ELFa( 4|C4 ( ;;(({Ccc`DۣeWCԧcԧc$$_DO! "&@00Q_: 0/C\@/ XX@0 6QQO @@( @0 P`D  B00 R Р -L =:c4jcmain() returnedi   !,@@(TQ 0/ oci -`LP@pe@D0D 000``UNH@ - 0LP@p8`0`) V -L@P`p 00  0 0 0 0i -`Lp@P 0x 0s 0n 0iֽ0νȽ 0 㻽㵽P@0㪽㤽T X@P 0P㑽X - L 0 $ 0 $ -0L  T  T p-H$,$HP0`L@ 0p -0L(  -0L( _ "- L0 -4L\ ,00,0 200b104 0 ,00 200b10> p-, LP 0S P* p4 ` ,  0P,00,0p 0 $0D PT0T0S , , p -0P@Lp8`  R   0@ 0 d -0P@Lp8`  R   0 @ 0 d -L_Œ @x`0 P  'H0!@ 0',0 0` 0 0' M-LM0'XX @X0 , %X 0  ( "('$' ,  pPP( 0"(X )%( 0 0 , 0'(h@(K 0-_02@P L0@ 0'0@-0@  0S  4000$ 4 @4@ -4L0S @440S - L0 -LM40S  3 lH0 ,P6 K 0 Kh6<99099 p-LM@`P3PUOx3e H0 Ph600 h0 \8^63 @W689S63  : M6J6P99t99`99999`99 Q-L@<60 769999 -PL$4p`V$ 4! ,0 w0 666,0 000,  ,  0h?PV@0D PT,0 0,099999999999 :9 0-0L @P ,00,0 R 0$ 0 00  0 0ȴ,00,0 R$ 0 0 00  0   0;00h0hȍpg嘎pg -@L⣴0  0;0hh-꠨g -L` @+;0 +꠨g -4LSPp `00  08#8<8#8000 08#8@08#803 08#8 08#80  0  8u4S0=0Sh;K b4S 08#8 00L$H@0@@000 31C0 1-L?rcWP`S #V @ 0DPT0`T0d  D0PT0C4Q -LàL0L0Ϡ@blpP30 0S PVd0P0,0 00P 03Q - @p`R0 0L PP 00 0 0008#808#80\4SX 03g4   -L@pX00S2q0W6 + i00` Y00P00Zpd3 00X3  #:0W  -0pS0L00@`% 000PU00S`U \3    83U 33X ;r :9`9@:9L:9 -8@QL0z2>0 p-8P@L@`4 00 00S > S 0 p R  B  h3 000 P3Xp 0 00 3X:9:9:9 0-L@LPZ 㘸0( ᐸ0( 0h臸' p-L@`@ ~PUP00SdXP ?lp  000PS p 0U 0 0 Q0P 0UPp@p -0LSP 0S" 00 @ = p`Z8:Xo`Z6 @ 3S `V 0@ 0TTPPQ @Om@ 00000@TP303p8P060 0 308#83 R 00  ` @}00hX ; p-L@[ 㙷P`dU  0㌷00PY YR`pp 0-LP@P 0.dlH@ @0cP' 0H@ 0V 0' -LM0` Pp @2F0S3  09P.0  0*0,0K0,0 Kh  KhS0S 08#808#80KhP  0P00 0S  0P3g4 Kh, -0`10#LP8p@P@ 00 0000  0 0, |0| 004 P咰`0  @ϱ0@  0:0  P   :9 -L M0PSp 0S` K@K 2&PS 03K 3[8#808#83K0` P`h3[8#808#83K 3[8#8<8#83K0@0 4 @K?0K 50T;@T*6 @0S4 000S$ 00~ v 60Ts@T*v0OK000 ,$P000Bl0  ^PH0@ UP0 0 0   @ ; p-L@P֮04`K" @p -2L M PRl2   ``0KST2`0 0 S<2004 plPRd0S| 3>1 :`@ 000S3033 T] 岴3dp0p|14 P=303@To3 `3`V㏏H0"S3R1  K冴0 ,pK &$3 00,0K,0K3 f @4  0+@K*K( 4  $#t003 P3,00,0P@Oc@ ;` $ X ;r   0-L M|P@T   P00 K0H 0@`@),($0 帉00t ;:9gd pg p-0QLM@`  `IUxR P 0P ,Vx p-0QLM@`  `[UxR P P0\Vx p-0QLM@`  `(UxR P P0XVx p-0QLM@`  `TxR P 0P (Vx -?L  ,0ϐ 8R2 d #8X$ -?L  ,0ϐ 8R4 h #8X$ -00Lϐ 0R (  $0@-19 0 0@0@0 0@0@ -L MA0P` ` ,0K "[D1R@ R $K2[mCX#X`(p@1ϕ R8 p (K"[p0 R2K"[0X00@ ?  00   &0Kl l0 00@0@,[@ r=@  0'$##" -MLMp9 0@ 0$@$ (, K2 R5 /0(0,@0@ 0$@!0S1 K! 0K1BK AP1 K R  0P` P$` 02X 0@ 0$@;@(0,@01 K! 0K1BK AP K00C S񟗲T2 02 0 0 0 2 0 0 0 0 1  (0P`(P,` (0P`(P,` (0P`(P,` (0P`(P,`'D -80)0L 0 '0 0   p-LM?@+P-` x0 00> `Px? R  (P01Ł 0PP9 x+r 00a=C4`#h` 0XP+x R ?0 :?`?`:?'8&;9 p-?LP@p0`   000l2  R` ^L00 S 0CJPV@pD#P#iX# -LM8 `x㴯0X2X0 00 D4 ,  42 R 0(K002@ Q@PA  0yPTk TM TUQ  002@P 0yPT p= < < < < = = = < 419 1 40R 1 崯v8 0x|R TU@@ 00@ R0 ,RU? h0 X0@@D0@@40 $00 U $' -LM4 < /<8 0@P` S ? ? ? <> ? <> <> <> <> <> ?  00 ,0 80A C0R> > ? `? > L? 0 , <@p$0P40@`  4n`00K O_ 0PP   8 04 <0 0(K8@04 R7@7@8@0@00 ,@ 0 ,  0 ,  00 ,0  0 ,  -L\M4@KP 03K/P3#K 8#c[Qr Qn 0S3Q  e2 3K2#K 2["[`0 2[d h0  R2 ㌂#K3K0[[3 1C 0"Pr0!2"[0<P"KKK 7 Py Ps r2 ">?DFcà.L !2c N"10,Ϡl`P!PdP0PhPc 0` P@:)(K T1   D1`  T!T1QQZ@K&05K015K P-V0[@S*T0[.S'Q0[-S$N0[S!U0[S[#!BR[ O[3 A 1C "P[05A1!1 00 `p["[2[D('8$ $xF:hQX;9;9v'N$P;9,;9 0-LMP!? 00R@2@ 0C 0h0CRI l2Ry 0R @:@00CR0 0R( 0? R2 0h,0CR> 0R1@@00CR 0R1@@01@@0 1 01@@01@@0x1@@0@0  001@@0 1 0h1@@0 0 0 # #0hD0@@0D 0 # 0h2 0 0R x'00 0 L# CH# D#P#;9 -MLM?0 p 000CSp(KBKII D Y0T `0S` @ T 0FpP@VP98! #  $1  pP pP04 9(K0P @ A(0K  0  pP pP9 (0K 0!(K  T0  pP  pP9 0  ' -LdM℀Kpd2 S108K(K9<ò99<%P@`PK+  TP` V0 @ TP`0008#88KT0  K40 d100' -RLM@$K4KpB0 #33 K2 4K2K 0` 1KM_KwPEV  @ 0` 0@T (\ (P  ( R9 0}&X#;9 -LEMpA0SO X!000HH1 R<10 S<08PK%1q "880K"17K6 K @ 5KNoK`FT  c80[7 [6[ 00P30 f@  0t 0$$$$̠ @  0g(K舀0 00&&P#X# -LPMp? 1S (K^Tl`KPD L4K@ Qa KܟEP 6   % RC 3R@ R> 3S; 14K3 R YM @ 0SSD 0 D B0000 . LP  .T0#10C 0P %ZK ]20Sp0 pQ2 RyP TKL t >K F8K B0h"0C4K02K#K t B("(04"43K@QBK0 5[Y90K 5K&Y*K !YM @ 0 B/S$[4[Q04KD 0 D B0000 <  YM @0 B S(DPt 0 P0 0C0 0 b0 RC  %Z0 R 5[TK< 5K06KNK pPt w5[K R@0 80Ba"$<9';gfff 6S-LP@ 8S:  X$p ?QX8  #8 0 8R`X  #8` p@@DSt T? R  (9Tp<<9$ -LMd!p0 0 @P  0$ $QPEu@ a? R0 ` ( U1 ?R" D ( ϔR4 h 0X 60mP?`VPT0ϔ PR6 l 0XU<'<9$ 0-0L PR ?/$ϕ<</@0T㺨ϕ/0T0h谨0$ 0-@LP@#40 00 @0@0<9' p-0L M @RP* 0`0 P PE|uX#KpU?0?T01KH01K01K0K?0P$'=9 -LHM?p$Kh`KD ZK _ H(@"(D0#K0K"K0 0H00< 0 0,P "' $=9 -LTMD_p p@laܡd ϗ R  { .0 /P006XE>ʂTχ D>TN E0CT >T >T.  0pX `>T 0CT 0T  0p0X 4X/ X0S  x x\  ϗ:? d¢(K=Tz !=T *=T =TlP2 4XX p 6@ x Gx(=T " 0CT 0TlPT= R p62 X= R   QE8; R#@f #\P x -@N`K@&@@:@4KDK @K$K HK px6 0xl"P2: R ϗ:? lP" X ϗ  0)00KK D:$K NKϗ 6X x)"@PwX0 Sx x9R  R 0CR 9 XX )@$9T 0Tp 6 = SW @S L9 p6ϗ?8T\ 8T@ 8TlP }X x80Sv p X vL8TW 0T# 88Tep 6 7 R Ļ8X 0X0̠08 XPX0 S7N X E7 Ro !ϗ j  囻`0 T XT 0`00b\0SX  P\ h t UW t0` `K  @l 6 l9 5`t0 030S R0  " %<0 S  S  7S  nS  0t B02 R B000 C B0 2 R00 lP000\0 W?P `T `  X 000a Sh0 Sh :L\ X flP X X#>PXP l寺3X 0X3 X@PX  7 喺T3X 0X,|3  XPX001 l9PI1S w/X ᰑX0ᴐX Pp62Q 0Q62 R XPp 6 2 lP CX X!/>PX0  R1Q. B1Qb # Q  QT A0XPiXPdp6 0p|!6060ϗ@ i X # ! a>X U4  㪹 PiD=9ii i7i i i iiii ";dT gfffL=9#H#81 i iii88?8i8i AB71"L#-%C$'? D0 R P04K04KK@0 NK@X0 r  0X2` T 070Rv 0Rc 0CRa9P- XD~^ !vX  x x ! =x? ` \1 Ra h1 4KK$K1>,0X ` XD Q.X0!0X0S00$X >00X  T 9X0+#@ x xP D2 RtBX r  0X02X 00002Q !0Q2QQ 2QJ 2QC 2Q< 2Q 2QR>3Q< D0CQ >0Qϗ / H3 R T3 XqXjX>f1>,0[ϗ  ϗ ϗ@ ϗ -L R5 RF G`P +H1 G0 0@0@(KDp0p P <C4s2 D@F Q0@00P@ @> R4 Rw GGDppx0KP7[㺖[G`P +G1  00C b bd3 R 7[* RQ  RO  RM $[Qt0# 0 0. P2 R 6[  2 R 2 RxK P wS eFg0 0S S} S2< @>z<@0 x<NFP E0  Q$[P& JK   DK   6K  0  0D P 0 0@0@F&`F꼤[>0P 7[4 F  xK 0 <0< P {F9 <00 0xK >J@ 0Ep G P 9 `: G(0 I CP8'&D#L#(>9=9>9`>9>9?9 -?LP 9Bϕ R2 d 0X ϕR4 h 2X|rϐ 0R2 d X ?R0 ` ( ϕR`4 h 2XjZ  ?R" D ( ϕR@4 h 0X?S` ".  t1ϕ R4 h A>CXH1ϕ R2 d 41XV 1S;0ϕ R4 h 0X0ϕ R4 h 0X ϕR4 h 0X ϕR4 h 0X0$p -,hLP$M}??@s 8 #K3K 4KpP $K躯 0K  h 70P9$ ! 01( !! # d # T #HH7H'p0C 4'00,7 $' <07 pp0d '006 &6pp ?"K2K*K0P"[::   6 R R% R +>2K 06"K P2[S? , 0} T% $6B@K4K 04K5 P5  [^5ࠃh5  P nş`@ 5 0@0A @? 00iL0@   ) ?0?`$0f10#4 4@R4}>??x4 x42RRh4  f,4^ʜ044@\,4`\?4 P@ 0@0 @? 0 @{@ 0@s0 @m? 30~@H 0@\00 @V?i_ V20e 0@F0 @@?<2 (0N 0@1C0 @*?90p @"?/2/P2PH2P? w0 @ 00 @?0 @?0 @0 @?0 @?0x @s0` @?i0D @?_, 0@A0 @?70 @?-'AB?[PP``0O?0@@ cAQaQ p- @L`0T 0TP$ U  $8P pp -0L040 T -,0L8l02 0 ;*c -,0L8l02 0 ;*c0 8 ;0 -1LMpQKP 0K 00`P 0@  T 0@`\ ڔ 0S 00 S R0Ġ T 0$ 04 000Ġ ;gmcgK0 0!2010P0S0SP(0-#206S,0&,000a>000, R000000 !2010P(0S(0S,P800="R$ 0 000 - 0p`L80@ 0R 10PS 0S 0 0 hVږ0/-000b10# BQ#4@0mN -80`L@0SS000p090LP4 R P40S 1v@0( 90 i! iC9 0-80 0$(L0@ɀP0h  -L@P 0h Q-L \ \ 0S 0 0 0  0 kC9 -0L0p@P᐀`΁0 0000i 0-0LP@40h 0-0LP@ 40h 0-0LP@40h -@QpLP` p`@`T`  P.P @$pTp,8S.   0S`(8S $$0SpC9 -LM80 `=2pS0KXRU;T1l!R7  p@l[P8`J0908 0@8 0 3, 0LpU$0S 0P#>S@ lX00090,op@lP8oiHD9 D9 0-L@P0h p-LM H`T  X@ 0 8040 0aҀKp 0KPPP@   ,0 0 ( (@ ^ 8᳀ -LM800<0 08 =P}80s<0"0080<04 @0 ,04@\^j4 PL@&j, ;, p0 0, 4R0><ʅ0 S00,0 ,4 0PLCJ 3( 25 < ( 480, ^0, P80@ B00p*0 W!`<apP- ,#(0L",A P p4,80< 00 80< `~(08 04p090(Ko&(K<0$(Ko<  (KoPD9 p-LMP~H`T 08 0$00jKp 0KP   ,0 0  (0 ^ @8 -`80$ @RL0p4PP 00$1l00< @0, 00 00C 00$@202LP0040004 -LMD < @ b 0%  0 <0,  @,00 `,0R ' @"0F08 @ 80R64 80 p2 @@<^:#:zc>0PP4*3 S R .J`` `0F 08 XP"$> @ 00C 0 市8 0pDP2$00S (K0 0000 ,@ 10R0S 4I@P<P 80 00 0B$@Bp -L M80+p` ,P4@0Ppt ,0 Pp $ 0000 ,P  0,K D,0pP , j044080< % t108< 0, 0 00 P22$`D0L@0%0 P0,!,Q 100,0P,0, ,0 P, 02,0R, $`g}00 p04lB pt2   lš0p \0S <2S ~p(Kl@< e  l ,i(0 p-LMP)}H`T 08 J00b~Kp 0KbP   ,0 0  (  ^ @8 -LM P=b@Vp7 0SP32,0Pn Y0P P, F 4,0p 0P  4# 800 0pS0000Y t  D P  1,01,0| @ R} 80,  PP& ,0S  P 4(p,` "k j( l0r,0 oP0,0os|@ };;;;;; 0- 0LS@P YP 0P 0 PIP0-80=\  0 `\0d hPo @ -LM=BT (KX20X2"|(8,X,H40 (Hc}U'Y P$ $`V 0SS l_P8d 0S 0C0b20000#s2(Y P40S`  4P$0U00 W 0SSQ 3N 4 <00b<0 L, 0 倐3. 0 p#> 00Y R00`V,0@ 1@*C6"*0S8# 00V,00,0 3 YE 0L0{@|0 R8SCX20CX2\$p0W80 @$0S 800 00lB pt2  B l˜0p \Z00 Z0 000Y{@|90SL{@w|N080갩g0 갩g 0-L@PPK0 -L0M80p="R =,+ )0*T d<0@ %0& $('$Ru *:R eR R R 0lB pt2  B l—p <\00z@(|$K Rk  R zD9R 0RU80 R S 9R RV8VUlB t2p  B l—!pP ,0 L#Ġ# (K 'K&K%@K(0KzR 2\8R 0R 0V8V!0NPPS񟗊x              D 7R RqU000~|7Ry 0Rv 0wRr 0sl7R[VY8VV!0NP`SP P     \                      X ^ǕA 0AlB pt2  B l—p <\-lB pt2  B l—p 0\Pd=2P SlBpt2 l2p , UlB pt2  B l—p 0\lB pt2  B l—p 0\lB pt2  B l—p 6\l— pt2  B l2 p, HlB pt2  B l—p 0\lB pt2  B l—p 0\lB pt2  B l—p 7\lB pt2  B l—p 7\lB pt2  B l—p 8\lB pt2  B l—p 8\U=  cJN4S Sr S0.Ÿ@(U@1@# @8 C4  02^/ 00l— pt2   l2pH ,O`K@' 8 M0K$40#  $<@L KJ0KK@Kl— pt2   l2L p,P 0  @P !0 0R@1@!  O0KU00U0 0 U 0R0* R# R  0  U`1 `#@f TP1 P#p@e wT@# xql mP P   . # #;;;lD9";+;4;pD9 -L@X P 0hB -LMplBP t2  B l2pP ,Z8 <0 @1pCWp!rW"@T`l• pt2  B l2 p,/.00 b` T!0,!@W 0 0 mI  0-=2LSP 0x$@0hMy -LMPP "R pWO 0``c00v[ VlB pt2  B l•A0p \4` X2\"0 X2\"{rlV@IX2V0CX2 lB pt2  B l•p 0\4 04 l• pt2   l2p ,` "p0=2l• pt2  B l2 p,"`$Q@`zlB pt2  B l•p 0\lf7`P80P81 P`z $P(Q`0P8rD9D9D9D9 0-LMlBP pt2  B l•p ,488h -LM`0Vp0P`VJ=2 SlBt2p l•p ,4 0S 00h#  -80L="R<2S 0-LP P@0jT0 -LM80P=b0V@  , 4@pP7 $`D00%0  00Q  170<0@ ,, 00C 00 2p$PL@v004p090w<2S a 0( -L@_ P 0h -LM8 P`p=2S  $K0 0 0 4@ 0(K(P060( 060(202( 0(0 $L@Bv(0T   $P(0 S00( 4090lBpt2 l–0p \0S <2S _w<2S l@_ . -L@ P 0h 0-80L@P="R 0P<2S00 -L@ P 0h P =2S<2S  -LMp0  R0 0Q6  090PP4 1 0@9P02>U 0 <P@;0E?01P E 0R904 0 @RJ1?P5@TZ 4  8~A PP? 4 @3 2 \!l—Ppt2 P l2p ,l—@pt2 P l2p4 ,l—pt2 `P l2pH ,, l—pt2 P l2pL , L0@ HdrlBpt2 P l— 00p\d`lBpt2 P l—p 0\@ zl—pt2  l2p ,@ T$@P@T 4 OlBpt2 P l—p 00\l—pt2  x2l— |,00 p\lBpt2  l—$0p \lBpt2  l— $0p( \lBpt2  l—p 3\lBpt2  l2p ,lRp t2O  0l—@00p \lBpt2  l2p8 ,l—Y %Ypt2@a  FN.B Bl— c0#1A80p4 \lBpt2  X"`l—1p@ \lBpt2  ,l—:pH \lBpt2  l—P 8p\XlBpt2  l—pH ,0\lBpt2  l— 0pL \,@ 4P-l—`pt2 ` l2pH ,@ T0@@ 004  HHDHlRpt2 ` l—4p1 \H 0@l^갩gD9H;,E9@%I$h;! E9 -LMl`ppt2 p l2p , H H81S[ l–pt2 p l2p ,lBpt2P p l–0p \@l–ppt2 p l2p ,@dTP ,lBpt2p l–p 1\lBpt2 p l–p 1\  DlBpt2 p l–p 1\@E9 p-LMPl• pt2  B l2p ,d B`0 @`0P T <0`2xV0`2xK:xF:hE9|E9E9 -QLMp`G Q1 Q i<2l–0<2pt2 p l2p ,DHPT8 lBpt2 p l–0p \2<20C<2lB pt2  B l–p 0\<2l0<2pt2  x2l– |,00 p\lBpt2  l–$0p \lBpt2  $l–0p( \H8SDHT lRpt2  l–@@ 0p\lRpt2  l–@0p \lBpt2  l2p8 ,l–LH pt2P  10CN>C 0Cl–0b "!HQ0p4 \lBpt2  L8l! l–p1@ \lBpt2  l2pH ,lBPpt2  l–p:H \lBpt2  l–P 8p\ lBpt2  l–0pH \2 <2 0CD(<2L(H(il–pt2  l2p ,@@lBpt2  H(l–00p \+l–DXpt2 p l2p ,l–Hpt2 p l2p4 , L%I$ p-T0L@`TP @T 9S  @Tpg -04 10@LP  >00t*R90  q0@-P( HT L) 0!"4# 8̓ t\0S \0S  RJTPP \0SX00 P Pp0: p0C*:p0: _0C*:0p30 P  0 0 0-LP@@T09  0-@LPkp 0 0 9@)0hq -@4LP R00080 0 4P0,0 0$0(0 0-PL@ $?:P(; W ,0 04804@V0 :0*:1 0C*:,0 0@ p,H`P0@pDP0` p0@ L#D <P`0@(!(Dp#L440@F9E9E9 0-L ML@! 0Y"4#8 0 K00SPtɔ0X R1X R0K! 00P000SU\p 0(ɄK0p 0\F9 o  VP0 48Q Q| Q> Q L0 $ (,L  G< 048 < 8  P[0 48<@(0) *4+8<S(KO0 0 PP0   0 $ (, B 048<#,##Ƞ 00 $(,0"̠""N 800PPPW00PPPdH9`P VX ",0( 4;2( +>$0"` 405 6478`:p ?;P L<$+4"2L)540674 8<2L)! 0"#4 8̃ˆL405 6478;P8p 4 ? 4 8\,Q0P , 8K00K0S@P`P`D0 @@ DKB2MP`0 K 5?c`LW? L -L^P`p@ P@L) 0!"4# 8<^P@+ " "202 0-LILPL @08 H 0 48  `:pSt  㡂L  㝂P  㙂\YU  㒂 ㎂TP1S10 $8S :S V*R:::8*: 5 hk -pQL @T `0X`SP l!pl1` n`"X OU@00i p-@PLP? 9`S&U0f0P92`9S d9S 0 3 1CT#PQH P*jphg090 D =9SU  0eJpDI9;8I9 -40L@8 P贩g -pILT p@T `hP P  0<J @pTW m;LI9(0 S-$0@LB;`9S H:S h謮 p- L0410T`Ut@H h9S L)p :S0(0ph[00`00%SI 5S@ +(S *SPp*M0(00 S S SP PS S SS S SPPPPI9lI9 -@L>`9S H:S h -@`LPeVp (0S0(0(0:S P% :S$T0S! TT RX0X0X0 :T X0 0P (0S 00 0:S hf Lq0 0 ŭI9? p-@PLn`Lg0T0*TX PH:ʄ0CH:ph+g p-n`PL6gJT TQX0X0X0:TX H:0H:gp -yPLHzg> ,0 W9 * Ʌʅʅʅ ` ᥀@\9\`0)40@ 480<$P噻`WL! 0-@PL YU 09 Ac 0 )> 0 9Y @9l@$9 P R080S880΁ --LM K00,8 0H. K -dL@{P , P  I9I9 -@QLp` d:S HT +^L p P JT +^J9 p-PQL` L)@0h 0@ @@ppXU OL p P ZU pOJ9 - LgM`0l`p@@m/K0\P0lP K]K 1 S h d0  0K 0RSK 0 P`0 @T <  R !SiedA(J9 -@L`p  PPL ] X)R|F  0p)t R t9 RX9"100P<Vp #Ppt9^ 0 S0 S RQ  PUp)R t9 Rp 2T!   6PP (;tJ9LJ9 --LM K00,8 0- K --LM K00,8 0- K<0 0-PL @P qP0g -LMS8# 0 3,K WP`XI 0ĐK:0 . 0h0 0, 0l!0 P` Lp 0|0 H D P P P H0 0H00 l 50 + 0 S ?04X@ `p XP1X#\   ?04X@@,PT(K 00P@K00@@iJ9J9 -L(M`Q* 0K j5@T +^@T  ;pPP (0( @ D @D ~@ ~(KhV +^L p P jV < @ D @@  P  @ (L)04 8 S a(KL)! 0"4# 8  t@X RpX0S pW` C >p`X R AX0S  R 4) $$0 ! 1  L K 0 ,K)TP S@, l1KgP#,l.K0gP |Cl1 ,Jg,P1 S L KHA(PK0 1RS L KSK 0Lɚ@P 00@2 A LK00  R@P L0K QQ R ! Q Uvq AQTQL IPP A0P0T0SuL)000000000K QLK\P,0 `0L 1002@3 48 0S> L)0,0 p h0^R^Q@ @4 R 0 S@RTQQ 4 R 0 S@RTQx_T 0 xY,h +0(KoP{0S*^0P@/{ 8(\ P2"0CR202 0S00 y({;_XN9|N9;N9N9U -LzM\K 0pPP P  TM dy `y@(K =,KNR@P 4, l1rePP# ,OpA A P 90 : ;?@!`"`#`[@8![<  s!1H0!X x LyXii1X [\i xt `pP  .PE (pPa a l1,td,NpQ Q PpPq q Oy"R 0S0202y@P1 2$N9O98O9iedA(J9 I9(I9\O90I9tK9dM9 0-@1L PR "RE HT P0S J0T0R R R 0 0hKp)R \0S \0S R`0 l5P L)p 00h3O9O9hO9 -L4MpPK@`P 0Xɔ\048 L1 $(T\ o K"1   P X]L1U0@K `0` P 0 4 8,R* R R 09404 80 0 @00 @ @ @X\ n04 8,P00 marcO9;O9CRAMP9O90I9 -LvM`! \&((0"4#2 40  $,KO@P h    .v)v(K$P, l1cpP ,LA A A l,.K0 {c@Pc ,l1cPP,L1 SQ Q Q   wP t  vP x A~KXYQ Kp<W 0S&40$ $,K! OPX, l1bPC0!P >A0 48Lx1 $(T\ X,l1 b,DL l1,b,*08\`P@( L 0 4 80P 0#,##8  0L" 048 <  " "4"Ƞ 0 @} p9S 3#^4 0@@ T T0U T * \1A p `<`P ``TQ&8PaL0ST9V L) p L)0^\IT x:S P @TXʘ\l  P0 Pd `#V#`F h` X`L `@ 0 sL p hphP"9`SQ 09L `@  sp QL) p hn` 7P/ , 4S PL @p0SP $<$$$301 20@L  paL9 p0 oL) p ;}q`kPp iPL  L9 p0\ ZL LQ9Q9R9xQ9TQ9Q9TR9PN!N!`S9R9Q9R9Q9R9R9HS9S9S9#!xS9 -P0L 8@`pt!D1TK 81T8 ,1T0 $1T) 0H0/P t0T/ 0T .P00T 0T 00S0 0  B&B"B!B$%B'B(B)BݽG=0 @-0410^@ !40BS <0Q 1Q - 0@rud@ -LM<{P@UL ,@ 4S 0S ,S  ,C ,P$ ,#$0S{0Sx  Rqs  r`P $0, P  PP,c L0@sL8 $, KL;sP,c U,0S 4S `0S $S,   $0S$% $0&'48<04 506$7(,r{ 4QP'XPU$  XPP\f 0S `0S$ RQ$ $`U 80X080X ,0`P\ ?rpP   5406@ 427P<01002@ 423<0! 0"@ 42#<0 0 @ 42<043S0P0 40S  0SX RQX Xp4X4s P\$P`0X$0c   0mrP<    0erP@  43S (3 (XP( (|P (0S qPH  (# 0P L$# L K$H0LK\0 ht$0:98T =<ČT>Ȍ?; ,H  P $#LK09=8< >:; $? (H3 L \(@,P$ 09=@8<>Č?:;P|H Ȍl0`4p2$H3 8vHLH H0qLHO0X0rL"RD 0SH0L202r(XP( s48 2KG0s0S   /P 00h0  CR <#00@3  @0 QPZ.S8A8.L 0L@M0<X 1 @ 0rD3 ! 0` @ $P(V|: $Z% <L@K|L 0D D30@PpČ@嚀Ȍ`,@ $Z 80R L <K0p 16K   ` 0CSr PL#0@qL382K0 L0r88 XYV4cPPXpU $@ Vp RpTP Kp`W0#R P$@ @p  $?(<L  %PX T < P (KP@K T0T #<`0 "(T0h X \ d #4l Tp0 "|"X"4<tX..h.D`[J0KPKh[X0[OKp[I0K 0 HKGKEKt NKMKLpKKPKF0Ktt 0@KPT R0-0K00K/0K.0K0@ *0K,@K+@K)@K[X0#,##0 K/K.K-0K -LM L  A0q=<@嘡0> 0?@堐Čp8Ȍ91 t:᠑ 弁壠xᘑġ q ;堡夑 ġ̌ ጑ 0O1 pǏO O cK \`e?K P`CႬO<@eKp॓ S ̉Q `PQ a ̡ koKa |q mKsKpWp l q 封 l| X !@0p1 lA 3 0 ATeKpc_K`P` p P`"-Bp2MPcK`P` p  0P "c0`AQp `Kp4 0 Kx t lp劣X ̊( , \ x!1R `x @d ?$(\$  IKpZ_K`PI/K `pZ?KP`"-Bp2MP`ZK PIK `pPI/K e!c@`x!\Q0T0R _  0 kP[\A 圡9S@ M?K0@41 0A KKP`0PU`@p,q ( ^Kx t | VAL9L) 0!"4# 8̓ t 0X R] 1X RW  Q P 1AL)p \X(Kta|qV꜁儑L)p c Ux!1R`tA|QT\尡 !""4< ",D1  8 @! RX?@g | 0㓚!l\pP lQU0,U9`U9U9U9U9U9U9@-L)@ 0!"#48 <29 -LHM` 00K\0 @l#X@ P\ L)! 0"#4 8<4  L H  ?< 80 ,00 H@4;T$P0 T U\0P@t 0 dkVTb 0D @0 TpKP0 SOK \D0t !XQG &L ty908 :=<;`$>0(?P ČȌ<L "l!4!Ƞ!"D"X Z?`90:;=@>P8< (Ko(K 09pPp`405 6478<sb i\`0 0@0@` \ p , Kl,@TQS @T, 0 48<S P Kp`  P Kp`P Kz``~0]>p`xP K|kp`pl1 0T0J> p`fP K8Y`` )nh|iedAP9dM9$N9tV9V9V9 0-L \P@  S  L) 0!"#4 8<90q P02 Q " RP0#2  P  00-P0 L0 0) 0@ QH8LH@0@ \:*808 X:T*000 `:d*(0( x:*0V9Ĺ!!!d!L!!!`! -LqM`LK 0@p8mPP|,K@PP4Hş, l1SP? ,=Q p@ g01  gZ t P  g .g gT ğ,l1 S,x=(K p g.g g (,l.K,0*TP1 S  02( K01SS  [Pp@  l1,S,7= Pp@Q  tD g \@,0 `01 hN@P@PL) 5406748 <0@4P(@,P1 6L 8{H0 vX fg@m0a 0 0 0 /0C B0 0C B0 @ 嘀噀嚀囀圀址垀埀 L= BPI 0 407 001 2 3 5 6  !"#89:;<=>?@!1H0|!X g(80LYXԉD  \gt !  嘀p)% f@p 8f0008   B\9 0L)\y)(0*+48 <0##Ġ#+)*(0P@  0n@itV9edAV9dM9$N9 I9(I9V90I9tK9 -LM<`KN_Kp@K\e Ekvk N  I\(K -LzM@`TpP@K z K肏K,XPU @ @XU@ -LMPh9i)j 4k8|WN@ P4K ӿп K!0 " #ČNȌ@(`̌h ;p 4K  ;r PP 㩿P -LTM0 00 $ (<S S D$K<$0 0@ QH8LHhA2P  <$0aP  PYU800\PU 0d0$q~P LpxKT  $L)x t 98:p<= ;P>`?< L#?1SDOpPU! 3! (00  l0 ~`PP0 HLp !]P0@pPqx( sqoV9I9V9 W9Х! -LzM@`TpP@K z K肏K,WPU @ @DYU@ -LM@Ph9ij`4k 8Xp @P<K㿾 㼾 㹾(K  +eP 0! "#ČȌ̌h  ;p7 @8P (W9 -LTMd 00K\0 @(#X@ P\PL)! 0"\@4]#8D0 <`pい^<` 8p 8j,0 pZhp 僔_塛 jbYgQYzl H< K  LtD @ t)XPD0 PX`P X0S4 k @@PPL H < K ` pT` Pp Jh:lp\0GLpKL`PoT K pWXHp$+44@0 ,0 X@p\D@ @GPJ PU`d@L 0DK@ D @ <K0Q@@ R%! d@ 0SD !& \@t9 XQ4HV4 pL ULpK(KWD\0@ D0 @@ D0TKY!\P,L)p (dHW9V9 p-L9`] \L^_  vpd ypL9!] @\^P" D_# H L BD#9pTW9 M-L0Rp Q(KL)0_^0\]LǏ] \0^_4 8<4@Ps`   7,#@$,#Ƞ#\$d$x? 9:;P=`>p80<@(Ko\0<\0< p 0(($0K0h莜  X9P8`4:8;P?@ (A\L 0]^\l h0 P @ _@ČȌLK@ @ `P@$(hL0@ L48 l pl0G L^<NdkᣄT 45L@VNV\\ X0 K\ K `P d@ `Pt p Q{ptp p ` p0Rd@tPT`h 0@l`t0 , !!,H t P Lp u0`, pp@p < !,,X<8P 4` `tK  D0 < 4` T  $P D` @ K Dp@Pp@P8ʠP@ K p P+ 00 0 0 0 0Pl K K\pKX\ >. @   0@ 0@BT*TX :PNCi 00H$廋 0  Z W840L)(((̠##H#<0@8p[p4[夀L9 @Č壀89p妠  Ȍ:`< =P̌| ;>@x ?$(\  }|PK`pKpWP`P`B2MP` K cP`T`U 0dpK@0@Sb PPTP 9S_0K@  LPK`@K @ < 8`K0K`pd0KQ8` 4p  RL9L) 0!"4# 8<P`UQtə0X R^  0X RV 0@P1Q:L)p THX@}P T9S 7P" L)p (Ko.0  ފ$! tp ^$ڔKpKpWP`P`B2MP` K sc0`p Thd`P\ lP0,U9U9U9U9`U9 -LM00K0 @%@ P0P`L9P]!\ "@ $#`(^ _` L ZP 0`KP PP0@U0@ 0Hh d 嘀dP0H 0c0C  x t h R 0 8@Qᄛ4X T0 x0K0 @ H0 D@ X0K0S@80 4@ h@K0@P@@ t9q0X@T% T !!!!!!!V V @t)0L)p 0PPVX`p0 0d9+ Ki@VG98 -L9@] \L^_  pTW9 M-L0Rp`  KL)0_^0\]LɐpG] \0^_48<4@s ǏP`7"#@$#$#\$d$x?9 :;P=`>p80<@ Ki Y9 0- @0Ld`0 p: 0 B9)D0D X:T*<0< t:|*404 :*,0, :l*0Y9X!!!!!l!!,!0! @-BA 0 0#^0E-Bl pA `P (  0 8 , 40<`. VPg-\0\   0"  P1 0<0gg 1 0cgg-1 0 gg -p`@QLU   YP 8p8 10!  \@ggg -LM`, V@Pp)   0` i@P# 0 0 Y  YYP 0,(K P `P   } - 0L @P`,0S (0  L pdTppP L(p A 0 (0pW9X9 -`@LP'=p0S  U R P H8 P H8 0 X000 H8 0H0iB> - 0L0 0T0 *TX : 4@T @T -LM 00K0 @L-@ P0PL9娐]!\ "@ $#( ^_尐 T ZX 0`KP X 崐0@R0@ 0Hp l l0L 0c0C   p R 开0 HQ<㣔4ˉ|0 0K0 @P0 L@ p0K0 @ pKH0 D@ 0K0S@8 4 @0 <@ 凔ˉd ` 开>@ XBP K QHQPK  p K  `KK`VpX ?Wgd p K  H K h d   8`K`Vp `80K`0 \@ \d Qʏ 0hK@h d dW 0hK@h d A \1K8BL0 @4+ 0 " | 0##@ K D0@S(ڨ 0tx t0 @ 1X R02 V `0S hY x t @D0 SG  J  .)90hKļT  DP @PhY K  V T@ˠD @PD@_Y X@ @TX@  0OᘀK 唐 T T HX  v PPq  Pl 7h@Pe T 60T ? K Kh @PPL` K  @P> K @ PP1Th K  yP  `@ K  @hP0P @ K XPo 0S` b(KW@$ `0S\X@ hYd R@d\K V>W<FV`| @0##ഀ` \ H\2 @x t hT K  HX@x t yP   0 0 0h V{`0h@SsjhKT囻hD@0 T岱 K @@ @T@ˠ@PqDX0@V & `^( h\+ T;  #0~ K PND0O\ʷH^V W `^\P h\d^t@hKx0@9Ÿhx 0@$@ E PTI K  TK@aP` K @ PTPD\I0@V* `P, h R/ x^2 T+0 !00 0  K  -PD0O\=H^:VW `P\Q h Rd\ x^tP"HQH^H\59\ 0 0@ 00T 0*TX : :(⍺8Y9Y9Y9Y9gXY9Y9DY9 -L MLɐP! 0i"4#8L8 K00STt 0X RM1X RI0K! 00T08 R- 0DR࠳ 0S,pWT4V h!L!4!!!h!^0>& p 0^0>' K^0> ^0>p 0Hٺ@T `t9`X TȺ\F9p80<@ KiZ9 -L@G00 TүP0  H p:09X*808 T:t*000 :*(0( :l*8Z9 !""008#8S0C0S00`7>p 0` T30#T 0` 60C00 #T0$#T'4(#T 0` T30#T0 08#8R000 0)/0Qp0 01(K 3 p,0 P @0T @,t`pPUu˱jnL[9 -3 ML /003c )@  0@ T30 #T0@   V3 H#T 8#0T <#0TU3 0 @#T0 D#TP3SB0 #T0 #T #3T L#0T@ ,#0T @ 0 T3A0 #T @ 0 p P @#2 TXP@80PK@0#0@ TTpt! 0 08#800,#@DT  0@ T30 #T  0@ 9U#  00 @#T0 D#T3S  @ 0 T3# 0T9 @0!9S(K H#H0T9 4#0TNjn -PL@p`.T1T% 0CT/  08;@4T %01T 1T0/ @4T6@ @06 @" Y0@`@P608#8@6@@ ?6@06&@F@Pi 7i 8i8 0-L@.P'0h/ -L38 KM@ p@0@  0@ T3B0 #T0  @ ,#$R< 0S  0@ T30 #T @ 0 E , K 2+[[P35#5000b00a 0a0 " 2 0 B S 0B 48#( RYA0SU_0SQ B("(P< 8K+[ 0AH1P07#0C220 T1< R 1× d b$\C c $,K $+K $P $TRK0 0@0@88K|(K0 8n00 @0@&8l[9 -L M38 S0 (K@  0@ T30 #T  0@ ,#$pP :  D4 Rv g 0 0@0@3S 0@  0@ T30 #T @ 0 % ,#$pP4 0 ,#T40  ,#T ,#0T ,#$ 0 D#$ H#$ L#$ ,#$pPm0 0@0@ x $#$Pv  #$00 @0@P`1  B("( R0 9!_ !C0S0 07>0`,0 0` T30#T 0` <1 60C00 #T, 0$#T, "4(#T 0` T30#T 0 B08#8 Q000 )  #$ UP` P`0 0@0@ jn -@L 0  0 0h<9 -9p@T  L×0#T3#$ A?@(0,@×# 0TL0@(0,@×(#$@ ,(0P`(P,` -9T@  LÐp#0TC0#T×$#$2?0@S, ×0$#T3(#$2,P`0@0×@000(#TC#0T×#0TT -LMÐP0 T3 $3@ @$@T* "T|Õ 0T_ 0Vx`@0@ 0n T i脂T TA@pp""8 -LG-@0 084 0<0   0 0 84 0M<0   R0 P ` p@  l0 P ` p08 40< 00 (0$ ,$  084 0<(00 ( 0$0 ,, 08 40<0 (0$ , 0 8 40<0  (0$ , Ѝ88R@- @0 08 40<00 ($0 ,4 08 40<80 (0$ ,< G-SkM0@   0 0@0@P@P`P`p`p堀p 堠Ԁ$ؠ(,@0 408 <0@0P?UU[ [`00p R0@10XHA0崀0㸠P @h1X100 (H1@,00 0#00 c80`1*dH`n`1lȠppp0P,& #'a0 ` P0eZ@1P1 (@#@0b*,0c̠0 c<00*0$10n010dLp$1'P#1  #P1\0T1@1,0D100(0T1`#D1&@#0nc80`$1dH0(1101(1 &#1` P#T1eZ0X1D1 0H1b*0 *lȠ0(0pX1'a#H1 @# *0l̠c<p`q0(q1andL`p1& #1P'#h1,0Sh1 \U0000 d`X张0 HȠ 0\LĀ8! P `p蠝0@?@ Q$Pa(` q,p048<p@@pGp?PP@4P`0`kߍP h 000QhP@4P`0`G-Q> 0`Pp 0e01 Fjjf>0:-: 3*f?*0A :  :**   P0!V!" Z!P 0 `Pghgԫc81s s0@0 0@0,c<c@-;@ 0$@@-:@ 0$@Pკ$0 -L h}8Xcg -LM)02Ԁp(0 0@P(0,@!  @`2  ,K0 0 `,0 ( @) Q@) P@PAQ 0)$K| c gdg$gg -0#L0M0@`ß 40, :BU{ 0) 0""00S X 2@8P 8< n)(K p0@S 0<0 l2<080 T2 L"10 P L 4,H0 : 2  0@ D @ H @ X T ]`P`P0K0@P0 L@ 1< 8@R H0XK@D PK!8PAD K @QDa $0!00S`| 0 0c b"GS0c aR bW00S0!((R08 C4C2 C10Xt\( 0L q[D0@0P 04 (`4KIu9 gg cdg$gg -`LMKOKp*t{M\PK*QKM( m( @ߛKcԫc p-@PL` ;U (V1(#Q 0 0#0PXP,HH ( ,劝00+ 僝 0 pԧccc8cj n1 ^2p* K<0Pl"[0R  Y>X X R h0X@ ?| x0 4`R<@ ph ^26B 0bC  R7AQT7Rw 0PS0K |K0P h `@<00 j H0l0 |K48dP D PQPR00S40,00@<0V`w0<S t X@l0T0(4 K@0TV ^@ t+06040H00  H t 0P0 <D@TT\ `P`p4P8`2@8P 8< d UL 0.S$&L@ B@P L@ T pX :Lڗ PG=<jH0t SN<jt0@ tK+04 K60<t@X(0\0/@P?V UF40H0X1@0P 04 P0t tHy\@ Cpl0PL! Pl0,0 t04PXP 4h 0K 0Pw \ #T0Sk* ;0S9@0U5:0S\ \ 0S 0S 0S0P R @ R 0@4 R(K0S  R P`0OTS/0 0OR 0 C, l5.)0S#Q 00KP0 H00@PQ -L4M  $0 0<0 @K;   1KB Kc -L4M0@ $ @K <0 3 K|c 0-L M(0@ P b$p(!0S(0 K0S   00 $ (0!Z(0 9 J p-0L@`P5 P p;0p0d0p0|000pp0P d0P |000pP p0p0d0 |pPd P 0-@LP 0h([9 p-0L4M"`@0Ph P 01`0D 㸓P <LK( 0P H0 t  Kp[9lc 0-L8M @( ,0 xP!0K H 0@ $ K0[S< L@KLK0L@KH0 0H0 c c p-0LS@P p R R`d fP0 <0p`8[P0 S QP [9[9[90 <#<0@0  p-0L@ S 4n"Pn"Xn"m"ln"m"m"m"m"m"m"m"m"m"m"m"m"m"m"m"m"m"m"m"m"m"m"m"m"m"m"m"n" Z"P8#`(0  ("( Q&*0(00 $0 e0b$000p` PB8#`Pp`P\`P0PP`8#$ $0V0$0000p[99 gg -LM0 0P0,0 , (0U@$p0`>*V2S/00@0 S\p"Xp"p"p"o"p"p"p",q"p"p"p"p"p"p"p"q"p"p"p"p"p"p"p"p"p"p"p"p"p"p"p"p"h@`T  ᗒ 0P,0pS(0$p@0`0 0S000 (K`@T (000 $00a$0 `ᐐ@`嘝p@`d0\@`0pd `㰐 !@` pd@9\9 gg0@- 0P840 ( H 00S@ 00S0 S%*΋0" KP 0S0  R*對(p( 0S0 S*[ KTp<囍"[00b0"[000"[00b0`h -L@ h! `p0PS` :` p`#TPdchsl -L 00 , 0^nP`U TE*Ap1 @f0P  00,08 0 (KT-*. A.0P@ @0 0Y 4 00< 0S0c>0a00 , K@@@d>00n 0, 00 6@r"м"T" -L M,p`@P K00` pP 0SK -LM@,0  0b+2` 僢 0PP'22 Vp!@!P#*@ @T!*0S P 0P: *p 0PP  n* j*(Kp Pa* 0R P0 S, xPP -L0>0 1! ``cl]9\c`hۣe" -LvM@PD@ P  L` 1 ` 倀 KKpP@PU p@ (,00P(K,!0pP@(0$ ,!0pP @0,!h@K 40pPuP5[S p0  [ )3[@RL 0PwpPc[Vq $q ^  0S!!(0K!  1R01  0>. 00b>01 !  z *1|!0@ 0` HR0`a S(K1 0   0 !.  . a0 S2Q>222>30300 5V* 0! 1 1 0KP PHС `! 00\ . 0C0b!00`H  ! `\ʼ#[Rp`   1Q8 1 `0R1 `000 40 Q\P  0 c, 0K4K ,0KP\:00\,%* , b 00b$1#[0,0 0,! R:0Q*"!B00  000 #[a p a ! , ۣe" -LHM8QH1U@$0 p DaV $K 0tP3P `h -L@P 81S@@ -L M (1@ @ `@ 0SD ݂P 0PSU *0 S   0 S  R: (K00@ T T@ T T TpH@ Dp  0T0S  Tp p T p@T TT D H 08#8;00 0 40  8 ,! 0  $,',K.z,'Z0<0 v(1, 0(1,0,  ,0 , $00$0, 00CS 0  c00P (1 0(1? 0& @< ? h&'+0sP@0 00 S S0 S S S H H00H0 0SHD 0, 6 0,!tpt]9/cx]9`h -LP P   %P`pPU c U@1J## Pp *@% p-LM R 0.>0 0` Ȍ. qΌ@P 00 `Kp -LM pR`$K0.>0 0`. 0 @P`0 `P@,  0P``0 `P  . . 0`` -LM @R`@" 0:#:S%0:#:S z'zW qP @  @ Ȍ PqΌ00p @P K0@ 0-LQ@ P21C 0 P  QP P0\0 0 "!B?$00P0 -0LS`@ p2PC@0 0 000 p@P00R00S p-@PL? 0%2AC `~ 0P  ?8$`p p-T1!!1@@Q(!L00>0>0 1 R70P/*"`!B ` 10a 0`0PP PPP0P:"!B00` 1 0 10a0P PPp00C>!00 cc!,$cT" 0li0li -0LPM@ 00 l0( , X0 B0`K@\ ` L0 H@ uP P $-K)D]9]9]9 -L8MB 0R<0 0 !Q0S 0`0  a 0, (K01 :0 0*@P0 `rPUh1PU,K0@c 00 0`Cp0K 8@ 0p X/@F 8K 80 PKD KP0 L@ Hp ]P& P ňPU 0- ,04 Kj 4K1@K@``ds0 30K2K0@ <` `F<K ڧ(K,堈(e$cg]9 c^9g$^98^9]9 -6嬖LMl|0[Kb 儈 g뺠뛭=_*'" Ǜ~(TP, Q e<6 R0 0$6 00  !!D 0(D  !!` R0@a 0 ,0E00S 00400 4 0S000 0 `0  0  !!$ 0,$  !!0)05 D01~ L1[bD4 000<8( 0A R4@4@@ P  kp@P0@0`p @0FP`pP`pX@\Ph@lPp`tpD(T@`d*1@@@34 D!

