %d bps... ## Ready for binary (kermit) download to 0x%08lX at %d bps... ## Binary (kermit) download aborted ## Switch baudrate to %d bps and press ESC ... load binary file over serial line (ymodem mode)[ off ] [ baud ] - load binary file over serial line with offset 'off' and baudrate 'baud'load binary file over serial line (xmodem mode)loadbload binary file over serial line (kermit mode)loadsload S-Record file over serial line[ off ] - load S-Record file over serial line with offset 'off'double wordbytehalfword%s at 0x%08lx (%#0*lx) != %s at 0x%08lx (%#0*lx) Total of %ld %s(s) were the same Base Address: 0x%08lx Zero length ??? %08x %04xinfinite loop on address range[.b, .w, .l] address number_of_objectsbaseprint or set address offset - print address offset for memory commands base off - set address offset for memory commands to 'off'checksum calculationaddress count [addr] - compute CRC32 checksum [save at addr]cmpmemory compare[.b, .w, .l] addr1 addr2 countmemory copy[.b, .w, .l] source target countmemory write (fill)[.b, .w, .l] address value [count]memory modify (constant address)[.b, .w, .l] addressmemory modify (auto-incrementing address)memory display[.b, .w, .l] address [# of objects]NULL device name! BUG: failure at %s:%d/%s()! /home/jsg/u-boot-2015.01/common/miiphyutil.cBUG!miiphy_register: non unique device name '%s' miiphy_register: cannot allocate memory for '%s' mdio_register: non unique device name '%s' %s: %d - %s <--> %s No such device: %s %s is not a known ethernet MII devices: '%s' Current device: '%s' PHY reset timed out PHY speedPHY AN speed read failed, assuming 10BASE-T PHY duplexPHY AN duplex read failed, assuming half duplex FDXHDX10100fullhalfIEEE 802.3???IEEE 802.9 ISLAN-16TPHY 0x%02X: OUI = 0x%04X, Model = 0x%02X, Rev = 0x%02X, %3dbase%s, %s Error reading from the PHY addr=%02x reg=%02x addr=%02x reg=%02x data=%04X Error writing to the PHY addr=%02x reg=%02x duThe MII dump command only formats the standard MII registers, 0-5. %u. (%04hx) -- %s -- (%04hx:%04x) %u.%2u,%2u = b%u%u speed selection = %s Mbps%2u = %5u duplex = %s%2u-%2u = %5u selector = %s%2u-%2u = %u selector = %s%2u %2u-%2u = %5u %smiiMII utility commandsdevice - list available devices mii device - set current device mii info - display MII PHY info mii read - read MII PHY register mii write - write MII PHY register mii dump - pretty-print (0-5 only) Addr and/or reg may be ranges, e.g. 2-7.next page ableacknowledgeremote fault(reserved)asymmetric pause able100BASE-T4 able100BASE-X full duplex able100BASE-TX able10BASE-T full duplex able10BASE-T ablexxx to doasymmetric pausepause enable100BASE-TX full duplex able10BASE-T full duplex able10BASE-T ableOUI portionmanufacturer part numbermanufacturer rev. number100BASE-X full duplex able100BASE-X half duplex able10 Mbps full duplex able10 Mbps half duplex able100BASE-T2 full duplex able100BASE-T2 half duplex ableextended statusMF preamble suppressionA/N completeA/N ablelink statusjabber detectextended capabilitiesloopbackspeed selectionA/N enablepower-downisolaterestart A/Ncollision test enablePHY control registerPHY status registerPHY ID 1 registerPHY ID 2 registerAutonegotiation advertisement registerAutonegotiation partner abilities registersleepdelay execution for some timeN - delay execution for N seconds (N is _decimal_ !!!)No MMC device available no mmc device at slot %x OKERROR#part_num shouldn't be larger than %d switch to partitions #%d, %s mmc%d is current device mmc%d(part %d) is current device get mmc type error! MMC erase: dev # %d, block # %d, count %d ... Error: card is write protected! %d blocks erased: %s MMC write: dev # %d, block # %d, count %d ... %d blocks written: %s MMC read: dev # %d, block # %d, count %d ... %d blocks read: %s YesNo DDRDevice: %s Manufacturer ID: %x OEM: %x Name: %c%c%c%c%c Tran Speed: %d Rd Block Len: %d %s version %d.%d High Capacity: %s Capacity: Bus Width: %d-bit%s OK, force rescanset dsr %s mmcinfodisplay MMC info- display info of the current MMC devicemmcMMC sub systeminfo - display info of the current MMC device mmc read addr blk# cnt mmc write addr blk# cnt mmc erase blk# cnt mmc rescan mmc part - lists available partition on current mmc device mmc dev [dev] [part] - show or set current mmc device [partition] mmc list - lists available devices mmc setdsr - set DSR register value eraselistsetdsrgatewayipnetmaskrootpathdnsipdomainping failed; host %s is not alive host %s is alive pingsend ICMP ECHO_REQUEST to network hostpingAddressnfsboot image via network using NFS protocol[loadAddress] [[hostIPaddr:]bootfilename]dhcpboot image via network using DHCP/TFTP protocoltftpbootboot image via network using TFTP protocolbootpboot image via network using BOOTP/TFTP protocol%s: %s missing environment variable: %s Expected string literal: %.*s Expected string: %.*s eth01-%02x-%02x-%02x-%02x-%02x-%02xbootfile_path too small. (%zd < %zd) Base path too long (%s%s) Retrieving file: %s Expected include path: %.*s Couldn't retrieve %s Maximum nesting (%d) exceeded Ignoring malformed menu command: %.*s Expected label name: %.*s initrd=Ignoring unknown command: %.*s pxelinux.cfg/path (%s%s) too long, skipping pxelinux.cfg/%spxefile_addr_rpxeuuidConfig file found Config file not found .dtb./localcmdNo kernel given, skipping %s ramdisk_addr_rSkipping %s for failure retrieving initrd kernel_addr_rSkipping %s for failure retrieving kernel ip=%s:%s:%s:%s BOOTIF=bootarg overflow %zd+%zd+%zd+1 > %zd append: %s fdt_addr_rfdtfilesocmalloc fail (FDT filename) %s%s%s%s%s%sSkipping %s for failure retrieving fdt fdt_addrMissing default: %s Invalid pxefile address: %s Error parsing config file -pext2fatanyInvalid filesystem: %s Error reading config file sysbootcommand to get and boot from syslinux files[-p] [addr] [filename] - load and parse syslinux menu file 'filename' from ext2, fat or any filesystem on 'dev' on 'interface' to address 'addr'pxecommands to get and boot from pxe filesget - try to retrieve a pxe file using tftp pxe boot [pxefile_addr_r] - boot from the pxe file at pxefile_addr_r getmenutitlepromptlabelkernellinuxlocalbootinitrdincludedevicetreedevicetreedirfdtdirontimeoutipappenddefault-arm-sunxidefault-armscsiscanning bus for devices... Found %d device(s). scsidevsres Reset SCSI infSCSI dev. %d: no SCSI devices available Device %d: SCSI device %d: unknown device ... is now current device SCSI device %d not available SCSI read: device %d block # %ld, count %ld ... %ld blocks read: %s SCSI write: device %d block # %ld, count %ld ... %ld blocks written: %s scsibootboot from SCSI deviceloadAddr dev:partSCSI sub-systemreset - reset SCSI controller scsi info - show available SCSI devices scsi scan - (re-)scan SCSI bus scsi device [dev] - show or set current device scsi part [dev] - print partition table of one or all SCSI devices scsi read addr blk# cnt - read `cnt' blocks starting at block `blk#' to memory address `addr' scsi write addr blk# cnt - write `cnt' blocks starting at block `blk#' from memory address `addr'invalid op setexprset environment variable as the result of eval expression[.b, .w, .l] name [*]value1 [*]value2 - set environment variable 'name' to the result of the evaluated expression specified by . can be &, |, ^, +, -, *, /, % size argument is only meaningful if value1 and/or value2 are memory addresses (*) setexpr[.b, .w, .l] name [*]value - load a value into a variabletruedo nothing, successfullyfalsedo nothing, unsuccessfullyminimal test like /bin/sh[args..]-o-a-z-n-eSee InterfaceAudioCommunicationHuman InterfacePrinterMass StorageHubCDC DataVendor specificHuman Interface, Subclass: NoneBoot KeyboardMousereservedMass Storage, RBC SFF-8020i (ATAPI)QIC-157 (Tape)UFISFF-8070Transp. SCSICommand/BulkCommand/Bulk/IntBulk only12 Mb/s+-%d %s (%s, %dmA) %s %s %s %s String: "%s"Self Powered Bus Powered Remote Wakeup InOut Configuration: %d - Interfaces: %d %s%s%dmA Interface: %d - Alternate Setting %d, Endpoints: %d - Class - - Endpoint %d %s ControlIsochronousInterrupt MaxPacket %d Interval %dmsusb%d: %s, USB Revision %x.%x - %s %s %s - Class: - Class: (from Interface) %s - PacketSize: %d Configurations: %d - Vendor: 0x%04x Product 0x%04x Version %d.%d USB not stopped: usbkbd still using USB stopserialUSB is stopped. Please issue 'usb start' first. USB device tree: config for device %d *** No device available *** Device %d does not exist. Device is no hub or does not have %d ports. Setting Test_J modeSetting Test_K modeSetting Test_SE0_NAK modeSetting Test_Packet modeSetting Test_Force_Enable modeUnrecognized test mode: %s Available modes: J, K, S[E0_NAK], P[acket], F[orce_Enable] on downstream facing port %d... on upstream facing port... Error during SET_FEATURE. Test mode successfully set. Use 'usb start' to return to normal operation. stor no USB devices available no current device selected USB read: device %d block # %ld, count %ld ... USB write: device %d block # %ld, count %ld ... %ld blocks write: %s USB device %d: (Re)start USB... stopping USB.. 1.5 Mb/s480 Mb/s5 Gb/susbbootboot from USB deviceUSB sub-systemstart - start (scan) USB controller usb reset - reset (rescan) USB controller usb stop [f] - stop USB [f]=force stop usb tree - show USB device tree usb info [dev] - show available USB devices usb test [dev] [port] [mode] - set USB 2.0 test mode (specify port 0 to indicate the device's upstream port) Available modes: J, K, S[E0_NAK], P[acket], F[orce_Enable] usb storage - show details of USB storage devices usb dev [dev] - show or set current USB storage device usb part [dev] - print partition table of one or all USB storage devices usb read addr blk# cnt - read `cnt' blocks starting at block `blk#' to memory address `addr' usb write addr blk# cnt - write `cnt' blocks starting at block `blk#' from memory address `addr'failed to stop USB controller %d unable to get descriptor, error %lX config descriptor too short (expected %i, got %i) %s: failed to get descriptor - too long: %d selecting invalid interface %dERROR, too many USB Devices, max=%d Cannot allocate device context to get SLOT_ID Couldn't reset port %i USB device not accepting new address (error=%lX) unable to get device descriptor (error=%d) USB device descriptor short read (expected %i, got %i) usb_new_device: Cannot read configuration, skipping device %04x:%04x ERROR: NOT USB_CONFIG_DESC %x ERROR: Invalid USB CFG length (%d) ERROR: Invalid USB IF length (%d) USB IF descriptor overflowed buffer! Too many USB interfaces! ERROR: Invalid USB EP length (%d) USB EP descriptor overflowed buffer! Endpoint descriptor out of order! Interface %d has too many endpoints! ERROR: Invalid USB EPC length (%d) USB EPC descriptor overflowed buffer! EPC descriptor out of order! failed to set default configuration len %d, status %lX USB%d: Port not available. lowlevel init failed scanning bus %d for devices... No USB Device found %d USB Device(s) found USB error: all controllers failed lowlevel init cannot reset port %i!? ERROR: USB_MAX_HUB (%d) reached Did not get interrupt on CBI cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X (NOT READY) cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X No storage devices, perhaps not 'usb start'ed..? USB Storage Transport unknown / not yet implemented Sorry, protocol %d not yet supported. error in inquiry Device NOT ready Request Sense returned %02X %02X %02X READ_CAP ERROR scanning usb for storage devices... max USB Storage Device reached: %d stopping %d Storage Device(s) found ## Copying part %d from legacy image at %08lx ... Must specify load address for %s command with compressed image Bad Image Part Invalid image type for imxtract Loading part %d ... Uncompressing part %d ... GUNZIP ERROR - image not loaded fileaddrimxtractextract a part of a multi-imageEnter choice: %s not found usbkbdstdinUSB KBD: Error allocating private data Failed to get keyboard state from device %04x:%04x Saving Environment to %s... ## Error: cannot export environment Environment size: %d/%ld bytes ## Warning: defaulting to text format ## Error: external checksum format must pass size ## Info: input data size = %zu = 0x%zX ## Error: bad CRC, import failed ERROR: Environment import failed: errno = %d at %s:%d/%s() /home/jsg/u-boot-2015.01/common/cmd_nvedit.c## %s: only one of "-b", "-c" or "-t" allowed ## Warning: Input data exceeds %d bytes - truncated ## Resetting to default environment ## Error: illegal character '='in variable name "%s" ## Can't malloc %d bytes ## Error inserting "%s" variable, errno=%d setenvERROR: Cannot export environment: errno = %d at %s:%d/%s() %zXenv_buf [%d bytes] too small for value of "%s" edit: runrun commands in an environment variablevar [...] - run the commands in the environment variable(s) 'var'set environment variables[-f] name value ... - [forcibly] set environment variable 'name' to 'value ...' setenv [-f] name - [forcibly] delete environment variable 'name'printenvprint environment variables[-a] - print [all] values of all environment variables printenv name ... - print value of environment variable 'name'editenvedit environment variablename - edit environment variable 'name'environment handling commandsdeleteeditexportimportprintsaveenvsave environment variables to persistent storage*** Warning - %s, using default environment Using default environment /home/jsg/u-boot-2015.01/common/env_common.c!bad CRCERROR: Cannot import environment: errno = %d at %s:%d/%s() !import failedstdoutstderry Y yes YES In: No input devices available! Out: No output devices available! Err: No error devices available! bootm_lowbootm_sizebootm_mapsize%d Bytes = Unknown OSUnknown ArchitectureUnknown ImageUnknown Compression%sImage Name: %.*s %sImage Type: %s %s %s (%s) %sData Size: %sLoad Address: %08x %sEntry Point: %08x %sContents: %s Image %d: %s Offset = 0x%08lx ## Loading init Ramdisk from Legacy Image at %08lx ... No Linux %s Ramdisk Image Wrong Ramdisk Image Format ## Loading init Ramdisk from multi component Legacy Image at %08lx ... initrd_highramdisk - allocation error Loading Ramdisk to %08lx, end %08lx ... noneuncompressedbzip2bzip2 compressedgzipgzip compressedlzmalzma compressedlzolzo compressedaisimageDavinci AIS imageFilesystem ImagefirmwareFirmwareflat_dtFlat Device TreegpimageTI Keystone SPL ImageKernel Imagekernel_noloadKernel Image (no loading done)kwbimageKirkwood Boot ImageimximageFreescale i.MX Boot ImageInvalid ImagemultiMulti-File ImageomapimageTI OMAP SPL With GP CHpblimageFreescale PBL Boot ImageRAMDisk ImageScriptsocfpgaimageAltera SOCFPGA preloaderstandaloneStandalone ProgramublimageDavinci UBL imagemxsimageFreescale MXS Boot ImageatmelimageATMEL ROM-Boot Imagex86_setupx86 setup.binInvalid OSLinuxnetbsdNetBSDoseEnea OSEplan9Plan 9rtemsRTEMSu-bootU-BootvxworksVxWorksqnxQNXInvalid ARCHalphaAlphaARMIntel x86ia64IA64m68kM68KmicroblazeMicroBlazemipsMIPSmips64MIPS 64 Bitnios2NIOS IIpowerpcPowerPCppcs390IBM S390SuperHsparcSPARCsparc64SPARC 64 BitblackfinBlackfinavr32AVR32nds32NDS32or1kOpenRISC 1000sandboxSandboxarm64AArch64AMD x86_64ERROR: - must RESET the board to recover. reserving fdt memory region: addr=%llx size=%llx image is not a fdtfdt_highFailed using fdt_high value for Device Treedevice tree - allocation error Using Device Tree in place at %p, end %p Loading Device Tree to %p, end %p ... fdt move failed## Flattened Device Tree from Legacy Image at %08lx fdt header checksum invalidfdt checksum invaliduImage is not a fdtuImage is compresseduImage data is not a fdtfdt overwritten## Flattened Device Tree blob at %08lx ERROR: Did not find a cmdline Flattened Device Tree Booting using the fdt blob at %#08lx ## Flattened Device Tree from multi component Image at %08lX Booting using the fdt at 0x%p fdt size != image sizeERROR: /chosen node create failed ERROR: arch-specific fdt fixup failed ERROR: board-specific fdt fixup failed: %s - must RESET the board to recover. nulldev** Too many args (max. %d) ** ## Command too long! %.*s%*s %s - %s Usage: %s - No additional help available. %-*s- %s Unknown command '%s' - try 'help' without arguments for list of all known commands Unknown command '%s' - try 'help' 'bootd' recursion detected Command '%s' failed: Error %d CksumxyzModem - %s mode, %d(SOH)/%d(STX)/%d(CAN) packets, %d retries Unknown errorBlock sequence errorCRC/checksum errorInvalid framingCancelledEnd of fileTimed outSorry, zModem not available yetCan't access file Loading from %s device %d, partition %d: Name: %.32s Type: %.32s ** Read error on %d:%d ** Bad Header Checksum ** ** Unknown image type Partition Map for IDESATAATAPIUSBDOCHOSTUNKNOWN device %d -- Partition Type: %s (%d:%d) Vendor: %s Prod.: %s Rev: %s Model: %s Firm: %s Ser#: %s Vendor: %s Rev: %s Prod: %s device type DOC device type unknown Unhandled device type: %i Type: Removable Hard DiskCD ROMOptical DeviceTape# %02X # Capacity: %ld.%ld MB = %ld.%ld GB (%ld x %ld) Capacity: not available DOSEFI## Unknown partition table ** Bad device specification %s %s ** ** Bad HW partition specification %s %s ** ** Bad device %s %s ** hostfsSandbox hostbootdevice** No device specified ** auto** Bad partition specification %s %s ** ** Bad device size - %s %s ** ** No partition table - %s %s ** Whole Disk** Invalid partition %d ** ** No valid partitions found ** ** Invalid partition type "%.32s" (expect "U-Boot") FAT32FAT Extd Boot** Can't read partition table on %d:%d ** bad MBR sector signature 0x%02x%02x %3d %-10d %-10d %08x-%02x %02x%s%s hd%c%dsd%c%dusbd%c%ddocd%c%dxx%c%dPart Start Sector Num Sectors UUID Type %s: calloc failed! ** Can't write to device %d ** %s: 0x%x != 0x%x GUID Partition Table Entry Array CRC is wrong%s signature is wrong: 0x%llX != 0x%llX GUID Partition Table Header%s CRC is wrong: 0x%x != 0x%x GPT: my_lba incorrect: %llX != %lx GPT: first_usable_lba incorrect: %llX > %lx GPT: last_usable_lba incorrect: %llX > %lx %s: Invalid Argument(s) *** ERROR: Can't read GPT header *** %s: ERROR: Can't allocate 0x%zX bytes for GPT Entries *** ERROR: Can't read GPT Entries *** GPT: Failed to allocate memory for PTE %s: *** ERROR: Invalid GPT *** %s: *** ERROR: Invalid Backup GPT *** %s: *** Using Backup GPT *** Part Start LBA End LBA Name Attributes Type GUID Partition GUID %3d 0x%08llx 0x%08llx "%s" attrs: 0x%016llx type: %s guid: %s Partition overlap Partitions layout exceds disk size %s: failed writing '%s' (%d blks at 0x%lx) MBRPrimary GPT HeaderPrimary GPT EntriesBackup GPT EntriesBackup GPT HeaderInvalid port number %d Error:Too much sg! timeout exit! %s: No memory for ataid[port] ATA No Link on this port! %s: No mem for table! scsi_ahci: Error: buffer too small. controller reset failed (0x%x) scsi_ahci: SCSI READ CAPACITY10 command failure. No ATA info! Please run SCSI commmand INQUIRY firstly! scsi_ahci: SCSI READ CAPACITY16 command failure. No ATA info! Please run SCSI commmand INQUIRY firstly! Unsupport SCSI command 0x%02x Can not start port %d 1.564bit ncq ilck stag pm led clo nz only pmp fbss pio slum part ccc ems sxs apst nvmp boh %s: No memory for probe_ent SATA link %d timeout. Target spinup took %d ms. AHCI %02x%02x.%02x%02x %u slots %u ports %s Gbps 0x%x impl %s mode flags: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s S/N: %s Firmware version: %s Product model number: %s Capablity: %lld sectors id[49]: capabilities = 0x%04x id[53]: field valid = 0x%04x id[63]: mwdma = 0x%04x id[64]: pio = 0x%04x id[75]: queue depth = 0x%04x id[76]: sata capablity = 0x%04x id[78]: sata features supported = 0x%04x id[79]: sata features enable = 0x%04x id[80]: major version = 0x%04x id[81]: minor version = 0x%04x id[82]: command set supported 1 = 0x%04x id[83]: command set supported 2 = 0x%04x id[84]: command set extension = 0x%04x id[85]: command set enable 1 = 0x%04x id[86]: command set enable 2 = 0x%04x id[87]: command set default = 0x%04x id[88]: udma = 0x%04x id[93]: hardware reset result = 0x%04x vgaclrlogofill the boot logo area with blackReserved %dkB of RAM for Framebuffer. HDMI fifo under or overrun HDMI connected. Setting up a %s console. 1024x768allwinner,simple-framebufferallwinner,pipelinede_be0-lcd0-hdmiCannot setup simplefb: Error setting properties Cannot setup simplefb: node not found x8r8g8b8Error, wrong i2c adapter %d max %d possible twsi0Status Error: 0x%08X Timeout waiting card ready MMC Device %d not found MMC: block number 0x%lx exceeds max(0x%lx) mmc fail to send stop cmd Card doesn't support part_switch MMC: SET_DSR failed Man %06x Snr %04x%04x%c%c%c%c%c%c%s is deprecated! use mmc_create() instead. MMC: no card present Card did not respond to voltage select! %s: %dSUNXI SD/MMCWrong mmc number %d mmc_cd Caution! Your devices Erase group is 0x%x The erase range would be change to 0x%lx~0x%lx mmc erase failed mmc write failed HALFFULLENET Speed is %d Mbps - %s duplex connection Received packet is too big (len=%d) emacCannot find console ## Baudrate %d bps not supported ## Baudrate may not be deleted EHCI failed to shut down host controller. out of buffer pointers (%u bytes left) unable to allocate TDs unable to construct SETUP TD unable to construct DATA TD EHCI fail timeout STS_ASS set EHCI timed out on TD - token=%#x EHCI fail timeout STS_ASS reset EHCI failed: timeout when disabling periodic list EHCI failed: timeout when enabling periodic list port(%d) reset error EHCI fail to reset USB EHCI %x.%02x %s: xfers requiring several transactions are not supported. Timeout destroying interrupt endpoint queue Timeout poll on interrupt endpoint PH6PH3ehci_vbus** Unrecognized filesystem type ** ** Unable to read file %s ** ** Unable to write file %s ** ** No boot file defined ** %llu bytes read in %lu ms (%llu bytes written in %lu ms** Can not find directory. ** ** Cannot support non-zero offset ** ** File not found %s ** Extent Error ** SI ext2fs read block (indir 1)malloc failed. ** ** SI ext2fs read block (indir 1):malloc failed. ** ** SI ext2fs read block (indir 1)failed. ** ** DI ext2fs read block (indir 2 1)malloc failed. ** ** DI ext2fs read block (indir 2 1)failed. ** ** DI ext2fs read block (indir 2 2)malloc failed. ** ** DI ext2fs read block (indir 2 2)failed. ** ** TI ext2fs read block (indir 2 1)malloc failed. ** ** TI ext2fs read block (indir 2 1)failed. ** ** TI ext2fs read block (indir 2 2)malloc failed. ** ** TI ext2fs read block (indir 2 2)failed. ** invalid extent block < ? > %10u %s Failed to mount ext2 filesystem... %s read outside partition %lu ** ext2fs_devread() read error ** ** %s read error - block * %s read error - last part error: overflow occurs Error: Invalid FAT entry: 0x%08x FAT: Misaligned buffer address (%p) FAT32 FAT12 FAT16 Invalid FAT entry error: wrinting directory entry Error: reading directory block Error: %llu overflow Error: writing contents Error: flush fat buffer Error: writing directory entry Error: finding empty cluster Error: clearing FAT entries U** Partition %d not valid on device %d ** Error: FAT sector size mismatch (fs=%hu, dev=%lu) %s%c %8u %s%c %d file(s), %d dir(s) Error reading cluster No current device Interface: Unknown Device %d: No valid FAT fs found Filesystem: %s "%s" reading %s Error: non zero offset is currently not suported. writing %s Can't list files without a filesystem! %s/%sCan't load file without a filesystem! invalid distance too far backinvalid distance codeinvalid literal/length codeincorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid literal/lengths setinvalid distances setincorrect data checkincorrect length checkneed dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versioncompatibleFDT_ERR_NOTFOUNDFDT_ERR_EXISTSFDT_ERR_NOSPACEFDT_ERR_BADOFFSETFDT_ERR_BADPATHFDT_ERR_BADSTATEFDT_ERR_TRUNCATEDFDT_ERR_BADMAGICFDT_ERR_BADVERSIONFDT_ERR_BADSTRUCTUREFDT_ERR_BADLAYOUT1.2.3Error: inflateInit2() returned %d Error: inflate() returned %d Error: Bad gzipped data Error: gunzip out of data in header initcall sequence %p failed at call %p (err=%d) ERROR: Failed to allocate 0x%lx bytes below 0x%lx. .%03ldlist passed to list_sort() too long for efficiency ## ERROR: unsupported match method: 0x%02x Env export buffer too small: %zu, but need %zu himport_r: can't insert "%s=%s" into hash table WARNING: '%s' neither in running nor in imported env! WARNING: '%s' not in imported env, deleting it! %s %llu Bytes%s%lu.%ld %ciB%s %0*x %s ### ERROR ### Please RESET the board ### %s:%u: %s: Assertion `%s' failed.%*llu## Warning: gatewayip needed but not set ARP Retry count exceeded; starting again bad length %d < %d Invalid pxeuuid: %s U-boot.armv7*** WARNING: %s is too long (%d - max: %d) - truncated Host NameRoot PathOpt Boot File*** WARNING: using vendor optional boot file *** Unhandled DHCP Option in OFFER/ACK: %d DHCP client bound to address %pI4 (%lu ms) DHCP: INVALID STATE BOOTP broadcast %d Retry time exceeded; starting again ethact%pM%s%daddr%saddr/home/jsg/u-boot-2015.01/net/eth.ceth%dmacskipethmacskip Warning: %s MAC addresses don't match: Address in SROM is %pM Address in environment is %pM Warning: %s using MAC address from net device Error: %s address not set. Warning: %s failed to set MAC address Error: %s address %pM illegal value Board Net Initialization Failed CPU Net Initialization Failed Net Initialization Skipped ethprime [PRIME] Warning: eth device name has a space! ethrotateunknownautoloadNFSnetretryonce ICMP Host Redirect to %pI4 %d.%d.%d.%dnvlan*** ERROR: ping address not given *** ERROR: `serverip' not set *** ERROR: `ipaddr' not set *** ERROR: No ethernet found. *** ERROR: `ethaddr' not set *** ERROR: `eth%daddr' not set Abort Bytes transferred = %ld (%lx hex) *** ERROR: Cannot mount *** ERROR: Cannot umount done *** ERROR: File lookup fail *** ERROR: Symlink fail Retry count exceeded; starting again T /nfsroot/%02X%02X%02X%02X.img*** Warning: no boot file name; using '%s' Using %s device File transfer via NFS from server %pI4; our IP address is %pI4; sending through gateway %pI4 Filename '%s/%s'. Size is 0x%x Bytes = Load address: 0x%lx Loading: *octetblksize%c%d%cFile too largeFile has bad magicblksize TFTP error: First block is not block 1 (%ld) Starting again TFTP error: '%s' (%d) Not retrying... %s; starting again Retry count exceededtftpblocksizetftptimeoutTFTP timeout (%ld ms) too low, set minimum = 1000 ms TFTP %s server %pI4; our IP address is %pI4fromFilename '%s'.Load address: 0x%lx raise: Signal # %d caught ( w /*-+ 1234567890.=1234567890  -=[]\#;'`,./!@#$%^&*()  _+{}|~:"~<>?U-Boot 2015.01 (Jan 24 2015 - 09:46:38) Allwinner TechnologyvSJoSJ8tSJySJ ~SJSJSJ SJ J pJ SJ 7J8Jl9J8J@:Jt9J$J ZJ:JJKJ<J7J J9J9JJ;J8J08Jh8Jp8J8JT:J8J8J8J09J:J:Jd9J9J|9J;J<J<J;J;J<Jx;JJpJ<J;J;J<JP<J=JpJ@<JLJpJJ0<J<J;J;J;J[addr [arg ...]] - boot application image stored in memory passing arguments 'arg ...'; when booting a Linux kernel, 'arg' can be the address of an initrd image When booting a Linux kernel which requires a flat device-tree a third argument is required which is the address of the device-tree blob. To boot that kernel without an initrd image, use a '-' for the second argument. If you do not pass a third a bd_info struct will be passed instead Sub-commands to do part of the bootm sequence. The sub-commands must be issued in the order below (it's ok to not issue all sub-commands): start [addr [arg ...]] loados - load OS image ramdisk - relocate initrd, set env initrd_start/initrd_end fdt - relocate flat device tree cmdline - OS specific command line processing/setup bdt - OS specific bd_t processing prep - OS specific prep before relocation or go go - start OSL`JTJTJWJTJTJWJTJTJJ TJTJWJ@TJTJWJTJTJWJTJTJWJTJTJ/JTJTJ[addr [initrd[:size]] [fdt]] - boot Linux zImage stored in memory The argument 'initrd' is optional and specifies the address of the initrd in memory. The optional argument ':size' allows specifying the size of RAW initrd. When booting a Linux kernel which requires a flat device-tree a third argument is required which is the address of the device-tree blob. To boot that kernel without an initrd image, use a '-' for the second argument. If you do not pass a third a bd_info struct will be passed instead J[addr] - run script starting at addr - A valid image header must be present/addr [-c] [] - Set the [control] fdt location to fdt boardsetup - Do board-specific set up fdt move - Copy the fdt to and make it active fdt resize - Resize fdt to size + padding to 4k addr fdt print [] - Recursive print starting at fdt list [] - Print one level starting at fdt get value - Get and store in fdt get name - Get name of node and store in fdt get addr - Get start address of and store in fdt get size [] - Get size of [] or num nodes and store in fdt set [] - Set [to ] fdt mknode - Create a new node after fdt rm [] - Delete the node or fdt header - Display header info fdt bootcpu - Set boot cpuid fdt memory - Add/Update memory node fdt rsvmem print - Show current mem reserves fdt rsvmem add - Add a mem reserve fdt rsvmem delete - Delete a mem reserves fdt chosen [ ] - Add/update the /chosen branch in the tree / - initrd start/end addr NOTE: Dereference aliases by omiting the leading '/', e.g. fdt print ethernet0. bus [muxtype:muxaddr:muxchannel] - show I2C bus info crc32 chip address[.0, .1, .2] count - compute CRC32 checksum i2c dev [dev] - show or set current I2C bus i2c loop chip address[.0, .1, .2] [# of objects] - looping read of device i2c md chip address[.0, .1, .2] [# of objects] - read from I2C device i2c mm chip address[.0, .1, .2] - write to I2C device (auto-incrementing) i2c mw chip address[.0, .1, .2] value [count] - write to I2C device (fill) i2c nm chip address[.0, .1, .2] - write to I2C device (constant address) i2c probe [address] - test for and show device(s) on the I2C bus i2c read chip address[.0, .1, .2] length memaddress - read to memory i2c write memaddress chip address[.0, .1, .2] length - write memory to i2c i2c reset - re-init the I2C Controller i2c speed [speed] - show or set I2C bus speedJ,JTJTJdQJJTJTJJJTJTJ{JJTJTJsJ܍JTJTJ{JԍJTJTJ{J؊JTJTJ{J̍JTJTJ{JdJTJTJ{J8JTJTJ,hJ@JTJTJ\TJ4JTJTJ~JJTJTJ@'J JTJTJ{J4JTJTJ,hJ4JTJTJJLJTJTJJJTJTJ'JJTJTJJJTJTJJJTJTJJJTJTJJJTJTJJJTJTJ]JoJ.uJaddr part [dest] - extract from legacy image at and copy to default [-f] -a - [forcibly] reset default environment env default [-f] var [...] - [forcibly] reset variable(s) to their default values env delete [-f] var [...] - [forcibly] delete variable(s) env edit name - edit environment variable env export [-t | -b | -c] [-s size] addr [var ...] - export environment env import [-d] [-t [-r] | -b | -c] addr [size] - import environment env print [-a | name ...] - print environment env run var [...] - run commands in an environment variable env save - save environment env set [-f] name [arg ...] .uJ9JTJTJ9Jh4JTJTJ@J\AJTJTJEJ<JTJTJLJ7JTJTJSJT6JTJTJJtJTJTJuJ5JTJTJJ<JTJTJVJJJJJJJJJJJ J JJJJJ$J$J,J,J4J4J<J<JDJDJLJLJTJTJ\J\JdJdJlJlJtJtJ|J|JJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJ J JJJJJ$J$J,J,J4J4J<J<JDJDJLJLJTJTJ\J\JdJdJlJlJtJtJ|J|JJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJ J JJJJJ$J$J,J,J4J4J<J<JDJDJLJLJTJTJ\J\JdJdJlJlJtJtJ|J|JJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJ J J J J J J J J$ J$ J, J, J4 J4 J< J< JD JD JL JL JT JT J\ J\ Jd Jd Jl Jl Jt Jt J| J| J J J J J J J J J J J J J J J J J J J J J J J J JBJ^JeJ(s*K>;( td$   " @   V G Tt l   4 /( | d ,  <$,(\ "LE1T< <|| Mt H><~~<fffffffff{|`8ll8 |<~~<~<~~< 0``0(ll(88||||88<<<fff$lllllll||| 0`Ɔ8ll8vv000` 000000 0 0f<l8l||||`0||0xv`0v~ x|||||8ld`````ff<~~~p0`x |v 08<0`||0`vvffffffv~8ll8|0000`|`bfl0`܆ >`bfl0fΚ?<<<6ll6l6lDDDDDDDDUUUUUUUUwwwwwwww66666666666666666666666666666666666666666666666666666666666666666666666666666667666666666666670??07666666666666666666666666667076666666666666666666666666666666666666666666??66666666666666666666666vvxllllll`00`~pffffff|``v~ffff<~~~~`0``|```0|~~0  0~ 0`0 ~p~vv8ll8 ll<l66666>:%N4 CUpU,,mmUG((GpU,,U,UU,֡,mmp(pU, &vs"N5zN܎~= ,,UU,,,*m,p(pU,,֡,m֕(pU WP>"N5RRzNX ,U,֡,mmGpU,ҕUU,֡,,mUGU,Yv->"N5RR:M$ (U,֡֡,,mUpU֡ДU,U,,,ppU֡ֈw8>iN5500JH< ,U,֡,֡,,,GpU,֡(G,,U֡,,UpGp,,CTH>"5MEuJ{= (+ ,,UU,֡,,Upp,p(GU,,,UUppppUm֕, C6008Enux7? p,,U,U,UppppUmmUGp,,,,,֡,UUUUUUmKU gMbxx#gK+G C,,,,֡UUUUUUmUUUU,,,,,,,,,U,,,,m**UU m~dS66cmk} ɡ,,,U,,,,mmUU,,,,,,,UU,,mmU, Km٧lm*Be, ,,,,,,UU,,mmUUU,,,,,U,,֡,UU(C*mmmmmmBe ,,,U,,,UU,,UUUU,UC(emmm*B ,,,UUUU,UpppppUU,UUUUpppːp, BЃee} ,UUUUppppppppUUU,,UUUUUpUUp peG m,UUUUUppUUpppU,,,,,,,UUUUU˕,,UU ֈ +mUUUUU,,Uːp,,,,,,U ?B +֕,,UUUUU֡,,,,,,U,,,˔ eBkkBkkk U,,UUUmmm֡,,,,Upp, 2kBkп**m4 Uppp˕,m֡,,,,UUU,U˕ ,eeBk* 4+ UUUUUUU2,,UUU CGkB쿣 + ,˕,UUUUUUUmUUU,,UUUU4 壃m +4 UUUUU,UUUU,,,,,,U, peC}Ɉ C,,U,,,UUUUUUU,,,,,, B44+ ,,,,,,,,UU,,,UU,,,,,mC؀2 ֡,,,,UUUU֕,,,,,,,, B +C ,,,UUUUU,UU,,UUUpɀ+ B UːpUUU,,,UUUUGU +Cmk( (UGGpUUUU,,,,,,,Up++ekG 4 GpU,,U,m,,,,Upp } e ؈ ,GGmU,С,,,UUU,,˕ ( + UGU,֕Um,,,,Uː,p 4 ek + GU,Gpm*GGp,UUUUUG CBk 4 ,Gp,֡,U˕m֐GG,,UUUUUp ؕBG C}C ˔pU֡,,֡GU,֡UUUUUCCek?؀4+ U,֡,,,,p,֡,UUUUUUUD>]yeBe4 CpU֡,UUppU,֡UUU,,2]iIBkN! 4ػ,,UUU,,U˕,,UpUmHjIi]/Y}ek~f 4CZF',U,,,,,U,U,*r;V)]I]>if4eB>Zf f[sL,,,,pU,,pU`JHJ)s]IIII:WpBsPy f7>ο,UUU֡U`>---3]IIIIIY (J-Px.WQW1MP-],UUpUUUm,֡UpuP>III]IIIIIiO BJ:Pb#_)3]]sUUUUUU,,,,֡UpphuPIII]II]II]i]% *KPsvHuub3I]]UUUU,,,,,pp_-IIIIIIIIIII]I"Zy ec_)--))vP-II>I\UU,֡,,UppU,`v]IIIIIIIIIIII]܋ 2)-3---j-3]IIIs\,U,֡,,,Uː˕,mAo>IIIIIIIIIIII>N8 UeB)-]]IIIIII>III\V֡UUUUpp,,o3IIIIIIIIIII]]i"b4keekՈ[)]]]]]]]IIIIIIIqmmUUU,Uppp,Av]]IIIIIIIIIII]]^eee #)3I]IIIIIII]]]-\m,U˕UppU,_v3]IIIIIIIIIIIIII>/heek OP>IIIIIIIIIIiiI]-FUppUUpGpu-3IIIII]IIIIIIIII]-eeeeek+ )3IIIIIIIIIII>>^A'UGpUUppU,m9j]]IIIIIIIIIIIIII>0wɔ,֡UGC j-III]]II]]JAU(GpUGpp,9vPP-->>]>]]IIIIPuW yv3II]II>j)ߗmmUG((GpU,,U&E_0Hoo))j--]IIIII-vnw[f y9P]]]]>-)v7mm,(pU,U,އ@nxx9o--333v0dT[f f 4#oP--j)ox,,mm,GpU,ҕUU,֡mm6t6#xbJ)b#T1W+,,,,,,,}ʷuoovoxSm,mUpU֡Д,֡U,֡,hlww@Sn@T1׬UUU,,,m|T@nn6,,,֕GpU,֡(G,,U,,,,,Up,TT1*U,,,,,,,,m*O1.୷ȴ,,,pp,(G˕,U,֡,Uppp,cʳm,UU,,,,,,,,,,p蕕֡U,UppppUmmUpGp,,,,,֡UUUUUUUU,,UU,,Up,mmm,,֡,UUUUUUUmUUUU,,,,,,U,,,,mm,UUUUUU,,,,˕,,,,,,,,U,,,,mmUU,,,,,,,,U,,mmUUpː˕,,֡,,,,,,,,,UU,,mmUUąDe$bDҶs6Tu tڌB{T$e3nȽ쒼{Ĵl^ւL*zZ ̋j<DEۖފMjrbJk4vnbvӒ|~^Tc-;¦֎&\EnL֒cznƆۤVnPe%쐦j¸>T t^&8IƤ 쨼܄܋`*R̸zLDdoJyWJTJsWJ>JyWJTJcJ`JcJdJWJ=JWJ8JJJJJcJtbJcJcJ>VJx@JDVJJ*JtJ2JJЁJdJԁJJKaJ^JSaJTJJJJJdQJJzJJJJJJ|Jp_J|aJaJʹJ\AJմJJȂJ]J05JJJdJdJdJTJfJteJfJfJagJeJleJeJdJDeJdJdJeeJ\eJleJeJeJ,eJeJfJJXJJhJeJhJ iJiJeJiJjJhiJeJleJniJ5lJeJeJfJ)hJ|fJ2hJShJJljJqJ$J/J8=J{TJTJDyJJyJyJC\JNJH\Jh\Jz{JЄJ~{JgJhVJ?JoVJVJaJ(%JjJ`J{JpJ{J|JfJ8JfwJwJ^JJdJ~JJ@JJJ}JJ.J~J}JJ~J~J{JJJÀJegJhJleJ6uJsJxJƂJՂJ JhJJ&J{JJJJUJ|JYJhJJ JJ,J{J̠J/JCJWJJ[JJ{JJfJJJTJ$JKJ*JT6J3JOJȂJJJJNJvJJNJ2\JTJ\TJ(JbTJTJJtJ J1JȂJuJPJuJuJYJ5JaJTJ{JJ,J<JJDJJJJ<JwJJȂJJJJ-JRJtJRJSJU`J JeJfJ%J J+JIJ_J\J_JJSJdJ[JJ{JhJǝJJJJJJJ`JJ\JJJJwJtJJJJNJ!]JTJSJJbJ8J]J$RJaJHJe^JDTJSJ^J(JJ JJXJJ J$J(J,J0J4J8JJJJJJ J J J J J J J$ J J J J J J J J JlJpJJJJJJ J$J(J,J0J4J8J<J@J`JJJJJJ JTJJ@JDJLJPJJJJJJJJJ JJJJJ J$J(J,J0J4J8J<J@JJdJpJJJpJ`JdJhJlJJ J J J J J J|!J"J"J"J"J#J#J#J#J&Jd'Jh'Jl'J4/J8/JJ>J>J>J|?J?J?J?J?J?J?J?J?Jh@Jl@Jp@Jt@JhAJlAJ BJBJBJIJIJIJIJIJIJIJIJIJIJIJIJIJIJIJIJIJIJIJIJIJIJIJIJIJIJIJJJJJ,KJ0KJ4KJKJKJKJKJLJLJLJMJMJMJMJMJMJMJNJNJNJNJOJOJOJQJRJ RJ\RJ`RJdRJhRJRJSJSJSJSJ0TJ|TJTJTJTJTJTJ,UJ0UJUJUJVJVJVJVJVJVJWJWJ WJWJWJWJYJYJYJYJYJYJYJZJ ZJ8ZJ [J$[J,[J0[J\J\J\J\J\J\J\J ]J$]Jd^Jh^Jl^Jp^Jt^Jx^J|^J^J^J^J^J^J^J^J^J^J^J^J^J^J\_J`_Jd_Jh_Jl_J`J`J`JhbJlbJpbJdJdJdJdJdJdJdJdJdJdJdJdJdJdJdJdJdJdJdJdJdJtfJxfJ|gJgJgJ0hJ4hJ8hJJ>J >J>J>J >J$>J(>J4>J8>J<>JD>JP>JT>JX>J`>Jl>Jp>Jt>J|>J>J>J>J>J>J>J>J>J>J>J>J>J>J>J>J>J>J>J>J?J?J?J?J?J$?J0?J4?J8?J@?JL?JP?JT?J\?Jh?Jl?Jp?Jx?J?J?J?J?J?J?J?J?J?J?J?J?J?J?J?J?J?J?J@J@J @J@J@J@J@J @J$@J(@J,@J0@J4@J8@J<@J@@JD@J\@Jusr/mdec/README010064400000000000000000000001431246044122000123300ustar00rootwheelam335x u-boot 2015.01 beagle u-boot 2015.01 panda u-boot 2015.01 sunxi (Cubieboard) u-boot 2015.01 h0-H,I x+H+I x*H*Kh0(H'Kh0%Hy$Kh0"Ho!I x HioQ K!FhLR U0F)hoRT J F 'ς|_L_W_WT_W&~W _3^W_W$_WF &F "pFFF #F1F*F F  Fp*FO0Xh4 K`( (ahH ahH h~X'X*pFF0XhI*F3+'hh:(!.(iHhhI F`. Ѩhh(fO4$ F"p;Yk0W-EFFOYMZ*XWL "phlSKx:)`P "x.