 g@]q@y-`@ß,K 0 @@+P,0 c3 C  0S 0 "6P0SEeX20S P 4ŸR$09$0 0 @Pk dr 0s!0 @ 80 80e 80 @T1`V P^?U |@T 0 0@PU`V 1 P>!1 P5 tt1 P, ``1| P# LL1u P 881n @Pa(!00N !0HO帇嶇崇岇將宇嬇媇igP 89gggggggc@^9$ gg$;UiLg<j|i ;"gghgT^9 %cV9Чc\^9h0hg0.^9g"^9"^9"^9.^9._9g_9p^9H^9 _9^9^9^9^9^90X00X   PX0S0 0SX0X00P0@-@PT! x0tS X R x0S\ RX0X 0X0t0St0SX@0X0X@0 0-L@PX0PS00 0U 0S0e00 -0LS@ ^ x x0Rڭ00C0 0X0 X0 0t t0S - LR@ X0S0@ R0SX0X0 00S0S  -L P 0 0  -L  P00 0-dL\0PU @0$0$^MPU 00TM0h#c#cg p-P@L`0$ 0CR0 S 0S  0R:0\0p 0M0\0p)M 0-PL@,0@0 p-`@LP,0ph 0-PL@,0 @0 - L M, (@,v T4 Qb0epP , ,|(0 S@0P 4`  "100 0c4 0 @X 0eP00e0,0p(,G40 0b0(K 8 p-LMH 00t0t0@T P<0 S$ `D0 N0S@Tx#cg#cP_9 -LM`@p$0S $PP0 N$0S\@000,0hX_9 p-LM0@SxPȐ 0R: `  40gN 0 BQ *xh`_9 p-L` 00 ;@ 00@PPp 0-LM@,0P00x0S h0XX -N0SD R00 0S008hg#ch_9#c -QLME hp0OO$ Bb!R^V )@pP]21C Pp, (P! Pd0S 0xx M0Sd X00> RPpPpU h 8g#c_9#c_9p_9 p-ZL" 000X00SZ0P#Z 0O Y,@`PPppYp `0ST0 P0Bc&0@0@?<Pp0Y;;@Bc p-L M t0Ϡ`$P ` Al31C0R D0 R 0P@`$ $P `   $KKpMb?B p-\0LM`PP0PHH0@^ ,0K(P $@ ,` CKp;g; ;g -LbLP0 LS@lQ RP L N 2t00S. U 0D  EL00CSL01SGUx00x040 0@408@0UL0 D0!0D00S000i)[pD0 7L0,0CSL0p00p0D!R/$0 0@$0(@0%D!0H+L00CSL0ʴU T0S t00t0,00 @L,00@H0 0@0 @<0 0@<0@@i@cggg 0-D0L # 0  !D D !X00CS0DP0S 000 @0h0gg@cDc -L ;x0P l l0@@@2\0\QT00S<<0 R@hL$W3$g@cDcgg; ;g_9 -qLlQU $0"  1 R/ H00CSH01TN*VP30`0SD G?0$1S p1PP0  !$ $ !(11 RH00CSH0[ NUP 0@P `W0S i>000 0@@0/A?0 1S \0PP0  !$ $ !0ig;dgg -D0L 0  !D D !`00S0 H0 R 404 @,0( hgggg@cDc-A" J1S 1 0<S RZ020CQ^1S100S^0Q:0P$0 -L@P00 p-0 !L$ Q$b1@sP 0<!0 ! 0U 00C0p0 #  1 0 10 0C0p8 2028 (("800 0-0LS@P P R000 u! 00C0ty0lgg p-LM0`P}@P P \-P Kp 00 0 0 ( $ 1K0 , $01KP K$00$00 00K P 00CS 0 00K P01K$00 $0 -LM`Pp Q B  Q D00BS 0 K0S@ @P K40K,@ (P 4@ 0P KZ  ` -pL2`0C8#8S2C P@U R 00 0 PU@Z@@0S 0202S' ' PD PA4 8!@ <hx' 00202Sg - Ldv`@,H00000C400 20  2$g_9 -LM8,0,0 @H{vPH tP? P<,0 2 0SOH0 `Pp@0 0 0  `t t t t,"  0@S`S  0 `S@ R 0s 08C8SN 0`S@40s 040< 8 @ `cVڃ ?`cVV0' 02@r 0W ' 0@' 0q A0 qAg_9 -LM` 1R/2P 0 p!, 0' @A Lt du@ Bt du0ST02, 0R0(K000 02Q0p, ' 0,P0' @p@B@BA  t,0! dYu@@B@@A Qs dJu00202S' ' p' 0 -`LpbPP ` 0 S  S0S<0 ``0BS 0-` @  Y `  -LlMPp+@P ` 0匀K0 0  0`0CS 0 V  KkV0P0` l ` -L `qP@1 00qW 00 000   Q$  0R0W0S 0WP( 40U  1 2 1 1s 0U0 P00 1 21 0-@ MLLPHP 0 @Dx00, @ ,0 $ 0,000C0YJP 垕 ]00Qp0 ZP圐 R00 000 Y40j@0 P,00,0  B 00 0 @,00,0  B m@0 a p_0Z. 8  <"!B$J0 j[00SHڈ!43C" cb @KSB4pK@0K,8 p@!Q4p 0 , 0p=)A@ -B4p 0 , 0@40 0@ , S X8 ,0R  L 0R 0@=9 =L H D0 4 d0R 00 g[s a 0#SP ]@ ZMb_9;?BQ -LM0`A8@~Zs|J 43Zw 0S pP - 00 040PP#(*80QU#PU 0S!0S 0,0 . @0  ,W 00CS 0; p0 U` 000 48 0(0 @@0@ P'}  ,0 .,00,0q  ,0 ",0@ R0,0- `   ,00,0<PpP @ .4.0QUPU 0^0S1ASp@kP  p-L@TPP( D`%0l U  ,0P P1

0p `0`0`,K@0 @P0` P 4,kg0, ~Hc -LMp4 8 @P 8K` 嶑P*840 @10@0!0P,0 P@8 ,K ,P8 0,0 B0R,0 P8  ᏑP'00K@ (K4K  けP`@Z`J,K ,归P0 ,0@T0P,0 ` J iP'00K  _P -L$M"0004 0 pZ`P Zr Z `l@Pj a(K00 ,!`P(0$0! 0@;00@,!0`P1 I ,!00`P0  %P,@ 00P,K  `P3`P;, 0h0b 0 R`0PA0P41<  Z Z (1#208`0 @S00S 0S Z ` P  0S* `x00 ,!8@di`Z$1 !S`#`3R0 0!( $0S Vj `hD`hXc@c -LMp" ,1l2 0 d2 o'pP (K0  !d DD !]c7? @ 0 @ \ lp hp p d  L͟T" 0K X L2 H" ?K.K K4q Pr q $q Dr @2 X! ( pPE<,D41h `r PP@T h"@ , Ru 0 p`2pP0`2 00P,K`e 0` 巏pP00K@ K41PQ@ 6i$P  !t l" 0\\ (ih+;rX?T"c 0  !d DD ! %i0A0S`r hR hR`r  0S 00S  ?< 0`S` 0A? 1 41041 0,41 ,, `Pp @T  , R 0 P00P`e,K 0` 7P00K@ p}?W{pypw<: RK(! 0`"00 00100h00`00>00a#6x0L! . L1H!0>0>00a#6 |0 <1K>0#60D10@! (Pd"08dd A4! P= ( QxDh$P  ! X\;hl" 0\h(((8倸T"X?q  0  !d DD !v?P\ p<  @]`@ H 00 L@KbK h2($P d"4 `Pd $ ,(ad^0P@h1lApa eT0XS0# 00 hdd2V/6d004@\\1dT40V@0!!d0D  D !!dD @ 0!!d0D @ D  !d" 0 !D 0 D  !d2 6l R 0  !d D D !@0!!d0D &D !!dr 1 0  !d DD !l 0R 0R ll ,0 0 d"l2P 0l00Gd"D0 s0@ 0@h`$0@0@0@D4凷@\5gl"\ 0d@ (,0S KP( p2K (d(Pd"D0  t)X?T"O d01S/ L R, ( S (41 +  ,1S+0D 0R K (1d010  !d DD ! S#p3( d2@aBd21C0 \  q 0R 0R0R0!!d0D D !! P' 0!!d0D 0 D !!l 1l  ,1`0 1 1l"0,O 040 P4  `V,X < K4K V@@PX/F8KP%l" 0!8P'X8 00040@4 00408 40 4$00$04  00CS 04 <k4 , <a4  8gc8P 88`h,$c/c 0S$ R(0(0(0 , R$0(0,0$ (0, -L@,f 00C0gD$c 0-L@P $ R(0(0(0  J 40P40qdP * %h8e(  e 00C00h8gg@$c -P@\LP` pP 0  !D D !@\@ |&h4@ @00$S$0#@0Y/00h| R 0 0 0 ,h -`Qp0,!L`a ,@T ,0S ,1 r $@T{ DP v~< S# )0SD  $0 0  !$ $ !Y1, 00Sp P #cH R )0S$0"0  !D D !, Y% HY/0400 $0  0  !D D ! ,YY/04000S$ P b\" 0 a5Pj ,0 Y0Y?  0S hP ia   @ `9 p-L\M0@ S`  K\0lK`+PP0SQ K 㢋P 0S Q lKP 㗋PKpP 0-@L8y4P,0S00 0040@4P[0h30$c<$c 0-LMPb@T  05@T 0 R404040 :ᑮ$0  @ီD0 `M0  !D D !  % 3<$c0$c^9 -0Lp@P , !$ $, !`0S T  T   R0000 0 $ s hX $0 s!} 000!L0S0 0R)0404040  R 0 0 0 $ : R 0 0 0 D  P0S0 0 0` ,@T% $$3W@ $pD0? S=C  !D D !H R   $W@$0 3h = t10CSt1N P#000 <+lt1S@02#4t1SD0 | lya?, @0S  00 p 0  !D D !b lQlD0 ^K'$0 t10CSt120S.,0Su 0!!D 0 D !!("(Y? D@ 0!!D 0@ D  ! 0 !D 0 D  ! i2 #@,r6   "ah0Sh ch0 @F2 R 0Tp 00,h|0S  V% Pp pP l'$ _kggUiL`9@`98g `9 -L  -LM@Q K00  㰉P u % l@-88 @2 1 0!0 c@HcQg -L@ R 0 SXPPP0Q  ,1S 0S Q 0, Rgg -`0L RP 0@@<@P @PgLc-00  0 0t1,000,a =\"$ 0l!(i -0LD @ $h -L`@p"`P @_L JJ^(! `0004P4D@,1 D Q0 D, Q 8, 0,  d!<R000D0 , D0D<DD@ɌD Ȍ8DD0 R0 0 PI 8%00d!<R000D0  kg0g -L$M@ D0 ` #>!S  = S ,!<800 -QL@M'0S S -$K0`@KA< Z \<  0I&@T   0d&P P pp0 0[`P@05f@ e`\PU`V0 0 CXgl$cg`9 -LM`x@08 K !6P$ K @" 0$@|0 @5```0pCAD0@P@$U<`KHc`$chcLg\$cTgXgPg -PPL3 0  bB&!0`xG01 SXG#0!B  %0#,i@BF Tڲ (0&]i|LgPgXg\$c -1L$MP`(!31Cp Y>00, Ã0ʃQ #0@S00'0,Q0T0a(K *[ e!>0 C6 00 6P@40  04 0P @@@PP" ,  Z0 0cC61᱀00@4 0jj00S00#00!P0eXg`9Hc\$cLgPga9 QP3-L@P`p:P ắU hf  _e(a9000 0 l10S 0Si 0- PL@Z0h0 Q0B0R+00 l R 00CS0 i -0L,!,M10 `l  P@p0 T  0S (K+@ D 0@0 8pK 0O+ < 0T@ D00~,<0S  ,#+P iH 8 -H0L l  R@0 00P00i0 Sl1 000i  0R00  ]0R  T0R0B080S880 -LMbp<0 P @2Pp8 lp (K)0  @Y2`00Dp00@P,P0Sprp4P 4 10S 00<000 00*  4, 0 tx00S88080<0 8PR00,K  >pPA,0SH0O 80M00@ 0H!,00  00000,P0 0  ݥ00; @pWpW<8  `0b 0R0@ b0 @ 0@SSTV[eX,0H0v40S4 pih!CeHa9P Q 0, RH0 @0 P,0 S,0 S0PggT0 L0 P 0P ,0 S$0ggH0 @0 P0 S0 SPgg -@LT )0S0) R Q  @T - 0L,1@SPp ` 0S ,@T$@T ,P 0SD0W00000CS0$@TR00000CS0 - 0L @R |0S0|0 R000 00CS0 vZ hrZgg - @R0L00 ,0S 0,10,1 -LPp`P@P' ,1T\ V HZEZ u ,q R000 ,0SL ,A0S0 00P@VA 00 @P@,1  V0  !D D ! `00!@ R00!p  q0 0100V 8Y0YS,1 000gggg p-0L 0 !@PT`@T 0Sp) @@T P0@0S0`p@T 0S) pg g -L@ 0@T @bPa9 p-1L M`P ```) l1@dAdQ0S 0C) D10 0S 0S 0S LP/`@\ R0S =PP PP@0 , !D D, !Z P A>0U 0U -@tL`,Q [ 0SX 0S 0S 0S PIv 0S 0S 0S P9pP\ /Rt@v`t 0S2 @P0 , !D D, !t P xt 0Sv 00Qv 0S tv 0`S -PuL`,A Q 0SN 0S 0S 0S P?v 0S 0S 0S rP/@p@\ QuPv`u 0S( P@0 , !D D, ! u 0Sv00Qv 0S uv0`S -PuLp,A` W 0ST 0S 0S 0S PEv 0S 0S 0S P5w 0S 0S 0S P%@\ >QuPv`wp@0 , !D D, ! w 0Sv 0S u -PuLp,A` a 0S^ 0S 0S 0S POv 0S 0S 0S P?w 0S 0S 0S P/X@\ PuPv`w p@0 , !D D, !u P w 0Sv 0S u@- 0p 0^0@p   p0 @  P`t0@P`P`x0@  ɚ;6e -l@L 0 0xpt -L M` @08@ 4P @P@ P@0 , D H0  S0 @ @ H @(K(1( R1! 0O@0 <@  0? 0@P:  0<8H@ K 4X%* 0@P%D0  0&H@DPT 0,@@ K ! 0@P H  0Hgʚ;; -L$MSp 0K< KH0K<KHPK`00K(4`@ 0PQ/N`LaD#b $K0K< Kb0(!@0JS######<# 1QE 0S= Z  1 ?Q 00SZP/ Q '$ 0f `. .  2x0 ?l0 d0 0S:0SPP 0` fQ$;;x$cp$c p-LM@(`KP xP SKp p-,1PLQ \0R00S0D!@TPDA 8@`T 0@Ttp00Q \ p p -0LSPp S# S P7Q  hP/ PP @T ` @`TV0S,1 h0 @T `@T 0 R ` 0,g0 S-L@- S SP6P D(^)^ 0N00S,1 0 \ )\ 0 RD1^ࠡP P P )D1^ࠡP0,gp0p-Q0$0P 10`u W0@0PpvJ 8p- D0 W_` 0@0Pp0D   @-Q@SQ 0R  0RT^P P -0L/Sp@Y0x!WTY  0 R /R0/S .S0/S N@`T:T" T' 0TPD/S 0u/S d@@e`d B@LT*0/SP @Pt NPT0S*00D d BL`F PNT?a9a9 -d!LRp 0CQda0S P@  50PS@ ,0d1 -XLp`@PMP0F @`T 0! 8 -0DL ~ ,1 R p ,p3 -`LM0Pp  0@0+% 00  $1, ,@KtBW `M 0,0 ;  0@\1`A K 2 1C0<8xF:a9p- D0 Y`W0@0  0ppp@-D0 Z`W0@0 ^ 0, R  0p@pp- D0 \`!!6:P#\Q"F`p*0pkp- D0 P`W0@0 p 0pVp@-D0   P`W0@0* p0S)d#$#8##$#$#$#$#$#$#$#$#$#$#$#$#$#$#$#$#$#$#$#$#$##@P`W0@0Q 0p@@ 0p@\`W0@0G-DpU |RT !W_`0@0^ ^h  0@0[Vc 0@0M 3^4 @ 0@0u ^b )^w ^>0G$S:#$#؎#؎#$#$#؎#$#ȏ#$#$#ȏ#ȏ#$#$#$#$#$#؎#$#$#$#$#$#$#$#$#$#$#$#$#؎#؎#$#$#$#؎#42W, $2W 0W !W_`0@0Y @ 0G)^$W *W W^ )^WW @ 0GvW 'T10S 0@0 0  G_0G<S؎#$#$#$#$#ȏ#$#$#ȏ#ȏ#؎#$#$#$#$#$#$#$#$#$#$#$#$#$#$#$#$#$#$#$#$#$#؎#؎#$#$#$#$#$#$#$#$#$#$#$#$#$#$#$#$#$#$#$#$#$#$#$#؎#$#$#؎#!E-D0u 4Qtڀ4Qo 0xW 0S  W_`0@0 44\ L(4\ 4\O 4\W00CSK 0@0 3\ 3\` 3\  0@0 3\g0C\=3\: ʈ3\0 3\  0@0 `3\: /T3\6 0C\2 +0E$3\ 3\ 3\W603 0CQ2Q 0@0 W0 2\ ^ʜ2\ 2\WW0ST h 0#40#"B L2P82\#2\ 2\ 1\2\ E1\zWx0SR SsT  0#40"!B 0Sh0C\k0C\ T0\t@ 0@0F WDWA0T!Q<D1\ 0\m,1\ 0\f1\ 1\81\ 0\10\ 0\@s 0@09 XT | 0#40#"B $0SQf f@oB@i$wt@m"Bwd gdt,`trtti$i m @t,@ht@~fli@Ni48i8 ^ p `@, 0p `@S  0(KoDX7Z 0SS(K0NS^9 ^XZ0S 0SS S0S0 SXZpWE `VC@TXNZX X X Z XZ0SX`Z^0S[ 0SS SU0SRXY.Z Z KZ (ZQX4 X X X XxZ p `@uZ ZZkZXKZIXNZL0SI 0SS SC0S@oXZk Zi Zg Ze Zc Za Z_ Z] Z[ ZY ZW $ZU ZS XXGZKXBZF Z CXFZC0S@0S=5-Z2Z/X `a9 -@L$MDKp  D0 X`W0@0 0@8S Sx  KhR 0 Ki6 0SQ<  @(R(0 Ki%8xF:b9(b9 -@L$MDKp  D0 W`W0@0 0@8S Sx  KhcR 0 Ki 0SQ<  @(RR'0 Ki8xF: :PUp W_`UpV@TGPt pWX@,GP2[`W0@`  0*p[ P`0@0!Pʌ pKUpV  W_`0@0 @dGP6 pW_`t0@0  W0@0  0@0 U pW_`X<,@G0d0p  <0$8 P*8D  + @8T +  0pG4 0S P Pp@0T P 0PS @PW  A44P00 S/RR 0 Rp 04 /RQ0 0$R $1&CP  30S 0AP`P`p+Vp@D8t @GP P`\V@GPIVc 0@0I  0@0b 0@0+@8 HGPe pWX@FP#Y @6GPS W0@0 $w@FPE P`W#@pF0PApA0W_` \`!0p@HFPp( @4FP" @$FP @FP 0S0S0W@FP @FP @FP 0S P`@ FP 0S0S0S0Wrhb9tb9|b9b9b9`c9b9Lc94c9b9b9b9b9b9c9c9 c9 -LM0SF   +`,0K[p@P=V4 0S@p.  VDPP 0 S00 R =P3 0OUp 0@S+W"0@0D0"P @+Cp+<\q` @D06D0+-@W?PP0"`U@` @Vpii0 , !  ! -@L 0@cg0 , !  !-|!X0"0CX0 R 0 00d  0  ` R0>X!00X1X!R|g -|LX00,X0!00 @dd0$@d@X1 T`@00 V06p0 0 -L MD1P @8p^@ >(KP 0 0 0 gPT (`K !gPW  0 81$0 S>"(( 3 K -L MP0 ER@0`@V U U; T* !1, 0 $ ( 1$  1$00$0 1$00$0 1$0@0$0 U $0,K0$0 0 0 (0 Mg@PV@ ,pK f@P @ K 1$00$0  1$0 0$0  -0L)0p0 .!D D@.!PP%!D )D @.! , !$ $ !|0 Wh%X0@P `0S 000 0@@0gg -$0`3P0# DLp!0@3PN = @@0  "! !  "!0 1D D + = SN !(2R.,0S>? D ,1 R8#8Y/W0m U@a D  D  !0@3P@R 0  !  !2G D D8#8Y/0Y/B0W) @!VD  Y?P  @0@ h0  "! !  "!0 | DM$cd9 -LMpPD`R0 Am Z @ D5 Ay 0  !  !,  0  ! 3 !0  0  !  !.!$ %$  !$00Z00S @T T @T,0Ss t)0@S Sd S`n V (Ko Q005; H0QP  !  !(K0 1 10,0 1,   D1S0D1Dž ,1 R 0,0 0  !  !j$3l!R 0S  RGP RC $  1 P92 (KoIY )0S$0 D  `h,p3Y00Sk0P00S`U @0  "! ! !("(0 D0 V* YT 0!!$ 0%$ !! , !$0 3$0!!,0SD ,P` H0S` 0)060  !$ $ !`12S201Ņ$0 j 1gP0  "! !  "!k00SH0Se $0b < _ 00#!001 00#!$cidg - L mN i Pp-L`P @T U  D0 V@Tp P-L@wP  h S-pL ,1@T< P,0SD0 h 0S  P X*@TZ# R& GP& @T @T P,0SD0h P X   0,g -LPp`P P U 0 R Q 0S U U U  hlP @T0P \ 0S U U U @T U  p-P` UL@0P PQ (1S p= @ @P  0S ppUp }p@B -0LpP`P U`T~@P`  &P` U Xt T  0h 0h d0h -4a@LTPpB U!T!T = D @,@P  0S  !@P $0c P  U t T  0h d0h 0hP @B0$10CS$1000<$g 0-LP :0J/@80$10$g 0-00L$!PR @0@0 -L M88 0@ $J 0=Kg#d9$g -`L00@P" p}9 0@#P1 ^1010  !!!0 ! !!0P1 1P 0R 10P0$c -$0L@S ?0D   10 P Q$0 0  !$ $ !P1Q 1$0 1|1!D Q 0D   10 nP0  !$ $ !0 , !$ $, !$0 -LMp 00 0K 0 9PP 4K a`PE,1PPO0HL 13`Q5 0D   10. P +  @0 & W01 B0 !   ! 0 Q` K a`(K00 U#V#J 0: ` 0Aឍ004P/1,ȟ@Y P`v0S`PxPBɚ;cd9;; -0L@T D0  0!!D 0)D !! 0 1  @TD g -LM@PDA ~`01\`XTaD0  1! 11  (Ko !0 000 @ 0! 0 , !    ! !00V1 0!10101(K$c p-L`P0S @ T0p >@T R0000 0  R0000 0   -pL@` PRP W` P 00  00S00@ P0-LPP@@@T: 0P T 01 R0D00Bd9 0-LM0PS Q@ R  R 0A@S0@ 80SK` a`P  0 B0 00 0@@ 0 @8S0 -0LQp1p!WP4 0 0CW , @ R W`1`!P$0 70S( `\ 0 f0 0 0pf0@ fW0 @  P0S  s` t_ g`UiQ -L@M0P@00 ,@ IPL #0S 3@T H p LP0S +7P@PTPHP p|3Pp h  \#`PP H  K0B ,R ( Lş 00ş 0 5  4` 4{ 7ğ ğ hğ {LD@ PPr0So |4m-k 4d :^C0(K ( b(00Pß L@ P00R00S? l3;`C K, @P0 R- 0S$ŝS 0 ,Q A 0S͠ 2  2 A 0`Ÿ A 0`Ÿ PkϠ 1 0 0 0 t1 \1P 4   0l$~^gga0ici4;4Oc8;h@$c<;(clg)c,$c-c48D$c ; g(ggMblh h8gh$;;h )ci0gg gg$g(8.c(; hht h08%c/c-c -L@M0PS( p$ 0B S@$KX`K!pX@P 0@PX00C S $4$<$D$$L$T$$$\$@P -@La P (K KX@PP$ 3@P 1( H  a R* @`````` 0<|@P!(0 (K0 A pTK0@Q  {8|T Q  X@p#(%cUih.p&%#@z1P& 00  RT0; DKPPpK8 PP4V4aOn8KrD @0 <0S yD0K8PK`< 0P `QDP @` < 0P@`=9ADP @` =C<0 0$K0<N @ 0?B`(c -LM 8 fP&Y  4K% 00-| `p04` 0p o| P, #4K  NPZ 8-P (K 4K \NPXP400,0%"O04@`00@=)@ -40 0@ , Lg@B -LM@pTP $`K0P K N0PU0 0P$@K N0P0 p-L M`U $@K t% NPV   yNKp; -L T*p 0!R30,00Q0S Q0!R 0S S0 R 0Sʵ!k #8_$4]$0[$(X$$0T  R$`h9h9hh9(h9h9h9h9h9 -PQL 0 Qp0S" `0S 0C8S 08J@08 J 5RZ 08Z `0SD; -0LS@`p50S&0S  0PS)0U 0S P  㭽Pp0S00S0|#0p#0S X #p0 4# i脽"(ch9h9~9(i9h9 -QLM0P0 4 ,0 (  0 Qp0 $ R 0  `0S 0C8S  08J@ 5R 08Z `0S`0 R , R $0DS 000",K4Kb";(cDi9Xi9 -LMr@ὣ0S 1 80S00噣X] 0 QP @V ` 0,0 Q0S00P t@@00 PJXJ D d"Y   !0S  0S V 8CR0S00 S00 0S ?,0 pW00CS0T P<(KP 8CR00"tg(cg9xg|i9;pi9 -@PL` pP  0hZV 0!(c_: -LM08`, J|pP4 ( 0 $ 08JE00C8S0P4K08Z,Kx ;; p-`@L PP  0ph !pi9820P#! 00"8Q#(p@-(0 S<3(057<@ @00@09780<S3 ; @@0@008<<7P`@ +7P`@ :00;@0$TP7p"pE-`p0S S \^V P00@ @Q u00 0 0S`Ru00 0 -LM80PSD`= tpX98Y (@Ġ 00 ,0 m 00 ;@ 00<(K kP020P`00 @$"X W Y 4POT 8SD4K80XW0  0 gggQ S 8Q20 R  \  \ | 0 00|  | 0!|  R  R | 00010|  0001| 0  0| 0< P0S 0 SP}c -LLP @0 R 0P 0P RPg -LMp/`P@P (KP=; c0K  P 00B0 S=?( K Q02\0A0@T (0 0 S @ P) @TX \ 00 P0.Sa0I0Sa0B0SW0BXg9xF:i9 -L MPp`+ ((0"4#220 $04 D,K?P 0 @x(K, l1_Pl ,0ͦP 0t ]` ,l1 Y,0< N l1,J,܏ pi9iedA$j9i9 p-LM(PK PKp(0[S  00C0 S00•0S@`Q @@Q P10}c 0-0L~M@Kx Kd0kPP0^K0 @@0@0  K0XS QD0 Q<0 Q4+00K0븧cp"u-lj9X,_:Pj9 -PQL`. 00S`S%p0@T@T 0S P00SxP020$ 0440apCWPE@xg -L@P TP0@T @T 0S$@Tj9xgj9`9 -LMx`0  P@T $0s (0q @TU 8@K \ HP RR< ,]}1((00((0000QV ǟ0#4PP0 7@PK$88@#D0a'$B( ,0KE@P VPPpT00S 0S V 0Sc 0SJ H(K R 0S(0 @ &P0&0T0U0SxƟ0s0Sh @pPP000  " 40 $46 020$ 040 0 6 %ş00a5 0W 0S" |$ %0#(("#4@!| ,40T,((0 "4#Q r  <0R05 p J5 "88 #$0a0""p 84 "88 #$0a0""UpKV 0Sx tp ㄜ@g[Pg4P 0u03V0STU(0K@E0^*S@ ,K0 PP 0S$ a3\#  YW L@g#gምTP X,0S] S7 ,0@"00䂟2TPPp,K 0NEPP Pa 00K0P 0,S0 0\ ,@0 L@T@T $0s (0@TDP , ((0"4#220 $ 04ă\0 l `@P 0dP@ P`V  `P pW (0 P @ QP @VPP|,@ 0 \\`@P 0P@ P`NgggЧcgcL9Hk9;j9cc8k9i$k9k9`9j9j9,y99j9j9xF:9k9I:j9<90k9xk9k9k9⍸t 0-P@L{,00S,0 0h`d -0LMp80 < e,00Cs,0a 4K4PK`d0,l PU`QMJx0pL1 Ppt x0@ =9@pt =Cx0d0Y*<0S /PP`P`80 0@80<@PPT`8 *qs(K /HP`P`00 0@004@HPL`@0 0@@0D@0=@P` ?B l9 -鰀L0`S Pp@0@S 0PSp0S P`p@00@S 0PS  0  0݋mcOcmc*\< 0S!  0@  i0 0D cD0I  Y4  0LS@0!*P: 0E40R\!: d0 R00S,0R0#03P0S<08  , 8 0 00j0 @R , q 3P R] v @000@0!mPb (K@4< E>* W?: R e 00 R0S8,0R0#03P0S<08  , 8 0 0@ 0  i0 0D cD0I 0Y40\@ * W %0 :4 S R!*0 80@< @ <0@4@< 8 0 , @#40 8 , l9A-(p@p,@ P$`(p,A -LMpP`@P    0  K -LM` QPpA:0A @T<P6 \B  T?: U 0  T: 0U Q -  2 U: 0S+P0pe000 0P T T0S*@B0ep0 R000 d ]#l9 0- LRP00 @M @T0@B0 0 0h -LMAPU^, p`C ZQ  ,0FS@0$P(` 0@ F,@ ,0 0 BS0 0R 0 0 ,0p0  0000 0 (KPP- p 0S00P0P00 "  0Z0 0    ުP ,0@p @Z  ㎪@c,m9g0 -S0  R 0 Q R0S0 S0000 00Sa0 P00|g@-D 00bO 0$@P -L8MPP 0`0 0S R@1@# R/ .K  |T .0[<SJ 0 8KD0 @0P8` @ P0 L@ HP 4P X T < J X@K  0LpP 00CS 0" (K.K 2.pP 080 0@P0 L@ X @ H 4 T D < DY0P9pT- [00B0 S 00B0 S QX@K $Yp>R0SPc`g8m9 -LM i -L M0 K0 0 K -L@L R 00CS 0 $0$ g|gg -@L 4 R00 0S00h1g -1Ls@ 000 @00 D0ٍ 00@)cgg p-1LMQPL t1Q! l1Q d1Q` `x 1Q+ @1Q81`  x0`00,00  x&`P K5R`P@ R 00CS 0 00` ㇍0 @aɎT0` @@xPL H 00``0000x'}flvt~fwt@ggg -l0L RX@80 D 800000 r0|ggg p- L@`7A@P <0 S tpm@pgg - 1L @P`p\ 0-`P LH 000\  0Sb 0b Q@1 @!T `P0Q 0Q`$#`ggP, RQ000(0 0 , R 0S00CS0,Q R000 00 ,Q 0-L8MP@׈xP\00S 000$0  R00# 00$0$@ QA$P Q& L0 80C PL0 @T |1|!0t!040aSHᐈ0S @ᝈ;ᅈK00001Q 004 0$00  0'lLK$@ P# (0X 0T:d Q00000$00$ $$ D d t)c;gm98m9 0-L M 0@02P 00#^ 0#^002(4x0S K0,K0hDd (0Pgm9t8 p-L0`@T! @T 40RP 40R PU |0| t0 40 c R ه @T0<phʇ)c)cx)c;gH)c p-LMP0 K 0  ɇ@T < 40`Rp00 V @@ @ <04 S`H0@ 00bS*ᓇ P R0000  0 M PKp -4L⇢,0@T  @Th菢)c)c p-`PL@v00  0@@ phV 0-PLR 00CQ0! QU  0SpV@T K3@T0 0S 0 00 0S0)cg)c 0-@hLP0h -L MR0  04 0  80 0 00BQ0Q800S@ 8 0Sʠ0l,0 < P< 0f8S8pLpZpj < 0< 0 0 $80,, @\ 40@d08 0` 000 P00WX 0@@ @(@<@0@4@xpH@L@|@@@l@ 00fp0P th @@@@@@@`Q嘆ᕆ,0^@0# 8180呡0000T0 R? !0S 0 00000(Ko葡8pL < vP< 80R D1 Sʠ\: \l 0l8 ,0 c\ \0 8 l, [8 @0ʠ8 ,0 U00g@8)cg)cg n9$)c0)c<)c(n98- \ 0Q|  @ 0Ug -L MtptP`@F ` 0 04`V pPKcgDn9p8 0P \|  @ 0&g -1pPP0 ` U00SL@ 00S@P`0U00PWP$A WW V 0 RU h0\0 R P0 !PV  0U00hc)cgg -RL\M !|  x pD D p h PH p%PP00mPu `0  @p d0 \ X0 l pp l 0AZS_x$H$H$$H$H$H$H$H$H$$L$H$$$H$$$$$$$$$$$H$H$H$H$H$H$H$H$H$H$$H$H$H$H$H$H$H$H$H$H$x$H$H$H$H$H$$H$H$L$H$H$H$H$H$H$H$H$H$ $$$H$H$H$$$H$H$`$H$$$ $$H$$$$H$H$$H$4$p0Z0p0  D@W00 S} | z(K>| rd  d d0  `0X0  \@T \00dQ00(Kd h  R^ (0K2h0 5:Ra x ]pM\`Ph@ X0U  SL  L d@LL dt `L @bTZ D W00 S 00 |  @DTXQ Z  D W00 SX@@ |0  tP @eTZ DW00 S000 |   @Ddd d  ] 00` X d00d0 d  `Vz-@Pu`X@ u` @ b` p0dd dYd  Vd0@S 0@8CXo@1A h>0 ` l@Ph d(Kl 0Rh@h0000d( K(Kch@  d\`P\d1d .d @+ 0@8#X`@+dd d@ 0@8#X`@lP P?Kh LP ?K`@X` 9X Rp0p X p d00d0 {0\` p@rd) H `d 00d 0 d   X X0 pdd Up0+X Pp0lPdd p0 d d D@@0p d0 0d0 ;0\h0 h8\Q@h  \ 0P h \0PbU\PL L őd0 m T P  `  0S S S`P@T0?K0(@+@?D Ru Zg D W00 S  | i @0P? K@h LP ?0K\pd @ d 0d ǟ@xX P` H d @l ]d\ǟ H bd d0 d@ 0@8#X`@Up d00d0 l00Lp!0000L Qp l `0 p*P 0@ \l \ p00P!0l 00A 0 \?\0 p 0@P`@0@Po@0@P`@ | @DAD@W00 S |  hh PU):h0Z| `L @bT:Z D W00 S000 |  @D0| @D%0| @Dd ` L0@cTZ D W00 S 00 |  @DTP | @Dd Z[ DW00 SF |  X| V U) Kh %(0Kh0 H  %2h >&BbP`h (0Kb1(@K 09P0 0d*PQP` @Dh@ h (K00b0 P0@P`@]000D0S  Rl |@ . | 0Bl| =d d  d@ 0 8#8@T0 P@ 0 T P }|  @xQ pT0P@0w `Pj  P@ l@2A \@QTK<@00` !0@0^S!0@0^S^<,Z9 DW00 S |   !0@0^SD@W00 S |  !0@0^SZ| h4PL \P?L0 P@T0?K @I| PT0?K =^ Z DW00 S>00 | {p 0?@\0 p n9Ln9pn9hn9xn9`n9l9 -L@MQ  K" 0( K 0 K(0 --0 L M0CQ0  0( K  K0 K( 0 0-LM@TP8 0P40@ R 88|)ch --LMP 0 e,0@ R K{|)ch -@LI: -L9 --LM 0 7 K --\0LMl!D0 ,1 Q @@ ,1  0@Ki 0-LM@< +PK0@ U+[P @ P> K09 -p-LM `r~ 0@PP P00 R0PP Kp|g -p-LM@ `O~P 0@@ @,0 R0@@ Kp|g n9 --xpLM0PSd0 P `AO L&P 8 ,@ 0@Lh)cn9`9c -@0 L( 00CS n9)cn9 -LM  0o9@-0R0S  c1 #880S$H*@!< @!0  !$ $ !0dg -LMP`RD0#40#00S P!RT b1L!#88P$H*H1pK@ \P1[0 1KP { p- @LTP`T{p ~} @P! 0T1 H!0L1{|~ppE-鰠0S㨀 p嘀` @00 q0 pP A8Pq 0S2  0S 0N0;)c)c ;)c, ,0,0Q0 ÷ )c)c)chh-000 \ 0   )c)chh)c@-p-\PP0\` @6 0L0 \S8\6  ^! 0L0 \S\ 00La L ^ W0LRA0L0S7 L^V0#02S R0a00X\x\@@ @-paLQP`ࠁ@@@a0L0S*\0 0@0 S008C8!0000@ 8 R#8 P P PP@0 -p0E L`0SD$8$,$D$,$4h,h}$hzhv;_:;|8t5l2d/\,T)L& p9)c_: 9Lr9`9 r9q9q9q9lq9Hq9$q9q9p9p9p98p9hp9 -LM0 S S, C SA S?  R R  08 R R#Ā0S*8@㰐pChP08#X(0BHT}Pp0  8P#08#X(0BHT 8C8s , 0)c; 0-xPLq h0 Q 0000DE0@40@0QTqT000)c)clr9|r9 p-XP 0P`SL @800@SP 00p)c)c;9 -d`dP 0\pr0L0 J@0 0S8P@C 00 ;)c)c 0-0d L(\TPPP0@ P *04 00r9@h)c)chh 0-t1L @R ` 0S34$X$4$$$4QT(1 T0`!10 0 0c0C1 0S*0h0h0h@a@Ve0 0 0c0e})c;)c ; ;r9 ;r9r9o9r9o9r9 0-t1L @R ` 0S>$<$H$X$X$4QT"(1 T0`!10 0 0c0C1 0S/0cd0U:c0h0h0h0 @d="Kpz0 Lr@@m8j)c;)c ; ;r9 ;r9o9r9o9r9r9s9 -LM40p,S0 @h, 0' 00 @(r 0 P (r @BVW 0Rp,eQ sQ dQ ,%Y h00T 0 SW@@A)c)c; ; s9 p-LM0P S S` S S S S 0 S S S S S STx@K!P @ {x0 S S x8s9o9 -LM R R00P R R P R R  08 R R# R R R R  P R 0S@8@!Cx`0 08#h(0BHT(P0  8P#800 08#h(0BHT0 8CHt Qs (K,`K!GPs ]Z)c;o9Xs9 -<3L M `RB$SP93 P8CxnTNT 8UC@4yTYTYTyT#c0B0c10 (K !!U,00c0C!,00`H (K8C nTNT C@yTYTYTyTc!2Q @P' Q 0S$ PZD P0 s 08s 0pPA q@4p  0@ !0 8s qPC!T08s0(K0!!,H,0Z0  <P 04 :P00 004  Hv)c)c ;ls9`9 ;s9 ;s9s9; ;;s9o9s9o9|s9 -L8cY(Cx02B  $"0`S/ @P 0PS( 0P0  [PW WV W0S (B(00R0S wPc0ISF%%%%PQ0SD@0@S -PWc0ISX%@%(%%cY0    0@00+|00SS P@~)c; ; ;s9)c s9 -LM`p (@0 S SPP S@S(K,K!P0, R ڜ?P QPqP |2p 0 P,00aZ<f 0s9h h)co9o9;s9 -L0MȠLK8 LȠ`CxT #3 Q W ß0SأP @$0 @S P0  \$0PPS @U ,PKpa 0Pk,@t H# T0(i PKtKW,0sq aT,",p RP 2"PP@ PE U @D2 |B@T`Ÿ 8C8s S<2 P(2\ 8C8s S1 PP!001 R$ @p 0S# 0fP0  P0S S0WpT(KH@,@N0S @P 0S 08P0  P0S S0UP p0@S 0S 0P0  P0S S1pTA)c)c;t9t9;; ;x ;`t9t94t9 -LM0 S SPpp0 S S P S S S S  ` S S `0 S SPဆ0S @@0S P 2P@0S@ T T`` TPz1 0 L B*R%%%%%%%%%%%%%%%%%%%%%%H%%%%<%%x%%%%%%%%%%%(%%%%0 S0` 0$KT ,K!P, 40 T ,K& K(0K@P,"[2[@0@ T ,K!Pt,  RR@@ R{P40 Tk ,`K!@P,E0@ Tb ,`K@P,d 0@ TT ,`Kq@P,e z0@ TB ,`K!V@P,@0@ 000 T*0@ q/000 T? C W000 zß#00s03S0I000 lD000 gT0@ b:000 ]50@ Y10@ U`+0@ O'0@ Kt#0@ GR000 B,`K!P0S ,0A0 0B0 RS 0B0 RS Rt R R R !P,00& K(0K@Pf"[2[,l0@ !@P,0@ !@P#,0@ & K(0K@Pc"[2[,H0@ & K(0K@Pre"[2[,80@ & K(0K@Pbd"[2[,(0@ )ct9)c)c;\u9(cxu99|u9u9o9$u9<{(4LP(P >hmu9u9hu9N- 21COc 32C8W tT mP #T T  㰦8 -LM`@Pp kP  0 0 0P pVK -LMpP` k@P  $0 ( 0 0 0@(0KP@ 4 K0Q  0Q0Q  1Q h0QD000D000PL0L000L0L0}f~fs s@-<0! rH r<0@0  ^0 @0  4*cD*c<0! rH r R00 0S00\ R00 0S000-<0 H@P @$PL030\0SL0 1 910T 3 #@-<0 HQ L0 !0@ 0$@)! 00b@ S3# 0$@ -L M$@ T 0KDv9 hL < L0gfff-\  )0h SS\0   ht hR  Rx0x0'' Q Qx0x088 RA -0@L1  00 ( 00Q p00  (00H >1>1>1t00  |0S0 0 0l0$0(Qt h h p-QL M@`@00CSI%I%I%I%J%000 P@Kp-@p0h0`0K KL0 20埧 @  hx hl h ht h 0->PL U@:h0h p(h lHh hh00 \ @0H0 0@&0 U;h00U:h0 ht hlL% 0-LP 0N᤯P.8CR0 -@L`^eVpH l10RUV hp t0`0t00|H0U l10 XH f fi;lv9 0-@Let0P0t00hf p-LM@eP`H0St0t0$ 0  0S H0St t  0  0S 0t0H 0tPP fx*c p-`DLp 40l#"B PKeH L00bO 0$@H >RPPӆfp1P91p<Ϡ.,0@lEnb <@K00H@K0 @P` IJP0 z0 ,0Rvg:D0dqP,0R:$0 hH0K 0@H0 D@ @ P!D88iQxv9@KLɚ;@v9v9v9k_kw9v9v9v9 -@Lt0 | xhO -.H0LS@ t0h0t0H=9 -t0L@@ 0  P H_Pt0@0t00 0S Pt0@0t0 - L X_ X X X - X00"# 0@d 0 d H!PT#0?0S W%U%W%U%W%U%W%0r8#(.a0HS H0 `0HSsdX%W%W%W%W%W%W%W%W%W%W%W%W%W%W%W%W%W%W%W%W%W%W%W%W%W%W%\X%TX%lX%LX% 0 .0Pc0> cpH  P``0O0@d  d @d>V0 H>{  0@d 0 d  H P 0>eHb 08#(08,!#8 Q0A8#(}zA0H\XSNP 0@d \ d Hw Pj ;^P!P(P'P)X)P0 l 0@d 0 d  LHU PH>SB >x h8`C: p-LP@{bt0`   U ecp0 cp 0-t0L   % P"20#0 P0S  @@T 0h0@T00 P0S P ^T @^? -LMPP b(`$pK @P $ @P` @P $ @Pt0:t0Ac0>0> p-`QL@ Pd aP]Up -LM2@0 SP 50 ^ B?@0CS+1 ? R  t0 ! W0N>N2n @ :t0\ 8CRat0 :t0>%`(pKⰎ > PP ( S PP0t 5*0t b.8C8Ac Q.PPQJPUZ84w9 -LM0pP,2 8" `4r 0r Fat @ 0  82$$$4C0 xb02S 42S Kz0(Kfb#0l, R VQӽ 0H0S8V` V(ڠ\#?0@ @V; .H p .` . 0O0@d P d `l pʨ0H0XVQӄ 0H0X`H0@X8"xt0p"0t0h2HN7P0`FpH0X`H0@Xaa Qp1|#K  ᛠP0 p!`04"R S4"  10S  p0R p>SW pѥ0B @Q Q Q P1W pmD \ |0PY 0V @T00!P 1FM0S-   0@hP0 &&%a42S,"Q#0 a 0" a# 0" 4K 0" *ci8x h*cgi`g*c *c p-L@P`` (Q+Q%t0 >;.t0.[3phGap0t#40#"Bp0t HQHP z6 (3 Q HP, .hzt h h -| @0S00L>0 Q>|  00CS0 tBtcg -`pLpb70 㨀^@ `  0@D  D 9@P ✠% !,t 00S t PWP|@$ o 20P=h t {RyW  b @h0(PTh ?R](0Sڜ0  P HH Pt0@tu0 0S Pt@tt  p [ t|  0S- 0S  0S 0SI 0SW~ X*| t p 0@$  $ h0 t@0  th0@t t    0R40,50t o pG0 #Y!   