+0! " `/0аh! "/(`(h @Lx 0۲ + ١7۲+١W۲+7HO`f\3CcT)h-HZ(K+Jh+K0Fh$K!Fh F0'H1F"FG 5 F#K8FJh K FtF+hH6H%H!8F 8F  HooむHむ₀む?Z[Z@BむnZ(むvJ/&Z pG pG*-M@%8O7.F+F"O[ E T IhXtJ   R E2* ) %+;K\m~`h`h hh[ hh# hh{ hh(N! " hK "!hESBSAe! " h;! "h5#U! " h+! "h%B##D! " h! "hB̿##3! " h ! "hBԿ##"! " h! "hB## # F ***ц.[ -o3#- o3#FF %#.F%.F;F=F>F?#@  (((( HpG ( ( ( HpG HpG HpG HpG HpG HpG HpG HpG HpG`\\L\R\p\x\\\>\(8 FF((B%H %H<,8#H- !H8@-+HHH<, H HHHHHHjHg-P-HHHHx8@FHR>\\\\\\\\\]]]#]\\N]0]=].K8$F F0hB4 , 8-MFF Fi)F$'FJH BF;FBR3('$)O #sEJ"Q"B 3XpER(O 34HЫ ",0H!h .H(  #U6/|" "U"TH!ch;+!J"JR# F1 H[PF8)FRF[FH XF(0F(H)F9+&F9B X )Fe6=`]孂d]X]h]x]MȰq Os$"F(H!FVH]-MFRHJPK@PJPLF1 MHOCLK#F21SIH,(FFH$@',F1Blڔ@H !>H=H !"#!_5H$1S6H(F$.HO&F%1E8ږ*,HRFZF+1+++#H#H#H#H-,1!HC!+1+H.H 674 HM]]]]]I^/&] ^9^G^O^f^n^8]z^^^]]Ig^F!%F1(HٲU F#Hb(F0)F:F3FHX 8F(0F(є1sHG!H<!WFH3! H, 1 !ز H ^^^/&^^ _*-AFFO4KXh"I6 H(! K` K`hh"I(hh"IFH F~Fȹ$hh"IFP.ВIeHQKx+юH$9 ":(F4 ,hh"IFx. FGF(А1+(F4> ,Ѻ "h!FFwH)F(FTFsH1+(F!hh"mIF(@.]!F "hF2FdH !h "9)iBF_H1F5 xS+" J+F+&*K+P+%k+f+j+p+s+ PH%,OH%'MH%" LH%JH%IHW&1FGHFH :h.nF& ##AAA!O8FOdO###05H5Hhh"4IF!hh"0I F(k.F(FF(^z+4'H0FP5!"h%(B H0Q_XǂTǂ3__c_h_o_d____L_`F`Z`n````a9aVaqaac/&az+,hhXIFXVO;h+UH|.#!Fh"!F"Fh!F"F(i9h2FFJH#FB8hS1F"FCFEn8hGFDH/hhDIZF(4=O;h+..!Fh"!F"Fh!F"F(i9h2FF5H#F8h"1F"FCFn8hGF/H/K)F/JBF,$?hh"*I*F(." "h!FVF$H)F(FF H )FH0Fz+KH` LH!h hFz\B\A$ FKXǂaa*b8?bqbSKbbbb0$!DqD*QJ{ {C"+1 )B 0oBg0 Kxr J$!p`K F H!F[ d`fJ@ h`FpG`𵓰 'F$lP.HhO5%#p8F`0bpcd0OC9+F (~9>+ Q.9+Y(F`0n"hDD(0DD!"d#"#0-M%@x8FFFh@d#XFDDDD!" #(=ղ"*F1FFF(#8F1F*F#F(#x8F1F*F#F(O0 #xcxI#ZB\\+#pFRx*3#xBF (+8FO08OEY (9=+5  @B`8O1 opG7hn%GAAA!Or#"F(۴#(FI @CJo@Jgn@fֲ F $2F!+FF(F(HH!FO0xxD$ H"F I8F!2F+Fp$ p9f^ff"#Q&B&qBD&1+ЃnhCC"C!#Or "pp3 HO0f-A} FFF$FO0<*)#p F#F(#x+O38xxC#98FBF#F(!?'*FAٱB"FT x pxp124 }OcJCCX3 pG`むM)h )HB OdJ#OLCFDQs`3D + N(Oc"/`YCc3DZ`HPpLむf`むpOdM!N"F(h8(``+h\CO33QpLむ`む pG-M}F G$FH@#`1"!h PF|0*F0#F$y(āy1#y1w  &$ 9(ڡH C1+|00 + # +@+###h0d#`&PFAA"3FGBډH '2FPF!#Fr(F (ڀHFuf9F~Hpa!F:F pPF!F2FH(vH !U`ax)rH#"x *pHF p!FO;a^F #sCqQDHy(kSDbH/$O:x*yx)J0)r) ;xD1B *SH:BQHkx[E#Кa.NHO s19F  s {SDD" " p#&!2&!*8HFB5H,q4H(0Hq D9FsSDcX{{B"s Zs*&HB$Hs3"H{ 9FpCPDp(Fp-MFFF _$ F!(t# ZzhB Phx-)<ic) b)0s) t)+#O 'F `F>xh!"F, '$2F]F3HF \O0Y!"!BF=6P"9F$Ho#K#H$J$Kh@3$"I!HJ+#O!P"HI KHJKh@3Q !:F ` H)E q˂rUq,Xr/ FFO0 F/xfB;4F=+0F+x+ F=(0F-M%xFFF(FO0,F FTE48F)F( 5F e p]E #<HAF:F Fr0IF J# P@hX1 "(̿ X F ˂7 FF(F"B08 FF(*F!8@ F8*F}XhF hF I HiF"(`hiF?O0 }.Ks 0\pG$  0KDpGx$0 ߿K\pGeXx1( Y(РTXBXAO0 8$P@ " "$ C$P@8F`x!+aH$$H#Ob H I@ K H J Kh{#0C0uv˂q;v,X#Ob#IH]˂$o-MF #FFFF`)FKWFFرhEژE0FD*`  hF+D FQF" K%K D*0#8FD'0˂q!8F F1($؋i#FG(8FKC$P, 8T IQ` JT0`8T I` IT aJT0Za8O081m}R=F F }@pG FJ0KXhCjGɿpG}@LF F }@pG FJ0KXhjGpG(KS jGO0pG@0 lpG(KS jGO0pG@0 YpGF} FFF F } Kh $0+(($K` Fd`KhpG`K"`pG`FFEhB  ,   F F@O0FIFFFjP(FIe(FI`p F,, ""F1FH)F FsvvJ2"  pGT 1IpQ`1IT 0H`0IT `/IT a.JT0Za(F,H$F+H 1FF {)FF v!FF qF& !IkF IeF I_F )Fa !F\~1F W (, IEF0 C0ps Avvh_ K(pFhF0F!RB KhBKhB.` FpO0pl FI`I `I@`!뾤lpNh]h%(t$d$T_ h+DB`B0 h+ ICS` h@ I` ph-JE ]`h`p˂ςt(PML!huhB%*D9P[ Dhh``BY``AKhB|@K@hu`aP DhBh``!!p@h*DhQ/MBka!+a``h``B 08xT <  T0.x T x@@<@TU Tq TA T 1T"L%T"L%{AT8T8T:yiyATvT9TH z$PAT TRTR{pfAT <TpPTpP|AT}T T }&TYAT5T5:Bm!T0T0T00!TcTcTc\ !TwaTwaT"L%}!T|T|TO,!T-T-T-}P!TTT m3 !T[T[T[ y= !TcTcTc/m!T! T! T! Q>!T_eW T_eW Th-{0yR!T; T; T; !Tc Tc Tc 4aT1 " T1 " T6U !Tٹ Tٹ T6{HaT2 T2 T6- )!TzTzT6PaTTT6 >r!TmnTmnT6piaT&T&T6k*!T:~T:~T6.aTTT6!TITIT6[daT;GT;GT6 !TqTqT6aTFTFT6;!TTT6/qaTTT6V!TTT66haTdBTdBT6[!TdBTdBT6ЭaTdBTdBT6 f&ZA!TzTzT6 ̐aT T T6 !TةTةT6 43aT7/T7/T6  !TrnTrnT6 GaT*T*T6  Y!T`T`T6 sDaT_^T_^T6 ~2!T{T{T6 .aTTT6\}%!T3T3T65HaTTT6&'ɴ!TfHe TfHe T6!aT9,!T9,!T6|p!Th."Th."T6Ϛ aTG"TG"T69!T[`#T[`#T6S#(aT$T$T63!Tfs-%Tfs-%TaL&eaTo%To%TaL]'!T)=a&T)=a&TaL-maTٶ'Tٶ'TaLDu!T,(T,(TaLkaTCpU)TCpU)TaL^!T)T)TaL pLaT6]*T6]*TaL˛S!T[+T[+TaLbaTF$W,TF$W,TaLMQ{!T-T-TaLEaT.T.TaL!TK/TK/TaLaTW0TW0TaL7 !T1T1TaL qaTO2TO2TaLP!Tw3Tw3TaL"NNaTQ4TQ4TaLZ.!TO^4TO^4TaL&aTp5Tp5TaL&!Tsu6Tsu6TaL1aT;7T;7TaL&h!T;;8T;;8TaLNaT"8T"8TaL!Tٯ:Tٯ:TaLGKaTj:Tj:TaL<!Tw5Tw5TaL2eaTTTaL!TtkTtkTaL)aTXTXTaLJ!Tk/Tk/TaLqEaTr)Tr)TaL7!TՇTՇTaL^^aTˑTˑTaLEQQ!TFNTFNTaLa[aT[T[TaL!T% T% TaLk aT[( T[( TaL!T T TaLpIaTXTXTaL<*b!TWTWTaLoiaTWTWTaL!TWTWTaLYaTWTWTaLr|!TWTWTaLkfaTbMTbMTaL !T2T2TaL  OaT2T2TaL ;R!T}T}TaL  zaT}T}TaL RL(!T}T}TaL JaT}T}TaL :kY!T}T}TaL BzaTTTTTaL 8&!TTTTTaL q-aTTTTTaL:!TTTTTaL+{VaTTTTTaLו!TCTCTaL:!TCTCTY5 Bu!TCTCTk: +=BuaTCTCTaL!TCTCTaL aTFTFTaLH>ؑ!TFTFTaL~{!TFTFTF?ZP!TFTFTF?aTFTFTaL~oR!TFTFTaLw$MaT6T6T5 !T6T6TaT6T6T\vJ!TQxTQxT̰aTTTd!T5!T5!Ty;>!TcTcTc<zc!TqtTqtTqt=6>!TJTJTJ"u( !T#IT#IT#I"-?!TTT4Ŋ!T%T%Tf !TTT(0 U)!T%iT%iT%i(mqF[!TGTGTG(!TETETE(W )T TŻ"TŻ"G]pT8T 9͈h#(y&.5 42O2:t"(#$ . ..MAKEDEVconsole tty  mem kmem null zero stdinstdoutstderrksymsklogbpf0wd0arwd0awd0brwd0bwd0crwd0cwd0drwd0dwd0erwd0ewd0frwd0fwd0g rwd0g!wd0h"rwd0h#wd0i$rwd0i ... . .. binmdecisbinisharei . ..encrypt ftpgrepJfgrepJegrepJgzipJgunzipgzcatJlessJmoreJ sed@signify . .. u-boots.tgz . ..termcap . ..MAKEDEVconsole tty  mem kmem null zero stdinstdoutstderrksymsklogbpf0wd0arwd0awd0brwd0bwd0crwd0cwd0drwd0dwd0erwd0ewd0frwd0fwd0g rwd0g!wd0h"rwd0h#wd0i$rwd0i%wd0j&rwd0j'wd0k(rwd0k)wd0l*rwd0l+wd0m,rwd0m-wd0n.rwd0n/wd0o0rwd0o1wd0p2rwd0p3wd1a4rwd1a5wd1b6rwd1b7wd1c8rwd1c9wd1d:rwd1d;wd1e<rwd1e=wd1f>rwd1f?wd1g@rwd1gAwd1hBrwd1hCwd1iDrwd1i#!/bin/sh - PATH=/sbin:/usr/sbin:/bin:/usr/bin T=$0 [ "$eo" ] || eo= hex() { case $1 in [0-9]) echo -n $1;; 10) echo -n a;; 11) echo -n b;; 12) echo -n c;; 13) echo -n d;; 14) echo -n e;; 15) echo -n f;; esac } alph2d() { local t="$1" local p="0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ" local sub=${p%${t}*} echo ${#sub} } h2d() { local s="$1" local f=${s%*[0-9a-f]} n=${s#[0-9a-f]*} echo $(($(_h2d $f)*16+ $(_h2d $n) )) } _h2d() { case $1 in [0-9]) echo -n $1;; a) echo -n 10;; b) echo -n 11;; c) echo -n 12;; d) echo -n 13;; e) echo -n 14;; f) echo -n 15;; esac } unt() { arg="$1" tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" while [ "$tmp" != "$arg" ] do arg=$tmp tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" done echo $arg } dodisk() { [ "$DEBUG" ] && set -x n=$(($((${5}*${7:-16}))+${6})) count=0 [ 0$7 -ne 8 ] && l="i j k l m n o p" for d in a b c d e f g h $l do M $1$2$d b $3 $(($n+$count)) 640 operator M r$1$2$d c $4 $(($n+$count)) 640 operator let count=count+1 done } dodisk2() { n=$(($(($5*${7:-16}))+$6)) M $1$2a b $3 $n 640 operator M r$1$2a c $4 $n 640 operator n=$(($n+2)) M $1$2c b $3 $n 640 operator M r$1$2c c $4 $n 640 operator } RMlist[0]="rm -f" mkl() { mklist[${#mklist[*]}]=";mknod -m $1 $2 $3 $4 $5" } M() { RMlist[${#RMlist[*]}]=$1 mkl ${5-666} $1 $2 $3 $4 G=${6:-wheel} [ "$7" ] && { MKlist[${#MKlist[*]}]="&& chown $7:$G $1" } || { case $G in wheel) [ ${#whlist[*]} = 0 ] && whlist[0]="&& chgrp wheel" whlist[${#whlist[*]}]="$1" ;; operator) [ ${#oplist[*]} = 0 ] && oplist[0]="&& chgrp operator" oplist[${#oplist[*]}]="$1" ;; *) MKlist[${#MKlist[*]}]="&& chgrp $G $1"; esac } return 0 } R() { [ "$DEBUG" ] && set -x for i in "$@" do U=`unt $i` [ "$U" ] || U=0 case $i in ramdisk) R std bpf0 wd0 wd1 sd0 tty00 rd0 wsmouse R st0 ttyC0 wskbd0 apm bio diskmap random ;; std) M console c 0 0 600 M tty c 1 0 M mem c 2 0 640 kmem M kmem c 2 1 640 kmem M null c 2 2 M zero c 2 12 M stdin c 7 0 M stdout c 7 1 M stderr c 7 2 M ksyms c 8 0 640 kmem M klog c 6 0 600 ;; vscsi*) M vscsi$U c 100 $U 600 ;; video*) M video$U c 38 $U MKlist[${#MKlist[*]}]=";[ -e video ] || ln -s video$U video" ;; tuner*) M tuner$U c 75 $(($(($U*2))+16)) 644 ;; systrace) M systrace c 50 0 644 ;; uk*) M uk$U c 28 $U 640 operator ;; tun*) M tun$U c 33 $U 600 ;; rmidi*) M rmidi$U c 57 $U 666 ;; *random) n=0 for pre in " " s u a do M ${pre}random c 40 $n 644 n=$(($n+1)) done ;; radio*) M radio$U c 97 $U MKlist[${#MKlist[*]}]=";[ -e radio ] || ln -s radio$U radio" ;; pppx*) M pppx$U c 103 $U 600 ;; pf*) M pf c 46 0 600 ;; pci*) M pci$U c 88 $U 600 MKlist[${#MKlist[*]}]=";[ -h pci ] || ln -sf pci0 pci" ;; hotplug) M hotplug c 37 $U 400 ;; gpio*) M gpio$U c 13 $U 600 ;; fuse) M fuse$U c 77 $U 600 ;; fd) RMlist[${#RMlist[*]}]=";mkdir -p fd;rm -f" n=0 while [ $n -lt 64 ];do M fd/$n c 7 $n;n=$(($n+1));done MKlist[${#MKlist[*]}]=";chmod 555 fd" ;; diskmap) M diskmap c 102 0 640 operator ;; bpf*) M bpf$U c 22 $U 600 ;; bktr*) M bktr$U c 75 $U 644 ;; bio) M bio c 52 0 600 ;; audio*) M sound$U c 36 $U M mixer$U c 36 $(($U+16)) M audio$U c 36 $(($U+128)) M audioctl$U c 36 $(($U+192)) MKlist[${#MKlist[*]}]=";[ -e audio ] || ln -s audio$U audio" MKlist[${#MKlist[*]}]=";[ -e mixer ] || ln -s mixer$U mixer" MKlist[${#MKlist[*]}]=";[ -e sound ] || ln -s sound$U sound" MKlist[${#MKlist[*]}]=";[ -e audioctl ] || ln -s audioctl$U audioctl" ;; apm*) M apm c 34 0 644 M apmctl c 34 8 644 ;; usb*) [ "$i" = "usb" ] && u= || u=$U M usb$u c 64 $U 660 ;; ulpt*) M ulpt$U c 66 $U 660 ;; uhid*) M uhid$U c 65 $U 660 ;; ugen*) n=$(($U*16)) for j in 0{0,1,2,3,4,5,6,7,8,9} 1{0,1,2,3,4,5} do M ugen$U.$j c 70 $(($n+10#$j)) 660 done ;; uall) R ttyU0 ttyU1 ttyU2 ttyU3 ugen0 ugen1 ugen2 ugen3 ugen4 ugen5 R ugen6 ugen7 ulpt0 ulpt1 uhid0 uhid1 uhid2 uhid3 usb0 usb1 R usb2 usb3 usb4 usb5 usb6 usb7 ;; ttyU[0-9a-zA-Z]) U=${i#ttyU*} o=$(alph2d $U) M ttyU$U c 68 $o 660 dialer uucp M cuaU$U c 68 $(($o+128)) 660 dialer uucp ;; wsmux|wsmouse|wskbd) M wsmouse c 63 0 600 M wskbd c 63 1 600 ;; wsmouse[0-9]*) M wsmouse$U c 62 $U 600 ;; wskbd[0-9]*) M wskbd$U c 61 $U 600 ;; wscons) R wsmouse0 wsmouse1 wsmouse2 wsmouse3 wskbd0 wskbd1 wskbd2 R wskbd3 wsmux ttyCcfg ttyC0 ttyC1 ttyC2 ttyC3 ttyC4 ttyC5 R ttyC6 ttyC7 ttyC8 ttyC9 ttyCa ttyCb ;; tty[C-J]*) U=${i##tty[C-J]} case $i in ttyC*) n=C m=0;; ttyD*) n=D m=256;; ttyE*) n=E m=512;; ttyF*) n=F m=768;; ttyG*) n=G m=1024;; ttyH*) n=H m=1280;; ttyI*) n=I m=1536;; ttyJ*) n=J m=1792;; esac case $U in [0-9a-f]) M tty$n$U c 60 $((16#$U+$m)) 600;; cfg) M tty${n}cfg c 60 $((255+$m)) 600;; *) echo bad unit $U for $i; exit 1;; esac ;; pty*) if [ $U -gt 15 ]; then echo bad unit for pty in: $i continue fi set -A letters p q r s t u v w x y z P Q R S T set -A suffixes 0 1 2 3 4 5 6 7 8 9 a b c d e f g h i j k l m n o p q \ r s t u v w x y z A B C D E F G H I J K L M N O P Q R S T U V W X \ Y Z name=${letters[$U]} n=0 while [ $n -lt 62 ] do nam=$name${suffixes[$n]} off=$(($U*62)) M tty$nam c 4 $(($off+$n)) M pty$nam c 5 $(($off+$n)) n=$(($n+1)) done ;; ptm) M ptm c 98 0 666 ;; tty[0-7][0-9a-f]) U=${i#tty*} o=$(h2d $U) M tty$U c 12 $o 660 dialer uucp M cua$U c 12 $(($o+128)) 660 dialer uucp ;; st*) n=$(($U*16)) for pre in " " n e en do M ${pre}st$U b 25 $n 660 operator M ${pre}rst$U c 25 $n 660 operator n=$(($n+1)) done ;; vnd*) dodisk vnd $U 19 19 $U 0 ;; rd*) dodisk2 rd $U 18 18 $U 0 ;; ch*) M ch$U c 27 $U 660 operator ;; cd*) dodisk2 cd $U 26 26 $U 0 ;; local) test -s $T.local && sh $T.local ;; all) R gpio0 gpio1 gpio2 gpio3 gpio4 gpio5 gpio6 gpio7 gpio8 vnd0 R vnd1 vnd2 vnd3 sd0 sd1 sd2 sd3 sd4 sd5 sd6 sd7 sd8 sd9 cd0 R cd1 rd0 tun0 tun1 tun2 tun3 bio bpf0 bpf1 bpf2 bpf3 bpf4 R bpf5 bpf6 bpf7 bpf8 bpf9 pty0 diskmap vscsi0 ch0 fuse pppx R hotplug ptm local wscons pci0 pci1 pci2 pci3 uall rmidi0 R rmidi1 rmidi2 rmidi3 rmidi4 rmidi5 rmidi6 rmidi7 tuner0 R radio0 video0 video1 uk0 random tty00 tty01 tty02 tty03 R tty04 tty05 tty06 tty07 tty08 tty09 tty0a tty0b apm pf R systrace wd0 wd1 wd2 wd3 std st0 st1 fd ;; wd*|sd*) case $i in wd*) dodisk wd $U 16 16 $U 0;; sd*) dodisk sd $U 24 24 $U 0;; esac ;; *) echo $i: unknown device ;; esac done } R "$@" { echo -n ${RMlist[*]} echo -n ${mklist[*]} echo -n ${MKlist[*]} echo -n ${whlist[*]} echo ${oplist[*]} } | if [ "$eo" = "echo" ]; then cat else sh fi  . ..MAKEDEVconsole tty  mem kmem null zero stdinstdoutstderrksymsklogbpf0wd0arwd0awd0brwd0bwd0crwd0cwd0drwd0dwd0erwd0ewd0frwd0fwd0g rwd0g!wd0h"rwd0h#wd0i$rwd0i%wd0j&rwd0j'wd0k(rwd0k)wd0l*rwd0l+wd0m,rwd0m-wd0n.rwd0n/wd0o0rwd0o1wd0p2rwd0p3wd1a4rwd1a5wd1b6rwd1b7wd1c8rwd1c9wd1d:rwd1d;wd1e<rwd1e=wd1f>rwd1f?wd1g@rwd1gAwd1hBrwd1hCwd1iDrwd1iEwd1jFrwd1jGwd1kHrwd1kIwd1lJrwd1lKwd1mLrwd1mMwd1nNrwd1nOwd1oPrwd1oQwd1pRrwd1pSsd0aTrsd0aUsd0bVrsd0bWsd0cXrsd0cYsd0dZrsd0d[sd0e\rsd0e]sd0f^rsd0f_sd0g`rsd0gasd0hbrsd0hcsd0idrsd0iesd0jfrsd0jgsd0khrsd0kisd0ljrsd0lksd0mlrsd0mmsd0nnrsd0nosd0oprsd0oqsd0prrsd0pstty00tcua00urd0avrrd0awrd0cxrrd0cywsmousezwskbd{ st0|rst0}nst0~nrst0est0πerst0ρenst0ςenrst0σttyC0τwskbd0 apmapmctlχ biodiskmaprandomϊsrandomurandomarandom dumb|80-column dumb tty:\ :am:\ :co#80:\ :bl=^G:cr=^M:do=^J:sf=^J: vt100|vt100-am|dec vt100 (w/advanced video):\ :5i:am:bs:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :@8=\EOM:DO=\E[%dB:K1=\EOq:K2=\EOr:K3=\EOs:K4=\EOp:K5=\EOn:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:as=^N:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:do=^J:\ :eA=\E(B\E)0:ho=\E[H:k0=\EOy:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\EOt:k6=\EOu:k7=\EOv:k8=\EOl:k9=\EOw:k;=\EOx:\ :kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:l1=pf1:l2=pf2:l3=pf3:l4=pf4:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[0m:mr=\E[7m:nd=\E[C:pf=\E[4i:po=\E[5i:\ :ps=\E[0i:rc=\E8:rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :..sa=\E[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t\016%e\017%;$<2>:\ :sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: vt220|vt200|dec vt220:\ :5i:am:bs:mi:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :%0=\E[29~:%1=\E[28~:*6=\E[4~:@0=\E[1~:AL=\E[%dL:\ :DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:F1=\E[23~:F2=\E[24~:\ :F3=\E[25~:F4=\E[26~:F7=\E[31~:F8=\E[32~:F9=\E[33~:\ :FA=\E[34~:IC=\E[%d@:LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:\ :SA=\E[?7h:UP=\E[%dA:ae=\E(B:al=\E[L:as=\E(0:bl=^G:\ :cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:\ :cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:\ :eA=\E)0:ec=\E[%dX:ei=\E[4l:ho=\E[H:\ :if=/usr/share/tabset/vt100:im=\E[4h:\ :is=\E[?7h\E[>\E[?1l\E F\E[?4l:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k6=\E[17~:k7=\E[18~:k8=\E[19~:k9=\E[20~:\ :k;=\E[21~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=^H:\ :kd=\E[B:kl=\E[D:kr=\E[C:ku=\E[A:l1=pf1:l2=pf2:l3=pf3:\ :l4=pf4:le=^H:mb=\E[5m:md=\E[1m:me=\E[0m:mr=\E[7m:nd=\E[C:\ :nw=\EE:pf=\E[4i:po=\E[5i:ps=\E[i:r1=\E[?3l:rc=\E8:sc=\E7:\ :se=\E[27m:sf=\ED:so=\E[7m:sr=\EM:st=\EH:ta=^I:\ :u6=\E[%i%d;%dR:u7=\E[6n:u9=\E[c:ue=\E[24m:up=\E[A:\ :us=\E[4m:vb=\E[?5h\E[?5l: usr/mdec004075500000000000000000000000001246133476000114115ustar00rootwheelusr/mdec/am335x004075500000000000000000000000001241413457600124325ustar00rootwheelusr/mdec/am335x/mlo010075500000000000000000002404741246043755000132350ustar00rootwheel@ CHSETTINGS4?/@@/@@/@@/@@/@@/@@/@@/@ﾭ +1) \ //   /@П P-A 0@60@/O-p`$0@E-0O004300CS$@_01``V pp  P bpVpW*0S* Pp^pW*0S*Q0????///@-@/@-@/@-ch-^ \0 //D0@+ 8 /H;0 ,0!3<S<0`0/HMb00<0, " # b /Hv@-@dD0$(@00 S/0S000C S0000/0@п/P/P/@-oS9@@-0s0 S S S 00  00 Ѝ@- 03//S 1S0/S /.S //S /,S/S /S /S/K/2/-//P -Q 2Q Q 8/3/./=/0-P@ Rr0^R8S" S00 <01P V @  P C @  P  @ P@ /@ 18<`$(HLPT d\ X\`d$1     @00!30>S/@-@@/@70@$0-S\  1 ˠ$@1    /@70@ 001     $  (  , //@/01 ! 0 0 R$R/@-,4O0S  0S0  S *  0@Ѝ/@P/ 001 ,  P  ` , //@P/H 0 ( 4@0XRS//@P/ $0$ $ $ @$ D$/D/A-@`pP00@00  0  L0 #s_30S4SAA6/@D P 67007 6/D P(67007(6/D@-  U2 Q2 80@@G80@70@@G70@@-W@-W0* H 4 Rt UH4 RX0T  T H X T004T0,0, l ( p H T @PDD60@D P/0Ps3 8 /Ԡ M Q52:  @- `Y% b60@@-P0 @ 4///@- P %/@M000cS00Ѝ/@-OJO@-OO~@O:0@l90@0@-@MP` $PLHD@>< $P!5P @ 050 0P@0@Dt@nl0ST%d $PxZ  $PLPlNPL`JT r$P D A$Ѝ0;/@L:0@80@d:0@80@D/@90@<80@M/@ :0@T/@90@d80@]/@f/@@-PPP @P` `0@P `@Tp0S ` 0PQ @ Ѝ/@/@U3#0@@-tP LPecPL0@p@-XMP84R4B(, ` $P  $P  #P W #Pk $HPg  #P 'P\0  p #P?00S0  @@'P 4x 'P q;D'P  #P  00'P X 0v'P O-`P @'t'P .'P<<8 XЍpT0@D70@;/@]/@m0@r0@0@0@/@p/@/@-TM P|x j#Pd\ b#PP L [#P8  U#P$TЍ䠆T0@T/@/@]/@8/@D/@0@/@v-TM P rTЍT0@@-XMP  -#PsT  !#P0/0 0(  #P00 0  #@P  "Px0/tt p0l0 hh 000\06XЍT0@T/@0@;0@/@/@/@]/@,;0@H/@`/@/@D/@0@:0@/@/@0/@/@x/@H/@`/@/$02*     /X0@ l0Rd0  2/   2/ 2/ @ B 2/@   P /'V@-|0<0qAP 0@SP$(E_" 0S"}_0@$ @-    @ !;0@0@@-dP @N@-AMM0 0Pp@P U`PT P@"4"  AލЍ0@/@0@p@- @0`, 0Q 0S,Ć0*40 4t PpGW(պ (4SC404t@ Ѝ 0@ M-D`pP @V)  Q*$RjZ` PP: $Q.  *$Q ,$R ,$RT 00Q  a$K$ R\ QBR\ RR$R \\ B$ Br QP~u" uw$R ($RCo$ $PhU )$ ($RC^$ $U0 Pd0$)$R$V `j$ p j$$ uЍ<0@-$$(0 \$$ $ 4 Ѝ 0@0@ 0@P@-@ t@40CS  0)44/P@P0/h/@P0@R; P; E-p0P`S @0P @@T% -0 s R @0 S T ,R:S,S S 0S P T"!* @// R :R@0P0 R 8P@e@ 000L0@P- 0\ X\<0Q P DR10@p@-PPp,`@P fp UpT0@0@p@-PP 4`@P fpAppO0@0@0A-@0Pᨀ`00@S@p ^@Pt =P 7PyP @$010 0Ѝ0@L<0@PY0@`0@/@M-R0@2Q`P@X  0JS|./@./@//@p//@//@X0/@0 e 0p% 0] 0 RZ Sb00S_ppXWppP00 ATSYS00R  0FS00S>ppppg;p 0 0 0\- W  .RR&pW,p0  0W  S 0R XR \  :RRp\ pw0 0v.0p p)X :X # 0 dp 0 @ \@ P@X T P < 0 ,pFЍ/0@T0@l0@0@0@0@0@E-@ԀAMPp @0`S ^@P =P 7P yP T`PP@@fAUᅁ GP00PAߍP<0@T0@)0@B0@B0@Q080/  $ /[0@/8@-PPX @P H@ _0P  PP @80@0@0@@-@_P@ M-MM3 pP G P @ Pd@OP0?Pdh `.0?`0C }. 0 0>0@p' 0 00R0h000 W0 0 0 pGp 0W000  t 0S0d S00000fS 0` `0Ѝd<0@l@0@lh`@-P0p `uPQ$ @0pb@0oSrpW` F$RR0 R0$R00    d<0@A-pQWA>W PpUPP5P @Ho*Q `G0g```F0dS0`@d00d 0    00@@@000eS00PP{@-@P0 P000@-P0S Sa`1US1S10/@- @<6P R( P /0@0@M-M0 ?0d@?0@0 M$ Op`?p04/$P !UQR |k@\1!8/r )0@)0@P/@-@PP0"01 R 4 O?N?0,/@@-@P < 2 !0S41@D4A,/@A-@PL0r@ `Q0!S41D4A,/@@-//000S//@-Q# a/@a/@a/@a/@$a/@$a/@$a/@$a/@'(( @'t0pd 0 # "00Ѝ/000/@-@ M   @P}  Ѝ8@-00P00R@0 (!D0 "00 0 10 P 0(18-4M,0  100000 004Ѝp@- M 0`000@5P8 0 P   , R\  R PPU J@T*,Tڀ Ѝp@,*0@B*0@@-$ M$ 0@000sP Ѝ,!R -$M0 000`$Ѝ/< @-0S Q 0^*0@M-`R0M PP Qm;dPp00W!1[  !́ 01͑Rd     @P@[ !   @ P 49 @ Td0pW*0Ѝw*0@*0@8@-@PP ^0 0 kP Tp88@8@-@P00 0S @/  Q !Q % 5M-YMM D`0@40L H0PPP L045 8L00H0P 0D P0#85 040H058L0PU PT0\X \<@0D HQ\ g/@g/@g/@g/@g/@ɟɟɟAˠɟ ɟSXSf0`  P `UhhPQdPS?"?"( '  "? U 1#0(())**PQ0 84 0 <ÿ$+4"#[ Zx0| 0ASi/@j/@ j/@,j/@j/@j/@$j/@777777 00" 0  LP0009l00S 0 0 84 0 <$+4| x0D R"03#l00 R 0^0(?( (?(0 Pݠ4(00 "+v 0 7065$ `d8h0yPPppd?p30hP6`$ 0$p0,0(0fPP X03?40S Q2/8 % %:Q t%t% $00$0P5Rp p?pX 0Y.700 5|4p0@0@00`5" B<0/P?03? 03?N 000SI0Y.700 4|4p0@0@00`5" B<0P00S$0P0$0-A S $ *P'p?p/PP ĀoP p PPP0S $00 @0$0$00$0U0 p x$00$0反pl?/ 70DP4 5`H`8L0 P0H`40L0P00w$022Br 00PP pW2 !$00SS3,1200VPP 0R P 0R 0R 0R fP$0 11U [`0`,1!PStp<d0h0d1 P0PS00R0! R  0( R  0!((R  0 000CPD 0O 05EP0L SSsW#< 7T0BS*S80pYލЍ/@/@*0@) /@/@@x}/@u*0@ +0@+0@P/8@-0S1 0S. 0S+ 0S( 0S% @PP8| 0000,0000@P000H01@01<0100,0 0 88t@0@hd/@`/@`/@/A- M@P 000S0@00S0003/P~,PPM Pq000_ 10S10 000hP0S1 0xo7p 0p0 WPP))00000 10 0R 1 0DPP_ 0S`V* V (0S?Q0,B0 5%P#u`*$a 8PP (1S  /PP(1SPPUu ,?u0%1 ЍK+0@a+0@0S80@-@$Mm%1SOpP,$1SP0 $XP POP d (1S8 00(0S?005000%1/$Ѝ0/8@- T@PP0@@ RPPU &1S P8t@0@0p@-@0S S,0 0,0 ,0 0,0(10 0,0(10(1 `VP PPP,1808,1,1<S00uPP,QP,1ePp@,10,1pظ+0@7-0@0(P/@-0$Po8@-@PP P8P88p@-P@,10,1, ` `,1fPp,1 fP p@Hp+0@-0@E-p0`@P$1 zeP`E 0!rP01S leP0!((#03SP  0P XXXWVV 0SS"P< 00 08<1V0P01 0\ Q70Q3hPPHU  v  0010 1 010101 0V! 04 0 pP W`1l#`pf 010016W 0jPTTX  5   01 0010U !  0 pP W`1l#` pf  01 001 01001W 0jPlpX    010010U  !+0@ ,0@X-0@8,0@X,0@J-0@,0@8@-@,00,0 P01ePT 001 P01zeP8@1,00,08z,0@,0@l-0@8@-0@000dP0_eP,14,1UP,1 OeP8;(1@14@1,0<,0,1808,1,1<0;0,13P,1.eP<,10,1(1<(1 0418,0@,0@-0@+0@30A-p,P`@P2 W W000C$?0V`00000'0 000( P00X0 P0P00?0o`HH,0@,0@,0@,/@0-1u@-0lPw 0P|-0@0@-<0@0/@-@0/@-@ 0/@-@$0@/@-@(0@/ Pp@-@ P`A mp@i@/@8@-@@PP 8(0@@-A @<@/@l@- @ Dl@-BDID/x@0@"@-0s0@ 00 | 000 00q q Q 00 0/00| 000 00 q Q 0/0s0  Q/@-@0s0pp/$ 0S  0s00/10@0P \ 0@-d^ 4 @P 0@/0/x0 R /R\R`//@-`0@S S SHQQQ0EQQPg0PpEd  \cP*p0S S S"00@@T0! T TP0  0#4 @ 00p\p A00pRp/QM-@MQ0P`1%?! ? ? @M?p?p1T: 0 0 PP Р2!1 P`@cР  p:P1P`@`T 1 p?0?0@0M?? $P Р РK-0@A-P { 00` 0p0 @.00 ip`@0 0S  S00A@- 10SP@@p`P  P@*@ <1 S@@$@ 00010P Sl @`P P 0 8 P0@0x-0@-0@.0@0- ^0 S0 ^ 0 S0 ^ 0SE-Q@@ T(p`."PU *T 00S @D Pt@Q vP B` PE P0@ 0  0S  S00' %0 S2 S?>Q1l hP `T 00S@D `t@@ T @D g Ѝ .0@xH-0x P?0?0@0M?@c?@ P 0`0T n`P6< hP R( bPKxx/0@0@0@|0 0@-|M P @P T L 0@ @00,@L@0P@ |Ѝ0x/0@M-MMPL!l 0P00l0 S`p +w p  0 p  p@+!$' d+v`x@ gV F SpD0p(0 0pDp(p@00Ph 0P/U\UPP zLzPP:S" :00:zgP>00XCz?0/S\S :\:0`0P/$ l R0S(: 0': 0 0l0 0C?o2V  Rb p0,07 PG, Rt*00 0WS40f G W40  R\@Z 0Wh$00 4:4S0W4  (0SC   )S*R 0:S$0pP* :S0W0 S / S t 0{zP zP[ 0t ?$0,0 p0,000l0` S7V 0bh'G`0@S 00 $x0V@( 0c`S030#S :SC T6<:SPp l0`Z S908P?(07h&PF'7Z* 00R 0R0SW  :+SP  0 WX<W[<#PiP U [{$P0 Q00[v !0P$0 0000 00/R\R :SL 0R00G0S<@: 0h(%(00,qW, 0` 0S$  (0pP @?(0 0 `</ <0S t< 0{P @\hPP0jil0 S2 S?>U?:0d:@S :l Q'a70P P@ P 0`@P!R0hP`l0 S2 S>0V*  0@P  T0@ZPP 006 R0ؠͱrh 0 P h@u! @T P  Z00 :  0 0a :h 0:=P`Xl0 S2 S?>VO*ؠpZh0:)0@SPBl0 S2 S?>P9* 0"h* 0yP :h  ? : @T P 0:Ppl0 S2 S?>W*ؠ`*0UP : @P :@@h)S P{ P00 0p>ލЍ0/0@/0@c/0@u/0@/0@ .0@/0@@-@ MD`pS000# 00 0@000 ЍЀ00@-$M? 0 00P$Ѝ-00 `R #$" 4"s0/@p@-@P`00 000000C0pA-@`BpPU Q @P@PQ0  /0Sp@-@`PS:`Q@YQ P0@0p/|P@-@PpT0  `0SkiP0Uc00|M- M D` 0H@p000[0{0Q  PU u 00 U0E P@@0W0C?o20S2 \  L0 ^^FFFS03p3# p^ Wp.p.p~W qS06s00>F315s000-H0=\900%Wp.p.p~WqS06s00>F315s00 0S?  00-0S0 S00000480E0D0/4 $0R0 . R( ,!p//(0-,#!0|>0.0S 0s000000U000 (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx(08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx;//0P10@//@- 900#a40S0sp-0S=@$013$ PbS$0s@0 c$0@0$@00@-@@|P00,00@90E-p@`PH {V<0$,`(P.<0@0 p1S X000 V   @01\00M0XV&^~o0010000 P P0 0@<0@/0@20@/@X/@0PS#Q +30@Q0s0@000/8@-@EP,0(00(0,0 0ss0 E0003/EP8E-09@.@ p0s` 0SO&N40尃S P $ 0帀Rx*0b$X!01 z$0 0$00D00$ 0R 3S EQP0 0P <@-(0L(^ S (0(0CS(0g \E@/8@-(0@, <\(\0s0@@000 0s000ssJ00  !980S a@-0(, -@#T18  <0S Q(0C S0.0S 00s0S(Q0 D . R Qr 0    r  Qr `    E@T oSQ  QP8@-8 R 0 ( R4$r ,9.84\ @@(0===vpS0US 1US  01US H 0`P=0=00S 3/|/@g60@///QP# (0-<<!P- AqQ  r - /0A-TRU(pU0@$`{( `c@V @`#v0@V00$ S0U0= 00!`Q`0]0 0S`QP0p@-@@p( r4 $@ .84\ D\R  r r 1 `      <QE (A00R0Sv gsRw :RN t00CSn8/@D/@/@/@,/@/@=0)=Sb0_#4S S S0 TS S0 MS S0 G000 0@0== 0=5=6 0=`00`0,=0+=( 0=!0@S 0S0@"q@#Q?&>!40S Q000 0s000000000S 0 Q ;0`: R70S  :S .=>/= 800 L J 0S   0C"C"C &./S4 R \0 000 0s00S00*S >S007 0 3/P-0 000== #z 000= `0W Q#e= 0Ѝ20@F60@/@20@"30@E30@g60@e30@|30@M-Q ^A3N NN[LL|~`pW0p W+ pp pWp,"W :WcVabVa bpVpacVa M P Y0"-Q!10S$%*0s0 00  Q00S !*0s000Q0$0%*/0"-Q!10S%$*0s0 00  Q00S! *0s0Q0%0$*/1 @-{@5 00q60@1M-PA``T v` @@ -@A --  r  w0  @1p{pW  [x S@pp`v`pW  Vx T@pPf M-`Mp P@PX >11n?1 1=11= L4Q=0Q1 0S{0  Q'5% S0B0@q 0=0= 0=0!00S 3/PP1S 0 0S 3/1 4 ` q00D` P`44uP 4= 0==03= 4 =0= 4=0= 4=V0=0=6g/s00|#  t S%S0 ?@ 1 -01=0D >PU3 R/@P/@ /@,/@8/@D/@ R R RRRR0 "!0ZF .` R` s0斲!  0PV`- v`V P`1mQ Z"""`xc`~o` ഀᶀ  ~` V*0s0. R0! 1S Q:Q {/!P00S 3/P$U'P  p0B"S 08qXY1PQ01=0CS0=ą]~PPЍ/30@40@U60@A40@30@30@F40@R40@^40@j40@u40@g60@/0@V0@40@B0@8B0@zB0@@0@@0@A0@\B0@VB0@40@@-0S S @ @rA-p@`0 P`VuP 00p50@@-pPc@t@ @@@`Vt@  @p50@M-R(MPq 0 \L0 `00&0S010000 0 ,0 (  0c 00S 0S 000 S 0S0$0oOP@. 0{?@0@0`} Vr q $ 0$ Z' 0p 2 #q  0c 0-"!# $V& . V"~/ & R-@ V" 0~/0p@ 0p(  B%r ! ! -  &0S =@ 0 V%~_0R1! 0 S1!qQ  10|2Sb 0S0 0s0     0s0 0+V#1 0V# 1  0c"0 0 0=" 1  0V#<  #0$  0 .  !  ~?(000C05s000 V#" 0' l032& <0R:0@!0t@0S 0/@QJt0 0V%!0100S&0S04020 0 0S 0S0    (Ѝ50@60@50@60@E-P $@Sp0@& ss` B0R% Wo '   , ,lr  .l %  080 S 3/0% 0S@W1  ( P 03/00 ) P 03/p 0S 0W 00$0 0S0  &0S8/@/@8/@/@0S` 0`00 00i@T @TE`%0S EM-P B{!T 0 @T@D@001q``Spp pP~pT0T0 u 0s0q00T 0p0_-$r eRVS r S' S6, (0 0aV !1{QJ0305~,02,S-(0[%:)0 $ R01ŵ ! ,0(``cV`!V v  /,0`,`=.+R 1S 00 0`0 (0S`0B0 !0p 01 0F0 M60@50@60@50@M-0 {rWP 0 PUPEP1U@0t@\ U`v`V K` BM $@20HH!/0@ @ 00!000 P :( S@ ^ c000sq V`^ 0` ,00ЍMs "P@! @1  t0@00m`Ѝ0M-` pԱ 2{SP PUPEP@Ut@0 0@ r Rb a & R  "/R 0S1nS !S@E@ H 0 0s0M   srM @PPr&t@;@0h#> 000s00E001S S  Pu  @ l $l  !100h(!R B Mx0F0   sr 00M0( B p0lP J,00 S,0 BTs@@T @s|S0#02Sx00q0Zs0 / ] 0!0Ts0L0l00T00 060@60@=!08801<0//8@-Q1!;10S 0@S 3/$0!1060$88t/@@-10S 3/p@-!a0PU88#80w/u000P4@  TA4@S1< UT@@P@T0$0p040$  0000040/PD@0@x 40l0 $ 4 4 H@ ,4 ,  H4  DH4 /PD/JpG$B@BOFB(pB(pAB(ApB(poB(`oB(`AoB(A`oB(`_B(P_B(PA_B(AP_B(POB(@OB(@AOB(A@OB(@?B(0?B(0A?B(A0?B(0/B( /B( A/B(A /B( B(B(AB(AB(B(B(AB(AB(FpG  pG pGO0&)-@@pG@ @F :@CRBcF@CpG@@F :@CRBcF@CpGO DDDDDDDD`DdD DD DDDD0D@D<DDDDDDHDDLDDDD(DD4D@DD,DpDDD D\DhDDDD2D D,DDD DG DGLM DHpDHHH /@8D}/;2SAɳf16$?@@@@;<t ^0@s0@0@0@0@0@0@0@8(H #(-27<FP'@BDHDy/@w/@}/@4x/@x/@D H@H`HHH0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-D/@ /@ؼ/@/@/@/@/@@/@/@/@/@/@,/@,/@x/@/@ؼ/@/@ /@/@/@30@+0@<0@0@30@30@30@!B c0@P`p)Jk1s2R"RBrb9{ZӜb$C4 dtDTjK( ōS6r&0vfVF[z8׼HXhx@a(#8َHi +ZJzjqP 3:*˿yX;l|L\",<` A* hI~n^N>2.Qp:Yxʱ -No0 P%@Fpg`ڳ=^"25BRwbVr˥nO, 4$ftGd$TDۧ_~<&6WfvvF4VLm/ș鉊DXeHx'h8(}\?؛uJTZ7jz *:.lMͪɍ&|ld\EL<, >]|ߛُn6~UNt^.>ERROR: %s - start address is not aligned - 0x%08x ERROR: %s - stop address is not aligned - 0x%08x usbethaddrBypassing DPLL failed 0x%x DPLL locking failed for 0x%x Clock enable failed for 0x%p idlest 0x%x Resetting CPU ... offpc : [<%08lx>] lr : [<%08lx>] sp : %08lx ip : %08lx fp : %08lx r10: %08lx r9 : %08lx r8 : %08lx r7 : %08lx r6 : %08lx r5 : %08lx r4 : %08lx r3 : %08lx r2 : %08lx r1 : %08lx r0 : %08lx Flags: %c%c%c%c IRQs %s FIQs %s Mode %s%s undefined instruction software interrupt prefetch abort data abort not used fast interrupt request USER_26FIQ_26IRQ_26SVC_26UK4_26UK5_26UK6_26UK7_26UK8_26UK9_26UK10_26UK11_26UK12_26UK13_26UK14_26UK15_26USER_32FIQ_32IRQ_32SVC_32UK4_32UK5_32UK6_32ABT_32UK8_32UK9_32HYP_32UND_32UK12_32UK13_32UK14_32SYS_32resetting ... WARNING: Caches not enabled A335BONEA33515BBSKU#02A335X_SKA335BNLTUnknown board, cannot configure pinmux.Could not probe the EEPROM; something fundamentally wrong on the I2C bus. Could not read the EEPROM; something fundamentally wrong on the I2C bus. Incorrect magic number (0x%x) in EEPROM boot_osCould not get board ID. 00A1No AC power, disabling frequency switch tps65217_reg_write failure tps65217_voltage_update failure 1.5ddr_vtt_enboard_nameboard_revSPL: Please implement spl_start_uboot() for your board SPL: Direct Linux boot not active! U-BootSPL: Unsupported Boot Device %d U-Boot SPL 2015.01 (Jan 24 2015 - 09:42:44) spl: ymodem err - %s Loaded %d bytes spl: mmc blk read err - %lu spl: mmc device not found!! spl: mmc init failed: err - %d mmc args blk read error u-boot.imgspl: wrong MMC boot mode %s: fat register err - %d %s: error reading image %s, err - %d spl: error reading image %s, err - %d, falling back to default falcon_image_filespl: falling back to default spl: falcon_image_file not set in environment, falling back to default spl: falcon_args_file not set in environment, falling back to default uImagefalcon_args_filespl_load_image_fat_osspl_register_fat_devicespl_load_image_fatCksumxyzModem - %s mode, %d(SOH)/%d(STX)/%d(CAN) packets, %d retries Unknown errorBlock sequence errorCRC/checksum errorInvalid framingCancelledEnd of fileTimed outSorry, zModem not available yetCan't access file## Warning: Unknown environment variable type '%c' ## Warning: Unknown environment variable access method '%c' .flagsethaddr:ma,## Error: flags type check failure for "%s" <= "%s" (type: %c) ## Error: Can't delete "%s" ## Error: Can't overwrite "%s" oldval: %s defval: %s ## Error: Can't create "%s" .callbacks.callbacks:callbacks,.flags:flags,baudrate:baudrate,bootfile:bootfile,loadaddr:loadaddr,stdin:console,stdout:console,stderr:console,No MMC card found MMC init failed MMC partition switch failed redundant Writing to %sMMC(%d)... done *** Error - No Valid Environment Area found *** Warning - some problems detected reading environment; recovered successfully ## Error: illegal character '='in variable name "%s" ## Can't malloc %d bytes ## Error inserting "%s" variable, errno=%d setenv%lxenv_buf [%d bytes] too small for value of "%s" *** Warning - %s, using default environment Using default environment ERROR: Environment import failed: errno = %d at %s:%d/%s() /home/jsg/u-boot-2015.01/common/env_common.c!bad CRCERROR: Cannot import environment: errno = %d at %s:%d/%s() !import failedERROR: Cannot export environment: errno = %d at %s:%d/%s() y Y yes YES In: No input devices available! Out: No output devices available! Err: No error devices available! bootm_lowbootm_sizebootm_mapsize%d Bytes = Unknown OSUnknown ArchitectureUnknown ImageUnknown Compression%sImage Name: %.*s %sImage Type: %s %s %s (%s) %sData Size: %sLoad Address: %08x %sEntry Point: %08x %sContents: %s Image %d: %s Offset = 0x%08lx CPU-## Loading init Ramdisk from Legacy Image at %08lx ... Bad Magic Number Bad Header Checksum Verifying Checksum ... Bad Data CRC OK No Linux %s Ramdisk Image Wrong Ramdisk Image Format ## Loading init Ramdisk from multi component Legacy Image at %08lx ... initrd_highramdisk - allocation error Loading Ramdisk to %08lx, end %08lx ... noneuncompressedbzip2bzip2 compressedgzipgzip compressedlzmalzma compressedlzolzo compressedaisimageDavinci AIS imagefilesystemFilesystem ImagefirmwareFirmwareflat_dtFlat Device TreegpimageTI Keystone SPL ImagekernelKernel Imagekernel_noloadKernel Image (no loading done)kwbimageKirkwood Boot ImageimximageFreescale i.MX Boot ImageInvalid ImagemultiMulti-File ImageomapimageTI OMAP SPL With GP CHpblimageFreescale PBL Boot ImageramdiskRAMDisk ImagescriptScriptsocfpgaimageAltera SOCFPGA preloaderstandaloneStandalone ProgramublimageDavinci UBL imagemxsimageFreescale MXS Boot ImageatmelimageATMEL ROM-Boot Imagex86_setupx86 setup.binInvalid OSlinuxLinuxnetbsdNetBSDoseEnea OSEplan9Plan 9rtemsRTEMSu-bootvxworksVxWorksInvalid ARCHalphaAlphaarmARMIntel x86ia64IA64m68kM68KmicroblazeMicroBlazemipsMIPSmips64MIPS 64 Bitnios2NIOS IIpowerpcPowerPCppcs390IBM S390shSuperHsparcSPARCsparc64SPARC 64 BitblackfinBlackfinavr32AVR32nds32NDS32or1kOpenRISC 1000sandboxSandboxarm64AArch64AMD x86_64Android's image name: %s Kernel load addr 0x%08x size %u KiB Kernel command line: %s bootargsError: malloc in android_image_get_kernel failed! ANDROID!RAM disk load addr 0x%08x size %u KiB ERROR: - must RESET the board to recover. reserving fdt memory region: addr=%llx size=%llx image is not a fdtfdt_highFailed using fdt_high value for Device Treedevice tree - allocation error Using Device Tree in place at %p, end %p Loading Device Tree to %p, end %p ... fdt move failed## Flattened Device Tree from Legacy Image at %08lx fdt header checksum invalidfdt checksum invaliduImage is not a fdtuImage is compresseduImage data is not a fdtfdt overwritten## Flattened Device Tree blob at %08lx ERROR: Did not find a cmdline Flattened Device Tree Booting using the fdt blob at %#08lx ## Flattened Device Tree from multi component Image at %08lX Booting using the fdt at 0x%p fdt size != image sizeERROR: /chosen node create failed ERROR: arch-specific fdt fixup failed - must RESET the board to recover. serialstdinstdoutstderr%s: Sparse image block size issue [%u] sparse image block size issueFlashing Sparse Image Bogus chunk size for chunk type Raw%s: Request would exceed partition size! Request would exceed partition size!%s: Write failed %lu flash write failureBogus chunk size for chunk type FILLMalloc failed for: CHUNK_TYPE_FILL%s: Write failed, block # %lu Bogus chunk size for chunk type Dont Care%s: Unknown chunk type: %x Unknown chunk type........ wrote %u bytes to '%s' sparse image write failureFAILOKAYmmcERROR: invalid mmc device at %s:%d/%s() /home/jsg/u-boot-2015.01/common/fb_mmc.cinvalid mmc devicegpt%s: updating MBR, Primary and Backup GPT(s) %s: invalid GPT - refusing to write to flash invalid GPT partition%s: writing GPT partitions failed writing GPT partitions failed........ success ERROR: cannot find partition: '%s' at %s:%d/%s() cannot find partitionERROR: too large for partition: '%s' at %s:%d/%s() too large for partitionFlashing Raw Image ERROR: failed writing to device %d at %s:%d/%s() failed writing to device........ wrote %lu bytes to '%s' ** Too many args (max. %d) ** ## Command too long! U-Boot# ## Error: "%s" not defined %.*s%*s %s - %s Usage: %s - No additional help available. %-*s- %s Unknown command '%s' - try 'help' without arguments for list of all known commands ...Unknown command '%s' - try 'help' 'bootd' recursion detected Command '%s' failed: Error %d Loading from %s device %d, partition %d: Name: %.32s Type: %.32s ** Read error on %d:%d ** Bad Header Checksum ** ** Unknown image type , arocsdxbimbootcmd=run findfdt; run mmcboot;setenv mmcdev 1; setenv bootpart 1:2; run mmcboot;run nandboot;bootdelay=1baudrate=115200arch=armcpu=armv7board=am335xboard_name=am335xvendor=tisoc=am33xxset_default_envenv_import Partition Map for IDESATASCSIATAPIUSBDOCHOSTUNKNOWN device %d -- Partition Type: %s (%d:%d) Vendor: %s Prod.: %s Rev: %s Model: %s Firm: %s Ser#: %s Vendor: %s Rev: %s Prod: %s device type DOC device type unknown Unhandled device type: %i Type: Removable Hard DiskCD ROMOptical DeviceTape# %02X # Capacity: %ld.%ld MB = %ld.%ld GB (%ld x %ld) Capacity: not available DOSEFI## Unknown partition table ** Bad device specification %s %s ** ** Bad HW partition specification %s %s ** ** Bad device %s %s ** hostfsSandbox hostbootdevice** No device specified ** auto** Bad partition specification %s %s ** ** Bad device size - %s %s ** ** No partition table - %s %s ** Whole Disk** Invalid partition %d ** ** No valid partitions found ** ** Invalid partition type "%.32s" (expect "U-Boot") usbFAT32FAT Extd Boot** Can't read partition table on %d:%d ** bad MBR sector signature 0x%02x%02x %3d %-10d %-10d %08x-%02x %02x%s%s hd%c%dsd%c%dusbd%c%ddocd%c%dxx%c%d%08x-%02xPart Start Sector Num Sectors UUID Type %s: calloc failed! ** Can't write to device %d ** %s: 0x%x != 0x%x GUID Partition Table Entry Array CRC is wrong%s signature is wrong: 0x%llX != 0x%llX GUID Partition Table Header%s CRC is wrong: 0x%x != 0x%x GPT: my_lba incorrect: %llX != %lx GPT: first_usable_lba incorrect: %llX > %lx GPT: last_usable_lba incorrect: %llX > %lx %s: Invalid Argument(s) *** ERROR: Can't read GPT header *** %s: ERROR: Can't allocate 0x%zX bytes for GPT Entries *** ERROR: Can't read GPT Entries *** GPT: Failed to allocate memory for PTE %s: *** ERROR: Invalid GPT *** %s: *** ERROR: Invalid Backup GPT *** %s: *** Using Backup GPT *** Part Start LBA End LBA Name Attributes Type GUID Partition GUID %3d 0x%08llx 0x%08llx "%s" attrs: 0x%016llx type: %s guid: %s Partition overlap Partitions layout exceds disk size Partition no. %d: invalid guid: %s %s: failed writing '%s' (%d blks at 0x%lx) MBRPrimary GPT HeaderPrimary GPT EntriesBackup GPT EntriesBackup GPT Headeris_gpt_validget_partition_info_efialloc_read_gpt_entriesis_pte_validError, wrong i2c adapter %d max %d possible wrong hwadapnr: %d Error : I2C initializing first phase clock Error : I2C initializing clock Timed out in wait_for_bb: status=%04x Timed out in wait_for_event: status=%04x Check if pads/pull-ups of bus %d are properly configured I2C write: addr len < 0 I2C write: data len < 0 I2C write: NULL pointer passed I2C write: addr len %d not supported I2C write: address 0x%x + 0x%x out of range i2c_write: pads on bus %d probably not configured (status=0x%x) i2c_write: error waiting for addr ACK (status=0x%x) i2c_write: bus not ready for addr Tx (status=0x%x) i2c_write: error waiting for data ACK (status=0x%x) i2c_write: bus not ready for data Tx (i=%d) i2c_write: timed out writig last byte! I2C read: addr len < 0 I2C read: data len < 0 I2C read: NULL pointer passed I2C read: addr len %d not supported I2C read: address out of range i2c_read (addr phase): pads on bus %d probably not configured (status=0x%x) i2c_read: error waiting for addr ACK (status=0x%x) i2c_read (data phase): pads on bus %d probably not configured (status=0x%x) i2c_probe: pads on bus %d probably not configured (status=0x%x) ERROR: Timeout in soft-reset ERROR: failed to setup I2C bus-speed! omap24_2omap24_1omap24_0ERROR : check_gpio: invalid GPIO %d omap3-gpio unknown bank method %s %d /home/jsg/u-boot-2015.01/drivers/gpio/omap_gpio.cStatus Error: 0x%08X Timeout waiting card ready MMC Device %d not found MMC: block number 0x%lx exceeds max(0x%lx) mmc fail to send stop cmd Card doesn't support part_switch MMC: SET_DSR failed Man %06x Snr %04x%04x%c%c%c%c%c%c%d.