A0GS p0S P 0S 0SM @T T   t@(0 h0S&  .H0SNtp  0S 0SWt W W@ p p(0 S|PPvPY T 0S 0S 0S >08#8S>>>t  ^40SpSn l >(B8CS@1@#Td@DT]0p  x t  (Wt{pp !W|pl 'W`pi *W X?0|S W 050;,(0 0S050,| tWtW   ^tɌt z Tx 0>(DxW 0S **tWW9 tl 0W*tW   >Rs kQe0>t>tW  |@ P0 P p p P P 0 @Pp0 P P W 0@0S qtt/ W   rt}\Wˌtx5op0̌#40#"B0t )W}p ^W~p  R @0S>&| z h hl h80S8\, v 8 O8ᒰ80S, ~8剰0p^\#ppX\pi;gfff*c*c`g*cTT% -0L@  (0 P0S0 p-PDLp# 40#"B `Z@ $\0 t0191p$0Sp191p 0S0C 0 00003!0 !00l # B,0 000-0S 0x 0 QR BP0R 0P R00c!0R#<0c-H0P R 00c!0R#<0c p-@LV`Q@# 0 R00B0C 0 0 0A00P0Q  00b0<^,00\00S0 0@Wp 0-@LPV0S US 0S\ a aR QPb0bU00S0 00hW000 0 -@L`zVp^P V  0 PbU0PbW 0 b PP 0eS0 1S00PS0eS0 0PSW p-@L7V0`SP!  0P0Q  00b0<^,00\00 0S00000CS00 0UWp -PL`VV@.Q@*pQ% 0S a0 aR@@   P 0ax0 0S00`dd0Vp@hQ  W -@LP > MqP 0SB 0 S B! >lqV`0 0 0P  pUB> Xq -pQLP@p1}U Q( Q* `0Q! 0P ` `0RPP >`P  0a 0 0S 00pe 0WV R 0   p-LP@5U `R4 R0S) 0 0 0P \  a 0 10 0 P000  0UVp0 #0 00  V0BVp -LMpT0S" 0S 0R +Vp$K@@KP@K $KmV00l! D0 ,1 P ]i@-D0@ ,1 0S  0@\@ p-LM`PD , @T Q Q0 S 0  !D D !Kp`\at -Pp LD0` ,1 @T  s^ 0z\ `]` -Pp LD0` ,1 @T  Q^ 0G\ `]` p- PD0L` ,1 @T  0^0 [ `_]p`p, P0S P,,c -L@PP*0S( BT 4P: P0-LP@0P QT 4Q08C(R0S T0SR\ 0 -l0LPpU` @T * \4@0  ^PU,,c -d0LPpU `@ T*$04@S  RPUhB,,c -d0LPpU `@ T*(04@S  RPU}h$,,c -LMQP@#P P CP U Q4Q0S0\ E 0 $K*A$Kmx p-0LPU `0S@ T* 04@S  RPUd d0`S00T0 L0 %<< !d ph`,,c<h8c% hh c %( ,0 S!0Rh<h@-@P$ Qࠡ \00 a0 0l 0^Qʲ1 0 a0b0  R( 0 0 R`0 SQ1 a 00a01 a 0S*cPQ- ^0n\  S ^ 0n\S1  T0S   D00ccD 0b1  T0S  0  b D P0 0c00000 S 000-^\ 000 00 Q 0 S00 00C0 -L@ -L M@04KT` pU@ P P@p P U@0S 0, 40b0(K008 p-L`@PS @Sp 0-LPS @S0 0-PL@S 0n0hS 0-LPS @S0 -T0LP@ `STT X HX X0TS1 01$SDPL H1 01h,c 0-1!@T 0 QLP!TT@T0XX@0$ST0T0T@T0XPX@0h{Sh,c 0-@LPoS P0 -LpP`A @A1 00100 P1D001 DPD| D0-00@1L0 C0@0 -QLM`  p$R KvPP VU 0 @@cV@1 `d0 0 VpP  w9w9tw9\w9 0-80!@01LP0 0P@00 0-@PLP R100! B!R1P T0xU1:11 1 @,c h h 0-L@P@0SU 0 b 00 0PP 1  T0S 0S P00 P-L P p-@LPR 0R* (qR`p`000hRVp)Pp 0-@LPjR 0R* NR0000GR0 0-PLP @T@0 -L M@KUKXP 0-LPDZ@P 8)R4 1 01RQ0h0 h@,c h -@LPT`p U6PP 1P 01DP,0P P0H L`X@T@W@ W@pP @Т% p-@LP`. PP<  R'000 041  (1 D Dr1! 0D !X@T@1 0 1 p17pD Q7p P 0-LP\ P@ L@QD 1001qQ0 Q 1000 h@,c h -0L@T`PppP  PT  A1 @@E  0 -LM`P PQ@ @ R*@PbTp1e#Zp pP  0j0  - DDf0  0 P0 pP  ~P'00h00,0 Z  0j0   0   P@,0p08p -LϠMϜp0 zQ10 K0 `Po W0,0 ,@K`DD0@000|00W  pl 000 S0`00 WDV@ @PP= Z% 00 0bW1! % 0S +f W1! 0  00b\! 0   Pd0Wp00 W,(K, ʚ;w9w9w9 -LMl -LQӻRQ`pP PP 0 \@ @ 0S*@cTS5X yV 0!0 00P0000f0gPP" 1 `000 0X0j 0    0S 0S00P 0PX > -LM Q-Lp@`8+W 0 0g 0 1000P% 1 Q PQA @@AQPQ100D00 0g0 `` p3` x9 -L@P   -L@LPLpL[n <0Z@ET0h>h(;t,c h -@ ML 0@/!N0R< 0@`夠p夀P0@ @#5  00$P(U`$Km08B9 , #0,0 @p =i -LM ,0 S0 R< 0S  p ,P0S(KY  R0000S@  0 @ R TQ  0 R 0D0 @<0<0:0_AP 3S  0  0t03X0S 0b 0cP00 0 R80  0 Q \:P`dX00S0PpBY, K4 ",0 s 3W R2 0d0  @40pPP, 000cX 00V00S5 4P ,@T) pPjX00 V0S 0 V@1@!T@!R`d+1 00S ,0Sg  X@1K#`dpP,@@@@ <28 l0R0 , <0  pAW,  X V00SpR@F<8 #8*  0< & XWA(p0% #p0 , 101@0@:0  < R)A'p0+aX@1@!`dOppP  $ !< 8#8 ,z0p:0AW A9p#pAA p0<ˈA#pih@-<0  0 `0aR  $  1@91# 3S @ 0 00  80@S @0@ ?SR40S0 000R33    00330(0 (, 0 Q 0\  0\30C3(Q,0,0,00(, 000 30C3Q P0 \540 R 0 Q000-c0@-0PPL@ 1NT: PL31CPhP%: 2T0TD P0L20P000P00hQ hc P-LP 7 -LQ@ 00 0  c 1SS 00b00,C 1P00c0xP0S 0$0 0 -L P U`6ppP U+21@ @ C   0 P?py9 p-@LP`P`UP? QA0Pa0a0!RR 00b00,C 1P00c0UP` R$ p1SS 00b00,C 1P00c0P 0S ` R 0S$ pV ` 0e  000e0!RR00e0wy9 -0LS@ 0S -L@000 -PL@`pP 7PP 7h0 S0h00pS;0S\` p-`RL@PR 0RU  0 R 0 `0aR R4P0S2  0 1SS 0001P00S 0 00!RR 0001P000$0S`` $`ppۿy9 -@QLPpc 1 `0VXR 0SZ !1RK WR 1 V&@ @ 0p00!RR 0000!P000!0 !@TX+ W0 101gV!1R0 吳 00 0 0  1SS0 00$0S0$0@@W 0i螾y9Q-Q  1S. S' 000!RR 0000, 1P00000 0R$0Q ! !101 TQ RQ 000!RR 0000, 1P000$0S$0Q0 ! !101 # -L @0$0Q$ R 10S $ p-LP@ =`(4 040 J>0 p< ph)y 040ᄅ -L@8! Ƞ8 0,Ƞ @FំP 03y9400@40 3Fy90 00w000q -0@0>L06Jehd -0@080L06;VhU -L MP L32C0bC^ (K#0 0Rx P 0@0 pP>40  8 000T400  0%000 00 ,K 4 0 *7pP,00  04 , 0 000$00$00  00CS 0 8000NT860X7]T00,4 K006p*c~f -LMP I p0 < 4K`P (K 8K0`P 4P j, T,KD K=`P 8P] T, 8#H@,0 ,0䁟4 ,00K @ K=`PL00@0 0000800 <   D 000@ 00048`P(00S DK  `P<0 4, $00$0, 00CS 0& 0 $00$00 00CS 0 S84`P @ 606080 D6,6040 0:6,66,@, 0080, 00,0! ,0@ PRD PP00R00S(U 9R44,C5HR@ #P5P,08 K0, $00$0, 00CS 0 40 000@_P,4 弶 z9p*c~fz9 -LM 9@0 @K -LMP0  ʠ K p-LM@ K`\PP x0 0 P 00CS 0k4x -LMP Kp?@P K 0 `  0^@P  00CS 0 H4 $K04@P$ 1@$ 0S  P 0 QH-c 0-@PLP Q 1S 0 SD0 R0S0 0C#1S@T0P& p-`QLP@1@S P4 (0 000(   ( TphP 0S  0 -c -QLp` O@` ک (0  @h1-c8-c -0"LM0S0`0V+ 00 RPp,K ᯩ, p 0P0 0,@RP$00C$0,@00C03 R! KO`V\a\Q@0T0I (00(0D@T@Tp>( 00C0(0 0(0l/D@T (0 0S,0 R $0R(0p0(0D@T0SW @T D@T (0 0LlD@T 000pSh-ch-ch && -L M` 0PS4  2R `(K Q 00\p2 A h2!`/0@!b0S`0p1w N @+11k `  N  @l@T X 00 `ӹ 0 0PCp0K" 0sP .a`P,K M,0SSJ Ǩ, p 0PE0 0,@jP$0 !0@$00X00   ᯨ04720S,0 @ `W,pK~P ᜨ, @D 00C 0,AP$0h0C$00T0C0g`e #@KO 00 0 ˠˠTXKD K 7PPX0 pT0,1( , ,1 00,@(4@9 0-0LSP X0S0S S S0 PL K@P P8@{P0SD0 D0H0@H0(0( {70,z9-c-c-c-c-c - QLPp`5 @W@ Q00S0v03Q0SQ<$&$&|$& $&d$&#&L$&4$&%&`%&L%&\$&$&$&#& $&#&%&\$&$& 0S -W [Z X - 0Sm  y 8 V8U0 T0 02@P  80@ 0$@80<@,00@( @ 4 00 @5T'0(B8SH S& S$ ,0S S S #}{ P P0` 0 pPk0 0 P< T@<RA P`0P 0 @W@0Y0K HX 0S80 P  @QP 0P7X&@W@0Y0 P90 PPp P pPz9hHz9@z98z9-c0030000#00( 4000 %0 003008p@-X0X (@HPP`X \ $,@LPT` (HPXpxhh0hA-400 C6pǏ(#"B00 P' 0Q 0S@0@ R$0$0$00 $0 P`PU``0 0P`XP@`0d@00 0(P0S@0 @P0S@xhhh -`VpL& 0V\% 40 C6OPU`` R$0$0$00 $0 0 0$ 00 $0$0$ $ `UU\z9 -400 C6Lpȟ(-00#0"B005000 $0 (0 @0P`P `0 @ P` 0@0 0 $ 0p@@`0 0@`0d@xhhh -38!2CL0M,0 X@ P A0s!rGp(0P` P ` 0 @ P`R0 0 $ 0,0 X 00 Q, $0$0$0$0 $ 00(5000 40$C6Q0 ɯ(, (Xxh 0-LP@P@DTPU0 -pl`L@jP(  P@ (PpWxh 0-@LE-00P 0P v00  ~.00  00<00000  @P0xz9 -LM`@P-Kp<H@ DP w@P 00 @X.K0000000 -00L@ 00000#hv000006 -L M!0 C6B6cO`p`VpࠁQ 000S @d _,00AS00L1P&O0d P(qP03! 00a&0S0@00R 5 .0@妧嘧 R00C10/0 @L Kd 00?2c, dS0d004OcUi,oc4;8;hhhhz9hhthhQ 0-LQ0D0 P 0@OP 0 0h蟥hh p-@LJ,00` 00;0000 A 0S `10S0000000P <00   0S10S 0 @_Q t0S'0 0tphQ-0S*00800t00:000U00 00800}t00xtp0Shhhhh 0-00L PL00\<P00'0S 10S00 *   00  00  00 # 0 0@ 0$@00@ 00 0hV008000h/t00@000|000800(0 0@(0,@Yhhz9 -P2Ll!H2 }+p8WD Y 2 0PoPVif pP2 1 0PoPV30 f,00 :0S 00 x!0S  P2D4!0*7+pP !0S: !0tUt0SY00S0p R+Մ00700+`Ut0Sʒ40p R4 0S 00}sihhhthhhh^9 0-00LP D0#4 R21C 0Q 0  0 00<000hv00000*@;,$ l0000hmcOci - LRpf 0ST0(0 P00S $0@QQ XD x0 0@x0|@0P `00 0@004@ $ 0@00<000v*P 0l  0H  H +00800F4\P&X@  @h0 0@h0l@^@00hi -LpL0PS` 4@8@ R @00 00;00D` R E00 h00800hr -1L P@@*0@ Dp@ `P 0 @_R 0 P0OT sr m)+p0 R40S< xgSt0S0p Rhh8;hhh -SL M40 0 @) ,  `P CP0D0 @P40p800P  wPtxlp00 <Ph@ PR00 L3`4 P00,400*(Kt)3 , Po0PVFt0S22 RF4r>0#6Po ?QP@P8 P < 0OQ t0Sf!0 ?Q?A!0r,h*pL q11 RP@P0 ?Q0d1d!l0\ T1 \ 8q@A@!000@;00000Z 4t00300n]&,*p[PUhP P0p R80p R[,*p@0 @冪h!Ce-chhh8;hhz9hihhhz9z9 -L@ 0P  -LMp< 00 & ) 0PP(K` Tp P PP 00 00 8000l ,r@)T P(KD@0 0@@0D@0 0 h)z9h -LMp00  Z0ST0(P Z p0 0@p0t@$K0 0@0@00\9 000P(` 800@(, 80<@1 l000hi -LMP @Pp, Z `@P` P U (Ko, 1 -LM@h -L(M@PH `v>0~pW s(K4K 0H ,@K@1 PE,04 @r,@ TP<  0CPD < PR/JD 1`PU'J0O U 00HP`F<@T D1P @00;00!< TD B0 <D0\ 1@ > D8 1P(`80 p0@80<@(, T10 /00040K tx dP`0`4p8p0H08 8 0O`0@8 <d0h@@ R0 40K)D t0x@0 0D|00LP(` 80X0@(, 80<@ 0@ l000600sK/h:&i p-`0`` @X0TLP0 Q00cR0bc00cUpph8;hp-00H 0R00 P RT T0X0T0 P T0H pP` P`H0 0@H0L@pPt`phh -LM40PC6/`0`,0 R0dp`0dPh`ڈ6@ ,Z00000 @0 @4 0PB&@`?S RQh -LM||@P0@P0 0<(6@0@ 0 @d`hp4` hhh 0-4 LRP@H0a4@0<j 0-PPQT0T x0T0 PT hp0 0@p0t@H@0H0L4(00 \0hh<jh p-H`0VLPH0 00D4Ld`0SLVJ 00H` 00000 R  600500 RP P0P0T00PTp0 0@p0t@pP RT0T0T00P T0| 0p@ pt LH0 0@H0L@008np<jhhh -H0LSP 0H@ pHL Pp p`T 0@P0p P0^0pt 00000pn00000hhh -H0LS P @RT T01T0 P T0 1p0 pt l!H0\0 @H0L@DD1 Y$*(!p00 @p0t@40#6 vP`d0 ` 4 ~40CX:H`@圐XnlQtp Uh 0 `U 0t\p^hh hh<jihhz9h00000z -0ML 0 08`p@P0ʠ @ @UPT0T` P'HH0P h@lP`p@tPKh 剦Hch hhhhhz90@-P@ R( 0S%\ ) \ ^ \@ 00\0 S 0  0S R 0000@00 R P,  R/ 0\00 S 0  0S0S 0P@ 0S@@0  @0@000S00S0@ 0\@@  @0@- R 0S^ 0Sk0 0R 0SI0SD \   R00 \0S0  0S R( ^ 0Sm R 0S 0R00S00 S0 0S    R 00000 \0S0  0SR 0S@0T00 S @0  0 S 0R00S00 S0 0S    R R 0SP0U00 S P0@  0 S@ y -LXp5 PU?P0S`X`V 0S@ W`RP 0WPP 0RPPV 00SZ  `X `V 0S` P 0S0SP0SP0S  P 0S0SP0SP0S PQ00SQ00S p-` ML<@ X. WFʁ qp tq U<9 Xt0   0 0Su0000rtuXYTU0SVt0 TY t6 q: R Q W t0 00eR XY V qrruuXuVzrQ@{9 p-L M0PK0%@ `K0S 0S  0`%PKp  -LpP01 0101 P`u 0P@`PU`P `400v0@0 @ -@L0;00C0hb4h 0-L@P;UT004^0P0T$0 0   R04h.c -0SL 0R& 08 pố P` 0S@ 0@ 0p $0( 0S 0 0@ 0R0 @  -L M0P@T$pK `K$0   0`x@P ]0DS du&8u&u&t&t& 0 0 @K 0 @ 0@ 0$0 @ 0$  0@R  0S v 0 0$  @ 0R 0 0@ -L M0SPIJ@PN d @ 0@ 3 cHQ d0S\  0@  0S @ K  `V $ (0@(, P$0#0d0@S (Q,0, ,0, $ 00T 00F` pK'`@(K 0P ( `P w&w&x&$x&x&w&#@@T $0@P(  0S^ 00@T$0P( 0 0@(z@0SL P ( R,0,0,0,0$0 $0 ,0( P((0 $0PT& $ 0P( $0  q@ 0R:  0R& `P(0 @ 0@ ($ 7@(0$ (0S *(0S # 0R$0P( 0 0@.@'.c.c -LM40 1\l10 ,0 080 E\A0U@ p pppU2T 0 P9 ,Y,1; `PM@$ 0 p4  00 08 0@$0  8 0 ,0 ,0Y40% Y Y @\ @(K0@P(KoY0@1, ,1+@ @Ti -L M$@ 8 0ȔKX{94h -LM 80@ `#0 R\ 0 [  0!P|0P0C,P SP%0 ,0S 0 "xP  00W(0$  PR W(0$  0  R @ 0  ,0S (0$ | " `{9t{9 -LM40 0 080 R0 8`040 S P< 00  4 A#D@0/S L 0S/S 0S/S0dSH0$(c$0/S 440SɌ480SɌ44Ɍ4H0S 4 ! 0U D0U 0,P (0PH   "0Sy 0Sv 0 4  004 P V @PL R4Z4($0 jb4$(L@04SɌ4P0 ST@T$  ": P4 !,K0 p) W^o ,P4P0 S SJT30 S ((@ D@Z D@ L 0S/SY$0cH ($0/S^0/S 4`jnj$(4W PP4  000CSP  z40S4r @Q p!0.SM0.Sʌ4HIS4hR 8  @0! RN  T+ 00(K0/S $0 db$D0@S@ p0S 4 0p03R0S@4PɌ4 p@ ?@p G!pt4@0 R1 (0$ ,  0p .! 4 00S (0$ 4 Rs (0$ o p@$0( 0 jȌp4$0( @p0h@  -L(M840,! < p0`N 0SR @+$0 PU;$ R7 40 @0CQ0S/SL Q0/S l0` $0 @0,0 R3   5FPP@0 /R$ dq} P~@屐 PP@嫐00(K㯎0@S@+$0⧸P Pj@(0Sj PDPP`40Y 0 " R@ ,0S0,0Z$0S@『8`0K< PP 0PK@P@l +00k$ R8$ P?P0PS@o0h`h0@-P@ R( 0S%\ ) \ ^ \@ 0 0\0 S 0  0S R 0 000@ 0 0  R P,  R/ 0\ 00 S 0  0S0S 0P@ 0S@@0  @0@ 0 0 0S00S0@ 0\@@  @0@- R 0S^ 0Sk0 0R 0SI0SD \  R0 0 \0S0  0S R( ^ 0Sm R 0S 0R 00 S00 S0 0S    R 0 000 0 \0S0  0SR 0S@0T 00 S @0  0 S 0R 00 S00 S0 0S    R R 0SP0U 00 S P0@  0 S@ y -`LV@3 ^=0S`PVPU p` 0S`` TPR 0T 0RU 00SW `PV p PU` 0S``P p P 0S0SP0SP0S  P 0S0SP0SP0S PQ00SQ00S0-l@0l S0 UTR p-@LTP `P`@@T@p 0-@LPT P@@T0 p-@LT`P@P  R0T 0 PPP@p0@ 0@@P0 L0PP 0S 0RPh -LM 0 `0p00Ġ R 00@4l 04 0Q$0 $PK @$00$0 08P#8@$00Kmcch@-0@ d0h@0@ 0$@,00@80<@D0H@\0`@0l0X 0    ( 4 @ L P T (0S 4 R808080 Q(0S40 408080000  R0S,PP000 D000 ,0 0,0 ,0 0 0 0hh 0 0C 0S0S,DP000 8000 ,0 0,0 ,0 0hh -L@p`\ (0S 4PPU (0S \ -L M0   K0 P K蜭&-2L?0\ \ T 0S0ShT0S 0  0 R  R T 0\ 0R0S R0@- P@P -0A0@r@P - pLt Ɋ,0S+ 0 ,\`0h h0dx<0@@pP`0LP T0X@DPH`Z BZ ⻈YZ Nⷈeh i貈 -pL@T P` 0 `@S PQ 00 R 0 QR0 .c.c p-0L@`T  P @T P pH0@Q @`0(0S pp .c.c 0- @RL R000 00 @P D0S& 0S0 00@P00DP0S S t0d 0?T0 R <0< CL0Q0P0P0P0!Ce$/cVUUU -LP  p R R000   D0S 00hfL0\0P0P0P0ߓ!Ce{9 0-0LSP@,@00CST00 D0D @0S0@ 00@P@0{9 -@L  tt0P \ 0,0 ,0 0@h0S,0 ,0,0000@0hh -L@p`PHH\ 0 o[P  -L`pD@PT! 00  R 00@00$ 0WSD@PTW 08 D0S h;{9{9 -LPp` ]0@!D0S  0 @PdIH0@SD0S `;@ R% V@ p0S'PD @VP p0S00&y00 X,M00;00@U@ RDP) V P @PP p0S00800` 0Z@P 8  3 .@VR 宒{9{9{9 P-L H00CsH0   S 00HhTY唒|9 p-`LV@P00   R000   pH00H0!Ce@-Q @P -\ 00 R 0@%Sg/c -1l!RL ~PpU. `PU 0 00S00` f@sdW`pGZ`V Z v'P0@X PU`(I Fi-cg'5 8|9,|9 p-LP`\@0^0$C! I p\ 0P @0  0S p@0@  0S pp$3 0S p 0-L$@ P R 0S  0Q YkP$ 0 0-@LTP $ /h ^+000& - L@0 j1 M+ -LM@X `RP RL`0SIRGSE01 p+딀PTX [pPX 0S ` R,p  X`0,0 \KpP  1+(K` 0S 40pP0Sp R 0,plP00U0Sp0p00p$0 p40pP$0 P<$0YhP7p p-0L@P`    P$0<$0pV$0<$00 -L MQp@@ @+ R t1\ \ 0R@@@A 0,` K0S S S -`0 KiP`0x  KiXPQ0PU 0S0S PU-` $*$ @᫄0 00 $P0P3P `T* .c.ch -QLMp`0T@$KW00 FP@ $ W -0T 0CSlL@0  h0S0 hi -LMP@U000`pI<0 `9U2 V$P7U 00CS0 t0l0@0,  0  K 0SV 0 <0 KiV  0 t0c<|9P|9h|9 p-0L\@ !0phW (0S 00CS'0 S 0p  0SYt0S ,`Q00000000 ,0S,0 ,0,0000@0ph&TQ 0S00 S2 T 0S00 $ T0Q( P`Q T 0S 0RV`V 0;0;0$ :)0T0TQomk||9h|9|9|90lpi -0L @ T 0P Q T0  R 0R 0r03P0S 0  -0LS : - 0RL@l!  0 0S 0S 0S 000 00CS00:i/c 0-0p 0CSlQL@0 0 -P 010S00i -0L @P`  P<00!VP0#1pQ  RP  PP 00CS  R0   0S , R 000000 000 , R0 0 , 0 0 , |9hh -00CS1!l2?01L`P@p  0S 0S2o@T @T T 0S @T $O(T PT0PpT 00T PT0PT⚃T`  + 0;0@ WP Y0S    0 0 Uih -LM 2 `l10U0 4 8 ,0 NK ؁A0 ?0S0 " 0`! 1 `RC!0S8 P@UO,PUL P, R0000000, 00    D 0S ,0T00 00@ 08040P0d@(KT`p 0S 0S   |+ Pp' \0P\ `0< X 000 4前00hihhchhh h|9 -p0LM@p`0 $0K [P00 $P` P$  $P0S PT 4 0#40#"B $0S000P/c@U`V 87W ,30p @Thi|9|9$}9 -L_ P L0Q P 0h蝤$  0}9hD}9P}9g -0LP@U3 PU0 `ApP &@rp P 0$0 p0 00$0$(0$0 ␂/0B0Z 0!YZ 0@ .c p-0 ML@P@@` 0pt@@P宅`` 00@P妅H HH0 P0PPRKph%c;hX}9h`}9 hhhh - L⎋l}9 -0 P0@L`pu   L RP0P0P0    0EL X000 RL L0P0 @Pi  /c0/chc 0-@L0Q 0(0PP@ LQP0P0P 000} P0 -pPWL(` `0P$@@0$0 0 @$0@0$0$/c p-LM0K@ `P000  0P` Q/0 ?0S 0 00^00x80 Q$0  4/cccc /c - L h0@P H T0R  D D0 ?R4 0 007dh`g$/c(/c,/c -PP1l!L `@ 4!40 ,P1p P 0 @ T }P @ T 0 R B ʐ R S0( %S , 0[ PP 0 c, ihL%c0/c /cc(/c|}9`g$/c 0-0@0P 0LH0 000h /cc-0<2 -LMpP`  P  0 S0S 00T(0 $@ 00 0@(KP ߛ K0S -L M`@Pp YP " 0 S%0S" 00R$0 , (  00 0 ,K$0K p夛K0S -LMpP`  P  0 S0S 00T(0 $@ 00 0@(KP 徙 K0S -L M`@Pp P " 0 S%0S" 00R$0 , (  00 0 ,K$0K p僙K0S -L@P 0S  0 R 0 0 0  p-@0LM40 0Cd0 ` 8 0`@hKT0 P@ h 0` e@PLP0ST0 0"$ R*32C 0$Q @KpK,!0@P,1 Q {(@P0SR0  mc0I00 p p p s!P0 l 0 "p -LM c -LM @ -LM c -L`PM0p@0. ,, PD0 D0 t@ 0@xKd0 `@ p x H @p @PV\ U ,!(K R !,0 P0 @ @ ,!0Y@P @ 0R !,0 P0 -LM @ -LM c 0-LPM@P@ K0040 ,@ 0@dKP0 L@ 0 \ ` d @P HP 0SD@ 4K= DP DP 0 D@R D4 K@2DH4 K@ 0c0  0c -LM@`pJwP+0W@P 3y K0h@ @0  0@pK\0 X@ < l` pp 8 @PT0S P@KPT0P (T@@K0PTK ˠˠ0@ K P@`h0  c -LPM`p@50@0pK<0 @0\0 X@ h l p @ 8` @P$TP 0S0@0 0 h@ p0 @0\0 X@ < lp 8` @P T0S P@KPT0P TB@? KP@ K@5 -LM@ @K -LM@c0 K -LMjY VpP @P0 R@ (K0H0 @2d0 `@ 0xKp tp x D0 @P d@P\pW@@K 20:#:  D0唐 ;;0  V  V  V @XHK XP TW  V-@00 0X\KH K@00 00  -LM0:#: :  -LM :#::c{ -LM @q -LM ch -L M`P*P K<@K YP60PF 04K K P (@,p 0P$048,0/㵞 -LMp`@P K`PWCOK 0 0 ,0 0`PH Q0 0, $00$0,  00CS 0s,o0 @@0 <@ H0 D@  03K#K @0@cK- , H0K@@P 0Q,`L8 R00`P},00 0<`  r , $00$0 /c -LMP @0  @K -LM c @K -LMpP  0 S0PS   @,!0OP T@ T P(K0 `V(P T@T P( ` -LM1, ΄ 0 P夣Up1$048,0, `P+PT @PW X*Y,`, 0P PTW X00`(K0`k:h -0L p@T{@V 0 `uP$P@0$0 0,!@$0@0$0h -LM0`S% T K0 P00PUp p@0S 0S PU@0S W @@{T   0p 0  0p0  0p0[|g0h}9 -$0@@0$0Lp`rP 00$0,!0PP5 0PUU  $00#X00S% R0 00  0 P 0T0 00C0PU / #{h}9 -LPMD0<0 0C pl0 @0pK\0 X@ h p @ 8p ^@PTP,1(` R @P$0  a@ K[0 U P@ 0a@ -d5LQM`QpdPPK Z 0@PP (KD0T0  c0K@XP  t0 p@ 刐 P PPl 0< P VK,!0PP.,1L!R -PP$(P  .( p$0p,! 0%PP0S Pd0T`d/ (d \ $ `!  -P P,1d Q PPP  `ppdPPd!8$$d$d!$"2 0d1$d 0 d0K PP"d0@d$0h d!$$d1U$`$9d0S` d:d1 T0$U\000dP d1  0d(  Ad$0 dzdd!0,  d 0PP dP?d!008@K0 6PPI10S\1 P\ \\ K \1P pPT@T P P vd 3\d  0$ 48d!$ Upd1,1d $`A A/c^L%ch .c -LM0 0S K- -L M0   <0S-K K -LM   0 $0S-K K -LM   0 @0S-K K -LM   0 D0S-K K -LM   0 0S-K K -LM   0 0S-K K -LM   0 ,0S-K K -LM   0 |0S-K K -LM   0 T0S-K K -LM   0 0S-K K -LM 0  0$  0  40S-$K K -LM   0 L0S-K K -LM0  0S-K K -LM0  p0S-K K -LM   0 (0S-K K -L M0   h0S-K K -L M0   80S-K K -LM 0  0$  0  l0S-$K K -LM   0 t0S-K K -L M0   x0S-K K -LM0 0   0 0S- K K -LM   0 X0S-K K -L M0   \0S-K K -LM0  0S-K K -LM0  00S-K K -LM0  d0S-K K -L M0   0S-K K -L M0   0S-K K -LM    0 0$ 0  0S-$K K -LM0 P0S K- -L M0AS ' 't 't 't 't 't ' 't ' 't 't 't 't 't ' '0   H0S- K00 K<0;0 -LM0 0   0 0S- K K -LM0  `0S-K K -LM  00S K- -LM00  0 0S K-00w}9000 -@ ML̠ 0 @PK B p-@PL@` P< ?   0Pp}9 0  -L|M P@`\(  ,0 pP00V00S 0,! @PT t  X Q P00S pp$K,!KxpP x00b0at f@ -LtM0,!KPdPC l l0K0 @  00CS6 '\'d'l't'|''@0K4;DL0P@|0KpPK`D0H@dKX0K P$`80<@,0 0Dh\P@tPH`Lp 0(4@@TPX`\p (K   - pP LR3 ``(0S $0 0 @ 0 @ 0 = `00c@  .  0S` ` -L M p 40 R0 0,0 !P`Q VP! , 0 @ RP 40  P000c@ , (KUP -L(M`0 p0K@0 ,0 P L H0 D@ < P8p 4 @( W0 PKX@ Y@00 (K0 PKX@ Y@00@0 S T R@ b -@0L0C0P`p S0 @ -LM$0` p @PK 80K0@ ,P 8@ 4P K 0 K -@0L0Q00\0S  (1 S ppW P`V  /RU0 ` b 0a0 -(0L$   R02& 0P -LtM8p`@,a 20 S] ,< D000 40PP10S-PK S>PH K ` 0SP< PP8 0fPP1  0Sc  08PP%0 H000(K  040@0400PP0S 0r 0P#  0 0l PPSPPK5 00 000 @ 0 0 PPk  0PPd@;0  0 d0r @KP 0@|@ xP PP -LMPlp, P@P t Z000(K`$0 00 ; @P00$00\ ?00 @P 00, @ i -SLM 1 P  0K,!`P~ <,p0 \2@`0 0h t K\ t@ l0 d@ X@ 0`Pp!PRP u 0 S  ` @K0dp`,!@ P 4`KTK,0KL H T` , 4p 0 D < 8 mLK `RP  1 P!D0 c\)ڰPH0S6  `\ ڰP<0S0S 0@b1S"`#(:#00  (K ,0S `000@@0S0`g@`9 -LM `PQ4 0 , p0m 04.4 @P#X04 00 R@080 p 0Sj0 '4 00 UR (0 4 J40SM 4 @P 4 ,4 W000Q54P2(K8,!0@P*4 =80 04K,K 0 K0p@ T0Q0A/ 00  A0,0CUS4 0,@  PUh0P,,@ 0 K0`@,@0Q 0A/ 00  A,0h -LM0 Sz`@S"`p?à@ 8 @( K0D0"D0P0`>`P   (K, ` 勑` - L0S 0ET0( 40àLD@`T0S 1 0pP~98~9 -LMP`( T0R  $01 (4Rp R@% 1 W#*1 R 0s 0 2!1C0QX e@PBAD 0*T @D1 W:@0s 0 1P3!2C0$Q1 P@{p , KP ,0S$ᄾP3ᘐBC $0S000(0 @ * 0 @m@ @P mcgOcmcN 0C"(40 0ȁV000W 0@P` < B2MϠNl尀,0尀h0T,\0S0 S0;Z1hhQhnm88hk_k0@-@PP0  U0   R 0U 0  P0` R.00  \@ R (0U 0  Q00088E-@Mp 00 Q.\R00S .0Wࠃࠓ0ЍQR J \.\ 0 S.SQZ0.SR.0Wࠃࠓ00P^ J0 S .SU \ ^ZX \0d `h`cV 0 S  ^Q 0 0LV \00SQH\ᠡ'P0@ S  ^R 00A\  Q00SRQ 0S0C0^ Wࠃ~\_00W @0'!000c00 Q 0l T0#02SpRs  B0 S 00l bS0a  ~0 R0M 0 Q0F0 s R .R 80@-@0 S0C R .RN21CP 0 0 R 0e0@ 0  @@  ^@%J 0p 0 ^ BJ0r0 ^J0 BR0000@000  E- @@  0S ~? 21C0 CPbUP U`p@PEupG8 0`P0@Sw@pPUpG&J 0`Pᐠ0@SwPU@J 0P0SU@ J 0P0S 0S 8p@-@?0|03\0SP`@ 2 1C 0 0q  ? >1C0 0C 0S0 00n 0C0p 0S p/SN 0S~0S0 00n0C000Bp/SN V:0S~0S0 00b0C0/S 0S0S0  /S 0S 00L 03 0A0qQ P@ R .RQ4 0?AcQ 0?AcON -`PL@p`@0!0Sအ0 <P`lPh1 X!X10QP4!<1>A Q  0PP 00C0$#Bb2 0a 0>'R2 !0@~`l"`  Bp@31C#0 ` 00 @# (ihh8nm8Q;~9 R0S  0 0-PLd@ P 70 0= d0 -LM@p( $0P PK0`KH3   , 00     K0  (0S K$ K PP@$ ]$H ]K $0 $0 L $0 $ 4$ #40$ 5$ #40$ 5$ #40$ 5$ #40$ 5$ #40X$ X0$ #40K$0\   K0$ \00#400K0$ \00#800K0$ _000, $x0sX00#800, $x0s[W  Pm z N PL0 s0VT K0 0K0e 弼U R -LM@0 pKP,` x0s  hhP(K \0WlW;X0 00 , XpdX01Y0\p$00W 0, r 00K@PPX0 G2#,h l0Q= x0000s7 3PdX0A1A ,0KPPdX0A1y\0080 Y `X ,0H `0Cd04K 3PP 4强 JPPX0` 70bd040dH80c\ 4?49 -LMd@@0S` (0S` #@0S f( $00  %0`@0 -LM0P@, x0s` K0p`\ R#*d0X  B2!0C03r T0Q` 0_`P0$0\P0i/\ 0pNhH9 0-Lp c @SPQ0t `P2t0s H8kUZ0<0P᫴x0s[a,l 40u@Ph0, Pg p@ X,0K@P4 Oh W0@t0x@4 , 4@ B9Xh9h -LMP p 02@$p  0 !P  0P:0RT0S$pH0 X1$^D   !T00T01 01$pP0S5:0=lP,`P00W0S Wò( K,0K($K ,0'PP$px~H 04 0 0, $pᜲP K$喲 -LM,p`P4K(K 07@P$,K(04KP,(0H R:S 0S Q0Sg$KcP`,Z -LMQ@`PdX 032`DnP6"\050@0 0 P家pPX 0\ H `X H0N a 0P嗶pP !00 -LM@,0   -LM0,`<0  <01PD p,K8 K0PP40K,08K_PP.0, H0P*0@SH0 @0S0S 0 SP 0, H0 @0SƱp±(KUP0庱<\PP0岱<00<0 -LM,p8K,K 0Q@P80K,08KP30P,H0P *@,0PH0 @0S\ 0` \ SP d SP 0okpg(KT0^99 -LM(0 0C,Pp(0 @4K,KX @D4 0`P1(K,04K宵`P-(\0H0 R 0S  @000 A @D\0 0S (`P 0\ 00T00S$K ( -L M, ( K0 K0 pR^(0S$KXX0\p \H ,`x0sA ,K`X H `0Ld0 LpP@,H0 @ 3  RP,0x 4qP0 40XX0S( U$ q@0S (0e,岰 (0K,p pP(K0 X@0\p,p\ W,,p99 -L(M P\L ^p,:dX0  a<à  0, `PX0\ , #\ X4K>< K,0K`P ,0H S\00K H 40<KǴ`P00 \ H @@ oRH kRK0 0 L0 0$ 4#40% 5#40% 5#40% 5#40% 5#40X  X0#40K \K0\00#400K0\00#800K0_000,0x rX00#800,0x r[000$0SK-D  @  D 0 @ P: $0 @D0CS$03 0\ C 0y`P< K0  4K A X>}`P0K40<K4`P00\ H @\ 0g(K0孯0K`PL R K0 X, x0s P0H0  H L0,`@0P,` H -LdM 8 t @0|0 P x d ` 00 ,x \ `K0p p(K|@ 0Pp |x Pp | @0l@ ( KK0P Pb P0p0 X T  \X0 0R   S RX q P `m 0Y 0 S0C R .RY0h0 40 d0 p0K`d@ K,0KP@\8K00@K|@P20P88PH 0@ s 3S00S9 X0S`hp R PP pdd ( X T ݮVX `hp V0fh2h Q 0\0"'p [ x | ᵺ0p0 SX`X 0\`S  P~ T0S08\ 0 0  80KK PP` p`0$0\0x 4r` ,0SPZ V,` PR8 v 3\x0s00 @`Ru P 00R00SQ  O u | 0Pp `X0S  Z Rp \ ,40KPp l 40R x0 0;0|t p|X T `\ pX 0B$00.S  R R0.Sp`R ,` P `X0S  Z R= |~| x 0  x | P0  u | 0!Pp `X0S  Z Rr |Z| x t0 40@hQ`M0p0 h8ӭp@ dP p `\ ,40KPjl0S P t |[06040x P   `(0S | 0Pp 8X` 0A$0h0 0l0\;0p *t p|20 6p 0 t |(0\60 ,40K@P!lQ P  &40 x0 m\ ,40KPp l0xS40 |t p060|t P0p@ 6p@ 0t |P060 40p d 00  00 0-L`P @P004  0 0 -LM0K@`RP00 0  -LM"0K@`AP0   -LM`B`0$0 ,` (  h0PSp 0S\, KU  R 0P$  $KZ\~'9 p-0LSP@d0 0< 0S  `P  0P ZpD0S 0S p-``Pd0,0d Q L0L@ 0@T  T0@0 @0@ ,00@$( Z NBZ N ex N t Pp -L  pN`P `R T0`@0Q {` < 9 ;5$0 :$0`" -L8MT0Pp J@P (KPڈ7 U@ `,!0``@ T$0040  0$@P(K@ H H :~@P# T0``,P e4 0R  Z P < ; `b,0; KH@ `0 4 !0 4 !0 4 "0 4 "0 4080 0$02 0$08  24 \ 8#8R$402@SQP  0 400 0,0 0 @400 0002SL0 $PP80S 0 40S0 x0 0 40,0080 0$ 00020^v 8 0Br \p:0L m0Qj 8^g 40@<0 Ta,0<!<0@<@0 x rD 0,80<0@ L 2@?!04 H @D000H0`T 匣80D 4t0LP QT 2R"0D  0 D0x02tQ0 08l0l0l0P  S0CP0l04p0@N0@4 C`\ d07Nd @0RX O@@0 40,0P 0 P,ת0,0 |QKP0 0B 8P< 0gP P @P$00104P0010h0 0`刐 T0f"0#4X0 @0!@.X$ 0,00@0H&0%< 40| h0  x0|40+H#13 @Pq,0H@ LP 0|0,00 +0 ,k0,0 yT yLP@ sLP( mLP g(9098 -LMMVKp\  x PSv`P$0 ` RF-` R6XP K Z 0w`P (KKX Z 0w`P KZ 0)7p @040 c0K@0`0@080墾`PP0S`( &  Py010 0$00,!$00  $0`P ! $0T h 0 #40S`P $0 LM',! 0` UV$0F 0S`V`R0 0  00 0 0@>x0s009 ,Kw@P)   `\U/K`V KZ Kd@ 0,! `  Vt ? 0`,0@dP, @B_ZvKP\Z -MZnKYOKZ %MZfK Z M x aKmcE0 d B,0R+x'ԍ'ԍ''ԍ'ԍ'x''ԍ'ԍ'ԍ'ԍ'ԍ'ԍ'ԍ'ԍ'ԍ'ԍ'ԍ'ԍ'' 000    00 005w-|`| @!0@`$dP#r"XX 0' @(?0# O $ Y `@&0#@8^nCCX좙N 1s s s 40@0Dl00l 0@0 0@01c1c1cDl R0l0 0S000-D0@Qd0 \0<@P@TP0 @$P @000 000! 001@Q@- 0@ 0$@!00100000@Q 0 S 1 91 0-L M Pd\ @0 00RK0 p-0Ld@`X 0DUP 4%(P%(P 0 0"$Up89x9xF:9 -LMd\@80 P(,p  00P 4d@Y! 0 8 P4 Y`` 0 0 KP ` X080b3@_00@PS P0F04(K,0S`Y -LM0 d0Q 0 00S  -LMPp 0d0CS<ltP `q" T ` 0D0 p0S 0t S`P 0@t0x@8HIt0<0r@"t0sx0sU똀90d4q0d4 W0d 4Q -L@- -L@ - -0 LR@d`dPp pl0lV ] -LMPdPdpWMpoP 0@ BpTllpPp 0 pd p-L M0d@SPP Kp$`K90 00 , 0 00 000VT K0 0K0L0PN 00R0 -0@,LQLl0 ,\`h -LM Pd@pX0S  \0R`#:3LD$K謠K xHl Kx`P 0 !0 0,4Ka0K00  T` P` 0 00 ,0 "0.00 ( K0`P0  l0 ( 0\K^ K`0K0DK0VKX Ka0[ 0a0K0 ZKx0`h -LM0d`X ,pR  \0R#:K(K@0K 0@PKx<@K)H00 p U0 00 0  000 `X 00H `0Cd0 PPP圩d@HHH@ H0 H 00#40&[ 6[#40&[ 6[#40h [ [6[#40%[ 5[#40&[ 6[#40x Xr= !4 0 0 &[ 6[#40&[ 6[#40h [ [6[#40%[ 5[#40&[ 6[#40x r 3P t K|P) 0 }g00#80- [ X0#80[  @0S 000y dKf Kh0Kr0^K` Ki0[ 0i0Ke@ P0K, K 0X iK\ @ P P0  l0 , 0'0 bK0J`h1c -L`M@ Pd', 0 `((0l!(^x `p {,0U ,Pp402 (KP (0^\ x aP0dd t K0\ P  0S t0Q 0 0 t0@t @0\ 0P lVd0,l0 Pdlp 0 ` l$0 x 0`d dXX0P PQ  | X  Zp0S,]ltPf0 Q ,K 1P],dPdl Pp p  | X lp R K0mP\_pl'PZ,l0 ,)p d? KcPH00 0 0 XQX  0K0PV dt T d\h 0d0 X P\{Qp0l 0x  kt 0@000b._! x 0 .R?x  pQ ,H00 X0 |0 jPB \0S | x P R-0S8(t @@$ JKF?K Fl0 $0` 0 tl XpP JK F0S0th(0d 0 (0htypP 0S x j0x  d0.\\X` t2l 0h@P Q x L0p`t `0S\0 00TQL x 8| RF T0X@T9 `X H `0Dd04K pP'4 $4H0@x0lsX 40  0x0s $,$8  04pP 0@0S 04Z0wQuQsQqQi99Ԁ99 0-P@QLdQ0h2 -LM@p0d`SP,0s0s0s (K0s(0sX0s\0s`0sP0sTq (0$  0R PT!88S(-K0 0K00 00 y (0$ y0  ,0 s 0,0 0S P0 S 0, S p 0S~ S  0tPl0 (0$  0R P l0  0P0S 0  40s 0,00R0@0s 0800VT 0K0 0 K0 0s (0$ X 0S ^PQ0S 0 K0K000K0K0K0 0K0 0l(KoSK0 0K0dYx 0, S Psn(0$  !qv(PTA0sMg40sz@0sw -L M0,@KdP,p`y0 00, 0 0~ 0000K XK Pl K0hd2,0 K0 0L00, p 08@0, 0Xp 0\0 $E,0 S,0DTK0P 8T0, d0(0,\ \0 00@\0`@ 00 K\0S0S`X H a0C0"@(2"(@1<@00 !!   x0s@00!{ L0PN 0t ,0L D0T 0VK0, 0K00 0\0R0m -LM@ d0K,p00 0 <@00 !!  