%d%s is deprecated! use mmc_create() instead. MMC: no card present Card did not respond to voltage select! %s: %d%s: timedout waiting for ics! %s: timedout waiting for sysctl %x to clear %s: timedout waiting on cmd inhibit to clear %s: timedout waiting for STAT (%x) to clear %s : timeout: No status update %s: timedout waiting for status! %s: timedout waiting for cc! %s: timedout waiting for cc2! %s: timedout waiting for softresetall! mmc_cdmmc_wpOMAP SD/MMCmmc_write_dataomap_hsmmc_init_setupmmc_reset_controller_fsmomap_hsmmc_set_iosmmc_read_dataomap_hsmmc_send_cmdmmc_init_streamCannot find console error: overflow occurs Error: Invalid FAT entry: 0x%08x FAT: Misaligned buffer address (%p) FAT32 FAT12 FAT16 Invalid FAT entry error: wrinting directory entry Error: reading directory block Error: %llu overflow Error: writing contents Error: flush fat buffer Error: writing directory entry Error: finding empty cluster Error: clearing FAT entries U** Partition %d not valid on device %d ** Error: FAT sector size mismatch (fs=%hu, dev=%lu) %s%c %8u %s%c %d file(s), %d dir(s) Error reading cluster No current device Interface: Unknown Device %d: No valid FAT fs found Filesystem: %s "%s" reading %s ** Unable to read file %s ** Error: non zero offset is currently not suported. writing %s   himport_r: can't insert "%s=%s" into hash table WARNING: '%s' neither in running nor in imported env! WARNING: '%s' not in imported env, deleting it! %s %llu Bytes%s%lu.%ld %ciB%s%08lx: %0*x %s ### ERROR ### Please RESET the board ### %s:%u: %s: Assertion `%s' failed.%*llu(((((AAAAAABBBBBB0123456789ABCDEF0123456789abcdefep%d%s?%s %d: SetupEnd came in a wrong ep0stage %s %s %d: SETUP packet len %d != 8 ? %s: peripheral reset irq lost! WARNING in %s line %d /home/jsg/u-boot-2015.01/drivers/usb/musb-new/musb_gadget_ep0.cidlein/statusout/statuswaitUTMI-16UTMI-8BUG: failure at %s:%d/%s()! /home/jsg/u-boot-2015.01/drivers/usb/musb-new/musb_core.cBUG!, dyn FIFOs, HB-ISO Rx, HB-ISO Tx, SoftConn%s: kernel must blacklist external hubs %d.%d%smusb_init_controller failed with status %d Failed to enqueue URB to controller MUSB host is not registered bad parameter. Controller uninitialized gadget_start failed with %d bind failed with %d Could not flush host TX%d fifo: csr: %04x %s %d: rx%d, packet/%d ready? %s %d: broken !rx_reinit, ep%d csr %04x %s %d: no URB for end 0 %s %d: bogus ep0 stage %d %s %d: Rx interrupt with no errors or packet! musb_g_ep0_irqallocate_instancemusb-hdrc~~musb_ep_programmusb_rx_reinitmusb_h_ep0_continuemusb_host_rxmusb_h_ep0_irq&D /@270@70@@0@h/@270@ 80@@0@P T 0X \ 00000 0 0` 5 111122|77    $ ( , 0 4 8 < @ H 0L  ` `d   "  $ ( , 0 "4 "8 "< "@ "H 0L 0000 0 0 $X b\ b0000 0 0 $` 5p 0t Ka; Q&PKP2Sa0 Ԫ k&PKPJa; 3&PKPD./@d<0@d<0@l<0@l<0@t<0@t<0@|<0@|<0@<0@<0@<0@<0@<0@<0@<0@<0@<0@<0@<0@<0@<0@<0@<0@<0@<0@<0@<0@<0@<0@<0@<0@<0@<0@<0@<0@<0@<0@<0@<0@<0@=0@=0@ =0@ =0@=0@=0@=0@=0@$=0@$=0@,=0@,=0@4=0@4=0@<=0@<=0@D=0@D=0@L=0@L=0@T=0@T=0@\=0@\=0@d=0@d=0@l=0@l=0@t=0@t=0@|=0@|=0@=0@=0@=0@=0@=0@=0@=0@=0@=0@=0@=0@=0@=0@=0@=0@=0@=0@=0@=0@=0@=0@=0@=0@=0@=0@=0@=0@=0@=0@=0@=0@=0@>0@>0@ >0@ >0@>0@>0@>0@>0@$>0@$>0@,>0@,>0@4>0@4>0@<>0@<>0@D>0@D>0@L>0@L>0@T>0@T>0@\>0@\>0@d>0@d>0@l>0@l>0@t>0@t>0@|>0@|>0@>0@>0@>0@>0@>0@>0@>0@>0@>0@>0@>0@>0@>0@>0@>0@>0@>0@>0@>0@>0@>0@>0@>0@>0@>0@>0@>0@>0@>0@>0@>0@>0@?0@?0@ ?0@ ?0@?0@?0@?0@?0@$?0@$?0@,?0@,?0@4?0@4?0@;0]/@P\/@HZ/@,X/@V/@)0@0]/@P\/@HZ/@,X/@V/@)0@0]/@P\/@HZ/@,X/@)0@usr/mdec/am335x/u-boot.img010075500000000000000000013760641246043753600144400ustar00rootwheel'V_Tx&oU-Boot 2015.01 for am335x board` @ﾭ (OР iHMP  H4P  OР iHM  H4P | OР iHM! H4P l HOР iHMp! H4P \ OР iHM! H4P L OР iHM0" H4P D hOР iHM" H4P $ 11) P [//   /@-PPn|P @LP` `0m|@P `@LTp0S ` 0]|PQ @L Ѝm+nU3un@-~y 0D @-`MPPL @M4 @I E@I`Ѝnnnp@-PBXM0 40S0S #?00?/A-p`_0P0PSE@ @Gdd jK0@e@0 D 8`K0e0T*6O@0?AoYo/@-|0 //D0@+ 8 /H;0 ,0!3<S<0`0/HMb00<0, " # b /Hv@-@d@-/C8@-0H@LP$J%ZT*+@8?00?/@- @L[0 H 00L0/ P 67007 6/D P(67007(6/D@-@@ 0DŽP@ 0ῄЍ@-   L6@G\66@G,6П M Q52:MЉD <ЙؐI @,,, P 52: , 0@g ?, /L@P D Q:4 40QR:/gg@-0 0HL  0 CЍ0s@-P@0L`0HP  hMJX0TTTEJ0S  00D T6/Ѝppp2kpp 0 H AL0  a/@-`LqH R DRP,JO0SADP     p R R 00 100 10 0H L    Q R  a 0 L<  0( 000 ppATg ATATBT@-PP@|` \ PYT@-D0$Q 4I(0 0,00 I(op q0S @-@,P P |I@78q@q0/ 8000/@//@-zbq0@-M@ 00<8 0,0@P040cI($ 0^I0 00WI0  00PIUNnZ z C0c0Vv\AI@0T P @0 14001IЍ0;uqqqr>r(2Nr@-@ !Imr@-@ Ir@-@ Ir@-@ Ir@-@ Ir@-@ H}r@-@ Hzur/@- HP ksM000cS00Ѝ/0/@-OJO@-O@*@ T0?0?O@OO@O@-OO@O/@-EY @Yv5?//@-p @rJL!dd0 @!d0 8!d0 0!d0 (!d0 !d0 1d 0d 0!d0 !d0$ d0( d0, d00 d04 d08 d0< d0@ d0D d0H d0L d0P d0T d0X d0\ d0` d0d x d0h p d0l $8`87@7t7 ?@\=P`  $`TU40?(= 0X00`pvvvvvvj@-0@PtT`k?P0%T00S Ip?PP ?P@=P:@D0P? `?U @HPjvw// 00a40/ //,0>0,0/) ,  a, ,0#88,0, //4,  a, ,0>0,0, < /<048<0/0.@ /<00C<0< D /X0S X003?:00`0`<  a< < `\ /<00C<0<00<0< 8 <00C<0// + /@-zk@- ,0 45@0D\ @-R \X` \ X @->w@- >Wkw@->n >)wU@-  @=1w+c@-@-Q< P B< < P ///0@-@L e >2@-(/@-!( N(0 @(4(( , @-  P87// 00b 0/j///@-@-->:w@-0o@-@-@-=@ <UBw@- >vKw@-0H L Hb,@-?@-@-0<00Q/@-@- 70/Rp@-@@P %`0=E @@=pSw{wE-BXMp`P@) 0:PP#PQ Q E0P | \ Pd= 70(0 000 0Ѝ0=j?x@-@ ;@|Nv8@-@x=ODPP P (a= 0RBPV=CQ=BP| xJ=pG=7KP` KJPH@8=PP8ixx'Vxxxxxxy)yAyR@-H0@p@`P PoP`UUs@-PX`f;P@@P404`@ = 0:ЍpXybyUfyE-PB@M` 0@0p00^U000  1 x.P0  cD P :0 0< 0005ЍjU@-M@p`00P0 00CPX 0 00@00 FPP $< Ѝjl{{@-@)M-@Mpd@`P 0$00 hiY/X ?;B#B ?7001 W8< 8<C`GCh到儰.CP5 PJ PSL< 8弰R 8<#APd.<cB[ @$<AP,+< <Q  <{d000 0< 0080 KP<0LTP080H0< 0HDP 0 l;oQ0(SP BP PH P0w000000 03/@00003?000AL TFP ;nL TFP ;pL TFP ;qL TFP`?L T03?00FP 4;r000000:DJD0%SS <0 C00? D0S03?0P0S L @FP| Pl`;3 5R|  +0S@00 03?0S%0@@ 0 D0PSS 0<;C  ,$0A00Q0S 0SS00$ _Ppw |0儰`(00,000080/A0S :S G V;: 8 8@ : 80aP :8 @0l$ #0040:8 00"P<  <:`/ 0 :0 fO),0 V(0#03R V0 ``RSp`:D0S "0S: :sXH `>v8 000 asBPm8747  `İ iC  CPZ 00P00S1@8 > D  +0k`X vv  $ 0n/@ 0;/`P 0C:$p. aX X@ >:z 0;/`P   0;/`P X`@Ѝj{{'Vxxxxx{.|W|z|}|||||=}g}}hkj |}}}}8~}~~~!.g9A-`B@pPU U@P@ P D R @-@,9?4/// P$DP# @-@`P8P  Up 0H8P M@094///pp@-`HP@7P 4cP$603/pXy PE-7DP3 @"0`S 0  >0S XpPPYUpR; 0peD7@pPp@4^9  04/ Ѝp2@-@`0PQ 0$ %B CBP( vpP7PP `0x00h % PP L$9 | ,9 9ЍpPpOYWj PD R @-///@-@p`P0 00 P`9T:q`P 00`pqP 8/`P 9R; P; E-p0P`S @ 0P @@T% N0 s R @0 S T ,R:S,S S 0S P 1T"!* @//" R :R@0P0 R 8DP@e @ n00l00/E-PP`P@pP@fA P PUᅁPff8@-P(@(( 0-8WV`Qׁ@-(M 0 @p 00 0(0 0S T P P  0 (Ѝ`QA-@㤀M`P @0pS x6@P` -P 'P P P00܍4@Hl\ׁP- 0\ X\<0Q P DR]0 0/8@-P(@((> 8ZY`Qgp@-PHPp,`7@P fp U7plsp@-P4P 4`#@P fpA7pplp@-(M 0 @ 00 0(0 0S T0 P P`01 (Ѝp`QB0A-@0Pᨀ`00@S@p O5@Pt vP pPP @$010 0ЍNY8@Ll䂄gBM-R0@2Q`P@X  0JS|l\\\4]]^0 $ 0p% 0 0 RZ Sb00S_ppXWppP00 ATSYS00R  0FS00S>ppppg;p 0  0\- W  .RR&pW,p0  0W  S 0R XR \  :RRp\ pw0 0K6.0p p)X :X # 0 96p 0 @ \@5 P@X )6 P < 0 ,p6Ѝ2l낄+hHQ080/  $ /^/8@-PPX xm@P H5@ _0P WiPP @58蝃@-@_P@DiE-MLMhpPAGP?P%5@P/0  r  $`  `FoobP0V 5h`f i00C b 0Q_ WQp!   06 ` h0R0 ќ  Q [R)l lʟP0`p0 # ]R R  Rp!   D  0`0HW 0]QdĹ`  0 040X`10 0` 宼PL49` L9>P?N@ CgSX00`7X0sS `卼0P+PnU sUXPP9 0 0P`0& Ժ nRp0  0pP R R PUnR 㴻 A 屺 0P0sS -'0 "`Vp a-a0vS#P V | 00V00S @ 0 @@T  ;- eaS   sSq  `)-lPCPlS ``XĦ X PP pPU @6 0Ȼ `V@  d/T/ F8 ѹ0@SYx(y\yy z z z zq U0 %P e0%\ /PU?ڨ/0pEWP7!e/WP0  凹p1恺0 3P 9,.U ek/U ed/ S_/ eZ/Uup PbP B/X `P\z`PD0hSA0,cP1$/05_1 /01/0 1/01/ /01/U01.U 0 1.U0|$1.d.`.X `P +00 PP s  m 0o} `PL00pS!Pڹp..Ui 0ⶹPm`d.\$0TP 0 000.aS 4 . 0`P:I dS `P+:s.* :P`H`XP   P  $`P`PЍXlĐ搄1ב\l]Zt2F@˒Ӓ℀ڑ%@\kƓԓ듄0huG-KNiԔ󔄀?J?M-p` $P@PU  0M褻 0ϹP@-p`PIp@ @T᜼ 0 -ZEQM-(M@d`!PpP@[@߸ T 0 弸! S RD@0h 0@Pa0 Ⴜ8P $ 0 <@P  0 1@P@l6? $0P 0!@T/0h-6o `(ЍPQatЕs@-PA@Pth d@P\+`P+< 0@P8-ЍpᕄPp񕄀7@-P@#P  0 Ѝ0@- Ѝ0SM-` M hh0-SPp@Pͻ8 4F(!@PA00 !1婺P , 2׻ ! 0 QZ1>P>1  cD v@P, , Ѝ?YIF݄@- a 0 ЍM-8M,pῸPE*P( *P; ()`(PF*@P2    0〸PP T  pT @0S@PU00 X 0P:0P0 8 02 ((`Z8ЍĖoo͖薄▄ؖA-PPM+ q@`pT 0N SR׹@ U@ 02A- 3? 0 >0@d4?00@0坹PЍ@-ԗ Ѝ@- Ѝ@-哘 Ѝ@-h Ѝ@-pTMP `@MZPA0o       ,000D+000 P05ZP  +TЍ苜).RRE-M@`pP P@V @P P `~PHU 0SPQPU 0X 000Y 0S`- P@ @UVU@ ]P @T  0 x 0T 0o@000PUD 0iS cS` <sS tS` 6`` 0XP A* X@p@ J+V &Y PY@ V V@ GYOoB +YH 00+w XЍ/ᕜ맄RA-P`@B 8p6?P  0A//(J@- Z@Z0ZR@-` `hP*V@ppT00St]ZP,*P@T *o莝R@-Z* d d00b` C1P@:H*8*Y@P  *誝fg.͝R@-eZ@H* @,*=Z@P *4R@-@pP@gDAPU! YP0( u*xs* @gDAP`:De*hY0 ( ]*[*gf.Uhu0 .R0@/R 0S/RE- P ` p |@ P ЍE{> `dmwpPQ0  @@Y P ((*   Ѝ`wRA- % @G ppB`PP 8 3 0fY P )Ѝ`R2E-MP @ pqP`  P1#UO  @ w01Y P $$)fЍ/`A-BQ3P @ p`6Pp  U@ @00aS0 00PY P i) 'Ѝ`wRnM-p1!M⬁`P@ ` 0b? @ pPP`H47) @ 0X P ,) T1! T!)9=P[pP ^T  T0p3?00pW  @ 0X P Pd([PW0P 0`Ѝ/hp`p\p`U4҆w~|M-R(MaP@ Zp`  p PhP@[  `V ppp 0+X P (# ( R (  WP(0S 0 A^R|x(t(00 (`gV0 0P0@0(ЍdplpppK`넀&4KrRM-< P p@Pp  P D` A( 0dS0 00W @PP `Z , (((#( Ѝ謞`7r/@-@ *R ]T T T MA00*S B$S/0{S 0 }P P/004&/M-Paph[ 00U  @PMWI0UpP W@ꔘĘOoB7@@4O2PP!@O+` W" (8HX@`OoB@V@V@@V@@ V@@ V@@@|'ЍER @-@= 0R𙀀 0 wK'o/0 0 0 /ppp,0 (0 $0 0 0 0 /pppppp,0 (0 $0 0 0 0 /pppppp@-Y'P @C'p@-AM` >PP@  m? P @PN@2@H& ?8@t &H$Aލp)𚀀00S 0/pp 0 R0S?/p8@-808P@T@D&@P &8pppM-`2MP@F p&Qp   & R[ RX  R R  d L!Q?Z&P E 0g S @ 0=P9@P)ꔝННН0 p0T0C@!UP1``d$ 0`d^&T# 0S`dMQ.^&2ލK8ӟ8@-P@$P 01S0 0U0@ @l+&md@Pa&P L&@Tu0&8 &0P88KCgUM-M,@PU$Pや  K0T0 BT ;P 0Z %P jP & P|@Pl % T@PD %s $P%&vf#&6F &0P%P%PV`0@E0 p`5% %P PP'%`t %q pp PGuP UVA%e v`pp `F pv``Fv5%Y p`%p `Fv`R p_0p @p&%p H W30?0 0RpA%0p; D[p`F4 R ` 0@R0  ?R@3/h4 VL$ R  003/S[,4(0 R $%0%U% W3pp?p pPK%p P `0`0#00 00N0070`00 ;0 PPdS[{0 008#0# 03 4#<3 R0C  # 0cS`MS~  `H S!  `C "S` Br  8 " `@Q  ?Q@ tS` @  ( l"S` B -   D"S `$"#  SN C  ` R10 0 ` R ` `"0 0 00~0000p0 00 00Y00 p0`0 0p0~0`0#0`0 00Y000`00 B[,1 0PPed@$P $(@T _$!xP@V$@Q$0Z J$P   xhP k$PЍBwՠ۠ _,pppܛppppppptppppUáBQ'A-P`.:pP! \x0 @@UV  M0P:W W㰀0/pR4p@-P:`P/ . @)P V0V00V 00S: V 00S: 0S 0/pM-Rp̠@` p(Pp9@P x [``  0  0``0@ЍpKppR@-(@  n#pVR2@-Pz9pP- @ ``@ @ PP@`dh=#W00 W0000u0@SOPEu0/pmRTM- M`>9@PMT4Q T,Q (1T$QP q` Yp p S g` X0" T  T  \ 0j @p P0pp"@ x0`SO@8  "/ Ѝ~pʣR@- 0L  ЍLtRM-I(`$p@P 8PP; 0@@"U U"6P P`0-S  00S U UW@S@PW 0eW 0@Ѝppp죄򣄀҆p@-`PDY" <0@PT P @ppMp0 000 /pp@-$@P  j@@P 8@-P,0S 00S @0P L" D @ 8 @P@8/88pp|0A-@PT h"4`pW 0D ! Q 0!(!` V@p;Chu@-@P 0 !pMp@-P@@`P PpPpp0/px0A-pP`U 4@0S P kP@@ TP !pa 0P/pp@-@`P0Pp, 0P $0/S   ,  0*Ph 0   0P < 0     Ѝ0*ৄC5N7@-P@ p00 -R0  Ѝ0s@-`@ P0S -Q 0S  00S ЍpRM-P6`XM@ 0H I060B060C060D060E06040H0*PI@͕00ӅI0ͅV BC V DE V  xH0iSp9V$$fB@PCP@T.G00L F0P"GLFP000 0 0 0,P l@t@@2rSBP@3C0S+:D`E0V X0  c HP  @B C0RD E0R  `v`BC Q D R PuPwSBP@C0S:D`E0S: 4%P < @`v`PuPH `PD0SE0SB@00C0 S:DPE0S 0L0  0P p  @o00PuP0S D0,0,0S 0XX000PS10 3  0 PU4 (0U30064020800080 0Rm*0   2 `<00$0q 0-0S<Q=@S\2 X ST"004 D 00>Q-( $ŸR 2  0 40SQ 00S! S!  0SQ00S! S!   Qx$0lS 00Xg0sBH  @PVM\0H I  B D0 C <0 D 40 E ,0 $$0 XЍ/qqqqqprv%>huDqtFdB⩄㄀z}$@_mӄRM-B`M@0P`P4 0( D$ , <$ 8 4$ < ,$ 0 $$ 4 $尠0 04`p9P00xSPP 40p(0,00S ( wVR $0rVS00)PPrV wV0[M  Hsp[@ !.K 0P b@ 0 `0 @8 K< 0P  0<08004 xP[0KKS[pP 4P40p,0(0(, \PlV~,0rV(@ 0800<00% wVZ000400 0TS0X0[0 S00( 0;?o2n 00h?cPA  00`?o2P  00S0C  0S005  0S00'  0S00  0S00 0^0R R Rp' W?o2U000 USX00PPp`j AVB0oЍDP P :P Pd/ P : P P D/@/</8/4/0/,/(/$/վǾ径2P8@-@P P P9 T T0}U *8@vU #@DoT݀݀݀݀݀ހ |xXtVUl h5:PU` H8@HG곾8>3GVej|Mbÿ]8@-P@P80S8@ T8M-@P~p` 0S0P$Q 0 S/ \!0C\\ 08Z0  C (X 000`|    H`!00CS !10 ᴿP ` 0 ᩿P᥿Pl9S` 9VP `Ѝ虪տ(1ٿ<Ϳݿ7鄀Q/@-M?@00pP0`0` S< (y&=P>0%=0qEɄqp@-&M0P ,`@` 000pqq/M-Mg@?@PP lU@0`1 |0 h 0 00P$yJP>0W101 & $ AP 71S|00 S0 S @S0 00h0d0`v```0`` ` 0PT pK p 0P Ppl  ⳺  PB? 1 `Q! R㘺a `p"Qlsvdp 0PI0<3@m R Q6 0QN Q 0pE? 0R R)QG0 S aVڰ0 1F?00 M0    v0#&! &!R 80>00-0 $ "$ RQ00Z0 n@1T '` 1V `1dh !0000 0 @P+(p l@p@H`Ϲ ˹ ǹQ  0.Q  0'Q  0 P`)sPߍjɄɄɄɄʄTʄʄʄd˄˄˄ʄ˄'˄A˄˄˄̄<̄s@- 0@P` @&-ㄹ00&M TG s@p P`:$P V pf000\TLH0S4Ѝpqqt̄ġ~̄̄̄̄̄̄/@-r qh0 1  #0d   \Ѝp@-@ `P9T@ p@跹@-h0q10 0 d  8Ѝ@-r qh0 1  #0d   %Ѝ@-)h0r 10  0d   Ѝ/0 /ȡE-M?@P?@`p i P 가\pW 㰀Ѝ@-MGp`?pP@ P90 0  ?01S ) 3 P]'H D , R   R   R  Q ( $I irP [0(9 fЍ'̈́"M-.M0`?`S ʨr @ePPx# Z UP ` 0 4 0#40?  90 p01 S00   R0p 9h0 d 1 0pp` 0@P9Wp&꒎p9W5_0?00` P%0尰Რ 0* 7P .      p  0 S0S .ލȡ̡?̈́0F?0 \ \ 0S 0S 00S2/9 R  /@-@M h01  }/ !0 P09h0104 e h014 [Ѝp@-(M`@ P] 0000h01DP  !0}/  th0104 /h0104 &(Ѝp@- h01 }/0  OЍM-FM0WD"P`@??Pq0 RW3p$ h014 7 0   0}/  0PPZ0| h$P0 PW000S}W  }/ P9 W  P9 P 0p v ,?P `0R0 0CS 0S C/o0"S00SFߍV5USBCUSBSM-0M0!P!0R3 h0h@@100A 4 @4 @G0000S0_ h01 !0 }Ϡ P II h01 >0 I?`V< ሠ,  V 0 0p 0,0 0}?00$$ 9S  $0 $0 9,W ,W [K , pW `V0ЍV5s@-0% @0`$0S  ^pPU0 S ㊶S ` 00 R RR 100c!R RЍp`̈́M-MMG`@?`Pp = 0Sq  p 1#4L01M01PS_ R09,03/Y 0S ᡵ000რ20000@00 R0   00SS0S09 B0S$R#S! S X L@ Mpd  pW L@ M( PK̈́̈́p@- \@P`B00020000@00 00003/`p@M-PRMgq@`p00P t0r# 0R 6P!t0p!"@1 0*@ T A00 0* 0  0" 00 `0 0 2/0P pW0 (,x X( X$   t Ww``+ 00S00Pg000ЍУ@M-PRMgq@`p00\P t0r# 0R P!t0p!"@1 0*@ T A00 ㊴0( 0  0" 00 `0 0 2/0P pW0 (,x X( X$   t Ww``+ 00S00Pg000qЍУ@00P0t 0 /У\0p@- RL`P@0T4 td G$@p pУ%̈́A-`QU Psp'F 0S 00CS@4 P`P 0 0 0S 0 :PS\100X1T100P1,000F0 D+! R*!   +! 0 R!!  %!%  P PP 0S 0S 0S 0S 0ASx  P % R % h0104 ,0$9PI΄T΄M-M0pB?p`Pp 0 00 厳00020$000 00003/P XxE  0S S 0 0 E| Z x0 p$0U0^0 V 儰 " 0 2/P ?p ?p   p@t1B0Sd1L0:SK dʳpWF 8+%000 2000 00003/P Z--< 0 0002/ 3?0  0R   Q Q( #8R8  S #<BL M0 Pm ܍@{΄΄̪΄PM-MAȡȁ`pt PIJt0 t@ 0p``VlPDk0Di0D pAP^PF X14` 02"0PQ6(j6 _?` h`0 0 0}?00P0`0t Rʜ 0 ` 0`P   VP U8-P`Ѝ΄УT ̢τ1τ@- U8UPTPePlUTMτM-@d3 M\PX FXP  ?X`p  6`P@ P7 r  2R0 P0S0000X0S t0S \' PL H. W8%* 0- >[9  P0 @P U mXPI0S wP  0Px  P`0000H`*X,@T T  @_T TP1X#3 б`@eN 0⹖P 8A@ d0@ p `F ЍU{τ'Vxx |τxxxЄτЄꄄ*UЄЄЄЄЄ}~ЄRA-@MT`\ P*PK 0SHDX1  $pP+ 0S( !@DT1!  T T    @C0S 0( 0P  0@S !P@ `@ S 0HD@0@ @ЍMXMJ0ф9фXффjkфR9@-@` p/PP&V ^P/ @޴gSSsSP b-P @T@Pjk@S@.T qbS/ᘶLӄw7@-Pp@P@ 0S `冰PP D~P PWP Ѝ0q@-@P@'`$P pP0P}S6PP  @[  @ᛰm?o2@ck0ԄRM-0MP@ίPU   P0SP 0S  PA 0P0p0 h`P L0 <t@PP.$$P$@$گ" 峯P @㮯 0@ ;R   0$0$0PU  $ 0;S@x# `p pկPt@ 0{(@P4/Pm $QP$$y$Pa$D  PW $;P$$cPO$  PE $) $P$$A 00,00 0 (0 0,0((Z(0 0 P $ $P$$ 00,000!(00,0((7(0 0Px`Uz~P{ywPPUPLP0Ѝ3ԄAZIԄfԄtԄvԄԄԄJԄn󅄀Ԅ@-PpU`t @000  -RPE R fRp PEU ȪP@DP`Q@-0<@ՄRA-P`@B 8pP  0A//HP0@-@P,M0 0 00000@ 0(0T@T X@ @0@4峪PP,Ѝ0`Q~tՄR@-@  -Q  aR@D0T P`pP L LoP,`dpWՄtM-@MP pPEU* 0-S(0S dS bS cS rS tS PP pP p@$][Pl W00S @^U` WPUPP U#&0PfQQ SVP Z PE` 4 ᾬ0P @(@@ @ `0᮪PP0P P0L0*4000Ѝׄք+քAׄ^քք`Q3[քք @- BR -^ ^ a^ f^ R Q <| ,R \ @vׄE-,MpXP`=]Ph, 0 -RH R fRp H(!X0000S@ Bo6 AZ@@:PP& Q0  R QS C00`0@`0(0@ pݧ0S(0$ (,ЍׄDP`Qׄ ׄR/E-@0MRp00 0000@ 1B P00SpGa`WP@  0ӬX@ T?0@C?@ 02D01D VVa40V  ÷0S00;ߍ؄҆0/DP@-H000 00 Q 0S  Ѝ+؄@-@ά@@-M @◱ЍM-P @@M p EZ6` -R3 R& cR bR (sR tR #T TpEZ _ `⭰T p@0 P<TIG 㘰X  |WPE` P `0S P0 003 * j!p[@`P 0p 0 0h @5PPX0XX 0T03[  ,e@Ѝׄ`Q%[2؄ք o؄@-PP@p`W0@=S0S=PM-pᰠ`PP@P T@PPfPyP U@fT 00Es؄00@-@,M PO.  P 000 0(0P GPh Ph,Ѝ0`Q7@-P@P ѯ0S Ѝ08@-P@P  8@¯8R@-M@ P  <c8  P /܍]؄ 0/$ 0R 00/^@- $0S 0/^@-P 0TSYS001P8@-$P@  $ r$P@8@-@P 0!S|@@d0@07-0 0HHP<0<< 080{0000Ѝۄۄ`Q^Zք܄ @-07-00 0  Ѝ^`QQ0@-@M  # 孩0P |@0000 0XL 垧@P0@00 8088 0400(Ѝ-܄`QZ6܄܄ s܄@-M|`0@pPp#h` @@尦P H0HH 0D00 cЍ`QZ2؄܄ @-$0S;ַ @U@-܄M-0P@ p 0 `pP 0D K0X R  Q0 ᝪ0Pc40  PW`0 101Ѝ`QppQ% P#8@-P0@S 3/P8`0TQ T 8d D@ d0 8d 0 ,d $ d0 8/ሩ8`87@7t7 R/0 0$0/%Dꈩ-@-"M@T /( @"ލ@Ѝ/ R/0 0 0/DꈩP0,0//ሩP/0 CP0(0//ሩP/0 C@-0"M ᮮ@"ލH0@-@T @ 0S P P0@@0/0 /@-@(P 0P@- S@P @8@-`@Pp.P  (P  l"P  T :T IBل܄܄5  /p@-@P R 404BU0\PT00S@TU T U 4P@0`@OT000pU\0Pp@-@P`  b1000V:$00V`pp D< D< p@-`0PP`N@N@JD T00Pdp 0bSH00a8p0Pd PP0@d@ppQxU!P\/p@-0@ P`@U@Q 0a   010Rp81p@Q@  0`  P  Q  8@P00  Q p R *!B  0 0pQ"8Q[ TQ"nUQwTQ"|~\P  AQ R: 0 0ppQ|U@0YM-` 0 ЍMK50S50SlV `UV`~V*`1! P P06 0 00  4?0 S&380S[0 TS&6n0US7w0T%S&9|0~0 \ 0 00   ) P   f\0C0$PS  @fT 0``00  @ T 000 \ *@pL!  ,$R,#8 R[ TR,&n UR'w TR,)| ~ As^ B!@"  ^   \:  C!"RJ0 0 @ P  pfW 0``  00  pW 0   0 0 @000 N0C^ 0 RRP @  0pp0fSg1@1@ 0rJ@@N@pP  [0 [XI:tXP1@@0@40 s`01a0@c>0>0@p' 0 00R0h000 W0 0 0 pGp 0W000  t 0S0d S00000fS 0` `0ЍD℀$L wJ yL ݄Ks@-@P\`00 0P P  0P vЍpU@ Q @-@P P/'V/H/E-4M@H PpPT( 00,009PU6 廢P $' P0SL`2` (0P& P`- Pg x0  0, 0$00(0Ph0`X0,0\0 R $000`R[e ,0kP   P1@ R  *P " T P  0S0 S0SF P} دDU :PP  㺦0 0$\`1L  OCp PPsD0S "0S  㱯Q $0}|"P 㢯0 0 | $ Pm@0 0 03?$0g4Ѝ׿Uބ'VxxxxxބބN{߄A-P`@plP)  cp0U P00 x f   8US U 0*㤈*㬈0SP߄x߄x\߄0@-P0@M 0 000 aP  P R 0Ѝ0A-@ a0p PD00厡P 0/  "%@`V @`y`P s`o`Py 0X0 `@0S @4W$000U00H㄀㄀䄀p'䄀(1 Z䄀$ 0l  B   B   L 00/ /0S p@-P/@ `D"%;$ 0b00C000000p/c䄀@-@@䄀䄀@-pMP@P8`T 0P!(  o@Ѝ䄀M-P`UT p݀PP@B<@=P  30s MVS* pPꛇq0*0ᄇPp -8?? 0 |-? h  P HP<``Ѝ䄀䄀儀4儀T儀儀儀xM-0MP@Q$H0 0PUIuP<D0S- "0S,|( ,0,P! (@pWP0, 3?S P70 ٠Z@0@3?0PP0 U  L D 0Cp\0SX`P0S2L`` 0P $0P pPeP `P P$ A`=tdPd rPT P0SD 0S8@ P# P Z 0(00$ ,00 00d0$0h0(00lyu~ :Z Z2/@@i 0 S``Z`#V\ T0i0Ѝ愀7焀䄀Y焀愀_愀U儀x儀 愀x!愀5愀J愀s愀愀c愀/@-`@pBP,PP 2/淅4PP0S 0S 2?0  Pqp焀焀焀A-p#p`P<@P 0hS 㣣@@A-p:p`P#@P 0hS ㊣@@@-@0 +o`Ѝ焀@-@00 P 0S03?0Ѝ焀8@-@P.P8 8@t焀@-@0$ P ЍK{@-@0$ P Ѝ焀@-@0$ P Ѝ'@-@0$ ԀP Ѝ脀@-@0 ŀP03?0ЍS@-@0 巀P03?0Ѝ脀7@-@P0$ 娀P00 Ѝ0脀@-@0 噀o`Ѝ7@-@P0$ 匀P00 Ѝ0"ꄀE-`MPp4  @P= v0!i0 cX@ eT a_ 0 @UT 0T0@JdGX `B P 8: 0Ѝ脀+脀]@脀N脀W脀[脀hug脀x脀脀@-$MP `@pW  pW   #   h 07pHW $0(W  0SS0C  S00S   00CS   0 CSR pTW (00CS W 00 }P`#0S S ~p^ @P x0 tRl 4PX0 $Ѝ脀x脀)脀脀脀脀d脀鄀&鄀<鄀O鄀b鄀g鄀l鄀v鄀E-p` P@P8 00 @P8 20 l@P8 00 <@P@8 0Lt鄀Et鄀A-@M 0PpPPa@Z}P@P j~`ܜ ᾜP?  `CP-H0SS | p0O ! 0;} P >PP {Pp0SS | (P0H% EЍ넀~넀x脀)넀焀ꄀ$넀넀y넀넀8@-0PH@ P PB88M- M@00R0p0pSHPx000D00CS`$`da CP8e_8W 4$ ,Pk  3|D0S0nH0    |pZh` H뼀 8#qX , P` |  >Pqh٧D0S   LPb\ ǧD  2D0P S  )00  0 00#P @h@k Ek⠧iS0ᘧ  0P 1hD0SzP L0S2   GL0P S)8 `l5S0S 0D 1PR@ S@#@2T   g FP0 T00Sp0S  D0S0 | Ѝ넀<넀%섀?섀b섀섀섀넀섀x섀섀 턀"턀D턀_턀턀턀@-pL@$M`LP P  0p 0`00$Ѝ"℀0@-1M!S  ! ! !0@0A0S00 S B27701: BQAA@U0S:S B27701: Ѝ00/3333/ဩP @-p@`4@T,D4PDP@/LP/8@-<P@P < ㋙8@-@P 004 T40 408 L04 4 8 /L-DM< ND ⨘1000$0,0(0(000$0,03DЍyyyy Mqp@-P@ݘ `P  P:00p@8pRA-@P`p@*P4 PpW/t@- A-p0Q@`A SP0Sڐ00C0|U0*0P S0000 U 00C000C0lH5Q@-Pp` @P" BT@Q@@ @aT D0\p  k000@T w0p  [00090M-0(M@ l)0S\)X0P)0L)H)0D)PQ0S00X #000PP`p ?P .V <@0 0QP*JP p4p P P``" U= P sP dPh0 S*000P[00S עp`آ +`1#p gP000!SS\ 7e'00S0S0t'0000IU [P!P < 0 @ 0&A0@Sꐃ؃́ȀȀȀ(00PC 0P`V <@ 0 0P, )PY:Pz P P] P* P PP P PM Pb P` PU 00C0PPUt w00Cm`Pk*`F`V  З  P a_V`FL0SR*dc`%@Q0 0C0SE RA*b /00:0S :00C0Q. $.0 0C0S"Q `A`a ᄗ h  V`F00Cr$4Q& A r#  #0 S3#0SS 00S000S #QUS0S 00C0QM៖ R*b 0  #0 0C0S0 S*  }0( 00"0wP 0 c000<@0  0 (2 P0p Up_ P pp` V V V5 V =V  V 7V V( 200@dW00S 0St5 00C 00P00S p 0lP0S0 S0S p 0[P 1R# V00  0PPP  000 0 0`0 000`P000(Ѝцц҆U҆䩆9>2H5Bl҆ ҆E-P@.`ᰕPPhᶕPpF'`T  ᑕP姕U `@V 0 0aC1\Lem۶@-@ 84P  EOZM-MpPZ@`G1 ` 00M0 Ss"!0EZ@%p@0 0(0 $ -(0Pp $  SW JpP W | 0R@TР gP @` V@:K{򄀅 Lo- P  ^<<,P P< ֆ2M-M`|00$ 000 0ʔ@P 0P 000@Sō$$P0  P P P |0P!0S S S00@U 0= 1U, ! 3[@ T03@t0, = 1TT!PLU0000S T|P \0,05,0 0|0 P@`t@P@0`t@40P@t@ P@` t@ 0eSrPp0`@0t@iP@pt@P  p@-PH`@ ToP @↓Ppp蠆@-P Ѝs@-B*4S 0*4P`P 0PS S404S S`$4V0$4\UV\G 40 4HP <P 0PS0;41`C44UP 5P  0P 0(4S $4P0#S |P(4S  Vw $ 44P R 0s0 $s0RЍp ؆܆܆؆܆܆E-0 R@@#00(40CD)D4*DDD D$D0D,D'4S 4n ` pPPUf Q@PQ4SI4 $0S0  Q  Q5 0Q  R  ABQ r xR0P0@AA At PR00 a0AS P0 a ARW0AS 70AS>, 0Q 0S,Ć0*40 4t PpGW(m(4SC404t@ Ѝ ؆'1 M-D`pP @V)  Q*$RjZ` PP: $Q.  *$Q ,$R ,$RT 00Q  a$K$ R\ QBR\ RR$R \\ B$ Br QP]u" uV$R ($RCN$ $PGU )$ ($RC=$ $U0 Pd0$)$R$V `j^$ p j$$ uЍ ؆<0@-$$(0 \$$ $ 4 Ѝ ؆2܄>8P@-@ t@40CS0)44/P@荑 ؆P0/<M-MP)`U)p*UD @+pUp  0P+0,P $00 D0000 d00P0C ?o2L0040SPn0,@L@0<00#P@KKv℀H- 0d ?0?0@0M?@?@0P$ U  ဆ0HPS0S  0 0S 3/PP" R0S3/PP3/PP@00@0PP @00@09P (( 0H0 /-ZP@-@/Z]P@-@/Z]p@-`4@4PT 啅P <@ppLef,0, S Q ,0//ggE-l@hpPT 0  0`S800U0SP@ ЍfPfn@-H@TH@H@-P 8P P H0T  PH@H@-Hps/@-@PP@H0 SP0 0CQ Q 0//@-@@`PP,wpP?@P2 Q  00Pp0 P00S P P3/PP@ 0S b000 0 000W C7@-0P0@P0(0C( R P0 (0@(0C Ѝ0qs@-@P`P (@(0 S H0VD^(Ѝp7@-0@0 PP@PP Ѝ0@-P0 p`p@ 0@T`&P` Ѝ7@-0P0HP0@T (@DP@ Ѝ0 8@-00(P  U (PE@PP880(@-  0(,0S @3/P,0( 0 0(0,00@-@0 0S,0( 0 0(0,03/P 0 s@-@0D0XP0tD 09Pc pDpP PU 0 00;pЍp000S //8@-@0P0S$0S Z0 03/P 80H08-@-: ЍЍ/0@-@(0S =00@0 60000$0S -0 00S000S$"0$0A-PP) @00( @P0p008C`8`F80S P808`C0S 3/P  @P  0S0H0@00@00$0S 3/@P   vZ/00  /DA$ $0l0 0p0<4> h/D 0 Q0//DA 0 h0 88Sp/D 0@-0bMS 0 x@P x00,0 8 0 8 1@0`0<0X080\0000<Ѝ(1ᄀf\E 恀恀恀E-P4Mp @W`B`QFac`` d㰔Q㫔Q Xm1d$0040@ 0@4Ѝt/r 3a8@-P@C 8p@-@`: P S414p@-@+ S414@-@  0R 4 O?N?0@-H0H@H 0dC1P0P ,@ gf.||00lxC1P/!p@-@P` 6/ p0 0P@pfg./ p@-P@ 00b C1T :|P 0SP@ PU`0 pfg.@-l@p@-P@0p@/A-p`Pz@w 0 004/ЍA-p`Pg @d 0 004/Ѝ8@-PW@T R@O4/ @ GTPP8@-?0 QP P P $@-(// /HHDE-p$`0@V ʏ@PDP"P ᾏἏ0@@P@ Z Pd`X宏uP [t0;;9:02?3l&p@-`$@_02qqQ PU:zUp02pFp@-P$O`uzq<0S@T*T $02pm@-$h@2s0S 2RzM-`$@ $pUTWXqdTx^ 0S  xpVPPQ0s09{漺H1A:T, P  @$V6P  @D :4s00帲  00帲Th zP4@p@ Oj@T*TP@}02#Iv U M-`$@(,pTW X T\ 0S|VP PQt09{T㼺" H1:P0( $" P  /T  @D!:"r  02Ἲwpy0@:P $@P   0s00B 0@2@02Ѝ  >  p@-`$@Pt@:Ps0T@%PJ0:0   R$Xh @t@T!y<:y(0:@02p M-`$P@:s0  0P :y01x9:)pr  X HX$ЍMxpP ЍM0:xy027PP( $[uP9;:s0 *+㼻 x 0s 㼻x 㼻xX0s0 ; 0x 00 ;x[PЍM k 000S//@-Q#088@HHHH'(( @'t0pd 0w v00Ѝ/@-@P000S @//000/@-@ MUx   @P}Jx Ѝ8@-00P00R@0 (!D0 "00 0 10 P 0(18-4M,0  100000 004Ѝp@- M 0`000@5P8 0 P   , R\  R P6PU Jw@T*,,Tڀ Ѝp@ @-$ M$ 0@000sP Ѝ,!R -$M0 000`$Ѝ/< @-0S Q 0 M-`R0M PP Q;dPp00W!1[  !́ 01͑Rd     @P@[ !   @ P 4 @ Td0pW*0Ѝ $ 8@-@PP ^0 0 kP Tp88@8p@-`P@P _0S ^0S0s{pP_Pppp? @-@P00 0S @/  Q !Q % 5kM-YMM D`0@40L H0PPP Lv045 8L00H0P 0D P0#85 040H058L0PU PT0\X \<@0D HQ\ `hpxɟɟɟAˠɟ ɟSXSf0`  P `UhhPQdPS?"?"( ' ? U 1#0(())** Z Z 000PP00$xPP0V(`0t00p00'0 0d00X0 P0P00?0Yo`HHZahD0-1uM-(MPP@X l@ QQ 0 d 000 0CpW8*l0`g V`!0S0B00h Q # !$00@P  0@P   &001000@P 8KT @pP (ЍtM-0M`G@PIh1Pp0 0WP1P! X.U U  0010 Sh0 P 000xP U  0100gPHP\h0 pWᓬ*0Ѝ $ @-PPMP@f P 0`P p ` 0 pd 0t0Si  "Pr R RR 0M W0P$02,02 002(0UoF`FV: !l l l$Q )0S 0SS\X ЍH*8*,m ,Rr2hu8@-4Po@P  P u G88@-% @@-@g @8@-$@` Tp P0000 P T 0 0 0 Ѝ@ Ѝ@-0000 Ѝ@- l 00Ѝ@- ЍE-M0ppS 00PP00`` @P ~x;@ 0 P00S 00 0 0P bxP:ЍE-SP`pC}N P0P(0  00P@P  ЍE-p`M@PᗃQᒃQ00hU $8 0$40 0@P@PfЍM-Mp 0P0`0kV* e0f aQ@!0@10S T@!%80%40 0@  0PPP`Ѝ@-pP`@oP  0 00@P Ѝ@-0  a Ѝ0@-MP @P0 0  0 PMЍ0@-05  a ЍM-$0PpS ,@P@ 000 $ l00 0 O* @@t@P " 0Ġ00Z `'8pfg0 V'40 `! 0` ~0Pp f  0 0Ѝ<0P P L80/ 048<00/0@-MP@ 0TX 0 @Ѝ00@-MP@ 0T X 0  @Ѝ0A-MpP@` 0TX 0 (2c# 130 RlP @Ѝ040080 < ! /  &A-pᜀ@ePPU` 00S ll e@:0@T 0P l(m p/  $A-`ጀPe@@T|p 00S fl\!e@! :0@T 00S Tl/`\ -<S<0` 0  00S 0 0 0P00 /@-^ S\@@R00 0 R  00 0`00` 7@-<@dP 0P uv 5 Ѝ0A-@\M-0<@L000X `XTpTP00H  H"H0 0 0S( ` ""!0100 10kP9PJPX Hpf@ 0`+  p 2$PP0500 ($ ,  040 H0SX 10190 030@ p077% `V" PU 00P SPRPdSY 0U U ^1 00P P\0 S0S D0dP`x`S 8jP0".l &.0p  t0-jP0, = 'jP0.l .0p  t0jP0,= P00000D R.". S0@ <$0`0p0  S0@ <$`V !5%P(孿Ѝ2Tv"3% ;A-p`@ PPt @P D iPpP]80LpH0 00T000P000X0(00\00"0P 4 00h000<@ 00,00$00(0sp0qp`j0,0000C `V& , 0p@ 0@00< ; ;@0 0S s04 000M @ @ @ @  40, 03 @-@0T  1p @-@r0  10s0  00 T@ @-\0  10s0 00p 8@-@I0Pz8p@-P@ 0 30s0@  0 1 0 0`` 0 1 0 1u` r 0 1p8@-P@8A-P`pļ@P  e0p 00 2", 2#(00//@-` PP Rp 强p?o\20S0BS00\0S@B\OoB@T x ᢺh0VdUTᖺ ( 0@Pp `$P$劺HH.lbһ@-0  00 0  0 (  0( R  \R* Q 2#(00 8>= B83$ @0@0<0tl0  00 0  0 /M-P 0@p##,` 0##40#"40= ``FcJ 0R$ !(P.0  [[ᾰ00   0#(000S0p1!4p1"400 -M-0 @0p##,P0 "400#000= PPES0  a#"080 GS/ !( `V0 2#0堹% S!4!0 Q,<Q8<00 Ѝ-M-0P@#,`000!400#000 0mq0Cc PC 0#(000pW !(  \\ڗ000#(000pW <,0&  Q8 001 Q 00 000 p2"4p 2#000 0P +-M-p `P @0FS@L9yQEZ#0 ",`  "4 #000f@+ 0 @2"4@ 2#000 wx  00 @ 0M:R  0MpS  0M9M-p@ܡP @D 0Sn 0Sh``e 0eSa0-SV0Q * V" 7-hbP V V0sS I0bSsSD Mb0P0 C R RnStS4@R000-1S*:000# R 3 "R" 00S000C S f0000S  00V 1@S@0000 @ @D0 0C R 0 0C0 /R A-PBp@Q `V Jbpf@h/SRp@-@P` 8b F Pp 0Sp   S$  0,, p/@-0PQ 0#40pW P 0SpPa`~P@1~@# a P00p0S, s0" Q 0 R3?0Q6\?3 s0R?0 +r  R:0#4 0F@0Q00C?o2 # T0 0C \ R1  0 0C/@-@0S 0@\ S \/8@-,P 0S(@ \000S 3/ ,0S 3/4@ 04@D4 (0R00088@-l0,P00S 3/ 0S(@ 000800S 3/4@ 04@D4 (0R@-@@P`pP 0S !PE-p,` PU #0e 0 0PSP 4A3/ Q 0 0PSP 3/0T@T Dh 0@0S 3/0S 0 03/0,00`XY8@-@P 0 0S 3/8p@-P@P> T0P,@T0X0003/P`+ @x0 R#  0@:00 `\  R 2/I0 03/`P D0@ 0`01G0p `dp phZ0A-P\0<@<`p`P0A/@Tff0p@-P(@`4@D04 (0R $0S 3/<`4@4@D00p@-,@ 0S 000S@/M-`0,p@d0PD0t 00 070:00p0`@P񟗓_eece4eS+@\ 񟗆_`bee,``iV@ Q`@ 00B00C00D00E00F00G00M V0 0 0PT@{00C?o20#S000 @D 0S 0S10D [Ap 0       ,,  R   R rPk k(4J4 R 0 S R   [PX k4g[{00#$ LV1!/K @9 ,_000P T@ @D 0S P 0(4J4 R P 004 @ @D0  $ 0SS  p0P0Tp0 0 PP (4J40 S  p pG 0S 0PP  0 P4S 0S [0T@: @D R  R @/00  @P"  ^A R ^  !<"<  0;/0 P pXQd00Sm 3/jS7 0 S00.S/T 0SQr!4Pn [0 Si 3/JST 0SQZ!4PV [ ;/PP020 S :S!0@ A(0@40CD4\ <4040C00S !40S ( R ЍM/P 0S ЍM/[[ 00 00 003/P0 0p[!^ ЍhZ8@-@0S) $0S& ,04 (, P804 0S 3/P804 0 04080010 R010108 R0108800 S14000•/@-^) \ T0$ 0C @R @T 0X0@ PXp$0 (00p(0,0PU$ R*3/`/PD0ˮP6 R 0$ 0 ЍE/ Ѝ<>K[r0@-`M4 0?XX @@` X QY!1埮7P P ;X& P$] wP rPĬPt@0 h0o1( iXW`Ѝ%A[M(]at@-@0P`nPpPl p0h00P@ @p PD 00 0 WWWWW0p@-@0D00S003/PP (DPL 00@003/`P @PHd` X0 L0D003/`P ppWW.{WG_pxA-HM0pH@`H0 W \P嘀`ŭ R| Rp`\\\X0 000S0AJ S:!0S 5HЍty// 0hr R lrH  H @  @ 8  8 0 /`//0@-- P400t Ѝ[8@-P,@Q 0 03/00Q 0 03/00(Q 0 03/0(0,Q 0 03/0,000,08A-P``@p0P08000000T0A 0/Jp@-`$0PS" 0S 003/PP x0000l0@ `00 003/P (0 @p ppXl4 000@ 0Cs0D/70Cs/]E-PP@pD0.S:SPp` WP 00 0 00 0M-PMuVpVPtD0pp$p 00 0%000 0]0 0[0 0[@2 <V84Q ( V 4Q  00Vf`P30,8#`pP pP 3  #00#001000S 3/L3h0!=@#T3  L  DCD 30` ,3p 2 3 2 3 0000P cV0 tVC 0 [`P@2 @"08g<0003/P] H20D20P 003/P0 03/I20000,P100A0 0ݫ0 0ѫ 0tƫpIPN^00400 KP VP \@P妫8 0 @l0圫*P0L 07㒫@ЍVlX,Y\aXXWDYYXWXXX,'䂂O\8@- 0@gshs/ls- )Ks$ S%0P $rPD00D0\00\000`0$0`$$0%0CS40 040<00<0`00`0D00D00 8TM-DqP@(`TAT , @P T)1P0 0P0  ,UU P0000 00 0000kQPP00_P k p003/0S _P@ݪT )'\` 0S/@-@0S 003/(Q 0 03/0(0 0S 003/,Q 0 03/0,0$0S 003/01009 0,p@-@`P0S1!10@ 00@0 1Q!0$@03/PP)003/PP# 003/PP003/P( 003/P,P (0 03/B&P0GUP 003/`$`003/003/` `0 0d\ `T0P}j pWYXXXXX-[dp@-@P:` X00@dT   0 0 0 00 0 @@0SPU U`:`ЍpP)0ݩp@-@0Sp0  j01000S 3/0,P 020p@XY\ ^^FFFS03p3# p^ Wp.p.p~W qS06s00>F315s000-H0=\900%Wp.p.p~WqS06s00>F315s00 0S?  00-0S0 S00000480E0D0/4 $0R0 . R( ,!p//(0-,#!0|>0.0S 0s000000U000;//0P10@//@- 900#a40S0sp-0S=@$013$ PbS$0s@0 p$0@0$@00@-@@LP00,00@90 E-p@`PH {MV<0$,`(P.<0@0 p1S X000 RV   @01\00M0XV&^~o0010000 P P0 ⶄ20CC0PS#Q +30@Q0s0@000/8@-@EP,0(00(0,0 0ss0 E0003/EP8E-09@.@ p0s` 0SO&N40尃S P $ 0帀Rx*0b$X!01 z$0 0$00D00$ 0R 3S EQP0 0P <@-(0L(^ S (0(0CS(0g \E@/8@-(0@, <\(\0s0@@000 0s000ssJ00  !980S a@-0(, -@#T18  <0S Q(0C S0.0S 00s0S(Q0 D . R Qr 0    r  Qr `    E@T oSQ  QP8@-8 R 0 ( R4$r ,9.84\ @@(0===vpS0US 1US  01US H 0`P=0=00S 3/C/m@-7 @=3==0= @///QP# (0-<<!P- AqQ  r - /0A-TRU(pU0@$`{( `c@V @`#v0@V00$ S0U0= 00!`Q`0]0 0S`QP0p@-@@p( r4 $@ .84\ D\R  r r 1 `      <QE (A00R0Sv ZsRw :RN t00CSnԹ蹂=0)=Sb0_#4S S S0 TS S0 MS S0 G000 0@0== 0=5=6 0=`00`0,=0+=( 0=!0@S 0S0@"q@#Q?&>!40S Q000 0s000000000S 0 Q ;0`: R70S  :S .=>/= 800 L J 0S   0C"C"C &./S4 R \0 000 0s00S00*S >S007 0 3/P-0 000== #ў 000= `0W Q#e= 0Ѝ7r]11n?1 1=11= L4Q=0Q1 0S{0  Q'5=@L S0B0@q 0=0= 0=0!00S 3/PP1S 0 0S 3/1 4 ` q00D` P`44uPF 4F= 0==03= 4F=0= 4F=0= 4F=V0=0=ל6g/s00|#  t S%S0K ?@ 1 -01=0D >PU3 RĂłĂĂĂĂ R R RRRR0 "0ZF .` R` s0斲!  0PV`- v`V P`1mQ Z"""`xc`~o` ഀᶀ  ~` V*0s0. R0! 1S Q:Q {/!P00S 3/P$/ဝU'P  p0B"S 08qXY1PQ01=0CS0=ą]2PPЍ/`,Y%fr~/m2Q㄀P[Z,[YYHZ[[ 0)!), )/M-w@ҳP`< 0F F0[ `a 0$0(0   (0,0  007;< 0030008 r P 0Ѝǂp@-Pl ` @P?C P坛p13/ 09S@T P ppX@-00 @0 0$9S000Ѝ@@-@0 0Ѝ@@-0000 0 0zЍ8@-PPOU0A?3` 0S80000E00013/00`0@00( 00- - 08X@-$0PG@-(0Q 1S @/\p@-PP 0S0S 0S|pp`Pdp7  K@PD07 3/@P$ۚpp4\D^{0@-S@ 4 7 3/0S  7 3/\@-0S S @ @J\A-p@`0 P`E`VuP 噚00@-pPc@t@ @@@`Vt@  @肚MEM-R(MPq 0 \L0 `00&0S010000 0 ,0 (  0c 00S 0S 000 S 0S0$0oOP@. 0{?@0@0`} Vr q $ 0$ Z' 0p 2 #q  0c 0-"!# $V& . V"~/ & R-@ V" 0~/Y0p@ 0p(  B%r ! ! -  &0S =@ 0 V%~_0R1! 0 S1!qQ  ]10|2Sb 0S0 0s0     0s0 0+V#1 0V# 1  0c"劙0 0 0=" 1  0V#<  #0$  0 .  !  ~?(000C05s000 V#" 0' l032& <0R:0@!0t@0S 0/@AJt0 0V%!0100S&0S04020 0 0S 0S0    (Ѝc]]E-P $@Sp0@& ss` B0R% Wo '   , ,lr  .l %  080 S 3/0% 0S@W1  ( P 03/00 ) P 03/p 0S 0W 00$0 0S0  &0SԂԂԂԂ0S` 0`00 00@T @TE%0S EM-P B{!T 0 @T@D@001q``Spp pP~pT0T0 u 0s0q00T 0p0_-$b eRVS r S' S6, (0 0aV !1{QJ0305,02,S-(0[%:)0 $ R01ŵ ! ,0(``cV`!V v  ,0`,`=.R 1S 00 0`0 (0S`0B0 !0p 01 0F0 M]]M-0 {rWP 0 PUPEP1U@0t@\ U`v`V K` BM $@20HH!/0@ @ 00!000 P :( S@ ^ c000sq V`^ 0` ,00ЍMs "P@! @1  t*0@00m`Ѝ0M-` pԱ 2{SP PUPEP@Ut@0 0@ r Rb a & R  "/R 0S1nS !S@E@ H 0 0s0M   srM @PPr&t@+@0h#> 000s00E001S S  Pu  @ l $l  !100h(!R B Mx0F0   sr 00M0( B p0lP J,00 S,0 BTs@@T @s|S0#02Sx00q0Zs0 / ] 0!0Ts0L0l00T00 07]M-Pp(M`=S = 0 00S04?@P 0  0`00 0 0000%0 042  & (Q R  S020000'00S4"0 02Q0 Q0@0R 0 R0  00S0S030S0#!0=& 0$9S" 0#01 0 0S$9$Q Q$p Z Pq$!4#00S @M P0@R 0q.{?p =ʠ $0000$\8 Q$\* P' Ql \ ^  oR^  0 z Z8ZZ0  sR`Qn/-QP1 P!  s#{?P0@  Y` 0 Җbo   @(Ѝ=!08801<0//8@-Q1!;10S 0@S 3/$0!1060$88|₀@-10S 3/p@-!a0PU88#80w/u000P4@  TA4@S1< hUT@@P@T0$0p@-f///////(0 P  (PP//x[@-@ 03/00s@-0P0 00Pt@h`U 0SU P0S 043/P ,0  $0(@TЍp`x[[8@-P(@ 03/00P8(0@-@03/@8@-P(0@03/@8M-0P@c8 0`  PED  Pb Z @I `;V  0( @0 0 3 Q0S@ " 0Qsꔁ Z:0## 0  0=P Z:@0St 0 `ZZ0@STM= Z T`,w`Fa 0 SI[@ߕ  `;V``ݐ6@6`fĶ T #@ 0  0忕  :\@d廐X0P  0@P,嬐X0U6P03J xf# 0 S0f 0C00Z@㍕  :[5 @5 儥儵 T ӑ@ o  :\ @\0P  0P \0$50Z@N  :[4 @4 娤娴 T 唑@ 0  h:\ @P00P  0=P^ 30 1U3PQ0 0C P @1CR0@   0:[t9@3 @83 , T > @ ٔ  :\ @Ȳ`0P  0P `050圂 R@ 巔  9[x\2 @T2 H T 4 @ 嘔  9\ @ O0q 1P  0Pl10 150q0S@0n0 9[ `1 @X1 L T 嶐81@   Q  9\ @ O0 R BP 0[P l00 1U0P 0P0l-~Ѝ, 4 @[ (!^!<!8[!!("W""(0["@-@P ^| 000 l0 h@P RX 000 H0 D@PF4 000 $0 4@[<8[(0[8@-LPL@P Q 00P $0 8@H,M-0M<0 `04 S8  p P@ 0,PK $0K P0 0P0[S2[p0W: 0  M 00 PPg@㆓ P8U^ 0$00[@0[S S@@S@S @P῏B@00J T T  T@@80< SR4 00R00S 8P!<0@80P ꈠZ  $Pᑏ00TP TH T@@1< -~00 K"""넀"M-0MP`0 40 7(P 0M0,0 7@ 70` /R R(00  /7pP 0/S00 ,0S (tK,0K @8 Pk pi ,0SV!000S(J(`0S  @ 8 Œ8 7Z P` <R ,P7 0 $0K 000P 80 0 `  (V 0/S~0@@ ,0KqXlW 0S`(00 0,04 0KD,@-\P@0IP T@o T0SЍD s@-0 S @P0 `  P  0S 0  0  PЍp,Hp@- `@+@X7T! PP #S?RL0 S50 0`@TXa YP @pUpp,"X0p@-@PD0 @<0 DP B`D0 MpPLTM-P Mp@0? ? @ M!?`?`  BR*R!$ : Ìc0CQZ0 0   d0T* 0  Z0  0wP A  0 # R 0 0 0eP  0 0SO SB  0LP 0 # R 0V#0 000 S2 S?>V*ؠ` Ѝ@- 10SP@@p@`P  P@*@ 31 S@@$@ 000{30P Sl 2@`P 2P 0 8 2P0@0d ##$Q/A-@M`2PPA  2 p 0gS0 0Cs00.2P0gPc``EPU -30  S U #3 3~00100V  `` @3 00V 3܍]@-Q`1 @Q!$ 00@@HpbH 1p0W, 0 00S Ѝ 0- ^0 S0 ^ 0 S0 ^ 0SE-Q@@ T(p`."PU *T 00S @D Pt@Q 3P =B` PE P0@ 0  0S  S00 l2%0 S2 S?>Q1l h`P `T 00S@D `t@@ T @D g Ѝ $p@-@1` PP p@PP v0 S" S/jPGPp1P!10Pp $ M-+MpP2 @4p9 T WP 7 `8R| (  T R08 RX0X0*0{0`}0x洆6ᖣ#h0 ᖣ&0=Gh@0l0rPP T0 ( S<PR1P`` 1+>`02Fh0`cG6P 'P Np7g&0S*X `H7 0 07z @x Z㿀$  X<"0tS *X@ QlH 0xZe 6PPT0 S2 S?>Q Rd6Px&6TdƟP 0FX R@H 0x X H$ 0X0 K$ 0 N0P @ $ + B!R R !00X` lt&  10`h` `0cS0S7 $_$p0P k0P  `6$ bR 000Q 0V&HT0 S ZZ2h4PgT0 S" S/ Z:P4`-Z+ S2 S?>Z:"T0PA SP1H0PP=PPPUP @zZc8 /P3 0k00  P% R P  QQ Q   /o" R B Q   R  R|  0 @ A[ !b&Q\ 00 K0 | 0C0p! b6RLP P[L0 P 0P  0$嬅'T0 S㺱+8P1 0 02P0 PPP 6Pt | bP 充PԆ 2P0P00P}+ލ  =$ $ $$]$s$$$xH-0x P?0?0@0M?@/?@ P 0`0T /`P6< /P R( /PKx %;5M-MMPL!l 0P00l0 S`p +w p  0 p  p@+!$' d+v`x@ gV  SpD0p(0 0pDDp(p@00Ph 0P/U\UPP zo.zP:S" :00:zP>00XCz?0/S\S :\:0`0P/$ l R0S(: 0': 0 0.l0 0C?o2V  Rb p0,07 PG, Rt*00 0WS40f G W40  R\@Z 0Wh$00 4:4S0W4  (0SC   )S*R 0Y:S$0pP* :S0W0 S / @S t 07z-P z-P[ 0t ?$0,0 p0,000l0` S7V 0bh'G`0@S 00 $x0V@( 0c`S030#S :SC T<:SPp l0`Z S908P?(07h&'PF'7Z* 00R 0R0SW  ể:+SP  0 WX<UW[<d-PiP -U [{$P0 Q00[v l0P$0 0000 00/R\R :SL 0R00G0S<@: 0h(%(00,W, 0` 0S$  (0pP @?(0 0 `</ A<0S t< 07,P @\hPP0&il0 S2 S?>U?:0d:@S :l Q'a70P P@ P 0`@P!R0hP`l0 S2 S>0V*  0@P  T0@ZPP 006 R0ؠͱrh 0 P h岂@u! @T P  Z00, :  0 0a :h 0:P`Xl0 S2 S?>VO*ؠpZh0:t0@SPBl0 S2 S?>P9* 0"h* 0P :h  ? : @T P 0:KPpl0 S2 S?>W*ؠ`*0P : @P :@;@h勃S P{ P00 0p>ލЍ .%2a%s%% $%-$M (0000,000$Ѝ@-pMA0S, 000CS//////// 0݁(0 @P lӁ@  ,P& @+@ǁpЍ %%􄀠p%%%%@-00 000Ѝ-,M 0  qo,Ѝ-$M 0 a$Ѝ@-@ MD`pᄁ000# 00 0@000J ЍЀ&@-MPc8`@P fЍ/0A-a @P0W 0A NS& &M-@`\WPLUTr:@nL Ti:@B p Pps @PP^@.K@nD@3@#^@3TP@lTI@@L@@LLPPPNP,*@^b^ l P2:dPP):Pp^PP XPP%TPP W@TpGTW@ T T L PLL*LN.A^P @LpPPlP:n@P:U U@T*?^@^QPAE@REp3p#Tp3WplPW*^ TtD dPPQP@D$A@2^PU TD dpPQp@D$A @d TID}@.N@3@#^@3T@lT{P @P1TP#P3 TP#UqPlpUi:^8 PdU5PNpXTpPp\P%xpUTP'tppPWJWZpX TW PW \PH%UTHPH+HN.qQ^P@ pLPPUP p@@@UT@@ dpPUQ P bP b : b b bM-pT Q @ T H % Q2"% Q 2" `\-*0@8<@0@D`h`$ 0 P\8<P\0P\T?o2U0S T  0 @&P  0T` dЍmDᰀ 0L BM-08MP00#03\00ST000C a00 04@0C8$LLA(P , (N0,X<ND0 4Q@ Ġ , A @^;l@    Q5 20 2nΠL : Q`@ 0@ aA粀:n @pQ *`pW "`5 20p2 >dd`F`$`@nV\(@dT,ßpW  Tpd'* dp^.pW*4ppdp@h T!* dW0@ T* d@ppSf@ Tpd* dp^0\00L00000\_ `\0`X ,fL0V@CHp`0`d0`0S00 SVp0.0``V00, 0(@  d`F ``qA粀I @  N @a@  | SR1: l A b   0c<008<8Ѝ&&&M-M`@ Q@\ QA@@Q^'\^ @ 0Q @@P@T \*P@@ppp@wJPUT OoB^@T@F`Pp@PP@ⲀTPPP@PDU @T p@rTⰢDpPPP PTC, , H# DC( @# $  (`$`, P e/oE"4 Z  R J`0 P <@TPD   @PDU@Dt@DET: Q@@`t@@@P@,@U(@P@@$@P@P`@@@``Fp@H@@` `8@@2@@gA@`P`D``8`@ ``V `P@AD @Q5 @0@P @U @P` @`t@` `V*``pfW`l0pL0 0T0T00/>0l00P0@70h000`dh Rq*TL0A$0$0 0SW 0pGV`\V*W pGV`5S`c08 h0 \V*W pGV`R5S`c- 70%Q0`F"\V*W pGV`5SQ W pGV`V:5S S c ` R5000Q:h0 80h 00S l/΄S>l0pL0 0T0T0 0$7$0P04F`l08P00X0X0 0d %0P04500徤 1WR0p 0 8P<` 0p008P<` 0T0L 01 岠RWC 0pGV`S  03$0$00311 \W) 0pGV`5Q`aS5R`b@0  0@`30H000H0S V*W   pGV` `c@ 5S @ 00X0P01 RW 0pGV` 03$0$00311 ^W 0pGV`5Q`a@5R`b820DH000H0S V*W  pGV` `cD 5S D  ,00 0bD R1r00 0S 0  bD0S  c@0 00b4 S0a(c @S0! S0!c @c@AR 00@0S0E 0Sv  @00 00C 000000SJ VWd 0pGV`0  b0R00000 0S0b '6''J'c'P,Pw'''(Y'''(&&&0(E(40S%<,%4<00,4 S P0000 00 0`P0000S 0S VW 0pGV`0U0`P000000p 0 00(08PS<`0SI0 SE P40S (0S$ 00!,0( $ 0(3/P400h`0( `f V:4b 00000f4 cVp1p! `V  4f 0`(0,0 00( 000S,00`Sp0,p5`0P`f0Pe0000000000US 0 Se 40< S@000 R  0,00 0SQ 0S/0Ѝ0` 3?S 03?S 03?S3 #/, S$0S/ // /03?S *$03?\0R3?//A-0`0 pP2 00@0_0ES)H``x``````` @P 0S  P @4? @@ gP @@@ 0Q@- P Ѝ0Q@- P Ѝ0Qs@-`P0P @ P P PU000U 00C0SPUpЍp@- 00"P0S Ѝ7@-@P00$ P0SS Ѝ0@-@Pp`PfPT P @@-P`p@P03/R7@-P@ #P P@T P  Ѝ0 03?/@-`pP@P<Ͽ013?0 2/100@-1"  <_2O 00E-P`@pP'0TSS P  BP 0S @ `P0@S  @S Ѝp@-`P@z 0p@@-P`p@q6oPP `TPP _T@-@P@W@-@P@Op@-@`PPUpU0p03?0pM-p`(@PU P 1= 20P  P P PTPЍ@-`pP@p 0 Ѝ@-P  Ѝ@-`pP@p 0 Ѝs@-P4`@ P  0ЍpĖA-pP`P0`/S /P eP P@@0S 0/S S / PPP0h@PE-`PpP#U @*P00P0S 0S@QW0U  pq  Ѝ@- 0P Ѝ-<'^T a b888p@-`@"2PPp 0f 22/1 02/3? 0pp@-@`PPp$0f11$ 103? 0pA-@P(p(1` 3 10z  172/p6o$`8n 0 3?,#,8$#4 0M-@P`;P@=  : 1 P@jp  10; nP@  0  3? @03? 0T 0 100 0P 0$4O6o0 @`@8@-@P8P5_U $ 2/PU408 8 8M-`(p,@PP 05_R 6P:;78 pЍ0A-`p3_@P }W0 AA-Pp`(@P' 0! P   0  0 P04/  p00 0<P jЍ@-Pp`u@P 0 P   0 ЍM-@Pp`[P1 0&P)p'  @PP 5_ P0 P 40@   40Ѝp@-`P@ 0p@p@-P@`P  P  d0>p@ppM-`Pp8@PY03?S$03?0 @+ PPC  P  SP6$  7p2/$ . @4?(@ @@W&0VU1*0 S 0 C P07p0402003?,#,8$#40Ѝ P p ,0`$0P////C(((7@-@P00$0QS  Ѝ0@-08 P 0S 00@S # Ѝ>@-04 P 0S 0P # Ѝ9-00 `R #$" 4"s0Mr+rE-@1DMp$00 ``(0<0dP@P p0p0e0_0F?o2P0S 0 0R0S \p_ q0 l  e gQDЍst)))7@-\    @ Č @PU @PU\:$^p Ѝ0*!*@-`Pp0S @ @@@ 3/0P  dMpF*M-PU 0S \ `p^ @ 0ST6 T8 @pQ@A006 0@E^*` p` `W( `pZ$ S/U1t  Q5@D2 55:A 0PPQ5 51`b ` 0 ` `X*   @Ѝ0 0 0 X0\0P T0/A-0PPp@S` XpT@@Q\0S) npaoo1 r 0 E V0*X`P\TP \0XW 0\ b\  aPX0c\ALPHM-b pNW9@PT::S@ U5*@@#T@a@a\ AT):@a@UT\ P` \ X\  T* [* \: P0B b0  P`pGNЍp@-`P@P ;opw*0/@-Q 0$0480M-0M 9 00 P "   "ȟ0 H <   "  " lʃ (  # . @  , @ " @b% @ ``H@0 @.@ @$0@<@`8H@ @"@@$@lʃ@`H@@# @@$G@ @,@@$ @b%@`G@0 @.@ @$0$@<@`G@ @"@@$(@lʃ @)KDO@D@# @@$,@$@$`PG@0` @,@@$ 4G@b%0 @.@ @$04@<(@(pG@8p @"@@$F@lʃ@# @@$<@ ,! b%0" !0= #$!p˃,!Pa ! . 4b&0"  .0= # .˃,.a ! . b&0" .0= #.|˃,.\a !( . "!$ʃ# !pln ,! $ .0! 04c> "! ğ #, nȁ( ! . # 0 , "0# c> . "#   # "# lȁ ! "x# 0 , "0c.X30 0.0#D30 0"0#,30lȁ0! 0#300  "0  c=" *   ra̢  " ȁppp"p' 0 ` r "0 c=  h"*   a` H " @ȁppp "p' 0  "q0!c= *  @ԡa  "( ȁppp!p' @0$ @q @$ 0 c=  "h!a  ,  ȁpp .0000 0 0ЍxjVνp $|*ƇGF0FؘiD\"kqCy!Ib%@@QZ^&Ƕ]/SD!7Ç ZEogL*B9q"amD꾤 8K`Kp~('09|eVD")*C#9 Y[e]},O~oNC5:~Sӆ*A-P@p`10SA050205T0>0 @@dR: pI`dR@?Xh @ @H8B?? A0p@-1@ `? cRP7 c #8 }0P00T0 X p@gA-@pdXM`0`\ \ 000T *PdU P!@ }뿘 XЍ#EgܺvT2s@-@P `PT  OTp0T @0S@`V5ЍpRQ/M-@A⼰K@@@ T:` PdP  03/ P R: Z\ P*@fK@Ѝ諪M-XM0p8 <pP0 400`@8< 0 40 08< P0 PT 08<0t08<`0d08 < 008 < 0 4$00 08<0480!08<# 0" %0$ 8<' 0& 4(0)0( 8<+ 0* 4,0-0, 8 4000H00H 0P000000L000T0T ? -L!PL. P bL !H ,@  @H ͌b!"n @. @ @$l @,@ @$ `@- @ @a @$$@@ @!@b!@$8@͌@@"@n@$@@. @ @$l(@@ @,@`@$ ,@-@ @ @a @$0@@ @!@b!@$4@͌@@"@n@$@ @@. @l@$ @@ @,@`@$@ M   a " % +P%+/  ( ! dA " ͌ ' " "/   $ n ", P% P%/  P* . l "0 P% P% , `_ "0@$0 @#40`-@$0@$1? 07R# 8 bx b##!<0!80!40  00000#40000000 0#40 00001 00#4 00 00 01 00#400000100#4000 Ѝ0mA-`M@`p`T *PdUP!@ 돒`ЍM-hM0`8 < 0O 4008<`0`d 08 < 0 08< 0 400 8< 0 4 008< 0 4$008< 0 4(008 < 0 4,0!0 8 <# 0" 400%0$8 <' 0& 440)0(8 <+ 0* 480-0,8 4000 0P00\00`0000T0 0TX0$0@d00c#%"<" X0@#0@X0@$0@` 0P \ P @ lAF$lK$@,-@X0 P T0 0#T 00# a..0 d.\ d. T<Pp"0 0! 0bà,, P0 PPn,0n,p X\p'PPc pP l l {pp#pp'pe!! p pp`!@`!$p਋ %(d#%","p a!&"a+" \ (p0$(n35#<#p0b16# b;#0,0{pPp. pp'Plsu'|'pPcQV%c[%P0Pzp@p,pp'@`su'|'p@eAF$eK$@4@Xzp p p p'asu'|'p d.d.8zp p!pp'bsu'|'p0n,n, <ypp"pp'csu'|'p Pl l @\yp p#pp'esu'|'p @`!`!Dyp p%pp' dsu'|'p a!&"a+"  xp0p$pp'0nsu'|'p0 b16#b;#00`xpPp. pp'Plsu'|'pPcQV%c[%PP4p p xy'(u'sfy'䧟q'p @, * `CE$L$@  eAF$eK$@@8`訠*(*cki&ુ&``` `  (a((  d.d.< 고j+ડ+ 爠('( ܶ ! + bà,,   n,0n,  @ ꣠f*ড*` 樠*&* `X` D`" + c   l Pl $`棠f*ড* 訠*(* `ԥ ` `# * e**  @ `!`! $ (`棠f*ড*` 樠*&* `L$` ` % * d**  a!&"a+" ( ,`棠f*ড* ` 樠*&* `Ĥ(` 0`0$ * 0n** 0  b16#b;#0 0棠f*ড*,`$`渠+&+ `@,` 4`P. * Pl** P  cQV%c[%P P棠f*ড*0``(`渠+&+ `ร0` 8`@, * @`** @  eAF$eK$@ @棠f*ড*4`,`渠+&+ `44` <`  * a**   d.d. 棠f*ড*8``0`渠+&+ `ଢ8` @` ! * b**  0 n,n, 棠f*ড*<` `4`渠+&+ `$<` D`" * c**   P l l 棠f*ড*@`$`8`渠+&+ ` @` `# * e**  @ `!`! 棠f*ড*D`(`<`渠+&+ `D` ` % * d**  a!&"a+" 棠f*ড* `,`@`渠+&+ `$ `  *:/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄ0 n35#`<#0  b16# b;#0 0磠g*ৡ*0`D`渠+&+ `.` *P lSU%`\%P  cQV%c[%P P棠f*ড*4`pp `樠*&* `lp,H` pp'@`CE$`L$p@  eAF$eK$@@shy'q'`8p`pxy'*u'`q`p ` ` `&pa..`pppd. d.p`cgi&a&Hp<`H`hi&'e&|r`L`p p!p`'pbce&l&p`ppnaf&0nk&` p ` àg,,p@ppxy'(u'spp"p' pcà,, pppf,Pf, $ೠ`+࠱+ DLLp ' s pp#p'pe pp pl @l s(᳠a+ࡱ+$ ᨠ*!* $p p%p'pd!! p pp`!`!tt, Ⳡb+ࢱ+(   ⨠*"* ( p0p$p 'pn#%","0` ``a!&"jsa+"u' $` 00|'㳠c+ࣱ+,0H0$089#&5#0,0,`L50P0. 00#0P0p00bqv' b{'p40p(P㳠c+ࣱ+00(089#%5#U000P0* 0@0#PlCE$L$0P@PPgAF$gK$@V@80㳠c+ࣱ+40L00hi&#e&040P 0,0 0#P`..0PPPd.d.