0 @@dKm -L@ML X d 0T S,0P0  P`V` T@K00H0 T\0 0S `(KRPX05s cr SVqQV8p 4 dL0,  d `0 \@H\@ dQL@ T D \ < LP@0X 0@@b b3a R`Q<RZ2/ 00K XZ`0PVd <0Ld0c<@D \S0! lS0!@  lHSP1P!L  `0ɠV%L@0SU P`Y 00K X3`,KT8 K0_`PP00K8K,0`H\yX(0$  tT000oꓠm -L]M 0t d0x1 K ,  UKFBt1tA d! `1 @`VA a | Y?K0@ttq`1x2X 8#8R1 `AT@ 0\! X1 @| t1\ xqd|!\0baY_K`W?KPU`X@X\0d A ՞50pa `2 PV1Q 0p! l1 0 W p!h1 x< K00K,@K@P 4K,0<K呤P 4, <0X! cQ!H! 0P>* PR `Y?Kp`p Q { da `q p l! h! H!A0 P0S 0@ `pR Rd ` p l da `q h H!A0 P0S ˟ta\v x!|adA\0faY_K`W/K PU`XX\0d 50pa `2 PV1Q W p!zl!rt1W_K`PX`t1YK Aq 0t0g0x\ PQڌ1 00(Kx0s | \ X &0x p40 40Ȍ< \ p@0T P 0B1KhPR OK OAKA[ 0,$0(@K0La Hq t(K0Sm:UKt! P y0 4p! l1 0da `q h1 G01 da `q A04 00,0S00SX `H a0C"0n2O@  0@ T1 PA B!KEhPA[(0K 01Bh!UKh 0@4 4YKp l @A h Y_K`WKt1PU`FPV0 0U@0RX{4ڞpq, tAWK^K`PU`Kd `! (4ȞW_K`tAPX`V dqRU']0OK,A1KB YoKA1[  L H! 0!0(pK0t(K\%:UKt! P (PUSKd `! 6x0s 0@T1 PA 0UB1K U0OK,A1K`B@0@T1 PA ?PYK`P` ! t1?PYK`P`da?VtaWKY_K`PU`4Z|a 0OY_K`PU`Y_K`WKPU`A:9 -LLMh hT h@X d 0P ,PSLP P Ss NLX P\0 0TcP` Tb Q 0@TZW T X ,0KJPNP \ H Q0@MJ PppXdP RLPd`0@X0@031@ a< QT>QH @P0C P0PP\ D PXP@= X< T% H< 0Pd0l@Q  ,0\00(KSP PBP\ P0\0H0 @ L H@d0X0C03<P\P 0C`P @PD@ @P XPP@eP    `$'@Ni 2c -80LSP@!p@@P0`P |0 d TvP0 008P PP G 2c2c`9 p- L 0`S t0 PUPU 0S 0S@ pp`h -0L@pTP) `0S8 =PV 0R`@TV 0S 0@S Su`h0  0- L@`;0pS*\6Tz P6T :D6T 86T Z,6T P6T+ < 6T g6T 5T  5TP0P0P 5T :0CT (5T 5T 5T P5T `|5T 0T 0CT0S i70CT 705T0P00 0T 0CTP 0P04T 4T 4T 4T PP PPl4T 0T 0CT<0P0T4TZ 0T0P;0w 0CTs@Pk0CT] 0TT 0CTa0P:0^3T 3T 3TTQ0PP 0 M#0OS$,|3`ϐP 0S0P 06P40PH00iL0P0(0P0S0<0"0S 80@SP  i0P0S0D0  QPL@0P0=0P0]0@S0P@@0P00P@00P0=01 @P] J1 0 P 400D0P0 i PP ,1 T ,1 X X1T ,0T P1T :(10SP1T 1T0S i0S0 0R 0R 00 P H0Ts 0Tp P0PP080akB @}fwBlB mB tB@f@oB@nB @wt@|B@vB fB@hB yB}BqB@iB vtgB~f;;pBfB{B2c -@LJ H0S LQ`R0`0P `R0`0 -LMS00 Sp p@`0\P, 00  R400404 0@0 @ @`0 h0 封 ,00:0`S$P d 00S* P 0 0 $  (Ko(Kg -LMpQR X1ZPM  P 0 PRPC @8 80S P: @0  !0 0 !=@ R(P 0`P 800S80   0S 4K0 VE<0S108#81P(K4Kp' 0-LMRP  (@K  K(P U 1[!0 !K0 -LL̠Č.Č M!̌K!00 K0k -PLMpC P@ 0P80 P0  !0 0 !=!( P 0z@P X 0`S h04@K  @<0S80080 P8(K4K080 `00  00- L@]0PS8600  0- L@0PS`  0R` 8\0 0rp\0: $0S71 $ PQE :0S QH p P!$00S":`V. 0  0`  P `0 @ 0  ?0$00 pP` #P0S'P `0 0 0 0 gx9 - QLM`p Q -iQ Q pQ0 )*00@Tq i0TP,0 @P pP  q q17p Q00Q0000 0[T 0YY V  >7 0 0i 0   zv` vp ,K)7, <4("4!<0 -0 LBM0 P@PP `62P PPK,0P~K  K0ZPP l 0Sp(Pt0(0D R 1[S01K  @ 0HPF0@-00 \ PllP \@0 SP 000< 80P 000nS0 n00Q Q 00 84 004 <0-00 \ PllP \0 S P 00 000 048#0A S@-2*Qf 1@ 0S'''''4''t't'0@S 2S K S 0S0S Q0A0@S. )ڀS S) `S 0S0 S 0S @S00Q00Q`S pS SS SS S0S:00:PSS 10 S R2c -LDM@dK`@P5T@Dp @0S񟗽''''''''''''''''''''t'\'''''''T'@'''''''''''''''''''8'''','''''''''''''''''''''''''l''''''''''''''''''''''''''''''''''''''''''''''''''''''''''|'''''''''''''''''''''''''''''''''''''''''''0U*U$ KG$0S< K U0܇0q3U 0\ :0S b0 bS \* 00q`p000 0 0 K10Dp0 K10D00UU 0P :0S b0lS P*0 01@0UF*U$ K$0S 001@0P:01W| ڊ0P:01ъUkUk 0P:0Sd b0lS^ \P01U:0aS0 $("0P010zQ20aS/ 0< 8kP 01gd0S 010c[YpW01@Q0N0 K10DpH0 K10DBp@><,, 00S0000H2chh R000  B hh 0 gh404 0,0, 0c`Q;Qgh -QL M &2 H00SH0<6 KH00CSH0ʲ64 8#8 & 6 1K, KTi 00  0 R0000 0 0 0cPgh p- 0PL0cS@`$P  0P@ R*bP!00p 0 \%*0Q25 RP:p g -LU?넁9 -L@mpP 0.! ,  !d @P `ᓿ0S {8p00 @@hhh -L@mpP 0.! ,  !d @P ``0S Hp00 @@5hh 0-PL @k P0 p-`PL @740 P ` `pg -LM$pK@P `\P $0$@ T1!Q *]K2!  "]P -L(MH`KPp( @3U  \44K0 08 K-4 40, 0cS$ 000ghphlh -L M@㦼p8#(`@K+08#83K6 T0PU V 6 8#8 #K&x TȽ KP Y(00@K03K6 Ti tKc 0-@L^X1PS0h蜽 0-L@OP00h菽 0-PLB@P0h肽 -0 LRh2=딁9-Q 0P P P-0 0   p-0L@`T$@T S3P 0 RP U 8T1 SPUppp@2ci$ 0-H0L@PT $@T '3P0000@2c 0-<0L@PT@T 83P0d2c -0LM@PT$@T 2P0S P 00PK@`T SP,pK[1 83 [PPE`@T U@2c -LM0S  Q 00QK @`T SP,pK)1 2 [PPE`@T U -L$ML RP1P Q P 0 R BPQ PPL P (KL0D1YL RI8HK 0pW5PU J[P( 0Zp PEW  UHK`@0Sc8K0HK .[Z Y UL0 0eL 0` [8K0HK [P PE d2c -LM0` V ! P0@T PPPU,pK@T PU {0 32 ZP` KhhH2c -LP㒺p`0L0@T `(0S @A@@Th,,c p- @LT`PC@T@ 1P R000$0 0 PP 0S R000 0 0 00CS00$ R( (0@0(0 0 ($ pp@2c - @L 01 0- LP, P@ @ 1 40$    0$ (0@ 0@2c -0LSPp! @T @T @1P  `P%  P" g w1@E0/Sq109S@P O K 0@T$@T 1P000@p 00  $00$ `$@2c -1LSPd801i 00S0C p0 ` pK0@0p I/`i0050h00A~ 0-L@cP&,0h衺 -6@06L$0\ Q hh 0-1LS@P  &/0 /00P -@L -80L R@10@T2c 0-41L0M@T$@T  R0PP @{T$@K. $K00#K`@P `PP @@Kzh .@ 0HPP `@P cK0@2ć9М8 Q0-LP 0d0 @T@T  Y.Pl0~\ 0 R bd0;d000 R \0hTh -@L]0P@ \ \0R@@D] 0-@LjX1PS &8S0B8#8S6 (08 0h蜹0<;80@8 0-6P0L6@T |d@TJ 0h 0-L M,0P@T@T 6 6T!8H#8 R84 K KT@TQK0d2ci -pL#W`P,PU) PU7 0SXQ 60@^)*0 0# 0 0#^ -P Q  -P PUP^ -L`}0pPUPU t0W6 @T@T 0 R0S S-P@d2c -LPN0p`V`V t0W@T@T  0S *-P@d2c -L%1`V9 `V4 t0Z@T@T  0SPU 0 pR*0 0# 0 0# WY P  d2c -0LSp 00C0 SP@ 00BR0 SQP@T`U 0S U0S; 0`V`V .P .P0gS"\ 00L0 S0gP ^0P@@00L\0 SL0!l/@!b00RPXP0S H2cgfff p-L@`P PP  R 6p㒶@EԷ p-ppp p-LMK`e@PP PP xPPP g -PLpMUp`P JU :Ul [:Ud 0U h`C:UC*:0S^tP :岖U m:U} i0CU0CU*0CU 0U 0CU \ `0 0`0 6 0#r0S @ P`(K`PUJ M`9Ux`P`1``g`PP; P* P/`ѵ8@U 8U PT0CUy0CUf*00CU 0CUP``;` ` 1*`l8U㦵@Qq`08U9 f 0CU 0CUj`P d0   #d0 (0B8d0 "00 ]7U 50CU y0CUD`` 61M`7U #60CU8`PTT1S  0`0 5`=6U 0U 0CUl0`` 0#6U N6U 0U 6UT J6U 6U`P  `P T` `P 0` p0`PP`PO @Tt0 R00  6@K  _m  p* p TP0`t0]`P T R`P00 p0`` 061`` 0t0`` 0<`PP` 6ʕ`M?P` P ` L@K *, ,0KV0`0 {@K@ ,@ `P6 t #q#!^ """!1# |88   p-@LT`P7 T T  # #p/p0S 0S0S @T  l# h#p3000 00   00V#p@T  lM#d I#p@0^  0@000X B006#p2c2c2c2c -L M@O*PK0pK `P6hBT,@T)  "P "P00CS0 R07004`  l20Cl2 "Pp2 0Cp2] Z`$K T -L M@p*K0K` APP*0[=P$K700[ hBT@T  "P  "P0007 @P!  " "00 ph2 S0h"00/hB l2 0l2i"Pp20p24P7P -\ \:6S0d0\-P0P0l040\0\ (q2i 1i i i -L@H Hh”\  ^0700 h”\2( -L@·0`2< D0Cb2a" @00/00 c2 edc p-`2L@"P0 `iH14 hp j`lP0SP&0i !0h20L ph4(7(2( -PpL`.Y0 6 & !P2  !P11<<110 0@0@1 % 04"48#HH1TC <1T 41TB ,1T00S 0S [[ Ts& u!P 6`0S 0R0SX ]PP  x!<0T6`,cX2c5݆@?cLc -L MPpAAP`2@ [(K &R=5(@6(|6(@6(@6(@6(@6(@6(@6(@6(@6(@6(@6(@6(@6(@6(@6(@6(@6(@6(@6(@6(@6(@6(T6(@6(@6(@6(@6(@6(@6(5(@.K  "!뼀 ]`P7@ @ ἀ !  !E@88,/@0.K *@P─ .K 0`@P 1  6  ?0S #T#@D, 0Y]P  9ʚ; 00S S(aR\0S9\0p0 Q-L0CQ:D0Q %0CQ6@06{0l02i i -L@ S d L00S h; GZd0 3A},D9 -80\ LR@ &..h p- L`P&^@P+  08R+9 l00&40 0T!H1 0Uh j0i L 0,p g\ 0 p`947(P7(7(h -$LP h ,2ch90- @P@ P 00Mp- 0\  P`P` \ 00S@TP \pЍ@-xp`0 l0@U  0 @ RS0V2c -LPp $$0`&,RP0 Z  w x\00000  ]Z S -PQLMZ` V 2R. 2R@ 00St0S0@0(0,@0@0@ 0$@  0S 0S0\ ` @&0`p00 P>PC  0S 0S6 0 p p@P  p 0  Z p1 p!PW00` ! 0PW`P@ !0`0P @@! 4jI@7i 8i8 -LP`@  pP P `p0000  0*넂9 -LM00P4 0 P $KP`04K`@)4PK`< P`0@,0 (@ ,K0 P 0 ,K0,K0 PP*뤂9Ђ9 -LMpR` @P0PU@ -L  C0P w*x@(h9 0-|PL@Th 00#!000 00#! @T 0}h-0S  0 00Sp@- 0@PcUe\5*0   0`Q  ^ T 0SQ 0S p?R00S eQ 0SP 0S pr3p 0\à@-0@    @ @0 -P` Lp 0  0S0@Q :* 0 RQ /  \0R 000Q ^f 2 @ 0  @PP0S:  0   @ 0PP00R  0S 0 S 000S  -pL0S`0S 0@T  0 0S@0SP U 0PX P 0 p-L M`P^ 0S:Kp@   0P `0` PP*00P8 40?")cccc9h 9 -\ LApSd0 `<0@@ 0 0 @P0 `H cc 0-HPL@T 0\ P 00h 0-0LS@P 0P \ 0P 000(<9 p-@ LTRP 0` 0S 0SY 0CS 0 p0R h`(pX[( Q R 0S: ,O(p 00CS 008C8S08C8J\0 S  P RP 0S T T  0Sd( 0 p0A 0 p4(p0$0p9999`9h -L@ T@P0S R 0U0U R0 0T p Q 0 S R 0U0S 0 S @R 0S 00 0 \ j`P 00 00 0@000``p '`h09 -LMⰒ@0`T@!PRPU%Uㄢ||2 E eQk*0PSh 0RS BQ:`aU"0T`1 @q TL!``0@ 0  @@0S  ^P@TXppW0 gP @ 0 i,1, K 0s,0@S2\P P Q0h 100 0  d 0 00d0 R 0h1000@&  0LSccc;ch 8L9 -LM0 P`@ 0  @@0S  ePVP  %P P 0S PU9P Pp^# UL 000Sp` 0 @ 0V@@0 @@ 00 0  @ T0@S@@Q 0S!0S   0S`V  0Vpp0 pp0pST@ Q T00S 0S ` 00CS 0000R 0  @6&0|99h -L M` @ 0  @@0SPU00  Q *0 R 0R  Q 0@P(K0"0S  0S Bf100U40 PPU  0U 04 RPU10,0 @PUl04QlPUe 0 pP 0\ P  S 0 0 0R !\0, 0S0!Xp1Z0 0  "0 0p 0 0# ^P 0 R !P0  0R01p W|0  "0  0 0#\g TPcPac Q0-L@P +P 0000 0P  @P00T00S P 0T P -PLUPp+  R/ U@`#0`S(  @R" R 0Z P  0R:PW  `  w 3 -`LV0V 8CxW0 08C8J\F0 S  P RP: @T#@T 0W0P Y( 0.0PU% P  0R:Pڐ PN@P 0 0 0000P@ 0 R 00 0@$o$}$ h909 -LMQPp0`%( K0( @RV 0 0`  `( RQ(`0 00@0 `P@ 0 P @ 0-@PPL\ R000  0h 0  p-@LTP` X0X cP P 0< a!0S00@@p7p;c ;cth0 th - QLp@`0P0 S 0S-`%U`" 5T1Z(Z([([([([([(@[(Z(P[([( [([(Z([([(Z([( PN @ ` @ [QV-`0 ` `s`#-` 0S* {-e`%e`W @T8`0 0 0` @`1\e``P`9` 0S  0`Ԅ9 --`1LM@0 T, ` 00 A p@T3  0 P!0R!R 0SP 0 ZP P  RPW  0SP 0P seP Qp@TW 0P deP P(K[[pthʚ;$Q,0Q 0 0S0xhh 0-T0L PR @ R 0S P 00,,c0 0S0h-1 R  \ 0P  RQ$0S Q #$0S S SS SSSS SQ,,c 0-L@PuP  0h./0 p-L@P`e P 0P @_pp/p"9 0-LM@PH P 0P R88/8 -@L1P@ P 0 @@7 0-L@P P@0 P 0@ -L0KM0,@ jP0X@ 0-L@PP0P 00A0h - @L!ͻ hȻ -0@L `@P  0xxpt@0P 0S   1 1  R 0 hxhh(;c P-LpDP81Q(  @P 0 0_0@Q PU 0$@W`: f@P X0W *P0@0 1@0@,,c$;cxhh -`0L R @ R 0S h Rb 0 ,,c$;c 0-P@0% L00 R  0S 0  P1 R 0⾻00hxhh,,ch P-L d  40S 0S <P0 , !h h !-@-d0 <PA d0 P0 <0R PA@ 0QL%c<0 R  R 2S4;c qp-L@`Pp U U0P0p0P0Y -销L0pS P0PSt0P@`D 0#P @$T` 0#P$;cs( 0 Hs( Ȱ-P2 S R 2 S,00CS,0 R0000 0 0 4;cp@-@` 0 PU1! \ *0 00\: Up lp@5 0-L@0DPP "&"0  0 0 -0LSP' @T=@T P,00,0@Tp, "0R8@#xT0W0 `P ,0T0r,0  @ 0``@00 ``p4;cP 0-D@LTP#>D@T  R 0 0 0 R 000 0 0  0S0C0  D@T0h9 -LM`DPP!00@ ,P 0`pXP`TpP`X 0S R 0 0 0 R 000 0 0  0S0C0&  P7 0 0O0 @`$PD R0 0D 00  000(KyL%cT%ch$9 P-L  R 0B0 h+H9 -@PL 0!!h 0 Bh !!R0, ! 0 B , !94P0P  㼸  常hph(h hP9 0-L MdP@TX0T( @@0@@ 8,,00K0<;c9hhc@(t9 -p0L @R  㹸P 0@ 00@ R 00<;ch -0@S0C00``PLp 㑸PP 0 M0P <P X0<00S0C000S* rPP7 -LM@`pGP  0p PP V \ `0R (d 00W00S / 0@Pd0  <<@@d0V0@@d0  4|0 , ! , !Z P`@ 4 h -LhMx`KP| @p|@ 0t0 d  00 p0 d|0KH n`@ptPH 0 U| K8Kl -L\0`\ d@P  # -LP``pP d0 @@V  P  0 0@T  -LM⠀K@`p@  00 <K0  ^KKt `PP140   `0d p: l K -LtM `t  61pP0 70S4 LP7@+ @ `@K@  ` \p `P 0NK0 M? Yd 00 000 ,0K@P Z J(K ,,,  -LLMlK@P@`p, h@ 4  P@, " d0  ,0@HP HL d,(K 8 ,0K`P  0`( 00 0, 8h -L`PP d0<@pP` 0 Z0 PD 0`@PD 0 10 0BR0U ` P @ TXU00  S@7 ,0S4 00S 0/0S, 0T0 S, " 4  R R000 վR000 Z0 P P, 姱 P 0 S@, 00PUP U 000004 @ (K 0  -LDMdKpP @ 1X[\0R XU  R0 P P]0`S @T 0SC0P0 @T3 0S @T, W L 0X0 0 D P80`S P 0S  00 d0 05P 000@T0L0 D0 X0 X$K5h07 060T d0 0 5P000d2c -L(MP@PP0ASP(KHK `(  0`T<0 H D 4 @ Y pP DH0L 0C`S؎(؎(0((,((D@PELwPPLr 0㸰<0@ X < > 400hS P30 mP0  {PLT@PV @%T V 0/PP/P@ U  P`0l!@qBK K ,0K21C0b ?A1c0zhd(igfff -L M 0@0 SH(H((T(`P,P D@P00SAX/ , @,@  ,Pp @Z `Q 0 70 0BR0`0 GPP*p W@00P0, 0 0(KP,P vDU@@P00S +D1@CP,P P,P C 0-40L@0PP XP 0HXP C8000a0h400400hMP;c;gfff -L`R@pP TU _C@@TS S *@D0 0 80@0T@S# S U *@:CD0 0 000U 0S @0`v P@ @8`U 0S @000 -LM`@pדTPQ T< T  0zp $K <㋯lQ@d l1S p@ 8pP;l1 Q@180@ Q0001 0  mW0@004 0XPd ` a `R \0p40 pU P Phd00C0 00C 0< ᱔(00C0000ip(d!hP;c --LM0 pR,0 \d2@TX P@T3 0 !0R1S R SP  P P  P` R5 0Q 02 0BSMT(T(T(T(`(`(U d `X0P `0aR  R  40040B(K 0P VP L}B8p240`U  01EP0  d `X0P `0aR  R0P 0 VP wLP8 r 0Rz 40040T0HBPo0Pkthʚ; -p0L PRp`P @8U P ( $$ $0 ph4d!h`;cP;c@;c p-0L PRp`P @5h07 060d,PI$ $0 ph d!h`;cP;c@;c -LxP ^@P 0@  `p T 嶠$ 0 @0 0md!h`;cP;c@;c --LMP@ 0U40 ,@ 0@ @  0S[FPP 1 0S`V p 㦭A(KQ+p_V V(p ѭP7p  0@ȟl1P帀 0`, `00V PW /U &6;T017p}-pupPE 00 0\& 8 @0Y0 : Y00?Y0S1K@C 00 K0S 0#S R 0#S0SR 0S ;0 00CS}꼢(((8(8(Л(Л(Л(8(`p&0S@ 8@PP/p`  0P@,  d0 @T 00@S' ,0 T{ p?0S ,@ 0S 0S 0C{P@,  K,0KpP , PK  000 ,0 rK~ ,0 `P 00 !, 40 60400   `0 K`L0P ㋬@P7p   C@  K03, 0d@(0,@, (n00 0, & ,H0 00S Si SQ ,00P HP0S KpP`Q ,pPV,@ ,@40S `I, @4,04/000, 4` 0, \`,@P d 00 0d0,@H ($Y,060, n00 0, d00, `@, 4@T ,0},@,$0X 0 X ,8 $X0 0X0, n00 0DRA K 00KpP90 $H (0 n00 00 & 00d  0'0S`rwi`;cd!hP;c@;cD9 -LM0`S@2 S5 PK@ 00 <K0 `P 140 600 ^K\0t  `C0pS PU 0S K d0Q 'n0 0R@R 0Hl(0 ,d  n00 0h00C@0F @0帀 0/P00000n 0a0 Si -0L@M 4PRp `K\@K@ 0D0 !H 0P0  < P 50 00  \00 0g`0S00 0d!h`;cP;c@;c 0P 0CP>@t 0C!` @#2 40P 0CP$0PN=@ 0C! ̇ P P10"104 P PP10N  0\ڿ20S?000S \ -H8LS@ 0CSH8 06 H8S06p@-@P`0"U@T$b0"PU0t0" ^" 0S0R  ^P0,0,P"p 8H0P <0Q00P0S  0 00S  00SLR@ R0@-X@P \ 0S 0S "0 !B 00h8 Q-L QQ20@Sꬪ(((Ī(̪(Ԫ(((7P"  P P nP P,$`0 lH T9 Q-L QQZ$P> 6P? P? PG 0@*SH(P(x(P(P(P(P(P(P((P(P(P(P(P(P(P(P(P(P((P(P(P(P(P(P(P(P(P(P(P(P(P(P(P(P(P(P(P(P(P((HP 0P   `P lP`@ 7njT9 p-0P`@LP`R\(H((\(<(0@P`|\ 2 R0Sp<@0@P`0@P`p48h9 p-LRȭ((((ȭ(p, LQ0O P`ph9 -0@p 0$@ (, 7LSI 7(P`S5 S6@ (, \!00CS (ܮ((( (0P`(P,` (0P`(P,` (0P`(P,` (0P`(P,`0 R 4;0\U0@(0,@7S  0P` P$`y0@(0,@7 8L"R  -LdM}@ P'0 Pr 8Kx t -0x@S4t Rdx t0 0x t0 -0x@S4 3! P; @   0 Pf7 xQ ?0"0Q|0 |0S|  0px 0 K @P`; 0 0<7 Z8[P70[S 0S  8@KR0(K 0C8 K0P 80[S&P80[S!8@K0 P `p;@ 0 7  1@ 0 80[S= $pK HK P |1@x| (K\1@ 0 081@K  0Pf@0  @7 *PPMU! 1W/R! 0;O `p0  7  6@ 0 PMU7470 0 @Pc 0P /(!8@B/ R-L@`0T T 80H 84 < 0Q0bC|99 --0LS1p`m Qm1_AP 0S   R_ V0 00Sr  0S .7 1.7 ^ V 00S  ^Q 1.GT@# P 1.'R! 1?0Q y1.GtT@m4 $(0`m8 89T9 -7 P`0@0Lp- 008#QQ 0-0S1 p0Q`@WH0 Q0(0 @ Fn$ -에0`@ QL@PR  0ZP TU U    TU =P"  00@@T@=  ZZpP 1W/R! x6@ 0@@ S  P4= 747 ZZ47# l? S (l_47S G74LSP @P Z   OPu ` 8 S4l/ XP`-0S6`V 3pP ` -pLM =-0`0P0P U` 1N0S PP 0 P8P 0 U0`= 0R!   7p(7 17 = S-000 0S-000 0S-000  -000Ԇ9 -@L|75-%t"}Rx2 x2x2 h* -@L &vT0i H1 0Ts0000|0| Rd  d 10b\ H00St2 ?x2@x; F: m061m)8;c<?90 0000  0@-1 @T^* T41T^  T00S 0 0000H!00 =4;0s03S 0S00 000S0  :4;0C0C:4; @ @  000 0S0:0   :S  R00h0  :4;00:4;:0s030 0[04+0CR  ̫< 7.  0>. 0 > 0.> 0.> 0 2"`((@P&X(h(`(h(h(h(H(h(h(h(h(h(h(h(P(h(h(h(h(h(h(h(h(h(h(h(h(h(h(h(H(  7 00SQ="!B10b> 00 0 == p-NLTP`@@T 0R! -P V %Pp -L\MP @p`P*tK  / nK+ P"hK ! HK|0|XX L00 0C 0 L )0C (KtK  @hK `(( 9 -LM 04a8b #8$0(Sp"hc S KVOK 0F898#8 &@PK1 OK 0K ~ 0. -LMPU@ p$ 0`K)0K&PUp)0[ 0)0K  E @=)K 9U=@K  (K -L"M`04 8 $#8(0"(SpP S S KOK l gQ<OKy .QOK 0PK Q > -LMQ@,`KPp 1  PK -LMMPPP`pNK b 5 1PP -LOM`d V p* 1@^K2K08 `V p#H d *K BK  ,K VL@K m(K p-7L`P@9 0K 0 9 s 0R>:0 "#A10a> 0 00CS/d((D((((T((((((((d((((((((((((((((4(0 0  0)S0 SCLR0S 5p0SQ/phphphphK  048# @(R"!B10b> 0 0 0C-LS|(T(t(T(T(T(l(T(T(T(T(T(T(T(|(T(T(T(T(T(T(T(T(T(T(T(T(T(T(T(d(z5h+h hh -0L0C@S T(,(H(,(,(,(<(,(,(,(,(,(,(,(T(,(,(,(,(,(,(,(,(,(,(,(,(,(,(,($(zh  00CS(((((((((((((((((((((((((((((((Rn} -NLT` @ RD0D0D0>@ D0H  NT"]pW 21C! c. QpP@  W h -LDM 0\ 0C0@  p$@`P 0d `0 dPK`0@\l0 h@ ,l@#$0@`P H#H$8p0!,X Sp` : X  =0=4h080S* @0PK   T K0 80RKS0K  LK FKTK  B@@K 0P 1\p唀 (KX@ =0=K4 -L$M@p0 @00L K080 PJKK0K  DK{ >Kw LK M  B H 52P 5PC 0 0 L0P 0 0 B0  `!4 08@K040 "880 "4<0     { - 0 0  00 0@0@ (K= 0=3 -LP@  ß00 0-LP @P @0 0 -LLMP  d `0 Qp0SK\ S0K0 S G0R K QK @R0K KK EK0 0S 0? K>0K=pKz 0 S 0 0S00000p 05K 4K50K0h0 p0 d0`SKl#|t 0 t*d` *XdX"$#h*4`l WU 0~帎>N>,@*0,* 0 09g; -L(M@p`Q(`(8((8K00S0,0K00S00,0KPPK0+0K)0K*0K  0  g@ {@T (K8K  2K 8K  2K 8K  ~2K  z8K -LXMp l d t h p0P  0RSdP0 @R d 00S  P`| x x0|@$$,0@H p#H80@ L#D<P`t0x@ 0@xD p4R` \ *p0.@PT@ p ,P 0 BjR 0 T 0S T dP T00@00h@!!R @t` 0\@"X !8X8U$h"H ht E⠐0!1 0 X`L@K8#8 h +TP0paXhp @PX  0@a0g T@! h06X dXX pOP@ 0W 0pU` [.P` jX , RPP l p=0=B-T@-0T0 T(KS lp=0=4-x $T d@00Sd000+-1P  0pX0 @t`K0h !!p,VEh0t@E⠐K0S:`\.XX!h5T+[-1TP0 0l@p=0=,T,T p,@T@ p,T@ }p,T,l=0=`K T n -LP@  㥘00 - @LIؘP0 1!  -L,MP T p L -0PH0 T +PH0 0 gR H 0S TH < < 00 @0@H#4<<_  0 03 00 "880 040 @ 40L !Rk 4 P`0@0LPCo` 8@K9 L T <0`YgH@`pD @ D@b 00gT@! @D @   dL0½YL`p @D  0W0pD0  0 VP,P PgY P& P U`` P   PP T=0=+H+0H0 H(K L0CoP"88 L0 1+=,1PP P0H@0 ) P,P 0 0 0PLP0<!T @  @0LS 0@P 0$$$$ P @ L 0AH 0 0 0 Tw++H+H1H P0 0 -L(MP pL P H P0` 0R<@K  9K  HP D,0P@0 a P X*P\@0 0 BjR |@  0S @0 s@0 @  fZPPVP@@ PD  0@a0h T@! H0ͼD dZD 8P@ 0X 0Up `+Pp jZ  RPP`` LL =P0=*@*0@0 @(K+Q+1P  D0P,@K 0 *0H },0SP*+@5+@ 1@P0 0uP*@ LL =P0= -LP@  㕖00 - @LBȖP  -L$MH L ` D w+0P@0 L )P@0 0 iR @ 0S L@@ P D0\ 2\20 ŠD01@, ,4008@K30  5K  DϻL 0eZT@@`0P<0  0@a0fT@! <<   dD0ԻZ;P`@ 0V 0`Up +Pp iZ  RPP  HL=0=)@) @ @(K+`*1P  @p< 'P*P 0 0p<@ 0 #Ƞ#\#0PD0y@ 0 0 0 L)UV+@**@1@ P0 07 0 S00RSS   -0,.0RL ,>@0#200   N000N "" N04\0N7 2S0S `= 0`=0S `= 0`= - 0LS='0R=   - 0LS='0R=   -LM7@S P0  0S00 %>$   0<  - 0L S` 04#1@#"BP2Sp 2S? t022S  Q o02 - 0LS@00 $("8{" 21C!Pc`5S 3RC`2S2S  rhc2S  ZpuV]R5S @P5@( T ご05 -@L hr_: 0-LM@KP  P P P K0@K \ qP00CS((((X)P)Q#8N#8 0-LM@KP w PP 0ST)<)D))L)4)K0@K |_ 8P0ST)<)D))L)4)\) W#8T#8 -@LAPp ,P0 Y 0 0u: PPjYk:0 $("10Y_:`A8!#Z P`A @8# P 1 PI0SF  YA: 048#8! Y05:`C8 #X00 P `C@8#8P 1Y: 04Y1:0 $ 20Y :R0Y:1 P )(*0\ `=(0`= LY0\ `=(0`= L -L4MPP L=0L=(K7S ^ 0$X 0  T  8 p0Y40 `: 0Y:0L D < P H @ 0-S@`  SP`  S `pY: 0Y*`=0`=P0S 0SL0P  =0=XT 804$H0D03 H0Q,> HrP"000@0S  <P <0  y $|2   {$\2 R 3 777 777(2Q3#5W$20Sn Sh 767 !000 L6 1\A@08 #888 S,;0,;x=0x=2H` c=S<` _ S 2SL` XXR`=0`=Q+@K  sPFPD0SA0D S D ;D R Ph x 000gpyp0  t07670L D < P H @  < 9xF:L9H#8 p-LM PQ ` đt=0@t= Kp ĆD ȠH,Ƞ$H@$ p-`LQP@  P   !p 0@S  Α p -LpM #R0 (K8 p !0&`0 " $PT #0P0 sX :% 0X\ %p:\00 |0 ` 0 x0 t0 p0 l0 h0 d0 X0 0*S S P  5P 5:S S P`X: p0X*`=0`=Q 0S R 0` S`1.'R!d=0d= 7S `\ Qh=0h=`0/ @ 0P PP" hQ  d R  d0P0d0 TP'48R#x P4  x R  P $000GT 0S :Q ;@:0 0 S 'O0 0  -E?0$0#sp0X t  |0' xP ]2S |P Y -S hP T 0SQ pP O=S dP K SHR`=0`=BR ` =R 0X0 7+@K  P+0S lP ' R$S"0tSt 7 F> | ` x t p l h d X t0S  ;Pj !000ipP ><lQ >M00]7SG8;SDt0X S \1 RK 7678XtdQ 1   0 0S  30'  0 Q'5" pL KPp@JPH00@  <008  #[- L KP00l ~PP\X0767< K#8 -LMpW( E`(K(0S'  Q 0 U# 0@`W0(PU $@P+  PfjU+e$1P (0S 000C `b 02$@P  "P #(#(##V## -L M7P`p L2S V P 0R 0(@K!K l0R =0=#L0 0@P0@  #ꈎ\#8 -`L $ 04"48#xW;ھ 1R" 0PU2 $@P,  0S+ e ` 0S'`PH=0H=0S0S p pG0PUH=0H=m#m#ꪪ -LM` 0PSp :@00S ),)8)`)'PPH=0H=#2K 01R0S= 0F0f8#8 $#$"Kt  (00 PP  "$K2K  ,K  2K2K  ,K 2K  ,K 0SFK9 ꪪ 0-@LsP"000hOt -LM`p!28#88 ,0 NP0M(K2>0Q 0, S PU @0 0@0@g"`00 S0 00#  }P00  vP4 U 8" 000 @4``@8O@T8O @BP8+"n, 0N@m ` -LM` p@T!  NPP |0 $Asp0 h080X  @5@ ;80$Km7S $K#8$8|9T(8 -LM`pP80  PU$=0$= WP P  (Ko!@ =0 =I  Y4  U$=5, %02$=5<:0SP@0P @40 S00PY5@38 0/ 2 1C! c %``PR00SRP00S 08 P(K&80  30 0@0@ 0 Y 7S 10 #2R8#0 <00 40.  0S,=0,=| 7S 80 0 00; 40Y Y Y) YR0=00=7S^ 2 S TT^ T\ 6gP  ׮1T@ 80|(Ko!7S>R0=00=97S ' .P(=0(=-6  0f7 < 1 60@8 0B <=0<=P=T0P= ' 7 0@TPTL=0L=00@  pP@ 80800@@=0@=:  pPD=0D=1 P  Vx0 00"5 ,0 (Ko P4=04= ,0 (Ko< p-3@ 2L`\P0 0  "3"0?03 3*2"0\2"00C:2p - LM !0 b, ! lp8 #= b 0*"*RX P`]N20\`  0 A%020/"-0?00bV0, 0 b! a0=Z.0 ಐ(Ko -PqbLg! lMŞ8\@# &80 00  =  - 00c:#: Sʜ 00h:#: S=0= g1b`Q- 00h:#: S  0$KmhZ<  -0` L p' ^$ 048#N  10^:0BPU @ 04 #2$8#8"&0EPU@ 04#28 #8hq< -LMp  0 S 048#X< "!0 b i 1! b!@58 S4 x 7b.00 S2a`2  0<0 &Z 0iA@cZ.4 5 , Zn505`u]N, @ %SX%X0E8?S-@ P <3008 B  0*0 8 ͊ s@ CP ]>2S; 0 @P40Q5 , = %04 040 0(KQ =  - 08 0b:#: S0 80(Kog 㼊 %%Z < n< Tx)') 0S00\ \0Su0S *S-\" ڰ\ \ \0\ P\ \ =0=\=%0%V0 -PL@`np\ڰ#2S#2S 2 08#8? !\#P00C:ü2 ho -LMb, 1c80 ,04` 1a@1#2`8Q#0` =0 b  P- 0j:#: SA 0az'zWW"408` f10bP`]N20\`  0 %020/"-0?00bV048 0ac= 0 ́ b ("(*"* b1 ᳠ 408` f1b]^00?"BR 0 0@0@,(Ko, "00  50`005"RC 5;84 0a! cZ. (Ko,=,0,=(KoZfP0_.°05pt_> JQ005584@ a10b0_>Ⱐ0  ,(KoY]]} 0-P@L ! '0:0; B0 [0C\z%#53c0t0d D0u & 64 0&,0 l ,+p00;t 4+78;0 -@PL`! pU' Q:0 0;Gpp0 0\4[BC:$R(8-S0T /3535t0c0u 0d 0 6 0&06,+l 0;p04+t 8;7 |x 0 0|00|00|00|00|00|00|0P0008S000 ->LMQ` $>Q ?>Q >Q >Q >QI@K! "7SL8 HKI0K! ( psL>Q -@>Q \4>QH ,>Q9 $>Q\>l[pP\80 T=Qc =Q! =Q =QA7p900A=Q @=Q =Q =Q.d=l-pP.l=Pp Pj1.'R!d 1?008p87S7S  8p R 4p<Q <Q <Q  0Ϳp(K<Q <Q2 <Q`<lpP!<  R 7' 7 ;4p7P<Q H<QY @<Q}. 0p<Q 0Q 0CQ; @Rplp|;l峌pPpP;l娌pP@ P7;77S7  ' P4p:l剌pPǘ  0S774p4p77~+P  cpu7 :0 0>00> 000>00>000>000>000>S S S S00 0>00>000>0p06p47p#500)00+7SO' qp!7"]<000=@00P`0S 8l pP 0SS0p021Cc  pP`V@Pp p7@- 8p㳀ᴁ+ p 8l׋pP6A0AS2p'7 ' S' R7S  7{ 20C'pd7l孋pPIK! pPI0[ SN @I [L(HK4p75p0 00&l勋@P{ 00 &p6l}pP~7 0S7 <4p7r\6lkpPl174p207b6l[pP\0S 757 4pO5lHpPI7 k 0S764p7=5l6pP77@w 208S54p,n7SY7Spp5lpP@ Pr Pc 0 7p2#>1PP D@P 0SАKP000@P 0S:   PpP℠E p7K  p8pHK:0; I0KI _p757 U4p7;7  p00CS"M@P R2 0S/ R r0a ! c. Q (0S0000!0ac00   pPq pPjYP@ 7 B<4p7-]~00>0~>>0>S0>0 .0.. .0 .0 .R0> 0S S S S >0>0>0>00>0>0>00>>S 0>74p67 Yp p0Q 8p Q4p m7S37 P`0@0*&7 ;4p7ii i4i i$i i i8iii);c 8(s0\ 7S4;0\  0@-P@ R( 0S%\ ) \ ^ \@ 0 0\0 S 0  0S R 0 000@ 0 0  R P,  R/ 0\ 00 S 0  0S0S 0P@ 0S@@0  @0@ 0 0 0S00S0@ 0\@@  @0@- R 0S^ 0Sk0 0R 0SI0SD \  R0 0 \0S0  0S R( ^ 0Sm R 0S 0R 00 S00 S0 0S    R 0 000 0 \0S0  0SR 0S@0T 00 S @0  0 S 0R 00 S00 S0 0S    R R 0SP0U 00 S P0@  0 S@ y -`LV@3 ^=0S`PVPU p` 0S`` TPR 0T 0RU 00SW `PV p PU` 0S``P p P 0S0SP0SP0S  P 0S0SP0SP0S PQ00SQ00S!!  p-@LTP `P`@@T@p 0-@LPT P@@T0 p-@LT`P@P  R0T 0 PPP@p0@ 0@@P 0-,HLPT ! pP@@T0  R-L@ 02 "0/400 40 )n  R0-LP@ 00'.40r W|2t0|2 048#8+"+ RL05 102 $ 08 40<2 "0~ -@r L +Ȕ\ 0p R< 0p0 -PL@ p[`f \[ V @[0S  [00[0 mT= a0T=[@ -@L`Pfp @P @PhHg -LPp`4@P ep0S  0S 3 #0S R@/g:0S  p-@PL! 08;Pe` 08008phg -LPp@`505`VT@ 5S 5 21CcZ5 21Cc]@02@T0P 2S 2 @޺ 0-8LSP@  080C080A봇9 -hP0L8fe 5@PW@ Xp0(48R0V 0`S=W0=@ mf -0(48LR@0(48R p-L@`PPl=0l=  9 ''8p p p p-L@`PPl=0l=   p 0-LP@P 40p0d0009f0d H 0:ȇ9 -L`dp @PU@ s8;PSDU@hf -LpPd`d@@D@fT8;S he% -@LP@  50@1h p-PLdN` @ ePeQ php -LQ@ 08hǹ 0-@PL--C0@1@P 0h0 -L@ h-  " 0-H.0L000000.0P  7 00000S .000000000'  =` 00000000 P  F 0<0< p-L`pPUp1.GPT@p(1@$R@ p0R@'d10@S9 9  L(@R :0R? @ 1# .0.0@@ @@#@@0SS S S@@.0-@@ 0 S@@7   P@@p @@@@ 0' WP @;OP@ -8\p`Lp P`Vo`1NGT@ 7 0  8p RhQNG8N p` -6LP 7! 8T7S7 07@Pp<S,+5V@ ,;`S $PW 0RVp@W   7(% 0008; 7 {▫07xP'0S 707h\0C7{x9P:9 -Lp%=&0= h0h  `8+7 P`0@ 00 $05ᴇi$9P:9 -`7 LSR R R 0SX  pb@PcU b000c\ 00SxX)Y)Y)Y)0S00IPPX X\ 'D[[ ?04;2S   n#8 -7LSHMb000c00@Qʐ0P 0.RP P PP 0.R 0.R 0.R#8 R% 0S 0 $(, <4!4"<#Q#:Q@Q`Q Q0 0@S QQQ p0   ;8#("40 .0 0.0C 0 -(L"HP  0 0 K -(L"HP  0 0 K -LhHPP&$x 0 $L&  p@帀 p-8L`#Xi@P   ;0 B 0P ?p -(Lp"hOPP @  K0 B  0`%  ! p--0P` 0 @ 0#40V/L    0;#;C40d/  0#40S/ P?#80P/"$ P?0h/ pTbf 0-20P0 @P@D@L 0 -"0@LMp0*00` P4 0 0 }#8 0-0P0@PT@#@L 0 0-0@0@ LP0 -LMSPp" +@Kl 0 0  00CSb)`)b)`)`)`)a)`)`)`)`)`)`)`)`).@K fY00P@ `5>I&40`P0`S\Z&40`{&40`- =4"#400<00Pa7 R(K00P @`  00@`  00 (@"h  08#h&4  0`@0P`  00`P  08  #hP00P00P| > S0C0P 0 0F  P 08  #hPx 00 (P"hjz#8w#89< 49 -"0L@M+pK0`P 8 00  0d0C0t#8 0-00@0PL00C0d0C00 p-@ TL`PP T000p+1phVT9 p-0L` P@P 00%P  0#40 b p -L hP @P&x 0 .0"(0CT0;8#("4@& 0p 00b0 0 -L HP p`P$ 00$,0CQ0@p  9# #80   00b0 021CcP0 " 5/S 0C50%?R0 B)  -0Lp @H`P) P00A0C0" 00 @"$ 2/S 0C50"?0R B) 0#40 @b@ @ -R0 R S * S $SNȠN4 Ƞ,Ƞ0 6NȠN4 Ƞ,Ƞ0 V -L[ R`p p\L@:W 0<S "00PP^J 0 F 4%0\ 1 #      pP2 7P T7;8# 40 Z 0 #40M : ;[P{i[0S?7$1 ,' 00c0 00  R'  0  `d0  Bp0  08# ' < 8 p-Lp@a?0`L(7QA 4%0Q   6PP L(0 S7 00c0 0p7  u -LM`Qp\ P0[ P 0 @P`PP0!P21   o k' g7  XX*0- 0@006  w7 06P$K PR 0"Qgp@d08 \0T 0gX 6 (0 @  #8$89< t9 -@LAAPP`p  2 P 0iSS0S 0  7  0S h0 0h菱 -LM@` P 0iSS' 0 S4@P=0= 6K   P=0= 7 L2S 3"[R=0= n >00Svq)q)q)q)00;'80@0 p 0PU  PPP"[  @P=0= @0pS00P&$2 "!7Sd 0 X 0@0(K1  "[1R tp < @ > <0R#! 