<0㳠c+ࣱ+80000XY%#U%0Va80P+ P P+ 0%P P0nP+P@0n+ 4P 㣠c*࣡*<0 04089#%5#\W0<0P0!0 0#Pbà,, 0PP Pk,pk, DPD03e9#1#@P0$P08P娠*%*W 0@0P0"00#Pg 0 P P Pl @l P 03e9#1#DP0(P01? 07R# 8 bx b##!<0!80!4<0  00000#40000000 0#40 00001 00#4 00 00 01 00#400000100#400000100#4000#0020 0#40 00'0020$0#40$00 Ѝ0[A-hM@` pl`T *PdU P!@ }븈 {hЍ 0p@-@P`T]R]00 000000C0pA-@`BpPU Q P@P@-=@S S oo[*Q0  /0Sp@-@`PS:Q@Q P0@0_p/ P@-@PpT0  `0S\\P0U\00 E-@`p]@P0T*0 0S  3P0PPP@P0 M- M D` 0H@p0000[0{0Q  PU u 00 U0E P@@0W0C?o20S2 \  L0ZU@0S E0 S:PbQ QS* ^  b0@0<0 0 S SP@#S0SSPd0 R=RRQR Q RQ=R0   ZP  v@ 8 P:  0 P RR \R R0  0S @8 Z0000KH0( ,@ 00K@ 00@S  \X 8 @ b@P<0U*0SPY80@C U]P  !P  ;XPK B+s++@-P`@p0T  0S6/P@@-  Xv5+M-`p< @P0 0 0S 0  [ 0WЍ P0` 0 Kcq'  P` `@8 WV (W  ЍMWnm++++M-XM@xP`@S@vPUpP0000TJ 0WU p1p![ V  ! V  r  r   W  W * 0R* wW  PE|0. a P*  BX0 @gDB0hWWP XЍ臞,(1]4鄀0@- R 0 R0#s01 # A"!0P@T @D p .p .p .p .\!0  0\0#s01 #0d>@-A-p`@T *PdUP!@ `ᵃ@-@  0!JЍM-@`pU 303: @T 0 PVWV2#Q `p UT:@TP 0૰jpf`  Ѝ@-V ,8@-@@[ P800  /]@-@P 0@80S *000C ]R p@-@P@`0S P S  0s0 0p0^dqb/0`p] @0S0/@ Q/0S0/ 0 \0C R /R/@- 0^ @^ l@ 00c0Rs/@ Q 0 0c0\0s/q 0S S//0 0Q`/8@-P@t@00C R8U8 R0  \`/P 8@-PW@P ~/8-0S  A\ S8@-PU @P  80-0 q\4n \00 0 SQ/0-@ 0l0S00  0 00C Q@-`@pxTP P@D"@1 00Q/P0 @Q/ cssa/@ Q 0S//E-`GpP CPU@e@  PEP qP 0\//p@-@ `TP1P! @Tp耖@-@T @DP/0@-0x@@ PQ S R! \-0A?o20D00 0#$\ 0]M-P@`PW V p = 08 3 p 44 0, 'p 440         p 4 N 01  ЍA- M@p ` x0p PT @@@D0D U0%U0-  P U` ЍaYqYp@-Q2QT!F !! 10e0a00 %2c0000 0 #A2c0000  Š\Ld0000@@pM- ap SR Ѝ@P  ~ P"(30$PP" 00 #1c000J1 100%2c 000J 03#b0  Jn00JJꟆZ| p@-QP@P`0 `F0P Ĵ D0eQӴP@ 0 c Rp0,M-XMPxp Z|@ 'pp R r@D0-@D+@D [ Z@D@D 00`0 Q ZJ``r  T@  0`=`f0V0c   RTZ/@PbXP[ Z0 P X  P  0  RTZ/@Pb0 0CV  E00SRWUZVP0  0STZPXЍlM-XM`P0Sw %S0@90+S  S #S @@-S 0S@@@@0C Qp `00C P 7'0pG*Spp0`W pg@0.S00C P ࠓ 00C \8(0H0*S0X  0hStSL\Z\P`0 lS`lP`L0nQ cQ %Q XQ dQ iQ sQ oQ pQ uQ xQ @  0pGW00 P E pGW @0 000aS IS$ MS qiS mS@@ kA@ pk@$ ß00P :!RQ 00R @@06S#@$00\ :  R P 00R @@ @0$4S@@%0, 0 $ 0 0$b Q~S0.S 0@@0@ 0 w!@p @0 @ 08P0`8 0  ?0 a 8P5 @%000SP0`FP( LS    lS  ZP0 tS hS0Sr r S ? @P `00cXЍm]0@-0@0S 0x\ D0 R R  P0DQ 000C 0Cs070CS*0 P0]@-00@pPe`P 0S R 0d0V R Ѝ@--\ @`M-00S 0xQD0 #R  R 0`p@PD\0@D @Dt@7@D_UT* + ]@-@0 KR GR  MR kR    iR BR000-@-  Ѝ Ѝ/-@-8Q Q 0꠆@-0<@P8p@0 1`0FQ@ 0 00( 0$ 0 0 0?00/ ( 0 4 <  M-ᤀ(p` < @0P`0  p` !   !Ѝ< >\ p@-\0\`\ P "H@ <00S0pP00 p@$ (  0 L _, h00S/@-OP 00cS<@000 S(MP00@w@( , 8 ,RM-`M FPj0@ Sf0ScpW`PU]|0SY  z0 RO0?s0S S G (`,  @a ] Y  U 0 ])p0S%  H00ZPP  ;k`d`0 P@\Mb -@-$0 00 0  M-(MP1P`PM@%ԡ+50 0@p0``P!(Q!$$(" P!( , P!( 0P! ( 4P! 0 8   0B0 8< 0 䠟40`0PS0_QP00  0 0CQ  `C `D0<X0XP00(Ѝ  - >\Mb| @-L0I? P8PM@|,0, }R}. @W - R/@-LKH0Q P@(PP@qJ- s@-`AP@T  spT @0S@VЍp@-@hK  00 0 00 0@-M @9JЍ-@-@8Q4 M0   Ѝ. .40 R 08Q 40S// 00S8/ @-,M@p`  MPP  FP   @P LL| L  70 00 000, (1V$ 0L00S20V vJP 00 0 00 0 ` Pl_Ld ZL003/PP <PL,ЍYM.v.. ...B.5..+//8@-@$\P R0L0@@4Q04@0 400808 A-@ha@dQ000u)HcJP < /414!S eP  !R PK@T`K?O*`=JpAH80S KKW P@K P tK8 h`4@0T~ K | DQ/Dr//0/b]///@- @P,03/0   ,0-P  $/ 0P (0// 8@-P`IPT@0S8UDP04006 0R(0  89P8/ t @-@0S[K$0pP` 8fP   4P0UPL` 2/P00 0 0U Ѝ 0 /@-P0SoHx@x`0Sp 0S \yIp0Sp4`@040W0 P -0 0P/ 넀0 / /0 0 0 0 /\ P  @-LCIP @P@$IP0 @' // 8@-*IAPP P P+ P%   000 0o*I0 R |00S p p0 h0'`0 \ \00S:  <0 80 by 0 t H  \ P 0  / \ 0/P D0P/@-@\$0?00!#  Mb 0Q A0#s0#sp/@-?@- QD2@2824"?P%_~^uP` `U0? Ps0Sʴ1@ A?s0 S@ A Qj^ ^g 1@ A?Ͽ\s0V^ \U\W SP SQNRL`ov`RG0 @RC0S@ P;  D0 0SR00  , 50 ?S0S" 0S0S0SxI lS1p?@0qs0\ ( 4 8 , 0"S BA BR00/0S"S 0R@- R | 0?@-S$ s  #,S8 Ѝ-0@-0P 000C S pp@-F@8@-E@0SP F0F0|F|t0pFwh0d`0\X0PP0Q8D 8@ ;$ L  ȶ 90<\:0D\ @-T@0S H H0?00@ ; 0|K00@H\ E M-P2b r@ @@`pPᘢ`{}0SSt20S[ Sr S> 0`} Ul|T|<T|hhT|20S10S 10S  PH!p PGGG +q吱tG1HP |1 %lG%0cT10P03/8AQ  $GE1E U 1 0  000@U  (T0`M@0`FЍ H ?0 b0$ 0 Y000 ( 0 1UЄ @-M@ 0 3?S{3:0S 0SPD0T 0T 0, 3?0 3?0ۍ   @-M0 x 0 3?S{3:0S 0S0S @T,0 ( rۍ   @-M0 ch 0 3?S{3:0S  0S @T(0$ @5ۍ   @-M0 =l 0 3?S{3:0S 0S 0S@T  %ۍ  A-M0  0 3?S*{3):0S% 0S"0S@T{x`P7w5_/S `N 0@ 0@ۍ  @-@w@0S: 0@/Rp@-M` P b0 @01  R0C1 0T @DA!   ܍p2p@-PMMS1A<Ͽ5Ͽ    l0@` L0Uo  0U8080 40@0,00ۍЍp      A-M p` 6?P@0 V 00C1! NUP 00 0gC1ڍ襆L00s/@00S/@-M @b 0dC1ڍ  A-M p` Ox P$@6? 0P V 00C1!  UP$00 0gC1^ڍ @-MMp`7 P$D 6o@0(0,0 p0e$` C1AڍЍ 0@-MM P 0 @ 0 0e C1+ڍЍ0 p@-M`d  0 3?S6{34:0S0 0S0S0S S$0`!PP TQtEEMQ#^ET d`@04OP 00 RP5ۍp L\&1U 0-DM00CS2" #T#d#l#|## 000 $0 0 000 $0 0 $0 0` T0 @0 4000D`DЍ   L\ 1p@-0 QpA0AQj$,$D$h$$D%$`|p0Zp|Y|p>p|pppT0K|ppp4A0D0$D 100p|pppD/000 +0 (|ppp P0`0`0@0 P}Uh 0PP 0S0U80  00p@Bp  *1 C1]1 d1L\ 1  %@-H@000S4MD@y(ID}>@D 11%A- 1Qq 0Aa0100S10S( #, s S4+*D :P Dq`0`a0@ D D 0S 1P 0 0R C@ CQ C 0C}cU0 0 /0  ЍA   |  $ 1 1 22L  ^2 }222U2%#D   @- 0  @-pP@C$ 0 +@0P @``+; p0 $ 00P0QQ?1H0`D0p[00@H  2(( $ L 4 8 , E-@0S$ S-`+p P PP x FPQ    0 0R0   Ѝ$ H |1s@-`op100CPSH+++++++@<00 @@1!0"##0 0 @e;00 "440<0<0s Q*TAH2/ DRD2Dp0W8B002000S( #, s S4 pA:YpP pd 00YAQgA0 bA0S t1\ 0 0P PRALA bA@LAQ ,FA !, @QA 1 :A+A1 00 0 0E  0@q0 0@K0, ЍA3X\3\\3| d p $ 14 1243L  ^2 422U(42h P 0T\P\,l T ` \ `\R8@-P@HU0@P  R  HIBJHCBB@B#OF@(s@(sA@(As@(so@(co@(cAo@(Aco@(c_@(S_@(SA_@(AS_@(SO@(CO@(CAO@(ACO@(C?@(3?@(3A?@(A3?@(3/@(#/@(#A/@(A#/@(#@(@(A@(A@(@(@(A@(A@(H@BpGH@BpG8 Op@pG#H@BpG(ȿo@O@&)-@@pG@ @F :@CRBcF@CpG@@F :@CRBcF@CpGO@rrrrrrsssss%s-s5s=sEsMsUs\scsjsqsxssssssssss\adi;;DINS;Zx0N"℀ⶄ <ńͿEńͿNń󄀢󄀵N{넀넀넀넀_愀넀넀넀넀넀넀넀넀넀넀넀"℀pDHHHDl Hl@Hl`HlHlHl7`l(QP8SPO P0{|yy0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-HF FGGG @H 8tsusxsrPrDutq8(HDH'@B))!)1)C)S)d)v))))M넀T<󁀬򁀼 #(-27<FP̤`\(8Ȧ 4<`ȲDLJPJII          a䄀+?Qcw Ʈ ֮ ᮄ 쮄 <?u í ߭   3Ou_whi ?i ?uMu h u   !=YM\ h u   Ѭ묄72 9  @ @G0N0 U0@\0c@?!l@ ?!u@@?!~@?!@?!@?!P?!` ?!`@?!`?!`?!MM℀℀℀℀℀℀℀℀℀ ℀℀℀℀℀℀℀㄀㄀㄀㄀'㄀/㄀'㄀3㄀8㄀ A㄀ H㄀N㄀ T㄀\㄀i㄀r㄀{㄀㄀㄀㄀㄀㄀㄀㄀㄀㄀J㄀P㄀㄀㄀22߄߄߄߄߄߄߄߄߄߄226℀A℀G℀M℀T℀[℀_℀h℀n℀u℀{℀℀℀℀℀22 u%6?HPai ᄀᄀᄀ %ᄀ/ᄀFᄀOᄀN{hᄀMvᄀ}ᄀᄀᄀᄀ ᄀᄀᄀᄀᄀ ℀℀(℀22!B c0@P`p)Jk1s2R"RBrb9{ZӜb$C4 dtDTjK( ōS6r&0vfVF[z8׼HXhx@a(#8َHi +ZJzjqP 3:*˿yX;l|L\",<` A* hI~n^N>2.Qp:Yxʱ -No0 P%@Fpg`ڳ=^"25BRwbVr˥nO, 4$ftGd$TDۧ_~<&6WfvvF4VLm/ș鉊DXeHx'h8(}\?؛uJTZ7jz *:.lMͪɍ&|ld\EL<, >]|ߛُn6~UNt^.> !1Aa  0@`@@A@!  @a`10  @ #+3;CScs`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O      3Dh&  fdt_fixup_memory_bankscomposite_unbindallocate_instancev7_dcache_inval_rangedo_bootvx_fdtfdt_find_or_add_subnodeprint_part_efiget_partition_info_efido_gptset_protective_mbrgpt_restoreext4fs_devreaddevice_removeis_gpt_validalloc_read_gpt_entriesis_pte_validset_default_envenv_importenv_exportdevice_probe_childdev_get_platdatadev_get_privusb_get_configuration_nodo_env_exportdo_env_importcb_getvarrx_handler_commandmmc_init_streamomap_hsmmc_init_setupmmc_reset_controller_fsmomap_hsmmc_send_cmdmmc_read_datarndis_command_completemmc_write_datarx_submitalloc_requestsomap_hsmmc_set_ioseth_bindusb_eth_initusb_eth_sendusb_eth_recvdfu_transfer_medium_ramusb_eth_haltdfu_fill_entity_ramdfu_init_env_entitiesdfu_get_bufdfu_get_hash_algodfu_writedfu_readdfu_fill_entitydfu_config_entitiesmmc_access_partmmc_block_opmmc_file_opdfu_write_medium_mmcdfu_get_medium_size_mmcdfu_read_medium_mmcdfu_fill_entity_mmcmusb_rx_reinitmusb_g_ep0_irqg_dnl_registermusb_ep_programmusb_h_ep0_continuemusb_h_ep0_irqmusb_host_rx(((((AAAAAABBBBBB$$bootcmd=run findfdt; run mmcboot;setenv mmcdev 1; setenv bootpart 1:2; run mmcboot;run nandboot;bootdelay=1baudrate=115200arch=armcpu=armv7board=am335xboard_name=am335xvendor=tisoc=am33xxloadaddr=0x82000000kernel_addr_r=0x82000000fdtaddr=0x88000000fdt_addr_r=0x88000000rdaddr=0x88080000ramdisk_addr_r=0x88080000bootm_size=0x10000000boot_fdt=trybootpart=0:2bootdir=/bootbootfile=zImagefdtfile=undefinedconsole=ttyO0,115200n8partitions=uuid_disk=${uuid_gpt_disk};name=rootfs,start=2MiB,size=-,uuid=${uuid_gpt_rootfs}optargs=mmcdev=0mmcroot=/dev/mmcblk0p2 rommcrootfstype=ext4 rootwaitrootpath=/export/rootfsnfsopts=nolockstatic_ip=${ipaddr}:${serverip}:${gatewayip}:${netmask}:${hostname}::offramroot=/dev/ram0 rwramrootfstype=ext2mmcargs=setenv bootargs console=${console} ${optargs} root=${mmcroot} rootfstype=${mmcrootfstype}spiroot=/dev/mtdblock4 rwspirootfstype=jffs2spisrcaddr=0xe0000spiimgsize=0x362000spibusno=0spiargs=setenv bootargs console=${console} ${optargs} root=${spiroot} rootfstype=${spirootfstype}netargs=setenv bootargs console=${console} ${optargs} root=/dev/nfs nfsroot=${serverip}:${rootpath},${nfsopts} rw ip=dhcpbootenv=uEnv.txtloadbootscript=load mmc ${mmcdev} ${loadaddr} boot.scrbootscript=echo Running bootscript from mmc${mmcdev} ...; source ${loadaddr}loadbootenv=load mmc ${mmcdev} ${loadaddr} ${bootenv}importbootenv=echo Importing environment from mmc ...; env import -t -r $loadaddr $filesizeramargs=setenv bootargs console=${console} ${optargs} root=${ramroot} rootfstype=${ramrootfstype}loadramdisk=load mmc ${mmcdev} ${rdaddr} ramdisk.gzloadimage=load mmc ${bootpart} ${loadaddr} ${bootdir}/${bootfile}loadfdt=load mmc ${bootpart} ${fdtaddr} ${bootdir}/${fdtfile}mmcloados=run mmcargs; if test ${boot_fdt} = yes || test ${boot_fdt} = try; then if run loadfdt; then bootz ${loadaddr} - ${fdtaddr}; else if test ${boot_fdt} = try; then bootz; else echo WARN: Cannot load the DT; fi; fi; else bootz; fi;mmcboot=mmc dev ${mmcdev}; if mmc rescan; then echo SD/MMC found on device ${mmcdev};if run loadbootscript; then run bootscript;else if run loadbootenv; then echo Loaded environment from ${bootenv};run importbootenv;fi;if test -n $uenvcmd; then echo Running uenvcmd ...;run uenvcmd;fi;if run loadimage; then run mmcloados;fi;fi ;fi;spiboot=echo Booting from spi ...; run spiargs; sf probe ${spibusno}:0; sf read ${loadaddr} ${spisrcaddr} ${spiimgsize}; bootz ${loadaddr}netboot=echo Booting from network ...; setenv autoload no; dhcp; tftp ${loadaddr} ${bootfile}; tftp ${fdtaddr} ${fdtfile}; run netargs; bootz ${loadaddr} - ${fdtaddr}ramboot=echo Booting from ramdisk ...; run ramargs; bootz ${loadaddr} ${rdaddr} ${fdtaddr}findfdt=if test $board_name = A335BONE; then setenv fdtfile am335x-bone.dtb; fi; if test $board_name = A335BNLT; then setenv fdtfile am335x-boneblack.dtb; fi; if test $board_name = A33515BB; then setenv fdtfile am335x-evm.dtb; fi; if test $board_name = A335X_SK; then setenv fdtfile am335x-evmsk.dtb; fi; if test $fdtfile = undefined; then echo WARNING: Could not determine device tree to use; fi; dfu_alt_info_emmc=rawemmc raw 0 3751936dfu_alt_info_mmc=boot part 0 1;rootfs part 0 2;MLO fat 0 1;MLO.raw raw 0x100 0x100;u-boot.img.raw raw 0x300 0x400;spl-os-args.raw raw 0x80 0x80;spl-os-image.raw raw 0x900 0x2000;spl-os-args fat 0 1;spl-os-image fat 0 1;u-boot.img fat 0 1;uEnv.txt fat 0 1dfu_alt_info_ram=kernel ram 0x80200000 0xD80000;fdt ram 0x80F80000 0x80000;ramdisk ram 0x81000000 0x4000000, !Device Firmware Upgrade0123456789ABCDEFEthernet Gadgetarocsdxbim Android Fastboot$0123456789abcdefLZO  Texas Instrumentsmusb-hdrc~~EPTGMKUSB download gadget    ;kCould not probe the EEPROM; something fundamentally wrong on the I2C bus. Could not read the EEPROM; something fundamentally wrong on the I2C bus. Incorrect magic number (0x%x) in EEPROM Could not get board ID. board_nameboard_rev not set. Validating first E-fuse MAC eth1addrA335BONEA335BNLTSKU#02Error %d registering CPSW switch A335X_SKA33515BBError %d registering USB_ETHER usbnet_devaddrERROR: %s - start address is not aligned - 0x%08x ERROR: %s - stop address is not aligned - 0x%08x usbethaddrBypassing DPLL failed 0x%x DPLL locking failed for 0x%x Clock enable failed for 0x%p idlest 0x%x serial_omapgpio_omap(fake run for tracing)machidUsing machid 0x%lx from environment Starting kernel ...%s bootargsFDT creation failed! hanging...Bad Linux ARM zImage magic! Kernel image @ %#08lx [ %#08lx - %#08lx ] /memory## WARNING: fixup memory failed! Resetting CPU ... pc : [<%08lx>] lr : [<%08lx>] sp : %08lx ip : %08lx fp : %08lx r10: %08lx r9 : %08lx r8 : %08lx r7 : %08lx r6 : %08lx r5 : %08lx r4 : %08lx r3 : %08lx r2 : %08lx r1 : %08lx r0 : %08lx Flags: %c%c%c%c IRQs %s FIQs %s Mode %s%s undefined instruction software interrupt prefetch abort data abort not used fast interrupt request USER_26FIQ_26IRQ_26SVC_26UK4_26UK5_26UK6_26UK7_26UK8_26UK9_26UK10_26UK11_26UK12_26UK13_26UK14_26UK15_26USER_32FIQ_32IRQ_32SVC_32UK4_32UK5_32UK6_32ABT_32UK8_32UK9_32HYP_32UND_32UK12_32UK13_32UK14_32SYS_32resetting ... WARNING: Caches not enabled %s for %08lx ... %08lx ==> Unknown hash algorithm '%s' HASH_MAX_DIGEST_SIZE exceeded sha256crc32syntax error ERROR : memory not allocated %s=%s ** Abort ## Error: "%s" not defined U-Boot# *?[\%uERROR: There is a global environment variable with the same name. %s: readonly variable%s=%sHUSH_NO_EVALUnknown command '%s' - try 'help' or use 'run' command IFS \$'";&|#;$&|exit not allowed from main input shell. HUSH_VERSION0.01showvarprint local hushshell variables - print values of all hushshell variables showvar name ... - print value of hushshell variable 'name'thenelifelsefiforwhileuntildonebootcountbootlimitbootdelayWarning: Bootlimit (%u) exceeded. Using altbootcmd. altbootcmdHit any key to stop autoboot: %2d %2d DRAM: Watchdog enabled I2C: baudrateNet: loadaddrMMC: ## Starting application at 0x%08lX ... ## Application terminated, rc = 0x%lX resetPerform RESET of the CPUstart application at address 'addr'addr [arg ...] - start application at address 'addr' passing 'arg' as argumentsTrying to execute a command out of order ## Checking Image at %08lx ... Legacy image found Bad Magic Number Bad Header Checksum Verifying Checksum ... Bad Data CRC OK FIT image found Bad FIT image format! Bad hash in FIT image! Unknown image format! autostartyesAutomatic boot of image at addr 0x%08lX ... Your platform's zImage format isn't supported yet! bootzboot Linux zImage image from memoryiminfoprint header information for application imageaddr [addr ...] - print header information for application image starting at address 'addr' in memory; this includes verification of the image contents (magic number, header and payload checksums)bootdboot default, i.e., run 'bootcmd'boot application image from memoryloadosramdiskcmdlinebdtprepfakeRamdisk image is corrupt or invalid Could not find a valid device tree verify## Booting kernel from Legacy Image at %08lx ... Unsupported Architecture 0x%x Wrong Image Type for %s command ## Booting Android Image at 0x%08lx ... Wrong Image Format for %s command ERROR: can't get kernel image! Can't get image type! Can't get image compression! Can't get image OS! Can't get image ARCH! Can't get image load address! ERROR: unknown image format type! Could not find a valid setup.bin for x86 Can't get entry point property! Could not find kernel entry point! XIP %s ... Loading %s ... Uncompressing %s ... GUNZIP: uncompress, out-of-mem or overwrite error - must RESET board to recover LZO: uncompress or overwrite error %d - must RESET board to recover Unimplemented compression type %d WARNING: legacy format multi component image overwritten ERROR: new format image overwritten - must RESET the board to recover initrd_startinitrd_endERROR: booting os '%s' (%d) is not supported subcommand not supported ## Transferring control to RTEMS (at address %08lx) ... confaddr## Transferring control to Plan 9 (at address %08lx) ... filesize## Transferring control to NetBSD stage-2 loader (at address %08lx) ... /chosen## ERROR: %s : %s ## Starting vxWorks at 0x%08lx, device tree at 0x%08lx ... ## vxWorks terminated alias for 'help'helpprint command description/usage - print brief description of all commands help command ... - print detailed usage of 'command' %s arm-linux-gnueabihf-gcc ( 4.9.2-10) 4.9.2 GNU ld (GNU Binutils for Debian) 2.25 print monitor, compiler and linker version.callbacks:callbacks,.flags:flags,baudrate:baudrate,bootfile:bootfile,loadaddr:loadaddr,stdin:console,stdout:console,stderr:console,.callbacksethaddr:ma,## Warning: Unknown environment variable type '%c' ## Warning: Unknown environment variable access method '%c' .flags## Error: flags type check failure for "%s" <= "%s" (type: %c) ## Error: Can't delete "%s" ## Error: Can't overwrite "%s" oldval: %s defval: %s ## Error: Can't create "%s" No MMC card found MMC init failed MMC partition switch failed redundant Writing to %sMMC(%d)... *** Error - No Valid Environment Area found *** Warning - some problems detected reading environment; recovered successfully Bad magic number Bad header crc Bad data crc Bad image type Empty Script No FIT subimage unit name Can't find '%s' FIT subimage Not a image image Bad Data Hash Could not find script subimage data Wrong image format for "source" command ## Executing script at %08lx sourcerun script from memory%-12s= 0x%08lX (not set)arch_numberboot_paramsDRAM bank-> start-> sizeeth%dname = %s eth%iaddr%-12s= %s current eth = %s ipaddrip_addr = %s baudrate = %u bps TLB addrrelocaddrreloc offirq_spsp start bdinfoprint Board Info structureList of available devices: %-8s %08x %c%c%c coninfoprint console devices and information\cecho args to console[args..] - echo args to console; \c suppresses newlineread EEPROM @0x%lX %s: addr %08lx off %04lx count %ld ... eepromEEPROM sub-systemread devaddr addr off cnt eeprom write devaddr addr off cnt - read/write `cnt' bytes from `devaddr` EEPROM at offset `off'exitexit scriptext4loadload binary file from a Ext4 filesystem [ [addr [filename [bytes [pos]]]]] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from ext4 filesystemext4lslist files in a directory (default /) [directory] - list files from 'dev' on 'interface' in a 'directory'ext4sizedetermine a file's size - Find file 'filename' from 'dev' on 'interface' and determine its size.ext2loadload binary file from a Ext2 filesystem [ [addr [filename [bytes [pos]]]]] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from ext2 filesystem.ext2lsusage: fatinfo [] ** Unable to use %s %d:%d for fatinfo ** ** Unable to use %s %d:%d for fatwrite ** ** Unable to write "%s" from %s %d:%d ** %llu bytes written fatwritewrite file into a dos filesystem - write file 'filename' from the address 'addr' in RAM to 'dev' on 'interface'fatinfoprint information about filesystem [] - print information about filesystem from 'dev' on 'interface'fatls [] [directory] - list files from 'dev' on 'interface' in a 'directory'fatloadload binary file from a dos filesystem [ [ [ [bytes [pos]]]]] - Load binary file 'filename' from 'dev' on 'interface' to address 'addr' from dos filesystem. 'pos' gives the file position to start loading from. If 'pos' is omitted, 0 is used. 'pos' requires 'bytes'. 'bytes' gives the size to load. If 'bytes' is 0 or omitted, the load stops on end of file. If either 'pos' or 'bytes' are not aligned to ARCH_DMA_MINALIGN then a misaligned buffer warning will be printed and performance will suffer for the load.fatsizeThe address of the fdt is invalid (NULL). libfdt fdt_check_header(): %s - too old, fdt %d < %d - too new, fdt %d > %d", "* 0x%p [0x%08x]<0x%08x%s[%02x%sfdtaddr/* NULL pointer error */The address of the fdt is %#08lx New length %d < existing length %d, ignoring. libfdt fdt_open_into(): %s No FDT memory address configured. Please configure the FDT address via "fdt addr
" command. Aborting! moNew length 0x%X < existing length 0x%X, aborting. mklibfdt fdt_path_offset() returned %s libfdt fdt_add_subnode(): %s Sorry, I could not convert "%s" Unexpected character '%c' libfdt fdt_setprop(): %s libfdt node not found 0x%08Xerror: unprintable value 0x%plibfdt fdt_getprop(): %s %s%s { Nested too deep, aborting. %s}; %s%s; %s%s = %s/* NOP */ Unknown tag 0x%08X libfdt fdt_delprop(): %s libfdt fdt_del_node(): %s magic: 0x%x totalsize: 0x%x (%d) off_dt_struct: 0x%x off_dt_strings: 0x%x off_mem_rsvmap: 0x%x version: %d last_comp_version: %d boot_cpuid_phys: 0x%x size_dt_strings: 0x%x size_dt_struct: 0x%x number mem_rsv: 0x%x boorsindex start size ------------------------------------------------ libfdt fdt_get_mem_rsv(): %s %x %08x%08x %08x%08x libfdt fdt_add_mem_rsv(): %s libfdt fdt_del_mem_rsv(): %s flattened device tree utility commands#size-cells%s: %s: %s fdt_initrd: %s linux,initrd-startWARNING: could not set linux,initrd-start %s. WARNING: could not set linux,initrd-end %s. linux,initrd-endfdt_chosen: %s WARNING: could not set bootargs %s. Unable to update property %s:%s, err=%s %s: num banks %d exceeds hardcoded limit %d. Recompile with higher MEMORY_BANKS_MAX? device_typeWARNING: could not set %s %s. reg/aliasesethernet%deth%daddrlocal-mac-address%s: Bad cell count for %s rangeslinux,phandleCan't set phandle %u: %s okaydisabledfailfail-%dInvalid fdt status: %x Warning: device tree alias '%s' points to invalid node %s. Warning: device tree node '%s' has no address. Warning: U-Boot configured device %s at address %llx, but the device tree has it address %llx. #address-cellsframebuffer@%llxwidthheightstrideformatdefault [ [directory]] - List files in directory 'directory' of partition 'part' on device type 'interface' instance 'dev'.savesave file to a filesystem bytes [pos] - Save binary file 'filename' to partition 'part' on device type 'interface' instance 'dev' from addr 'addr' in memory. 'bytes' gives the size to save in bytes and is mandatory. 'pos' gives the file byte position to start writing to. If 'pos' is 0 or omitted, the file is written from the start.load binary file from a filesystem [ [ [ [bytes [pos]]]]] - Load binary file 'filename' from partition 'part' on device type 'interface' instance 'dev' to address 'addr' in memory. 'bytes' gives the size to load in bytes. If 'bytes' is 0 or omitted, the file is read until the end. 'pos' gives the file byte position to start reading from. If 'pos' is 0 or omitted, the file is read from the start.Bank %s: -acmd_gpiogpio: requesting pin %u failed gpio: pin %s (gpio %i) value is %lu query and control gpio pins - input/set/clear/toggle the specified pin gpio status [-a] [ | ] - show [all/claimed] GPIOsValid chip addresses: %02XCurrent bus is %d Invalid bus %d Setting bus to %d Failure changing bus number (%d) Current bus speed=%d Setting bus speed to %d Hz Failure changing bus speed (%d) Bus %d: %sError %s the chip: %d writingreading%08lx: %02lx %04lx ? %04x: %02xCRC32 for %08lx ... %08lx ==> i2cI2C sub-systembusdevloopmmmwnmprobeUnknown operator '%s' Invalid data width specifier itestreturn true/false on integer compare[.b, .w, .l, .s] [*]value1 [*]value2-lt-gt-eq==-ne!=<>-ge>=-le<=## Total Size = 0x%08x = %d Bytes ## First Load Addr = 0x%08lX ## Last Load Addr = 0x%08lX ## Total Size = 0x%08lX = %ld Bytes loads_echo## Ready for S-Record download ... ## S-Record download aborted ## Start Addr = 0x%08lX ## Switch baudrate to %d bps and press ENTER ... loady## Ready for binary (ymodem) download to 0x%08lX at %d bps... loadx## Ready for binary (xmodem) download to 0x%08lX at %d bps... ## Ready for binary (kermit) download to 0x%08lX at %d bps... ## Binary (kermit) download aborted ## Switch baudrate to %d bps and press ESC ... load binary file over serial line (ymodem mode)[ off ] [ baud ] - load binary file over serial line with offset 'off' and baudrate 'baud'load binary file over serial line (xmodem mode)loadbload binary file over serial line (kermit mode)loadsload S-Record file over serial line[ off ] - load S-Record file over serial line with offset 'off'Base Address: 0x%08lx Zero length ??? double wordbytehalfword%s at 0x%08lx (%#0*lx) != %s at 0x%08lx (%#0*lx) Total of %ld %s(s) were the same %08x %04xinfinite loop on address range[.b, .w, .l] address number_of_objectsbaseprint or set address offset - print address offset for memory commands base off - set address offset for memory commands to 'off'checksum calculationaddress count [addr] - compute CRC32 checksum [save at addr]cmpmemory compare[.b, .w, .l] addr1 addr2 countmemory copy[.b, .w, .l] source target countmemory write (fill)[.b, .w, .l] address value [count]memory modify (constant address)[.b, .w, .l] addressmemory modify (auto-incrementing address)memory display[.b, .w, .l] address [# of objects]NULL device name! BUG: failure at %s:%d/%s()! /home/jsg/u-boot-2015.01/common/miiphyutil.cBUG!miiphy_register: non unique device name '%s' miiphy_register: cannot allocate memory for '%s' mdio_register: non unique device name '%s' %d - %s <--> %s No such device: %s %s is not a known ethernet MII devices: '%s' Current device: '%s' PHY extended status read failed, assuming no 1000BASE-X PHY 1000BT statusPHY speedPHY AN speed read failed, assuming 10BASE-T 1000BASE-X PHY AN duplexPHY duplex read failed, assuming half duplex FDXHDX10100fullhalfIEEE 802.3???IEEE 802.9 ISLAN-16TPHY 0x%02X: OUI = 0x%04X, Model = 0x%02X, Rev = 0x%02X, %3dbase%s, %s Error reading from the PHY addr=%02x reg=%02x addr=%02x reg=%02x data=%04X Error writing to the PHY addr=%02x reg=%02x duThe MII dump command only formats the standard MII registers, 0-5. %u. (%04hx) -- %s -- (%04hx:%04x) %u.%2u,%2u = b%u%u speed selection = %s Mbps%2u = %5u duplex = %s%2u-%2u = %5u selector = %s%2u-%2u = %u selector = %s%2u %2u-%2u = %5u %smiiMII utility commandsdevice - list available devices mii device - set current device mii info - display MII PHY info mii read - read MII PHY register mii write - write MII PHY register mii dump - pretty-print (0-5 only) Addr and/or reg may be ranges, e.g. 2-7.next page ableacknowledgeremote fault(reserved)asymmetric pause able100BASE-T4 able100BASE-X full duplex able100BASE-TX able10BASE-T full duplex able10BASE-T ablexxx to doasymmetric pausepause enable100BASE-TX full duplex able10BASE-T full duplex able10BASE-T ableOUI portionmanufacturer part numbermanufacturer rev. number100BASE-X full duplex able100BASE-X half duplex able10 Mbps full duplex able10 Mbps half duplex able100BASE-T2 full duplex able100BASE-T2 half duplex ableextended statusMF preamble suppressionA/N completeA/N ablelink statusjabber detectextended capabilitiesloopbackspeed selectionA/N enablepower-downisolaterestart A/Ncollision test enablePHY control registerPHY status registerPHY ID 1 registerPHY ID 2 registerAutonegotiation advertisement registerAutonegotiation partner abilities registerPHY does not have extended functions Reading from bus %s PHY at address %d: %d.%d - 0x%x mdioMDIO utility commandslist - List MDIO buses mdio read [.] - read PHY's register at . mdio write [.] - write PHY's register at . mdio rx [.] - read PHY's extended register at . mdio wx [.] - write PHY's extended register at . may be: , and may be ranges, e.g. 1-5.4-0x1f. sleepdelay execution for some timeN - delay execution for N seconds (N is _decimal_ !!!)No MMC device available no mmc device at slot %x OKERROR#part_num shouldn't be larger than %d switch to partitions #%d, %s mmc%d is current device mmc%d(part %d) is current device get mmc type error! MMC erase: dev # %d, block # %d, count %d ... Error: card is write protected! %d blocks erased: %s MMC write: dev # %d, block # %d, count %d ... %d blocks written: %s MMC read: dev # %d, block # %d, count %d ... %d blocks read: %s YesNo DDRDevice: %s Manufacturer ID: %x OEM: %x Name: %c%c%c%c%c Tran Speed: %d Rd Block Len: %d %s version %d.%d High Capacity: %s Capacity: Bus Width: %d-bit%s OK, force rescanset dsr %s mmcinfodisplay MMC info- display info of the current MMC devicemmcMMC sub systeminfo - display info of the current MMC device mmc read addr blk# cnt mmc write addr blk# cnt mmc erase blk# cnt mmc rescan mmc part - lists available partition on current mmc device mmc dev [dev] [part] - show or set current mmc device [partition] mmc list - lists available devices mmc setdsr - set DSR register value eraselistsetdsrgatewayipnetmaskhostnamerootpathserveripdnsipdnsip2domainping failed; host %s is not alive host %s is alive pingsend ICMP ECHO_REQUEST to network hostpingAddressnfsboot image via network using NFS protocol[loadAddress] [[hostIPaddr:]bootfilename]dhcpboot image via network using DHCP/TFTP protocoltftpbootboot image via network using TFTP protocolbootpboot image via network using BOOTP/TFTP protocoluuiddisk partition related commandspart uuid : - print partition UUID part uuid : - set environment variable to partition UUID part list - print a device's partition tablemallocWrittenReadFailed to initialize SPI flash at %u:%u No SPI flash selected. Please run `sf probe' updateERROR: attempting %s past flash size (%#x) Failed to map physical memory Updating, %zu%% %lu B/sSPI flash failed in %s step %zu bytes written, %zu bytes skipped in %ld.%lds, speed %ld B/s SF: %zu bytes @ %#x %s: %s SF: %zu bytes @ %#x Erased: %s sfSPI flash sub-systemprobe [[bus:]cs] [hz] [mode] - init flash device on given SPI bus and chip select sf read addr offset len - read `len' bytes starting at `offset' to memory at `addr' sf write addr offset len - write `len' bytes from memory at `addr' to flash at `offset' sf erase offset [+]len - erase `len' bytes from `offset' `+len' round up `len' to block size sf update addr offset len - erase and write `len' bytes from memory at `addr' to flash at `offset'Hex conversion error on %c Invalid bitlen %d Invalid device %d:%d Error %d during SPI transaction sspiSPI utility command[:][.] - Send and receive bits - Identifies the SPI bus - Identifies the chip select - Identifies the SPI mode to use - Number of bits to send (base 10) - Hexadecimal string that gets senttruedo nothing, successfullyfalsedo nothing, unsuccessfullyminimal test like /bin/sh[args..]-o-z-n-eSee InterfaceAudioCommunicationHuman InterfacePrinterMass StorageHubCDC DataVendor specificHuman Interface, Subclass: NoneBoot KeyboardMousereservedMass Storage, RBC SFF-8020i (ATAPI)QIC-157 (Tape)UFISFF-8070Transp. SCSICommand/BulkCommand/Bulk/IntBulk only12 Mb/s+-%d %s (%s, %dmA) %s %s %s %s String: "%s"Self Powered Bus Powered Remote Wakeup InOut Configuration: %d - Interfaces: %d %s%s%dmA Interface: %d - Alternate Setting %d, Endpoints: %d - Class - - Endpoint %d %s IsochronousInterrupt MaxPacket %d Interval %dmsusb%d: %s, USB Revision %x.%x - %s %s %s - Class: - Class: (from Interface) %s - PacketSize: %d Configurations: %d - Vendor: 0x%04x Product 0x%04x Version %d.%d (Re)start USB... stopserialstopping USB.. USB is stopped. Please issue 'usb start' first. USB device tree: infconfig for device %d *** No device available *** Device %d does not exist. Device is no hub or does not have %d ports. Setting Test_J modeSetting Test_K modeSetting Test_SE0_NAK modeSetting Test_Packet modeSetting Test_Force_Enable modeUnrecognized test mode: %s Available modes: J, K, S[E0_NAK], P[acket], F[orce_Enable] on downstream facing port %d... on upstream facing port... Error during SET_FEATURE. Test mode successfully set. Use 'usb start' to return to normal operation. stor no USB devices available no current device selected USB read: device %d block # %ld, count %ld ... %ld blocks read: %s USB write: device %d block # %ld, count %ld ... %ld blocks write: %s USB device %d: unknown device Device %d: ... is now current device 1.5 Mb/s480 Mb/s5 Gb/susbbootboot from USB deviceloadAddr dev:partUSB sub-systemstart - start (scan) USB controller usb reset - reset (rescan) USB controller usb stop [f] - stop USB [f]=force stop usb tree - show USB device tree usb info [dev] - show available USB devices usb test [dev] [port] [mode] - set USB 2.0 test mode (specify port 0 to indicate the device's upstream port) Available modes: J, K, S[E0_NAK], P[acket], F[orce_Enable] usb storage - show details of USB storage devices usb dev [dev] - show or set current USB storage device usb part [dev] - print partition table of one or all USB storage devices usb read addr blk# cnt - read `cnt' blocks starting at block `blk#' to memory address `addr' usb write addr blk# cnt - write `cnt' blocks starting at block `blk#' from memory address `addr'failed to stop USB controller %d unable to get descriptor, error %lX config descriptor too short (expected %i, got %i) %s: failed to get descriptor - too long: %d selecting invalid interface %dERROR, too many USB Devices, max=%d Cannot allocate device context to get SLOT_ID Couldn't reset port %i USB device not accepting new address (error=%lX) unable to get device descriptor (error=%d) USB device descriptor short read (expected %i, got %i) usb_new_device: Cannot read configuration, skipping device %04x:%04x ERROR: NOT USB_CONFIG_DESC %x ERROR: Invalid USB CFG length (%d) ERROR: Invalid USB IF length (%d) USB IF descriptor overflowed buffer! Too many USB interfaces! ERROR: Invalid USB EP length (%d) USB EP descriptor overflowed buffer! Endpoint descriptor out of order! Interface %d has too many endpoints! ERROR: Invalid USB EPC length (%d) USB EPC descriptor overflowed buffer! EPC descriptor out of order! failed to set default configuration len %d, status %lX USB%d: scanning bus %d for devices... %d USB Device(s) found No USB Device found lowlevel init failed Port not available. USB error: all controllers failed lowlevel init cannot reset port %i!? ERROR: USB_MAX_HUB (%d) reached Did not get interrupt on CBI cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X (NOT READY) cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X No storage devices, perhaps not 'usb start'ed..? USB Storage Transport unknown / not yet implemented Sorry, protocol %d not yet supported. error in inquiry Device NOT ready Request Sense returned %02X %02X %02X READ_CAP ERROR scanning usb for storage devices... max USB Storage Device reached: %d stopping %d Storage Device(s) found usb_dnl_fastbootuse USB Fastboot protocol - run as a fastboot usb device## Copying part %d from legacy image at %08lx ... Must specify load address for %s command with compressed image Bad Image Part ## Copying '%s' subimage from FIT image at %08lx ... Could not find script subimage compression type Invalid image type for imxtract Loading part %d ... Uncompressing part %d ... GUNZIP ERROR - image not loaded fileaddrimxtractextract a part of a multi-imagedo_bootmERROR prep subcommand failed! Subcommand failed Argument image is now in RAM: 0x%p Argument image is now in RAM at: 0x%p splSPL configurationexport [kernel_addr] [initrd_addr] [fdt_addr] img "atags" or "fdt" kernel_addr address where a kernel image is stored. kernel is loaded as part of the boot process, but it is not started. initrd_addr address of initial ramdisk can be set to "-" if fdt_addr without initrd_addr is used. fdt_addr in case of fdt, the address of the device tree. exportatagsusb_dnl_dfuDevice Firmware Upgrade [list] - device firmware upgrade via on device , attached to interface [list] - list available alt settings ${'%s' is not a number %s: %s dev %d NOT available Writing GPT: ;uuid_diskWrong uuid format for partition %d No partition list provided Missing disk guid Partition list incomplete success! gptGUID Partition Table - GUID partition table restoration Restore GPT information on a device connected to interface Saving Environment to %s... ## Error: cannot export environment Environment size: %d/%ld bytes ## Warning: defaulting to text format ## Error: external checksum format must pass size ## Info: input data size = %zu = 0x%zX ## Error: bad CRC, import failed ERROR: Environment import failed: errno = %d at %s:%d/%s() /home/jsg/u-boot-2015.01/common/cmd_nvedit.c## %s: only one of "-b", "-c" or "-t" allowed ## Warning: Input data exceeds %d bytes - truncated ## Resetting to default environment ## Error: illegal character '='in variable name "%s" ## Can't malloc %d bytes ## Error inserting "%s" variable, errno=%d Please enter '%s': setenvERROR: Cannot export environment: errno = %d at %s:%d/%s() %zXenv_buf [%d bytes] too small for value of "%s" edit: runrun commands in an environment variablevar [...] - run the commands in the environment variable(s) 'var'askenvget environment variables from stdinname [message] [size] - get environment variable 'name' from stdin (max 'size' chars)set environment variables[-f] name value ... - [forcibly] set environment variable 'name' to 'value ...' setenv [-f] name - [forcibly] delete environment variable 'name'printenvprint environment variables[-a] - print [all] values of all environment variables printenv name ... - print value of environment variable 'name'editenvedit environment variablename - edit environment variable 'name'environment handling commandsdeleteeditimportprintsaveenvsave environment variables to persistent storage*** Warning - %s, using default environment Using default environment /home/jsg/u-boot-2015.01/common/env_common.c!bad CRCERROR: Cannot import environment: errno = %d at %s:%d/%s() !import failedy Y yes YES stdoutstderrIn: No input devices available! Out: No output devices available! Err: No error devices available! pre-reloc realloc() is not supportedOut of pre-reloc memorybootm_lowbootm_sizebootm_mapsize%d Bytes = %4d-%02d-%02d %2d:%02d:%02d UTC Unknown OSUnknown ArchitectureUnknown ImageUnknown Compression%sImage Name: %.