08#< 32C0"R`08#< 0<<0021  pPP 00;PpXP\000]UB8 M=0= 0' 0K     $0  0@00ꈎ < 9 -LMpQP@`z \000W]T_ T: T" TI =@0=7 T @T T ]P `0 3@PVHhF( 0P `P= @0=("(P 6 !⾭0 8`F((8"(#8P 7S `("(P 6 !✭0 8`i܈99t9 -L,M P` 0@lHP 0@p PD0p ` P` 0@`LD #D<P`0@ HD#H$8p!,,1 S@ *D  L PL @=0= @=0=(K(1S:D L P< D gL,  04Sa b04S 0<4.J@"!BbH >@ 00. 40 0 DH @0|HD0 0@808L08F E0@$@<`D0@A#DPC <  p  00` <0 `p|HL08008F E0@$@`D0@ApPLC #Dp<P`(B0@!(pD`#L4 (0  (H08@0 VHL< P@ 4PUh 0S 00L H0H 0 $("H0D8S21CqpcH`凮  w|HL08  4` 0@$P`@hP d` @P`h0K4P 0@@@4#D<P`  @  0@@@!( #L4P`  (H`~ pHL PDp 8  0@,@pH`P 0@pDP0  ` p 0@#D <@ P`0@@@!(#Lp4L (,!H6 HL@ LLˆHL !⽪H0$8 0#8< h949 -LM01S /  0@,Hp` 0@PD0P`p  0@ L#D <P`0@(!(D#L,!p4Rp%*89  (K@ &P0΃! PK? P p@P  @=0= =0=(1S:@ 48#8Z0 P a b0cP4epX:d d`0X: S 0PpX): `0X$:00S0S^ PP R+@K  P0SP  SP7 P Q R 0S{ P  0S `@o @Q  0R  00 0  X  P^ P KP L0S  @0S4[SD >  0@p,H`P 0@pDP0  `p 0@ L#D <P`0@(!(D#Lp4 0(,!01& q ,ş8$ 0w PPI  04S  |0Sp F E0@$@Ap`D0@ P #D<P`C B0@!(#Lp4pQO ^0TqXH1PPQ y  P3#  `VX C  0R@@"!Bb> 00 0 - |H0(8008F E0@$@`D0@ApPL #D<P`C B0@(!(pD#L4 (  (0@   PbPU\ `0S[0 $("H0D8SR21Cqpc> 00 0 |H08  0@`$P`P ` @P`0KP 0@L#D<P`  0@(!(D #L4P`  (`~ p@  P@ 000  0 L   )P .@K t P0S 0S P @@T@T@ PP =< #8t949#8 -L`Mt 01Sp 0  0@,Hp` 0@PD0P `p  0@ L#D <P`0@(t!(D#L,!p4Rq*a b0cP4epY0:d d`0Y# *)0PpY`: 0Y:0SR+@K  yP0S0PpY`*X 0S (Kt 0SS<X  ptP t0` vt!p0N  048#80\a0b $("(c Q00\0S 048#H 0B8S0SS"R 0Q1 !  /   8c P=0=0S0S0S 0SR   0S  WP   #} p-@ TL`PP T0 00p+1phl|9 -L`P pP pF @t1 0`! \0  00S00 00$(SS"(08#( 0S7 0S08#(1 "4 0 0  C Cq0CB#4Ac Ba0b @OTP⛥pP U/00@P0@P 08#(ꈎ M-LM0, 8 #X40 0@ bP( Z c @ >;8#(@#< 0 ,;1 08!"8 08!"4 08 8714 04!8"8804!8"4<04! M? 0@418A,@&,( ?$KkA400$D<@ #\#pT l#4<[@<8@ FEpDPCB040[A0!⽥8  $K蜉9 -LM` pPL Pc /1 0,!"8 0,!"4 0, ,+14 0(!,"880(!,"4<0(!!D 0S0 c 0 6 ?$Km!q \80Px 0#40  002<8#(#< $Kh9ĉ9 -LMP pP> `c u/1 0,!"8 0,!"4 0, ,+14 0(!,"880(!,"4<0(!!D 0S c0  0 0& ? Ki! @804 K7@40t9ĉ9 -LMP`Q<  ;pP; @c 0 0   0cS  (` d 6 0$Km0!ĤP8 0@ `@40 $Kt9ĉ9Q7788772 S-L 0-7p@6l 700!= PQ L0S 7  77707770>7S 27 p@- `0@``=  W s2S 7S   0P0+ pM^ 10"R, W?S<< 7k S00Rk0 -@Lwyh -L M4  8s4p4 ? 00 [`p, ZRi Vf P\X00@  X0T @ V 40 ( 0, 0T , = \G 0P2  0T, \00+ S+ 0F0Z[0[`٥ Y00[` 0 V0A 0Z\000S , 0r0300 (K\ Q 0S\P0P  P\@  -L0 Ƞ8^@pP,Ƞ#h 7\S7 V 6 8S,;0,;x=0x==0=p 08Xz  Ȑ0000(L80Q/9< p- Q` `VLP0 0C0^S@0 0C0^S@TtHT`PP\@UDph;V 87V@@$0Tp@,9I:099 -LMW`U@p TP))8)X))U UG4+[0R68 '3R'C@ 08:;4;p0\@<3  3# #p3@`ßl3 d 0 X7 0H8P0ESl)l)) )0ES갡)D)D))Up U 0707 !r 'np [dh2  U)p)))ԡ)w 7S0C0 07S0C0 00H8wIyGwWD W00 06A!~P,;0,;W&0 0rWp00 0g7d 00@ \!<O000 07I'8 P HH뀊9999< xF:Њ9Ԋ9999992c 949`9$8 -LMPp480 0@`W 2S  32C 0"h2S  21CA@cZP]Nu@5S @5@9 T 5k05 -32C@LM`ip*> X 0i 2嬣1: 0%X8#O? @00*L0P  00 J 8)T -LMP@`[OZ>@c40$A$p, ' 0bhP1 0 -LMP@`@O 0pS0C 0 S h|P*>( 0c  ' 0>ꫪ -@Lw y H >D 08 0j00C"7$ $0l"|2  * r))')p@-P \S`0/ S0, S(p$ 00S 100 0P@J0Q@0SA PLZpV \0R*@p0 - @0 0000 L 0\ TP0PL @0Ba$!B30b0@/LP T耖C5010   [0 R!0S S01000 % !!00 p-0`00@L@LPᶝP 0S S 0 [0Q *0 QR 20a0#20p -RL pP@pPT @t&  P E` -LM4@ ,Kt 0@ @ PK谬)($8 -L M0@ (KJ 0 @PK褬)+8D  tQ 0 S"0!B ($8-<JQ !0 S0+80@-@ !X 0lS  1\0}>EN-E8 BS(00"S: 2 1C00 2 1C00)8GD  tQ 0 S"0!B ($8 -LMP3 p0@ 00@ 2KT=2K00<0<P&n:00 P,KC ? ;0 4 K30K1<14 K 0H$K2c -LM< @ ;P6  p  t0@(0@e 6K0P2K<`0:00  P`0K  < @ 0 8 K70K1<18 K 0H(K2c -LM0`KpP@ (@T@U0 00K/KBK, +@ቭP d 400 S ኯ@ K00 R -@0`L`8p峓VP 0S0C0 0t 喰h蔓 -LhM(劫p ,嚓P p0 $#$("(("80CS  M v3(K 0 0K |0 `rX@K| ,KmP X`KWPK000   p 8P  06KR6K +P 00p T0 娱@P d0 ` \0R  t t p0,NP d0 ` \0R/ Y? 0PU<  80Rx0 `Pu d P40S`\0P PP h@K,K 0#80 8s,0S h@K,K 0  0,000 R^ ᬮt0S @ 0 | 0K| < 0  DK6K >K2 3K0E KF0KF K 0CH ᦒ0 t qh@K,K 0C o0l0   P T0  `"`0`O0@P0T@d00d0x0 l0R0S;x 0@ 0@x0T`Q |00C0 0 Hx 0S00C0hPw `P``\PP h@K,K 0lH80 8G t 塯tp00 WP ` \0R@ 000 ) Th@K,K 0?80 h@K ,K0/ 08L@ 0l P0T@a2c X999;cL%ct!h999 -0L $!$("( BRhGhؑ- ^ 04"48S 0 000^: 04"48S - 0LS! 04"48S he 04"48S0   Q* P hP p-L@Jl0`አ\00S PP 80R 0UphKQ;cx!hL%c p-0L P&@P 0@0S (@p`^`P  0 )@p@3?p@ -L M`!P p,P @-  0^ 0 P000  00(KQ! (0,K PP,d0  0< K0#P  t0P, p 80S D i 0P\P\00SMP k Qgd 6K@ PcTq2 R? BTj0 S@@@ 000,P T0  d00d0 R,P ,PLP0S} 8"P0T@42 P T,04 &>rD0S,f#Ps< K010!\BDY5 ,SP`D < K00\!GP0SU 0 kDPPB ,1P> @ [0`080S* P% P,, d00d0,/P00@P0T@ @@:@`@@@00C0hT0S~DP <0< K,094.82cL%ct!h(;;cl9L9;c 9 -L MŸ`^P08p dlQUF U: U (K8Ÿ80  0 0@ 3 10 S W R !QP0T@   00  0S pp!80(KoW PQP00 d08;d0@@`@(Ko0Sh0W050 P@8! yd0 ;d00`S@0@ PP 0 R 08 Q0@P0T@s@0 (Ko=|!h@9!hL%cc ) 9@.8t!hx!h9 p-L MQ@P` KpP * 0< @`2^$ 0$PKph@;cT"h -LMp@J`P< 0 0    0; 0T0@0 0@P0C 0@P00PN0 0C 0 P0p 0,KrK&K%PKPPV$ 00 0 K<hcT"h -@LT @T 0 R(0SC \\0 ( $0S,0 Q 0$0 @TAP"h -LGP0 R R 0S00S000 RhIc p-TPL0SpG80 @`T  @TphHP"hd2c p-L@刎PG$0`0CS04S U 6,0 R  .HphZT0P\ 0S0S  P 0 08cc 0-xP@LP \ 0S0S P8 )cP \0 0 0 000c -L@ P04"48#hdV&ڲ1 0S*jPP  00d 0 pGPI 0d0 0 RX RE R o%$000od 00 0&@T 00S1#0`AqpV `V 0 R4S  x3R Q$00CSX)d)d))d)4#000ofß000& 0SG 000oUŸ000& 0S0R 0S QQ 0 R$0 0P P 0 R 0RP{ ( 000$0Sz r:Sp0$0m!0000R 0S QQ 0 R$0 0PQ PN 0 R 0RPD ( 000$ R<02&8 0$05P5 0 0R)@T' @T$ 0 R(0S0`4S2 $`"0(`(0S/@$@!\0(@&0$0#000oo,0 RT"hgfffP"h -p-X0LM ` , 00 P܌@P  ŌKpT"h 0-PL @R 0S0S R 8aP0  00   0,0, 0S  0c -PL坌`E0 4Sp$  V 6@ 0(0Fhwp  @=$@2k! 0(@P"h l0l -@@L@L0P k00 t0@ @@ 0hP"hccȑ9P.80S S  P0 0 BQ0S 0`000 RP0S1 QQ 0a # <4!4"<0 -L M0`PCUP KspP <@K D0 ,0K+ K(  TT E R0000 0 IFЋ60 `2i -L M@Q Q 0 R 0pRQ000T1Sp$K06 `P `00`0  0\0@DPK0 @ 4K► hTP pD0S 0  0 000E 60 2`p1i -0@L H0S h@ 6D -8L @.PH0S h#@  0- @PL=ᇆdP (0d00 00h 0-PLP T @0S(zT00 -LMSPpQ 4@<`KT1SV  PPG? (0S 0(0 0 Sl14(0(0(0X0 0$0Tp0 06("8 (4$R3 $ 00H06("8 " R.UY(KE0SDu6P(ẬëPK6P(0H06("8 d0S0(K0 d i  0-@LP~T00!R00P    a6`K$T T6 0 t1 rDK!*44 %6 FDD X0 0\8 `KDD Fii@ii ؑ9Q Q 0 R 0RQ -L@0\\ t0P6 QQ 0 R80T H0Td2c!Q Ƞ Q:8 10: 00* 0x"h -@HLP q0H0 -Lp\@P` 0S s 00S" LP/R000  00@0 `ڥ ŷ0S 40S 800R lP t@TT S110S 0R0SQQ 0 R8005 0-L@HPP HP 0HHP$ H{@0 Q Q H0( R P0QP0 L uH0S 0S$0S(0S X0 Q0P  PL ZH0 p-@P` PL =00P30800p -LdMH@PT `xpKH`@ &d0P t H0 008Kp0 l `0d @膭d0ኢKn 0尥 p-L@` 0 \ @P P 00P30(00pphT -@@00LDHPWl0 $ 勄勂? R 0 0 0 R000  R 0000 0  (00C(0@h׸8|bh p-@``LP  0 P  $0P  (`ph7599 -<L48M,4pLPK`@!<%K 0 L 0K`嵏P0K @寏 @p$001K -(LM"(0 `0p8@ #, P @T 08 40 @TL U3SE l0  ,0S00S` 0S0S0S 0Sf , 㪴P0S^ 0S[$0SX(0SU0S<0S90S6 0S3Z 0 4ZZS 4 8@ @T8(Kl0,(0S Y Y30S80S , R ,Q80YS, R 40S80S0S0S0S 0S 0S0S0S  8Pe30 Sa8@ 0S -L Ml 8 < @4 000 M t1t!08!(#R!1Ph Ph0!!p!11p1!4` 0 08Q,8 , , #H08V#H # T00T03S 04,4"48 #X@;P`F <0t,0 P8P1(K  ^P ,P喏(p0 ;c;cLch;c;c -Lc8>cc -LXM4`K@p 0 30K4K0@ &PᄘP* d 00S%t@K@ p` 08 $0Kl D p夝P$HHj$PD0 8P _P KYP>c* p-PL@`P= `~P 04$48# X  h~ph:JQ':l0Q$\0Q)*\ \04"48# Q\00AQ h0 0QS 0QX 0X0p\l S\\.8 -0LP `0>c<>c -QL M@`Pp@ $KB70S S *@$ 8` `y봀@P" PUP0S@|N @x@ 04py@P>c<>c\dh>c -L MKyKH 0Ϡ< A$0/@#b  8#" KQMb -LM0Q  ! 00 <2  K  -LM@0 P`JP 0S EAFU(pS 0!08PBU0 0p1Z p, pPw 0`S S U0S S@  U@UT# DSSPd`  V   1Z<1 p(KQ 0 0 Q  8Kℭ0 7 K80K0 8K40 力PP d0 4Y P 8Ki0 7 K80K 08K 40 oP\ T00T0A͘pP  0 0|4P忘gfh -LLMp@ `04"48#XdU&000(K 0$U$Q  0/P %000 `Pp%0000(S(p1 0  @AQ**| *0 *0 * *0 *0 * *d * *0 *0 *0 *< *5 R 4 R1  000{4 R U000T@ڴ000T@ʲ1#U0 0U R 00S 0)SCU00U000}4 R1 001000,K 0 00Pd,`0 1||3 RU p3 RQ T#U  10URPK `@K opPK j f0 LKO0KPKo0K_0KpK`K \K  lK(  00Kh0P 2 R# W]Tk@pTf,*,*,*,*$*,*********** @[@Y@W@U1 (0"0PLU900 gd@@K 0 ?0K@ K0s S<0  0<0 X |P 00X  0SB3 HP0  09`P000  001@PK ɫ0 @ K?0K0|<0  21C0d 10\ 0(  H0 0\dh>c>c>c>ct>c>c<>c*\ch;c -p-LM` 0,@0 K{PP  M4{Kp -PUh#0`000L0Sp  AR00U0S1 ! @ 0R:0SS S S S S S S S S " 00 0  P| 04"48#8SWQ    0\QP1! 1 R@P 0S!ԑf(0 (0 0b0(Ua!0U00P0 U00 UX: 00 01D 0NS@: 0, 0N, 000Q 000A ("(04"400  0>0>00>0,l 000U0S 0("(04"40+!AP N\dh99 -LM@P  P h p- LM@T`@PK0`0P@& 0T PPd@PK ![0(( b!("( 0P0 xcc@>c -L0hdeh?c 0-LM @K`3PP P  0R4K0 -L$MP@` p;l0-@   0 K0 # 0 K0 Pl0l0`,y@P> P" 0 0S`yl00 Pl0l0`D@K>  0}P`DpK ۩0 D0KC K\08# 0 K=K>K?Kc0DpK ©0 D0KC K -L MQ` 0SP  K ŸA0`KvP 0B!S#********************@*h***$****<******-P&R 0 P`uPU 1 RP÷ x 0 Kit X 0P Kit 4 0$A 0 @t`PV, @0S0p 0 pt뼀P0S~ 2@A3u  0x0   KiUsHp0Sb 1@M`%3Y@?c>cg>c0ghDgh>c>c>cehfh p-d@`LPP 0S j000 0`P 4p`gh -LFM10 4! l@pf4Pb 0S S(EZ  0R] ;`0 00 0ŖP JK ᬨcXghfh>c p-` 0@01PC e BL❦ 0!0e 000e0 04"40e8#8  $#$ p -0L `RP opP 0S $PP 0@010 0  00  @X@D0P 0P0 00k>c -@L+T`p 4 |PP  00D#1 p0i -Lc>cfh - @LTp l` Py R0P00@ -0U0C0 $R000 h>cpgheh -销L\ p`00S 0CP`P1@ 00S 0CP @T 0 00\@hh>c>cfh 0-0PLP @000P0@hhfh 0-L.0PPT 0@0C0S0D 00 0T(@P 000h/@hhfhXgh - 0p 01 cQL * 0  0Q  0q03R0S %000h刧d%00C0R R00 \ `0#$0$(!44"S @ D0 $!$("^:@T\3  04 !4$ $8(#8"8PnU#ڲ 04"48#U  !04"408#8 $#$  04"40a8#8 $#$ T0 `P $ 0 $4,.4("(8!(#8Rcڲ 04"48#(Q PE R0<00 ,#@U00C0Y 0S00pp @T0` 0#$04  04"48#Ƞ\ 04"48Q#h0\s0010S ceh@hh -LM0@KpP ( 000K/K,P @aP? d` `1 R; ` \0R7 \+1 + 0S> 0S? #<#<U(t@pTQQ 0 R8 0 S  \ U K'1<1!4U \8#8U4U8#8U>c -PL00`qc0S 1I2@T @T 0S 0S 0S 0S 04"40g8#8 $#$(!"(  $ $)"(04"48#XQTF "똡C04"4R!`00`0m<`PO PHq@D1  Q ;$N Pd00d0 000 `P`P. @00@0P0 0$q!$ ("(04"40ꄠ40040 |0x0 L 0  d00d0 00 0@hhfh>c>cpgh\ch;c -L@,rpP b000 R P 0@SX00X0  i^r@P 00 0 P 0@SX00X00X000 0X_0<ST 0<SP 2000t00t0{!P000 04"48#X000Ź Q000ų 0S  b_XP UP& 0S% r R 0 R(00(0  iiq6p00p0 E@P000z Pu1<1P|  | 04S(00(0`fht>c -LB <P@?c p-P ML@Ÿ@ 0 Pߥ(Ÿ( 0 Pץ Py AnA#!B30b0020aA   R1P\!* n4\4*0 R0S 8ChV N#!B30b0020a4A\4:1P 1RP1A)㰡"("(0P210: P   @ Kphl0^d0\ Ē9pgh̒9eh;c\ch=c>c@hhx"h.8Kx.8oؒ90ghܒ9Dgh9ehe>c>cВ9 p-LM@0  Q0e `d PK  0S S S! S Kp !K 0S08# 0S  0K"08# 0S0![ 08# -LM"2P0Sp: 02K00a 04 @"48f#8!,# $8#$$. ,8#8!8Sc -P p04 48`G#8SLB*0S010D fP9*@P2 ! 00 A0p! P p  㫚P@ ⥚p 04"408#8 $#$  0 0  0 ㍚p<h -LMP< 0p01 cX80 0((K 804"48#8P, @4 0 [0 408`04"4:18#( 0 :04 0 $#$("(Q0Ա40:0ı0c 8#8 $#$ 4 0P ,<0 S04"40 <0 P0S? !x000x0]4H00H04 04"48#8S+@ `PJ 1`80 @@S00!1,(01(0 @10 0 0|202, c!,8#8 $#$<0 S  <0 PP 8x00x0>\ <00<0 00pcW7/ <00<0202%fh<h -QL,M` pP0 L H  , K,0pH0 PP 001H0 0<# u VD KT I <P 0Q =000 0 00(  0SB q@ P d04@z p5]j \d0Yl0  0ST80 0 0Sh r 0s V 0S d0 61P+ P0  P' 0l $#$("Q(P3:1<10S "jP lQQ 0 R@ DK3PT LT0S i(KDP ą0 0@0@ 0 H0L! 4  4 0 80080Y`ir<!7 0\10000X ! 4  62 0S QQ 0 R80 0 R 0S P0S 6 WP!< (0R$0S.$6ST"3PT00T01<1P0V0 0S X00@00 04"48#Y: 0 P0Sh !Hx00x0奿 0HPS0@0@S) P d0 X0l\0S\$!(PL00L08  均P APT00T0+D@K D`KT@ PPL@ W0HPpT 0U@ 0 : ]U$ PD00D0202hfh p-RL@ P` PE@p@pkS dS4S 0 PphmSnS(D1RP5 0 0 0PP@ 0S60 Rl0l000l0l0P@ @T -@ [0 0 l00@0PP 0S@0 S [@ @@" --LM0 0 P@l0 p`-00S,* @P7( q0y0 ` x("(04"408 P  p0(0 0H  PAQ(KQ`0P 0S 04"48#8QS0S , "\00\004 40fhDhh --LM@2pP( ,2U o PUE @0 l0l@(Ty R 0S8 RO( R 0RX"  !0P@P l t10S@0  (K 0@P0 (0PCt(r0(0 PUX" l 00S@0   (K 0@P (0P @p$K N(L0R 0S 0 3@004  B4 0 3@NDhh?cʚ;fh - QL`P0@* 0t03Q0SQqa*Xa*a*b*pb*b*Da*\b*b*(b*Pa*b*hb*b*b*a*b*b*p0^ Tx p i 0`S0SM 1p8pTg0 p V+pI |1@x pP\pPK !0> V8p( p_pp 0S0S/p0(0p-p5p9p0 P p P p8rhP1pV 0 ,忡4!0y`t帡?c?cDhh999 -L<`@41à PddUp !@0P0@AW 素ᶐp' tf/㗕|Q Q V# 01V 4 #tfi4<e (a 5iphh@-@1M    QP> (19C8# ("(8S 0 Ӵ (B(R bA9C08#8(R00Ӱ0Ѡ =0 0S01AS0#!8#(B8 CP&8!̱P ü&,0 0 20TDiBN|1S(  S < t0b? S  -LMY0PS S, /(K 0, 40 0 (0*0S`` @ @pP7 ,D 08 # R+ 1 7( 0<, 40 0 0` ,`0(0 YP PLa`` ⬔ |⨔00%(@ 72 <(4"4!<0 <(4"4!<,0 0 0D ("(04"4 0 :#40* 00S  <4("4!<0: X2T"0T0 <(4"4!<0P <4("4!<0Y RQ R, 0b8#8#!<80 #80!010bAY 0S|RB R, 0b8#8 $#$(0"0"(`0!0 Y R8 R/B 4  0j\0@0x 0 0 % 71Y,0 c("(04"4 0!1Y ^40h0q  x0 0 Y Y D 0S;04 2<h (@c>c>c -@Q`RLMQp % 02K R RP VPU00U0SRF R R @00`eV00S RU 0BP U0 0 ん<( 4"4!<0 v <(4"4!<0 0 6S-t0`0@1A : 08#8:AQ00Q000@ H 0?0,qi@ o?cTDi0@c;r* -LM0`S Y0S S0L0X  0!0# 0 " 7 !800#L 刢L0"HAB~drd2, P RfL"0S< 82* ! BR0 0R000@^ !0?0pd1@0Sd!00da0㼀0  0,`1R0|1 HL!`o{P!> 04@P`1dA@, jQX 7 8 00#!L xf^/  @0x!|1H/@x o 21CU @ 00P!@ TU@$5i5i?c46i@c@c0@c;TDir* P-L@ 1T T @],aTPl0'@(@Ca<0T!Pl0<@C a0T!;@@c -LM@P! X D! P0 1 dqK ` `f! kX-0S%  0 , K/PP= cb? 0@X1A Pp0P0MPd @0 0@0d (K|2| t2RH (K  P! 0 0$ 1 `P  㣑pPx  X  t0 Z 娀\00b  Y *P 0a a|S0SD0Dp0P0P!= SA `0`S$ 000  崐@P  Ud @0 0@0d ,0@P !0q [0 20   0 p0R0P000:0:HTP!DX} YTDi@c(5i-c -0rLP|`V@Pp ``P |!R2 R(0 py`X1ų10S S03V`!t@V@!@@3b/ R8 @D#h.8`#hx$ p10S; S AgL!0S01S 1 \P R8 0l@Cx9 l0 0lpCWp1`0%Tt h1l1 |S 1% A5pg6R R @x0 R0! S 1 !T0 R l00l@C PNNl2@2:`p`@c2$@c9>c -|0GL`@pP PU:E7h0R1\XP @)00PR1hM=@-c -LMpP @0, K`P 0 0R ( (K 0aS0BD 0a0bS #P @l0l <0 l0w0w000030S S,0S H 000 00PP 0 0 rP Po D@D0t t 0S "2S1 `0 R!t0:t0=t0Px T0prX1P hRT!00 001006<2 4!0$"?08m000:Sn: S7 100! 00&?0mD R1 0cS!`> 0@P1TATC.P O 0(@0 @ Y h90@P !0 80NP00A:H Cl0 DPM 7< h;TDi(@c?c A-L@J 0\:@T 0c 0bS R@TH剙0D L1M0L1  l Bℍ 00C 0 9 -6| 8SLP@p@T  0S  ِV,  0@S&1 `0V 00000 U  | R l0 0 P 7HwP |0Hot04t0t04t0Gi -LM`0 ᠎P P  00lSں 00lSpWP, $ 0! lPU0U0 P` 0O0@0@ `M0000e0     0/8 4 0 W  1QS P R0000 0$ 1Up 0 0lQ0@ @,P尀U㲁 ,0S0,   0R (K R 0` 0R(Ko 0 Y  0R; $!0000/ 0a1 0@ @,P尀U㲁,  0@_8@ 4P @P@P@ p 0,@ /8 4 0  s R0000 0  0R GiTDi --LMx00 4 x0KH 1 0#2S S  (K 0R :Y 0@`jT,` TPP P  2 @10\1 \( ,0U9@T 0,#21S  S R0 000`n^,` P<` ,  H $0$$@X%4P,̂&.,%    R  R > 0P0"!U00s UK 101P=P LdP  },`,``,` 0   (0 d w  80KP 8 0R:0[000N  R 0S0sA 0S0S 0s7 R   0S0S0S+ @0S' PP <000  0R0% T:Y PPE UP  @@ R 0S PP M p;R  G  CH  <(4"4!< D0  <4("4!<@0 00 + ,0Z@ 0@\K d@Kc0K0xK @KK0K@GK0 ^  ^ ( ` Ҋ <  Ί0 0 RS02 J@TI \ 9PU 0Ro @#3RX101 R |0@  @|1S SPx9A ,@@w0 00(, 0vPU R 0S:D R \ 0`@ P1#  @ 0 0\41ʴ@T H0K0(  0 PHQ @P PhȟX!0 b0b S0@ @0 \ P@dPX`P a1 n0dPR ?S0 0,1(1\ \ \| HQ 0T!R D00bS0c^/V !R0B" N1Ɂ ,0^0, 0O0@0@00 0, `n,` 1^0n Σ 1ɱɡ0,` ,`6VSʨ@ 00c0a0PU0U000O0@0@ RP 0R P U]t0 0t0# P @ 00cS10cSn U = @ 0(nPdKsKpQ Qz 1P0P 1$0 ?008h70S @0dP`XPP0S3HQ D T10bS00dS'ڨ@199000 0K  V101 00cS10cS0O0@0@e`,``e ,` H0S DT10cS`!0bSIڤPL  `1R 0R 0RL6 S=&02 ',4 = #P 00 0B 2  80KlPl 8@ 0R0% *8” @Pt0PP t,0O0@0@t0@ 0@d0Kc K ` 0KKK0|0 K  1AQ T!D00bSJ0 @PR00U0S% ^0S9Q `10cS 0\1D T!,0S0 P 00cS0`S 1S:6S  dP`XP (<PUTDi?cCi?c 0DiPPKc49Hi-cDi?cCi?c?cHi 6i;Hi 6i(@cH? @c (`PVu U 00lSg00[q 6S7 1Ũ@t0 @UAt@3 0 0bS.000!0 !? 08zg@t0`0`SS1R!P1Q!]81S \ cn 1'0 1,0@S9@0L0  Z?P  P 6 Sʠ$"P00S P,`P VXPX 8C(RR R ʠt 000t8C80CS@*X* *X*X*̝*4* @0bS R 0bSQ0PU,0S 0 R0^0000H00 SH1 @t0Ńt3P3Cf0 |1S S  @,A  4u@,4t 0S @ PV@4P3Cfy 06 0 ( 0 g 0 00j4 6`PM J 00cS ,`,`C 68C QBʨ@ 0R0S  $,0K  @t0t16S# S ʨ0lSڨ%6S$! 1S !10cS000ű`l/H0 P  @0SH08\ @ <10cSpl) 1S 40&@0?0f A$1T'P1#0Q  !S | R l0 l V0br@< 00t 0p!0bStŨh1Vha 0 0bS 60CSoL***h**0P$83CevT  rT   x8 P3Cej T @0  `(0P ?0Pe  r     0P,dKK 0PP f p 0DP` idKK 0  &@t0t00006@C a f00 cR 0ITT10P\1000 06D*@0L*?08+et0`0`S 00C0@ddѼ _@P`@P,`  P 0@,A ;9[\!0 0bSTR,/0  P dKHKK 0@Pp,P+ P  P101,6V@P 'P 08Vl,`V  0R H1 0c0cS000h0 0S[ Q! f  00cSڨ @PP0 0C0b0SH00@00L10L1,`8#P<0 8 0/,`1S1R!P1Q!P1 =QX 1$@Pt = R T  6  tU0P ,0@@,|/0 U @ | | R l0 0  Kt0ătb t0tt0ătS tt0 @0@fP 0R0S-dPX`P0n aS0 R&0P000 @@,0|O0@\0@| | R l0 sX 1@t ? R T 6 0tU0 @H0S @0S ,!S0b`%S:, (10(1  Q0P@t0ătt 50St xHnP @|0H?fTP T 0S @T`*Pf ]Tct0ŃtW0`00 f M @@$608#868C8S% ?ڨ  1'0 1: HwnP |0Hft3 :c,T@PP0 GP!P$1Pc8a0'0 !@\0 0@\0`@@$!0, 0cS Paj ,A(AS,fT@"P2tb-p"c 0H 0R0 @0S8\   <10cSl 0Pc/00 S  | R l0 F4t 0p!0bStŨh1UhQ廼0 1R& P40 0?0b1 < 0  t0ătt0t0S t0@PbHmP @|0HeHmP |0He(cX ;TDi?cHi(@c -L| -0-0L@08C8A9Q/h1 !S0 Q xQx<0 / b&8 S0Һ6 xB0@c;L9 -L`Mt |0Pe@t t`het`f 8-400`S:70 10 0h0 2t0ft`r 0\ `1`!R,nx Vx0xS`"`3 ! 13^hhX0g0V1!X x0d d X@d` P0\b0c3QX` . X hPt0 \:0 t0|1S Sd S .0t0 t(K1Sh r0SH1X:S0!0bS`Q QH; 0b` R0a0aSTt 00aS  0Q ^ 040@ t ;ax ^hhX|Vy,a40 @ foj p aX pʃd XXp H r0 S X RT0!0bS&0ODH0@p)H0L@DሻpP LIX00S+㛻1 0X0 0"X0X0x ` 00 0x 0S0 (p  (t00t0PpP lHX00S 0X0 0X0 0,0 x0S x0 ` @B t0 1R B X40 <(4"4!<0p <4("4!<\06 X0`#P7P` 1Q!0\ a7`2 S 0S0S"("(\0 04"48#800 cQ0ՠ0 ڸ& 0Q 1("(" 0 0202r R 40 1 0cS!0|0 ( |1S S S ("(04"40| @x00| q0%00|S;0H l@ t tQ5l1l\l@0\0@0t` 00 0t`P  10cS0``!t`dQT 0 S   4X0|0 T ,< $8 #$,,p.T0K,A  4TK 0T| p ,dd00d0Pğh00h0t0fh t`    Vt0 `t` 1 0cS 81!S3 <8!0000@ 0R #0?0_40X?0S< 09406320@(0C8#,("(#80 0l 0|.|H 0Vt D0 p TKp 0#10 " 0t0$_Jx 0PU7 t 1@0S0KT@K 04 4(KTK 0a@=t` & T"R1p < 4("4!c ;N`9Hi0R1\R!0  Q 0-LEM|0@g Q 0S- J_K  ~K -|> -|< -|1S# |8 -|( -XK/X0T :0X!K0\QL)0DH -00|, -| -Fi,FiHiDDi p-LD@P`fP00T00S d0php -D@LPpKT Pg d0 X0 00h0W0+P 7S -@ML0  0 @ @K0*М8Hi -L Mp@Q` (K0S PPQ 0@SŸ3P8 PŸ. P+ U V' 001@0 @ 0L Pi @0S D^ < ,$ !$0,0cS10cS  0I1 RV @ 0@P< DZ <,$!$0$L0cS10cS`F0l $#$("Y* h1Y,*t05t0 p10dSupA0^/t10 00j3PAP @Pd8@K} P8K@7K` 0cK4P 1Qt05t0<0d?c)Ŀ*Hi*>c0* -L(M@PQp` (K0S0SJ UU 0ES៕LU UG 1 R VA 0S ]  0R:<KH}  <0K\[#[P0p3UB P3 @08S D^ < ,$ !$0,0cS10cS04 0S0S s嘐 0pP 0SL03PAP @P < K0P4)Lc*М8Hi -LD@@68C8S S\06Oh6S,0 R3QAQ @QN 0-@LTP R0000 0 o*@T00Gi 0-L@P 0000GiTDi p-|P@L@`t0xPt06t0 @\D@p0t0[ p-6| SL@P@`h 000<U8#L00S8C88#ph06 00 0TDiN - LP}PPpN @p81@P0.@7 Za@@ |ZT  vZ 0-S00t00| " 0C18#8(BQQ/6ڀQ0ü6p0 $1 1h!l!l  00|1|1 @0@0  w x DPGi@c*.8*@c@cB?Kc>c -L,MP@ PL0 P T ||0@ @ H0H0 Pd`X0`0lQ< PO 8$0@ R RG T P  @0P0PP 0 0 0L0LP  ,<$4 !$ 4),%c>c (@c -@xLP|P`F |P4 P@, z zp0:0`0#$#  #   0 g)0(@# 0 0S 0 0 P P1 00 001@ ez0+ 0 80 0(  0@`P |1S S(0 0 S0 0 0D 0 00(0S+}1pᘳ`<h 0-L M@PPf 0@@X 0@Px0 h0Yzd\ 0;S<00L 0<0S<:=K0h (Hil9Git9Gi,@cHi h<h*|9d d0S=0T 0S00D 0S=00S( (0?0c0HiHiHiHi;gfff -L4@440 (0!nj h7Hi(@cHiHi 0-@Lt0P6 S `0P T 400aS0h, ,0 ?0P3YHi(@c;Hi p-L M@t0`V% 40040&(BP1 R|0@  0 ?08YKph<00<<0KphPʄ0^x0l 40`0Q*80 080x0LPP_ 0TDiHi;HiHi(@cHi -@L_t0p0 h,00,0&= R P0` r0r00r0p04h0a P * 8(C89H C1S01P:000<00TDiB(@cHid@c 0-@Lt0P0t0k0hT -L0M`t# |^ p!0 RJ70cS608#8(R62 &$  $ 0S8<C@$ Kr(0-0(00 h1C1 S01("(8C8S&ƱS0ü6 "0?0"X2 R$ |@T! 6Sں6Q@0 R >P d0 X0 |1S (PP X0Q 2e6Qʰ0 G P!P 8QPV$1 AD10D1|c-0100tD [5t0K^?0 4KDK(0LK40 0@K x|0 00K/ K(0T,0 (0Dk_0X0dTDiNB0@c;>cz0*Hi 0-LP@@@wWT0 p-|0L@P@X`zP 0X`P h0R:0V`1V GPPD!phIT0\ QX`X(!10bQ 0 0`V`!pl@cp@c-c p-|0L@@PAP 0`00n `S0S0\10S0GD V ph40 \! 0 `\!ph@c-c -LMp`WP P0SR@ Q㕏K"! * @P 0S:QR K/J@PS2[S S @(KUK|S[P P? C8K k&PUK HKd&@P c -QLM 0S K0S0S P0@ SAP T \  0 0HP膿0P @0S   0d?c)Ii\* -@0@L@P@hK --L␩PM000` 000 , 0@#2S S/ ,(K0c0K 0 Sp p *:W 0S000 0V $#$("(8#X 0 dR' U00U0S 0000c0K 0 Sp `p * 40K⸰PZ 4 0R0%p *(}b]HK0Y0 0S 0S0s 0SU 0Sl0 : 0Y0 0cP[U^ U d@Kp0d0KcPK06K1  T7PU h l0  Y@(YT< PU @0 Yl0 000c2  (0V0(06  00S 000H0S 0sAY? R00d00dSPU`#0RYV ,0S00S40S80S0S< 0S9$0S6(0S3h0S> %0@P7 Y h0l t50Sh @0   h, K 4V h0l 450Sh @0   h,K 0hp吧h0dK@ P,0]P, 00 00,0 @0   hP \Y (@ p0@PU 0Y,0 l @40S@0   , K3V l 40S@0   ,K 0Y l0  ,0S,@K @0S@ )0ںV l0  ,0S,@K @0S! 0Ǻp @dKP ,0PK 00 0ih0S Y h0l 20Sh @0   h, Kh3V h0l 20Sh @0    h,K0ph0dK@ P,0帽P h @k7dKo0d0KcPK &K 0`0 , doP@V"Y  0> $0"!0Y$00C ( |ѻPUD0T00! 000Y: l000 .(@  0@9P#000 oPj#0Rf8 R 0R_( R 0RY( h蠼Ph @HK00l  0 hP EHi49Iiʚ; -L㝹Ii -LlM@Qp PU (K`VP0@Sl iPe P 2 R W 0x S 0t0 p v L0KLK0 nKPKL`KDK| |x ,c4 LK P2l0 Yd xt 0R:0@Knh`K0 xt嶧@`PKn0 g0KhKnx ,7P PXG ["[pLK l08l pLKL KD0K |0 DKLK Px p uDKLK }P hLKD Kl  | tl pLK l \0T Q[DK"[0(+P6&)Lc\*IiМ8-Q@P P*R 000P: 0:HIi@c -LMP)0Kp @)0[ !#R)K R ᱧ (0/0(0(K%aVT 5,  , 埧001S %1S L5,  , 叧0701S1S1S ,1S Q ( BPk$700001S41S81S 0SN S 0SD S00S S000(1S 1S  P @ @ 0 000 ("(04"4#0庐(1 0 ! 204 40)[Z Z p#(0/0(0l00S 00S0 0 0``000I(0C8#8 $#$("<8"( #8"000 YB U)@[T T` "(0/0(01 00S Sv) +0K,@0+ K*K*0KL  0*[48( <"4!<#,## 0000 1S S0 R0 0(0C@0@0@0 R00C@  00C@0@0@ 1 00K(ۥ00,<$"*)0+ K00(0C@   00Kå00,<$"*)0+ K 0嶐0+ K*K*0K *0[0 +0K⬥ 0 㦥 04"48#89C40HIi>c -LAMxdp +0KPእ+ ["2S S (00(0#(K 0S :"2S S Vx( 0S*ᳪPP + ["2S0 * K唣0S000 04 8<,<$"* * K{0SWQ )W( 0S:W} )W@G ,&=P 62 R =KK,cmX 0 +1K,!K 0(1 KK( g[@P d0X<00jO0@W0@u )W,BY LP  0938P 00 0n @ 04 8<̠<Č,ʠ*K) K)K P>  048<!$!0!̠ 0)0[:("#! !4!(0 *K 0)0K  P  )0[R 0 0Q@mPPc000 00 0800@X`@$00$0(80 0@-@$ 0@0 0 0 #EgvT2ܺ -L@M@ hKe ph( 0 @ 00# d ,0*0 0#`a0"00# \@dȟ0! 00#X@Dlŀ0 0 0#T@$(0, 00# P@ b* 0.0 0#L@0"00# H@ǟ`0! 00#D@̀0 0 0#@0n)+C0,0O B0#  <`G' 0.@0 0#@8@@dE0"00# 4 0$00#0`ǟ` 0! 00#, ǀ0 0 0#nd@& 0. 0 0#  -P@0" 00#<@|0!00# ` h@\Ɵ0 00#lƀT@<0,00#@@& 0. 0 0#  +,@0" 00#aX@0!00# `D@ş0 00#̀0,00#\@% 0. 0 0#  b)H`E0"@ 00#@@dF4@0$00# ` ş0! 00#ˁL0,00#n$ P.0 0#  T0b&P"H@`0"0# ğ<0 0 0#lȁ0! 0#d@d$0, 0#  HX0b. 0.0#L@, 0"0# ğ@0a 0 0#4@ā0! 0##h0n 0,0#\@  * 0.0#P0`0"0#D@ ß0 0#ll΁0! 0#P#,0 0,0#`@ 4 b( 0.0#h@000# L@Ÿa0 00#lˁ000#T@"0 0 0#  % 000#\@|` 000# @@\Ÿa0 00#d@<ȁ000#H@"0 0 0#  ,Ab- 0@00#@@PQdK0P00# PP4aX0`00#``Xe000#<|` 0 00#` \lˀ000#D@? A10N@b@P, P0@ R?W@pG 0 _?W@P0 W(K (KoQc@, Mc I,0!pc?WP -L$M L 1>?0@0c40 S.,0.D < 80 @0 L0 #\##4pmvmznܼNS @L❀fm 00@0#@D@H0g{  0  Pl PM舂0na0 P0#    P T0` 0fk00#̎00i$ 8Pl1 X0  P$0 PĐlq dK 0'b,p hQdp` P} 0P `p h 00lˠT1P $Z g{0q 隁 0ppfKXa0 $!@ 0 @@Pa018Ba  n @ 0@ a0g{ e[lp @  0@p`dI 00 0 nb)h0Hr `la p `0 01lip 0  la dKa pPcH0gy  `0`h P 0`l 0` P80hh  e[ 0P 0T P 0 g{XT˄  0 aP 0PP0a8@  0  hDL1fk e\ ᜐ@ 0@ 0h@ lˠ K Xp! `0 l! !0p l0e[p  ab*  pL0<` ༐  0` 0L!`dK 0}  Hࠕ00! b+ ! T1` ` 0e0i  0 `, 0``L0lʀg{Pp a  T P\vfl0   0p0p, pP0ig} @,1lA l1@Pn 1 @  Pfk @P@0H` 0Wl1 0P荁Pl1  00lˠP g{ 0 eZX0 pP `  %8Pj0$ 0#Wh0 PdKPHahnਐ0*0#  gT0 !P`Xj`@pì 0. 0#  (xT1 %`pmnpX` a0,0# @ @lL0 &pe[zlˠ dK 0  0# fk '88 h0  (` T j0$ 0#a`0g{dKHP0* 0# h )@Y@0 P i `LP !lɀ` Y0jfj 0. P 0# &PnPP ` 0,a0#@@ d0yflˠ ``dLp 0 0#]jX1 %pp`gz` `L꩎0$  'e[ 0#` H0d g{p dK0pin0* &0# P1h fk (  ሀ hpPj ̀ 0. 0# !0hq 0`[\b,0b;(! 0`Xq n0,lˠ@ a{  0#T@I`!  0P!` ꪎP$0 P% 0: HQ 0 (夀,`L;] 0p0Da % 0dc (K -0Q^q?`p@PfUpLpV@@Z* Q :@ @0Z* Q* aoy[@ u[ @@Z`* -L$M01>?0@0c40 04L0 0^#<<0 8 0@ #8D0 L0#\#pT..l<[#4)KD[<*K4/0K@L04 00K40-PK C.KP H +K,pKH0K  U 'DH  0#<0 "( 0#40  Q \Z(K8Ac< 0@-@0@ $0$ 0 0 0 #EgÉܺvT2 -LZM@  hKZoOh b4bp   _0!dj i .i ( c `0`  cc,0 " 01 \ \0 (bx  c   q! X a=ii .ଐ cq-T 0 ,' i0i  0̐ 0Pb1 0i(i   , a=! L!aL bq *L c-HL1 . i0i ,0 01 0bq'D  @i i jj! 堐 ጑ 张 吡a=(-༠c <0, cc )b0 8  .0ax  b ,  8 =j|x! 4 pb!Q? `P0`?SpP`0L`@  goGU@pb@ BU C?0YP@p ;?0Y@P 0 -LM`Pp(K  !62 b1 R<0Q0^ ~?@ Q R 1  !1PtT\qT Kē9O8G-M 0H 0@ 0 P$P`(`H`,P  0p@  00@L ` 0(, 00($ 0 ,@ 0j0!(P,@ f 0 @0 P.!T,f. 0$0@P0L0(  0,P$ @(0,@8`< PD08}PZ1Ab_`j?qā^f> AfoQ0@^ q  0@N01 joQ0@bq  0@ߍ(P8 -pRLP' D@A1>0` W@;@ RpG`@D  Q*H0 0@WH0L@W耀cW-:P` P@1@ T@D 8 `ph PP@1 0S@DRH0 0@H0L@PP@1 0S@DRH0 0@H0L@SH0 0@H0L@y -pRL`. D@A1>?0 @c W1:PP P@1@ @D  pj?W@<@pG@ ?W@D @W PaP@1@ @D PUP@1@ @D 0-8PL@ EPP Q@0@0D@H0L@0O8 -L\M<, @@H l h p P P 0 t p0 t0 < lp p0 t t K @KP0|0 x@ H`0 4 0 lK@  L#D,<4PK`!$P`t|0K, @^ 0 (KT 0SQ0PM xAcUUUUP888 -L MP@`pP DHL.