*s %sCreated: %sImage Type: %s %s %s (%s) %sData Size: %sLoad Address: %08x %sEntry Point: %08x %sContents: %s Image %d: %s Offset = 0x%08lx ## Loading init Ramdisk from Legacy Image at %08lx ... No Linux %s Ramdisk Image Wrong Ramdisk Image Format ## Loading init Ramdisk from multi component Legacy Image at %08lx ... initrd_highramdisk - allocation error Loading Ramdisk to %08lx, end %08lx ... noneuncompressedbzip2bzip2 compressedgzipgzip compressedlzmalzma compressedlzolzo compressedaisimageDavinci AIS imageFilesystem ImagefirmwareFirmwareflat_dtFlat Device TreegpimageTI Keystone SPL ImagekernelKernel Imagekernel_noloadKernel Image (no loading done)kwbimageKirkwood Boot ImageimximageFreescale i.MX Boot ImageInvalid ImagemultiMulti-File ImageomapimageTI OMAP SPL With GP CHpblimageFreescale PBL Boot ImageRAMDisk ImageScriptsocfpgaimageAltera SOCFPGA preloaderstandaloneStandalone ProgramublimageDavinci UBL imagemxsimageFreescale MXS Boot ImageatmelimageATMEL ROM-Boot Imagex86_setupx86 setup.binInvalid OSlinuxLinuxnetbsdNetBSDoseEnea OSEplan9Plan 9rtemsRTEMSu-bootU-BootvxworksVxWorksInvalid ARCHalphaAlphaarmARMIntel x86ia64IA64m68kM68KmicroblazeMicroBlazemipsMIPSmips64MIPS 64 Bitnios2NIOS IIpowerpcPowerPCppcs390IBM S390SuperHsparcSPARCsparc64SPARC 64 BitblackfinBlackfinavr32AVR32nds32NDS32or1kOpenRISC 1000sandboxSandboxarm64AArch64AMD x86_64Android's image name: %s Kernel load addr 0x%08x size %u KiB Kernel command line: %s Error: malloc in android_image_get_kernel failed! ANDROID!RAM disk load addr 0x%08x size %u KiB ERROR: - must RESET the board to recover. reserving fdt memory region: addr=%llx size=%llx image is not a fdtfdt_highFailed using fdt_high value for Device Treedevice tree - allocation error Using Device Tree in place at %p, end %p Loading Device Tree to %p, end %p ... fdt move failed## Flattened Device Tree from Legacy Image at %08lx fdt header checksum invalidfdt checksum invaliduImage is not a fdtuImage is compresseduImage data is not a fdtfdt overwritten## Flattened Device Tree blob at %08lx ERROR: Did not find a cmdline Flattened Device Tree Booting using the fdt blob at %#08lx ## Flattened Device Tree from multi component Image at %08lX Booting using the fdt at 0x%p fdt size != image sizeERROR: /chosen node create failed ERROR: arch-specific fdt fixup failed - must RESET the board to recover. descriptiontimestamp/imagesarchcompressionentrydata%s %s algo: invalid/unsupported key-name-hintrequired:%s (required)%s %s value: unavailable %s Timestamp: %s Description: %s Created: %s Type: %s %s Compression: %s %s Data Start: %s Data Size: %s Architecture: %s %s OS: %s %s Load Address: %s Entry Point: hashHashsignatureSignCan't set '%s' property for '%s' node (%s) sha1md5Can't get hash algo propertyCan't get hash value propertyUnsupported hash algorithmBad hash value lenBad hash valueCan't get image data/sizeCorrupted or truncated treeuboot-ignore-skipped + error! %s for '%s' hash node in '%s' image node Can't find images parent node '%s' (%s) ## Checking hash(es) for FIT Image at %08lx ... Hash(es) for Image %u (%s): /configurationscompatible%s Kernel: %s Init Ramdisk: %s %s FDT: %s %sFIT description: %sCreated: %s Image %u (%s) %s Default Configuration: '%s' %s Configuration %u (%s) unknown## Loading %s from FIT Image at %08lx ... Bad FIT %s image format! Could not find configuration node Using '%s' configuration Could not find subimage node Trying '%s' %s subimage Verifying Hash Integrity ... Unsupported Architecture FDT image is compressedNo Linux %s %s Image Could not find %s subimage data! Subimage data is not a FDTCan't get %s subimage load address! Error: %s overwritten Loading %s from 0x%08lx to 0x%08lx %s: Sparse image block size issue [%u] sparse image block size issueFlashing Sparse Image Bogus chunk size for chunk type Raw%s: Request would exceed partition size! Request would exceed partition size!%s: Write failed %lu flash write failureBogus chunk size for chunk type FILLMalloc failed for: CHUNK_TYPE_FILL%s: Write failed, block # %lu Bogus chunk size for chunk type Dont Care%s: Unknown chunk type: %x Unknown chunk type........ wrote %u bytes to '%s' sparse image write failureFAILOKAYERROR: invalid mmc device at %s:%d/%s() /home/jsg/u-boot-2015.01/common/fb_mmc.cinvalid mmc device%s: updating MBR, Primary and Backup GPT(s) %s: invalid GPT - refusing to write to flash invalid GPT partition%s: writing GPT partitions failed writing GPT partitions failed........ success ERROR: cannot find partition: '%s' at %s:%d/%s() cannot find partitionERROR: too large for partition: '%s' at %s:%d/%s() too large for partitionFlashing Raw Image ERROR: failed writing to device %d at %s:%d/%s() failed writing to device........ wrote %lu bytes to '%s' ** Too many args (max. %d) ** ## Command too long! %.*s%*s %s - %s Usage: %s - No additional help available. %-*s- %s Unknown command '%s' - try 'help' without arguments for list of all known commands Unknown command '%s' - try 'help' 'bootd' recursion detected Command '%s' failed: Error %d CksumxyzModem - %s mode, %d(SOH)/%d(STX)/%d(CAN) packets, %d retries Unknown errorBlock sequence errorCRC/checksum errorInvalid framingCancelledEnd of fileTimed outSorry, zModem not available yetCan't access file Loading from %s device %d, partition %d: Name: %.32s Type: %.32s ** Read error on %d:%d ** Bad Header Checksum ** Fit image detected... ** Unknown image type ** Bad FIT image format Partition Map for IDESATAATAPIUSBDOCHOSTUNKNOWN device %d -- Partition Type: %s (%d:%d) Vendor: %s Prod.: %s Rev: %s Model: %s Firm: %s Ser#: %s Vendor: %s Rev: %s Prod: %s device type DOC device type unknown Unhandled device type: %i Type: Removable Hard DiskCD ROMOptical DeviceTape# %02X # Capacity: %ld.%ld MB = %ld.%ld GB (%ld x %ld) Capacity: not available DOSEFI## Unknown partition table ** Bad device specification %s %s ** ** Bad HW partition specification %s %s ** ** Bad device %s %s ** hostfsSandbox hostbootdevice** No device specified ** auto** Bad partition specification %s %s ** ** Bad device size - %s %s ** ** No partition table - %s %s ** Whole Disk** Invalid partition %d ** ** No valid partitions found ** ** Invalid partition type "%.32s" (expect "U-Boot") FAT32FAT Extd Boot** Can't read partition table on %d:%d ** bad MBR sector signature 0x%02x%02x %3d %-10d %-10d %08x-%02x %02x%s%s hd%c%dsd%c%dusbd%c%ddocd%c%dxx%c%d%08x-%02xPart Start Sector Num Sectors UUID Type %s: calloc failed! ** Can't write to device %d ** %s: 0x%x != 0x%x GUID Partition Table Entry Array CRC is wrong%s signature is wrong: 0x%llX != 0x%llX GUID Partition Table Header%s CRC is wrong: 0x%x != 0x%x GPT: my_lba incorrect: %llX != %lx GPT: first_usable_lba incorrect: %llX > %lx GPT: last_usable_lba incorrect: %llX > %lx %s: Invalid Argument(s) *** ERROR: Can't read GPT header *** %s: ERROR: Can't allocate 0x%zX bytes for GPT Entries *** ERROR: Can't read GPT Entries *** GPT: Failed to allocate memory for PTE %s: *** ERROR: Invalid GPT *** %s: *** ERROR: Invalid Backup GPT *** %s: *** Using Backup GPT *** Part Start LBA End LBA Name Attributes Type GUID Partition GUID %3d 0x%08llx 0x%08llx "%s" attrs: 0x%016llx type: %s guid: %s Partition overlap Partitions layout exceds disk size Partition no. %d: invalid guid: %s %s: failed writing '%s' (%d blks at 0x%lx) MBRPrimary GPT HeaderPrimary GPT EntriesBackup GPT EntriesBackup GPT HeaderFailed to unbind dev '%s' on error path %s: Device '%s' failed to remove on error path %s: null device No match for driver '%s' Cannot find driver '%s' Cannot create device named '%s' (err=%d) Virtual root driver does not exist! Virtual root driver already exists! Some drivers were not found rootroot_driverCannot find uclass for id %d: please add the UCLASS_DRIVER() declaration for this UCLASS_... id Device '%s': seq %d is in use by '%s' %s: Device '%s' failed child_post_remove()%s: Device '%s' failed to remove, but children are gone %s: Device '%s' failed to post_probe on error path dfu_bufsiz%s: Could not memalign 0x%lx bytes DFU complete %s: 0x%08x %s: Wrong sequence number! [%d] [%d] ERROR: Buffer overflow! (0x%p + 0x%x > 0x%p) at %s:%d/%s() /home/jsg/u-boot-2015.01/drivers/dfu/dfu.c%s: File too big for buffer %s: Failed to fill buffer UPLOAD ... done Ctrl+C to exit ... dfu_hash_algoERROR: DFU hash method: %s not supported! at %s:%d/%s() ERROR: Hash algorithm %s not supported at %s:%d/%s() nandNAND support not available! SF support not available! %s: Device %s not (yet) supported! dfu_alt_infoERROR: "dfu_alt_info" env variable not defined! at %s:%d/%s() ERROR: DFU entities configuration failed! at %s:%d/%s() DFU alt settings list: dev: %s alt: %d name: %s layout: %s RAW_ADDREXT2EXT3EXT4RAM_ADDReMMCOneNANDRAMfatext4%s: Layout (%s) not (yet) supported! %s%s mmc %d:%d 0x%x %lxdfu: Read error! dfu: Wrong file size! ERROR: Cannot switch to partition %d at %s:%d/%s() /home/jsg/u-boot-2015.01/drivers/dfu/dfu_mmc.cERROR: Device MMC %d - not found! at %s:%d/%s() Request would exceed designated area! ERROR: Operation not supported at %s:%d/%s() ERROR: MMC operation failed at %s:%d/%s() ERROR: Invalid number of arguments. at %s:%d/%s() ERROR: Couldn't find MMC device no. %d. at %s:%d/%s() ERROR: Couldn't init MMC device. at %s:%d/%s() rawmmcpartERROR: Couldn't find part #%d on mmc device #%d at %s:%d/%s() ERROR: Memory layout (%s) not supported! at %s:%d/%s() ERROR: unsupported layout: %s at %s:%d/%s() /home/jsg/u-boot-2015.01/drivers/dfu/dfu_ram.cERROR: request exceeds allowed area at %s:%d/%s() ERROR: unsupported device: %s at %s:%d/%s() %s: %s: error: gpio %s%d not reserved dir_inputdir_outputget_valueset_value%s%d: %s: %d [%c]%s%sunusedfuncGPIO%d_omap3-gpio unknown bank method %s %d /home/jsg/u-boot-2015.01/drivers/gpio/omap_gpio.cError, wrong i2c adapter %d max %d possible wrong hwadapnr: %d Error : I2C initializing first phase clock Error : I2C initializing clock Timed out in wait_for_bb: status=%04x Timed out in wait_for_event: status=%04x Check if pads/pull-ups of bus %d are properly configured I2C write: addr len < 0 I2C write: data len < 0 I2C write: NULL pointer passed I2C write: addr len %d not supported I2C write: address 0x%x + 0x%x out of range i2c_write: pads on bus %d probably not configured (status=0x%x) i2c_write: error waiting for addr ACK (status=0x%x) i2c_write: bus not ready for addr Tx (status=0x%x) i2c_write: error waiting for data ACK (status=0x%x) i2c_write: bus not ready for data Tx (i=%d) i2c_write: timed out writig last byte! I2C read: addr len < 0 I2C read: data len < 0 I2C read: NULL pointer passed I2C read: addr len %d not supported I2C read: address out of range i2c_read (addr phase): pads on bus %d probably not configured (status=0x%x) i2c_read: error waiting for addr ACK (status=0x%x) i2c_read (data phase): pads on bus %d probably not configured (status=0x%x) i2c_probe: pads on bus %d probably not configured (status=0x%x) ERROR: Timeout in soft-reset ERROR: failed to setup I2C bus-speed! omap24_2omap24_1omap24_0Status Error: 0x%08X Timeout waiting card ready MMC Device %d not found MMC: block number 0x%lx exceeds max(0x%lx) mmc fail to send stop cmd Card doesn't support part_switch MMC: SET_DSR failed Man %06x Snr %04x%04x%c%c%c%c%c%c%s is deprecated! use mmc_create() instead. MMC: no card present Card did not respond to voltage select! %s: %d%s: timedout waiting for ics! %s: timedout waiting for sysctl %x to clear %s: timedout waiting on cmd inhibit to clear %s: timedout waiting for STAT (%x) to clear %s : timeout: No status update %s: timedout waiting for status! %s: timedout waiting for cc! %s: timedout waiting for cc2! %s: timedout waiting for softresetall! mmc_cdmmc_wpOMAP SD/MMC Caution! Your devices Erase group is 0x%x The erase range would be change to 0x%lx~0x%lx mmc erase failed mmc write failed SF: Failed to set up slave SF: Failed to get idcodes SF: Need set QEB func for %02x flash SF: Detected %s with page size , erase size , total , mapped at %pSF: Warning - Only lower 16MiB accessible, Full access #define CONFIG_SPI_FLASH_BAR SF: Unsupported flash IDs: manuf %02x, jedec %04x, ext_jedec %04x W25P80W25P16W25P32W25X40W25X16W25X32W25X64W25Q80BLW25Q16CLW25Q32BVW25Q64CVW25Q128BVW25Q256W25Q80BWW25Q16DWW25Q32DWW25Q64DWW25Q128FWwait_for_user_access Timeout cpdma_process timeout link up on port %d, speed %d, %s duplex link down on port %d error %d submitting rx desc cpswFailed to allocate PHY device for %s:%d Phy %d not found %s Waiting for PHY auto negotiation to complete TIMEOUT ! user interrupt! done PHY reset timed out %s:%d is connected to %s. Reconnecting to %s Could not get PHY for %s: addr %d Generic PHYSMSC LAN8710/LAN8720SMSC LAN911x Internal PHYSMSC LAN8700No serial driver found## Baudrate %d bps not supported ## Baudrate may not be deleted SPI error: unsupported bus %i. Supported busses 0 - 3 SPI error: unsupported chip select %i on bus %i SPI error: unsupported frequency %i Hz. Max frequency is 48 Mhz SPI error: unsupported SPI mode %i SPI error: malloc of SPI structure failed SPI TXS timed out, status=0x%08x SPI RXS timed out, status=0x%08x omap3_spi: invalid wordlen %d /home/jsg/u-boot-2015.01/drivers/usb/gadget/composite.ccompositeusb_dnloadmusb-hdrc%s: failed!, error: %d DOWNLOAD ... OK Ctrl+C to exit ... f_fastbootstatus: %d ep '%s' trans: %d Booting kernel.. 0x%lxError %d on queue Bad status: %d downloading of %d bytes finished ERROR: unknown command: %s at %s:%d/%s() /home/jsg/u-boot-2015.01/drivers/usb/gadget/f_fastboot.cFAILunknown commandERROR: buffer overflow at %s:%d/%s() FAILbuffer overflowERROR: missing variable at %s:%d/%s() FAILmissing var0.4bootloader-versionU-Boot 2015.01downloadsize0x%08xmax-download-sizeserialnoserial#FAILValue not setERROR: unknown variable: %s at %s:%d/%s() FAILVariable not implementedfailed to enable out ep failed to alloc out req failed to enable in ep failed alloc req in Starting download of %d bytes FAILdata invalid sizeFAILdata too largeDATA%08xrebootgetvar:download:continueERROR: %s: rndis parse error %d at %s:%d/%s() /home/jsg/u-boot-2015.01/drivers/usb/gadget/ether.cUSB RNDIS network up! ERROR: can't autoconfigure on %s at %s:%d/%s() ERROR: can't run RNDIS on %s at %s:%d/%s() %02X%02X%02X%02X%02X%02XERROR: can't init RNDIS, %d at %s:%d/%s() using %s, OUT %s IN %s%s%s STATUS HOST MAC %02x:%02x:%02x:%02x:%02x:%02x RNDIS ready ERROR: %s failed, status = %d at %s:%d/%s() RNDIS/%sU-bootERROR: controller '%s' not recognized at %s:%d/%s() ERROR: No memory to alloc RNDIS packet at %s:%d/%s() timeout sending packets to usb ethernet ERROR: can't alloc requests at %s:%d/%s() ERROR: received NULL ptr at %s:%d/%s() ERROR: rx submit --> %d at %s:%d/%s() ERROR: dev->rx_req invalid at %s:%d/%s() RNDISCDC Ethernet%s speed config #%d: %d mA, %s, using %s de:ad:be:af:00:00usbnet_hostaddrERROR: Need valid 'usbnet_devaddr' to be set at %s:%d/%s() ERROR: Need valid 'usbnet_hostaddr' to be set at %s:%d/%s() cdc_connect_timeoutERROR: The remote end did not respond in time. at %s:%d/%s() usb_etherEthernet DataRNDIS Communications Controlep%d%s%s %d: SetupEnd came in a wrong ep0stage %s %s %d: SETUP packet len %d != 8 ? %s: peripheral reset irq lost! WARNING in %s line %d /home/jsg/u-boot-2015.01/drivers/usb/musb-new/musb_gadget_ep0.cidlein/statusout/statuswaitUTMI-16UTMI-8/home/jsg/u-boot-2015.01/drivers/usb/musb-new/musb_core.c, dyn FIFOs, HB-ISO Rx, HB-ISO Tx, SoftConn%s: kernel must blacklist external hubs %d.%d%smusb_init_controller failed with status %d Failed to enqueue URB to controller MUSB host is not registered bad parameter. Controller uninitialized gadget_start failed with %d bind failed with %d Could not flush host TX%d fifo: csr: %04x %s %d: rx%d, packet/%d ready? %s %d: broken !rx_reinit, ep%d csr %04x %s %d: no URB for end 0 %s %d: bogus ep0 stage %d %s %d: Rx interrupt with no errors or packet! ** Unrecognized filesystem type ** ** Unable to read file %s ** ** Unable to write file %s ** bootfile** No boot file defined ** %llu bytes read in %lu ms (%llu bytes written in %lu ms** Can not find directory. ** ** Cannot support non-zero offset ** ** File not found %s ** Extent Error ** SI ext2fs read block (indir 1)malloc failed. ** ** SI ext2fs read block (indir 1):malloc failed. ** ** SI ext2fs read block (indir 1)failed. ** ** DI ext2fs read block (indir 2 1)malloc failed. ** ** DI ext2fs read block (indir 2 1)failed. ** ** DI ext2fs read block (indir 2 2)malloc failed. ** ** DI ext2fs read block (indir 2 2)failed. ** ** TI ext2fs read block (indir 2 1)malloc failed. ** ** TI ext2fs read block (indir 2 1)failed. ** ** TI ext2fs read block (indir 2 2)malloc failed. ** ** TI ext2fs read block (indir 2 2)failed. ** invalid extent block < ? > %10u %s Failed to mount ext2 filesystem... %s read outside partition %lu ** ext2fs_devread() read error ** ** %s read error - block * %s read error - last part error: overflow occurs Error: Invalid FAT entry: 0x%08x FAT: Misaligned buffer address (%p) FAT32 FAT12 FAT16 Invalid FAT entry error: wrinting directory entry Error: reading directory block Error: %llu overflow Error: writing contents Error: flush fat buffer Error: writing directory entry Error: finding empty cluster Error: clearing FAT entries U** Partition %d not valid on device %d ** Error: FAT sector size mismatch (fs=%hu, dev=%lu) %s%c %8u %s%c %d file(s), %d dir(s) Error reading cluster No current device Interface: Unknown Device %d: No valid FAT fs found Filesystem: %s "%s" reading %s Error: non zero offset is currently not suported. writing %s Can't list files without a filesystem! %s/%sCan't load file without a filesystem! invalid distance too far backinvalid distance codeinvalid literal/length codeincorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid literal/lengths setinvalid distances setincorrect data checkincorrect length checkneed dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionFDT_ERR_NOTFOUNDFDT_ERR_EXISTSFDT_ERR_NOSPACEFDT_ERR_BADOFFSETFDT_ERR_BADPATHFDT_ERR_BADSTATEFDT_ERR_TRUNCATEDFDT_ERR_BADMAGICFDT_ERR_BADVERSIONFDT_ERR_BADSTRUCTUREFDT_ERR_BADLAYOUT1.2.3Error: inflateInit2() returned %d Error: inflate() returned %d Error: Bad gzipped data Error: gunzip out of data in header initcall sequence %p failed at call %p (err=%d) ERROR: Failed to allocate 0x%lx bytes below 0x%lx. .%03ldlist passed to list_sort() too long for efficiency ## ERROR: unsupported match method: 0x%02x Env export buffer too small: %zu, but need %zu himport_r: can't insert "%s=%s" into hash table WARNING: '%s' neither in running nor in imported env! WARNING: '%s' not in imported env, deleting it! %s %llu Bytes%s%lu.%ld %ciB%s %0*x### ERROR ### Please RESET the board ### %s:%u: %s: Assertion `%s' failed.%*llu## Warning: gatewayip needed but not set ARP Retry count exceeded; starting again bad length %d < %d *** WARNING: %s is too long (%d - max: %d) - truncated Host NameRoot PathOpt Boot File*** WARNING: using vendor optional boot file *** Unhandled DHCP Option in OFFER/ACK: %d DHCP client bound to address %pI4 (%lu ms) DHCP: INVALID STATE BOOTP broadcast %d Retry time exceeded; starting again ethact%pM%s%daddr%saddr/home/jsg/u-boot-2015.01/net/eth.ceth%dmacskipethmacskip Warning: %s MAC addresses don't match: Address in SROM is %pM Address in environment is %pM Warning: %s using MAC address from net device Error: %s address not set. Warning: %s failed to set MAC address Error: %s address %pM illegal value Board Net Initialization Failed CPU Net Initialization Failed Net Initialization Skipped ethprime [PRIME] Warning: eth device name has a space! ethethrotateautoloadNFSnetretryonce ICMP Host Redirect to %pI4 %d.%d.%d.%dnvlan*** ERROR: ping address not given *** ERROR: `serverip' not set *** ERROR: `ipaddr' not set *** ERROR: No ethernet found. *** ERROR: `ethaddr' not set *** ERROR: `eth%daddr' not set Abort Bytes transferred = %ld (%lx hex) *** ERROR: Cannot mount *** ERROR: Cannot umount done *** ERROR: File lookup fail *** ERROR: Symlink fail Retry count exceeded; starting again T /nfsroot/%02X%02X%02X%02X.img*** Warning: no boot file name; using '%s' Using %s device File transfer via NFS from server %pI4; our IP address is %pI4; sending through gateway %pI4 Filename '%s/%s'. Size is 0x%x Bytes = Load address: 0x%lx Loading: *octetblksize%c%d%cFile too largeFile has bad magicblksize TFTP error: First block is not block 1 (%ld) Starting again TFTP error: '%s' (%d) Not retrying... %s; starting again Retry count exceededtftpblocksizetftptimeoutTFTP timeout (%ld ms) too low, set minimum = 1000 ms TFTP %s server %pI4; our IP address is %pI4fromFilename '%s'.Load address: 0x%lx uclass %d: %s - %c %s @ %08lx, %d %-11s [ %c ] | `-- |-- Class Probed Name dmDriver model low level accesstree Dump driver model tree ('*' = activated) dm uclass Dump list of instances for each uclassraise: Signal # %d caught $( w U-Boot 2015.01 (Jan 24 2015 - 09:42:44)  JJ  5 266T[ 26L6T[Et ƃtLt@ۃP,_vXv8]vbv gvjvnv tv ⶄ  zv t::;:= =p D_?t?0>X>P? ><<<`>< ?>t:d >h<|>p>[addr [arg ...]] - boot application image stored in memory passing arguments 'arg ...'; when booting a Linux kernel, 'arg' can be the address of an initrd image When booting a Linux kernel which requires a flat device-tree a third argument is required which is the address of the device-tree blob. To boot that kernel without an initrd image, use a '-' for the second argument. If you do not pass a third a bd_info struct will be passed instead For the new multi component uImage format (FIT) addresses must be extened to include component or configuration unit name: addr: - direct component image specification addr# - configuration specification Use iminfo command to get the list of existing component images and configurations. Sub-commands to do part of the bootm sequence. The sub-commands must be issued in the order below (it's ok to not issue all sub-commands): start [addr [arg ...]] loados - load OS image ramdisk - relocate initrd, set env initrd_start/initrd_end fdt - relocate flat device tree cmdline - OS specific command line processing/setup bdt - OS specific bd_t processing prep - OS specific prep before relocation or go go - start OS󅄀22G{22N{22_愀 22V{@22^{22b{22g{2222[addr [initrd[:size]] [fdt]] - boot Linux zImage stored in memory The argument 'initrd' is optional and specifies the address of the initrd in memory. The optional argument ':size' allows specifying the size of RAW initrd. When booting a Linux kernel which requires a flat device-tree a third argument is required which is the address of the device-tree blob. To boot that kernel without an initrd image, use a '-' for the second argument. If you do not pass a third a bd_info struct will be passed instead p[addr] - run script starting at addr - A valid image header must be present For FIT format uImage addr must include subimage unit name in the form of addr: addr [-c] [] - Set the [control] fdt location to fdt move - Copy the fdt to and make it active fdt resize - Resize fdt to size + padding to 4k addr fdt print [] - Recursive print starting at fdt list [] - Print one level starting at fdt get value - Get and store in fdt get name - Get name of node and store in fdt get addr - Get start address of and store in fdt get size [] - Get size of [] or num nodes and store in fdt set [] - Set [to ] fdt mknode - Create a new node after fdt rm [] - Delete the node or fdt header - Display header info fdt bootcpu - Set boot cpuid fdt memory - Add/Update memory node fdt rsvmem print - Show current mem reserves fdt rsvmem add - Add a mem reserve fdt rsvmem delete - Delete a mem reserves fdt chosen [ ] - Add/update the /chosen branch in the tree / - initrd start/end addr NOTE: Dereference aliases by omiting the leading '/', e.g. fdt print ethernet0./bus [muxtype:muxaddr:muxchannel] - show I2C bus info crc32 chip address[.0, .1, .2] count - compute CRC32 checksum i2c dev [dev] - show or set current I2C bus i2c loop chip address[.0, .1, .2] [# of objects] - looping read of device i2c md chip address[.0, .1, .2] [# of objects] - read from I2C device i2c mm chip address[.0, .1, .2] - write to I2C device (auto-incrementing) i2c mw chip address[.0, .1, .2] value [count] - write to I2C device (fill) i2c nm chip address[.0, .1, .2] - write to I2C device (constant address) i2c probe [address] - test for and show device(s) on the I2C bus i2c read chip address[.0, .1, .2] length memaddress - read to memory i2c write memaddress chip address[.0, .1, .2] length - write memory to i2c i2c reset - re-init the I2C Controller i2c speed [speed] - show or set I2C bus speedޞL22Lt22➄ 22构22v22랄2222񞄀쓀2222iX22`22wT22،22@ PȀ22idǀ22dƀ22|ŀ22ⴄÀ22ń ŀ22➄À22À22ɀ22addr part [dest] - extract from legacy image at and copy to addr uname [dest] - extract subimage from FIT image at and copy to _愀22Fӄ22󅄀G{N{_愀V{^{b{󅄀G{N{V{^{b{?ӄ22ask name [message] [size] - ask for environment variable env default [-f] -a - [forcibly] reset default environment env default [-f] var [...] - [forcibly] reset variable(s) to their default values env delete [-f] var [...] - [forcibly] delete variable(s) env edit name - edit environment variable env export [-t | -b | -c] [-s size] addr [var ...] - export environment env import [-d] [-t [-r] | -b | -c] addr [size] - import environment env print [-a | name ...] - print environment env run var [...] - run commands in an environment variable env save - save environment env set [-f] name [arg ...] @+22y(22dۄ@T#22kۄ122?ӄ-22pۄ&22wۄ@@%22؄@{22#22,(@*22\pQpQxQxQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQRRRRRRRR R R(R(R0R0R8R8R@R@RHRHRPRPRXRXR`R`RhRhRpRpRxRxRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRSSSSSSSS S S(S(S0S0S8S8S@S@SHSHSPSPSXSXS`S`ShShSpSpSxSxSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSTTTTTTTT T T(T(T0T0T8T8T@T@THTHTPTPTXTXT`T`ThThTpTpTxTxTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTUUUUUUUU U U(U(U0U0U8U8U@U@UHUHUPUPUXUXU`U`UhUhUBل܄܄(s*K>;UU4UUS?DC;=\E;_=DC;t=\E;Q"% 0WVVVi\][0_^lZZmtmdW  |WXW WllWWWW@@ W B ,X  `d Yml^^Q5XmYX   @ Yml^^Q5XmWXXEthernet Gadget @ Y Y W      @  @  @               @ႀX₀ႀႀ!001111XむD`Lむtむ,む4む<むDむLむTむXむYꄀ622&54422ل@+#لHل>C_`f2\A{2z\A{23ф@L@${`8L̀y@xCy,>$(7膄g2ȩVbLt<Τ㤄Tӄ@XӄpӄX̀4344>@h.ڄ1ۄۄ@jۄ@$FۄMC\kH2OkX%k0VTk])k0Vk؉c@(ـi^τxτLlΌlč,4l02l؉틄l_愀p A@?ww朄Ԅ@ԄՄ΀@SӀ󀄀˞ϞFy@By'zфDфL/5ZSԚ@#袄d@#ՠ@󡄀#构)00v).ീ랄譀𥄀ۥ7€;JPȀ𦀀Rd̀V񞄀𭀀ۥń,΀OòFUڄ@@%^ڄzڄ@S2ww2؄@{؄؄6}ۄ#ۄ2+؄@*للºdπźںu@uu膀؉<€ +e@@ф ффր"60@8ـ߷p̀跄E@0ـJ|䀀ńńUńD　]ńrń($T2apXC7Up K Dap@=apL=apX=apd=Upp=Up|=Up=Up=Up=Up=1wdH8]tW&9傄YBwLLӄkMτw0PH, 0PH, 0PH, \쁀쁀2 FHF $(,0488<D$ ( ,     D H L     48@TX8Xx@     """"""#8$<$@$D$%%%%()))\1`1d1h1l1p1t1x18 8$8(8,8084888<8@8D8H8L888888x9|999999X:\:`:::<<<<==>L>P>T>>>??(??D@H@PATAXAxApBtB|BBBBBBBBBBhClCpCtChDlD EEENNNNNNNNNNOOO OOOOO O$O(O,O0O4O8O??EEE E$E(E,E0ExFLKPKLL$N|NNNPOTOOOOOO PP$P(PQQQQQQQQQQQRR0R4RHRLR`RdRRVVVVVVVVVVVVWXXXYYYYYYYYZZZt[\\\\\]]]``````````````````aaabc4cpccc$d\dddeDeffffffffffffiijjj jjjjj j$j(j,j0j4j8j(k,k0k4km m$m(m,m0m4m8m >$>8><>@>D>H>L>P>T>X>\>`>dBlBtB|BBBBBBBBBBBBBCCC C$C,C0C4C8C>> >$><@(J4J8J?00?/A-p`_0P0PSE@ @Gdd QX0@e@0 D 8GX0e0T*6O@0?AZHZ/@-kP/-^ \0 P"/p0H0,+ $ / IY60 ,0!3(S(0`0/ IMb00(0, " # b / I1Q@-@d@-/@-@L1VP00 0 ,0000000#40Ѝ'[ 8@-0H@LP$J%ZT*@8?00?/@-1, P R xV4@-`@Pp00n000000 0 00000U\0@P4}0@Z@-n4@ M00  00 0 @ P x0="`0 Ѝ`-@-P0BpS`" @PV lP ` @P  8@Pٝ @2W2[5[=[B[E[@-0?@@hP@0*@0 @T0hPX`< ?H4P4X4H8P8X8*H0P0X03H/h hQ?;8Q?0?00??10?/@-,@4P@P(PT@@- L0, ,, ,0 0(0* H 4 R0U%H @H LH@1H@-@P40(0 dyP?T@ @@-~ 0 P 0 VX[][c[80-p2 @<0@<)0,00$00^:(0( R: ( 0c8*S`+S"S (#S D @ S0,($p0H@H2H1H@]I6n$L0P0 <0P0 ,0P0 0P0 00/$@]IM- *J`@=V00@=p2`0R0@0p2p296 P10*Sp2<p2J9009p:<BpPF =L*00=4:4*@188@1@= >3=@=@-688@=@= <4@=@=@0@=@:<<@:@:00 0@:@: 00@:@:00@:@;00@;@<00@<= 02==P)0=@98P5 =00 0000020@=00 >3=0 6 8800<400@00@: 0 0ȟ<< 0 000 0 0 0 00 0 000 0`8? 00@>@> ?<4@>H= 00H=D-:<4D=D= 00D= @::6@:=l'8=\7${=X'00=87`pP= 00P=L-:<4L=L= 00L==&0=6Q0&0006`pD0 00D0@ :<4@0@0 00@00\&00<6+D9  00D9@):<4@9@9 00@9909c P 5|@or P pE%90095T 0pPJ =\%00=D5D%@188@1@188@1@= >3=@=@-688@=@= <4@=@=@0@=@:<<@:@:00 0@:@: 00@:@:00@:@;00@;@<00@<= 02==P$0=@4]8P5 =00 0000020@=00 >3=0 6 8800<400@00@: 0 0ß<< 0 000 0 0 0 00 0 000 0`300@>@>00@>@><<@>@><:@>H= 0 0H=H= 00H=D-:<4D=D= 00D= =6:==$"8=2="00=1PP= 00P=L-:<4L=L= 00L== 02==!0=p15 P( 0d!000@1P`D0 00D0@ :<4@0@0 00@00 0200 000}0D)  D)@*,$@)@)  @)) ")) )@ @0]@0 @00@0@<0@0,0/) ,  a, ,0#88,0, //4,  a, ,0>0,0, < /<048<0//<00C<0< D /X0S X003?:00`0`<  a< < `\ /<00C<0<00<0< 8 <00C<0// + /@- ,0 46@0D\ @-R \X` \ X @-HB.h@-BBQ` ?B6h@-  @@>hZ@-@-Q< X B< < X 8///8@- 0L T0@$ P (B8@-0(/@-!( K(0 @(4(( , @-  eP// 00b 0/ ///@-Z@-AGh@-0*[@-d\@-J@-M@-Oh@-A,hXh@- A%m`h@-݉H L Hs@-PX`?P@T@P404`@@ 0PЍp'j1jx>5jE-PB@M` 0@0p00^U00`0  *`` xP0 ` c P :0 ^0< 0005Ѝ贊x>@-M@p`d00Ph0 00GPX l0 0p0@00CIPP $;@lL Ѝ贊;l`l@-@r/M-(M`L@HP 000 w.4>FF [00 V $ $ūFpJFTPpFP P=?P T0GPp9? 6到R ?#'|EP?F[ d?EPP? D? Q] ,?p 0 p?oT0̵S6 ZFP P 0]00\00^0GLG0X`0]00\00^0 03/@00L003?X00_00T _ RR $0` 3G00? j?D R03?`0S ] 4RHpP` X ` '0S@0P0 03?T0S$0E눴@ 0p D0SS 0H=?| #]0A00Q0S ^0SS00 P`c H0\Xp0L00P00T0$0]ME[ [ 50Wp?h?8$ E L> $07P ,p>0$   > g,0 W0#03[W ppRS} >pD0S "0S> >s XH p>w8 h x00dt0 aFPot$ < x<  pᐰl G p 1GP\^ 00P00S*@: @ F  +0TpX ww   01@ 0;/pP \>&X ^D^ ^>`5X a 0;/pP   0;/pP Xp(Ѝ贊lll'Viiii jl&mImimmmlmmmnfnnn ooPo"oA-`B@pPU U@P|@ P @-`@$>J4//jo P!@-P`@E<P  Tp 0@6<P L`@(="4//o^op@-`HP@<P 4dPT$";`03/p'j o PE-4@"0pS 0  nC0S X`PP]U`? 0`rD;@`P``@4=  04/ Ѝ^o@-@ll`p0PQ 0$ E EP(l qpP;PP l`0x00h  PP LO= `l ,F= 5=Ѝp9p^8pI@pSpp P@-//@-@p`P0 qCqnqA-`P ,@P P ?PP KpT ?PP  G00 P`e>T:z`P 00`pzP 8/`P J>R; P; E-p0P`S @0P @@T% W0 s R @0 S T ,R:S,S S 0S P :T"!* @//+ R :R@0P0 R 8MP@e@ w00Y00/E-PP`P@pP@fA P PUᅁ贅8@-P(@(( 0-8}|X:q@-(M 0 @p 00 0(0 0S T P P  0 (ЍX:A-@㤀M`P @0pS x8:@P` -P 'P P P00܍,!ErqP- 0\ X\<0Q P DRK0 0/8@-P(@((g 8llX:Prp@-PQPp,`@@P fp ;p9Y\rp@-P=P 4`,@P fpq;pp4Yrp@-(M 0 @ 00 0(0 0S T0 P P`01 (ЍpX:30A-@0Pᨀ`00@S@p 9@Pt vP pPP @$010 0ЍG0!rPr3M-R0@2Q`P@X  0JS|TtȂ|0 $ 0p% 0 0 RZ Sb00S_ppXWppP00 ATSYS00R  0FS00S>ppppg;p 0  0\- W  .RR&pW,p0  0W  S 0R XR \  :RRp\ pw0 0{:.0p p)X :X # 0 i:p 0 @ \@29 P@X Y: P < 0 ,pK:Ѝ9YrsQs1sis  $ /LE-M\MW`?`9P@4P,:k@P@*#:p帠&X㴀W018#0 UT0x @e0P X `D2   bdP 0@PHT@T8@09؍\ЍPxes8-s' js0M-Mp`M_`W?`" W㨠&X@018#0 U T|0 e0P     lP0@PT (88؍`ЍP's8@-@t8P[@P 0RC?Px U O?P` 0ST @@1Q@  R,~988@Cl'VssssttR@-D @s9@9t0 i9ut0@-M@P,@$DH@DUP@PP  H9T  l@7 P 69f197,9)9xp,h@`8X<Ѝ0ttttttt*[ttttuu+u4u>uHuOu@-@HP 8P (`{ubDuR@- R@P@ P P  ;0P8@ uuR@- R@P@ P P  *0P8@ uuE-Bp`8@T 4 4D|PRS0.0I.O.,DL81S<8PU 8@ Ѝv|>w$E-pPUUA 8p`P pp@U8\0H0`PpK8H8PW b8YwR@-0 0c@-֨ Ѝ@- Ѝ@-p Ѝ@-ܨ Ѝ@-d Ѝ@-帨 Ѝ@-ʨ Ѝ@-R ЍR@-Mp 8P@ @0YL`P pP  07ͺЍzzE-RMP00ʂE@2`` 04LP) pZ@P  07 f a0 0 0?P0 (7!7@Ѝz{B{p@-P@T7y`P0l7 v1QP 703?S 017(@7@ppjfQ 00S SSt 0S   QS //QQ/QA R/KE-@QP`P $`=7VV 77`47`PE)7p@T E-7`*70Tp堠@DADVV`1 7l@T`7HpHV DV@`  7,E78# 0P4 RM-PM#p0aS6`R\=0S 06 3P2 8 G50  mP00##P" V4  _ 03?R*  6%P! G 6\0@S 6`| H`P.X 7P  .X003?  $  2/P0* 6 P;   PX @OP jPd 0sSX 0X 0o 0PH 0 <R(˟ `P0p0 # >Q_ WQp!   0 ` h0R0 ќ  Q [R)l lʟP0`p0 # ]R R  Rp!   D  0`0HW 0]QdĹ`  0 0T0X`10 0` PL49` L9UP?e@ CgSX00`7X0sS `0P+PnU sUXPP9 0 0P`0& nRp0  7 0pP R R PUnR  A 0P0sS 2'0 9`Vp 2a0vS#P V | 00V00S @ 0 @@sT  2 eaS   sSq  ` `r2lPCPlS ``XĦ X PP  pPU @6 0 `V@  d5T 5 F8 0@SYTx .U0 %P e0%\ 4PU?ڨ40pEWP7!e4WP0  p10 3P P,.U e4U e4 S4 e4Uup :PyP 4X 7`P\`P D0hSA0,cP1k405_1 d401_40 1Z401U4R401M4U01F4U 0 1?4U0|$184(d34`14X `P 00 PP     0o} `PL00pS!Pp33Ui 0P`d3\$0TP 0 0003aS   0`P:` dS _*`P+Q3* ZP`H`XP  D ?P  $<`P`PЍ -O~  @iKÁ݁ӓ!g!4+<X^ebmzCłԂ/=Tkf>҃#=\%ߎM-p` $P.@PU  0M 0P@-p`P`p@ -@T 0 3IQM-(M@d`!PpP@[@ T 0 ! S R[@0h 0.@Px0 8P $ 0 S@P  0 H@PWl6? $0P 08@TF026o `(Ѝ9pʄ݄9 s@-Py@P0th d@P\0`PK< 0@P2ЍpJ9p^Z7@-P@#P  0 Ѝ0@f2 Ѝ0SM-P8M 0Y2_`-@Ph dRX!@PM00  0 q 0R X8:P8: p_7'L pcp@P, 18Ѝ訅,Hp )@- a 0 ЍM-8M,pPE.0P( (0P; (=`(PF0@P2    0PP T  VpT @0S@PU00 X 0P.0P0 8 0& ((`8Ѝ-*['[6QKAA-PPM+ |@`pT 0Y SR@ U@ 02A- 3? 0 >0@d4?00@0PЍ@- Ѝ@- Ѝ@-岢 Ѝ@-凢 Ѝ@-pTMP `@NPA0o       ?1000D&1000 P0MP  1TЍ?qRRE-M@`pP P@V @P P `PHU 0SP^JPU 0X 000M 0S`- P@ @UVU@ qP @T  _0 x 0T 0o@0002JUD 0iS cS` <sS tS` 6`` 0SLP E@* L@p@ 0V L M@ V V@ LOoB LH 0k0w LЍ/ *RA-P`@B 8p=P  0A//*@-M@M0NA-P@NU`p `@0VPU00S UW u NPP0@PU 00/W0 0o R@-M/ d d00b` C1P@:H/8/M@P  /,p.?ObR@-N@H/ _@,/M@P /脍R@-@pP@gDAPU! :MP0( /x/ @g3DAP`:D/!M0 ( //p.׍f?0 .R0@/R 0S/RE- P ` p @ P ЍE< `dwpPQ0  @@fM P ((;/   ЍRA- % @ pp`PP   0M P /ЍR2E-MP @ pqP`  P1#UO  z@ w0L P $$.iЍ/A-BQ3P @X pS`6Pp  IU@ A@00aS0 00PL P . *ЍRnM-p1!M⬁`P@ ` 0= @  pPP`H4a. @ 0nL P V. T1! T!I.;P[pP T  T0p3?00pW  @ 0PL P Pd%.[PW0P 0`Ѝ/ e~|M-R(MaP@ Zp`  pPhP@[  y`V ppp 0K P -# - R -  WP-0S 0 A^R|-t-00 -`gV0 0P0@0(Ѝ,,"(6_RM-< P  p@Pp  P D` k- 0dS0 00tK @PP-`Z , (R-M- Ѝ.w_/@-@ *R T T T A00*S $S/0{S 0 }P P/00`+/M-Paph[ 00U  @PMWI0UpP W@ꔺĺOoB7@@4O2PP!@O+` W" (8HX@`OoB@V@V@@V@@ V@@ V@@@,Ѝ(7R @-@; 0R 0 wu,o/ᙎ@-@@P 0 P PDub3R:A-`P@pW- PX :X P 0S Q 1/ 0S 3/8PP@%`/4Ơ0 0 0 /DXP,0 (0 $0 0 0 0 /HhDLP ,0 (0 $0 0 0 0 /hHLD P@-9,P @#,p@-AM` =PP@  = P @P@L>H+ >8>] +)Aލp?qXo00S 0/DP 0 R0S?/&8@-808P@T@D+@P +8`$$M-`2MP@F p+Qp   + R[ RX  R R  d L!Q?Z+P E 0g S @ 06;P9@P)8880 pe0T0C@!UP1``d 0`d.+T( 0S`dQ..+2ލ0,oo8@-P@_)P 01S0 0U0@ @l*md@PA+P ,+@Tu0*8 *0P80,)Mkx>M-M,@P')Pや  l0T0 cT \P 0Z *P OsP K* P|E@Pl * T9@PD *s $P*&vf#&6F &0P%P%PV`0@E0 p`5% *P PP'*`t *q pp PGuP UVA*e v`pp `F pv``Fv5*Y p`*p `Fv`R p_0p @p&t*p H W30?0 0RpAh*0p; D[p`F4 R ` 0@R0  ?R@3/h4 VL$ R  003/S[,4(0 R $%0%5* W3pp?p pP+*p P `0`0#00 00N0070`00 ;0 PPdS[{0 008#0# 03 4#<3 R0C  # 0cS`MS~  `H S!  `C "S` Br  8 " `@Q  ?Q@ tS` @  ( l"S` B -   D"S `$"#  SN C  ` R10 0 ` R ` `"0 0 00~0000p0 00 00Y00 p0`0 0p0~0`0#0`0 00Y000`00 B[,1 0PPed@)P s)@T /)&xP@&)@!)0Z )P   cqP K)PЍOhE@dDX`$\H%TPox>kBQ'A-P`H8pP! }x0 @@vV  n0P:W W㰀0/pR4p@-P8`P/ O @JP V0V00V 00S: V 00S: 0S 0/pM-Rp̠@` p(Pp7@P x [``  a0  0``0@Ѝ|4,lpRMA-Mp7@PFTQ TQ 1TQP ` ` ` p0fW T  T  ^ h @` 0 P@`P(0p@4 '/Ѝ<CHMpVR@-(@  'pR-@-`97pP( n@ P g@ @ aP0 c T'W W0Q*/pR@- 0L  ЍeRM-I(`$p@P 6PP; 0@@{'U Uq'4P P`0-S  00S U UW@S@PW 0eW 0@Ѝxtp ғؓ(p@-`@EV pP O8P*'PdpM-P@p 4@D`P 0TWPT0SMP004&  0M/<,8,p@-`PH@P,&pU00LPp論@-0o8,@- +MR@-1P R@ ^P`R2 U PPP`&pPHl0l P@` &T<0P^0S8&0_ &8,ΖŖȖ,@-D@P L0P 0S ;: a&8,NRA-@- @ `pPeP@  0hO&.GP@PH&1 3/404 @T( :&@T@8,cȖŖRE-@3 @ ` p P&P@  0l&FP@T & 0@ ;@7t@@Pt@`,P@t@?T|ŸQ 0  养  ]Pv@Ts 0` @PP1 R "@"PP U@0 @JTPVPD PVǶP@ 0P:` P@TPC*L10V @8AP PL0!SR00C0@ 0 0000T0C0 pA@P @?Tq 0tu`Ѝvuآà$ԚКʠ/F}fɡ͡)-`x8@-@PH08 R<80PP8 @8P!>1?@-0P@P#`tQڄ0|`80p@ @"%{PxHu@r80(@PZ_w£ϣA-p` @(PG0S 00S ]P( 0P!0 0Sx 0  @02# QP:,RЍޣPE-PM@`0P4p  0  02# #p 0P.Z   0S 00S  R0hX @02# QP0 ЍP$LWcM-M P`;U0P0P@  Q00@0X@GPpAP  X;80S p81pPU P0S  ~ "PP0S:8 R P Pq 0%%SR*x FP %b% 0` PUp < o0 roᨂ P _0 00<0޴\0 H  ʴP0 ôP0 弴P0< 0Ul `00h00P <0cX0P P0( @p┳$%p匠'&'@00H0S X 00hPpL8PpT ゴPU  r|P$ p?%h\8X pPpp@@`P,pr@Ppgp0 0c p<帴`匀 0 5PQeɤϤäҤڤȖŖ?q09KQդY{Φ$ӦsJ +]NaiM- M`@.PF@P d)P T$P DP 848  px0 0'0p0PKP \6@,7P@9 093?@00 P  0jKP `;9 8H4:80 @Pt@ Ѝŧx>RA-MP@3R ``ỵ0S 00S% (P" 0P000S KU=ʂ4 㛵0   d!!!  Q4PE6U%x,d6P {`-P rP`p j P` dp4 "5U56 NPHP80SD670 00Ѝ*P=H_E-p$M4`@PP  '2T T T Ov @5Z1  1 ýPV@PPQQL1P ͽ801P Ľ0S 0S z0P ⯽q0P ⦽h0P ❽_ R YTQ <0嬾RWH@PRTP$ЍOhx>&l&Ш&ڨ(&HE$&t%&H&WTQp@-`P@+0 F@#pRp@-M,@`lPP0F`FS!P 0 +PV```TQPP V *Ps*PPЍp?qĚ *R@-@ 3T T &RRA-ppP`%V@5 V /P 00+S &S *S %SY/S -S` ^S |S   ! AE-M`(R0 0FRpCB  ij 1:Q  㸳 0.S 㯳W$  㨳W 0 | 0 Q 00As0 S70As0SW0As0S< 2 00  Q0 `0@00'_pP &t_@P000 0`@P` 00BV`ld_U_D@Ѝ@<8Dˬ@Bެdf//RM- P`B@p0 "  V 00P  VZB Q񟗀,`@"?o2n00h?cPA - (00`?o2P  00S0C   0S005  0S00'  0S00  0S00 0M0R R Rp' W?o2U000 USX00PPp`j AVB0oЍ(6P P :P Pd/ P : P P D/@/</8/4/0/,/(/$/ͮݮP8@-@P P P9 T T0U *8@U #@DzTT\dlt| |xctaUl h5:PU` H8@HRꫮ06+?N]btEZߍ8@-P@P80S8@ T8M-@P~p`$ 0S0P$Q 0 S/ \!0C\\ 08Z0  C (X 000`|    H`!00CS !10 ᘭP ` 0 ፭PቭPl9S` 9VP `Ѝͯ8S(.ůѯ8Q/@-M?@P ݍM-P1@!  1001 01S l\{X@p1WE@r !4n0l!"#!f$1S a$\`%1X#*  O+10S S SC-,1>+10S.7D4 `p@$ЍM+. Df'bv*ϰװ% @-@!PC10(pH`s#4 P  0ᶬPᲬP1S |!Lh!T!HC?B/0 ! s#4  Ѝ+8fCbRA-8M@` PaPQP% |61^p6 `JP  LD@P @60S8f  ,9@P kPP @uV Em$Q ㊬H@ T @P$V HPP 1SQ@ T PPWPP<- 1S95 @PkV} گ`pP  ѯ9P`ڸ00SS JS FS" %KS PS kS fS jS pS sS @P4P (P PPV h0Vd1  v` #0 0 d `  6p |yP @ \p@P$V@P `P 0S U@ %P M 0Pz 0S q%T<@P&8r0SgV / * `% @T0i  0d00pP0`0` S< (y&=P>0%=0舓+p@-&M0P ,`@` 000p舓/M-Mg@?@PP lU@0`1 |0 h 0 00P$yJP>0W101 & $ AP 71S|00 S0 S @S0 00h0d0`v```0`` ` 0PT p) p 0P Pvr  ⒨  PB? 1 `Q! Rwa `p"Qlsvdp 0PI0<9@m R Q6 0QN Q 0pE? 0R R)QG0 S aVڰ0 1F?00 ,0    v0#&! &!R 8 0>00 0 $ "$ RQ00Z 0 n@1T '` 1V `1dh !0000 0 @P+(p l@p@H`⮧ ᪧ 㦧Q  0.Q  0'Q  0 P`)y PߍPֹ:Jpĺ 'ݻ"s@- 0@P` @&-c00&M TM  Ip@p P`@ $P V pf6 00\$ TLH 0S4 ЍpZdǼܼ/@-r qh0 1  #0d   \Ѝp@-@ `P9T@ p@蕧@-h0q10 0 d  8Ѝ@-r qh0 1  #0d   %Ѝ@-)h0r 10  0d   Ѝ/0 /E-M?@P?@`p G P 가:pW 㰀Ѝ@-MGp`?pP@ P90 0  ?01S )  Pc H D , R   R   R  Q ( $I irP [0(9 fЍ "M-.M0`?`S ʨr @ePPx)  Z UP ? 0 4 0#40  0 p01 S00   R0p 9h0 d 1 0pp` 0@P9Wp&꒎p9W5_0?00` P%0尰Რ 0* ѳ7P .      p  0 S0S .ލ%0F?0 \ \ 0S 0S 00S2/9 R  /@-@M h01  }/ !0 P09h0104 eh014 [ߥЍp@-(M`@ P< 0000h01DP  !0}/  t㾥h0104 /h0104 &(Ѝp@- h01 }/0  OЍM-FM0WD"P`@??Pq0 RW3p$ h014 7 0   0}/  0PPZ0Z h$P0 PW000S}W  }/ P9 W  P9 P 0p v ,?P `0R0 0CS 0S C/o0"S00SFߍaUSBCUSBSM-0M0!P!0R3 h0h@@100A 4 @4 @G0000S0_ h01 !0 }Ϡ P II h01 >0 I?`V< ሠ,  V 0 0p 0,0 0}?00$$ 9S  $0 $0 9,W ,W [K , pW `V0Ѝas@-0% @0`$0S  nPU0 S hS ` 00 R RR 100c!R RЍpFM-MMG`@?`Pp = 0Sq  p 1#4L01M01PS_ R09,03/Y 0S ဣ000რ20000@00 R0   00SS0S09 B0S$R#S! S X L@ Mpd ۣ  pW L@ M(& PKep@- \@P`!00020000@00 00003/`p@M-PR Miq@`p00P  t0r# 0R 6X!t0p!"H1 0*@ T A00 ۢ 0* 0 0" 00 `000 02/0P pW0 W(,w`6 o#X(lt X$ &$    + 00S00Pg000 Ѝ@M-PR Miq@`p00ZP  t0r# 0R X!t0p!"H1 0*@ T A00 g 0( 0 0" 00 `000 02/0P pW0 W(,w`6 o#X(lt X$ &$    + 00S00Pg000m Ѝ@00P0t 0 /\0p@- RL`P@0T4td <@ppӽA-`QU Psp'F 0S 00CS@4 P`P 0 0 0S 0 :PS\100X1T100P1,000F0D+! R*!   +! 0 R!!  %!%  P PP 0S 0S 0S 0S 0ASx P % R % h0104 ,0$9PIHBl@Gl'Viilii j&>\fn}oRA-@MT`\ PPK 0SHDX1  $pP+ 0S( !@DT1!  T T    @C0S 0 0P . 0@S P@ `@  S 0HD@0@l@Ѝ6P67@-PpU`t @000  -RPE R fRp PEU 忚P@<9X:@-04!RA-P`@B 8p3P  0A//@90@-@P,M0 0 00000@ 0(0K@T X@ @0@4媚PP,,Ѝ0X:eR@-@  -Q  aR@D0T P`pP L LmP,`bpW fM-@MP pPEU* 0-S(0S dS bS cS rS tS PP pP p@"][Pl W00S @U` 㦡PUPP U#&0PfQQ SVP Z PE`   ᵜ0P @(@@ @ `0ᥚPP0P P0L0*4000Ѝ<.UkX:>I @- BR -^ ^ a^ f^ R Q <z ,R \ @,E-,MpXP`=4Ph, 0 -RH R fRp H(!X0000S@ 9o6 Z@@}PN& Q0  R QS C00`0@`0(0@ pԗ0S(0$ &,Ѝ<9X: R/E-@0MRp00 0000@ 1B 矠00SpGa`WP@  0X媜X@ T?0@C?@ 02D01D VVa940V  ÷0S00;ߍA0/<9@-H000 00 Q 0S  ЍU@-@@@-M @ĠЍM-P @@M p EZ6` -R3 R& cR bR (sR tR #T TpEZ _ `T p@0 P<RIG X  SWPE` P `0J P0 003 W j!p[@`P 0p 0 0h @,PPX0XX 0T03[  ޚ,e@Ѝ<X:0I\ o@-PP@p`W0@=S0S=PM-pᰠ`PP@P T@PPfPwP U@fT 00E0@-@(M   P 000 0(0 @Ph Ph(ЍX:7@-P@P "0S Ѝ08@-P@P  8@8R@-M@ P  <咟8  Y P /܍ߍ 0/$ 0R 00/L@- $0S 0/L@-P 0TSYS001P8@-$P@  $ t$P@8@-@P 0!S|@@d0@0-0 0HHۗP<0<< 080{0000ЍX:LH* @-0-00 0  幗ЍLX:Q0@-@M   妙0P |@0000 0XL 嗗@P0@00 8088 0400(ЍWX:H`* @-M|`0@pPp#h` @@婖P H0HH 0D00 \ЍX:I\* @-$0S; @U@WM-0P@ p 0ߔ `pP 0 K0X R  Q0 v0Pc40  W`0 101ЍX:,^Q% P#8@-P0@S 3/P8`0TQ T 8d D@ d0 8d 0 ,d $ d0 8/oHohnmn R/0 0$0/@H-@-"M@T /( @"ލ@Ѝ/ R/0 0 0/H-@-"M/( @H"ލ@Ѝ/P0,0//P/0 HP0(0//P/0 G@-0"M ͝@"ލH0@-@T @ 0S P P0@@@-P @p0 S x P @T P P 4 P  oЍ0/0 /@-@/ P 0P@- S@P @@-`@Pp˜P  弘P  l嶘P  T :T ls  /p@-@P R 404BU0\PT00S@TU T U 4P@0`@ T000p|>\0Pp@-@P`  bŘ000V:$00V`pp D< 㫘D< p@-`0PP`N@N@JD T00Pdp 0bSH00a8p0Pd PP0@d@ph:p>!P\/p@-0@ P`@U@Q 0a   010Rp81p@Q@  0`  P  Q  8@P00  Q p R *!B  0 0pQ"8Q[ TQ"nUQwTQ"|~\P  AQ R: 0 0ph:t>@0YM-` 0 ЍMK50S50SlV `UV`~V*`1! P P06 0 00  4?0 S&380S[0 TS&6n0US7w0T%S&9|0~0 \ 0 00   ) P   f\0C0$PS  @fT 0``00  @ T 000 \ *@pL!  ,$R,#8 R[ TR,&n UR'w TR,)| ~ As^ B!@"  ^   \:  C!"RJ0 0 @ P  pfW 0``  00  pW 0   0 0 @000 N0C^ 0 RRP @  0pp0fSg1@1@ 0rJ@@N@pP  [0 [XI:tXP1@@0@40 s`01a0@c>0>0@p' 0 00R0h000 W0 0 0 pGp 0W000  t 0S0d S00000fS 0` `0ЍD<h:@p>A-01pPl?P0SA@$VV0 V0$V00    % "@pl oQrpW  B$RR R00 $R0   0000000 h:M-@Q+TЍM0  XpDPUh0 S  S  `\ h00\ P0 0 0`S`fm S:0 Sgp   E$RR R @  $R  @   @0壕0 h  00[- 0 0 0 0  E$RR0R00@ 0 0$R 0 0@0000@0000000h P'Z* 0 0  E$RR0R00@ 0 0$R 0 0@0000@0000000 Pp7:=`P 0 F00R00P(  E$RR0 0R 0000 0$R  0 0 00000  y h0R 00 0000g 000000Ѝ:h:A-pQWAW PpUPPP @H⦩Q `G0g```F0dS0`@d00d 0    00@@(@000eS00PP@-00S嫘000_R@- R 0x>@-@M@@  ᮔ @ (03?co@Ѝ 8@-2/@@03?co<0 R/@-P`p@V # % %(@<A!<@2/ ^ 03?00 @- gP  @謗w@-H[@P  ,S0P  0L0`w@- DP  @Q/;@-@ @f0SS/ / 9 8 9 <9@- M@400$(`pP0  0 2/ 2/00S PDx`U 0 @ Hdv 0 0R0S < iPЍ/E[hxP  0/x>@ Q @-@%P uP/'V//M-,P(0p`ppfXc ,ƒP  ῖ@PP :ϒPJ  㱖@PUl (0P0PPPe K 1`R  Pd :N 75V <P(  %0S0 S0S+  P&D0S "0S   0HdP 00 H  P@00 03?0Ѝϯ'Viiii jA-P`@pP)  $p0U P00 ḋ  s 8_US U 0**0SBGo jS/0@-Pp0@Ml 0h x0d0t0 aP l P R l0Ѝ0A-@ a0p P጑00֑P 0/  "% @`V @``PP `#`P 0X0 X`d@0S @^4!W$000U00H^8 3L$ 0l  B   B   L 00/ /0S p@-P/@ `D"%$ 0b00C000000p/U@-@@|@-pMPc@Pw`T 0WP!( v 宊@ЍM-P`UT p=PP@B<@P  0s ጊVS* ҊpPڊJ%0*0ÊPp '-8?? 0 |+-? h $ MP HP<` `Ѝ&Fs jM-(@Q000`VP= ` ᐔ@P P&)+~P P 0S 0S@ ᥃PC ,74  @d#D0S& "0S%@ 0sP @~P0 3?S `0 0@3?0!``0 V   :Z Z2/PP 0 S@@Z@#T L0Ѝei j'<)KU/@-`@pPѤPLPa 2/>PPt0S x0S 2?0 ntx P(b0/j>g>[>V>/P @-p@`4@T,Dᤏ4PDP@/LP/8@-<P@P < 8@-@P 004 T40 408 L04 4 8 /L-DM< ۏD 51000$0,0(0(000$0,0M>DЍѱ qp@-P@j `P  PǏ00p@opRA-@P`p@P4 PpW/f@-4CA-p0Q@`A SP0Sڐ]00C0|U0*0P SM0000 Ud A00C000C0@YXQ@-Pp` @P" BT@FQ@@ @aT Dz0\p  000@T +0p  0000M-0(M@ d)0ST)P0H)0D)@)0<)PQ0S00X 000垎PP`p ?P )V <@0 0P* pp P P``( UC P yP jPn0 S*000P[00S p`ẜ +`1#pꯜQP: gP000!SS\ 7x'00S0S0h'0000IU [P!P < 0 @ 0%A0@SlH|(00PC 0P`V <@ 0 0P, )PY:Pz P P] P* P PP P PM Pb P` PUy 500C0PPUn *00Cg`Pe*`F`V  \   V`FL0SL*XcT%0 0C0S? R;*b  0040S 00C0Q( $0 0C0SQ `A`a  \ V`F00Cr4Q& A r#  #0 S3#0SS 00S000S #QUS0S 00C0Qٌ+ R*b c0#^o0 0C0S0 S*b  0( 00"0tP 0 c000<@0  0 2 P0p pP pVp` V V V5 V =V  V 7V V( 200dW00S 0St 00C 00P00S p 0nP0S0 S0S p 0]P 1R# V00  0PPP  000 0 0`0 000`P000(Ѝ> X@Y E-P@.`?PPhEPpF'`T  P6U `@V 0 0aC1{Ȅm۶@-@ 8[4XP FD b(M-MpPZ@`G1 ` 00M0 Ss"!0EZ@%p@0 0(0 $ 弋(0Pp $  SW JprP W | 0@TР gP @` V@KIS Lo- P  ^<<,P P P@`t@P@0`t@40P@t@ P@` t@ 0eSrPp0`@0t@iP@pt@P  p@-PH`@ToP @Ppp蠆@-P Ѝs@-B*4S x0*4P`P 0PS S404S S`$4V0$4\UUV\։ 40 4HP <P 0PS0;41`C44UP 5P  0P 0(4S $4P0#S |P(4S  ܀ $ 44P R 0s0 $s0RЍp E-0 R@@#00(40CD)D4*DDD D$D0D,D4S 4n ` pPPUf Q@PQ4SI4 $0S0  Q  Q5 0Q  R  ABQ r xR0P0@AA At PR00 a0AS P0 a ARW0AS 70AS>, 0Q 0S,Ć0*40 4t PpGW((4SCq404t@ Ѝ 7 M-D`pP @V)  Q*$RjZ` PP: $Q.  *$Q ,$R ,$RT 00Q  a$K$ R\ QBR\ RR$R \\ B$ Br QPu" u $R ($RC$ $PU )$ ($RC$ $U0 Pd0$)$R$V `j$ p j$$ uЍ <0@-$$(0 \$$ $ 4 Ѝ \ P@-@ t@40CS0)44/P@ P0/<.MM-M@)pḡT)@㳡w*㰡TT P+㦡T @@ 0P+0,`喡 $0l0 D000F0 d0P& M-@Pp `V嚆 @ {P;/@P ?oUZ2 S:/P/. 0Si @-@MQ꼻l E0 0Z0T00D@Z E0,C(A$Ѝ@ 0S } Q$@HHH,H8lrcPU @T 4 @5C% 2l!b1`!XVЍLЍ@C]&-<AfJ@-@-P0000S*@-@"00CSꔽĽԽ̽hd ` \XTPLH@@ @0]@-P0S `M-`.ᙅ@Pp 0f@ p  q00SP T  c00S  \  P 0S( PEЍ FrM-M`@P9pP p,pppLp PpV`P pBP tP :-P` p T fp  |PZ R P  00S0   RZ  7 R >_oRZPUd\2\Ÿ0S 00\0@Ÿ \ 0\ 0!Ƞ Ƞ\ 00 ,PLP} zPPz zP`   PP)  NUL  RUx `V  PRP U x *,@ vP   R  P P !PQ   pAЍz=ϯ̪(3Op1US1S10/@- @<6)P R( #P /M-(M0 ?0d?0@0 MpW@?@0P$ U  K0HPS0S  0 0S 3/PP" R0S3/PP3/PP@00@0PP @00@09P (( 0H0 /IP@-@/IP@-@/ Jp@-`4@4PT `P <@ppȄ|,0, S Q ,0//pE-l@hpPT 0  0`S800U0SP@ Ѝ|@-H@TH@QH@-P 8P P H0T  PH@v7@-Hps/@-@PP@H0 SP0 0CQ Q 0//@-@@`PP,wpP?@P2 Q  00Pp0 P00S P P3/PP@ 0S 000 0 000 7@-0P0@P0(0C( R P0 (0@(0C Ѝ0qs@-@P`P (@(0 S H0VD^(Ѝp7@-0@0 PP@PP Ѝ0@-P0 p`p@ 0@T`&P` Ѝ7@-0P0HP0@T (@DP@ Ѝ0 8@-00(P  U (PE@PP880(@-  0(,0S @3/P,0( 0 0(0,00@-@0 0S,0( 0 0(0,03/P 0 s@-@0D0XP0tD 09Pc pDpP PU 0 00;pЍp*000S //8@-@0P0S$0S 0 03/P 80H08-@-< ЍЍ/0@-@(0S t00@0 m0000$0S d0 00S000S$Y0$0A-PP) @00( @P0p008C`8`F80S P808`C0S 3/P  @P  0S0H0@00@00$0S 3/@P   |"IQ@- @֙ә 0 >@P8@-P8<0@0S(0T"@@ 8@諙@>@-0  c JfЍ\1̃̃̃̃̃ ̃$$̃((̃,,̃00̃44̃88̃<<̃@@̃DD̃HH̃LL̃PP̃TT̃XX̃\\̃``̃dd̃hh̃ll̃pp̃tt̃xx̃||̃̃̃̃̃̃̃̃̃̃̃̃̃ x(@x$/H0   0 d$ h$ l$ p$ |$ D$ !$@$ L$( $( R/$  $ $$ $/H0@09c0 @4/HHs@-@`P0S T: T@`0053@5:PЍp 0@- \ 0S 0 Ѝ@-@9P 0(0C(P @S \ (0(0C  Ѝp@-` P@0T* 0P @ p@@- @P  @ M-pQ@ 0 !0`00  ́ R z P }  b R*P W}P  ׁP  RX 0W S  T 0 00ЍKs@-@ ;P0 ` 01S}PP  0400S  3/@P g 0 QЍp@- P @ 01S 0400S 0 H 0 3/P Ѝ@- P ( P04003/ Ѝ @-@ P , P 040 03/Ѝ*@- P ( P04003/ Ѝ5@-@ P , P 04003/Ѝ? 0 /@-@@ 4 Q@Q*S @A@R 01S 0S 3/P<0 0 0M-@4M@` P pP )0 p 1R  00- \03/P  D P   0x0Q Ѝp4I8R@-@0 S40 4p@-M`PH `@ |P 000 000Ѝpl0PR 00/r t8@-P@ 8p@-@` P S404p@-@ S404@-@ 0R 4 <0800@-H0H@H 0dC1P0^P ,@ p.||00lxC1P/!p@-@P` 6/ p0 0P@pp./ p@-P@ 00b C1T :|P 0SP@ PU`0 pp.@-鳴@p@-P@0p@/A-p`Pz@w 0 004/ЍA-p`Pg @d 0 004/Ѝ8@-PW@T R@O4/ @ GTPP8@-?0 QP P P $@-// / HHHE-p$`0@V @PDP"P ُ׏0@@P@ Z Pd`XɏuPSt0339200H?3$ ظ9p@-`$@_00qqQ PU:{U5p00pYp@-P$O`{q<0S@T*T $00p@-$h@0s0S 0{M-`$@ $pUTWXdT^ 0S  xVPPQ0s01{漲H1A2T, P  @$6P  @D :4s00帰  00帰Th zP@p@ Oj@T*TP@}006\3hM-`$@(,pTW X Td\ 0S|QVP PQt01{T㼲" H12P0( $" P  >/T  @D!:"r   00ἲwpq0@2P $!@P   0s00@ 0@0@00Ѝ 1Qp@-`$@Pt@2Ps0T@%PB020   R$X @t@Tkz<2gz(02@00pM-`$P@2s0  0P 2Jz02Fz92!pr  X HX,ЍM3zpP ЍM0200"zw005PP( $SuP93:s0 *#㼳 z 0s 㼳z 㼳yX0s0 3 0y 00 3ySPЍ`~000S//@-Q#$$,4444'(( @'t0pd 0 x00Ѝ/@-@P000S @//000/@-@ My   @P}y Ѝ8@-00P00R@0 (!D0 "00 0 10 P 0(18-4M,0  100000 004Ѝp@- M 0`000@5P8 0 P   , R\  R PPU J8y@T*,Tڀ Ѝp@@-$ M$ 0@000sP Ѝ,!R -$M0 000`$Ѝ/< @-0S Q 0]DM-`R0M PP QH;dPp00W!1[  !́ 01͑Rd     @P@[ !   @ P 4 @ Td0pW*0Ѝ 78@-@PP ^0 0 kP Tp88@8p@-`P@P _0S ^0S0{pP_PpppR@-@P00 0S @/  Q !Q % 5kM-YMM D`0@40L H0PPP Lw045 8L00H0P 0D P0#85 040H058L0PU PT0\X \<@0D HQ\ lLT\dɟɟɟAˠɟ ɟSXSf0`  P `UhhPQdPS?"?"( ' ? U 1#0(())**yP0L SSsW#< 0yT0BS*S8)yYލЍ4,4t) 34@x};ufP/8@-0S1 0S. 0S+ 0S( 0S% @PsP8| 0000,0000@P000H01@01<0100,0 0 88>DA- M@P 000S0@00SŎ0003/P~,PP"e Pq000_ 10S10 000NP0S1 0xo7p 0p0 =PP))00000 10 0R 1 0*PPt0S`V* V (0S?Q0,B0 5%P#u`$a PP (1S  PP(1SPPUu ,u0%1 Ѝ0S80@-@$M%1SOpP,$1S P0 $P PށP dct(1S8 00(0S?005000%1/$Ѝ0@-G@PP,//@-`\P@pT 0H 0S 0 V @@D_8f0/>8@- \@PX0@@ 峍P,PU &1S P8D>0p@-@0S S,0 0,0 ,0 0,0(10 0,0(10(1 `VP 媇PᦇPP,1808,1,1<S00uPP,Q@P,1;ePp@$,10,1pظJ0(P/@-0$Pop@-P@,10,1`,1 fP p@p>JE-p0`@P$1 eP`E 0!P01S eP0!((03SP bs0P XXXWVV 0SS"P< 00 08<1V0P01@s0\ Q岀0Q㮀hPPHU    0010 1 010101 0V! 04 0 pP W`1l#`pf 010016W r0njPTTXX  C   01 0010U !  0 pP W`1l#` pf  01 001 01001W 703jPlpX     010010U  !kJJJ8@-@,00,0  P01ePT 001 P01eP8@,00,08&cJ8@-!0@ 5<0 5?0 5t24t22@0200H46H4H1*C$**C$*000P0eP,14,1P,1 eP8;(1@14@1,0<,0,1808,1,1<0;0,1P,1ePD,10,1(1<(1(041l8 H@H&E~J30E-,P` p@PG Z Z 1Z0 000YPP$OPP0V(p`00000'0 000|0 t0t00?05 PCP00Ao` H@ H Hmt{60-1uM-(MPP@X l@ QQ 0 d 000 0CpW8*l0`g V`!0S0B00h Q # !$00@P  0@P   &001000@P 8T @pP (ЍM-0M`.@PIhPp0 0WP1P! XU U  0010 Sh0 P 000_P iU  0100NPHP\h0 pWᓬ*0Ѝ 70!P P  R000//@-! ЍL0@-S@0003/P 8@-PP@ 8oPP8<80@-0CS@0 K#0S@/8NM-ؠ@[Z @Ta PWV  @PA08000S 3/T0M/L-MR@40@@@SR@TpPW\\8@P\1/PH0S 40Pt#3ЍA-R`@P`` `SR`VPp@UQ `@T   Q A/@-@h\^ P"@-H@ ~PP0@!jPPQ@-P` (0R `@($ T)$0Pr`w ` /$ C.  R1$|^ R`3$\ L4$Hl փWl0 P?$_HM-@0@M` p00t0l 㳃@t0TZlP ᩃ 00ᯃ`08 0 !c104P8P,00 P<0 00 YupP0Js   ' 0 0n P( 0S 00D!3D1000l 0@2ÿ0T PW l!hh0dqS  P00UR@ЍCHM-0Mp`T0PP G 0  0000'0@$@0X 0 X(0100,00P Jp  Jpup T R@0 `c p0ЍM-8MPXpp A7$ 0 0d 00TV l "T`1`!S `c40`!JPJp@ up>0,0,0 R.  0(0\0 ( 0P1 S $P S  B10B1000 S0B03B1000Q !@f 0!08ЍM-0` Pp@p t0Z{ [ l o  0jPl bpl [  0VЍM-MD0P0`A800pld080p SX080 l 9t0t0 @<0<0000 @00H00408@l "0<0H yl"lP*  P90 x   00l 0 00Q|@ 0^040P 040 (01000< 0CS01s(0*0H04 400C@ 0(0 Q #C!R. R R l d n"( D R !(R080@0R000CS8&\&)&)))&0P00Q0S000000P00Q00S000000P0 0Q00S000000P00Q00S0000(d0 ቁ D l03,00C,@T000@0"PT0, S, d0Т2#0, d000 t0X00 0Pxd0h Rtd J(0 0`L000S"k L0,++   @0D@dR10@ k  k0 @C0cRA @4K"ok0  ~k0  00  0 40@  0b S0 ࠍ  B  Q"  S0␰R  . 0  x00"1/ЍM-02"UQ: `l  dR 0 jpP, @ 0 p 嶀 X000000J  0J@P X 0   0=@w Ѝ0M-P@ t0l 0}l x00p` 0FSA 00 S !r6 l0d `R@1S,< @1R( 0S%  0  c0bQ CQ ^C0\  R Cl @ 0]` pЍM- MP`lp@d00c00  0@@000 t0 0 @@p0 00W; 0  00 00[)0l C* 0  0  0jP00    0 0 0 0pl @ ЍM-(M`@ l $ ( iP  [ 0 0PP   l0d 0S"2 h0P0 {0 30 .  P d 0 @ 0 0 00X 0  d z0 ( 0 0 00  .X  (0P$s0(c000t000U 00V01! 00qs ` Js 00S p 0as0S `ӂ 00s p} p$$Jp 0 1 00\k 0 t Jp1  0 PE B0usupV 7 0`0  00V  0  V  0S0100 0  0 00iP000 0  0 00YPP`PP X  P p0us(Ѝ8@-P@`0($#(# $#Rx0x0$3$3p0p0(3,Q$gP ` '\! $ ,,8@>,??>(?@-@l [~ 3@1SPoA-@P`pl E~0  C "C!`0 0A]M-,p00(0X*0 [Z*0 @ P0 C@ ``f 0P000``0( PPhPЍM-@M 0AP 80p AWH h`Ih (Eh hPP'0x 0|`HL |L`HH f91010 00HS 0P 0 3\01\0` 0S '0S`' 0' Vo*0 0S' P @g 0QP:@\h`Pt  0S 2:Sl0`QT0\0Xd00PH0'<    H1/ P 0Sd 00 0 |0L0HH sfH Q  't0S \'@T@8^ Ѝ Y|fM-0M0T`PP\(0`@00 000C00$0(00 0$\(00PpK@00]%(R0l@100QW-d0*0 ( 0@PD p @ 0(=0pC0c000 p!  0GP 00c000! 0 0pgT 0 pg,0W 0p!p,pTP  0@ 0@d@@@g0Ѝ%NM-0MApP@`P( T0Sx(PFT0S(0T 0P00f%(R0p00[X,30 `00 0upPppJ 0,C00pC0c000 p! 0 00P 0c 00$0" 0 |00pgUpgU 0!01,0`00 0Pupp 0P _0PeP,0` Pc0`0p0Ѝ <bp@-@P00@?`,.0P%|uP P@@ 0@00@@0$1 @ $1 @A0 1UB@0 0 @@ 0 000pY0@-.,00#0 U UR( .U UR$ #T TR A @@ P! @,"P! ,    #103.0080 \ 0SI000/00p/00pp/00p/@-0 c 800z0,00 0000# Z0 000Z1p(000k0(0S -`P0S 00 0 000 00,$00$003/0$3/03/W 00b0 0 0b0V,0S IZ1`HЍM-(MHQ ` [ZP@ 020S0rQ~ S 2   Ru*`WVp*d0 p`a $0o$0 `po?V#!SRWp `o0 3/d o p0 S 333/Pp$Z  0\0  00SX`Z3 `V 0 00p03/0 3/03/ 0W`f`0 SIp 0 Stpp 7pp(Ѝ0@-,M8@$ @ ( ! <0 P,Ѝ0M-M⼀P`@Сh0  0'oP 0 0 00   S00S0p 2do0 3/P 0^ n00j! 080` 0M @pW d np0 %P0V S0ೄ0<03/803/0 DpW ` 7/0 080d nh  `n R0 0 003/0 3/08080S0``3/V00S 3/ЍE-LMP`pP-`@H Xh P`vn  ;0 $" 01/@ 3S  0 T@T000LЍ M- M@P `\%03/ 04  3`022SQ 0S S4 @S S4 442/4嵻YH0S4H0Q񟗝꤁,D2S 2S 2S 2S 422S423S432S322S323S333S332S323S332S2 Q Q tSS dQQ(0 $S\323SP332SD322S8323S,333S 332R:2S6C 022222222223222223232S<2020$_  eH2@D32<230"22 R 3 S3 33S332Bσ* *P  Q *r TiQP L022\0  R P P P P 1" " "Rd R:\0Ő0 !S4000\0  !0;00 "T00@ \00"D`00H d00h00l0000P004 kJU`H\TF,ENHaaHIJBUGN@LIJ<=A\MRrso(_ c8m^P@- @P@zR030 R R\ 0 ##0 D 0 ##|00 $ 000q/q0/ 00T /0p@-0#\0@  BR(ꘅ\\xQ   Q44   <+a&Pa0038!0p0@-00S S SSP102##0S4009 10LO?T \P XP TP'03#003# 0##03# 0##0@P`A$\P P @$X0P$TP0S S S02 B00 ( * Ă 08 : $</@-0@0@@0$A0@0@.00#4<0s#8 S !0# S<o00\R $gUUUU3333E-`X1QL!80S@Q@P\0:8\08 V1P0sTPZ ;4\ DS02<2020b202020PP \  ! HPe Z200 VXX 03 " E>P!tL!@-@0P0S ʕ\`  Q 0@P ` QP |  p0s 00P(0\0R0\0d0X0 0\ : \ 0s 0\ R02<202 0"`2t02p020\! Q  *2 *200(000\xt@-Mp0`@cP @K P< 0 Kpc@ P nЍ{@-}z 0 0 0@P@-  P  0d@Rp@-P@04`03/ p T @ p8@-@04P03/ p 8040 0S //000/@-  oP  ZP P0S;V Ѝ00@-@40DM P0S0 < R _Q00D04@$080(0400000,03/P DЍ0耍Ȏ8@-@A0PQ 8@-0<0u8@-@@PQ m8x 4 R//R8@-@ P:R 8U0@S0  T 0Sl卷8Tᅷ8P <~P R@P RU P./ -03| 0q00Q> 03 @-@v0T  1p @-@g0  10s0  00@ @-U0  10s0 00p 8@-@B0P}e8p@-P@ 0 30s0@  0 1 0 0`` 0 1 0 1u` v 0 1p8@-P@8A-P`p@P  P0p 00 2", 2#(00//@-p`P꜓|PP 堶PP?o^20S0LS00^0S@L^OoB@T  ჶt0WpV`w ( 0@PP p$`,j H H% H H_l@-0  00 0  0 (  0( R  \R* Q 2#(00 8>= B83$ @0@0<0gl0  00 0  0 /M-P 0@p##,` 0##40#"40= ``Fc= 0R$ !(P.0  [[ᾰ00   0#(000S0p1!4p1"400 -&M-0 @0p##,P0 "400#000= PPES0  a#"080 GS/ !( `V0 2#0~% S!4!0 Q,<Q8<00 Ѝ-HM-0P@#,`000!400#000 0mq0Ccw PC 0#(000pW !(  \\ڗ000#(000pW <,0  Q8 001 Q 00 000 p2"4p 2#000 0P -&HM-p `P @0FS@˴LcQEZ#0 ",`  "4 #000f@+ 0 @2"4@ 2#000 b  00 @ 0M:R  0MpS  0MjPM-uaã@0xQTp1T4 iW@Xi/PaoN@T 0S 3/ `@2P6 a0S( \% T p"3/P 0 #( K@Tm Ѝ00 /xA-Px`@0B/ QB  Q 0S 4pP T J0H`DP`F?0 L PppM  0^+*1 \㣃0 ' oI0 p\J0ą`\ K0.1N0  㶠PI0S J0S K0S IXGRs@-p P!@0!RN1<@  01$01(01,0100P0 %HP  CP*>P,9Q0!,P0D` 0P!  P0P!0% 0P 00 0|J 0uJ< 0DP  IoЍpx~,̧,ȧ4hLI/@-eM M5RWP T0P,@T0X0003/P`+ @ׯ0 R#  0@:00 `\  R 2/I0 03/`P D0@ 0D01G0p `dp p0A-P\0<@<`pCP0A/@T0p@-P(@`4@D04 (0R $0S 3/<`4@4@D00p@-,@ 0S 000S@/M-`0,p@d0PD0t 00 070:00p0`@P񟗐0HhS+@\ 񟗃<L00liV@ QD@ 00B00C00D00E00F00G00M V0 0 0PT@{00C?o20#S000 @D 0S 0S10B [?p 0       ,,    R tPk j(4J4 R 0 S R   ]PW k4g[{00#$ KV1!.K @9 ,yC000P T@ @D 0S P 0(4J4 R P 004 @ @D0  $ 0SS p0P0Tp0 0 PP (4J40 S  p pG 0S 0PP  0 P4S 0S [0T@9 @D R  R @.00  @P"  ^A R ^  !<"<  0;/0 P rXQd00Sm 3/jS7 0 S00.S/T 0SQr!4Pn [0 Si 3/JST 0SQZ!4PV [ ;/PP020 S :S!0@ A(0@40CD4\ <4040C00S !40S ( R ЍM/P 0S ЍM/[[ 00 00 003/P0 0p[!^ Ѝ8@-@0S) $0S& ,04 (, P804 0S 3/P804 0 04080010 R010108 R0108800 S14000•/@-^) \ T0$ 0C @R @T 0X0@ PXp$0 (00p(0,0 0V@-p+@PP0H@` @0` @003/P X0 0H0 0 0H0 A-$Q` qHM @R@`$0 /8T@! N@0@@HT .4JUQ - 0R:000:06DT0d0S0AJ S:!0S 50 $ 03/HЍ0 0H0 vHQP 8@-P@? 8@|?/E-`p@܀P녡P 0 00S 0 0#>㽥PU$ R*3/`/PD0娥P6 R 0$ 0 ЍE/ Ѝl/I4Ho0@-`M4 0>G? @@` ? QY!1|7P P >& P$C wP rP壣Pt@0 h0o1( FX>`Ѝ:I *V@-@0P`.PpePl p0h00aP@ @p VPD 00 0 wwwww0p@-@0D00S003/PP ߤ(DPL 00@003/`P ͤ@PHdŤ` X0 L0D003/`P ppwwswA-HM0pH@`H0 > EBP嘀`墤 R| Rp`B\BX0 000S0AJ S:!0S 5HЍ:/ 0grhr lr Kr R$  BRD  D \  \ 4  4 <  < `  ` D  D 0 / 0hr R lrH  H @  @ 8  8 0 /8@-P,@Q 0 03/00Q 0 03/00(Q 0 03/0(0,Q 0 03/0,000,08//4 000@ 0Cs0D/70Cs/KE-PP@pD0.S:SPp` WP 00 0 00 0E-PMf=a=`PB2 0 00 0`000 0Z0 0P0 0=2Q ( =2Q  00=htpPh2h0,8\"pPP D2  4"00("001000S 3/2   A 10p 1 1 1 0000f j=0 |=Z 0l XqA<0003/P ,10$1P00,@@100 0-0 0!x8 0 `d0H0D 07 `Ѝ" w/xPx3JEvxxwxx&xxx06@-0P`(@000 00 000~RQ``00Jd` pS 0@@ 0P0P0S 3/ R 0R0 @0000XP T@PPo 0 0 0003/PP0 0^PЍ0 wxwxxHxPxxxxxv$J N ]$Y=gP@-)& P  : P  t:dp:P `)D DNP <d:P 4!),1垠?@P 7P71 P" `  R 2/ҞPK O̞ >Hp0 ѠP |7)@xHPD0@@,1vt&0@dT*RPd@ڟpp$9S/ R0  90;8 00/M-MP  ?H) 0 !R  @@pSpW$  0 S0SN@3@0ݤ@P土-` 9 9000000(01 0l`0700@00000S0o=Q1P ,(0P @@o P Ƃ 1S060 a 3 0 SPx0`@W9    <0/02- 8Sp0zg30p00 W4 pSW$0('   *8<0Pw,`8zM8@0 g0040(\ !R #(p\``  0@00倠 ~F0 0yF000sF0 000?000 001P3cFF0c#?S$ gF dFaFp00 $FP:0? 0?RF0S 8ᯞ0 0 001qP增8100%  R R R PR R @R  l l  @ " )S8 0c9  P܍;]@-0 00 0#PTm蠆~@-0 00(0PBm8蠆28QD/M-0`pHY 04#S S #S@K00@P #Sz S #S S 040 Se  S:  SW S 80 0                             00 00PS 00 0 04#$R R RB PB@ P00PPs0S :S*PtBPlB}0)STBPx 0P00 0p *0 0Q Q01 xQ Qtg0  088$  :IQ: . , ! 4 0< 0}>2P0 . KL^* 0'*0 0 $R R R 0 6R R R00.00 0 00:*00 ἰ 0000P@P@@7 04V`V`TV >7i 0909ЍxGGG0@-@ 4 @MQ@M-]pB p`0 >Q PZ 0000(2P0]0` @ 0 60 0 :0P0 X0 @  OD0 0P ` 6   :D R $!=G# P @ > @ 0R#D= .0  0    $  "$   $  "$ 0000@00@007=L0p "R(g000`Ѝ@x !Ϡ\@- ЍA-!X@HYQTUU`00@0A@AtM-(M`HyGV* V*_00UPPUH@P ``@0RP 0`0C3 @0EP  6  67Z$40=080H0 RPà  $0P`H R P0 $0QAAo Q $0 p1 0$0    0P00H??#C0??C0C$1S P00000 C C.P$10$1PP P (ЍI@p@-PUp0@\`0c20c@B00 ?0?`00PBPp諪E-pHYP%$10C$1CC}0@`0V 000B 2C PP @$1S@@娜妜ᤜ\A-p  `@PP $O CTCO@PCP4m@@XPЍ8@-BP40 @ 0BP.88 H8@-@0SfP0 PUhh弚8 Q5D0 ! 8J5fP PU B50 ! 8@HI@-,嬶P@-p@`PprP{㓶 5PpPm1C/ ! 100<0000S0S00000S0;;00S0::)H!S018100S0800S07!S01?8100S0800S0700S060 0@D@ =C R   b+   0S 48%ぶ(0 ; 000 Ѝ H@HpPpPL HQPx 40@-S$(@,p Qm00-0`V p04>{ ^^FFpFS03 p3#^ Wp.p.p~W qS06s00>F315s000-H0=\900%Wp.p.p~WqS06s00>F315s00 0S?  00-0S0 S00000480E0D0/4 $0R0 . Rp//(0 -,>"0q>!0.0S 0s000000U000;//0P10@//@- 900#a40S0sp-0S=@$013$ PbS$0s@0 C$0@0$@00@-@@72P00,00@90ᯚE-p@`PH {3V<0$,`(P.<0@0 p1S X000 7V   @01\00M0XV&^~o0010000 P P0 T5050PS#Q +30@Q0s0@000/8@-@EP,0(00(0,0 0ss0 E0003/EP8E-09@.@ p0s` 0SO&N40尃S P $ 0帀Rx*0b$X!01 z$0 0$00D00$ 0R 3S EQP0 0P <@-(0L(^ S (0(0CS(0g \E@/( 8@-@,0.

0 0S&<\/(\/0s0@@000/ 0s000ssJ00 80S o@- (,0#-0S7 <0S Q(0C S0.0S 00s0S(Q0 D . R Qr 0    r  Qr `    E@T oSQ  QP8@-8 R 0 ( R4$r ,9.84\ @@(0===vpS0US 1US  0 1US H 0`P=0=00S 3/x5iY@-7 @=3==0= @y///QP < <0(R-=0 Br R"  0s0 00= ///0A-TRU(pU0@$`{( `c@V @`#v0@V00$ S0U0= 00Q0]0 0S00QP@-0@@(r4$@ .8<` V,]E|\p̠ @U(p@p(`,pU@T -  ( @-0S 0@E-@qMԡPuP0xs0SpPP``uPPP=uP 00=S S00=S'71"/P`uP=SpG 0qTRU (PU $`{ 0 0f`v`Vs`v`J G$0?V0$0 S@0ȍ0H`=` 30S 0000=2==0  =SJ=0T?Q (Q 0=  `{ X )#0s{_ aT?Q (Q =R 2=@00RB000 R0 -000-0==S<<叕000==S S  `0  QJ Q Q=0=00=R :R R 0AS0S0 r R0?&>4P DPR  r r 1 `      <QE (A00R0Sv rsRu :RO r00CSlLt$=0)=S`0]#4S S S0 RS S0 KS S0 E000 0@0== 0=3=4 !0=`00`0)=0(=% 0= 0CQQ C!r C#R?&>40S R000 0s0000000S 0 ^ 70`6 R30 S :S +=>/= 800: R 500 B#B#B &>?R40S Q000 0s0000S>S-0 0007 0 3/P#c 000= Q#p= 0== `0[ЍK- ]&iYFM-Q ^A3N NN[LL|~`pW0p W+ pp pWp,"W :WcVabVa bpVpacVa M P Y0"-Q!10S$%*0s0 00  Q00S !*0s000Q0$0%*/0"-Q!10S%$*0s0 00  Q00S! *0s0Q0%0$*/@-{@5 00sY8@-A`0= 00s000 0 _00=0-=`0Rs0P RP0S=0=00S 3/`P81M-PA``T v` @@ -@A --  r  w0 @1p{pW  [xK@pp`v`pW  Vx@pwρ r !0s00SR  |\P/Ps M-`Mp Pᨖ@Pe >11n?1 1=11= L4Q=0Q1 0S{0 @Q'<<5Ӓ81 S0B0@q0 %=0= 0=0!00S 3/PP1S 0 0S 3/1 4 ` 00a|p Ppl4uP, 4P ,= 0= 44,=0=@ 4+=@0= 4+=0= 4+=0= 4+=W0=0=a6g/s00#   S%S0}0 ?@ Δ 1 0-1=0Pk PU 3 RT%%`%l%x%% R R RRRR0 "0ZM .p R^ s0旲!  0PTp- wpW Pp1}"C/  - Z"""pxsp~p ഀᶀ  ~p W*0s0 R Q:Q {/!1SP00S 3/P4幑OU(P  `0B"S 0LaX`Y1PQ01=0CS0=ą]KPPЍ/H! ".9iYCbzzz*yNyyzzj$0Q 1S //p@-PP 0S0S 0S|Qpp`PdIp7  6@PD07 3/@P$6pp0@-S@ 4 7 3/0S  7 3/@-0S0! 4Q00 4//!404/@-/P@H0@-M0P Hc @P  Ѝ00@-MP H 0@P@  ͐Ѝ08p@-M0@? D cK @0 D cK @ܮ0PPc @KԮ0  cK @̮0 ``c @KĮ0 PcK@彮0 `cK@嶮0 PcK@寮0 `cK@娮0 PcK@塮0 D PcK@嚮P|pvppp00@ PE*xpthN Wip QNK]FЍp@BY@-0///////(0 P  (PP//z@-@ 03/00s@-0P0 0ZPt@h`U 0SU P0S 043/P ,0  $0(@TЍpzt{8@-P(@ 03/00P8(0@-@03/@8@-P(0@03/@8M-0P@c8 0`  PED  Pb Z @㪑 `w&V  0( @0 0 3 Q0S@ " 0Qsꔁ Z:0## 0  0=P Z:@0St 0 `Zọ0@ᴍTᮍ= Z T`,w`Fa 0 SI[@@  ` &V``6@6`fĶ T 儍@ 0  0   %\@d׋X0P  0@P,ȋX0U6P03J xf# 0 S0f 0C00Z@  %[5 @5 儥儵 T 4@ А  %\ @\0P  0P \0$50Z@㯐  |%[4 @4 娤娴 T @ 呐  ]%\ @J:00P  0=P^ 30 1U3P:0 0C P @1CR0@ Y  %%[t9@3 @83 , T 埌 @ :  %\ @Ȳ`0P  0P `050圂 R@   $[x\2 @T2 H T ^4 @  $\ @ 90q 1P  0Pl10 150q0S@0Ϗ0 $[ `1 @X1 L T 81@   岏  ~$\ @ k90 R : 0[P l00 1U0P 90lIߋЍT\hx{ Md`|{M|PXt{@-@P | 000 l0 h@P X 000 H0 D@P4 000 $0 \hx{d`|{PXt{8@-LPL@P Q 00P 0 8@pTM-0M<0 `04 S8  p P@ 0,PK $0K P0 0P0[S2[p0W: 0  M 00 PPg@ P#U^ 0$00[@0[S S@@S@S @P B@00J T T  T@@80< SR4 00R00S #P!<0@80P ꈠZ  $P00TP TH T@@M< Iߊ00 K M-0MP`0 40 "(P 0M0,0 "@ "0` /R R(00  /"pP 0/S00 ,0S (tK,0K @8 Pk pi ,0SV!000S(J(`0S  @ 8 &8 "Z P` <R ,E" 0 $0K 000P 80 ]0 `  (V 0/S~0@@ ,0KqBXlW 0S`(00 0,04 0KlT@-\P@0IP T@o T0SЍl s@-0 S @P0 `  P  0S 0  0  PЍpTpp@- `@」+@M"T! PP #S?RL0 S50 0`@TXa YP @p ᶉppTX0p@-@PD0 @<0 DP B`D0 7pxt|M-P Mp@0? ? @ M!?`?`  BR*R!$ : ߇c0CQZ0 0   d0T* 0  Z0  0wP A  0 # R 0 0 0eP  0 0SO SB  0LP 0 # R 0V#0 000 S2 S?>V*ؠ` Ѝ@- 10SP@@pᡉ`P  P@*@ {1 S@@$@ 000p0P Sl @`P P 0 8 P0@0Ņ#,Q/A-@M`PPA   p 0gS0 0Cs00.P0gPc``EPU "0  S U  ~00100V  `` @ 00V ܍K@-Q`1 @Q!$ 00@@2p(2 p0W, 0 00S Ѝ0- ^0 S0 ^ 0 S0 ^ 0SE-Q@@ T(p`."PU *T 00S @D Pt@Q 3P YB` PE P0@ 0  0S  S00 a%0 S2 S?>Q1l h`P `T 00S@D `t@@ T @D g Ѝ5p@-@1` PP p@PP v0 S" S/jPGPp1P!0PpHM-+MpP2 @4p9 T WP 7 `8R| (  T R08 RX0X0*0{0`}0x洆6ᖣ#h0 ᖣ&01h@0l0ӇPP T0 ( S<PGP`` +>`02Fh0`cy16P 'P jp7g&0S*X `H7 0 07z @x Z㿀$  X<"0tS *X@ QlH 0xZe 6PPT0 S2 S?>Q'Rd6Px&6TdƟP 0FX R@H 0x X H$ 0X0 K$ 0 N0P @ $ + B!R R !00X` lt& 0`h` `0cS0S7 $_$eP `P  `6$ bR 000Q V&HT0 S ZZ2h4PgT0 S" S/ Z:P4`-Z+ S2 S?>Z:"T0PA SP1H0PP=PPPqP @zZc8 P3 0`0  P% R P  QQ Q   /o" R B Q   R  R|  0 @ A[ !b&Q\ 0 K0 | 0C0p! b6RLP P[L0 P 0P  0$Ȁ'T0 S㺱+8P1 0 02P0 PPP 6Pt | bP 塀P5 2P0P00P}+ލi5xH-0x P?0?0@0M?@?@ P 0`0T `P6< P R( PKx,M-MMPL!l 0P00l0 S`p +w p  0 p  p@+!$' d+v`x@ gV  SpD0p(0 0pDt.p(p@00CPh 0P/U\UPP zdzP:S" :00:zP>00XCz?0/S\S :\:0`0P/$ l R0S(: 0': 0 0l0 0C?o2V  Rb p0,07 PG, Rt*00 0WS40f G W40  R\@Z 0Wh$00 4:4S0W4  (0SC   )S*R 0u:S$0pP* :S0W0 S / \S t 0SzP zP[ 0t ?$0,0 p0,000l0` S7V 0bh'G`0@S 00 $x0V@( 0c`S030#S :SC T<:SPp l0`Z S908P?(07h&'PF'7Z* 00R 0R0SW  ~:+SP  0 WX<UW[<YPiP U [{$P0 Q00[v l0P$0 0000 00/R\R :SL 0R00G0S<@: 0h(%(00,W, 0` 0S$  (0pP @?(0 0 `</ ]~<0S t< 0S~P @\hPP0B~il0 S2 S?>U?:0d:@S :l Q'a70P P@ P 0`@P!R0hP`l0 S2 S>0V*  0@P  T0@ZPP 006 R0ؠͱrh 0 P h}@u! @T P  Z00 :  0 0a :h 0:P`Xl0 S2 S?>VO*ؠpZh0:t0@SPBl0 S2 S?>P9* 0"h* 0P :h  ? : @T P 0:KPpl0 S2 S?>W*ؠ`*0P : @P :@W}@h~S P{ P00 0p>ލЍZ5-$M (0000,000$Ѝ@-pMA0S, }000CSyyyz zzzy |0|70 @P l|@  P& @+@|pЍs # @-00 000Ѝ-,M 0  qo,Ѝ-$M 0 a$Ѝ@-@ MD`p|000# 00 0@000J ЍЀ8 @-MPc8`@P |Ѝ/0A-a @P0s| 0A j|w D ~} 0L BM-08MP00#03\00ST000C a00 04@0C8$LLA(P , (N0,X<ND0 4Q@ Ġ , A @^;l@    Q5 20 2nΠL : Q`@ 0@ aA粀:n @pQ *`pW "`5 20p2 >dd`F`$`@nV\(@dT,ßpW  Tpd'* dp^.pW*4ppdp@h T!* dW0@ T* d@ppSf@ Tpd* dp^0\00L00000\_ `\0`X ,fL0V@CHp`0`d0`0S00 SVp0.0``V00, 0(@  d`F ``qA粀I @  N @a@  | SR1: l A b   0c<008<8Ѝ   M-M`@ Q@\ QA@@Q^'\^ @ 0Q @@P@T \*P@@ppp@wJPUT OoB^@T@F`Pp@PP@ⲀTPPP@PDU @T p@rTⰢDpPPP PTC, , H# DC( @# $  (`$`, P e/oE"4 Z  R J`0 P <@TPD   @PDU@Dt@DET: Q@@`t@@@P@,@U(@P@@$@P@P`@@@``Fp@H@@` `8@@2@@gA@`P`D``8`@ ``V `P@AD @Q5 @0@P @U @P` @`t@` `V*``pfW`<= P 0S 4) S. (,08<l P L //R6 <S1R  0P8@-@. 0P S(0 $0 S0%0$0 0(3/P UPe00/UE2P000ES$0 (3/000$P408@/88||P  R $0S 4@-Q@ ( 3/( $03//RM-` Mp Xp@ ?@TLD@DPU\EPEQ Rp]V0@P?TLD@D (\0\\ \00 0 \  0 \  0 \ 0 \\   0\ 0\ \0\\  \@\ @0 0 \  P'Vm0`@'P5WV}GW=0pG0W F 0b0S1R 0RR@0@0RPP@R0RP0RP0RP0RP0RP0RP0RP0P0@RP0@RP0@RP0@RP@P0p`pV0@Pi'@e'P ЍP6 M-0M@T3 0[0S,08P S<`p 00 0 00 00000SꀍԎd<̐8| |ܚ0 <tx R 01 VW` 0pGV`0U00S ` , 0,0t0-000'0 0S0 p%&Q ?0000S%R$ 00S`Fh?  `3 0 04 00PW 0pGV`Vu0PS ? > 0SU$   , ,P%T-P`0P0W 0pGV`V 0SP0  , %4,P-0%8%\.0/Pm`0P0W 0pGV`V 0Su  %$ 0  , ,P%T-PO`0P00+ VW  pGV` @PRP<P , ,P%T-P0P 0S `000 % @ W1!Z 0S P 0 bQ  b _0    @0pj j@@0Sl0@0000;# Wc K R P @0 S 2@ 57\Z:0    $$\pj  A R00@0000:# W5 K R $P @0( S 2@ 57\Z:0    $$\pj   R$0000  VW  pGV`!U:`P R4,0000 4W 0pGV`V%<,%4<\0TP4PP` 00 0S 0p 0 008P<`c0040 00 0S 0S 0`5S0W 0pGV`V0P00S0 S S9 0L0 0T0x9P00X00d9000%Q`F0`5SVW 0pGV`%8u <#0#R9Q`0P@ 0@0Sc R!1Z!Zv  pjT 0 0j 00 00@0j@Wd 0pGV` V0"0U% \ !QSd0%W0``F0 8h000\ h0S*VW@ pGV`h0`F0Q800 h0Sh00800 S>l0pL0 0T0T00/>0l00P0<70h000`dh Rq*TL0A$0$0 0SW 0pGV`\V*W pGV`5S`c08 h0 \V*W pGV`R5S`c- 70%Q0`F"\V*W pGV`5SQ W pGV`V:5S S c ` R|5000Q:h0 80h 00S l/΄S>l0pL0 0T0T0 0$@$0P04G`l08P00X0X0 0d .0P04600 1WR0p 0 8P<` 0p008P<` 0T0L 01 岠RWC 0pGV`S  03$0$00311 \W) 0pGV`5Q`aS5R`b@0  0@`30H000H0S V*W   pGV` `c@ 5S @ 00X0P01 RW 0pGV` 03$0$00311 ^W 0pGV`5Q`a@5R`b820DH000H0S V*W  pGV` `cD 5S D  ,00 0bD R1t00 0S 0  bD0S  c@0 00b4 S0a(c @S0! S0!c @c@AR 00@0S0G 0Sv  @00 00C 000000SJ VWd 0pGV`0  b0R00000 0S0b ( Z ? n  ?\>   hG  " >    T i 40S%<,%4<00,4 S P0000 00 0`P0000S 0S VW 0pGV`0U0`P000000p 0 00(08PS<`0SI0 SE P40S (0S$ 00!,0( $ 0(3/P400h`0( `f V:4b 00000f4 cVp1p! `V  4f 0`(0,0 00( 000S,00`Sp0,p5`0P`f0Pe0000000000US 0 Se  40< S@000 R  0,00 0SQ 0S/0Ѝ0` 3?S 03?S 03?S3 #/, S$0S/ // /03?S *$03?\0R3?//A-0`0 pP2 00@0_0ES)괢  8888  @P 0S  P @4? @@ gP @@@ 0Q@- P Ѝ0Q@- P Ѝ0Qs@-`P0P @ P P PU000U 00C0SPUpЍp@-@Pp# `PfPT P @@-P`p(@P03/R 7@-P@ DP P@T P  Ѝ0 03?/@-`pP@P<Ͽ013?0 2/100@-1"  <_2O 00E-P`@pP'0TSS P  K P 0S @ i P0@S  :@S Ѝp@-`P@  0p@@-P`p@6oPP `TPP h T@-@P@W@-@P@Op@-@`PPUpU0p03?0pM-p`(@PU P 1= ; 0P  P P PTPЍ@-`pP@ p 0 Ѝ@-P  Ѝ@-`pP@ p 0 Ѝs@-P4`@ P  0Ѝp-A-pP `P0`/S / P eP P@@0S 0/S S /  PPP0h@PE-`PpP#U @*P00P0S 0S@QW0U  pq  Ѝ@- 0P Ѝ-<'^T a b 888p@-`@"2PPp 0f 22/1 02/3? 0pp@-@`PPp$0f11$ 103? 0pA-@P(p(1`  3 10  172/p6o$`8w 0 3?,#,8$#4 0M-@P`\P@= : 1 P@jp  10; nP@  0  3? @03? 0 T 0 100 0P 0$4O6o0 @`@8@-@P8P5_U $ 2/PU408 8 8M-`(p,@PP 05_R 6P:;78 pЍ0A-`p3_@P }W0 AA-Pp`(@P' 0! P   0  0 P04/  p00 0<P s Ѝ@-Pp`u@P 0 P   0 ЍM-@Pp`[P1 0&P)p' & !@PP 5_ P0 P 40@   ! 40Ѝp@-`P@ 0p@p@-P@`P  P  d0>p@ppM-`Pp8@PY03?S$03?0 @+ PPC  P  SP6$  7p2/$ . @4?(@ @@W&0VU1*0 S 0 C P07p0402003?,#,8$#40Ѝ P p ,0`$0P////<4   7@-@P00$0QS  Ѝ0@-08 P 0S 00@S # Ѝ䧇@-04 P 0S 0P # Ѝ䢄-00 `R #$" 4"s0;4poE-@1DMp$00 ``(0<0dPhP m0p0e00F?o2P0S 0 0R0S \m q0 l  e gyDЍ   7@-\    @ Č @PU @PU\:$m Ѝ07 P @-`Pp0S @ @@@ 3/0P  d}mu M-PU 0S \ `p^ @ 0ST6 T8 @pQ@A006 0@E^*` p` `W( `pZ$ S/U1t  Q5@D2 55:A 0PPQ5 51`b ` 0 ` `X*   @Ѝ0 0 0 X0\0P T0/A-0PPp@S` XpT@@Q\0S) npaoo1 r 0 E V0*X`P\TP \0XW 0\ b\  aPX0c\ALPHM-b pNW9@PT::S@ U5*@@#T@a@a\ AT):@a@UT\ P` \ X\  T* [* \: P0B b0  P`pGNЍp@-`P@P klp 0/s@-@P `PT  Tp0T @0S@`V5ЍpRQ/M-@A⼰K@@@ T:` PdP  03/ P R: Z\ P*@fK@Ѝ諪 0p@-@P`mm00 000000C0pA-@`BpPU Q P@P@-=@S S OrokQ0  /0Sp@-@`PS:Q@Q P0@0^op/ P@-@PpT0  `0S(m&mP0U m00 E-@`p=@P0T*0 0S  P0PPP@P0 M- M D` 0H@p000[0{C0Q  PU u 00 U0E P@@0W0C?o20S2 \  L0` Pl^0l0@4``@l&%&&7(&AHE%KYM-M8@T@@CS00DQ@@T000CS0S0S P)3 0S \03 @RSp3 R`0 R 5R0S  0 0S0` 0S  2l` |P  0S \ 002 _R R  42 RQ0Ѝ%%%cSc%%t&&$&%&{Mb%%@-$0 00 0 %%%%M-(ML)H2HrPDP^@%+c@`P1(Q#("4P!4 2( , P!( 0P!( 4P! 8x B/c01 150 190101}1@010 S Qb?ZP0 8< 0 400PS0_QP00  0 0CQ  젊C D0WX0XP00 (Ѝ%%&{Mb%&%%%@-L0N_=P8,^@,0, }R}. @D%%?/@-Ls\H0Q P@(PP@O[.%s@-`AP@T  pT @0S@VЍp@-@F\  00 0 00 0@-M @[Ѝ5@-@8Q4 M0   Ѝ9B40 R 08Q 40S//%00S8/%@-,M@p`  PP  P   P ]]| ]  70 00 000, (1V$ 0c]00S20V [P 00 0 00 0 ` Pl;]d 6]003/PP <,],ЍHB9ylb:8@-@\P R0L0@@4Q04@0 400808%%%@-x0Q 4 RRR4Q44Q,P00%%A-@`a@\Q000H [P < )414!S P  !R P\@T`\?*`ZpA80S \\W 4P@\ EP t\8 h`4@0T] \%%&T?||Zߍ@- @P,03/0  %,0-P  $/%0P (0//%8@-P`ZPT@0S8UDP0400 0R(0  8P8%%|& @-@0S\$0pP` 8EP   94P0UPL` 2/P00 0 0U Ѝ%%@-P0S,Yx@x`0Sp 0S \6Zp0Sp4`@040W0 oP%%%.0 0P/%Me0 /%/0 0 0 0 /&p& &@-LZP @FP@$hZP0 @(1%8@-YAPP ,P 'P+ "P%   000 0o*I0 R |00S p p0 vh0'`0 \ \00S:  <0 85&1j >%|&& &&'&%P 0  /&0/p&D0P/@-@@$0?00!#  &&Mb'0Q A0#s0#sp/@-?@- Q,2(2 2"?P%_~^uP` `U0? Ps0Sʴ1@ A?s0 S@ A Qd^ ^a 1@ A?Ͽ\s0V^ \U\Q S SLIRG0?s0RB0 @R>0S; P6  0 0SR00  ' 0 ?S0S 0S 0S0SdZS1p?@0qs0}%@-M@ _ 0 3?S{3:0S 0SPD0T 0T 0, 3?0 3?0ۍEEE@-M0 1x 0 3?S{3:0S 0S0S @T,0 ( ۍEEE@-M0 h 0 3?S{3:0S  0S @T(0$ @ۍEEE@-M0 l 0 3?S{3:0S 0S 0S@T  ۍEMA-M0  0 3?S*{3):0S% 0S"0S@T{x`P7w5_/S `5 0@ 0@ۍEM+@-@@0S: 0@/Rp@-M` P 0 @01  R0C1 W0T @DA!   ܍pp@-PMMS1A<Ͽ5Ͽ    .l0@` %L0Uo  0U8080 40@0,00 ۍЍpE&EEEt&EA-M p` 6?P@0 V 00C1! UP 00 0gC1ڍ襆L00s/@00S/@-M @b 0dC1ڍEEA-Mc p` Ox P$@6? 0P V 00C1! UP$00 0gC1^ڍE@-MMp`7 P$D 6o@0(0,0 p0e$` C1AڍЍM0@-MM P 0 @{ 0 0e C1+ڍЍ0Mp@-M`d h 0 3?S6{34:0S0 0S0S0S S$0`!PP QtVQ#)VT d`@04OP 100 RP5ۍpE{6x> &0-DM00CS2d 000 $0 0 000 $0 0 $0 0` T0 @0 4000D`DЍMME{E1p@-0 QpA0AQj(p`|p0Zp|Y|p>p|pppT0K|ppp4A0wU0$sU 100p|pppgU/000 +0 (|ppp P0`0`0@0 P}Uh 0PP 0S0U80  00p@BpEM:%SmMt{EME`@-H@000S4U@(U}>@DN`A- 1Qq 0Aa0100S10S( #, s S4%cT :P RDq`0`a0@ T T 0S 1P 0 0R T@ TQ T 0T}se0 0 /0  ЍAM%EM&E$&ME/l&&n%x>`<DNt&ME|1s@-`p100CPSHd$Hd@<00 $@@1!0"##~0 0 @se;00 "440<0<0  &HN8mUm%D` @-000P SDD$S@8S404,00S@LN{~{X!`NA-\QP  2|SQxbP  Q*TRH2/ DRD2Dp0W8B002000S( #, s S4  LpR:pP >pc 500AQR0 R0S t1\ 0 0P PRLA R@RQ ,R !z @R 1 RR1 00 0 E70E  0@p0 0@y0, ЍA{{&%\NhN$&4N$l&&n%)x>8`NHNX!{{dNLNXNt&TN{R8@-P@H_0@P  R  HIBJHCBB@B#OF@(s@(sA@(As@(so@(co@(cAo@(Aco@(c_@(S_@(SA_@(AS_@(SO@(CO@(CAO@(ACO@(C?@(3?@(3A?@(A3?@(3/@(#/@(#A/@(A#/@(#@(@(A@(A@(@(@(A@(A@(H@BpGH@BpG8 Op@pG#H@BpG(ȿo@O@4)-@@pG@ @F :@CRBcF@CpG@ A :ԜFACcFRB@CpG@@F :@CRBcF@CpGO4xe&  ``%`,`3`:`A`H`O`V`]`e`m`u`}``````````````````w]{]]]"ů+ů4[p<  *w w  wW w < +w +~%KIl McHX0w+4yvu(v#d*2<1<0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-1?@(p$@ (p8(HDH'@B0 A P ` r       $.`Meg ]]?? #(-27<FP    DP (8$  ,4 LĐ)*,**1HI I@I`IIP    #     , %S #"%),0@H\]]]]]]]]]]]66eexe  !%* 3 :@ FN[dmsy<B&e(39?FMQZ`gmsz y(1:BS[qx   !8AlZwho| @Y 1&?$0j\?|! NY$ yH$ !B c0@P`p)Jk1s2R"RBrb9{ZӜb$C4 dtDTjK( ōS6r&0vfVF[z8׼HXhx@a(#8َHi +ZJzjqP 3:*˿yX;l|L\",<` A* hI~n^N>2.Qp:Yxʱ -No0 P%@Fpg`ڳ=^"25BRwbVr˥nO, 4$ftGd$TDۧ_~<&6WfvvF4VLm/ș鉊DXeHx'h8(}\?؛uJTZ7jz *:.lMͪɍ&|ld\EL<, >]|ߛُn6~UNt^.> !1Aa  0@`@@A@!  @a`10  @ #+3;CScs`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O 2x0x0w !     $$$0$$*EHCI Host Controlleru-boot  fdt_fixup_memory_bankscreate_bbtnand_select_chipverify_bbt_descrcomposite_unbindnand_transfer_ooballocate_instancenand_fill_oobnand_scan_tailomap2430_musb_enablev7_dcache_inval_rangeset_default_envenv_importenv_exportext4fs_devreaddevice_removedo_env_exportdo_env_importmcs7830_basic_resetusb_get_configuration_nomcs7830_recvdo_bootvx_fdtfdt_find_or_add_subnodecb_getvaromap_uhh_resetrx_handler_commandcreate_int_queuedevice_probe_childdev_get_platdatadev_get_privrx_submitalloc_requestseth_bindusb_eth_initusb_eth_recvusb_eth_haltmmc_init_streamraw_accessomap_hsmmc_init_setupmmc_reset_controller_fsmomap_hsmmc_send_cmdmmc_read_datammc_write_dataomap_hsmmc_set_iosg_dnl_registermusb_g_ep0_irq(((((AAAAAABBBBBBbootcmd=run findfdt; mmc dev ${mmcdev}; if mmc rescan; then if run userbutton; then setenv bootenv uEnv.txt;else setenv bootenv user.txt;fi;echo SD/MMC found on device ${mmcdev};if run loadbootenv; then echo Loaded environment from ${bootenv};run importbootenv;fi;if test -n $uenvcmd; then echo Running uenvcmd ...;run uenvcmd;fi;if run loadbootscript; then run bootscript; else if run loadimage; then run mmcboot;fi;fi; fi;run nandboot;setenv bootfile zImage;if run loadimage; then run loadfdt;run mmcbootz; fi; bootdelay=1baudrate=115200arch=armcpu=armv7board=beagleboard_name=beaglevendor=tisoc=omap3loadaddr=0x80200000rdaddr=0x81000000fdt_high=0xfffffffffdtaddr=0x80f80000usbtty=cdc_acmbootfile=uImageramdisk=ramdisk.gzbootdir=/bootbootpart=0:2console=ttyO2,115200n8mpurate=autobuddy=noneoptargs=camera=nonevram=12Mdvimode=640x480MR-16@60defaultdisplay=dvimmcdev=0mmcroot=/dev/mmcblk0p2 rwmmcrootfstype=ext3 rootwaitnandroot=ubi0:rootfs ubi.mtd=4nandrootfstype=ubifsramroot=/dev/ram0 rw ramdisk_size=65536 initrd=0x81000000,64Mramrootfstype=ext2mmcargs=setenv bootargs console=${console} ${optargs} mpurate=${mpurate} buddy=${buddy} camera=${camera} vram=${vram} omapfb.mode=dvi:${dvimode} omapdss.def_disp=${defaultdisplay} root=${mmcroot} rootfstype=${mmcrootfstype}nandargs=setenv bootargs console=${console} ${optargs} mpurate=${mpurate} buddy=${buddy} camera=${camera} vram=${vram} omapfb.mode=dvi:${dvimode} omapdss.def_disp=${defaultdisplay} root=${nandroot} rootfstype=${nandrootfstype}findfdt=if test $beaglerev = AxBx; then setenv fdtfile omap3-beagle.dtb; fi; if test $beaglerev = Cx; then setenv fdtfile omap3-beagle.dtb; fi; if test $beaglerev = C4; then setenv fdtfile omap3-beagle.dtb; fi; if test $beaglerev = xMAB; then setenv fdtfile omap3-beagle-xm-ab.dtb; fi; if test $beaglerev = xMC; then setenv fdtfile omap3-beagle-xm.dtb; fi; if test $fdtfile = undefined; then echo WARNING: Could not determine device tree to use; fi; validatefdt=if test $beaglerev = xMAB; then if test ! -e mmc ${bootpart} ${bootdir}/${fdtfile}; then setenv fdtfile omap3-beagle-xm.dtb; fi; fi; bootenv=uEnv.txtloadbootenv=fatload mmc ${mmcdev} ${loadaddr} ${bootenv}importbootenv=echo Importing environment from mmc ...; env import -t -r $loadaddr $filesizeramargs=setenv bootargs console=${console} ${optargs} mpurate=${mpurate} buddy=${buddy} vram=${vram} omapfb.mode=dvi:${dvimode} omapdss.def_disp=${defaultdisplay} root=${ramroot} rootfstype=${ramrootfstype}loadramdisk=load mmc ${bootpart} ${rdaddr} ${bootdir}/${ramdisk}loadimage=load mmc ${bootpart} ${loadaddr} ${bootdir}/${bootfile}loadbootscript=load mmc ${mmcdev} ${loadaddr} boot.scrbootscript=echo Running bootscript from mmc${mmcdev} ...; source ${loadaddr}loadfdt=run validatefdt; load mmc ${bootpart} ${fdtaddr} ${bootdir}/${fdtfile}mmcboot=echo Booting from mmc ...; run mmcargs; bootm ${loadaddr}mmcbootz=echo Booting with DT from mmc${mmcdev} ...; run mmcargs; bootz ${loadaddr} - ${fdtaddr}nandboot=echo Booting from nand ...; run nandargs; nand read ${loadaddr} 280000 400000; bootm ${loadaddr}ramboot=echo Booting from ramdisk ...; run ramargs; bootm ${loadaddr}userbutton=if gpio input 173; then run userbutton_xm; else run userbutton_nonxm; fi;userbutton_xm=gpio input 4;userbutton_nonxm=gpio input 7;, 0123456789ABCDEFEthernet Gadgetarocsdxbim Android Fastboot0123456789abcdefTImusb-hdrc~~EPTGMKUVY ZZ YVUe03f] lr : [<%08lx>] sp : %08lx ip : %08lx fp : %08lx r10: %08lx r9 : %08lx r8 : %08lx r7 : %08lx r6 : %08lx r5 : %08lx r4 : %08lx r3 : %08lx r2 : %08lx r1 : %08lx r0 : %08lx Flags: %c%c%c%c IRQs %s FIQs %s Mode %s%s undefined instruction software interrupt prefetch abort data abort not used fast interrupt request USER_26FIQ_26IRQ_26SVC_26UK4_26UK5_26UK6_26UK7_26UK8_26UK9_26UK10_26UK11_26UK12_26UK13_26UK14_26UK15_26USER_32FIQ_32IRQ_32SVC_32UK4_32UK5_32UK6_32ABT_32UK8_32UK9_32HYP_32UND_32UK12_32UK13_32UK14_32SYS_32resetting ... WARNING: Caches not enabled rev0rev1rev2Error: unable to acquire board revision GPIOs Beagle Rev Ax/Bx beaglerevAxBxBeagle Rev C1/C2/C3 CxBeagle Rev C4 C4Beagle xM Rev A/B xMABBeagle xM Rev C xMCBeagle unknown 0x%02x EEPROM is blank or 8bit addressing failed: retrying with 16bit: Recognized Tincantools Zippy board (rev %d %s) buddyzippyRecognized Tincantools Zippy2 board (rev %d %s) zippy2Recognized Tincantools Trainer board (rev %d %s) trainerRecognized Tincantools Showdow board (rev %d %s) defaultdisplayshowdoglcdshowdogRecognized KBADC Beagle FPGA board beaglefpgaRecognized Liquidware BeagleTouch board beagletouchRecognized Brainmux LCDog board lcdogRecognized Brainmux LCDog Touch board lcdogtouchRecognized BeagleBoardToys WiFi board bbtoys-wifiRecognized BeagleBoardToys VGA board Recognized BeagleBoardToys LCD board Recognized bct electronic GmbH brettl3 board Recognized bct electronic GmbH brettl4 board Recognized LSR COM6L Adapter Board lsr-com6l-adptNo EEPROM on expansion board noneUnrecognized expansion board: %x unknowndviserial_omapOMAP3 Beagle boardNAND%s for %08lx ... %08lx ==> CRC32 for %08lx ... %08lx ==> %08lx crc32syntax error ERROR : memory not allocated %s=%s ** Abort ## Error: "%s" not defined U-Boot# *?