$ . . Ƞ,Ƞ  D,, ,4..D, @.$ @$.`0PK p@$,4  0 ,@  v 3 0,40!0 0##$ 4# ""# !"!!" ! 2!26:0#`p4 P!@!4 ! $ 0 (K3333UUUU -,0L0@,0 << " 0h#HJi 0-L M 0t#pPp0@l 0D@FDPF@ h0@FK0hFȓ9xIiHJiГ9LJiؓ9 -@PL d0$80D8QhDLJixIi - Lp`B`P W P80Ud08@ ( B@PPxIiLJi -@QL^ ppW`$P0S Y#20 !   \P0@0 0 000  @BcAc -LMⰡ00 SP? )1p`^0 @0S$ 0!/ V U 010 R010 R PQt #200 R @ ^t`VX 2p(KV ^"3(K0@ pP ,P0@`@00 000 AcBc p-@LP0` RpQ 0ES#2@1 R U 00  Q 0 S Q pPZ@U( 00  PBcAc -0Lsq0SK RY|PPU 0S00S  00+U>l 0`P7 @3" @3 @#200 〠 3" l000`kl 0 m<0P  ZPP TPBcAc -pP0LS`P @VP#:3"@ 0S0C0000SP P0  0S (?AcBc -L MpP] <0SZ 4 8QU 1PQ |1 PY`:d R 0`0d R80K nP00K0@#0(04(K3 " 0.0S  0@0/00@0 @|0  P p( 80(04 T8AcBc 0-LPL0@S ,0 |0   0HJi̻+Q@-@ \0Q  P 0 SQZP00Q0S @10  -LQ`.R.\V&  \* V  R b\`FPXVp`V @@lT@!d >XpJJJ J<9999 -LQp`-R-\V% 0\* V 0 S c\`FPWV`V @@lT@!pd >WtJrJpJ mJ뤔99P9l9 -L`RAQ=8 Rp.0^p.W& 0Sc^pV$ WQ `dV pRP 0 @nT@!  P 0'J($JpJ J99Ԕ99 0-LdMPP#t@K` >x x0 p l h d ` \ X < 8 4 $ T P H D @ 0 , (  K0I BcH+0++D9 -P1L PN@0SJ a@ TE P, 00 R0"PPU.Nx!00S PP ?=l vP 6= lm li0@ T0P != lX P =l NBcBc1p8 -P00PQ0SL0eQ` X0S  X$00l 0@PhuP XP  !_= !l@ 1S  RUa 1`l =P@D 0BSDd+\++++l++++++++++L+D+<++++T+<+PtP l @P  R0 !P0p@ PPU `l P@7 30 @ PPU`sl 0P  0R !("( 0p@ rrrrrrrl @0S l 0S 0S 01S 060#0 R0 P 0R !("(  0!S0!B("( 0S 01S 0j0#0 R0 P0 0R !("(  0!S0!B("(  0S 01St 0\0#0 R0 Pgpwpup p ppmpkpip00@ p0 000 S077@0BcBc0CcBcDcDchDcBcDc4BcBcCc88CcxCcXBc CcBc@DcDcCcTCcEc|Bc -LM@`l PpPa Xa 03 0L( KlP UL P 0 0U2XJ  (0U(*XJ e@A0?P00S 1\1C40A\.0@D0 0l/P  0CR0(l P$K( K lP CU0t(0 x 0`0`r -LM8@0T8  Up4 0 , $ ` 0!R 0QQ  R(KQ01Nv pP K >;$ d@T4XQ ,0 00 2   K&;4 0 Q$ 4"80K ,0S ("(KK 0 0`hK( 0 Q 8 0Q :("0 (" `Q, P?df: K  0PS`@f0eT@ 2 S80s1} 00" ,2 `4B , 0S 0"K42 RTP0," ("(K  Q9 4"8 0 42$ PR6$@e T @ T Q 428  04 0( "(K 02 , t:4"8 0 s4" 8  0w0SS(S  W:(4h 0K`0   @KK$ "R- @ D:2 \5 428 0K 0:(" <(4"4!y :?31314Ecp90Ec -pL@ 0   RP`0 0` 00ŊP U000@-pS`P @0 000   000 000  " @Tp@-`RP @0 000   00 0000  @Tp0@-PQ @  0 000 0@0PU0@-pR`% P 13 RP@0   "  80#440# ># b1#  @ 0@^ 0-@P LX 0#40 "( 00  0#40 "( 000萖8 -(0 $ , 08 40< 003 -@Lz 502 -LM,PK` p4 ,[  V 0R3000[00K–\< ,[  T 0R3000[00K 0Q1 0Q11 0#P1@1!@0#T1z @2K1 0#P1  0R3000[x 000#0K  0R3000[x 000#0K -pLP`@~Vz_1 0#P1`F V@  3b0`R1!~ 220VS  21!0#P1z_ `h@ < -L@M\PK`pM@2!2@0\0#0@@T  202K -@RL@M@P`$p  01\PK@2!2@060#0@@T 2Kp{2A -L@M\PK`pD@k2\ j2@0\0#0@@TS  )1K -@RL@M@P`$8\p 00\PK@52 42@060#0@@T 1K\p2@ -L@M\PK`p@2X 2@0\0#0@@T  }w1Kt -@RL@M@P`$Xp e00\PK@1 1@060#0@@T KH1KXp1@G- 0$M0| l L\ ̠<Č4HX p%Č$h Px (*@&'4@%l,| @@ @ 0!0R#00c4  b0 0 0# 00P! 0#00ϠO!Zp`ᨀᩐ#`p @ <\ L4 , $HX $$ @%4,P.$ &',)<$Ѝ p-LM@0(`K/1P00.0 0@0#0Q0Kp -(LM"X0`Kp U@T Kd 1 00 d0T ꘖ88EcI?("(0 -""LM 0`, 00 P" 000 @Pp 00#00  "  0p0#0 0  ,,0@W0 (Ko0 -H$H0p!`L BP@0D 00 0hW -@L00 0h0 -L@MQ@d ` 0Kh0 0 0h@D0E @H D  L@ P h0S H@K0`@ \P LPT0 XP 0K @K~0`K``[\0@$L`X`0K@0Lp#D <P``0K@0D#L4p `0K0@#4<$D,`0K0@#<4($LP``0K@$4$@p`0K@$<@P`@K8K0!@"X @0 <@ ,0d@K@ K@K 0K$08K X 0`0K0 @XP`0 \@ T@PE@TT@ XP h`0F@HPK`PU`P`HP D` P``FvP` t@K{/0K /P(K訖8 -L4MX \0  X0H T !H/< \/H@P L <@ D @ D@XT @H 0Q@ < D0 8KG/(K\ 8K/< 0K/T8K8 KPKP[\0@$L`XP0K@0Lp#D <P`P0K@0D#L4p P0K0@#4<$D,P0K0@#<4($LP`P0K@$4$@pP0K@$<@P`8K\0!@"8K 80 4@ j/0K <f/PK0@ D0P L < 0 < D0 |ꨖ8!!p@-(0`"dP  0". . @0   0 .0.   p谖8 0-0 1 0LP  Ⱃ 0@,00@0L%c -LM Y90 0R40 001#((8, "X#H`p $  H   %`V Xp  $8,  8 ,0S* L%c -4L@.chG-@0 084 0<0   0 0 84 0M<0   R0 P ` p@  l0 P ` p08 40< 00 (0$ ,$  084 0<(00 ( 0$0 ,, 08 40<0 (0$ , 0 8 40<0  (0$ , Ѝ88R@- @0 08 40<00 ($0 ,4 08 40<80 (0$ ,< G-S5M1 ! 1! 0A1@QAPaQ`qapȁq $(,P !014 A"802<@ RBa?V V1 1 00q R Q{~?xQ" 2BRtb`rTH<0$ #2CbRrH<"02P pQq(%@'Q$brtlȠn0%p`T"c8qdH`p"01!P#2"&0'c*1a021eZ021` 0 (22@#,0n,0c̠0dLc<01`021&0l20p2'P#l2  #2\022,0220200(02 #2lȠ#2n@#0dHc8`02 &02l2b*0p2p2'#ap2P#2Ȃ` eZ02̂30#02 #l̠p(2Hn @#0 Ƞ0010H1 0X1 0h10x1010x10l1!0`1%0T1)0H1-0<1101500900=0 08!0(804!1 8(1 0 8( 001 !01 !01 !0t1 h! 0\1$ P!(0D1, ,!00 14 800< 0 !40!0401!1Č!x1Dl!`1TdT!H1t4!<1$0!1!$!0 $ 0 $ 0 $  !01 !01 !0|1 p!0d1# X!'0L1+ @!/0$13 !700; ?0 01  1   !1!1t!@h1\!P`P1D!p01,!0(1 !101 000 000 000!0<0!0<01!1 ̌|!p1Ld!X1\lL!@1|(!$1, !1!,!0 , 0 , 0 , 2H" L"1# #1" "1" "1" "1" "1" "1" "1" "2" "2t" x"2`" d" 2T" X"2<" @"20" 4"2$" (""3 " 0#3 20#22"#2 "!#@,P.` d"xBR AbX2aLR"p!0#P%"|rh\2PR@r4(3BRbp',  #<$L%\&l"Dr8,0@P`\2,̠r崂x.h"#<Ýl<02'|(",,Ġp儀ā|H PB.(DR#8b,r#Ġ2 !$L%\&l'|@X##8`T0@$P`R pr02 #402 #8|02%D#4t02%X#8p02'd#4h02'x#8d0|2#4\0|2#8X0h2#4P0h2#8L0\2#4D0\2#8@0P2#480P2#840D2#4,0D2#8(082#4 082#80,2#40,2#800 0  0 0 @ P`p  00|@@xPPt``ppplÝ " 20B@RPb `hp!pd"`#\%X&T'P ) L0*0H@+@DP-P@`.`

p ?|$h(\,P0D"4 8280,B<@@@A@pQ?U405ލU c r 00ā`V c40@  @0 -@Lphx) 0-H$HpP L@  d08e 0-@(PL  0p0h7 0- @PL $)(,0h $R0-L@P 00@0 D),0 +0  !!! 0 @ 80D@ $@   0@Dh.$ ! 1 ` <$1 A _/K   K  lAL04#.0 @\0 C#T0 !!H0l!  00   K , ( K  0KK0@t0 p@ l!0<1!4@X $ h A 4 0 <D1 @A 0KL H K0@0 @ tK0K\ .,@ $8lt p A !>d<1 8A !!X0    K T P K  t0KK0@t0 p@ K0K | x 1l!D@1!$MÄ. | x  (` ,@$\ X K(A dt0K0@@t0 p@ |KA?K.0aTP | x e%H!0Q !!GKl!0P|H  0@d ` tKt p C?K|K IOK0`PTP| x %@ PQ 8Ql!4 =Q!E_K`X!8 |K| x KK|PK`p\3!!@P`X MK|P x` Q_K`SKP`A`l1, |B"x,=`! 3OKUK@P`WKP) Y?K` P`P`%=3@!t@D |?3 ?ST?3@ "}lP ??C?S=l0 $0Pp @(K -P8LP`p 0`R1!\ 0 0 Q< P8< `pl8W W 80 0Q< 080@ pd` -L(M8, P 0Q <0<0 0Q00L0 < H HP p$ .]%}'M$-100??#* ?S??s M$?3)m?0C ??C@PP?(@? 0p p 0@.040 0@ ,@ 0@P0 L@ 40K P0K%V0@<0 8@ W`@<0KP`4@'y0@tD0 @@ P@`D0Kp,p@H ,@  H040000 0$0000 00(0,000(KG-QDM@P8<04(, $t    0 "<4`p6( Ƀ.8080! " ()00 @`pp(p 0 ,(`$8*pǃp   "@@@!00# @$` p Z  DЍ - 0P# `$LP`pg# $ -LM , (0 @0`% &,0Ktt 0#@$0 @dd0d@d p%&,0K0#@$0@p  '0(0$Kemosuespmodnarodsetyarenegylbdet -(0p0 L@ c&(0'0P`0@% & `0!#@" $0P!,`"$ -@L  -L@Tp! (0P0(0 iT: ` W% eP@hT ` K%@D XTPT  o;% -L0MH@K`pPS 0 }K -L,M H D L0 `Z{@ LPH  R\ \PLG{PG 0: S t0D@ 0 ?Sʱ LQ ?HK|@0,P+{ ?p|UL20 R02 0 P\W L#0S0 P W(KL@1 0P80 0: SwD0S0X0S<0 @0 , , 0O00p'T P @<0O ȟ P T K /<@0@Y80 4@ mb @,0O0 p"X_8W\80<  @0 L@@0 0t t0D 0 ? SʏHR0T R80H RJ<  @0!!@0 0 v @0 @0 0 k 10P/ {z2<  0,!0 0  ŠUX -LM,   0P`,0S,@p,Q@T@a0  0p P`(K0S,pz@,0S@S0  0p@P` G-M$PP`l00h 0P01>0  0$5@ 0p RT001Tx?>   cp i  0S0X d @JTb001^ pQ?>   cpG C  0`0CW^ Bb   R 01Q 0110l1X100`1$ő\ 1 0R 02S\0 P3Ѝ 1 >0   r  R 10 01 -L$MH L  p ?z0OO^P`1`>PL 0  BSLaeH L08`0?>   cpH 02ᠢ0!$PL0` p2RLH `08?>   c 02L!0$PP| 00`1ɯ D @ QL,0S PQH 08 bS180 1, !1!40 L00 0,<0 h1< PoQLL `0Oς  1>0PO>p@P` Q 804 \0 0S. 04  0 S ^,@ 0O QD  RH  0-|Q. ?(KLH,0p S0QJ 0H 0 r-7.U HEc8ܗ89̖9x99 -L\MH< 5 Qp< @ <`000 00 0<@@P(0PpǏpP @p8@ ?@d_y8 4 @ 8@`4!4P a, QU.QU109P1@ 80<Q8 4 < @0@P @ ?  b<@. _@Pp@ȟP y4 Q 8 <( @@8`04Q SPQ C` 0#y<0 \3R 2<0@, 0PD0 Z= 0Yyd ` @娀ȟ 0Qy`@PdK ? |0 | <,,l0 h@  @ 0h@ x@ ` 0 F.lKP-y ȟ0),@@ ?xD 00C0<0, 2R0S @3CL#020C2 0+L%cU 9@99~ -LHM\ 0pSPo0@0T8Z0LOPo P` 0OVʶ <4 S?bw0 @ \00 P4 'HP0O8P 0@ ?w00` Sp 8'08S8@``00`Q8 ςX  !D 08P 00`4PR@0 0  R,6^88@`0?0 0,p0P@`W 800@$ b $ 4 D0@4 DL# 00 08P5DQ8p`0/ 80 0cQ@< P0 5`08X3%@_Q8`0  0]P"004(Ko_~UF\ 08D*0 +w \@ 0;*0şp 0*(K8 8$ 8@`$80@_ P LÙ n 88P   ? 0@3CL# 000\@4Q d0@Su8p4 R 280PuWt@`t0u0P tt0008l3 R8TT0 !000t84S`06C cB SWAQWS 3 P88`0 0nP 82 R8`0  0+ 08 80   ? 0@3C0@L" 000\T2Q1 d0@_X@ TP S c6Q SPQCX K u8p1 RZ 20, 0PP0 Z5X K vd ` 娀 ?L H0 v0PO`sdK&,L K lp h h uL K ` F.lKPu `0', @?uP00080 ,R8TT0!000\ 0 ))P8X 0  P , Pu8X 0 \ 0,(()L%cU d999ؗ9ė9T9(99 -LM 8 0 L8`4 pP(K 08 P, H 0S 2 0/ @G00P00a0 S0"Q^a\0/ A P  d2`R\0/ P@ 42 ^\0`ϊ1` Y 0@ QR0 ~(C)0P ?'u1^\0/ 1> R,P1^\0?0  0<0  B 0 ;0@0 4D00L#040 Q 00C00 ,O|08 0 ZzV1>0  ?>0 @0 3C004L#0000800 ((L%cU 99H9h9 -L$M@ D DPAP(K@D P, H P0 $h0U 0 S 0S P@Q0N 0R P3,qz02SQ0 @_ 0 <@ 8P tD @_P 80 UAO>@P `L H  Q  P 0@4 S 0R  0P  PU 0P0O0@`0D  `Yp 0@_@, 0T P'Q800cO  vU80pY,2{ %L%c9 -L0M L `LLH PPT P0 00S  L #PD H^U #0O0@00S T08U ZO 04 R40 p F0SFp W^ T K Dn@ < 8 Z?s `0 , 0 K 1>0 108\` 2Rψ0O0K` 0@1 >00SHy 0@ <0 T Z p T K pJQ8 4 }Z8PK` 1ψR` 1> 0 #0P @` ^$  j$ 4 D0S@4 DH0L# 00j 040Z0C40  j! 400400L8@K0AD@@ 0 0 R#A4Px 0@ <0 S 0@ <0 @K(K80,@dYn \^ 1/X`0 0O0@1>0 AR!0 \ `! 400C40 i! 40040T0 RY3 1> 020$  B$ 4 D 0@4 D80L# 0 ^0C 0  0Rυ0O0` @1 >004Ay0@ d! 400C4000 c! 400C40L%cU -LM ,  @_ 0vq8  0pq4  ?n0 0dq`, p  p@ ,8P804@0\ BQLT4 ABQ0 CBĘ,0UPT@!4 V< ᰤx<0PQ`004oP`1`#Z ,oV`!@V`YL#20T 0U00 RH3 VHY@0SJL#20T 0U 00 RH3 Vt\AZ@0YL20 8@T@!@`02 08\Y YPL20 80S@@2 08` BVPZ,(K004`wo~~,@SoT, PL#2, P\08`V04`V PT PL#^08@T04`V P P  -LMP040 00 `@4pOP @ 0$6$p(K  XO ,0P>* 00 ,0 n X= H#0S0C0h0 K P 4 (0 0pP+0d0Q5h@T'dp@l0S 0l0@l0S~l@l00S0l0 00 ,0 H#0S00 n_0 DP#0hp0 0$# N$HeЗ8(9ė989tC,9̘99 -LM d $5S. @pd`  t x02 f V@ SQS K l@0@ P o  10Ptpx7 K X\\o\ (K^4KKx0KtP0K Po0@@ 8K0KcP4Q@K00(00 0K80`S 2 K Ze㼠 %nŸ ?p^ Z 1P` OP`@0R P R80P0(0 Sn A0S] ,v P0S[ 0vZ&`pQ d0 ctx> @SPQP#00d0  c6 0SQxd "t 80O`p X_000K n yP' 0 S@P0(0SK ,3uH K@00,KyP,0 H0@_0 ^,v0u0v00H00 f0@000 R0G,0 !A `gPP@0A#O 1"1?0P HA`p-8PP`# P P 0 r3p1>0 R! "A@e0 0@A0#O 1#"1?0P01 FA` -LM 4 P80 1\ plWRl \R^Q V0 $400p004 00,K0 nPP ,i(K, g80S4,85H 8 0  ,  00@@^3  pQP485@0L 0p U -Lm9\%P0R 0 R40Rh0 S8P0!RTcHEcC-0 LS03Q% 5p00P5,5MS ڬ4S9Ӭ4հ4S@0Ӱ4Ѝ0t0/Oq,,REQ `PNo,P`PLH0` 0`O/0U4e85X< 8P 0` 4 @( X0<0 8P 0` 4 < K><@$0#= ,K ,0P@S Ԝ 00 0P@@ =S  P@(K q되,9,9 p-0LS@Pd0 0D0S  充`P p0  P ˛Rp -LM, `20\%R64d 00  8@_d t,`p`p<@D_@,_`Vp` p, ,0C@$0(@[`4P8`,P0`%T@9 -$0L Pp`  ~@P`@0 S@`$V ~@P   ,0 | @O -LM$0`bp NPUMT500#0DPP00U  R@ $KPHc0@T @ ߛ 0@@Y 0Q 凙P LEh A =$0`B:$0 -LT0u/0LS^`P`004 S:O/ 0@ P%! P\b 0!00 0 T$0005LBPL<L 05S0004%T0 80@P000 LR0 H MgX8TL9t9 -L,M$0PH ,P L  (K`20D0 崙L0H DPP.~L DZu`2D0OO[/ P`$:,@K@gP],PHpP#cL3P#L3P#h Bh0 S, 00;00,c(5`(0/ $,L  40@z[P@ L080p ` ,0 H,b80@`\ p@0\4 0f0PH4LD/d  `1, 0P#Q,@K0D@AgP ,br5$%R ,0PS$% ,0SL0K 8< K80 4@ < 0 k{RD  H0J꼛9<, -L$M@pTŀ$K ہP@ 0 n}PXd, @ @Z 04 0 4O  4$"0@<0 8@ @_@P< K @@PZxZ`0d  , l1. @\$Q00 (Kf@P (Gb0,xZ,(0 H `, 0 ,0 (/bKЛ9 -LJM`L QKh p/.P0$N5%0S' L `@0S P@; (p\@ K08@laP0 `pZ@P ((0( R-0[.0[S "[0R4 0R R 9w(04( (0K@P ( T (Q&w$K@(@i..9 -(0L(\;; ᔃ@90 0 @0刃H@!0Re D\S QX <1 T  TL!R,kFfPH @P(0 ~ ,K U`@Pl,d0PH1 N dL L\I LH 0RP0Rp 0l 0с P,00P00SR0S \!P1R 0 0 P0\P!0@ 00D1 D! R T X! < 0 .R 0 @HP 0RTQ H!4 R@H000  H!H0 00@P HH1  B 00C0H   P!L0S H 0 L1 0: S X!R@P1D 0#6 LH@PX1S) <\HH1  B L00C0  B H000L1 0LL, Pd@ P@Plij,l b, j00 0 0: 0K g_@Pk0^f dPP!d`Uf X1Sal CVrjU0ojk 0V @ 0߀  0Q L yL0S\B@]k`p0Qn L1 p0Q@OdNOK P 0@P TQ@ H!00C0 H B H0 00.ljXQ T\ 0P, >E t`0p@.P- ; 0t04 p "P,0 J 0@ h04@ ɯ , TtQ0 pP,  0P, P ,  0P004 SR000Q 0S 0;0P 0S 0;09 -d@p0Pp LP` LP#P 0S   0tP   0:0000   0 0L ᬊO -LMPd`(  R0d 0St0p 7g02& (0$  K_P80d 0S t0p g 0-L MdP (0$  00K00 R- 0 K0CS0 0 000 0 000 0 0 $ \0 0@\0`@ l 0 P 0 80 \0 0@\0`@L%c -@L0Sh1 -L MP`0 Sdp0s0s0s @(K0s(0sX0s\0sP0sT0s8 (0$  p0R ;@P Rd0 <3 R@(0$ ? @dT 8#8R 88d0%d00d00"00T0 R@0"d R q (0$  0@P p  R000 ,@ @ R R  0@P$0,@Sb:] l0l (0$ 0p Q ʖ@P l0i  0~@Pb@0s000E 40s (0$  0 0 00@0s 80 0@0040s ,0 04000@P4q@ (0$ _ 0)@l% "T0d0d 00 S*q}l00000sdn40s@0sg -pPd`Lu  0@0@ 0:0  0p 0t  0( X 0 0$@ 0O,00@ 040 0O80<@ 0@0 0OD0H@ $0L0 d0T0 l0P00S:(0 S(084 (0(  h0O$+4` \0 \0d0h@ -L0S 0-L^ P 00S \ R 1S1  01S  RZ(@aA@ 0@@"00000 -LM, p ` P4S,@PQ@T@a 0 PP 0S,0PA@4S@S 0 PP@  -L M @p0S Q#0 GPA(A4倢 0$ 0,K4 LP1(@,0aHPQ8 8000   00* 0 R0$ 10C1,I(K  =<-0S$t,QH  =l@9`99 -LM =  6ė9 -LM @`0PQ $0:  Kb@4r$ 0 K4 LP$`q@ 0 H\2 20 01  000 eI G ̈́0|9ؗ9h89 -LpMp @P P`, ! mp(K: S3 (@6@ (0X  0P , (0  0pP40dPQ !R0 "00S0805 0d0ꠔ @Y ڸ$0Qp0 0^  \   0 ̈́ (989P-LiL%cО99 -LM @p ` RP   Q 0R 0S pW $`?(@?P4 QP 4 $ 000 9 9(- -LM P剂0@P(K4 4,K KPV40 RQ 4 $0pa00 ,0H`i?Y @ a 00qb P 0S<  0S6 \P Q@ Q 0SG QT 400c.?Apd PV 00`A@ 0T TP,FA0 #  00C 00 0C0$,H$0"{T  A 02 10>!@P<0<  T 4a0> xp P@ = 989x99 -L M P剢@P00 (K4 4,K JPW,0@TH% (>!\1@0! 00C000* 0C R0$ 101,G( 0 (0`00dq \P 00`A @ 0T  hSdp BP`  =4D0 ,E1099\9|9 -LM  @ 0 0  0 Q 0 F A 0( R @,K4K)J`P,00(K(0 4K 0:`P 4 (0004K``HI0, $40@2@t0x@ ,08H,0<`8KK0K`P8 0 B18 0XPUX HK`  嘠KcE 4,@K@I`Pw,80Hp YA T 054K 0`P`4PP40 0@4``H0 43@t0x@0 H8K00<`0F`PB 2(K 0h 0P  Q3 ,F 04K 0`PR40K0@H0 4``H, $402@t0x@, H8,0<`,F`P DKH0KP ,KF{,DH0K Sp# *@p4Qp R0 w0P80S@K2@4lH, 00P;00,D80@SW 04C0 00 0,DT804K 0$`P4@@804 (K20h  Ag ,FK4PPP)H0 4 3@t0x@ 008H00

*0pS0|1 x5]?KP`(@K`Q \a !PDtQ pa X?*0S> F/ZKD0@h1 dA  0U!KU![KV1KU1[ 08#8(0K0 Q PoZK p]K xl!㄁!0 @d 0 S:  0S* || @tQ pa |A -LQMh! hA 0刔`1 ZKL0Sd `070 hY1KVKht 0R 00d1 U@pIh_Ÿ 0P@ LP (@K⼐d`4 8KX dXK NK 8@ D` < H T` @` m(0@`"00YP (K 0#68#80C S񟗾N-N-K-N-K-N-K-N-K-O-K-N-n0O Po 0^55!,@ n@P000,K/00KF@P0`t0 0R@Ppd)0S@1 M?C(K(Kp @`Kd!,o0@P00xPU ) ?Q,h!x /0@00S0@ 0`p@ 0d Ppt0S0G0E0C0A0?0=0;nPl 99 -L8ML LH H < d PX P% H0@T T+ T 8 Q L  0S 0SX0 0;0U8 Q4 R0000(K<X0 @0@PX Q } 4S| H < 00KpPP0X80 T P <\4 @ (~ Hw, 4<H0aDX@@ u4 PR]D$ 0Sc ,90t03U0SX000\ 4@00$D0 c4 n X !X@ @0 0ãL@ @0 0 ^UQDX ,K@PPi`@0X@P3U0 X<PPWX0H ?vPPg<p4Sx*P\,h9XP` U% PQ,7T~X L<? LTK 40X80l@Q  *V6 P)X P <9,99 -LM  d 0 00 0vR@4S@(K  P@ P, 0S2U2 4S c8R SQQCQ ,K h0;@T&$`(p,h <0cZ Q Hl0 @P,57,@ @0S# x@0PQd ` ڜ44c cb SUaQUs8 4 0Dh@ l  aZ!`P 0OTdXK }@0S RP4S <0 t p0  P0S 0 ڜ@tP4p5 c S\Q\PTP P DT|@ xP Ĝ@ @ D0K\@ 6P d P P# 0XPKP^P`V  E0pP@@0`YT0 @P0 @  6@T@ @P 4@#P c5, S.Q,K0;@Pt|P\ 0lS0! ?KQXU , P<00cPSl H ๢@,l6T0SqRz@4S:P@$0  S(0SP8K,@K0 0K h0 @:@ ,@P86P(0$  000d SdPP,4S:(3[Dp K4K L0S `0=@K.0<0K8 d 42K 0C3K L0S `01K0@ 0 0. 00 K/ KlA ,D K0@cpP (0d ` 00Q!/ pP 0! B! 01000,eI~000  $pP ,00q `hi9 -`@0LSP`pAI( (0R `6IpU  apP-d0!R" 00 `pU  a !0 00pP 0! B!H`p`  pP `h -LhMP @, 0 ( (0pR` `,0T H,PH`DJ0BJ (K\ (0Rd0 0 1Jd0   PY  daP08dh d t !Ry 00qt 0 l0: S\ X   J,d0P`0 dhd ! !h 000FPP Y 0 h`Pd0S d@sH`pH\ Rh@ 0000aPh0! B!h 0YH0S$ `PH,NHI0I00 0 0L 000K = 0a_l0 .Rf 0`P  `K  `F0 0^P 0``X 0R` \QS  Rp T0 l  Zd0S,H`h $P0 9 ,K <P,dP` dd d R d `0Rh0R@ O 0X^ P,00P00S+R#0S t0hS 0 0 0t h 0X  0\ !0,I\P0Ql0 p T0  0_ 0^ d0h 0R ` 0   0 R `0R d0Rd0 0: S p0S`h 6Pp0TQ00S ` 0! B!`0fGd@p Q10C1 10C8#8S1g d 0d 000,HG00 0 0J 0K <0PE dh@d0YL0 a p R\L R.GY0+GH\`0h 0R@l R `02!R !`000Ph PG l R `0! B!`@000epQgHp"\` d _P d0!R\ Re 3ZGB^tCl0SP 010C100000(/FsL@HK! B!00 00 0 0 l @0 0@`P60[S#[0R  .  0T  0X 0C0< lA 0 0@`73999Н999i..9 -LMP 0pS, d`0s0s0s (K0s(0sX0s\0sP0sT0s! (0$  0R suP 000 0T0   0000 0<$T0 R0 0 @t (0$ dt@ 0 y㘐ST @uP0 S R 0000R@ 0S 0;0Q 0S 0;0 p 0S S S  0-P|l0 (0$  0R uP l0j ,0 =\Pc@0s 40s (0$      ,"0 "0 1 \0 0@\0`@00@0s 80040s ,00BP Pu0 (0$ 2d@ 0R tP R 0S  OotP   0:0000   0 0L (0$ a fqQ`0 S BtP(#@0@l0l0s540sI@0sFL%c -LMd 00 nCK p- Px0 @L0 `P d 000Xq0(D0`E`p.cA-RpP `$(@#00 bR:  Q3a0 R R0d0e S:0e0d  S: R:  aS* 0P-L0 0a00P00a00P0a0 -LMPp i"P  t$0(,@ \`,K 0` `P !P  (KiLPiHHOiDQi p-P`L@F @` pPiؚ8 0-@PL7 @ P0HOi8 -LMPQ`p4 0^ 0^,:0^)* 00000 0000@P  K@ 0y!P 0@@i @89 -L$Mp4 W80 `PSXppxa@P3 $ (0 U.:,00V,K0K '!@T# ( $0 U:,00VR 1 S0!  $ P X @T (K,40W@:00W8pX080WxpW*Xp -L4MPpU@80 { 0<%Q01Sr:0a bU,0 8 50 R 10 ->0 -v-``  0, 80P` UP(Kf4   40 ,80 P:P   0 ,80`P $P  4800P, P p-Q M@L ` 0 @@P 0@@P| 0@@Pp 0@@slPdh 0 @@gY@@0*080 KpQi9Pi9$Pi9xNi9HOi9Pi8 -L$M$p   Wz34 80 `g 0 P0b\0j   @PS@g0T#QB Q!1P! 0`P`V00V03Sg@P `0PU`0U @T (K@ R 0S@(0$ ,00V: R `0U@@0ST 0" P$( ,0  0 R 1S0!,K0KEP, 4V@:00V8`80 -L !Q 1S 01 0AS 10 ! 10A0][99 -L !Q0L49 p-@L !ƌ\`"S  QP P 0 p `p Q0S  0  0 00`p X99x9 -@`$0 L0b#6<@ SpTQ&0@ P P8TP\P<@0!PR00R0S0 !P \ -LP@!ƌ0C  0S0 !h밥9 -`LVP`PV@p$4 0SPP 00 0A S 10  ! 1 A 00CS0 UX01SZP `FeU -@Lb 0kP  0R000 00 0 p-"fL@P  00b0fS 0S 000  pJHԥ99 -LM@p, ,0S%0, Q@TQ 0SJ(0` 0  !( ( !0C 0,0 ,0S(K#P  0`>P H,` &: 0 B   !( A( !8FQ =(/Q,,  T9\9DWi 9R -PL@XPP) $F%6@i0p0!a @ ppf bjPP@ 0 0!< R$0(0$ (PRidSi -b@L Qj 0@sb JjhRi 0-0L@1$ R(0(0(0  R 0 P 0S P 0PS0!P 0S 0CS080PS0000hK0h9 -P1LXM@`TPpF pTK0K‐K( 0@ , (0$Q\ $ \0K((0$0^X0 $ ^0 !0SU000 0Rp0 P ^0\Q,0@(0,0\QX0(00P0W0X S(KmdSi 0-@P ML@4 ,0P@K0hRi9 -LpQ$M@H L `D@ Չ1P< P0 S@CWeQ0 0a00P 00< 00@WTa 0S0C0@0 DP @0 DP T\LPpWAD!1P 08 0P 4 ,0 @W1 0 SQPC0WdP00 `00R4P004 8000 P 'JD 0S U0000PRH @W(K@Q Q,00,0000DP 0@0 ><묦99 -L@L\p`P \ RU 0S  0BsU 0h<0 00RUh 0h* -P0L00 0S@p` 0Cs 0h 0h 0S[ 0 -L M $0<@p0b#!& X 00Cs 0X4X(K 0@gd" 00Csa@Qeb hP(T   b^h b 0i@P b Qh0 0 0As Ye`\100 !1 000  0!0c0,0 { 4 P!r,0  P!4d 4 40T0 P !S  @YbP10  1` 0b g0Esfb gh i 0H  i0A  ꫪ -L@\`P@z 0Ss Z$p P@P_ 0e#vig20!Q  pe bgP 00@P0Sq W0<00!  R 000 0  000W 0  c!00CS0? 00Cs2D0`0 D0< @@ R$0(0$ @( $@l< P@ D00D0S $@0l#6S"(<x0#8\':WX: 0$  c"&<0000D  D 00C0o " $@o z"$@RidSi -@LP S00 p-PL : `P@S`0  !( ( !PeM&:jMpDWi 0-@LTP (0 0  !(  ( !0BD^M;4GM(0hu0S p00Cp0DWihSiUi -LqP 0 0 hSi 0-TP M@LH 0 P@(0 QAK0hhSiئ9Ui 0s0 0 p-0AL01 @_P ` 0S P 0S 0SpRpP %P 0S00@ P`p 0Sp8Ti98 M-L M@00< D @ <0@S[D 0" 0@@ H0 SB2D4 00 H8 <@80 aV5  Y, ,s 0S(r X\ 4P_ pQ10@P0PSڕR 0 B0 U@0S R0H00 ,`V8HP8 Z!p00jp0(KOW/`pD0OWVD Q<@0PWR0OWPVZp p00jp0YD 4P0@Tp VX4@R8TiUi p-0LP@ R,`p0@S0a!p R P 010U`P V000V000C0S R000  8Ti99 - L@PQ M-LM0 0`0 , R 0pO# @  Z (KY i4p PP (0 @ 00CS--4-4--- 0SE0@TLKK80K(C0 , !( (, ! 0C *0pW0p O &#*0@Z0pKpڄO0O#Y0QE !i[K9DKDWi99T9 -`ȟMLVF &(*0&Z S0  pT(K - 0Ls` 0CS 0 'K R$0$0$0 KK@T (: 0  !!( 0 (  !!Jt!0㕒dK@TLJ @R&R00R @P P !p00Cp0 0Rc Ddi !90XpQU @T 10@P PL Tp00Cp0@4TPpWLHcDWi9UiUi8Til 0-L MXPU@@DDT 0Pi, ((0PaK0te98Ti9Ui -A2LMpc S1 # $0KڇP(  $0R`0@P@RP0S  A0 000! 0 @RPc c -LM0@C2A P # S<#Sp8 c 0K⚇`P0 L2 S<#S PQ R000 R0QL2  S<#SPc kc 0`0p  -LM A B2 \̠# S<# S@p= c 0KN`P4  L2 S<#S PQ R000 R0QL2  S<#SPc c 0`0p \p p-`L@c 0cPP 0S 0  0Sc b`Pp p@Q0@S: p-PL@c 0c`P  U0 P c bP`p p -`LPc 0vcpP,  V@ (01 P0 0S1000C0SP\000M@Tc b`p 8Ti@Q0@Sڽ -LP F& 0S\1 p`@U    0@S/D P #c0YP@=  0@00`+ 0S5p0`0 .H @R 0$0 p$H0c bP@ dۿT`p`@0P,N(L$J\Hcxe(HcLHcXHcUi(9ȧ99L9 -L M@ YpP` D < 0  !( ( !D  D @ Xp :@P`0s  1@P (0 X  0 X<0 p<D\@ @(K0 0%@S8 '08 P  05@P 0  !( A( !.!( &(  ! P 8 0100@0Y`p4 4  R4 :@`p@T4 0R  & G&0 , T 0PP (0"0  !!( 0 (  !!@TP m0PP0 P 5PP}>@0 , !( (, !0!<@0  !( ( !@T0 00@S@ :0@Qo30  !( @( !P Pt S@P @ <L(0ˍ0  !( ( !LZG5<CG  6P @010p9|9DWi -`/ML&@!*$Kp 0K @ $p @ @@PP P  "M 0 , !( I(, !  G 3 FKDWi -LpG1PUT `pFV@P'P@@P0W  X R`P0@PF @`T. P`P^ 1@P  W00X0S \P^@DZw(F`FU k`LHcXHc 00 0M0Ѝ -LMD<0 0 @8  @0@(K800<40 #40#"B P0 4 09 0cP` 2P0#0 e` p,0 @ :@P`, @0X Y@| 04 0 p  0H 0 P<pX@ @8 0r0k@08 @ 0e0@]< @P 400 -LM@Pp`D K P0 U@1$PK2$* P $0T: $0ST0S p$0#&R :0R*0a 201JW kDKDWiHi9 p-`@LP   ph -bLM0p00 R22ll    P  .(0!g 0  !( ( ! 0 u@"0㾋@TG U 0 <aiPN000@T 0@p1P5  0 N0 00P(0@0 !( C (  !( , #Y- $C00CT(K<0 000: 0  GT000,00>I00XC1HCT  , 0  0UiiԨ9DWi9 -LMϟ @? \ : P L H0 PKyPm , ?(0O0  !( C( ! PK 0C<L 0<cP T PK 04+0  !( ( ! 000%UieDWi999i(999`g0 0@+(0 0  !( ( ! ! Q-L`pP#*@JV  0P T   @- 6(@004@ 5(@80<@ 3(@ 0$@ 2(@(0,@ 0(6@P0T@Ui, 0S00000 㯖ei -LM KHD0#&R*0R*0a#20<jHi -$1L@T< Pp`D0! R"Q )00CS 4-----4-P l l0R*QP 0l Q*QpP@TV \0 RUQ <0h<0`@TgHcUi -@L<'0<0 - 0@LD*0D1Hc 0-LMXX0X P@p0*L @@Pk@PpK0HcHc,Wi.  . Q!  -L΂n^P`Up*S N@ PeN0,0 hT  h<jHc.  . Q : -L(M@ .  ^P U< p#: (K  P e!fV8  @,K , 0S0R*@VX 0 PP  @TF (18P  14@K0@ 4 0@ `'P)4 R @Q00000 0J4 4 R|< e<@ fP 808.0$8  004OcHc<j -@dPN`@ RL @pp .0  @ Hc -|0LM R h ;KK 0( P0 +3VO/41f? K Ui8iHc49 -L$MD @ Xa 0H#Y*qZp1H`00X80 N J$J>00>0Sp1x# Z00 W0~Sp8  Wz3X@3 8 ,0K @P 0d,S0!D <0 z` 0 ,4PK@ 04@ 0P @L 4Z<0cX@ (KHc>00   -L$M DL 40KT4 p00 < 0SO h"h2QP8 \< \9 j`,K8< 80,  00$0P!4@,`T 4 ,:,0 @T 0\ 4,:,0 @T`4K-&(K@A<0S ((1@ 0S 0Sq<4K&0C! S, 0 0 l0Q @ T00 ˂|T< 0 S ` `R`^<0,  04K `%P_ ## P9<jWiWi(9i -LPp 눀`0t@t2< 0R 10 P <n*<*d*HcWi p-PLMP*@`Kl P X0#&R*D夻0R*0a 20 >*JUx<jHi\9 -LPM($r; 0R Zl 2   ; Pq; 0R1   ;1ZhK@ @@h`K|!p8*0 @P@0pP`8A1X;P1 Q 0 hK!PR U};Z u;U1h K@U@PQ 0*<1(K0@p  T0 00 @` P@N;VWi## HcWi9 0S-i9 -̡LM /; Q 1 R R AR   Q;* 0 1 S0P1* p X00W0S1 $1 hWp80`$K0!&0@P0 `gP?pX(10 0 Q *0h6 0(0  X00W0S X H 10  0 R0 0, S0, R$KWi,ocHc# `- -LMP<8Nl@T`p(KT,K, Lp0    P, 0 <8,Wi#9 0 p-LMP8p`K! ̃.# 0@P0 PKp,Wi 6 0 -LMℑ8~p(K!ph 00  0@P0 P>41W ,802 0cP`0  !!( 0 (  !!04 L :P@zG`W 0p '@Pp0x Ll1pS 0Wj00S,(K, `,,  a,Wi#Hci9 -LMp@ `.` $PK @ 0$@ P @*Y ]K -P`pWL "@P+ (0 0  !!( 0 (  !!0 Z0@P`:P@`XW% D9'49%  Pp00Cp0ꬩ9DWiUi -LM>0`~0^p@0P 0` `P @P 000T 0 S 00 0P  K0 @P##999 p-LMP@ 9|`|0 p0"  `0R0 P b 0K@P0 P 0`KpӸe,Wi<j#HcD9 -.L M  8 80(Ǩ0!Y# 0@P(0 eP0 ,(KZ1P ,08`0ap`p |1ph  a(RP4K@  0 4@ m"PA,P0U984 ,0Z0S. :@`p4@ R00000  0  0 %0  !( ( !Z0C 4,0Z0S$,8 YHcUi<j -L M0`SpP5 0S@0SQ4KP40 0 #*@,K` jP L,!&R*8 0R*0`#2 0 00  000 JU  !0 0S(K0~@<8 0`S008 ~ ,I$e0 0S <jHit9Wi 0Q-L@ 00SD00D0p@-0\ @!@1Q% \ 1 !R`#`3P TQ030 "SaP^ Q0#02SQ#3T0#0 2S%ppP 0 S(0$ ,00\1P -L`$@0@PS:b V@cp V:E f@U>0e S 0SR F@U0P@0F\2 lU" R!0e S9A U R0ST0l0U 0SS1:Q0P@U 00b S9R R0e SYD0S0e SI9@0S,  `0R 1P `0R 1 -@PL`@T `0P 0Q-L@ 00SD00D0h0@-D0DQ 0$@ 0TT0ST0SH H0RL L0RP P0RX X0R 0 00R 040c@P4@PP80S@Q 0S@ R 0S00 0-L@PP D0 0U:$0U#300< h00h0 Q-&:$0@2 PP 0Q:0Q4@0Q*H0Q:L0Q:TP 0 R 0Q:0Q4^D0Q*dP0Q:0Q4 0 Q:i$0(0@-P Q0#03 P$ 0S @@1 Q#3PQPQ 0T # 3P R0T # 3S RdQ T0#03P0S T0#03R0STQ 0T # 3P R0T # 3S R\H0LT # 3P R0T#3S@P T # 3 Q RDT0#03\0S 0 0i-$ (,@0 R:D0\34H0R:L0\34 -LpPU/ 0S,`@T1 T R& @TP @0 Q 0` 0S0@  0S@@@`rP nPU 0 00p 0 0  R P; X> P@0T 0` @M0S0P  0SPPP`?P ;0SP040S0p  0SppP@&P#0Pp0p 0 0 z0S@00S0p  0TppPP@p -Lp` R 0SPU 0SY0 0`R 0S0S @TP R0 0@ T`@0S0P  0SPP`PP@@ PRi Q 0S R 0S 0R 00  S`00S0@  0S@@@`9R 0S0Q 0@ 0S0P  0SPPP@uPr@ 0R 00  S`0d0S0@  0S@@@`VPS R 0 00 0@ T`@D0S0P  0SPP`P6P3@y R 0S0P 0@ P 0S0P  0SPPP@P@ ` -pLWP8 @TD@0Sp`W`V p 0Spp U`P@ 0U@@ 0R@@V @@TX  p`W `Vp 0Spp` 0-PLP@" #3Q R  0 S R0P 0  Q@@000 0@0P  SP 0S0#03 P P 0S0SP0SP0S  0-8LP@P'< Q00R03SQ PD0$ T(0, 00\ H00SP 0T00 -P$L@p` 0!S8@T- P $ (0,0 0S*:@@P` $ 0S X:W WP P0P d0P sV@ ;P@ A2P @i P 0S0SP0SP0S PQ00SQ00S -@8L P< 3T 0-(P@L2$00$00h2 p-(@`L2$P0$02p$phy$0M 2 -$0L @MhM$0M$0L {2$0M 2 M-LM4 040` P @xh 10 Sp!z3S0CD  , , K00K0 PPFY`+,PU (0$ 0TI*,Q $ (0g @0RDT:H0RLT*P* 0@P@T :,P,  ` x(K0g00T0@ , K00K0 PP  `40`@y z^, ,P `<0T* , j p-LM$0P (@`1!lLP 1$0 0$0$ X0[z1$0 6L 140040x140040x8 -$0LP@ 1PU40040(`1$0 1p1A%LPpP3U 1$01KP -QL M< @0 8 80Q:<0R0,0 ,(K 8<@P^ 0ZD0Q F 0ZD0G>$Z(0, 00Q5P 0Z<,  D0@4 0040 00 ^ @  $0<`Z p1p!Q`!V<J b|@P& PU# @ 00CS"'.'.'.'.'.'.8 m0,0  8f , , 8 ]0@TP jW P妰4 0S00S a00CS0u$0 Z p1p!00S @ L0 D0<pbP0b 0b04P`@p0@ 0A,P, P Zq$0Z p1p!$0X0ꔪ9DWi -L@^T0000AЭް9 -L`PP1 @ qT p  fU $0R P@T,(0, 00,000  0@@ 0-L M 0@RPP x0SVPK0$0( ,0 0 $ (,@ @֯ЭȪ99 0- X0PRRUL*0e/s B@Td >000B -\0L@  Hh&<h"4/00d P1d@0CP1h/hiiLg,WiUi -@LP  R0000 0 P 0-L M/ 0d0 d0d 0d R@P 0 @嗨p 0hd @叨TとL 0Dd@儨(K0hLg,WiLe9i9i9hi -Z%ZULp`e   t < @3$0X+*@0(PS$@d,P  << D05 0P0 04 48 ,0S    4   o,(P$$ bP!  b `h0@,408@0 dPtu00Le7T$0 0-$0L 1PU Q-d@T P10P1db-0\0T000000 P 哢@P \P 0 ^@Pd0. d0d0S00>00 -LMp@P` & 0:#:S 0   Ć Ć780 P 8 0 Ki0 R>0>001010!# -LM ʠ,ʠ\ 0R lR >0. R 0^  0fP  0-LM@ʠ,ʠ\ 0^* @l^ >0^ 0T.Ơ0 H R P (4d 6R0  0-P 88`0S*#8Ui -L -LQ 00 (` P00 P00S#@-@ʠ,ʠ\  0R lR >0. R 0^ Tw.w.w.w.w.w.w.  0@j  0@  0@\-0 " 0S  ʠS,ʠ\ 0R lR >0. R 0Q  0 03@-@ʠ,ʠ\  0R lR >0. R 0^  0@ -LM0p`VP@  IDP*"*R 0T@bT >0N@T 0Q  0 -LM@ ʠ,ʠ\ 0R @lR >0. R 0T`V0TK p U 0P $PK0@ $@ P @d L -LM0 ,0  p ` 0 \ XTPU 0P0S0  > S V@(K C@Pʠ,ʠ\ H>0n`V  ,  a:#:S0R0S3R,  7 | 0(!6@ Q 0@TU 0((1 `0,K0 0 @T,0 00\  BR  B 0V 0@pW ` P @ 0 S  @ 00 0SS SQDSPPB 0  X @S @nSA ST0 YPV 0   p0P0(1 `,K0 @S0P 0(!6@ Q 0@TS @wXʗW@k,!K 0 @Pax0L 0S 0 @X 0Z CR   ) $ /? -L,MH T H P :#:S0D >0 Z< *2 P08 40 ^8 04P L 4 T TD8 0vP4 H4 P4P , KPr ,P. 0< R*L 0,<$ QSa 0R^:D0<Y!0000 ) 0 0 0 R# Y0 Y0,P,  0<Q PH T8 LD8 吸L8 34(K@ Y@  Y@ 0R0 , < aP 0S0000S 0S,00 @4` @dP P00 PH T8  040 4  -LM`@00 SpP (K 00Q, KPP00@0S 0 0K PP000, R 00CS 0,0,0 00@SP *10 0 000@-P@ R( 0S%\ ) \ ^ \@ 00\0 S 0  0S  R 0000@00 R P, R/ 0\00 S 0  0S   0S 0P@ 0S@ @0  @0@000S 00S0@ 0\@ @  @0@- R 0S ^ 0Sk0 0R 0SI0SD \   R00  \0S0  0S    R( ^ 0Sm R 0S 0R00S 00 S0 0S    R 00000 \0 S0  0S  R 0S@0T00 S @0  0 S  0R0 0S00 S0 0S    R R 0S P0U00 S P0@  0 S  @ y -LXp5 PU?P0S `X`V 0S @ W`RP 0WP P 0RPPV 00SZ   `X `V 0S ` P 0S0SP0SP 0S  P 0S 0SP 0SP0S PQ0 0SQ0 0S0- @0 S0 UTR p-@LTP `P`@ @T@p 0-@LPT P@ @T0 p-@LT`P@P  R0T 0@ PP P@p0@0@ @P -@LPP`p 0  !( ( !00C0, 0 0, U ,0 `$p0,0P0  !( ( !000 -LPM< 8 \Kw Kp@-d0 P0U#F"``@ 0T !P01Rb`0^pHcHi0@-0 @@$!( (P@@$!0@ - rL\R20 RP@L0R P U3 @0Q  Q*60 0 0R0 4 R0B60  B0CR0 \4 `LV`@DPV 0 SAP!@P@ 0R:P Uh\ `LV`@DPVʹ|U60 0 R \ `LU`@DPVHc,WiHi9ԭ9 -LhP \0*0  0P 0@ 0P Ui9 -LM0  4 0  P, 80 < @  (2(b$ȟ. 0PQ<0 @_TO T"vM\(00\Ql!L0R A0R @0 Ul!L0R 0R d (0 0R0HA :#:S 8 40Z C$1P*VR, 4B  ,F@<00@ 8!"&0@(Ko 0@ ?SʭRD0@0@T P0U ?@P 0QʙP(KShUihtWii,Wih(989 -LMP`4 Vp@q V,0S  0SQ21C  4000(K 4 Ph#2000 0 P; U, X `FJ$&0RL04@<0@0D0H0: R*YG 0  !( ( !0`VPY' 021C, P B 4,  )4 (Ko#|!4 0@Pd0X(Koh3,0 g ΔHcHiHc9<9p999X9 -LM,a0PS  A* pW$ >0n`0gV@P0U,>0 N@ U $`KP% $J U/叔hh@(0>0>0 0U vtHcdghgi<j999 -递L@M0 , 0 \ 0 @@$6^ p 0 0b\0!6u"3@u `ᒉ0SEڸ 0PcW@"#::2#0PFU`` ƠPʌ0L04<0@0D0H0 R 0S ! 00 0^ n3  b0S 0pePcUg 0, >0>00 00 >00"` 0 P00C 0 (0 0, `\0TXL(K(ȓ,WiHc`iB}HiUi<9dgWihg9@-0 .!( (@.!@l@-00S%(00A R0 10  0  !( ( !@00C0(0 00 000000 R 000 0 !( ((  !  B R 0  0 Ui,Wi-(0 C RH 000 0  !( ( !00C000S(00  !( ( !00000  0 R00P00 0< R0 0 0 0 Ui,Wi 0-(0LP R0 <10  0  !( ( !00C0(0-&,0   PP@0!!( 0(( !! 000(0 @0 0!!( 0 ( !!00  P P,WiUi-000CS00h00`0 000 !(07(0 ! 00C 0,WiUi -L@\ $0 0  !( ( !QA 0  !( ( !A000A -L$MPŸL`D@0@VPU8 4 <0 /<0@PPOTFt 1@ ?S,) Z 0s ,0\(0\ʘ1!lL0QHP`0@K  0 @0 ,@ PP @(KR1D0Q Po0RO 0@VUX0@< 8 K VV 0  !( ( !h0 Q0  !( ( !ShUihi,WitWih -LM`@.p,PK 0P(P  ,@ @vPP(,^% @ 0 0  !( H( ! R000(0  0  0 ,@^$K4Oc -(L@L7 R 010  0Ǡ   B ( - RN 000Ȍ 4!00C000S  0 00C 0 R000  !0(000(000#!h R 0 0  !( ( !00C0, ( 00,  0 Ui,Wiyp -QL/P`pW5 1(0&r`VP @0Ds(0 0  !( ( !`VPhW(0 ! 0  !( ( !sDWi -L M0@KS8 0 ,@ G ΃,Ơ0@ cP4 50@T2 6P` P `8 e000p0  !( H( ! R000,0  0 q 080@T4(K8d9 0-L0LP@L|00 0X El0 $0lE@lV0hi갵.Wi -p0LSDP`(0! R& @0!!( 0c ( !!0,`SP' \ \ X4 (0 V!(0 R0  !( ( !`0PS0 !( 0 (  !0(0   0  !  -LMpP@` 0 \   00 0 0 00 ,0  Uy 0 A0` 0W2 0  x 3X00S0 0v03R0S ̠@w@3PVP 04 (0X00( X/TU(K00  x 3X00S R @ 0v03R0S  0 0$# BX T 00@0000 ,@  0 ,0 0ZDWi -`LPp@T6U#:0`V @@dG$H04$ 00 F$0U0S |h%@l0!TX0&h$<)0d#8 # UVlii`iHc 0-,P& L@0L0h<j -0@LyHc -LMp aP U 0P 0S U@ P4# @TPU@$  0ZW`P0S U@`0` lL0@Q@P404$0 8`ili|9i,Wi -LM`@P V 0p @ZUJ 04 L0pVP  ,$ +  <j 0-PLqD`@0h 8Pl h@0@0S T0li`i,WiHc -L$MD H0 80K@0H0p 00K@ ,0 PS0 , 40 Sʴ 0K80K0S @PoD#Q ʘ H 00S @#6:1< @ @@HTl P` P `@Q ,0S@ <0 0@ <0 40SX < R (KL D @P (0   0SC 0  !( ( !(0 0  !!( 0 (  !!0 R @^0@(A0 P0 `00  !!( 0 (  !!00S80S@0 0  !( ( !PdH`0`0J00`SF*A80@SFP`8P 4` A -LHM004 ;Bv @0S0p0 W0PW@hKH0;@T70#0l0 HGl `0"p PR0!!( 0 ( !!`VP1 Y (0 @l0p  R00S  0  !( (@.! , !( @(, !HhK 0(Kh0@-dd ,\O 0C2dS03S<0<<0!R?CQ@00@0,0dH00UiVUUU - LM pXW00S 4 F PG L6L&H0PQ0 `@ R 00R0SE| 10 1@ `(0 $1 0$1(@P p00p01Y0100XW00S(KXP 4 0Rʼ0R0K,0 000 N`p4P, K00K@ @P4mpPUJ X (0B@0!!( 0 ( !!( ' @D@ @׾14M `V (00`W  04 R0K,0 000 c-- U`l UtR00 t   81X081k (0 ``t01001o  (10(1(@PT0@ 0S"] hp0S l0Qy (P0  !( ( !000`Ÿ1 Y PwW0@@ Y1( K0 00_ @ 6,10,1"0!!( 0 ( !!a ` 4P4tK@, , K00K @P00 P#00  4K4 pP  @0  !  ! 0P&} !t(@u0 ! +@ W00000  !VtD0P(@hhUiDWi -LM0sPo!0PU` V0P!@ 0eSB101   1Q d0St&P1\2d R@D0^`@0",0 lh0Qv 2PU9 0O Q ,R0jaZ``X00 %W# Z``X00P ( p@S  0P2 V i<1W0J<1 ! まP 0  !( ( !HPP0@  !( ( !( Hp0Q  \ Rn~khUihDWi V 004 0B6C0 P@|Y 0` aV@5 ,08@Y4ёP$D i,WiUiWi|Wi^9WiPWitWiUi -TLMl1HL02 8#8  P 3   @p@Ws 0 00, 0    BR4 0"@?C SD00D0 W0Po#0 PU`VP`P 0OTUR 0 0K WO @  ,0R0SPW 0T00000 0R0000D0 0 Pp l T!04PL <@p@WD1H$ pR1@p0W100 ,@ a4PS0e 0c0 ȟ00X@T@0@PoPU`Q D0xPo0Q RO 0@V@U@Pi,WiUiPWiDWiVUUUhh9Hc 0-0LMx lL0@QP `1 \O0TH/PQ8@ P ($0 Qi,WiPWitWiUi99;( 0@-P@ R( 0S%\ ) \ ^ \@ 00\0 S 0  0S  R 0000@00 R P, R/ 0\00 S 0  0S   0S 0P@ 0S@ @0  @0@000S 00S0@ 0\@ @  @0@- R 0S ^ 0Sk0 0R 0SI0SD \   R00  \0S0  0S    R( ^ 0Sm R 0S 0R00S 00 S0 0S    R 00000 \0 S0  0S  R 0S@0T00 S @0  0 S  0R0 0S00 S0 0S    R R 0S P0U00 S P0@  0 S  @ y -LXp5 PU?P0S `X`V 0S @ W`RP 0WP P 0RPPV 00SZ   `X `V 0S ` P 0S0SP0SP 0S  P 0S 0SP 0SP0S PQ0 0SQ0 0S0@-P@ R( 0S%\ ) \ ^ \@ 00\0 S 0  0S  R 0000@00 R P, R/ 0\00 S 0  0S   0S 0P@ 0S@ @0  @0@000S 00S0@ 0\@ @  @0@- R 0S ^ 0Sk0 0R 0SI0SD \   R00  \0S0  0S    R( ^ 0Sm R 0S 0R00S 00 S0 0S    R 00000 \0 S0  0S  R 0S@0T00 S @0  0 S  0R0 0S00 S0 0S    R R 0S P0U00 S P0@  0 S  @ y -LXp5 PU?P0S `X`V 0S @ W`RP 0WP P 0RPPV 00SZ   `X `V 0S ` P 0S0SP0SP 0S  P 0S 0SP 0SP0S PQ0 0SQ0 0S0@-P@< R( @0S%<4\ ) \ @^ 4\@ 804@0\<<0 S@ 8<0 < 40S48<< 4R 0@000@@0@0@8 R @P, 8 R/ 80\<@0<0 S@ 4<0 < 40S48<880S< <40P<@ <40S4@8@0<8  @0@@0@0@40S<80<0S<0@ <40\4@8@4<  @40@-4 R @0S8^ @0Sk<0 @0R @0SI0SD 4\  @ R0@08@ \<<04S<0 < 40S484<88@ R( 4^ @0Sm8 R @0S @0R@040@@S<80<0 S<0 <40S4 8 < 4 R 0@000@04@ \<<08S<0 < 40S488<4R @0S4@0T<@0<0 S@ 8@<0 < 40 S484<44 @0R@080@@S<40<0 S<0 <40S4 8 < 8 R8 R @0S8P0U<@0<0 S@ 4P<0@ < 40 S488<@88 y -4LXp5 8PU?P40S8<`X<`V@ 40S4844<@< W`RP 40W4P8P8 40Rphii p-h0ML` @P0 K@ @fP0,d(4Kpxdi9 -L,MH D d@nL LH 080  DQH H0<@0 0Oᄤᣫე< ~D LD  ?]0 PD#<0eXmH0p0 ,To@ 80K0 P,2"@`\tPx`|0 84@H\ H< 800b ccQ3R 3Xሀ H0 R  H<800` ccQ3R 3X᐀ L0 0!MKLP0SWLL  00, 00D0EBD|<\< " @0O@ D L$@D? 0 8K 0K,0Kv@P!80si40sfw PL0 0R0  \RH00@ ;00LGoH=(KPL@8oihi/!CeX/̱9 -tx 4DK#6:Lp@rP# (4@$0cOF#J6T[Qd@ Qw@P0Ot0x@i i00 ;@ 00@i9 0-0($@,0LP0൰P 0000(,P $$4R@0S" U0@ P 0,!Ax$h00bh0@P (P0(,$0Vc0e\, 0@&wgUidi9 -P"LM@d0Vp@ ,!0PP0SR S P!0V 0,!(K$40"!B 0S p@ @0OD K4#R0 A0  ZP@QCN@ 0p $!u\0@ Ipp@ye00S&  0dP vK,!0PP(0 ,|KPP(0E4 0P44;L$@d 04 000h0P0h0gOcHc09<9Ui -d1LhMPu  K3P K%5UPA %88#Č@ {pKa@0, [ @Zu\ [\` V00@P'l\ K$l 0@4 Lt0lP  &@$\\( {pK[ 0!ucP9i\9 -EMLMP`pa0S= S @P; xl(Kh3Z ( `PUDTU W 4OF#J64; 0#X@PAn+0`唕@PDTU Z@2@d @PG~KpGpG+,0K`@P+0TD0L@ H0  c0@|Kh0 d@ t x |p D` (@P0`0CSh/<//////@,0ST0! @\ `P0PU  r&P@ 0C@P\ m\P h00@0@ST00 000S, _,\ O,  k'@P 10S $\\@ @\ @Hc`iUic p-PL`,{U@@Tph]DWi -LMp`g0@,P@fNTK0$@K0@ $ @ `PV@$0  !( ( !@ R000 0  T PWiUi4Oc -70#L0`M*x0 000p  t cP| > W0h$40 S%:S 0 40 S:SQxP tQ! j`P$U |lK_@ lK ltQ  PS|@(K@x3x#lL0Q x0ST#t0  0OF*p#J 6|Y0 3# ĠP,0 xHt\PPw䂟P@6Q8040 t0SW 2"lL02\@0"000| =@ Pp |` @0PD H00H0x0S0 Pq |Pp@`* h0  !( ( !`VZJ|.(0Kp# pP| G00x;@@\00 6|YpW$ PZZ Y *g|0PS0S PX%k.Y p|lKs|Y 4Ochi,Wig!CeHg@ l. -Lp@Mt0q0 t0 pP09LK pP00P00Sp00p0Ui00  -L M0 S0d% @\0!@@@a0P  0@rl|dlt 0l@glXYlKhD0P 0$s,"sHg`iUi9diIJ9i̲9himch990@- 0S 06BQ*0 a("400@_#& U 0T -LM0 p>0n`Q70 a(@P$0S, |060>0. V  b 0 K@P0 P  ah=r K f 0| 0f#&B| 0S* 0| 0c#&| ܲ9 P-0L R.  . hr9 00 0 -L4M0\ P `X Zj @<0t"0b: 0S_ R@@ \P  Z00ST K0R00n\0T0@0@T0 B? @ġ0 l< L  @00KP0 H` Dp ,@ 8 @@ 4 G 0SV ,1@ XPK`0@H V @ T00T00S` T\`0 0C0 S V(K S@f X00R0S T0 `Ug0S8 XB2`Pl \T Xl!^,1XPK ` 9i -LM= - 0LS0S\qxpD0 0@`,PXW,9 M-LM 0  X0 0HW@`  | 0 x t0 0 |Pt Uzx0KpP` vP 0  !!( 0 (  !!:@p Q P`|@Tp 0`,0 PP x`K  KP" m ( m 3 @0 P0!!( 0 ( !!(  @Y 0Qy :`@|p\m xf R 0S P0000@%80S0 =0(KU`p00 @`P@00 |@ T0K0@x0 t@ 0P |` _,0 @|t Q x& (  0 S0@0  # 0  !( ( !0#83@`pQ]I{0!!( 0 ( !!Ҷ 0 S , K00KpPK 0 ,P x@K00@K0 @P@T 0!!( 0 ( P!!T 0^< ,0TQ. (0m0  !( ( !.!(  (  !O    0Q0 0PP^P ,0TQ0 S  0T01 T<]00  !( ( ! H( D0: 0,0 YD@@ m@Tj606\j oo00  p0!!( 0 ( !!90x@Spx Q=DWi̳9P9\99 -LM`0p @0U ` p KT0  0-LM@0/ 00H00 0 P0S P0000| l70S 0 Sj00    $Q(0(0(000 K0K0h6_oس99 p-LM 0@C^ :`0000P5  0   0 S 0 " P0  0 70S    $ R(0(0(0  0 0KphKp0 hKph5س9 p-LMP8K 414a@0TH>(0S $@T U0 0S3 0 0 R,0, 0@$@T@Tz,@T 01 P& 0S0  $Q(0(0( 0<0^,@TKph  08iHi@i -PL0`X  p0W0 04@0 0l!4l!i -LMp 00@"0h60S{  0SQ 0 0 0  0S$0 $0(0p0(<0@600 R; 1lK 0,!lP"PK`| 000P `@P0 @0S$0 $0(0p0(<0  40 0@0$K4o 0T0 l 40  L, K0 P(0P0, @(`0 @Qd&T 8 0#40"!B 0S@v9HiiHcOchd0 Hi8i9 -L M@R \IpP` 0 0!!( 0 ( !!0\p:@P`0s ^,  (0  X 0p\0 0RP P(K0 0P0\`p \:@`pPUY  U `P, + (00  !!( 0 (  !!PU 00 , !( (, !0(! 5P0 P^, @PPU ,K 0PPP,0 , !( @(, !:,00 ,(0 3,0  !( ( !I, 2Y09$9DWiQ00R0 S-LP P00S00S0P00l89Q00R0 S-LP00 P00S00l`9 p-`PL@ P`00P30@{p p-`PL@ P`00P30,@cp -L(M PU`@0S 0S0S{0Sz SITH DK0EUSP 8(@#h"x 4Ÿ40S;80S89 0 Qg 0@S.0S/+p P#Q  0S0s "K0S! Q 0SQ  0 2P 0 1(K 0 000  0は[^ 04.4 S*  P[0 0#P @0 0 [,^0 0*K ֪P[T0S0S iLi -L,M 0 ( SP!0S/`0Sl 0S 0S0sc ,0,pSa DKD`K, K7P 0S0 0010\ ("(04"43K#McL%c8`8g gP8i@9l9 -`SpL@ k 8#QP 7Q Y*7T0CT*7T 0T\e-P7Q 7QUY  m9x7T p7TQ 1CTP 1CTK P7T_ x4T/ 0CT+ 0T( 0CT% 7T_0CTt:X 6T5 6T  6T T1S  P60S6T-Ph6TY 0TX !`6R/PUPU  0m\P5T :50SQ 0S0S 00S2 5T $0CT|5T0CT*%0CT0CT*!1CTM1CT 5T $5TPK5T{ 0TzU Xq 0s $ S $0s $ S 0s d@0@0@0s <@0@P0@ 4T 9,0CT04T N 0CTR 0T90s !P`Q R@ʋ 0A0@0s3 PaPU`V@ur 0AP0@1P3TH 0TD3T- 0T6@+P2T3h@E(!P0P0d@\0TXx R@PP $0@P0@0@0@o SP|U~@Py Zw 0Bd610P0S (X!fR<PbU0@P0@ZQq0@0@pRPO0p IPP >AP \ ("(04"48#P R \0R00(!#&P0d0\ ("(04"40li@Mi iildiH9Ni4Wi@eiHii "i %i i i>Ti Ii i Qi L%cFiRi !i  -R  S LNMR`1 \ `4Q 1CQ 1CQ -(K0  0Sm0Sj1SSf1SSb R_3X^ 1CX[ 1CX0I `P P@QJ@0`SE0SBpK6W  5W K1W@T00   1FSK00KH\ `1t n pX`K: WXP80T@P40P@00L,0  XP T@ P L VP 8@KV0)D2X  XK V`!pWGpWD 0SY H`K VHP80D@P40@@00<,0 XK HP D@ @ < VPp1X0 VOKV  V$ $RKV`!6 K_K@@ V\\ V\ `1 '1%!KVT00   eK_KV$ $V`!6 @F@ |Vd00XmbFlVpK`fV  eVK aV4iiii 9 -L M`pV 3PU,P  0 , PUX t0S\@\T@T@T 0S,0S+ 0iS PJ~ 2 R ,  ,0 R00U0SU0040 V00S  P00^00Se 4 R 0 ,i,@ , R3 ,  0S9  0@hl*P hl* Z 0@hl+P hl+, 0 0@+P +,(K 0@*P *1@P ) 0@)P ) PZ~,0`,` ^RYʗR40S  N b0 0bSPR@}<40S9 d2cKcXi9 0-@LTP @T 0 R B5UPT00 -QL@R  UMRp` K\^0S[ .SY T 0 \J .\H ^I  0 a?R0a 0PK0KW0[ K A [R A0B0S 00 RNKq K []PKT00 <0 \ ("(04"4  0 T0 a 0 p-LMJOK`>L0 XPK@ T0000#0Kp gg -LM⨠K T0 8 VddX@KtPK`Kp  pK嗀K, `pK_K|pK{K0 (K@88 -1LS@ R hPGPp4 P2 GP 2PUU` ]TP  WTP U" U00 0  00  0 00  00#0 UP#P P =T  'TPIcHc -LMPpPDa0S"$K,1@T T P0-@T5P0`0S 8 _8 _0S 0 @ P `p pP@ P`p_8`0S 8800 _8 _Mcd2c9P99|99 -LPM⤠K @8S U\ ("(04`"q00K 4 KxKK  0  TT K0[xK00K` 0KhTK@0 \0K[ K(@ ,@ P@T  `V $K6@00@0 ?0@6 (p DE`P k(=KP 00 R`  _`8Mc<9 -LMh0@S *l0 S:68JK0CS P d0  L@ KPUP 9@8 -@L㔷0000#0 -LMPP T @0S(NT8pK6R\08#8@D0`K#Dt 0BK80K7K2B@P ` \0R* R\08#8@D#Dt 0BK80K7KB@P ` \0R d0  RJd0 0d0Kt @l?t @f?P8`8 -LM`\@pPe:U VT @T`00V00S 0S 0dS1!P00Sp` @P"J 000 00 0000!0000! 000 @TP Z J0 000\PZ0` W V00S \ p p W 1 1P00Spb 8#8%QA A0T@ @P"J 000 00 0000!0000! 000 @TP Z J0 000\PZ0 8#8%XU\EPEJ0PPZX 8#8%QAAp0,$T!Xp 0~,$8#XLpGRp<8#X8#8%P @@ $K 08#8%XU\EPEJ0PPZ8#8%QA A0T@,KsQ<,$!$',, %PK0SP@ S2 0P 000 00 00RP& R 1P"[2[[0[0!0000 0!00P00S S 00S S00S 00S ] ]뀷9T9P P0Kc@-@000S S 0P P 04"48#88#800000S 0S S00S S0000S -@L` pR! R 00S SV 0S PU P !P (" "(04"40!00S R W !P ( R !P\ ( -PRL`p- J;P 0S( M=00@tPp0 0 ?X Q Q P d0 `0Q  3PPP -`QL@Pp P P 0S  U R 0 PA0 d0x@@T 30A0`-! 0'! P 0!0P 0 -L(MRP(  8 @ T6 0 S0 S0 S= (K 0`PDpKO(0 C0KD K P8 `a P( I 04P. @ 00SPR^ J P(  00S S( 0S 8#8# / P( A`S`Q 0S `` NP0P @(Tw -LM`@ 0R0% ::PH 0 0QR0%p A:W= PEU@ R0 U00UR   bsp% 0PcU@0@P  t (0KLP ( 0R:0PD (0K:P ( 0R0%p *ZXi490 `i -PLU'@N N0  2PU `\0 00 pW  PUTQ0 H00  0 00b0  00C0li`ihi 0- 0RL@ * EPP ぅ070 -N 0 0C 0 0 -|pLF0Sd`00P LP 0 0@ 0$@xP-00hplg`iXi -L!80(qS00^PU 90P0C0S90`(0 0@(0,@FUP 0R*0S`0 R 00 0@004@ 0) 0R:@`PP P z:P olg`iXiKchii -L,ML p@ 0`SP :U  0$0 PJ(K ,0KP , 0R0%P * oY8< 0SNHP.P*,0 00SP  P4 0Q00 0 00P 4 @ NM JM040A  P R  3P~  04 8<0 0@4<1< Q 80 0p@F 048@ <,P<$"*<4#:Q  0q03R0ST( P0U0UQ\ 0 00eS R000 噆 @T00ǟO 0@ 0$@tǟQ00h00 0 00b 0x4'00C0 00@& 0$@fƟ00F0%0 0@0@0 $("(!04!48#8H0  h00@<h0l@@04"40d  0 E%0Sş005Q5 QZDZA  0484 <S  (LP "LP@ H\00H,0 ,8 0 H$("(04"48#8h("((0Q< 80 08 0S0H  Dğ00D4 Rğ|ğ0RQ0<00 PH D@$0@0S00 048 0@`4dD[PaH00  L QHH L@ LHL t0'P d 10 S 500S0C00 00S0C 0 000S0C00 00S0C 0 000SP 0S 1 0( 0*i Hp 00SL   `ALVitKcpi -LM0P @ $(,L<4,4" Z@`$Kl12TE \10SP@KG0 ?0K@ K8K0S6 ,m( (pP d0 X0\0Z:S`P l0Z*0@P \r4|0@T (@TP00S00S, ("(04"43KKc8Lc iKc*@KPKF`KFF0LKK 0KK0K0KKKF\KK F K F( ,0KE9,P (0(3,3@KF\KK0 0KKF'}p(K;0[0S0SN 44 R O/K  B.0E0 pR[0[0St\ ("(04"45KlK0[0Se\ ("(04"44K]O/K  B.0! MR\ ,0KP , 0R0%P 7*LeRH3@P  $(ZQ 2 R: \KL K  "R1x@KHF0pK \Kw0KxKCF( 5`P 0Q @T \2 R3@2 R \KL K H Q\KL K ( Q  H FPL  1 R O/KH.0 B⪖\K@L K  0Q2L0[SLA \KLK Ep3D 41 R \KL K eH QK0[0S@@NK(J( "$P$\ 0 a i0 00V 0 R O/KLK.0 B]\K@L K iP5F 0xQ00 R \KL K $L rQtKcMcPiDLcKcđ/9949pi<99x9̸9T9й99 -/RLpMp0 Q 00 S0% :Pf 0 ` P0 3V ,+Vg ,V V( 0R0% :PO 3V000011`PP 0@S0% }:P< 0$48#8 R`P<V 0Z0"X' hK7E0 \h0Kg K `@K,hKP KP 3 R~ 0 00KⰄPk3@P $((K 0R0%@ J:T 0 0Ra`P0S 0S0% :P 0 @2  0 00KyP 0 00R6:0W 00KjP 0 0R':0r 00K[P 0 0R:0P 00KLP 0 0R :0@0 00R0% b*PD@KLKD0 L0KKKD,9 4 LK@Pe 048 <:0RH0 00  L0K\ㄠ P t |0 p 刀 l`K ( 21C0!10\ X hK( 0K P+P7`@K  BWD#0  <(4"4!<( K0"p  00KՃP$ 0 0R:0C(0@P $(Mcpi49\iIc 9 -'QLMP@,P 2 R~ }(K(Qc 0/S0@%084HU U\ :\0 0 000^ K.0@_ 0MU0ESUU :V,$0!~@P p0QV R,p$0 ~P  8 R'V,0$0}P 0SV,#0}P  89pQuV,#0}P  k,a\fVs, x#0}P  .Q0S0G SS0C,0#0}`P| 16 0Y300~ V0  Ÿp8X`0@ 4$D8X 0@ 8$H#piMc49O49 0-PL @R 0S0S R  UP @0$ S00 00GKKcP9 -L$0w,0 r,0KcKcKcDLc -QLM# @P`p, ( I@P 5", K  >pf`0, K $K -`L4塤0@!0c48囤0!0c4<喤0P 0c4D古0 0c4C@@D0@ 00Q0 00Q DΤP@10 R 00d  SH,0 0C# L0 pPPP@ꫪL%c -, 0LRP*L0 OR8, 0S*4@pD`@` Ŕ@X4<0,0 H8@H00 Qk,L%c -LHLc(Q0( ,S  3S001 001 R0P -L.x0h|ghMc 0-LM @KvbPSM: 0V R*K:"[04"48#8 00@P  gt+00h 2`*0p@0@P0h @P!,0T0h `@0p@P@P,00h Xi -LM@` 0)S0p(P 0 0Q( Q0%(":P*0@P  (K( ,0KyP , 0R:0( ,0KyP , 0R0% *8-F0 EP00@Xi49 -0LpM40 ,% P) !+ 0S @-9I 0@$-9I-P`0@ |'R'P00`S2 ̟0 0@0@ s(K0S @O\0S|,10@#P ( (0xP 00@0@  0k0S ty#P\iP H)>8ɟ0 @p.Ppp@P0PK``hW@+fhP PpP`D@K.pP`P P`PpP 8PP <0SpU?=UZ8 \{0$K  !0 PRPN(Uy'Ud^PG ` =P 1P:Z   0SR 0P**U3 _(U"*P@U; X2UZ 0S70 @R 0@1S SPP@PPPZ 0S P00U U Z 0S 0P( S PK Pl0P00l09U ;U *P5U8U9U*Un +UU U *P,U .U *P0,@ 9P 0,KH @ PP ,0L@KS , }*,000 5e 0 t*tl0P0 0l0l0P 00l0TPi8! (R-LPp( B(0fP @@0S1` dP  0 0 7bP 000 0 0 0 -LMP`UdP0 @0 0P <(4"4!< $K= 0 * 000aP @ ZdpP +,d1c77 0 @0 0 000  )0@cPp -LM @4 8 G4<,$@a8#$@D  X00(@0 |R@y4`cPP@q P  wb@Pl1 (@pp ) @ 4 ,0K1@PZ400("Ƞ0l08#8 $#$(",0^!"( f , 04<8#,("(#8 0 0L08#8 $#$("<8#8"(0  0eP!  R4 000,0) , )<)00`,08^Wc@PP7@(K<h -LMPHKp HK\K 0 $) )Wp G P "   !XKmP  `XbTbPbLbP0KP 0 b Q R (K Q  TK !HP Q  PK !=P 8Q  LK !2P XT0Q S 0P0 S 0  L0 S 0@@T`P00(@CT0*8#8 $#$("<8#8"( 0L R Uu 00L  L0 <00X0S Ud 0 0 X  X00XT0S US 0< 0 T  T00TP0S$ UB 0+ 0 P0P  PP P0S/@ [( " BQ(  L*0S' 0S$0S!Q  0@P -0K 0  *P1 /U P `0S3 P X00@4)YX0\@0K 0  W 0S <\ 0 $(80S    R *8#4"<# #$# 00s 0x@KP'0 pKw0K'0x0K(  p0[S    07@P| d0 7 d0 0S0@@  1<10S SV Q QY HK0 ,K 0@K@P P,0 S ^W @0SY 0SQ X R 1@0108K\ ,  40K ! B\P P s1 @01, 6 0Sd S 0SU Sw  W D0 00Sl0R 0 P HPJ K\`P P , P \`Ps 0KP 0 #WQ 0SN (P 00\00SQD 0SQ1<<10&Rğ0 0@3 P 0@ 0S Q 0 0 @ -0KP 0  ` 00 0 00S 6 0 48#80 0 0 0 00S 60 48#X000( P 00S,,RO Q: 04 \3Q,0 P0S  ,00 ,0( P  ß`0 0@`0d@P002`U~"x0Ÿ0 @x0|@ 0 VPk 0Q`0 `b A 00S S00S S"0 0@A P 0@8W @0S , @K$*&@ #2 R 0S PG0S 6Qa00S]_ P 00S%48#80P 00S "48#8 0 Q  p00 @p0t@ P00S S 00S Sud0   T0S6X0S3,003Xih@9Kc p-LM@P 0`R :P" 0S* 0 @0@P0f @P)x 0K/eP  0R0% *T1D0@P0  x0 01 xXi49 -LM`4 wPj 1pPj 0p_PPb `P[ ,t ( @@0( 0@0 0`0W0 H ,* BA%XH  ;%0 0@40`0``````` )%0S5 20K<2 % ἕ0*0K弒K400`W00@0p@P@P p(KX^ D $X $ 00S ` `pig08 -@LT @T 0 R40S C R004   R000 @Tg p-TPL0Sp80 @`T  @Tphgd2c p-@Lˮ ("(04"40 l`("(04"400 PR ph g$P 00S McMc p-LP㞮0@8#8 Ġ#Č` G$P 00S 2U00 40 00040ph迯Mcg 0-P0P@LMKP0`0 00P6$ 0@8ggg -LM 0R0%@P :U$  0S ] 00S,!pP 0S Sx  ,0KcP , 0R0%P *$/ 3@P $(60S 0S|0Sy0Sv0Sv 0 $("04 48#8! CP\0h8#8 $#$ `Vj `Vg 0 R  B#P 00S0S[ 0SX0SU0SRXe 40S Sᗉ1 4 1@0S 00S@ `V `V0 0 R B^#PV$ 040Sd 00S0C 0 0]0SZ 00S\08#8 $#$("<8#8"( 0v0SE0   /#P\08#8 $#$("<8#8"( 0 0004q49piMbMcgh0GS S S S S 5S p-`@L(P#0V00@ 0`p -LxM   /  R  0  00 l2 XP P0S 0@ S*t0@PS 0PSX0S{ 0R @3@#PG(K K @ K"$ K|Kl0h0 x H Kd0\0 h X 054Kd0sN !\`Q R@@= 0Ad0 `@ |0@PP0 p 0G0KT t`V$ `08V#8 0pS:D@K"0 C0KD Kp  "`08VP#8K@ 㺤Kv"눐 XzQ0@d0 `@ 0@d0 `@ P@Nc -LMp0 ~W, 0`0P`U' PV,`U, W,0 Z:,4"0 0 *0V(02,200 @ %"P,`UWP 00S P3P#,冭(K4i S-`Lp@`PQPR00S`RU  P ` V V*` X   `P00X00S U  CS0`Vh@0$E D A0( #5#30830Tid2cNcMb -|L 0H 00 @&00 #5: /#300 00uMb P-L \  R @T 0 S *01 0 S00@ 0(R! L-J-d99 0-@PL` 0S[ 0SQ P d1 RMX1P U 0SCP0 Q C8Ss02 W 0   @T< Z @ ( @ (0HZ@w ( t28S02 00 )(0 PY (0 PRi8C00 0 28000"P0 H0Ba 0@eꔽ98 0@PP4TD B !P i@ 0 @@ 0P 0]1 0 i X@H$H04$48#(H@KH 00S0 0 0\0 8#8 $#$  Am  0 !`00Q0`P000   0 00 0Ba ሠ,R K.0 @e8@0 X .0,R Ke 4P80,0 NcgKc\iMc;Mb9p99 -LM@0P <Kp0  LK,P `V 7 RQ7@P N (K 0R0%P R:U \pK 0 \[48\lQ \ &300  L0[S @KH PPL0[S |PP@ 0PA A0P 0@[ J PD 000? K.0e@ K.0e8 0T?   ,0KTP+ , 0R0%P *W [0[0S\ \("(04"45K5 Rx  K.0d  n M 5q5@P $()e K.0dD [0[0S S4 RD @|P{4 R9 54 R <K Pt4 R# U i0 00S 84 R  K.0di0 D0 t0aP 8Q 0 R 2# S 9i @R@U@T} 0i 0S  0@  " 8#8S2d00d0P @PTY P 0   0TOHM0 PJUa 0SU 0 U  2S7 "2"0 -0!U* R  K.0d@80 ((U i0 00i JQ0 0 00<"0!R00S0 2d00i P00  @L@P`^P" D ቞0U00S 020 0 Md0  ]02 0?0 R {02t 0.;0L D00 #0Mc8i9499pi9$99T999;Mcľ9tKc -LAM@P<K $  LK6,01 P 0R0%P 7:UE p\K  \K `V xV0Sh0SM`6@P KL (K<0S080S-40S*00S'$[5R U0S HS  ,0K RP , 0R0%P *`5@P $(U <K)PbDU0S H*@K.0LK b( 4 R \K .0b  K.0b@C/K.0b8 00S <K K.0b v<K P  <0S 80S40S00SK K jH0SyD0Sv@0[Ss\0[Sc S( @KH P` R0! 11 0S  0S0S0 s 3X R S0S) 8[0[0S\ ("(04"45KL [ \K! ePp`P`1 lK@X i0 00S dR0S \K K.05b Ai0\]hR0S <U`1 R~  Mz@Ks K( 00KK@Ph d0  00 RS /^!<0RPP@SA "80S40S00S`00$\ ("(P00 Ġ"Č2\ K<K K2 @1 <K@00S@0`0\  0<K\ K <K K.0a|  ӲPP 0pa `UtKcMc0ix949pi999@99,9h999`89tP0S0SP@-0s l@0@0s H@0@0 @0@0s0@0 @L%c p-T0L@`TP @T 0\ R Pp4i -L`M0P\` 0S K qPd0{ x@K@d0 08KH0 t p l 0@ `t p-0LSP` p00S\08#8 $#$ ቚ0@t phǛw0 -Lhd Q 0 R  0q |0@0@T0X@| T 0@0@L0P@0@T0X@0@L0P@Mc9L%c -LMx@p8K8 رPPf d㔱T]80K0 0 K1 0K 0K00K0 840 0`,X@  @ Ԁ @, 0000 0 0000 4 0000 8 0000 0 0K8K0K0Kh0d |0 0B00 K@ P(UQ Kd@P 0 B1 RT@(K0H@K0 0  Ꮌ8H04D 0P,`@0P< P`0`@00 0@K 0K8K00K@ sh0d |0 R 0|  R au ` | `0 R Kv K.0_0 @P%@`08 @Mc: Q9l9 0-\0L@PT@T 0Sx x0RⁱP 0Nc p-L4Mp0P`1@T@T T p0 x0x R^P Kp@T@T 0 R0SpP Pp00p0H0 R F K.0_x0 8NcMc9 -L 0 A< i0 00T7 2 R( <K K.0Wi0 D ,0KFP , 0R0%` 4* L2 R h@T 2 R  <@ @ 0<K @@t0SN SH 0 SX [K 0 VK_1K`Kl 1[ x0301K 1["# 001K K0 $ (,< 4!4"<1 0 $ (,< 4!4"<1 A Q UP@4  @.00S0 R&  K.06W b@@T <0 R  K.0%W 0LP@ NcMcHi9L%c6MbNc9L9pi9499$9p99k00C0S𠑲6@& -d0L  0 0, 0BhNc0 -LM`i@_@P~ R 00 000Sؑ+o@q @,@2t <2( %00*K"K)@K0 0: pp @@@@ 0d0`0 0 * B,  (`z0(0@@@@@@@ P+ i@ 0 @@ 00P 0!0@0 Hi $H 204$48#("48#80 @ 00KP@:8= 0@@4DD(K?<hp8pi 0-0L R$ P0;S000<S<00t0@T@T 6@ d0  _P G@T0h0NcNcd2c\i \i0-Q P-R 8Pvti p-)RLP@` :R P>@p@ph軻S S @ph9P  @0 0 0@P @p@phYP 0S0 S [@ډ> @>@>" --LpM0 ,0 Y P`0 x@K3 0 pP@  >Y xKb >(K 0 :R ( pAP# 0@ 0 @ P p 0S 00( |0 RAP'CP7pH , @00@K 媴pP00 p0  0#$#̠`#8 0v00偳 0 :R0 q 0 R:(0 "DP7p P0@0 ( l0( 20 `= 0p :R T0@0P 04 ^|0, 0 0@0@Qtipi -LMP`Qp@ (K0SP0@S(P& P 0 R T  0R0V0S  0pQP vP Y@@< 0(p` @口LcМ8i)Ni -L8(MPp`0@`, 0SL  0S 0S0S  HKP 0 HKPH0KG K彲3PU  S PUB @0 l0  v0S,0S00SJ , P0S 0S$0S P P0sU 00@0 @L0 0b P"C 00@0@Xf l d20S.L0:@HKP ,0QP @EG (K40S80S =,=(00 @(0,@ 0sv =0sj, KX% |!0?@P l \10SML :@HKP ,0OQP;<,<(00 @(0,@0,0 T(0Sy r00@0@!  00@ 0$@;Y L 0b `0@PP PT @F<, Ktiiʚ;Xi -L,M QP`p0 8#8Qc괰0h00ȯ0Я0ȯ00 0ȯ00d00|0ȯ0ȯ000ȯ0!PW P  q00M@h<$K 0@Sx @-@ 0 ( SP0S /@^9@O@E U8@DPK0<K C0KDK 0Z@@@ɡ@DeW @ U+@㋌2p M@P6R@P_ 0 ៨@U 0SDPK @C0[S /@0@00}0S 1@x0S& 0S#0s S0S,@dH, 0(K@PX(PN0 P 0 1@Ab`0vP0  P  80, ( FL @(89KcKci08,9 9 -L|M`S@@3l0@  3pK 0 >PP p;Z K i;(KpT$ 0S P0S/P0S1P 0S 0S0s 0S 0S$0S(0S_ 8P0S 0SO ,0 ,0 0 =PP7P 0 R(1(0"(100241"41# !01 p0@  0#$# #8`000 0, K  G2 02, l0 , 2(0H `Pw$0S(0S9Pn HKHPK4[@K 0 >Pq@0H,,K P@PPR3S@K0@ MPoUB@KiHi -L`pBV P@ P! P9 T00PU0S+  /V P@ 00P P P 00W l `FpGW@ L @T0gG F`p( p@ @0H9`9D9I:@-@ tϠ0Cl$ !B l10b1 0!0c"0 0cb# a10` bP@ti_ N 0-@L P0h@-@R 0 0#\P0S SS0S0S  S 0SQQQQQ!Q1Q!Q1R 0S  R@R  0R\ P0Qc-R 0R^ U! !Q@-: R (2 R R -PPPP RrPP B PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R- RP1P P1P RrP1P  B P1P B  R010 1  B R0q0`0q0`0q0`\0q0`0q0`0q0` R 0\6 R B0-81, Ġ%̌T$\D#L0P  R0 Ġ01#̌  R R B0-81, Ƞ%ȌX$XH#H0P  R0 Ƞ01#Ȍ  R R B0-81, ̠%Č\$TL#D0P  R0 ̠01#Č  R8#8S    2  0<8P P  0S  P P  0S  -R0 0c BSR48 R p-@P`x BRpR0 BRRR P0 P 0Qc R-L" 0S B@ 0S \ @`0d S:^ 0R B^a00@R0Sa@ R 0S0a@00 P0SbR 0PP  R0QcR0S0  RR B0 0Q0 0QQ 0S0S QbQ- * 0 0 QaR *0\ 0 S Rb` `!  0@-RP@# A0La L\0   S00`P0S 0zP R00@P0S ZP\\ ^0 `0ȠR@-,Ƞp` Q R2RHV}GR0pG@00 0 0  0 0 0  0 0 0 0 0  0  0 0 0 PU @"Vm> 7("B 1@W b`0`WK W300 0 0  0 0 0  0 0 0 0 0 0  0 0 pG0 W `W 0 R 0,8(2C"B0 cbR  0 R p0\d0LL'82C00c08 P @@ R,B B[q p-@PL 0T("( 0$H,8L2C! @\` 0%H c@`R,B BR,B B,0QA>A0AQAApqL80@-Q@; R,P0 0,0,! ! 1!4##!#$" " 1"4##!#$""1"4# # !@D#$""1T"#T (P0@T0,0!," 00L8Q  0 " p-L`P@@Tp -PLM0@`. 