[\%uERROR: There is a global environment variable with the same name. %s: readonly variable%s=%sHUSH_NO_EVALUnknown command '%s' - try 'help' or use 'run' command IFS \$'";&|#;$&|exit not allowed from main input shell. HUSH_VERSION0.01showvarprint local hushshell variables - print values of all hushshell variables showvar name ... - print value of hushshell variable 'name'thenelifelseforwhileuntildodonebootdelaybootcmdHit any key to stop autoboot: %2d %2d DRAM: I2C: baudrateNet: loadaddrMMC: NAND: ## Starting application at 0x%08lX ... ## Application terminated, rc = 0x%lX Perform RESET of the CPUgostart application at address 'addr'addr [arg ...] - start application at address 'addr' passing 'arg' as argumentsTrying to execute a command out of order ## Checking Image at %08lx ... Legacy image found Bad Magic Number Bad Header Checksum Verifying Checksum ... Bad Data CRC OK Unknown image format! autostartyesAutomatic boot of image at addr 0x%08lX ... Your platform's zImage format isn't supported yet! bootzboot Linux zImage image from memoryiminfoprint header information for application imageaddr [addr ...] - print header information for application image starting at address 'addr' in memory; this includes verification of the image contents (magic number, header and payload checksums)bootdboot default, i.e., run 'bootcmd'boot application image from memoryloadosramdiskcmdlinebdtprepfakeRamdisk image is corrupt or invalid Could not find a valid device tree verify## Booting kernel from Legacy Image at %08lx ... Unsupported Architecture 0x%x Wrong Image Type for %s command ## Booting Android Image at 0x%08lx ... Wrong Image Format for %s command ERROR: can't get kernel image! ERROR: unknown image format type! Could not find a valid setup.bin for x86 Could not find kernel entry point! XIP %s ... Loading %s ... Uncompressing %s ... GUNZIP: uncompress, out-of-mem or overwrite error - must RESET board to recover Unimplemented compression type %d WARNING: legacy format multi component image overwritten ERROR: new format image overwritten - must RESET the board to recover initrd_startinitrd_endERROR: booting os '%s' (%d) is not supported subcommand not supported ## Transferring control to RTEMS (at address %08lx) ... confaddr## Transferring control to Plan 9 (at address %08lx) ... filesize## Transferring control to NetBSD stage-2 loader (at address %08lx) ... /chosen## ERROR: %s : %s ## Starting vxWorks at 0x%08lx, device tree at 0x%08lx ... ## vxWorks terminated alias for 'help'helpprint command description/usage - print brief description of all commands help command ... - print detailed usage of 'command' %s arm-linux-gnueabihf-gcc ( 4.9.2-10) 4.9.2 GNU ld (GNU Binutils for Debian) 2.25 print monitor, compiler and linker version.callbacks:callbacks,.flags:flags,baudrate:baudrate,bootfile:bootfile,loadaddr:loadaddr,stdin:console,stdout:console,stderr:console,.callbacksethaddr:ma,## Warning: Unknown environment variable type '%c' ## Warning: Unknown environment variable access method '%c' .flags## Error: flags type check failure for "%s" <= "%s" (type: %c) ## Error: Can't delete "%s" ## Error: Can't overwrite "%s" oldval: %s defval: %s ## Error: Can't create "%s" FAILED! Erasing %s... Writing to %s... !readenv() failedBad magic number Bad header crc Bad data crc Bad image type Empty Script Wrong image format for "source" command ## Executing script at %08lx sourcerun script from memory%-12s= 0x%08lX (not set)arch_numberboot_paramsDRAM bank-> start-> sizeeth%dname = %s eth%iaddr%-12s= %s current eth = %s ipaddrip_addr = %s baudrate = %u bps TLB addrrelocaddrreloc offirq_spsp start bdinfoprint Board Info structureflushNo arch specific invalidate_icache_all available! OFFInstruction Cache is %s No arch specific flush_dcache_all available! Data (writethrough) Cache is %s dcacheenable or disable data cache[on, off, flush] - enable, disable, or flush data (writethrough) cacheicacheenable or disable instruction cache[on, off, flush] - enable, disable, or flush instruction cacheList of available devices: %-8s %08x %c%c%c coninfoprint console devices and information\cecho args to console[args..] - echo args to console; \c suppresses newlineexitexit scriptext4loadload binary file from a Ext4 filesystem [ [addr [filename [bytes [pos]]]]] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from ext4 filesystemext4lslist files in a directory (default /) [directory] - list files from 'dev' on 'interface' in a 'directory'ext4sizedetermine a file's size - Find file 'filename' from 'dev' on 'interface' and determine its size.ext2loadload binary file from a Ext2 filesystem [ [addr [filename [bytes [pos]]]]] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from ext2 filesystem.ext2lsusage: fatinfo [] ** Unable to use %s %d:%d for fatinfo ** ** Unable to use %s %d:%d for fatwrite ** ** Unable to write "%s" from %s %d:%d ** %llu bytes written fatwritewrite file into a dos filesystem - write file 'filename' from the address 'addr' in RAM to 'dev' on 'interface'fatinfoprint information about filesystem [] - print information about filesystem from 'dev' on 'interface'fatls [] [directory] - list files from 'dev' on 'interface' in a 'directory'fatloadload binary file from a dos filesystem [ [ [ [bytes [pos]]]]] - Load binary file 'filename' from 'dev' on 'interface' to address 'addr' from dos filesystem. 'pos' gives the file position to start loading from. If 'pos' is omitted, 0 is used. 'pos' requires 'bytes'. 'bytes' gives the size to load. If 'bytes' is 0 or omitted, the load stops on end of file. If either 'pos' or 'bytes' are not aligned to ARCH_DMA_MINALIGN then a misaligned buffer warning will be printed and performance will suffer for the load.fatsizeThe address of the fdt is invalid (NULL). libfdt fdt_check_header(): %s - too old, fdt %d < %d - too new, fdt %d > %d", "* 0x%p [0x%08x]<0x%08x%s[%02x%sfdtaddr/* NULL pointer error */The address of the fdt is %#08lx New length %d < existing length %d, ignoring. libfdt fdt_open_into(): %s No FDT memory address configured. Please configure the FDT address via "fdt addr

" command. Aborting! moNew length 0x%X < existing length 0x%X, aborting. mklibfdt fdt_path_offset() returned %s libfdt fdt_add_subnode(): %s Sorry, I could not convert "%s" Unexpected character '%c' libfdt fdt_setprop(): %s libfdt node not found 0x%08Xerror: unprintable value 0x%plibfdt fdt_getprop(): %s %s%s { Nested too deep, aborting. %s}; %s%s; %s%s = %s/* NOP */ Unknown tag 0x%08X libfdt fdt_delprop(): %s libfdt fdt_del_node(): %s magic: 0x%x totalsize: 0x%x (%d) off_dt_struct: 0x%x off_dt_strings: 0x%x off_mem_rsvmap: 0x%x version: %d last_comp_version: %d boot_cpuid_phys: 0x%x size_dt_strings: 0x%x size_dt_struct: 0x%x number mem_rsv: 0x%x boorsindex start size ------------------------------------------------ libfdt fdt_get_mem_rsv(): %s %x %08x%08x %08x%08x libfdt fdt_add_mem_rsv(): %s libfdt fdt_del_mem_rsv(): %s flattened device tree utility commands#size-cells%s: %s: %s fdt_initrd: %s linux,initrd-startWARNING: could not set linux,initrd-start %s. WARNING: could not set linux,initrd-end %s. linux,initrd-endfdt_chosen: %s WARNING: could not set bootargs %s. Unable to update property %s:%s, err=%s %s: num banks %d exceeds hardcoded limit %d. Recompile with higher MEMORY_BANKS_MAX? device_typeWARNING: could not set %s %s. reg/aliasesethernet%deth%daddrlocal-mac-address%s: Bad cell count for %s rangeslinux,phandleCan't set phandle %u: %s okaydisabledfailfail-%dInvalid fdt status: %x Warning: device tree alias '%s' points to invalid node %s. Warning: device tree node '%s' has no address. Warning: U-Boot configured device %s at address %llx, but the device tree has it address %llx. #address-cellsframebuffer@%llxwidthheightstrideformatdefault [ [directory]] - List files in directory 'directory' of partition 'part' on device type 'interface' instance 'dev'.savesave file to a filesystem bytes [pos] - Save binary file 'filename' to partition 'part' on device type 'interface' instance 'dev' from addr 'addr' in memory. 'bytes' gives the size to save in bytes and is mandatory. 'pos' gives the file byte position to start writing to. If 'pos' is 0 or omitted, the file is written from the start.load binary file from a filesystem [ [ [ [bytes [pos]]]]] - Load binary file 'filename' from partition 'part' on device type 'interface' instance 'dev' to address 'addr' in memory. 'bytes' gives the size to load in bytes. If 'bytes' is 0 or omitted, the file is read until the end. 'pos' gives the file byte position to start reading from. If 'pos' is 0 or omitted, the file is read from the start.Bank %s: -acmd_gpiogpio: requesting pin %u failed gpio: pin %s (gpio %i) value is %lu query and control gpio pins - input/set/clear/toggle the specified pin gpio status [-a] [ | ] - show [all/claimed] GPIOsValid chip addresses: %02XExcluded chip addresses:Current bus is %d Invalid bus %d Setting bus to %d Failure changing bus number (%d) Current bus speed=%d Setting bus speed to %d Hz Failure changing bus speed (%d) Bus %d: %sError %s the chip: %d writingreading%08lx: %02lx %04lx ? %04x: %02xCRC32 for %08lx ... %08lx ==> i2cI2C sub-systembusdevloopmmmwnmprobespeedUnknown operator '%s' Invalid data width specifier itestreturn true/false on integer compare[.b, .w, .l, .s] [*]value1 [*]value2-lt-gt-eq==-ne!=<>-ge>=-le<=toggle[0|1|green|all] [on|off|toggle][led_name] [on|off|toggle] sets or clears led(s)green## Total Size = 0x%08x = %d Bytes ## First Load Addr = 0x%08lX ## Last Load Addr = 0x%08lX ## Total Size = 0x%08lX = %ld Bytes loads_echo## Ready for S-Record download ... ## S-Record download aborted ## Start Addr = 0x%08lX ## Switch baudrate to %d bps and press ENTER ... loady## Ready for binary (ymodem) download to 0x%08lX at %d bps... loadx## Ready for binary (xmodem) download to 0x%08lX at %d bps... ## Ready for binary (kermit) download to 0x%08lX at %d bps... ## Binary (kermit) download aborted ## Switch baudrate to %d bps and press ESC ... load binary file over serial line (ymodem mode)[ off ] [ baud ] - load binary file over serial line with offset 'off' and baudrate 'baud'load binary file over serial line (xmodem mode)loadbload binary file over serial line (kermit mode)loadsload S-Record file over serial line[ off ] - load S-Record file over serial line with offset 'off'double wordbytehalfword%s at 0x%08lx (%#0*lx) != %s at 0x%08lx (%#0*lx) Total of %ld %s(s) were the same Base Address: 0x%08lx Zero length ??? %08x %04xinfinite loop on address range[.b, .w, .l] address number_of_objectsbaseprint or set address offset - print address offset for memory commands base off - set address offset for memory commands to 'off'checksum calculationaddress count [addr] - compute CRC32 checksum [save at addr]cmpmemory compare[.b, .w, .l] addr1 addr2 countmemory copy[.b, .w, .l] source target countmemory write (fill)[.b, .w, .l] address value [count]memory modify (constant address)[.b, .w, .l] addressmemory modify (auto-incrementing address)memory display[.b, .w, .l] address [# of objects]sleepdelay execution for some timeN - delay execution for N seconds (N is _decimal_ !!!)No MMC device available no mmc device at slot %x OKERROR#part_num shouldn't be larger than %d switch to partitions #%d, %s mmc%d is current device mmc%d(part %d) is current device get mmc type error! MMC erase: dev # %d, block # %d, count %d ... Error: card is write protected! %d blocks erased: %s MMC write: dev # %d, block # %d, count %d ... %d blocks written: %s MMC read: dev # %d, block # %d, count %d ... %d blocks read: %s YesNo DDRDevice: %s Manufacturer ID: %x OEM: %x Name: %c%c%c%c%c Tran Speed: %d Rd Block Len: %d %s version %d.%d High Capacity: %s Capacity: Bus Width: %d-bit%s OK, force rescanset dsr %s mmcinfodisplay MMC info- display info of the current MMC devicemmcMMC sub systeminfo - display info of the current MMC device mmc read addr blk# cnt mmc write addr blk# cnt mmc erase blk# cnt mmc rescan mmc part - lists available partition on current mmc device mmc dev [dev] [part] - show or set current mmc device [partition] mmc list - lists available devices mmc setdsr - set DSR register value eraselistsetdsrnoronenandinvalid partition number %d for device %s%d (%s) %llug%llum%lluk%llumtddevnummtddevname%s%d,%dcannot add second partition at offset 0 mtdparts=mtdparts%s%dDevice %s not found! %s: offset %08llx beyond flash size %08llx %s%d: partition (%s) size too big %s: partitioning exceeds flash size %s%d: partition (%s) start offsetalignment incorrect %s%d: partition (%s) size alignment incorrect %s%d: partition (%s) start offset alignment incorrect partition size too small (%llx) no closing ) found in partition name empty partition name no partitions allowed after a fill-up partition unexpected character '%c' at the end of partition out of memory 0x%08llx@0x%08llxno partitions for device %s%d (%s) unexpected character '%c' at the end of device invalid mtd device '%.*s' incorrect device type in %s incorrect device number in %s no partition number specified unexpected trailing character '%c' no such device %s%d no such partition nand0=nandmtdidsmtdids too long (> %d) mtdparts variable not set, see 'help mtdparts' mtdparts too long (> %d) mtdids: incorrect mtdids: no identifier device id %s%d redefined, please correct mtdids variable could not initialise device list mtdparts variable doesn't start with 'mtdparts=' device %s%d redefined, please correct mtdparts variable mtdparts_init: no valid partitions no partition id specified partition changed to %s%d,%d mtdparts=nand:512k(x-loader),1920k(u-boot),128k(u-boot-env),4m(kernel),-(fs)delall device %s%d <%s>, # parts = %d #: name size offset mask_flags %2d: %-20s0x%08llx 0x%08llx %d no partitions defined active partition: %s%d,%d - (%s) 0x%08llx @ 0x%08llx could not get current partition info defaults: mtdids : %s mtdparts: addtoo long partition description %s:%s(%s)%sgenerated mtdparts too long, resetting to null delcurrent partition deleted, resetting current to 0 partition %s not found no such device %s defined in mtdids variable define flash/nand partitionschpartchange active partitionpart-id - change active partition (e.g. part-id = nand0,1)No such device Device %d: %s... is now current device %dx %s, sector size %u KiB Page size %8d b OOB size %8d b Erase size %8d b nand_writesizenand_oobsizenand_erasesizenot a NAND device Offset exceeds device limit '%s' is not a number Size exceeds partition or device limit device %d whole chip offset 0x%llx, size 0x%llx quietdump no devices available Device %d bad blocks: %08llx scrubclean-y.spread.part.chip NAND %s: Warning: scrub option will erase all factory set bad blocks! There is no reliable way to recover them. Use this command only for testing purposes if you are sure of what you are doing! Really scrub this NAND flash? scrub aborted .oobNo memory for page buffer Error (%d) reading page %08lx Page %08lx dump: OOB: %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x .rawsize adjusted to 0x%llx (%d bad blocks) .jffs2.e.i%s: error at offset %llx, ret %d Unknown nand command suffix '%s'. %zu bytes %s: %s markbadblock 0x%08lx NOT marked as bad! ERROR %d block 0x%08lx successfully marked as bad biterrUnknown nand load suffix '%s' Loading from %s, offset 0x%lx ** Read error ** Unknown image type Not a NAND device bootdevice ** No boot device ** ** Device %d not available nbootboot from NAND device[partition] | [[[loadAddr] dev] offset]NAND sub-systemgatewayipnetmaskhostnamerootpathserveripdnsipdomainnfsboot image via network using NFS protocol[loadAddress] [[hostIPaddr:]bootfilename]dhcpboot image via network using DHCP/TFTP protocoltftpbootboot image via network using TFTP protocolbootpboot image via network using BOOTP/TFTP protocoluuiddisk partition related commandspart uuid : - print partition UUID part uuid : - set environment variable to partition UUID part list - print a device's partition tableinvalid op setexprset environment variable as the result of eval expression[.b, .w, .l] name [*]value1 [*]value2 - set environment variable 'name' to the result of the evaluated expression specified by . can be &, |, ^, +, -, *, /, % size argument is only meaningful if value1 and/or value2 are memory addresses (*) setexpr[.b, .w, .l] name [*]value - load a value into a variableHex conversion error on %c Invalid bitlen %d Invalid device %d:%d Error %d during SPI transaction sspiSPI utility command[:][.] - Send and receive bits - Identifies the SPI bus - Identifies the chip select - Identifies the SPI mode to use - Number of bits to send (base 10) - Hexadecimal string that gets senttruedo nothing, successfullyfalsedo nothing, unsuccessfullyminimal test like /bin/sh[args..]-o-z-n-eSee InterfaceAudioCommunicationHuman InterfacePrinterMass StorageHubCDC DataVendor specificHuman Interface, Subclass: NoneBoot KeyboardMousereservedMass Storage, RBC SFF-8020i (ATAPI)QIC-157 (Tape)UFISFF-8070Transp. SCSICommand/BulkCommand/Bulk/IntBulk only12 Mb/s+- %s (%s, %dmA) %s %s %s %s String: "%s"Self Powered Bus Powered Remote Wakeup InOut Configuration: %d - Interfaces: %d %s%s%dmA Interface: %d - Alternate Setting %d, Endpoints: %d - Class - - Endpoint %d %s ControlIsochronousInterrupt MaxPacket %d Interval %dmsusb%d: %s, USB Revision %x.%x - %s %s %s - Class: - Class: (from Interface) %s - PacketSize: %d Configurations: %d - Vendor: 0x%04x Product 0x%04x Version %d.%d (Re)start USB... stopserialstopping USB.. USB is stopped. Please issue 'usb start' first. treeUSB device tree: infconfig for device %d *** No device available *** Device %d does not exist. Device is no hub or does not have %d ports. Setting Test_J modeSetting Test_K modeSetting Test_SE0_NAK modeSetting Test_Packet modeSetting Test_Force_Enable modeUnrecognized test mode: %s Available modes: J, K, S[E0_NAK], P[acket], F[orce_Enable] on downstream facing port %d... on upstream facing port... Error during SET_FEATURE. Test mode successfully set. Use 'usb start' to return to normal operation. stor no USB devices available no current device selected USB read: device %d block # %ld, count %ld ... %ld blocks read: %s USB write: device %d block # %ld, count %ld ... %ld blocks write: %s USB device %d: unknown device Device %d: 1.5 Mb/s480 Mb/s5 Gb/susbbootboot from USB deviceloadAddr dev:partUSB sub-systemstart - start (scan) USB controller usb reset - reset (rescan) USB controller usb stop [f] - stop USB [f]=force stop usb tree - show USB device tree usb info [dev] - show available USB devices usb test [dev] [port] [mode] - set USB 2.0 test mode (specify port 0 to indicate the device's upstream port) Available modes: J, K, S[E0_NAK], P[acket], F[orce_Enable] usb storage - show details of USB storage devices usb dev [dev] - show or set current USB storage device usb part [dev] - print partition table of one or all USB storage devices usb read addr blk# cnt - read `cnt' blocks starting at block `blk#' to memory address `addr' usb write addr blk# cnt - write `cnt' blocks starting at block `blk#' from memory address `addr'failed to stop USB controller %d unable to get descriptor, error %lX config descriptor too short (expected %i, got %i) %s: failed to get descriptor - too long: %d selecting invalid interface %dERROR, too many USB Devices, max=%d Cannot allocate device context to get SLOT_ID Couldn't reset port %i USB device not accepting new address (error=%lX) unable to get device descriptor (error=%d) USB device descriptor short read (expected %i, got %i) usb_new_device: Cannot read configuration, skipping device %04x:%04x ERROR: NOT USB_CONFIG_DESC %x ERROR: Invalid USB CFG length (%d) ERROR: Invalid USB IF length (%d) USB IF descriptor overflowed buffer! Too many USB interfaces! ERROR: Invalid USB EP length (%d) USB EP descriptor overflowed buffer! Endpoint descriptor out of order! Interface %d has too many endpoints! ERROR: Invalid USB EPC length (%d) USB EPC descriptor overflowed buffer! EPC descriptor out of order! failed to set default configuration len %d, status %lX USB%d: scanning bus %d for devices... %d USB Device(s) found No USB Device found lowlevel init failed Port not available. USB error: all controllers failed lowlevel init cannot reset port %i!? ERROR: USB_MAX_HUB (%d) reached Did not get interrupt on CBI cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X (NOT READY) cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X No storage devices, perhaps not 'usb start'ed..? USB Storage Transport unknown / not yet implemented Sorry, protocol %d not yet supported. error in inquiry Device NOT ready Request Sense returned %02X %02X %02X READ_CAP ERROR scanning usb for storage devices... max USB Storage Device reached: %d stopping %d Storage Device(s) found usb_dnl_fastbootuse USB Fastboot protocol - run as a fastboot usb device## Copying part %d from legacy image at %08lx ... Must specify load address for %s command with compressed image Bad Image Part Invalid image type for imxtract Loading part %d ... Uncompressing part %d ... GUNZIP ERROR - image not loaded fileaddrimxtractextract a part of a multi-imagedo_bootmERROR prep subcommand failed! Subcommand failed Argument image is now in RAM: 0x%p Argument image is now in RAM at: 0x%p splSPL configurationexport [kernel_addr] [initrd_addr] [fdt_addr] img "atags" or "fdt" kernel_addr address where a kernel image is stored. kernel is loaded as part of the boot process, but it is not started. initrd_addr address of initial ramdisk can be set to "-" if fdt_addr without initrd_addr is used. fdt_addr in case of fdt, the address of the device tree. exportatagsSaving Environment to %s... ## Error: cannot export environment Environment size: %d/%ld bytes ## Warning: defaulting to text format ## Error: external checksum format must pass size ## Info: input data size = %zu = 0x%zX ## Error: bad CRC, import failed ERROR: Environment import failed: errno = %d at %s:%d/%s() /home/jsg/u-boot-2015.01/common/cmd_nvedit.c## %s: only one of "-b", "-c" or "-t" allowed ## Warning: Input data exceeds %d bytes - truncated ## Resetting to default environment ## Error: illegal character '='in variable name "%s" ## Can't malloc %d bytes ## Error inserting "%s" variable, errno=%d Please enter '%s': setenvERROR: Cannot export environment: errno = %d at %s:%d/%s() %zXenv_buf [%d bytes] too small for value of "%s" edit: runrun commands in an environment variablevar [...] - run the commands in the environment variable(s) 'var'askenvget environment variables from stdinname [message] [size] - get environment variable 'name' from stdin (max 'size' chars)set environment variables[-f] name value ... - [forcibly] set environment variable 'name' to 'value ...' setenv [-f] name - [forcibly] delete environment variable 'name'printenvprint environment variables[-a] - print [all] values of all environment variables printenv name ... - print value of environment variable 'name'editenvedit environment variablename - edit environment variable 'name'environment handling commandsdeleteeditimportprintsaveenvsave environment variables to persistent storage*** Warning - %s, using default environment Using default environment /home/jsg/u-boot-2015.01/common/env_common.c!bad CRCERROR: Cannot import environment: errno = %d at %s:%d/%s() !import failedy Y yes YES stdoutstderrIn: No input devices available! Out: No output devices available! Err: No error devices available! pre-reloc realloc() is not supportedOut of pre-reloc memorybootm_lowbootm_sizebootm_mapsize%d Bytes = Unknown OSUnknown ArchitectureUnknown ImageUnknown Compression%sImage Name: %.*s %sImage Type: %s %s %s (%s) %sData Size: %sLoad Address: %08x %sEntry Point: %08x %sContents: %s Image %d: %s Offset = 0x%08lx ## Loading init Ramdisk from Legacy Image at %08lx ... No Linux %s Ramdisk Image Wrong Ramdisk Image Format ## Loading init Ramdisk from multi component Legacy Image at %08lx ... initrd_highramdisk - allocation error Loading Ramdisk to %08lx, end %08lx ... uncompressedbzip2bzip2 compressedgzipgzip compressedlzmalzma compressedlzolzo compressedaisimageDavinci AIS imageFilesystem ImagefirmwareFirmwareflat_dtFlat Device TreegpimageTI Keystone SPL ImagekernelKernel Imagekernel_noloadKernel Image (no loading done)kwbimageKirkwood Boot ImageimximageFreescale i.MX Boot ImageInvalid ImagemultiMulti-File ImageomapimageTI OMAP SPL With GP CHpblimageFreescale PBL Boot ImageRAMDisk ImageScriptsocfpgaimageAltera SOCFPGA preloaderstandaloneStandalone ProgramublimageDavinci UBL imagemxsimageFreescale MXS Boot ImageatmelimageATMEL ROM-Boot Imagex86_setupx86 setup.binInvalid OSlinuxLinuxnetbsdNetBSDoseEnea OSEplan9Plan 9rtemsRTEMSu-bootU-BootvxworksVxWorksInvalid ARCHalphaAlphaarmARMIntel x86ia64IA64m68kM68KmicroblazeMicroBlazemipsMIPSmips64MIPS 64 Bitnios2NIOS IIpowerpcPowerPCppcs390IBM S390SuperHsparcSPARCsparc64SPARC 64 BitblackfinBlackfinavr32AVR32nds32NDS32or1kOpenRISC 1000sandboxSandboxarm64AArch64AMD x86_64Android's image name: %s Kernel load addr 0x%08x size %u KiB Kernel command line: %s Error: malloc in android_image_get_kernel failed! ANDROID!RAM disk load addr 0x%08x size %u KiB ERROR: - must RESET the board to recover. reserving fdt memory region: addr=%llx size=%llx image is not a fdtfdt_highFailed using fdt_high value for Device Treedevice tree - allocation error Using Device Tree in place at %p, end %p Loading Device Tree to %p, end %p ... fdt move failed## Flattened Device Tree from Legacy Image at %08lx fdt header checksum invalidfdt checksum invaliduImage is not a fdtuImage is compresseduImage data is not a fdtfdt overwritten## Flattened Device Tree blob at %08lx ERROR: Did not find a cmdline Flattened Device Tree Booting using the fdt blob at %#08lx ## Flattened Device Tree from multi component Image at %08lX Booting using the fdt at 0x%p fdt size != image sizeERROR: /chosen node create failed ERROR: arch-specific fdt fixup failed - must RESET the board to recover. ** Too many args (max. %d) ** ## Command too long! %.*s%*s %s - %s Usage: %s - No additional help available. %-*s- %s Unknown command '%s' - try 'help' without arguments for list of all known commands Unknown command '%s' - try 'help' 'bootd' recursion detected Command '%s' failed: Error %d CksumxyzModem - %s mode, %d(SOH)/%d(STX)/%d(CAN) packets, %d retries Unknown errorBlock sequence errorCRC/checksum errorInvalid framingCancelledEnd of fileTimed outSorry, zModem not available yetCan't access file Loading from %s device %d, partition %d: Name: %.32s Type: %.32s ** Read error on %d:%d ** Bad Header Checksum ** (%d:%d) Vendor: %s Prod.: %s Rev: %s Model: %s Firm: %s Ser#: %s Vendor: %s Rev: %s Prod: %s device type DOC device type unknown Unhandled device type: %i Type: Removable Hard DiskCD ROMOptical DeviceTape# %02X # Capacity: %ld.%ld MB = %ld.%ld GB (%ld x %ld) Capacity: not available Partition Map for IDESATAATAPIUSBDOCHOST device %d -- Partition Type: %s DOS## Unknown partition table ** Bad device specification %s %s ** ** Bad HW partition specification %s %s ** ** Bad device %s %s ** hostfsSandbox host** No device specified ** auto** Bad partition specification %s %s ** ** Bad device size - %s %s ** ** No partition table - %s %s ** Whole Disk** Invalid partition %d ** ** No valid partitions found ** ** Invalid partition type "%.32s" (expect "U-Boot") FAT32FAT Extd Boot** Can't read partition table on %d:%d ** bad MBR sector signature 0x%02x%02x %3d %-10d %-10d %08x-%02x %02x%s%s hd%c%dsd%c%dusbd%c%ddocd%c%dxx%c%d%08x-%02xPart Start Sector Num Sectors UUID Type Failed to unbind dev '%s' on error path %s: Device '%s' failed to remove on error path %s: null device No match for driver '%s' Cannot find driver '%s' Cannot create device named '%s' (err=%d) Virtual root driver does not exist! Virtual root driver already exists! Some drivers were not found rootroot_driverCannot find uclass for id %d: please add the UCLASS_DRIVER() declaration for this UCLASS_... id Device '%s': seq %d is in use by '%s' %s: Device '%s' failed child_post_remove()%s: Device '%s' failed to remove, but children are gone %s: Device '%s' failed to post_probe on error path %s: %s: error: gpio %s%d not reserved dir_inputdir_outputget_valueset_value%s%d: %s: %d [%c]%s%sunusedfuncGPIO%d_omap3-gpio unknown bank method %s %d /home/jsg/u-boot-2015.01/drivers/gpio/omap_gpio.cError, wrong i2c adapter %d max %d possible wrong hwadapnr: %d Error : I2C initializing first phase clock Error : I2C initializing clock Timed out in wait_for_bb: status=%04x Timed out in wait_for_event: status=%04x Check if pads/pull-ups of bus %d are properly configured I2C write: addr len < 0 I2C write: data len < 0 I2C write: NULL pointer passed I2C write: addr len %d not supported I2C write: address 0x%x + 0x%x out of range i2c_write: pads on bus %d probably not configured (status=0x%x) i2c_write: error waiting for addr ACK (status=0x%x) i2c_write: bus not ready for addr Tx (status=0x%x) i2c_write: error waiting for data ACK (status=0x%x) i2c_write: bus not ready for data Tx (i=%d) i2c_write: timed out writig last byte! I2C read: addr len < 0 I2C read: data len < 0 I2C read: NULL pointer passed I2C read: addr len %d not supported I2C read: address out of range i2c_read (addr phase): pads on bus %d probably not configured (status=0x%x) i2c_read: error waiting for addr ACK (status=0x%x) i2c_read (data phase): pads on bus %d probably not configured (status=0x%x) i2c_probe: pads on bus %d probably not configured (status=0x%x) ERROR: Timeout in soft-reset ERROR: failed to setup I2C bus-speed! omap24_2omap24_1omap24_0Status Error: 0x%08X Timeout waiting card ready MMC Device %d not found MMC: block number 0x%lx exceeds max(0x%lx) mmc fail to send stop cmd Card doesn't support part_switch MMC: SET_DSR failed Man %06x Snr %04x%04x%c%c%c%c%c%c%s is deprecated! use mmc_create() instead. MMC: no card present Card did not respond to voltage select! %s: %d%s: timedout waiting for ics! %s: timedout waiting for sysctl %x to clear %s: timedout waiting on cmd inhibit to clear %s: timedout waiting for STAT (%x) to clear %s : timeout: No status update %s: timedout waiting for status! %s: timedout waiting for cc! %s: timedout waiting for cc2! %s: timedout waiting for softresetall! mmc_cdmmc_wpOMAP SD/MMC Caution! Your devices Erase group is 0x%x The erase range would be change to 0x%lx~0x%lx mmc erase failed mmc write failed Removing MTD device #%d (%s) with use count %d U-Boot BUG at %s:%d! /home/jsg/u-boot-2015.01/drivers/mtd/mtdcore.c%s: unlock failed, writes may not work nand%d%lu MiB BUG: failure at %s:%d/%s()! /home/jsg/u-boot-2015.01/drivers/mtd/nand/nand_bbt.cBUG!ToshibaSamsungFujitsuNationalRenesasST MicroHynixMicronAMD/SpansionMacronixEonSanDiskIntelUnknownTC58NVG2S0F 4G 3.3V 8-bitTC58NVG3S0F 8G 3.3V 8-bitTC58NVG5D2 32G 3.3V 8-bitTC58NVG6D2 64G 3.3V 8-bitSDTNRGAMA 64G 3.3V 8-bitNAND 4MiB 5V 8-bitNAND 4MiB 3,3V 8-bitNAND 8MiB 3,3V 8-bitNAND 16MiB 1,8V 8-bitNAND 16MiB 3,3V 8-bitNAND 16MiB 1,8V 16-bitNAND 16MiB 3,3V 16-bitNAND 32MiB 1,8V 8-bitNAND 32MiB 3,3V 8-bitNAND 32MiB 1,8V 16-bitNAND 32MiB 3,3V 16-bitNAND 64MiB 1,8V 8-bitNAND 64MiB 3,3V 8-bitNAND 64MiB 1,8V 16-bitNAND 64MiB 3,3V 16-bitNAND 128MiB 1,8V 8-bitNAND 128MiB 3,3V 8-bitNAND 128MiB 1,8V 16-bitNAND 128MiB 3,3V 16-bitNAND 256MiB 3,3V 8-bitNAND 256MiB 1,8V 8-bitNAND 256MiB 1,8V 16-bitNAND 256MiB 3,3V 16-bitNAND 512MiB 1,8V 8-bitNAND 512MiB 3,3V 8-bitNAND 512MiB 1,8V 16-bitNAND 512MiB 3,3V 16-bitNAND 1GiB 1,8V 8-bitNAND 1GiB 3,3V 8-bitNAND 1GiB 1,8V 16-bitNAND 1GiB 3,3V 16-bitNAND 2GiB 1,8V 8-bitNAND 2GiB 3,3V 8-bitNAND 2GiB 1,8V 16-bitNAND 2GiB 3,3V 16-bitNAND 4GiB 1,8V 8-bitNAND 4GiB 3,3V 8-bitNAND 4GiB 1,8V 16-bitNAND 4GiB 3,3V 16-bitNAND 8GiB 1,8V 8-bitNAND 8GiB 3,3V 8-bitNAND 8GiB 1,8V 16-bitNAND 8GiB 3,3V 16-bitNAND 16GiB 1,8V 8-bitNAND 16GiB 3,3V 8-bitNAND 16GiB 1,8V 16-bitNAND 16GiB 3,3V 16-bitNAND 32GiB 1,8V 8-bitNAND 32GiB 3,3V 8-bitNAND 32GiB 1,8V 16-bitNAND 32GiB 3,3V 16-bitNAND 64GiB 1,8V 8-bitNAND 64GiB 3,3V 8-bitNAND 64GiB 1,8V 16-bitNAND 64GiB 3,3V 16-bitAttempt to erase non block-aligned data Size of erase exceeds limit Skipping bad block at 0x%08llx %s: MTD get bad block failed: %d %s: MTD Erase failure: %d %s: MTD writeoob failure: %d Erasing at 0x%llx -- %3d%% complete. Cleanmarker written at 0x%llx.Attempt to write non page-aligned data Attempt to write outside the flash area Size of write exceeds partition or device limit NAND write to offset %llx failed %d Skip bad block 0x%08llx Attempt to read non page-aligned data Attempt to read outside the flash area Size of read exceeds partition or device limit NAND read from offset %llx failed %d Skipping bad block 0x%08llx /home/jsg/u-boot-2015.01/drivers/mtd/nand/nand_base.cWARNING in %s line %d Error: Ecc is wrong Error: Bad compare! failed nand: error: no NAND devices found nand: error: insufficient OOB: require=%d nand: error: CONFIG_NAND_OMAP_ELM required for ECC nand: error: unsupported ECC scheme nand: error: Unable to find NAND settings in GPMC Configuration - quitting Error:TWL4030: failed to read the power register Could not initialize hardware reset Error:TWL4030: failed to write the power register Could not write vsel to reg %02x (%d) Could not write grp_sel to reg %02x (%d) No serial driver found## Baudrate %d bps not supported ## Baudrate may not be deleted SPI error: unsupported bus %i. Supported busses 0 - 3 SPI error: unsupported chip select %i on bus %i SPI error: unsupported frequency %i Hz. Max frequency is 48 Mhz SPI error: unsupported SPI mode %i SPI error: malloc of SPI structure failed SPI TXS timed out, status=0x%08x SPI RXS timed out, status=0x%08x omap3_spi: invalid wordlen %d scanning usb for ethernet devices... usbethWarning: failed to set MAC address max USB Ethernet Device reached: %d stopping %d Ethernet Device(s) found Waiting for Ethernet connection... done. unable to connect. asxERROR: RX: failed to receive at %s:%d/%s() /home/jsg/u-boot-2015.01/drivers/usb/eth/mcs7830.cERROR: RX: got too many bytes (%d) at %s:%d/%s() mcsERROR: setting autoneg failed at %s:%d/%s() ERROR: failed to set multicast hash at %s:%d/%s() ERROR: failed to set configuration at %s:%d/%s() Error: SMSC95xx: No MAC address set - set usbethaddr sms/home/jsg/u-boot-2015.01/drivers/usb/gadget/composite.ccompositeusb_dnloadmusb-hdrc%s: failed!, error: %d f_fastbootstatus: %d ep '%s' trans: %d Booting kernel.. 0x%lxError %d on queue OKAYBad status: %d downloading of %d bytes finished ERROR: unknown command: %s at %s:%d/%s() /home/jsg/u-boot-2015.01/drivers/usb/gadget/f_fastboot.cFAILunknown commandERROR: buffer overflow at %s:%d/%s() FAILbuffer overflowERROR: missing variable at %s:%d/%s() FAILmissing var0.4bootloader-versionU-Boot 2015.01downloadsize0x%08xmax-download-sizeserialnoserial#FAILValue not setERROR: unknown variable: %s at %s:%d/%s() FAILVariable not implementedfailed to enable out ep failed to alloc out req failed to enable in ep failed alloc req in Starting download of %d bytes FAILdata invalid sizeFAILdata too largeDATA%08xrebootgetvar:download:continueERROR: can't autoconfigure on %s at %s:%d/%s() /home/jsg/u-boot-2015.01/drivers/usb/gadget/ether.c%02X%02X%02X%02X%02X%02Xusing %s, OUT %s IN %s%s%s MAC %02x:%02x:%02x:%02x:%02x:%02x ERROR: %s failed, status = %d at %s:%d/%s() U-bootERROR: controller '%s' not recognized at %s:%d/%s() timeout sending packets to usb ethernet ERROR: received NULL ptr at %s:%d/%s() ERROR: rx submit --> %d at %s:%d/%s() ERROR: dev->rx_req invalid at %s:%d/%s() fullERROR: can't alloc requests at %s:%d/%s() %s speed config #%d: %d mA, %s, using %s CDC Ethernetusbnet_devaddrusbnet_hostaddrERROR: Need valid 'usbnet_devaddr' to be set at %s:%d/%s() ERROR: Need valid 'usbnet_hostaddr' to be set at %s:%d/%s() cdc_connect_timeoutERROR: The remote end did not respond in time. at %s:%d/%s() usb_etherEthernet DataEHCI failed to shut down host controller. out of buffer pointers (%u bytes left) unable to allocate TDs unable to construct SETUP TD unable to construct DATA TD EHCI fail timeout STS_ASS set EHCI timed out on TD - token=%#x EHCI fail timeout STS_ASS reset EHCI failed: timeout when disabling periodic list EHCI failed: timeout when enabling periodic list port(%d) reset error EHCI fail to reset USB EHCI %x.%02x %s: xfers requiring several transactions are not supported. Timeout destroying interrupt endpoint queue Timeout poll on interrupt endpoint %s: RESET timeout USB PHY1 resetep%d%s%s %d: SetupEnd came in a wrong ep0stage %s %s %d: SETUP packet len %d != 8 ? %s: peripheral reset irq lost! /home/jsg/u-boot-2015.01/drivers/usb/musb-new/musb_gadget_ep0.cidlein/statusout/statuswaitUTMI-16UTMI-8/home/jsg/u-boot-2015.01/drivers/usb/musb-new/musb_core.c, dyn FIFOs, bulk combine, bulk split, HB-ISO Rx, HB-ISO Tx, SoftConn%s: kernel must blacklist external hubs %d.%d%smusb_init_controller failed with status %d bad parameter. Controller uninitialized gadget_start failed with %d bind failed with %d ERROR: %s Could not initialize PHY TWL4030:USB:Write[0x%x] Error %d TWL4030:USB:Read[0x%x] Error %d Error:TWL4030:USB Timeout setting PHY DPLL clock ** Unrecognized filesystem type ** ** Unable to read file %s ** ** Unable to write file %s ** bootfile** No boot file defined ** %llu bytes read in %lu ms (%llu bytes written in %lu ms** Can not find directory. ** ** Cannot support non-zero offset ** ** File not found %s ** Extent Error ** SI ext2fs read block (indir 1)malloc failed. ** ** SI ext2fs read block (indir 1):malloc failed. ** ** SI ext2fs read block (indir 1)failed. ** ** DI ext2fs read block (indir 2 1)malloc failed. ** ** DI ext2fs read block (indir 2 1)failed. ** ** DI ext2fs read block (indir 2 2)malloc failed. ** ** DI ext2fs read block (indir 2 2)failed. ** ** TI ext2fs read block (indir 2 1)malloc failed. ** ** TI ext2fs read block (indir 2 1)failed. ** ** TI ext2fs read block (indir 2 2)malloc failed. ** ** TI ext2fs read block (indir 2 2)failed. ** invalid extent block < ? > %10u %s Failed to mount ext2 filesystem... %s read outside partition %lu ** ext2fs_devread() read error ** ** %s read error - block * %s read error - last part error: overflow occurs Error: Invalid FAT entry: 0x%08x FAT: Misaligned buffer address (%p) FAT32 FAT12 FAT16 Invalid FAT entry error: wrinting directory entry Error: reading directory block Error: %llu overflow Error: writing contents Error: flush fat buffer Error: writing directory entry Error: finding empty cluster Error: clearing FAT entries U** Partition %d not valid on device %d ** Error: FAT sector size mismatch (fs=%hu, dev=%lu) %s%c %8u %s%c %d file(s), %d dir(s) Error reading cluster No current device Interface: Device %d: No valid FAT fs found Filesystem: %s "%s" reading %s Error: non zero offset is currently not suported. writing %s Can't list files without a filesystem! %s/%sCan't load file without a filesystem! invalid distance too far backinvalid distance codeinvalid literal/length codeincorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid literal/lengths setinvalid distances setincorrect data checkincorrect length checkneed dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versioncompatibleFDT_ERR_NOTFOUNDFDT_ERR_EXISTSFDT_ERR_NOSPACEFDT_ERR_BADOFFSETFDT_ERR_BADPATHFDT_ERR_BADSTATEFDT_ERR_TRUNCATEDFDT_ERR_BADMAGICFDT_ERR_BADVERSIONFDT_ERR_BADSTRUCTUREFDT_ERR_BADLAYOUT1.2.3Error: inflateInit2() returned %d Error: inflate() returned %d Error: Bad gzipped data Error: gunzip out of data in header initcall sequence %p failed at call %p (err=%d) ERROR: Failed to allocate 0x%lx bytes below 0x%lx. .%03ldlist passed to list_sort() too long for efficiency ## ERROR: unsupported match method: 0x%02x Env export buffer too small: %zu, but need %zu himport_r: can't insert "%s=%s" into hash table WARNING: '%s' neither in running nor in imported env! WARNING: '%s' not in imported env, deleting it! %s %llu Bytes%s%lu.%ld %ciB%s %0*x %s ### ERROR ### Please RESET the board ### %s:%u: %s: Assertion `%s' failed.%*llu## Warning: gatewayip needed but not set ARP Retry count exceeded; starting again bad length %d < %d *** WARNING: %s is too long (%d - max: %d) - truncated Host NameRoot PathOpt Boot File*** WARNING: using vendor optional boot file *** Unhandled DHCP Option in OFFER/ACK: %d DHCP client bound to address %pI4 (%lu ms) DHCP: INVALID STATE BOOTP broadcast %d Retry time exceeded; starting again ethact%pM%s%daddr%saddr/home/jsg/u-boot-2015.01/net/eth.ceth%dmacskipethmacskip Warning: %s MAC addresses don't match: Address in SROM is %pM Address in environment is %pM Warning: %s using MAC address from net device Error: %s address not set. Warning: %s failed to set MAC address Error: %s address %pM illegal value Board Net Initialization Failed CPU Net Initialization Failed Net Initialization Skipped ethprime [PRIME] Warning: eth device name has a space! ethrotateautoloadNFSnetretryonce ICMP Host Redirect to %pI4 %d.%d.%d.%dnvlan*** ERROR: `serverip' not set *** ERROR: `ipaddr' not set *** ERROR: No ethernet found. *** ERROR: `ethaddr' not set *** ERROR: `eth%daddr' not set Abort Bytes transferred = %ld (%lx hex) *** ERROR: Cannot mount *** ERROR: Cannot umount done *** ERROR: File lookup fail *** ERROR: Symlink fail Retry count exceeded; starting again T /nfsroot/%02X%02X%02X%02X.img*** Warning: no boot file name; using '%s' Using %s device File transfer via NFS from server %pI4; our IP address is %pI4; sending through gateway %pI4 Filename '%s/%s'. Size is 0x%x Bytes = Load address: 0x%lx Loading: *octetblksize%c%d%cFile too largeFile has bad magicblksize TFTP error: First block is not block 1 (%ld) Starting again TFTP error: '%s' (%d) Not retrying... %s; starting again Retry count exceededtftpblocksizetftptimeoutTFTP timeout (%ld ms) too low, set minimum = 1000 ms TFTP %s server %pI4; our IP address is %pI4fromFilename '%s'.Load address: 0x%lx uclass %d: %s - %c %s @ %08lx, %d %-11s [ %c ] | `-- |-- Class Probed Name dmDriver model low level accesstree Dump driver model tree ('*' = activated) dm uclass Dump list of instances for each uclassraise: Signal # %d caught ( w U-Boot 2015.01 (Jan 24 2015 - 09:41:52) d\5gg8gg *dgg g  g g bb@db,e$e d rb8#hddh&eb cDcLc|c@ecccdee8dd\dTfgg\ffgLfg0gffpgPg g hȖg0r0,gffff[addr [arg ...]] - boot application image stored in memory passing arguments 'arg ...'; when booting a Linux kernel, 'arg' can be the address of an initrd image When booting a Linux kernel which requires a flat device-tree a third argument is required which is the address of the device-tree blob. To boot that kernel without an initrd image, use a '-' for the second argument. If you do not pass a third a bd_info struct will be passed instead Sub-commands to do part of the bootm sequence. The sub-commands must be issued in the order below (it's ok to not issue all sub-commands): start [addr [arg ...]] loados - load OS image ramdisk - relocate initrd, set env initrd_start/initrd_end fdt - relocate flat device tree cmdline - OS specific command line processing/setup bdt - OS specific bd_t processing prep - OS specific prep before relocation or go go - start OStllQ %l@-l1l6lh[addr [initrd[:size]] [fdt]] - boot Linux zImage stored in memory The argument 'initrd' is optional and specifies the address of the initrd in memory. The optional argument ':size' allows specifying the size of RAW initrd. When booting a Linux kernel which requires a flat device-tree a third argument is required which is the address of the device-tree blob. To boot that kernel without an initrd image, use a '-' for the second argument. If you do not pass a third a bd_info struct will be passed instead xe[addr] - run script starting at addr - A valid image header must be present/ addr [-c] [] - Set the [control] fdt location to fdt move - Copy the fdt to and make it active fdt resize - Resize fdt to size + padding to 4k addr fdt print [] - Recursive print starting at fdt list [] - Print one level starting at fdt get value - Get and store in fdt get name - Get name of node and store in fdt get addr - Get start address of and store in fdt get size [] - Get size of [] or num nodes and store in fdt set [] - Set [to ] fdt mknode - Create a new node after fdt rm [] - Delete the node or fdt header - Display header info fdt bootcpu - Set boot cpuid fdt memory - Add/Update memory node fdt rsvmem print - Show current mem reserves fdt rsvmem add - Add a mem reserve fdt rsvmem delete - Delete a mem reserves fdt chosen [ ] - Add/update the /chosen branch in the tree / - initrd start/end addr NOTE: Dereference aliases by omiting the leading '/', e.g. fdt print ethernet0.bus [muxtype:muxaddr:muxchannel] - show I2C bus info crc32 chip address[.0, .1, .2] count - compute CRC32 checksum i2c dev [dev] - show or set current I2C bus i2c loop chip address[.0, .1, .2] [# of objects] - looping read of device i2c md chip address[.0, .1, .2] [# of objects] - read from I2C device i2c mm chip address[.0, .1, .2] - write to I2C device (auto-incrementing) i2c mw chip address[.0, .1, .2] value [count] - write to I2C device (fill) i2c nm chip address[.0, .1, .2] - write to I2C device (constant address) i2c probe [address] - test for and show device(s) on the I2C bus i2c read chip address[.0, .1, .2] length memaddress - read to memory i2c write memaddress chip address[.0, .1, .2] length - write memory to i2c i2c reset - re-init the I2C Controller i2c speed [speed] - show or set I2C bus speed`Led hhmpsv@դXY{`|خ@5DդXY{XpۤdĚɚ - list partition table mtdparts delall - delete all partitions mtdparts del part-id - delete partition (e.g. part-id = nand0,1) mtdparts add [@] [] [ro] - add partition mtdparts default - reset partition table to defaults ----- this command uses three environment variables: 'partition' - keeps current partition identifier partition := := ,part_num 'mtdids' - linux kernel mtd device id <-> u-boot device id mapping mtdids=[,,...] := = := 'nand'|'nor'|'onenand' := mtd device number, 0... := unique device tag used by linux kernel to find mtd device (mtd->name) 'mtdparts' - partition list mtdparts=mtdparts=[;...] := :[,...] := unique device tag used by linux kernel to find mtd device (mtd->name) := [@][][] := standard linux memsize OR '-' to denote all remaining space := partition start offset within the device := '(' NAME ')' := when set to 'ro' makes partition read-only (not used, passed to kernel)info - show available NAND devices nand device [dev] - show or set current device nand read - addr off|partition size nand write - addr off|partition size read/write 'size' bytes starting at offset 'off' to/from memory address 'addr', skipping bad blocks. nand read.raw - addr off|partition [count] nand write.raw - addr off|partition [count] Use read.raw/write.raw to avoid ECC and access the flash as-is. nand erase[.spread] [clean] off size - erase 'size' bytes from offset 'off' With '.spread', erase enough for given file size, otherwise, 'size' includes skipped bad blocks. nand erase.part [clean] partition - erase entire mtd partition' nand erase.chip [clean] - erase entire chip' nand bad - show bad blocks nand dump[.oob] off - dump page nand scrub [-y] off size | scrub.part partition | scrub.chip really clean NAND erasing bad blocks (UNSAFE) nand markbad off [...] - mark bad block(s) at offset (UNSAFE) nand biterr off - make a bit error at offset (UNSAFE)addr part [dest] - extract from legacy image at and copy to QtllQ%l-l1ltll%l-l1lask name [message] [size] - ask for environment variable env default [-f] -a - [forcibly] reset default environment env default [-f] var [...] - [forcibly] reset variable(s) to their default values env delete [-f] var [...] - [forcibly] delete variable(s) env edit name - edit environment variable env export [-t | -b | -c] [-s size] addr [var ...] - export environment env import [-d] [-t [-r] | -b | -c] addr [size] - import environment env print [-a | name ...] - print environment env run var [...] - run commands in an environment variable env save - save environment env set [-f] name [arg ...] ި@aD_@ZDhc\@[@ZP @ah:h:p:p:x:x:::::::::::::::::::::::::::::::::;;;;;;;; ; ;(;(;0;0;8;8;@;@;H;H;P;P;X;X;`;`;h;h;p;p;x;x;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;<<<<<<<< < <(<(<0<0<8<8<@<@<H<H<P<P<X<X<`<`<h<h<p<p<x<x<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<======== = =(=(=0=0=8=8=@=@=H=H=P=P=X=X=`=`=h=h=p=p=x=x=================================>>>>>>>> > >(>(>0>0>8>8>@>@>H>H>P>P>X>X>`>`>l# >1tbB#$?#>Bbt0# $?{ܐ&vӐ&vה2vV (ޔvV (EޔvP@ @(k   $ $ 93@Os@eC@|S@5 @u @E @U @6@@v@@F@@0V@@Gx@G9@^y@ur@uI@t@Y@q@@@@@@@ @ 0@ 0@ G^^u  u   1 I av    "7 M c x   @:@*@ J@ )<?, VL m>. N 0PQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~N()*+,-./0123456789:;<=>?&Q"% hwwv$wPp0,fYZDYwwww@@ w B x x h x@@@  x Ethernet Gadget)  @ @      @  @  @               @,lzz@{{$| |-:9|990:- F:L-d-l-t-|---- T'6%F@aMr$\)EYux`u1ikkik@hk˩Lѩ8j@kj$âʢ +w|3wd<Hetɔ v'vDvbXg8%$@8\wqw"Dh*Dp@Zp6wwy`yyzxxxw0wwxHxx y)yAy[@aFUD^ |؍|7||}-}|x|b)yAyV{h_{{QX{!h@@hhh̩Okp@yppMQ'vlvvj@jjjU5:Zy= ΒԒh ّ hޓzxhm ֕cgv!D):u8-pXi}@ 2o[w[[|d  d8s(ۤ'@[p ]@ypp.h@pԨZU@apT3g@PH;g[gt)yAy309WWt^t8!5dX9K0.@|p8=@B "jy;!CX  zq\4Ye  5\5\5\5\5\5\6Ye.>hxFr\}iw`qr|Oh\3P4,4,4,ѱ  $(,0480 4 8 X\`dhH"L"P"$$$$$$$$$$$$$$$$$$$$$'''(((()) )$)()***++,,0,L,d-h-l-p-t-x-|-------.(.H.h..x0|00000000011188888888888888888889 999 9$9(9,9094989<9@9D9H9L9P9T9X9\9`9d9h9l9p9t9x9999999L? @<@@@AAAAAAAAAAAAAAAAAAABBB BBBBBB@CLC\DDLH>> >>>>> >$>(>,>0>4>8><>@>D>H>L>P>T>X>\>`>d>h>l>|>>>>> ?L?P?t????@(@L@p@@@@A$AHAlAAAAA BDBhBBBBBC@CdCCCCCD @@-,00S Sw @ @0/ @\0@-0S S S 00  00 Ѝ @@-@ ꠆T0hPX`< ?H4P4X4H8P8X8*H0P0X03H/h hQ?;8Q?0?00??10?/@-@P@PPT@@- L0, ,, ,0 0(0* H 4 R0U%H @H LH@1H@-@bP@0(0dmD3T@V @ @0-p2 @<0@<)0,00$00^:(0( R: ( 0c8*S`+S"S (#S D @ S0,($p0H@H2H1H@]I6n$L0P0 <0P0 ,0P0 0P0 00/$@]IM- *J`@=V00@=p2`0R0@0p2p26 P10*Sp2<p2J9009p:-pPF =L*00=4:4*@188@1@= >3=@=@-688@=@= <4@=@=@0@=@:<<@:@:00 0@:@: 00@:@:00@:@;00@;@<00@<= 02==P)0=@98P5 =00 0000020@=00 >3=0 6 8800<400@00@: 0 0ȟ<< 0 000 0 0 0 00 0 000 0`8? 00@>@> ?<4@>H= 00H=D-:<4D=D= 00D= @::6@:=l'8=\7h=X'00=87`p\P= 00P=L-:<4L=L= 00L==&0=6D0&0006`p8D0 00D0@ :<4@0@0 00@00\&00<6 D9  00D9@):<4@9@9 00@9909c P 5|@orP pE%900950pPJ =\%00=D5D%@188@1@188@1@= >3=@=@-688@=@= <4@=@=@0@=@:<<@:@:00 0@:@: 00@:@:00@:@;00@;@<00@<= 02==P$0=@48P5 =00 0000020@=00 >3=0 6 8800<400@00@: 0 0ß<< 0 000 0 0 0 00 0 000 0`300@>@>00@>@><<@>@><:@>H= 0 0H=H= 00H=D-:<4D=D= 00D= =6:==$"8=28="00=1P P= 00P=L-:<4L=L= 00L== 02==!0=p15 P( 0d!000@1P`D0 00D0@ :<4@0@0 00@00 0200 000;0D)  D)@*,$@)@)  @)) ")) )@ @0@0 @00@0@<0@<Ѝ`0Hp0H$IH@H MHPH@ @$MH$@H40** ** */@H8@-0@P@  @     ****** +  + (  ( (  ( <0<"05 P  T *!* * ,? , .@N5 POO8@6PH@H)/0/0H@-P Ph8 P 8 P6  5  @-P p/ @o/p/0/ H0P/ Hp@-`PnD;`0x0d0h0p0l0l0p0h0t0>}x00|0p0|0n4 @ o | r 0s00p  @-00mD@ mm4000P00mP /@- P1m4@P/m4@0<8 /p@-MP@T mD00 0``0>0@p' 0 00R0h000 W0 0 0 pGp 0W000  t 0S0d S00000fS 0` `0Ѝ\T0 @X8 @,( @-P0p `uPQ$ @0pb@0oSrpW` F$RR0 R0$R00    0 @A-pQWA>W PpUPP5P @HQ `G0g```F0dS0`@d00d 0    00@@@000eS00PP{@-@P000@-P0S`1US1S10/@- @<6VP R( PP /\ @V @M-M0 ?0d@?0@0 M$ Op`?p04/$P !UQR |@\1!8Q1l hP `T 00S@D `t@@ T @D g Ѝ苽 @xH-0x P?0?0@0M?@?@ P 0`0T `P6< P R( PKx @\ @V @|0 0@-|M P @(P T L # 0@ @00,@L@0P@ |Ѝ0 @M-MMPL!l 0P00l0 S`p +w p  0 p  p@+!$' d+v`x@ gV  SpD0p(0 0pD% p(p@00Ph 0P/U\UPP z$zPP:S" :00:zgP>00XCz?0/S\S :\:0`0P/$ l R0S(: 0': 0 0*l0 0C?o2V  Rb p0,07 PG, Rt*00 0WS40f G W40  R\@Z 0Wh$00 4:4S0W4  (0SC   )S*R 0>:S$0pP* :S0W0 S / %S t 0zP z{P[ 0t ?$0,0 p0,000l0` S7V 0bh'G`0@S 00 $x0V@( 0c`S030#S :SC T<:SPp l0`Z S908P?(07h&PF'7Z* 00R 0R0SW  :+SP  0 WX<W[<PiP #U [{$P0 Q00[v !0P$0 0000 00/R\R :SL 0R00G0S<@: 0h(%(00,qW, 0` 0S$  (0pP @?(0 0 `</ &<0S t< 0P @\hPP0 il0 S2 S?>U?:0d:@S :l Q'a70P P@ P 0`@P!R0hP`l0 S2 S>0V*  0@P  T0@ZPP 006 R0ؠͱrh 0 P h@u! @T P  Z00- :  0 0a :h 0:=P`Xl0 S2 S?>VO*ؠpZh0:)0@SPBl0 S2 S?>P9* 0"h* 0yP :h  ? : @T P 0:Ppl0 S2 S?>W*ؠ`*0UP : @P :@ @hS P{ P00 0p>ލЍ @ @ @ @ @ @ @@-@ MD`p000# 00 0@000 ЍЀ薿 @-$M? 0 00P$ЍM-@`pU 303: @T 0 PVWV2#Q `p UT:@TP 0૰jpf`  Ѝ@- @ @0S0/@ 00c0Rs/@ Q 0 0c0\0s/ R0  \`/0-0 q\4n \00 0 SQ/0-@ 0l0S00  0 00C Q@ Q 0S//p@-@`TP1P!@Tp耖@-@T @Dp@-Q2QT!F !! 10e0a00 %2c0000 0 #A2c0000  Š\Ld0000@@pM- ap SR Ѝ@P   P"(30PP" 00 #1c000J1 100%2c 000J 03#b0  Jn00JJꟆZ| p@-QP@P`0 `F0P Ĵ D0eQӴP@ 0 c Rp @M-XMPxp Z|@ 'pp R r@D0-@D+@D [ Z@D@D 00`0 Q ZJ``r  T@  0`=`f0V0c   RTZ/@PbXP[ Z0 P X  P  0  RTZ/@Pb0 0CV  E00SRWUZVP0  0STZPXЍA @M-XM`P0Sw %S0@90+S  S #S @@-S 0S@@@@0C Qp `00C P 7'0pG*Spp0`W pg@0.S00C P ࠓ 00C \8(0H0*S0X  0hStSL\Z\P`0 lS`lP`L0nQ cQ %Q XQ dQ iQ sQ oQ pQ uQ xQ @  0pGW00 P E pGW @0 000aS IS$ MS qiS mS@@ kA@ pk@$ ß00P :!RQ 00R @@06S#@$00\ :  R P 00R @@ @0$4S@@%0, 0 $ 0 0$b Q~S0.S 0@@0@ 0 w!@p @0 @ 08P0`8 0  ?0 a 8P5 @%000SP0`FP( LS    lS  ZP0 tS hS0Sr r S ? @P `00cXЍ0 @0 @w-@-  qЍ Ѝ/@-Mp0`@cP @K P< 0 Kpc@ P 4Ѝ @ @P@-  P  0d@ 1A-pP(@003/P PU\0Pk` U U)0ES% 4/ 4/& 4/px 4/`X 4/PX 4/@0 4/0 4/003/P `AM-hMX8 0500U`1P @\00 0s0/S0s0S000H p(1 `@2S 23/ 0,3/  2`3/ V0(@ 3/0 h! @ R 0 S`0  0”`P%s:%u: %s: Assertion `%s' failed.%*llu%.*s(((((AAAAAABBBBBB0123456789abcdef0123456789ABCDEFError:TWL4030: failed to read the power register Could not initialize hardware reset Error:TWL4030: failed to write the power register Could not write vsel to reg %02x (%d) Could not write grp_sel to reg %02x (%d) BUG: failure at %s:%d/%s()! /home/jsg/u-boot-2015.01/drivers/mtd/nand/nand_base.cBUG!WARNING in %s line %d Error: Ecc is wrong Error: Bad compare! failed nand: error: Unable to find NAND settings in GPMC Configuration - quitting 0 @0 @8 @8 @@ @@ @H @H @P @P @X @X @` @` @h @h @p @p @x @x @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @( @( @0 @0 @8 @8 @@ @@ @H @H @P @P @X @X @` @` @h @h @p @p @x @x @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @( @( @0 @0 @8 @8 @@ @@ @H @H @P @P @X @X @` @` @h @h @p @p @x @x @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @( @( @0 @0 @8 @8 @@ @@ @H @H @P @P @X @X @` @` @h @h @p @p @x @x @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @( @( @eserial2tr @r @r @r @Hs @(s @O @N @L @J @pH @& @O @N @L @J @pH @ @O @N @L @J @ @usr/mdec/panda004075500000000000000000000000001241414206700124675ustar00rootwheelusr/mdec/panda/u-boot.bin010075500000000000000000006413601246044033000144520ustar00rootwheel` @ﾭ (OР iHMP  H4P q OР iHM  H4P _ OР iHM! H4P M HOР iHMp! H4P ; OР iHM! H4P ) OР iHM0" H4P  hOР iHM" H4P  ,1) \ //   ПM P-@0@/O-p`$0@-E00o! FLc&;+D@O0N7O2F_\ 2( FJ H V<3(FJ H ^<3_1)ѽ#????pGpG pG  @ @#?????0?"3@SB@B>?D#?D-AFF0?%3@8 |HI:F clB@F H2F I kB3@3FB6O,D#?8F1FAĻ 6 pGq| 8pG0$4h@BМB 0 0K"`pG{0JKh @@ pG{0JpGK b+"ZbpG HOSJXCK j+ݐj DFpG HMb Kj J#Z QD pG HNF!OzppGF H #0hiF H0h0ch0#h0 0h #0B1\1L3%R0pG^ Ck+pGLJ# FdEUSd@1J0{FJCB{F@ 9K"-MOF#F#FF#%1L# BFC7BB4VLFFOwOfF&OfPЋBBFFZ g_AEE  K ###3FKB#BB [ERE#F@NPNQLF c Kh p H z Khh%OFHH }1F*F#FH w ps |{ Fhxhk{) )pGh hpGFpG Khh KB Khh3h8 @pG|0D谂KS 0+a 0+Ca 0+ۃa 0+a 0+b 0+Cb0+c0+Cc0+ۃc0+cpGF#h"0Fch"0Fh"0Fci"0 FIh"hKDfhDpFF F!iG#i3#i[h!-h IT(Ozp!FhCi² }G#i+h!p@p F01bjFi F)"iF`hKhhKhh!!<PiH$L4 ( kFj<lF lP"nF`mdboFn@谂8-K-Lhh-KhhL#hh0 h#C `&K< h;#hh@ K h;Ԑ0CcC"h h `! K-KBKhh0 hC ` K< h;#hh@K h;8|谂\@B0ThF! #CB;K@BFF FyhCh h #BJhB F+hK@J:@CkhC`#hC#` F)FyF "KF_@B8KLhhKD}o#hhm(F#hh h#s ` hCs`h#` Khht#h"hFm8@|谂\p/FWo>4hB$D4`qWo4h$D4`BL<?rVO!h!A!`B I'h9hBB`U?+@B-E0IIzFBB{FCB###& l=M-=KhhN+hhOChF7L[+"#h2Fhh#hOrhh`+hh#h"hF\,+hFh%KF%H:h yh1#hK0A9F"`&FF`+hhCi##h"h0{FJCB{FE\IJ谂MbsF F#K$Nh%ehB l#l!ڲBBBѲoFF E #eO`"d\ E#e"d E#e"d ECC#e"d0+E%e#dp|0D!KFhvhCouuiI hh0"#h`FFsER3A9U!RA9F1R9F#0hh02`|谂8F FOsc +h0+h 0#cOC00 F# 0K 08@sY3k#cCsckpGnCcfpGpG iCaKiaiCbibKhhJBOтccc j Jj j kh JhBBoO%cJBKO#cCe|0D0T`D sF}FO   1E+GKBhpF(cOCh[+%h#C`#iCC#akh`j0 F)F F1Fh F!h`+k0#i#C#a6j0kiai#bib+i#a+j'J0hFhCo F)F^h`kh`h`kh` F)FQl03hhCO F0OCh[+ F) F. KhhCO F01 F#p|KIhhBIBOCcpG|0D0DsF#``c`#`h`h`[hc`h#`|ZhK`h`RhZ`h`#HILFN` `"h"*#` ` **%F4B` `p@*HDH@NPNOCh0{F@JCBym{F|FC;LB$$- ah6KhhhF-2Khhh`0H0N3hO@-O;hO@|>@3hO@U;hO@O-7O33@$O@@!F vBF"FH -- KhhCo 3hO@;h+O@@谂@NDH |B!8CKhh<$`AqhOtFh<$`+hh<4hd X H )(н+hC.`@B 80ll$ UB F!48?#C?pGKh@#@ OzKF9z)ؙyFHAByFRhihz pG$0@ KOB`h!ah"ahahApdh ehOzpgÿقK`pG pGpGIKBKJB,J,JB2B!JhIBQBJJJJJhIBQ1BJJJO2`A0@A0DA"J/;0D0D 0D00D/P `DpD`D4K!hh #@"D0"l"" <"@"t"$4#8#<#     hAq` hBr ` hBr ` hBr `$ hC`#{]谂K"hhFh 0tTX \ `2  #H]谂)J)K*Ihhh`(JB4 :B'2B-ТrB5"K#Jh`"K#Jh"JB"!JB% JB"bBKJh`KJhKJh`KJh` KJh KJh` KJhH UKJh`谂| 0D\<IJp`D00D`DȲPı찂! П M Q52:{<Й帐I @,f,, P 52:FE ,@0@ق(<, /L@P D Q:4 40QR:/ققB# ll iF#]0sFltnH 8!H w FKIH,F l ;l+o n0Zl FGp6!=!!b!iF@Q0ll@DRչpGF1H m2oFJ0F (W-H ,*LEl )L``*a"` F+ *Њ"K8Fab9F 0 hka0#hh#`  #hIl`l`qn"`nrMFR-h 3C,M JC C \C`H"KFh#hZ``{!!ATق ATATBTFFwFe!F=F(u0F!F!O5(F8 F KFAjB H  8j!F+`jH`*h 8(o!!FnXIu(nH h@}!!nnGKh?O3Os;`h+J`pG!$H0'$HH|'$HH'$HK B` 0K"`pG'$H0'$H8F F"F H I4 1$*F HI% &KB` 4K"`8 6 p'$H0'$HJ 803`pG@pG pGH0"0F+I"#k%l(Hjkkck jbj#j#H #i"Hiici #hHhhch -N!n!OZ"z"_C#c#_V v H #lJ"LF!F@"F H HS< #00)"n""""44#FH F!#FH  F~v8#FH s FrjL#FH g Ff^\#FH [ FZRh#FH O FNFr#FH C FB:w#pGH $LP0Z) S u$#c+F3pG0AQA@aC pGO$TOO F!4_ 0?O3?ODOODOOc O[$O@! 0dJZd pG3K-Ah1O@;hh[m|a;h h[ma F (KCD+O+;hh[mp`;hh[ma;h0 h[ma F F IFHwFH IDCEEF;he ,Ch[ma D@, KE I HVFH ( F|$$$00D$ Khh KD+ K@ hh[m|! K |KJ FhhB K JB K JB K JB( K#`|0D0D 00DpDXKJhhBKJBKK`pG|0D`D( KhhKB5  ( Jh#p##C3Cs Jh#p##Cp#Cs`Jh#C `KhKh Kh KhhF ]|0D0J0J0J"J"J "J"J3"LI#hhXm#h" Ih Khh KB #h" I@hH|`D O3FF]8L%h!h)CAq!`I!p8XJ@pG IH t@ Ĺ﯂$pG pGp LF 8J`eT0`6JT0Z`5JT0`4JT0`3JT0a2JT0Za1KT aT a/JT0b.JT0Zb-JT0b,JT0b+JT0c*JT0Zc)JT0c(JT0c'JT0d&JT0Zd%JT0d$JT0d#JT0e"JT0Ze!JT0e JT0eJT0fJT0ZfJT0fJT0fg#1me#€Y῁uKEiȁȁɁὁe1%%&&]'*-A.(.$!"(h!"Fhh9FO3F "F:9F:F HCF A. Шh!"O0 $h#C`appGhZ`x(O0pGhxpGhxpGJ8? TpG ܂H %-M%F.F,E%/F3#hB2# [ O E P,  [  `K ` F7`h hf` F` +h;h ~i8hbF(b0* zh +F+XF %&FFŖl ``` Fy h+#i A #`0`0#a! F~bh%F0vF`ŖpF 8Fh XBXA EӅx:\*33+ QF`(h`hs6`1F (` hh1F }h`(*h9i>BjhP#*hQjhQ;h%8FPfh+=!F8F0 F!3x*\*3++L*-MFF!Kh,;ДH k H S /$i$%B(KO8Z%p9Fv8 H GF (?H9F 745 F$݂E%L%X% Jx\ ?\I_+=;XBXApGFpGh-AF+v6](f#c`h&5a`p`@ F` hhQFhhH9F O48F Fݬhܫh+#`hh$ PFh`$%$݂%-M$FF&F(F!F(𯀯B F AF)FRFF0DkFF7!O8F/8F:!F"FFCx-+хBF =+BFO++х"8FzFH8FF(XF(8FF(F|@D0 F@6I:F+F?@F!@F BXFe ]F:#0=(F#RDM FyVF)FDO @F(F70D)F>F#O;H(F"qD F+)FF0D & F !p, F(F%-AFF(6x+5 !xOCx F0!FFI(F1F#F(F f F1F#y FC%/&U%-MFFih **+KK"`B *i *Zhh**i *O 'FF  ^3i;+ (@F4iDE/h7',,+,+@(F,@3h++yѳh[hh/߁shOhhF E  7;  S (Q!OF0+? +  PF !F PF F 9F? XD QFIYZFQFYY D#D0 F hBF wO C(shhh` shhh _ \sh $'Fh `T Oshhh`3 ,D ,ѻ> , ##3h+-J+@ 0+FS%p8F5-FGFCق{L ݂F0Y=!F[(F0!Yu!F0YB(F7FF!a!F0[YB08F;050_[YF()ndH@x0(#  EDO;GF# S: PFF)h AD8FFJI+h8FGI8FQF 5h8FAI8F hEPF\8F "!;:T8F8FJ1KhF;!00-HYYX  'K -Fk "Jo[o`3O5J+#`$*&,у ,Fh+#h+ $ $'Fc $' hF %孂A+܂%ق-MFF!"%z& A  N PH0`K3`Or!HO[!# 0H!H!0h!+ЖHAFO`O3 #h FG?FHJ bh*C "i FGFO 2*YFY  #(@#  !E *л&݀ػ"ػ@##л$8;ػ'@#\л|ÀcS#i FGF (h FG#!|?ƀYFh FGF"i FGEK²F\! i3a#i FG=JòF\Zh FG1Fz_(4?( {(4!n Fi3ahG  i2 a!^YFZ1FV!Rh FG }( Ih FGCFa!>$!'(? ch+X1h FGFFI#[  @ !)܂)&-& ܂1&6&;& (&"h FG !  |h FG !)?chkh FGF0NF:K"&` #B5K"`4. +'ch-H;!#!`c` *#6;9"i!KB/ F()- ! (PFAFFPF"iKB HEFjKEF( قi&U%[%@&K!K##@=][%m)8M,h\ KK`K(`aC`#`` 8$݂v&& H(! "hF$HKFlK`I'S'(݂FKhc3А,H!F%,ݹ(FF %$ Bp8Fz ' ,Oqp,   0CsC0[ pG H8\FFFG*pFF"T!F H1Fdi"F0FFH$XO4 Fp''-E8FFFF +Xh"x:)!#) "`hI qIh,$BH8F!1F O0 @sK8F1FBF#SF-H0݂( FH/!F@ RS'8F!FH F #(F!H"hKBH FH FH F H H% H%(F8(('V))0)K)\)`)*FF Kh@%$W$!"4(%B(FςsF HF  IF( K Hhv(F!F"kF"pw))ς)-EU#LF*F#FF3F{Kh#f!" f nP`8F)F2FN#PF^09FOc*F#3FG 0݂ς𵅰LFFFdFFh"F#THl*F8Fp1F# \F H n(F0݂++Fn F-MFF0C0(սO!Or8FKHFAFF\ u#0@ B O ȿF \8FTPF(DљH9Fz:hKBЖH_O00 =8F@(HRo# 08FЊHC8F?(HNo H6 y)dЂH?o ' _F~Hh3ooT0 xH.8F_(ѻ@]0\0;^0hDL0;iX0{+_0iH +[H! `x(0bHD0+0`0]H] MK*HpmneRf3 + @P0hT0+MJ8F!@9F@"XF #K|D0++@Hhoki,K] ***@.^0++@'1FRFy(@JFlPml\0cm F]F+`_E HkGHg8FYF O3<H\8FOZF HO5=0݂++'V))0)N)\) ,M,p,,,,݂,,--#-<-4݂ pH:D 8F KhHo _EBBcl;"0+^H]HosYO5KmRzբnxantR(@aoLHKHo'F WlXFxXF9Fp(sє^FPiG*MT`_0FQFOb#FFog h2FSFRO0D(FBoиw^ ^ F!HuoC *&o;@ 1FRF#FGF 1FRF#FGF(Op1FRF#FGF( H9XFF \)---1.>.I.w.-A%FFFB-Ŀ4V5 F 0hmDo nH!F  G  .o FFF#H*!"[,F!F:F # HF0F,nH!F G .{!.pF HFF@I amH#n0F)FG pw) //o-EFFF?h"0+&0F!jF+к%,FX$4TED(F!FBF #FL H M(F1FJ+FG {!/Folnq(F1F(F*F(4nJ3HpFn#I+FJ00F(cIFH" F !nn H FHpc/{!b/;j/}//oF  pGFFFF2F+F F9FG]0+ дoO0 KS pGsFL FHI$ 2F+FaC apقtтm۶IHHH ﯂j0o00-AFF((F,!F(F0Fo )FwGxF()F:Fr#U  &0FeS, F0F:!F(#h+p5F0F1F()F8FGF(0F1(F-EF FF*?(A xC$)F1F0FFFE&.Z&@  FIF' F/p,F\# I; FF( F/F F6  4*Xh! " F#o$D$]$$O$$!$:$*FHl $Xhh Gh0ih:F3FHT/ F#8.8-E*FOF?&hhh w3GhoF0ih:FCFH#%!F"h!F"FhiQF"#(i(;F)ijhH#H4F F'Y888pFhH# Fo FH 6ai ) H"i+ai" H H$,` Fp p<=!=9=/&ѱC< + J;#\ ) )x+9FpG) pG  pG-EF F)cF0H%rB--Hk0F5g0FD0F0D$HEX%@,1F"F HE_H%[,4|gB V%BBFRFH5 EH@,H=OPB bq]B:FBF H/5 HE(T=Q=V=f=h=~Lq=孂s=-\KF`H hނz=*-MFF@kXhxa+EіѳKh+G(B1FHHFH9h!"MC0 Fp.\"h!;FChBFHFJFw(DFH)oЯB!7[' F"@F~6*J EHAFx )2[*1 P 3&J0=x>{>>>>lނ1?-њ0s+ h9i ~iWrn)s)N-LF hFF0 F2F hw n*F!xi"FO7O5  ZEbE 5n* ѽBF h"PF@FGF h2F H ښ0s+@FiHF2F h.F@FIkݚ0v+"1F@@F)F.I*h!.*YDI4B@F_Ha+I*Fs+:I2Fp+l+@Ā& &--h,% hAFsK9F*Fho.FAF*FnH&)FlH FI0F_9F hMCF+{R#ZZ[s[[[[[;V h9F"BFSJ AD(FQJQHx/FW5-PMHQoB=FG!IHADE/O5<9F " hhF h {hF(iF;H=ѵB# 9HAD!B 5HAD 2H 0HAD B?Z-Hkr*I"/([ѹhN*F#H=-0h hhFH-r^FH#K?b?Pi??hނ]?==?????????}|>?@xhxh+T0HNh]i 0H-Yh F0Hh 0Hh x0Hi q)FHm0Hi f-3hHi ^- 3h~Hj V-3h{HYj N hFwHGwHDvI"tFHh1F"0axh"nIcF1F"h"FFh1FRF[Fvxh"`IEF(bѻhxp++5FFYHXHB h)F+FFFPHt )FNH5a+1F"h"FF8i1FRF[F_LF(FQF!( O(F9FJ  O(F9FJx FFH3 (F9FJdF, FF HvFPF&)F"F[F\F("IBF"H*!H)FEHH.OE ^*HH / `` K` t₀|₀PK1KxK~Kq"HƂ₀*-MFO0KXh!"!"_h Fh`(Fh!"%b!FF.FFHZDD +#@F!F:F F  0F "4FH*FIe H1F_PFK1KPK"pG Fx**0!",,, xh!" #@;@x*+0!"$+Cx{+тFF }((#F pI pG-MFFF\:NO Fh b:F[-F(V[EBP@F_h FPFF(F /H d ?$;9(!($C2)Fu)FFPFp/( 3\B\A4$B$$BԿ$$B̿$$ B$$  H$ FK*F hFLF*hahhh#ahhbH\ @ O0KK"`KhK`pG₀₀₀KhK`KhK`KhK`pG₀₀₀₀₀₀KhK`KhK`KhK`pG₀₀₀₀₀₀o@PO0pmFiFFFjFOaݨDD$F HhF| I0F!F!F"FH!FH0F mpk0MoL/Kh#JhY`ppG₀₀I#+ DD?pG₀8 K Mh,(x<L8₀₀₀-M& H}O45FF zWF²!F*j*g * * +T Qh2JBǫE(Q "+ J8F(B8(0///D8FB3(D ?^D+@8qDz2>D ?h_#D 8#²[3D? 3BSDFJлDD7"@Kh`@*hG:K"`/?*@@3JxB"hGS/K/IhZ `/IpB$+J` D? 6B (FЫFN&#&q#p##cp pN#pqxcq 0 q+F]FFF8'MMMMNBNn₀₀₀o₀₀₀₀₀₀₀₀₀S@p#`~Jp#"}Kp}J~KhByI `xJh+U+O~"qR+O!bqOrJ+x Ҳ `O qElJx`@)?)B@aI+ pO@q1aJ+y  pO-"r(\J+QyWJpO#br!+ONr1#rڱ*!s"#&cs #s~#s#t&&& & && & & & & #'#p cp pY#p p&Dx 0 pp+F.#&#p##&qcp pY#pqxcq 0 qB)Khh]d$Ozp<)F@F;)F*FHp)FHn?MH,`d$HAF^EFHULP0y LP0p|( F₀₀₀₀₀₀L/ςNhMN-AFF+.(h!,!"hhK!"hDhzFh!"q #F0 .`. p3D O0 ₀*pF7h!4!"phE!"Fh?( -#h-##x-"FF3h2-"FF32 D#FBx3O0p p-MF#H"JF"Ohh1h!U+"1FJhD1F"F)F F!FCF*F F4D ``O0 ₀₀PƂ₀*-EF\hFY,,,K-M,F+M+M!"xhO (N!"3hh6h!"Dh3FFE",9hh,9\xB"#F>DH)F$F#D  $ HqF*F FO0 EPJP9P@P₀SPP*LXh!"? `!hH ₀P*F4hF1!"ph%L!"h"h$h!"DhH*#F0 / h`/ \p;D O0 ₀P*sF F T!2FH+FO0p%*-MFFM0N 0O4h=hh!%CQF")KhD(H!FP-&H!h-%H!%H!xC$Hz`(њ0-+H"  - `- p,D+4` =`O0  kB+FD₀₀₀XKPP~KtKd= p FF\.FO0p`h! "OztIDC(FKBC(d  p-MFFFFWI "=FChBܸрhرL#h+ 9(##` H hPFAF*F;FFM`GO0XƂTƂSpF FF(1FH Fp #Ca F y( FpS!Kh@ TƂ *F'Kh*Xh! "F&*=Xh! "! "Fh(F!H?(F!F 1F(FJK1FF(FH(, K`^0+)F H H)F_  FO0TƂSSS T&T! L hlh h B0z+ H TƂHT*-AF6Xh!"NG!"FhA!F0h@F01hBF+FH8F(FH1AF*F0hG KJFH!FBFd$O4$ FTƂ]TTST*-EF=Xh!" N!"Fh!"Fh!F0hF81hBF+FHr8F(FHiAAF*FSF0hG K JF H!FBFWd$O4$ FTƂTTST*-AF8Xh!"!"Fh!"FhL!F hF!h:F+FH*F3F9F hGiF0F K J!F HBF` O0 TƂ US:U75L#h+ s(##`0HX h!LF(QЃh+HhO)Hl(H!#mL"$HڲC!n HanHhJ?IHF"۲KJiH)FFHJ,QKJHi-F  0TƂSZUfU{UUUU#|URUNUUU/&UUU*p&јh!"LF hMF(!hHK p IKF(F H=Tla(F40 pO0p FpTƂSSUV-EFUHFFFP(!"QK`, ,,(oOO0"hhmlhF FN DEBKAHih!hh"W>?? ' ` ~ ^ "' ,AAA AA'CEEEEIIIINOOOOOUUUUYaaaa aa'ceeeeiiiinooooouuuuyy"A"E"I"O"U"a"e"i"o"u"yA^A`A*A~ACE^E`EI^I`I~NO^O`O~OU^U`UYa^a`a*a~ace^e`ei^i`i~no^o`o~ou^u`uy!؎܎ɒ0ʒ䎒l&''ď(ŏďpi'|** h/l"@ Pt"@"  `"@"@"@"@"@"@@" @" @"@ @" @" @" @"@ @"@$"@@%"@&"@"@@"@"@CB H("@vwĞ @'"@H " H"1H%" I&"1H"I" I"@I "`I!"I""@1H!IJ" HS/ H"`0J @JJ # J"1J"PH"pH"H "H!"H""@1J!HJ" HSLJ@JM"D "D " H"I "HD" HE"PD!DH"pD`"Hb"H "H>#DF#HG#H"H@"H#J@(T04(--\0# #(#0# ^^0#0#<#D#d0 L#L#L#L#L#L#L#L#T#@7Ğ8@'(l0@&l0'# #0# ^^0#0#<#D#d0 L#L#L#L#L#L#L#L#T#@7Ğ8@'(l0@&l0'8lC #I#0N(#0$X0#T0#8\[<#0`D#HaaaĞpg@ffL#\jpjklHmKxpiiLm`ihi V\$T#V.symtab.strtab.shstrtab.text.start.data.openbsd.randomdata.sbss.bss.arm.atpcs4 !@Dd(PDP.DDc$BD6DdHD6Dd5MDdDdXTd<  De@DD6D6  |t tpTh45\@LwW{`dl"zG@, H`@ tv|Xł(TFL؁  -0;H]xhDvr{}ܩ| 8`(4@,ك8`p\|@dD ч0,8א8dۄDC@gSDlc8:`sR0c<*p8|XĬk], `h@%8\/8qtEJ<S$]LhmxTLd͌ƦHnhOI։Th%TL5 hH pV\xdx3,s؆|dj (ČHT|Ɓ44B`0.̬>PHX`ar`s(srs $08hlL ǂ*Lp  )z$4$kXFTUd<y8Ȱ$t`Dl@\(7LDP8 @i/DE,S8+p\xj Ql~~p@L(hd̸h$ --O>eXTv_,TTjDą v:$ #4 ] dцt}8Ҍ  @k q(* p 1 P? hH PL[ w@k { Y x(  ;< d0  |8 `  ,8 1 ED w- P< 1L Չb |Dr  x X ` #d Ȁ0 c aH ϏP D+ D U  pV" LP* f7 L a k x hU$ D sl Tj P |ύ pH  ܩ4! , 78 `~O ބDY P|i иs " , Ƃ r D TV l0 0`W 耎 $ D (č( 9 ylE }R xXg z \L x< ЇH l ` Hà , ( <{ x ,֋! m1hM H4{PPc$^y vd 0P਄D@lT /@\jHwt`P0Ķ@d@U,f łtmlP .@ރ&L(Nd…(xsD5e$ x)X(ylC $Ucx])jڌ tRlR@( t Tk #83 A40N$cԬmv0}PRhDx ,',wQ`x ݌TvXɅ\؞(Tl(|2h>еFrLU\kbאm {$XDlڄ@]XnÅ(ԦH`wXL/ЈP;DGNX$eՉ|PRTTTpj t!`0H= P T(|L+3 3(xISe,t݆04@@,sPlOpaH6wx!((t ttX8h\Xv e ()|ɂ5B蓊V24c@x kd~N,LdHH0|)R $0< 3@L <@VPh`u $Ă<<8|4PV|,xD4&82 5<$CH OYf,q(~ll)T"|H"&]"Ro"T։z"5"Z"t"`k","썄\"ྉ8" (""챁H"D##j$#,/#p<#,O#`#Gs#T|#`#|މ#@#T#pX#\D#-4W- @m- Tz-d-m-dm-,p-[(-̟P-?<-݄<-8-tk..|.ى&.@-.I.䔐GN. L$^.r. ~.ܝ.Ih.Pk.d֏.HG.,.|.l...d. /|//ُp2/s D/Z/`Ll/̴{/RT/T /p+,/{/d///|$/(j /ܸ0DՈX0&0ʊ802@E0pR0e0 p04w0'0К0t!800Å,0c0g0x0ȅ0hH 1%H1Pj@'1Hp51x<1K<F1H U18y]18sxh1q1̅ 1\`1<1ໄ(1ЅX1l˂1ƁP1E1W1n11| d2oh2#2)2`; 52,)LC2dHT2 f2$s2 t2Ԕ22d22H42pj2:|2TP33,3}`)3pN:3tT3L^3g3 z3UL3Q03_3 3h 3O3T3l3`߁383Հ4  4L$454`<4|H4<-P4V4a4Tl4044|4Ӆ4Ԧ4d4@'p4e,44, 4D4` 554 *5x55Ԅ$?5BS5b5 Ɓ\k50iy5hd5d55(45`545s@5t5"6P 6R6\cX)6脎t96D6e@S6^6В0p6,#6p6\06$6숇6 46Ϗ6 6tQ6 7 7x7LX!7$.7lH;7K L7t,Z7e7BH~7|~7@7N7ȡ7lʉX 7`d7L7{7D$7 V87#`8쌂 8c|8t&8(h/8C8Q8(ka8@@x8D8މd888 ]8Xs8N`8 8$ 8t9pσ9|!)9`x,79D9$ |S9%]9tl9 z9xL99T90l9T99<9|&9D9R:<:d':\i/:ȱA: ىxN:I(a:o:4фy:X::ȴ:Nj : Z:,:p:4L:u ;7X';Ё|2;:;PÍO;p\;Mi;xu;h~;dyp;,;4,;;,;\l;ĊD;zx;4< <06<0H-<{A<ł$F<[<`N8d<M4o<x<<<<<؁<Xa< <l< <$< <Ď=TE=lˏp&= \1=Ό:=(ÌF=ɌZ=Xj=|~=83<= /=\O=(|==P=l=̀>0D$'>C;>K> [>a(i>\e~> `>||> h>ȃ>>l<>سx>>l>lO>ς4?c ? ?D~81???OJ?-X?dۅg?` {?P?+?X|?Th??lC`?`?N?|ʄH?^@@x@0@<@|0G@{W@(i(^@ l@{@d@ @8p@R@@ @XL@k@%DAא AÁAރ *A4ACA LAxЏ$_AHބ@hA(sAD|AAAxpALcA؇A@A A]pA\AF\ B2BR(Bȷ:B<},GBWB_BqgBrXmB @wBxBB1BB`4BʼnPB`PB`BP`B(C$C8Cܟ*Cwx9CԘIC4PC%_C$]jC] Cn,CpC`r,C<CTCtfXCPnPCxTPC{DLDD$&DnL4DPC>DOD$,ZD֐bD0pDÂtzDRDVD@D2DHtD lD\DdpD,E E0̂DE@H?EւME|,[E@lhEssE0-EEHMTEEt\E|'E\EddEHEDkE,2PE׏\FLtFeD%FƂt-F?FCHFDSFąD_FLnF F{ FFp`FRF֌|FPnFL"FpF`FՅtG PGxT+G$b=G)GGrUG`O]G.DgG(qGD6GׅGd$G1GۄDGE8G GܴG݆GԸdG (XHH4H @H(JH YH obHt sH)}HuHNHHXHHpЎH͂HIσ<I< $I85I|BILIt_IdOpI0Kp{I,DIRIAI`CTI <IIԓI8lId`Ih( JԷJǍ,!J݋8J<HJVJ|lhJ W{JȂPJhOJ'$J8i J ɁĴ JJH0J(OXJ,R, K{KL,KtCK WKkKyKKୈKKބ@KHK1 K,K݁@K KPA\K(څ< LLE 2Lx*CLIL @VLcL8vLh4L(LL gLׂLRLL?HLmMMXi'Mא/Mܚ@?M |OMցl_MHs mM MUdSU vbU0wUԏLUĶUXU$U8UH֐UEU#Uh7U|Å$U7tU0XXUlV V\XV.V 09VÉHVnTRVOYV`bVL`mV{Vୄ(VTVXV4V8VV,VhkxVpgVVpO W!W2W<?WL'OWJ$_W̨|qW`t{WW`WGWDW܌W1W( WWMX0SX|X t-X4XkAXՐXX ՍDlXTzXn`XX,XuXcXÊX@XaXpxY4Y`*4)Yp:YƏHY.UYYaYoY@{YŒYkYYcYY쯉Y~YDYdY HYZ8Z \ ZP-ZH@ZxOZu^Z|PdZhuZuZ(Z Z@tZHC<Z엎ZTZxLZ Zd<Z8[[%[r/[GB[}HL[R^[MXz[א[[p[d~[t*[́[D[싃H[0[ [P\ (\D$A\:\W\ b\ӈLk\@t\c\D34\R\x8\Њh\\א\R\k\4\L@\/]Pl]ؑD&]-.]HP08] E]48T]Spc]p8s]] ]P|]| ]tL]h]@]Št]Tr]^( ^:^@zl0^8=^LL^ U^ďdf^d8v^P$^䐄^\>^v<^gx^o^`Ձ|^`U^ Nx_ܣ_(h !_,-_:_dG_б@W_5`_pg_cp_HSL__<_x_n$_m_D_Hl_c_Ѝ8 `m``*`tO@`$etT`d`H,u`y `@8` `TXD`@>`8ۃ``5`hf|``ܿ4a< aOa,0axP4AalӐLat\akias}ata4eaaa$a aaa䈏0aL$a\aȏbIlb4ib4g\(bD6b T@b"XbO ib tbL<b(bh̀0bdbybTΎbb`c cPcEx$ctr8-c܏9c5FcJD\c G$ictctcL,cRccXDcDcDdc䎊lcclօdd<(d<ύ@DdDTd@]d,hdT4pd |d<,dd1d3$dÍdd8HddOd e4ee4 !e<-e 9eHeX Ve4= `etge0dLoe14e ceԱ$eeteڄDeke8edeLopeT;$fPk|fT`*f܊1f;fHFHfOPf@]f|)dfDtfffn`fOf܄f܂fTډ@fXfuDfPiggt\gg%gdҁ-gP?gNYgXdg CTyggkg…g2g, gpւxg?ggg숉LhldhډHhX*h8hAhKhl@Uh-eh c4yhhh|xhpȃh`h,hՉhT hh$Ӑ$h iqlie$6icFi8O0Ni04YiHbiji"{iLi`ti4i0i@i (i|i΂i oiLi|4i(j j8'j 0j(;jlFj,ʅPMj(] VjxOjj@ rjT6{j Ej΍0j{j[p jTjE(jw\jOjаj-lkhU< k:Tk\!k$+ -k,m8kXXEk4]Nk4HWk0 gkPkLȃ$kkkkikkkLWxkDXkt̂LlL0l<(l$/D8l$ŃElLQl$1<nl EdylX|<l>ll$elpil`l(lClL:lP mpP*m(2mi0ImUmDю<]m0ݍ\lmemp$mmTmT4Pm|mԥm\mؐmD̅maxm( npn@'n8V 2n$Cn4pOnXQ_nwnnnp hn|Ln ߄@nхny nďn|nܚn@+<nS oȏo褀&o-o$LlHo|SoooxoT oM<oeToHoTqHoVoܒo,ЎDo,o\ph_ p@p@'p /p5p|CpĈNpYp0ipdׅLopdp*DpL[xpF,p{p(`(pl8p8p6pHaqeq! q+q":q̈́,CqhhUq bqD4nq0qhdq(uq@qܤq|q@qD)qӏXrčrrxl)rƅl5r̦Lr_Vr0_r;hor~r8Tr&r8frDr@rr(hrؔ4s.$sD#s+s:s<Ds<Vsk`sLjsиsDosT>s(Hshi8sss ߅4st܎PsLstDt|tL܋%t7t<,|AthQt4+`tmt}tTdt,tЁtlt|Ht`t UHttttt(ttLtTuN u|#u@P)uhh.uSEuލ YuvTiu zu։uU|uu u*uuku(ulېPuu,Lv,v,$vW3vN9vlHCv_tPv\udv0pwvqv載vpvpvLmTvvv0 vP vp[w$wnwX'w7w0@wގPGw0L\w*cwojw\twAPwmww|ww(w\Uw\wlYwd(wPɊxDWP xvT#x @,xĂx4x*;xEx8d0Wx|kxΏyxh(xشxxuxxc4x0@x(x8xmyV<y#yt`-y@Ey΃`My !\[yxeyD uyM$yy0;yykXykytwXy|3yyly҆ z Dz$ z׉@*z4zh;zk?zTڄDJz(Wzlzyz2Dzz|z<z(z`֐z0<zpZzz$X{4 {+#{pX9{`O{ST{g{|{pņ{†P{܏8{{(΅{{ {|d5|%|/|`߄L;|0C|rV|pc|l|މy|||||ً|||H|P|k|J,||} @$}N1}B}6(Y}c}Top}\}d؀} }T/H }d|},N}DE}0@}}쐄}ۅ~ ~\}~%~L|:~F~4i<_~<l~T4z~#~~ up~h~0ǎ4~а~~\H<~@'p~l~ r)S@0YlJf(VlY^r4V8sx&lgT0T \칋d$%&F1=Im\|h0pn(HȂTp ltπ\z(܀oܹ(H%(o<2pq;@JYXg@{XP'䅑4aH,<ʁ ف{0lwpd *85̈́0@lS א \WizD|p 0QN Ȃ؂iLT+䐐 x4.L4=lGbpW4]݅$kO0rS(xہTi$ŃX΃ ߃ #l$4j|00@kL^LdpwC<T$ D,Ȅ|,ՄdP߄DlԓN5@!48.*<>AOthxu c fp ɅضŅ \ԅdǎ4ۅ ` 0o@ hX'7BNJHDX݊e܇k$x <NhdɆ\Ӏچf \1 s;LER쯊e(Dtp 0D䩇l LJׇ$Ί߇Չ$.@aB@&tD/yh<xL4Ta`8Xh htю |цH(cl/Ĉڈ,   ǎ<'`. 484H|0QZf8CP(j…0`V4t׃щmLs4tS |։<&R8CۄDO\`ʁ@h|r[ˀXFIT,Ŋ0ϊ(܊샐|جD.=ltL#WƊ|mȑXvvd}PxE,ʋÎՋT 8l\4ʁ,H*':ʆT9 `ms {dT' dhى8ˌ`ՌHM䚃LO(4 إpi&4|=˅I@ņ0]0hՂv0Lд s4Ǎ؏ՍߍS؞|LƁT 5<IU(YD\k`RTzD&p\d̂YPΎׅ$$D@l&0 @FNQd^4h~H4D( TtNXT{8Rŏӏd\ޏ8+$]XT(x*X 3\< |TUlTz3hlU<'8ˁl<$͐e8lL$\E<S',44AHאR<h8Op|xאt4p8ˑD_$ڑlW\dH !c1lG?`St…0cq{WDTDLՃHd DLnȒڒ`х̶@gă0 7'42@ȋJO PxQ[4f4pu$`l tȓ$ԓ80DC|"k+T;THtS@_A\nQLX@ <P8U{\d˔єpߔPGT mH$Td1BhJ0X|k`$0}8q$Lx T ͕lٕ̓$ d*4Xd249PET.|PlX[jl@tNw`xhH\o${0ȖPܖ࣍lY\'T  T&t4<SPM Wg8 oX(xԼTQ|Op4dȗϗH0ؗIHb}L0҃ |l/<lMVZgptn|h؃ L/|Θ@ #,{߄@*,؅ >ALKe\d. rළ~$L,C +Hh`<\BƙҙߙHlnt 4xL#O0<7h& FQt^PCdu}0pC``(š, К}Nph{\Ȃ!{3\}M\YkfnĶzD z؁4%Pś䱆ܛx8j pbp&|0 DAsI5Tl]dUtNk<@4Μ~ٜl`'k hUd6,4ފtAxNwhZ(<g~lO $|Fǝ՝@j̄hcT<i!P'8 GZhPPXa`oTPL-lDŽ`8 $Dtʞ@۞tO`j <L'L8%|CtT~av  l P8xK-8ҟ/t oDlUd~0 8sE<ZjÃd<X($D,cȠLϠO@\_\x0߁03(\'l/H@X NPf8qz`d4E8H2 šN0ԡ<ݡԃP`@ğ  0܄D׉&\-3HxJsTW\Hg@xxt؀x`TՉʢ߃4Ѣ @ܢd @`A ӏ|(B= <L&^,o|,~<lvHxǣ\أĞd Xi Xx,1$4䕁0BHQ옅](m zĉc<@`ɤԤ؊Pl ΃D4(,4"/P> MvPZb$Fn0H<֐pUǥΥݥʁ`LXyp)H6X$>lLS c@lpF@}$T4~@݇\ŦT}ئL>` i(@(88ܻDTl~$hDއlpA4w׉L܁XdvXȧ|uܧl @t܄D lhȅ80\=܅L`aNj8…<zHτ8Xˎs(D ˨4Nۨrp d8  XJ*4m8BMބTX̎` ΄(kH{ȅpx=$ƩvЩtɏpکH$|<4l@X -</P;4Ts`tjhppePtX։8FL Xb$ɪ|s֪腉ߪ4@,xhĊf "d`2<\R4х,_toDl7LlȀD%«`(֫L̳Ȕ-8#h/XG\[Tc Hi{hЇH  UtGhIͬD6٬tL݄< \ltBt%H̓44y0CI܁`kp@|U,pܲ $̭4o@ӭޭL4H 8@$f05! ?@UhS`4nPۀs4LGTX ɮ ֮pχ߮8ۍ䴇Dm1dp(BĘLoR$d0lh/yhh iv@p6 ǍL̯@jl #h.8];$LLƏUtoh|,ph'~dIlhϰhHlI\$֐ 8, | '蛂|; BDM]Zyg:r( Ԭ߁ʱdױtUP$VT $mм0*BaNĻ<[0i`pslDD(<|\8Ȳdβt ٲ~L{tc#8Dl0\׉T9DȄHHW! \tbX?vx֐̋$07@8HóH!\ճП @||xU PX6ȚDM($Y4`~`mp,v}Yl`ގxƴBTӴ|Ut Xl8<֐  ,80#D4#<tCP؊0MV 8fhr |ـ@Ĥd̋Ƶҵ`t4r|Tl&(3L4B|IQL,^6~c P Ͷp,RL|Qp<xć'-;lpCMNVlыhȄt$n||X ͷ$޷,\l E4x |'3\#= HiW`xs ņ4H i ø~\Ѹ4i @ 0(։2\=kE赉xSlԐ\q.-D\~HمW$loιՉs䁐 8݄D#$.<@wMp`N4X`jDwT(ɎG@قn zX '<dH$ݎH8 %@<Ł F<Y#a h z `B\يL@D(|nwXL\v<h-$@p9TRڍ<_ ؇g|x $XOULm<0!-?DlThl\e 3$y԰DP/h܏H.x}< < Ր},LU$#3 Gi]g$ƅPpNyPk8 D|hx||HHXۂLp'&4L?4L̘Sk]l?Hk@uX|\֏ T$_t l8Dl $i4Ճ=Џ`JHG@^ ldnptlx{Ҁ|H ${dP8אs*!4j2@B؅M0UkH_\{4)y iv<8\ ĥ$_8,shAQTZ$zd`؀q솓Ņ HXPL\ \ \`#h%6\D? LWy8b<)nug,HpnTx8~x"4,CDHB,8w  0H8(0;B=TPSdvƎ4|@xTplσ<$"ํ82 $B $RH(`vxf쑋 lDF$HiLऎ"ă0@IU`<fds,Y@x$<P l1$lL҄xr4$c, EOV'8a m(G(~p0h~E` ,,0p.L3 pЌ|*x7tPEgK_Zt@dmk}M<l@ Äl`Ax)΅| pgء1;|\E,GXZ`ktt؏8 @$ 8Ɇ4ƒ`\ |x P #pl,+7<A00D@OTc,fl,sH4nd w$챀`\|Lt0\. ,%t1G$X(ŏ<f.pJ<P΃HӐ$ll ʁ8&@/ԋ8D6?$JW`tcDozeɄT要|x'x\N0$\=\1>xIp88f`Zo qz$5q|̋('|\XG<&o :k?\M젃LVf0xp8ysXXhu 0x,lM$ILdŃp`@胄(8 8Y>E(RЄ[HTp8p\hh4%2Ht1֐<]  NDq'/> Ml<ZUi\yԏ pX$<䱂,H]`P<cxd mH#tn/do08֐DlUa{nmul@$$ |v,t`$<(/ Ĵ-HlBr ULcPkm~{Xȃ8pp,xhxnuT H^x. :4HkPXBeo<8|υ\8@QptS(.Z4B軃I`18Tl`Ll{<l < ʆ<~Lt-8SU%02d1L=L$GxtWscx݂v8 sdi$ P@4 ||<؍8q M0@HLd]lMs쯁|<@e4h4셊\ r0LՌL  &Ѐh1Xԁ8tDV(ǂ]Ues4}S$ՐH x\4\\\ XXPx(,:஄xFUW̾<cȶm~Tdh,*U{%DՈ$ՆД<|--<|J(Vsdd\rt{l]`4߂x҂,0މL44Utqd4 [L+@:ɇpC4^8QD[3(l,x}sq|Єd}Äx`ul8P#_ૄj{`ɆxFi$,P 0$\ԊT@s,`8u#F64DXאbt<j-~ LRP`4`s\ TsQ _Xoi@}sт[d{H4-pHiܬऀhאP  8`+(?NU dwԅ0B|8X$\wx$܎`a4X6$ {@'$4@ڏ@TQ.Y‰ irjH(^W(h>l̛u '&( /`vP?OPd^lp*z8+( $ 4σ8Q|V͎ld' c,4,C|d8NՉWlk|l{tƅ0O׉x<7 H,(\ُtd|D("ğ@)k,9E, R̘`czjK4e(TA\a@.(t! d0Lɂ09SSхgTdy WpIxx $(X h , P<*t8>$lI^\kD-Dj`(dq`υ@lPT`3\(T8%DdPO4W-`fXJzx(bp8j$N0=@\D4 P|8AQԴdƒs|J $$`iɈ 0tk`ߍ-s8lJ0UH)4^k@fdz ,0iL|yT/hi9tk 0ʂ#pԀ5hG8R^$@i(x{hhTBd<_\t\' ݄@0܄T:kB@"QYf` t`> ۄD &8th_@${ՐȬT),e5#4E' Q\g8oTڏT|tk4La =Hm8KP׆ta %蜁1RhCR4,\jH܊tHdVCL S\ƌyl v Ԅ. T{: pt8K U0d@nvh,0(pU@Vmq l 41N"GhsXNk^ vXhx2@#Y\tM8  ĭl Hg\3C>l8 JW\\i·rXYT}SPĸ@(g4z@<8uX(`܇P䲊\+03$݉ =aITh`D||it&u0}\ Xdl xn0_(ԕ@G 0> 1}G,TXR^ n$zPx?D|X0iV(ڋ্h}!y *4 : E~UfjLNy!d{@|h sjא<$\x|($4hH%0,a 6DI<σ4Pl0`ltl0֐ xp$h84(4l܁` l րh  |.hׂ@\T$„(^@oLՀ{8ΏD9|IP̃,tHUqD h $