0IK$1  0K0R0pK Pd@0 Pd@0  Pd@0` `&$K` S-L@P`0 @R1SVPQ00QppW(,0\h0p(S\0 p,00L  P  %9$0( 4`,p$P0p@31310% -@PL$Q ,0S 00$0 -L@MPX \ `0 (K$pW 0 0,  P, P`4`< (0  0AS_00@00000@00000000(0 0 U, `F0P U, V\,KX0`P@,` ,0H0PU8s, `F0PU, kV\,KX0`P0S0 8P U, `F0PU, V\,KX `P( 0P1:=0VPT0 # BL !0@UᲠ:,0`F,0 T 020CL01 @PT粠V\,KX `P `4`0P =("((8#R  = 0 K0̃"(<  \`d \(PERQh U, `F0PU, V\,KX `PH @< 0 h,̟0 \ 0 Q7h威PEP 0 000Php0P0 S.l0TL T l L T0H H/D DP L0 Pv  \; 0 < 0  ,0H,0(8S0b00l0 $0 #4i4$p@0,0% -$PL4p^@F (\ 0@c T#*0 ``T*:d C@T*00(0S, 00000R00#3,05$ 02,0(00@c T: l# (0,00 d `4d (0,00@$`0 (P4 -pPL`@$PU 0S0 S P#( T b4(0,00 04d ,@0 S 8 50P 00 -LDMPT  8 8(K$X PH QL  \ 0 @D@ P0P 8p<`<@ 8 S00000000D00000 04000000p000 0T0x0000V_ L`F0zL Z0Sp8 ? 0 0VK L `F0zL  Z0\"'`?P  Ud 'w\`Pd JRh? 0 0V# L`F0zL Z'4,<'<$00 0 p80 0Sx  8T\aH  D00L@P(08pS<0S  l@L0T l0 T/^p0P(P8 7 0 07 0 0`l0pPX0Xd 0P P8 < 8 0 0G-|M00\`0 S\ 0 |0  2R0 Q2B@P0 RPU0@ @@@ |ЍU p0 RpW@0 00SJQS03<X 000Q\ 0|0 Q@ 4T $D@0 ^U010!W0!P808 0200@(0@L @$0, 840p  0@ , `Tp$(ń0@p@`p0 4 01# 1 l!c0  ll 0S@BpB @0 D4  4Q40A0 0440|0 2R0C8#(@Tw 000|08"C^B4 0@ T< P`0U |0S (aR  00 cRU  0( 0 [S 3 "R< 080 0  0bC1 @000000d0U0P0S PZ $(,80>P00[P030"S @  7 4^)  P0 4 @0S80 0  04L0#04 0 @!@00 4P @0 !0084 0@00400@̠$0(@,ز88T88P$ R 0SP-$^ 01 0C$ 0 B0P- $P | 0  !400  0-@PL0$Q P*UEU IU[U(0S 0,$D0S 0,$@0S 0,$80S 0,$0,qU0$00gUqU 0UG-p,l A?@0CR0Mx8|P0A?00`0`0, \0 00@ R 40 0 0t%Q!\!  00 RY*PUW  0 ^@ 0@ST@ 0R 0R`  0R' 0R" 0R 0R 0R 0R 0R  0R ` R 0l#PD 0@H08XT0 H4."D H @ H0D 0@@U*0*S -PPL@$`Q00V0SQ0Sn 0Sh  :TRpp Wb0S *R(0P(@ ES_ IS [S gS. Q TRZ :Q Rt0ST 9QN )21C00@S90PPpp,P~0(0,0Sq00 0S z8 0 80 #4 0 8q000S 8 P T  0b T XP ZB0SkS? 8080 #4 080 #8 0; 0  0  "4< 0 "88 0 04 0BL0S0c00s3Y( 00 S&0B2l 0ĀRT'  c0#2c aq00aQl0S 8!JG H800SS@SP ?R 6 0S   0p W p  0 S,0S ^* n88 0 \p,0S ^:W0[0 p0$0S   0$ p0 0W p  0 S,0S ^a:u 0 \p,0S ^{:W0g000Sd 1 R : 0   1S 0 S,0S \#> 0 \ ,0S ^* n880 R I00 0]V n88 n8}88!jg 0SD|[00ig00lI00, n8\8S n8T8{ K8 000C 0 }0 0^a , 0R  S $0QPS 000 0 0  0#4 0 0#8 0 0   R  0S[   0 0S  0  0#4 0,0S6 E0 0  0   0   0  R 0 0S!0 00 q00L0D 00pCL   BD8 8RʟR08 8B -LP@P$`V q@0 T00?Uʄp吐"!B 0h 0 P  0 T h 0 @ |P pꔳ8 -`tL\EPPUl8 H 0XT 1#D04 H00 @ H0D 0`p0Xd0x` 0\*,0lpA?C0ChQ 0BSV``0Sxlp\`0 SdTTT4aLD4A  !t@(4, 0! 0A9!0P933;ӗӅ@! 0@D00tx0l#3LPlptxpTlp:8 H 0XT 1#D04 H00 @ H0D 0lpxLQx0NUp0`0hlp= tBPPX`tPUZB UPh0S 28l  @RP 0C!@ 909hP\l P80 `Z00f l0\00 RtZ\ R80 b0R l0\00 Rh0S( ||18  0@R0`1  @9H!0900CQ lptp@ lpt0Slpt0 @hl0t \l P80 `0 l0\0R0 R S xp00c Sx0`0 lpQ`Z4848  -LPptDQQl8 H 0XT 1#D04 H00 @ H0D 0pWl` ,0l`A?C0CgQ 0BSl```\spDCD3a83L  !3, 0! 0A9!P0922;ӗӅ! 0002 t`0 BQl\t\PZ0L`0l08 `l` 0HX T2#D04 H00@  H0&D0 ` p BR` l``l`^j \ R80 b09 l0\00 RYxx1 8 0@0`1  @9H!090tl` 0CA`Rtl`l`8 `0`0l` H0XT 1#0H0tQX Q!\l P80 `X00l0\00 R XR5Q3l``-X4848  p- 0!PCUQL@`tP7l0\0 Stl0 P0`Qt08000 al0l0\0C0 R l \,0 aA?C0CR:Q800l0\0,0 RpPt0p03VQS \l P80 `V00ll0\0 0 RVpVp 01P? "# $P 00S P0S p-PPLp$`V (0S ,0S 0@0 @0@040  0R b R0q0*0R0,  $@8(@+L0D, 00 < @CL   BD`21C 0 0|` H@l@\@t@x h@p ꔳ8 -L M P\p` (K0@R1S  P(0 S0082(0,0S,2,0qV`f, V , `F, 0HSUV00V0S Y00é?Z00ê?40 0[-(V `@P@ 0Πh10 €0 $@B, 0A 4 TP 0`,40Xp00 L00(8, 0(@L 0(0#`D 0 (80!S  @0S D0S P 0`\ 00$P儐删(Ko404 00 0N_3131 8 -LM@ 0 0=Kp90` 8 o 0+ 0Q09  d0xQxA H0LQ40 , ,0 0 | \0p@-P0P ;L0`&N,;<0 @P` B[$0K8;`p@Nc,Nc@NcG-X1p0\;^M0100110\[`1@ 0T'+ 0 P\[3P`1!0 \[\1!@0T:`P@0 R P0`T 0\+Ѝ0<0 R0 P\[PXA-\p10  W@? `P! 0 00P`  ^`  P0EW#10\^ \^ V P! 000< 000 \( +-Ӳ0Ѳ000²0Ѳ0| G- M0@SR 0 0`1V0ಐ Z > VEP 008#88#800 "$ 0 c\ 0C0PU0:0. \e0nPLuʰ 0PU00*Y   Z  0000C^ Zh \$ 10. ⨄pP0gUڔ058#88#800 "$ 0 c\ 0C00`F,4 pP0gUu $058#88#800 "$ 0 c\ 0C00sPUNڐF058#88#80 0 0"$ 0a PA~ VA$3pP0gU+= 0%r0P UF058#88#80 0 0"$ 0a P AM ЍTF0 5 0C4Ÿ82 % 2pP0gU/2 %qP UB F058#88#80 0 0"$ 0a P A T0 5 0A4D!058#88#800 "$ 0 c\ 0C0p0P Uʸ F0 5 0+-058#88#800 "$ 0 c\ 0C04p0P USF0 5 0 0@-0@P 0CU0 0 ! 9090 0@S0p p 0<010)EQ )<0803ӗӅ1(0  4848 G-4@ MP '!0t`P0fUڜ058#88#800 "$ 0 c\ 0C00,4 Q*04 0CⲐ Yp 3+ 0̣` P0fUڸ058#88#800 "$ 0 c\ 0C0 0\3QU" 8#88#800 0"$ (0a"(R#A IX223pӗqӅ!0` P0fU}t058#88#800 "$ 0 c\ 0C0 0$2QUq 2  e^`a`0>8#88#800 0"$ (0a"(R#At1  QN:0TkpP0gUF<058#88#800 "$ 0 c\ 0C00 0 Ѝ0 5 0S00 5 00x0 5 0X 0 >0< 0 >0Z 0 5 048@8848(88 -LDMh 0,& p`W6@d >d @0 SU 0 5 d  \ˁ\@ 0S0%d0h 00?@T  @TQ=0! $ş`K 10\ B ` ğ` 0Q0CC!10 \K \  000@  0S 8#8  2 P 0 0 `{P4p R@`   B10 \ h pP T  X 0\0 3 \㳐3 ! \ಐ0PU1> 0 L` A010 W`` 0 P0SH0\0Yil ,0Tl X0@װ 0#!T R 00" PU`Qw G@2 R 0> 0 0 Q0CRA l00 B 000`0 0C BS`0 W> 00L0 K L R 1> 00P!Q@@PE 0Sc0 N!! p^L Y BL p( Id !d 10T\ @ 41 B8QX 00b0 0S0d0Y H K 008#\d0S P@ 0^ `(K 0S08#x 0 ` 0R(K0 rC dPU@(KP=TX< 0@-P@0S S t0 0"$0C0 0< 0 #40  0 -bLP@ Uzژ058#88#800 0"$ 0a\à A882(RpgPPŸ+0Რ08#88#800 "$ 0 cZ"0C0 0!a0P 00eS' U:x0 %`Q XLL0>8#88#800 "$ 0 cZ"0C0 0a0  ;㳠 0 0 0 % 058#88#800 0"$ @P0a\à AX 0 >048@-0@0Sڀ  0#4 0 L L000S00 0 0000 -@L@ ^pP`A 0>8#88#800 0"$ 8 a#8S2 A00  8#, #808#< U0 0 \  0 >0 -LM`pPP00 @2RU+p&(+kԅ@010> 0 R@DT0ş  5 0 ^ !0S  W R0QS38#88#800 0"$  8 a#8S2 A0,S@ T J048#88#80 0 0"$ 0a P AZ㠂P 30 10> 0 ("(("(  0#40 P0b\à B U  Bp P0 10> 0P U ,0P&M C@   00i00S(K00X048#88#80 0 0"$ 0a P A00058#88#80 0 0"$ 0a P A tJ0 4 0gT0H . @4A0 5 0 Q,84880 ## p-L@MXPKX T0 H `l @0D ( 0 , @P KpP@ DT@D@00=@p9 -LMO- Y I* Xb$\(  O-`Q* @@ P@ @Pp$DL%T\ @pP$HH @ PpD%\TP ` RPbWin4_cksum: out of mbufs p pgQMW@PФP``$($,Q@Qx       x         @Q@ Q x        Q0@cA@0  0  0  Q@A 0Q@Х@PP484<  Q-L |i9 p-LM0PK  % @`P  0SxZ1 0- L@P 0h`9Z1 -0L+p3000 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 2 R 2 R 2 R  2P00 R@A0P0A Rbs_notimpl_%s: args at %p-(O @mmap@r_1@r_2@r_4@r_8@w_1@w_2@w_4@w_8@rm_1@rm_2@rm_4@rm_8@wm_1@wm_2@wm_4@wm_8@rr_1@rr_2@rr_4@rr_8@wr_1@wr_2@wr_4@wr_8@sm_1@sm_2@sm_4@sm_8@sr_1@sr_2@sr_4@sr_8@|c_1@yc_2@vc_4@sc_8 -pD`@PL L8P$1( <0D $00HD!0C00wwww 0-0 lA  $0|  LPU0h0  !$ $ !<@!0@1Uiiii2-@xAPr?0RW` xb1Tb1`b1lb1` B`p Bp` B`RE0C`R9`c1b1b1b1b1b1b1c1` B`p Bp` B`p Bp` B`p Bp` B` B`p @R B`p R BRR `c1c1c1c1` B`p Bp` B`p RpPP2-BxAP00O0RW` pd1Ld1Xd1dd1` B`p Bp` B`RE0C`R9`e1d1d1d1d1d1d1d1` B`p Bp` B`p Bp` B`p Bp` B` B`p`p@R B`p`pR BRR `e1e1e1e1` B`p Bp` B`p RpP2-DxAP?O0RL` \f18f1Df1Pf1` B`p Bp` B`R:08`R/`f1f1f1f1f1f1f1f1` B`p Bp` B`p Bp` B`p Bp` B` B@R BR BRR `lg1g1g1xg1` B`p Bp` B`p RpP%x!$0000%x!$00000&x!$0000i0-2P? @P4@54?3P0p-2`? h@xAPPP`5P65?3`pp-2`? @xA@0D!x1*4 x x!40L0C0$Klig|iixi@j<j8,ocHc9,Oc0OciUi9 -t L@Q00 AN hV8hb0  "![2N TOcL9$9@-@Q >0^ 00\R 00$0(000 S-LP`% S S 1!p $pU4W @ PH `@H `@P h`bbp@ PH `Z* ` Pj $@L dixiiMp@-`R0 0@PU ^ 0P@PU T0p@ЍT -LPᠠZp` @ (0@Z -LP Zp` @ ,@Z -LPᠠZp` @ 0@ XZ -LP Zp` @1@ \Z p-LM ` 0  @K P`P@ CP% :4 ^  @ ^ 4: S@21C* "!B 0 :0^ 0 Kp -LM@`Tp*  R $ PR @0PS L   0 P  @R(K @ x -LM< \ 0P 00c80 0匢Xpw `tŸ Zy0 K40K [ 0 0S 40 Ro >*"*0L,  080< P @,T> 0\:00Q^ (KP 00b, :#: :cS1!\, ,8  000`Q!0S P 0pW@21C0,0,0X ` 21C0 0@T\ 8,0 0 S0@ p 0 , KU p 8("(8Q, "*46*, (00S 0p <j  -L$M$( 8 R`4 080 0 VR"PpPP%4V@1,K080K  `V 00pR00SP 00 4 $00( 0(K -LM`$(p Q,0W80,  PP p 3U00S 0S  @,K(K QR , 0 00$( p0$K -LM\@P$(`3*KpȌ$  K$K pP$0 0 $P(0`p.  0 Л88 -Lt9 -L>0^0P0@ iP* 0Y`p@00T*U U  0P J0SjZE Z p( 888Л8<j9 -LM0(KpR(0 $ &`00^*P0.Ơ\x@: 0c#\2 050:00$00$  $ 0S`V A KHi $ (    Yq -Lp@@`  ,PqP `00  000$0(0  P0@-@P# T!00Q:P  RR*> 00 0 bR !. .0  00 >00 >a 0Q00> 000 -LM4 8 @<0  8 080S 0 Q 8Q 1(1 1(13p(KE 80< R,` T: `@aQ40pPW ^ U:>0 >0 S00P`8< 0pdWp! <00S<0 @8<0\,` pV: `gpW PT:@e PU4 00Y00   ^e Q:>0 >0 S00`8<pf Wp!0dWp!U <00S<0 w `@8<0P,`k `gpWPU@ePU4 00Y,0  Y Q:>0 >0 S00`8<pf Wp!0dWp! <00S<0 2 `@ tt? 000$*!00|P@pp0 R8P\ L0R  K< hp80 ji4jLl1<jj p-LMP !. 0@;>00 `+.  0;>0 0p0 Rt 00PxP\ P0R  K@R hp 00Pxi4j|OcLl1<j0j@-X0@P R 0S \ Rj@-X0@P R 0S \ Rjd1E- \X1P1P!L1 @@1@*8!L`01`(!{ 1p*A!1A!P1PA 00 0 0 0 0 0 `0 @@0 p0 P0 P0?00?0 j jjjjjjXjjjj(jjjjjj1jH1jjj j0jjjj8jjjjjj4j 0 R 0a B0j -LMP@ D 0 S S 8 < 4 p3p#0 <0 d34 080 >0>0S00 q <>D 0+ 00)@ 03@pŸ0SxD &D JZS D0 @46ZS#PP @): RQP 8#8ZS#=)6?>14@D0 `p `V@# WU>000 p"Q0S P\ 1R , K, h`pV@D0J8ZD0 0(K)68; D #;1 4Q@p(0SD *JD P0\ 0R , K, hpnP\ 0R , K, hp\0\ 0 <0 P04 080 2 <? 4<0:jjji4jLl1<jj jj$999 p-``LM^P @ 0000@^Kpj p-`SL@P .:8#*l! #8\ 0"!B Q 00S:#50 600p<jX9 p-!:LM@ P0S OPY :#d1L R@ L000@ap81 RHxx ! 1 0S : 00 0`p0 RHxP\ 0R  K hpP\ T0R  KD hpwji4jj Ll1<j9 -L 0 Hgj00 R$0 Q! 00վjOcOc -0LM0S | 0@T00 KKhL00.*@ @@@^0@jOcHcOc 0-0@0 0LP$0   R00 Rt `P ` `000@0  0@0$0)$j<jԞg̞g9 -L(M\HT(EL2L ( BϠ01l80 " 0Wd8Q} 2@ < Pr 1  4K@ B0P @4 0 @3Pd4`VYH* @8`JVX=4 ,$*(":X1 0"P- 2C 0S0$ *"%0L000Ppp0S P\ 0R , K, hp<   @< >80< S @@0(@ 0P@T(K4Pgg;Hcdj<ji<jj4jLl199 -x3xsLMP00L 0, P U4 0So`@P E201^ 0"!B  APP0 " !B 000 Q P pP2 UYZ @: JT * P (JT:bRDB$r,0! 0! !0!0@1CD ?FD@b$J@$B!h!021Cc!@!08!81@ @@ rQ 0P 0P 0@0 P@D(KX 21C! cJ b|`Pg<j\99ijjj,jĞgȞg$jxijgg̞gԞg$)c9xglOc9Hg9g9gg 989 0-LM@40 [00Pp0 R |@8U!8P\ D0R  K4n hp,ji4jȞgLl1<j -LM0@0b8#Ƞ\.P+ `0p$0`!2 0SP5 H1 R 0R 0Qp(1 RZ'28#80100CS0 0JP\ 0R ( K(+hppph0 R P\ P0R ( K( hp<j ji4jggLl1 -!!:LM1p@!T, $ ,0P`j0S 0j0(K 0P00  ]  0|00000"0,0!B0L P @0S;0g<jg - 0Dap@L0l!R ?= ?0R% cEP 00#! @R00  00#!H0S  S 0 0iF0Sii j -0L0Όn`VPp@ZJ%:iP %6;#;K jV! /0?0000?OcOc9 -LM@\pP4 \`0`$: R.=P, $6;  #;1 P@p0 RP\ d0R  KT  hp00`$ji4jLl1<jj<9h9 p-LMa,:8#*! #P3 2C 0S0*  ! 00+00@Pp0 R8xP\ L0R  K, hpi<ji4jLl1 -LMP`0 M*&!*1! &::06S1P!B 2C 0S09 :X# P PpT0j0pVP*@  H08T0j0pVP:8#(0@0b0p 0S 00Sp (K0iP P\ @0R , K &  ,hp<ji4jLl1 -LM P`X%:*P&!*D1! &::6 Sp1 p!P!, 2C 0S0# :W#@@PL0HS H800jV@:p |P0SY0h@P\ @0R , K$ ,hpi<j4jLl1 -!*(":LM10P"! 2C 0S0 0* \" !Q:0Q *0b 20 0Hi -P!LM`@V%E   0j0P= :#5p\7 Q7>0' %#&R*:0R'*0a 20 <PP 0T0U 0 @00@0  (F#&R:0R: 0a 20 <PP 0T0U@00@0  D1p81 R $1P1\ 1R , K, 0h0p 0j0$  0S@ 0p0` Rl0(`0P\ @0R , K0, hpHii4jLl1<j 0-0LS@P 0SP1000T' l1S 0 T 01S 0S 0S  R00l00 0X   0 0 00P$00i<ji̞g - 0LS@ 0T0000i -LM<PP @ p4Q 0 pR Q 0\` @R^\aT P @D4\ @T \ 0``` *(":1 ` 0 p^" 2C 0S0 :#5 PL  0S c0S h3Q d3 R 0RL3p0 *x00x!x x1 $ 0R10> o薷1S 0S 0S  R0000 0   0 0 0h@00#! 0dP0  00#!00$00<jiig jjxg̞gi -LMP8  80e S030#U00 4 %*4 %!*! %::86S1\!s 0"!B Pl 00Sh Xg:#u@T\ Z 0Sv$&Ro:0R0a0#152100`0f*002p2B RdV4  0 )$R44SSD0SH H R0R01!0AT@0`0ó@0@0` 1ZU   B@0`00@00Q=4  4 0 ZXpP8 Rx00S 40SD 40 0S 14  (K` PP\ 0R , Ke, hp0 S  0S l8  40S 80(l0S 0$ Hii4j8<jLl1 -LM`l PP P "&R :0R*0a#200<0 < p@@@@V  Y  (K**(":10"P 2C 0S0 Y : #50P4 80  4>0S< $#&R:0R0a0#1521000*< R$ @0< 7\ 0  \~ @ @p$R4 SD0SH  0R01X'0QU@0`0ó@0`@0`] P` < 0@V 6 Z0 0 4 R000$ $004Sc V 6 R 0R 008 00S o<QN $RD4S<SD0S6H R0R01&0AT/ 5V2  <<<@0`00@09VI  @ @@0`00@0W@d <@0^ @[<0H < 4< @0`H Rgg4S[[4q 0S  l 0Si  4La0S 48  @ @p吽008 d0TDp0S44 Zi 0f *:$  0SpZ p0CSS P\ 3R , K, hp?0SA t3(<WL0P00 0P V <3 Z(30 0 \ P @ @p$R44SSD0SH H R0R01"0AT@0`0ó@0@0` `"Vv  @ @@0`00@0 P`40 0Sp  0S r 1Ll<<@0`0@0:@ l@Pp P ] !V+   &8P\ h1R 8, K48, hp8 <0< @e 0PSt `r40o Wm 0Pg 0S^ 0XX  @ @ h0HK 0S D0X ,0H0|jHi<jj8i ji94jLl1Hg9 0-LM \P0 04PT@_80q,0 0v8xgi0j P-LPF 1l1S 0Aq@p`T P 0S ` U  Q`PV Q 0 S- 0S0 S 0S 10#U@T% 0LT# 0D0 0 0S t0X 0S T0T0000H0Pi<ji -LM0!00Pp0eS P\5\, K , hp@T0D6P0D4@8@5p:#:S/,5,%0PQ,Kt"P} '*(":10"P 2C 0S0 ,00*"%0㔤0@p0pTS*nhP :*#:"*S6*H4H$0@Q  0&P? 4000 %*(":10"P 2C 0S0 000*"%0㔣0@p0pS*.Xd#0@Pp9X< PX43<#0Q,K!P p2 0n&P 4, <!*(":10,\"s 2C 0S0j <:#5  X040 p0S]*<p0S <P\ 2R <, K<,*hp  8 21C <0f0000 ;+ 0 0 &P 40,0 0K!PKpP\ 1R 0 K0 hp 4P0\ 0R 40 Kq40 p0hdp*P\ H0R , K(Y, hp%ji<jԞg4jLl1g,Wijgjg0 !Р!0 ! ! 0-0Lp4 40"!B P* P(ڨP0 R00 0l1R0C00p1@C\PU T 6 @^@D H0L@0輧cOcOc,ocOcd jlj -LM3cDt#\0s dC0S XC0S ( ("$0巶,30p42 SP< n 0Sk @Pᤶt OKg2~Ϡ "K(2 $ ȟd<0 0<PPZ0S? ``p p, 8R ," 60Q*42@02 " 4 1 <02 P4 UJ,," 6`0 pS1娑XAFCA|^;(K82L!082 08",S00S, 0ESH2<2022222222$2222222220S @0SN "8"8 #$|tlu3\jicOcOc9$j,9ljd j<j8|999@B9h9T9H9x9949 0-LM0PS K@P K0S@00p @  0@@i p-00L ` HP`N@^P@@eN@ 0,0 L 0L0H pZ<j0Oc9 -LM00 ( H >~p@g00^0L PU@`H@ $@K,0  $ 40OZUzj K$0Oc<j9 g 0-LM   $ l(0 D!P + 0.D 0D!.@ D1:40  4PD1L@E@0D!L $Q( 0800` E`0$0004 K0xMi1A- QQQQQQQQ RA- 0@P`pQQQQ R@-M Ѝ@-MЍ! !P: ZŒŒ#! !P: `B!,aB 0>ZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0 p@-@P`R p0-@P0R0-@P \, 0L 0l4 @P0R0-@P \4, 0L 0lRQ@P0QP: p-QLM@P` S 0V pxpS`@rP`&0-@P0R0-@P \, 0L 0l4 @P0R0-@P \4, 0L 0l51@P0 p-QL M@P`S K 0V Kp  Kp K@rPp`(Ƞ 8!"(,Ƞp@- @PpS`b `c0#3 Q. a l^#(8.(030# 80 (3#0"P@p.8BA Q ! C2Q -L@P-S'pU#`S PW0#03d g0U f  e00#2 S06"l P@X t@P` r0(@pP@-` a@ \B@-@0@-@QP a0 120^0 0100 -L\M@P`p d5`^0p(KS P  0W p#83K8#8ẃ[0 X$,8`K("X&3KK0<AZ0@L0"[[[2[x h[[$[3[xhOcp@-c@bP`T !L2pQ:P: -LMz -L MKrK K0-@"P#040 $ R ((0"4Smc40 $ R ((0"4Smc 0mc( (P08#808#80$0$$ $P08#8 d@d 0Q 00 -0L 0+R 0  hl0lP \0 RP>h PD0D @匰8剰0 hiAigoc9ocD$2 ;P 899 - LM0S @00左P@@ 尦Px@pp0 8`哤Ph<嚦P, @ococ9@9 @0>02 a2"&  0tflch+ x!l1$` $2 "DJEx!h1 4!1 1!1 )&! 0 x,15#l1 000\`0  (K0ʭ,ȭ(ƭ@@ocX9ihiAi,j` p@gTpcp52rcp9d j9dj` jDj ,oc<j99Hj9tj0jXjhjp jliLjt9999@j9j jj9;?lj (9i$OcUUUUH9x9 g|i9991\Oc\1XOcĚ1hOc999<j@9(9D9j0P - 0LS@#  @j40  "! V 嘬1zn哬|呬d劬P1lT公 Es u+B?  S POc@Oc9[9@9d9t9 -LM@T^`PƆ ?p 0p 04@0@e@oci -0L -0L000   p-0@`L P`@pQ20@- @$T P@  @ 00 0 00bS- 0 $400`S - L  @$B (0  -0L00p p-LM@P㥠0U` U U x1 Ox0 03R0S48 L#ȠR92929292492 MP pP) @P <1Q Q 0RS 0R S  0 U0 N 0 F 0 @ x@0@0 5P0 c0\ + 0L % 08 ؞g@889 999<989H9`99l9 -LM80,$ Q0 @99 p-00P@LqT0`  0 ,p0D0S 3S@p 0520940386<5 0 \1PX!X 70S9088;<: 01@ᑡP&>Q @ᇡP ph 0ph۪٪20 @ Ϫ̪xȪpŪhª20,X彪 L幪20,9xF:9999p9999`9999<9L9$9 -0L0S S S@ 0TLH @DFsP 41Cc/`g9 0-00L0p0C0SPࠃ @^   0.020 ^=2=2 >2d>2>2>2>22 0$ R0@$0 @@@@X 0SC <0= P$RFD1R;B0CS0h<0= $R2 1R:BSV@< =04R SV@@ *<0= $R@@< =04)0"0Q] 0@PP7 04SP1Z00j 00S= ;<00S9  R00 0S 0 480 00S$ 08 <04@P(K  0P#PP"#P0 SP R00 0S 0 480 00S 0 480@Pt8 N -LM0*S$ SD AS S08 <04@  (0, $  S (S S |婤08 <04@ 0$ $K0 480 @ P``0S<0S P` 0@,P (` ,H`P,0Kp0@PD0` p0@ L#D <P`0@(!(D#Lp4  0  8 <0409 -LPp`@P P 000$ 0"U0P  0Pg -0LS@`LPP `G ^00 R00 @ ` 00  0#40   0 0`P=00;000` P`70:0 0p0 pN00( R00 R 0(P0 00 0 000000C2Cp P 0 0  `P ` -0LSPpF 0SpB `P p=  囗00 P600;000p PpP0:0 00 @ @[@B Z (0S ]2d]2\2\2]2]2<]20[0 R 06P k 㣝P p 0 00[0$ 00b $0[ |z Y (0E0[0 Y (0=0[00[0 pPpP@: 0-Ld\P P1\ H1\00 0`Q! 0$ 9P 0ă \ #\ @ 0S@ S Q PT $xh謚TP P t8oc -LM0R pO , 4 P`,  VP- 0`S0SF8 _P =4 VP40 0  M84000P 0R ,P ,(K Q-L{`@: -LM<0p @R= 9`R PßP Z`KD PK9@KL \  0P@Q2 p L"20 Bx@T ^ 0S[ 0CS2Ll20D!0<מ4囟0噟0SP˞x0P @Ržx 從x 庞x 嶞x 岞x 꼠F긠D괠B갠@ꬠ>ꨠ<ꤠ:ꠠ8꜠6꘠4ꔠ2ꐠ0ꌠ.[xF:xA:A:A:A:A:A:B:A:B:j:t8A:p@:@:9A:A:A:A:I:,9@:@:@:A:A:A:A:(A:@:@:@:0"0Q`C 202202  202,04@KS!2(022003 S2ձ02ű0 4P zpPY 80S 2 81 -* 1z`2 `  $ 8}X1 -[`Rp0Sl$ >8P 1!,2:2@2<2  P 0S:sP 000   뼠 :'xIxP6 40 RdP_< : P` W,=2oc|8t8`_2hm2862,62i90@-@QP0 2T?\0S 0R00@ -QLp`@0P02^-?\0S' 0R$#@P! 2`T,3x`P2 00 0SxP e7`$ Z7 -PQL`0p$2U!2S 0S @ P 0@ P00P00S 0S  -0`L2SpPP@ P00"P00S@PR@-qr@ \^  @@Z@ -L M P`0p7P  P 2 L 0S@ 0S P@(K>0 !0QQP 0 0P)08 <041S,0  p @,0@S 0pS Z H = ܖ זt8oc' p-0PL2`S@2@Spq00r S\ o80Q 0Q   0CQ 0-LP@0h -L@P T, h#v0  !  !^v -00 LQP`p p@ 000P @pR -3LSP`p p@ 3P@pS0@-qr@P\^  0@00@0@0 p-0LM` Q08`000 2S020 23 0S0 0203S0 @00h#?040TsP Hxh400$P @OcocB:`9w2TB:$B:4B: -RL(M000 `  L0 \pP   PP D# 000 p 0@T08 <0$@ Y0H D0  08 <040ᕕ>0"0H@Qt0@uL  R  pPm  PPe 42 0a0 p 0 @ @ @P P\s0@,0  Y0 040  8 0<0 P 0 8 <040P G 0@,H, P`0@D00P `  p4 0@ P#D p<P80` !(< 0@p#L4P` P`  @0s PH K `P`(KY0P`0P`P`P` Nt8 0-0@0@PK@2L  0 0 S :;;S 0S (0@0@0@0cS -L@` PP p# @P p 0 0p00 R0 P0  !40 00pW00  ㎔0u -L`Pp@P P 0000P0 P0VB000%$00@0P0p P 0-L@P P }>0P0 0-PL@P P  00}.A0 P0Pk0 -LpP`@P P P 00 00G0P0p`0000wPI N -Lpm`P @  0L 0'̠''D;0(T @0pPT@&@  p-L`PJ@P P  0, 0f0C P0`9P p@ 0"200 0p0C0Sr0S 0@ <0= $$R 0A0 0: -pL@` PP p @P p  0 0_0C p P0  0#$ 0 pW 4勓 0$ R pw0u -L@` 㲓PP p# @P p" 0 000 R0 P0  0#$ 0 pW 0 $ BQ p@E0u -pL@` wPP p @P p  0| 0_0C p P0  03 0 "4 0xpJW +0u -@Lp BP @2 ]PP @) p$00 0` S$2l2؇2822\2\2 222P2̊2[ 0  00 ;04@T0#30Β@@\0 @00 30 0  BⲌ0 @:0@T00 [0 0030 0 + @T ㎌[0 0030 0 + @T v @\0 @00 30 0  Bg0 @:0@T0000[00 0""Ġ " 030 0 + @vTr03 0 "#  0 #200-b[0 0030 0 + @STO000K[00 \0#? 0n@@= [0 00 ;0_@1T-0#30 !  000  00\00    0 :0<@ 0u -L@PT `P e -@P \ T0 0x10 R0 `0  !40 00XDP@hp㞋0T00 T"" 0T00 T"" 0T00 T""  0T200 T  0T#20 TT T(0T, $ 0T T T8 T<040 TTT(0T, $ 0T@3T 0PTk0u0S22 2$2(2 -Lp P`@P P l 00 P `3 C0W0000&4 0`P` p-ML@`0 PPP0\3 : c 0PKp -L M`S@P VP K 6p PP% T%J 0S0a0a010 @ B Q0B RJ 0 @PȐP0D@T ;J -LMPp@`$@ P   $0K `@@@@P $Q 00  00  㓐 K -L MP $ 2pL@1㾐`P @+ (K $0K@@@ p@P$ R@ 00$000$ 0S (0S T0 @Q K0 @ N -L,M@`,@ pvPP @I ,KN 0@@@@ p@P7,\: 4 0 < 8  0K@@@ p~@P, R" 00 0<0 ,  08,0 040  ,0 0Q t 0 @(K@(0 @؏ N -L M@`,@ pPP @( 0K ,0K@@@ p&@P,0S@ ,0 ,   ,0 0 R T0 F@㜏(K0 U@ N -`LepPv d0( 008,d 040" P T O 00 @I00 '7<r 㕏@ $P0 0bQ 00  0  1R0:5'88# '40$ 80 ie  00DE:LZ9WEVD2TE: 0-DL!88#P!Xs@P 0 8( 40bS80 000h n0oc -LM  0R042D2 -LM) 0E042D2 p-0( LP,@l` Rp22222|2222$2 0S0C 00 8+0@00 <0 $)a0w@ph(p0 0 00Cs 0 ph800 $)a0mw$0K<0phh0@0$ 8< P@$08<0 -L$M 4 ,000 0@P^4@2] 0, PS 0 t@(0D $@0 0DD08 020@iP@@p0D4D20  Py6 0W*(( (h(%D P`@ W :;0@!0 H008 ,1 p0,l00v @00 <02 (K (Ko;0{ 2 0@Q  R0@L0 H@ L@[L0@S<0 8@ T W<@[ 000!!0@0,` P 0 C(Ko0u(2 p-DL!88#P!r`P 0@ 0@0008 ;00< @V phl0"0@0 qp  Cphlp@oc 8 8-#TL%`Kr@P 0@ l0p 09v0谝2 p-`@`0 S00Ɓ0,( L0LPV 2  0\ 0Q000CO@嶑4 {K (d00X0phdv,2t8`92F2 -LMK 0 K8 -P L d M@8 &"qpP 0@ k@$K 9T ,9T} K0CT 0CT 9T 0S@= ak9T '9T Xp9T :c h0 @\PqP 0P1S1S0ha0ht8 -L0M0P<0 ,0 00 40 80 @PE0EqP Pp`' p P  80K@@K @PP@0S 0S202 /  0 + Pp` @ 0 0S<0S< 0 Sl e Si  Sf (KP000$P Pp`<00S S| D3@#0S 0 ,p00 ,W@ ~00 ,T 0 !!g p-P0`PL00@8 ,000T08 \p| j - 0L 0<,| j - 0L 0<,| j -Lq@ǃq Ã$F:0F: 0-t0L M@P00< ,Q 8嫃 @ P P  0 K0 PK0| j00~N01@pdPP > 0d 0T05*JWZ/ QZ,K 00K塴P`0`0L00p0 R P\t0 \X , hJpWZ 6(K Hc<ji4jLl1(0 R 0Rሟg@0 jG-0M  "!@Qr 40R PQ R f R0Π` 00P 0 R 0>! 00 Q0 ^@ 0 8 0 0 @0P@ `P$ 0 0`(0p,9) 0 0 (0@P `$ R 40 QR PL0L 0 0!!Ѝ ꌟgg j j j0 0 j j j 0-H LP0S 0@  "!@0  "!0 j P-L 00 $ $往  帀G:hgG: -P@LP`p+0  "!0 8R  @P 0` p400P Y 0@@ 0 1m 0!! }@OcgG:H:  -0Ld0 SXr0@  "!@b@Rj 0!!0@  "!`0   ! 090!0Sf 0!!0@  "!C0  p! 000X!0SL 0!!0@  "!&0    000 0S2 0!!0@  "!  1  0  t 080\ 0S 0 !!pqc j j jP 00(( 0000!J j j j -0L@  "!@0!!$ $0 1h, j j j 0-< L0P@!!@0  "!0 j -<@L4 u( 8 0  j 0-@L@tpp0@ ` @A10 P0@ 0  "!舟g,H: jgg -0L0@  "! RL 1000 0  0!!茟g -@L`Z0DS0 ! $40 0   !DH: j - 1L 1`?ops+J쐟0Z1 0!!QU PP 0@  PU0!! ' ?opsZ 008 401oL j jgg j j00 0 S & -@LP  -@LP 0080 R  0 Rp0 0,g@00g 0-L04@H 0\T0P T0@P  0 0-L04@H 0\X0P X0@P  0 P-L@ 04 0\00S  20g`H:(0_P21H 0#R ,g(0_P21$ 0#I ,g(0_P21 0#F ,g P- L 004,0P ~0gH: -$1pL ` 0_WRBA< 0 V 22222h2(2O ~` _WBA< u0  q o/0_W `O f0` 0` ,gH: -0 cX0_Pp21P@ CL0  _T21C h7,g -40_P@2Lk 02,g -0 `@TLY000_T21 CPN0 rP_T2C P,g -(1L`p@ 0R 8 R0 R-_T21I$ _T21 C0  _T2$R1Q CTP@ @040 $`_T21FR  0R,g -_QLM8 RY0 021H8Y``VM _YDY0 02QR 88D"0HRpE ?Y0 0,0 ,QW3 18 T0`040  40Q 0Up' 0 P` 0@  PU0,0WS ڊY0 02QH`(K8   |_Y , H: -LP p@@}``y@@ P-L 0 $ $_|  Y|G: gG: -T1LM`P@ 00#!Q Ppp@PDPP@P0@ 04,gP P0p40 \qc; p-X0`L004 ,@ P Ppqc -LM@0P,ay0P0040 00pP80 040\0 04?0\0 040\0 0@4A0\ 0@804\ 0@<04\ 004@ \z`9qcI: -Q@4P`L8 Q 0 R 0  -5`0 R pp;p0 T0  5 0T관 0-LhM4@P8 0 0 00k0@ @8rch p-LM0PQ1 6Q* 6CQ @Kp0S 0 Q@ `0K0 0P @0Ti @0S0S @ ;rc!1!01!ŕ!͕!ߕ!00 PhiAid0S$0$0h0d 0-LPl00@8Lc`@ 0h -5pS    0 RL`?*0t0 00bSP1P#U@U084 P00<PET,\U@U PT,0TPU5SP0T@P,\`,0,0t0hB  -0,@ PL0p@T`6 -L@]P 0h -P0@LT,, 0PPp1p!P0,T,@`, P0T,W   4 (0 pGPPT,B0\`i -d@LT $0Sd0d0h0TmlTe d@P70 5 -0L@0`PU~p000 P p000U ?s /@ Hmw0! @0rcrcI: -0LPp0@ 0 To8 P0aT ,0000S}@ 0`SM084 P00<T,\0@00P0T ,@ P?  P"0S 1 1PT ,@ P0T@P \`,0 v00oRlP 0TT0 RP P 1 P0T@P \`,0 PT \zI: -0L P0p@`; -L@P 0hQQ" -LM0@ 0pS40 j ,< 40Xe P0T< ,8 P0 T `@P,8 0 0r03 S8 0dR !@, PP0 T,@, P0T,U  4  (0 0@0PE0P0T@P \`, 0 0S ,0SR0  00CP0T ,(K@X(Kou000P0T@P \`,0 J: 0-0LS@P  100S H 0hU(u100S00h@(J: 0-P0T,@L,Pt0Q  S  Q R 0hS 000#R00S 0h7 -|PD00Ux`LpD0|倀x("@62 @T T 053  @TD00CD0t=D00CD0P0T@P \`,0 pP0 T,  P0T,500D0"  0C D0 -P0PLT ,P0@T ,P0`T ,00p x0| 0 x0| sP0T \P@0T \PT0 \ -P0TP`@L \p,0 PT 0\PPT 0\PT 0\PPT8 \P0TP` \@,0  %hc -pL P2T \P0TP@ \`,0 TB0p0l0P @T0\FT R6`P0S- @U0l p  C00! l p 0067 01P:!+4T\P@A/TX1\ PR`PT 0\P@T0 \P0T@P,\`,<,Pl0T0 \P@p0T.3 \P0TP@ \`,0 P0T@P \`,0 %h -L@P ; Q-L Q2 -@`LP\PTX R PT0X0 -LM@PT0`0F.0PP |KhsF>X0hsPpTX0 p  ,!0P\+  1P`+ 04 0004 804 0$#660 @0`A0<0Q 0 W. W, 0 <0 b# 0  0  00 4  00 0 0,`0,X V D0D 0SD0PDP @00@0J< 0 ? R< X b@  dD0'R0@Q@Oc j89J:$sc -LM\  p^\ PP ` ( `P   $04@80PP< 000 @`0`@Oc -0L@P`!!(  BR*3*3)3*3)3)3)3*3s ,40 \(0\S0000 0, 000!.\08 \P ,0 \ 0!!tttp 0-PH0LS@ S 04W04 HP0 -PLp @`,,1 \JgKdLaM^0@0 S S:@@DP9T h0 \ ,; \8 , x0 -H0LS@ 4< 00H 04h-$2 -LM@00p`".0PP  K0 ` px( PP40D H0``$0K00 D  $l h0DFTpc jqc -LSM@XDp@( 0 `( (0 408 0`P 0PIPL$ X/.LP @0\u>0h8 p-`L8?`0S  L@Pa>0:0\>0:0ph Fg -LM☀嘠嘐P4p,`KP,LP 0S0S @@@@0  G,`jhjdjL:`gi$OcPjXj\jucucuc0-44 dd_-<00! /  /?  / O Ѓ) O)O`)O`)O`)`)   !6  ! Q`A@@PU!@[3P , ,"iВ)iВ)iВ)iВ)iВ)В)H-@-" P ?@-`300lS 0S0@ 0@ 0$@ 0PP@PP ?@-` T 300  (, 0 -LD0, 0$ -?@0L0 ,D 0 0T - 0Lq 0 Q  0X!R 0S`0(0S 0S p-LM @0@P4@P; 0X1S9 0S6 0 3  0P0P0C P0L  L Q 1L 5SP0  L "$  L "( O P0L  bq xKp - L400( 0-XALTP$ P@T T0S 0 J XT0P  U  RP: A@T0 -LM pX!R7 `V4 R T0S Q\ \0X V`Q( \0Sq 0P`40 $ @ 40P0 `X`T` KiXX`T` Ki400$ K`004$  0T`X``a`3 -LM pX`QJ  RG T0S P\ \0\R PB WTX\p[ 0`AT   $K 0P0 4`$TX\p @40 @t0 `,40 0D @ @TX\pP040 0`3 -(0LS@6 `0, 0 `0"0 `0XQ `0 D0 c\:@0 0RQ400H ,400 d10CSd1  4000[aL: -`0L(Pa,M: -L M(0PS d10Sd1 `0z `XQ `0 D 0lP:@@ 0R|Q,p400 P d10CSd1] Y 0DH40@ 0pP `f(0X P? @ 0S 0A T0CS (0  0 0 0  0X1S< 0S9  L L "$  L "( O P0L  b`00`0K 4000 400,k 0, H00n, 0@@D0H`0 400z`L: -0Q pL@`E @1 S|PF UP, _V-U.0LAS Da0S U)0_Q 1P! _Q__U _0_ _@`___|_@P@1T SPE \ q_U\ Lj_ D e_@PG9XM:R\M:xF:`M:tM:,y9k:M:,9 9M: 0-8L@PM_000 4 0h1 0`1l!0`9 -XALT 0S $P9@T p-LMXA`TP@T 0S $0S ]:P$ $0 0_@TxM: -L M0`0 X14,0040U? RD1 R'XAT' 0X0 `$0(0T0@TXQU1 8p,KΠK 0$P K(p <$PP@Ut3 Kd P 0  `0@@@\1 XA\!Ts_ucRg3^3M: 0A0-LPSm3l3l3l3l3l3XAT 0S $P9@T0XAT 0S $P@9@T0 -0LTp3 - 0LpP3   0T@D 0 TP $40 T` $80 T $< T0  $0 "$ -L$M0pS !Sr S S (KS S S000Sh0 P @ Th0 h @>$10l 0S 0< #30 0R:l@TP ml0 X `lP @_1C`V @l0 Y  `0lP@J1C` V@0@,\ Rd@0Sl@T 0s @l@d fPl 0 0l00 l0l00l h0l$!l0h 0$1l@`0S]h@h@P`@@TK PD h0P0h!00 1P`U40S1hP@F?D@hP@H=D@0SPdPH 0?`S@@C \ 0P6 d\ H0 QH0X0l TH  l0X`d 0L , `P@@T 54 { sT@H\ Qd@` VLgL  0SUH 000000@H 0 00H0 0H0 L 0S2H 0=0@00@H000 H 0<0 02H3L`  0Sg Rg @R  00HS80]`02 @0 0!D <0 hG/000H 80S0,0 P`@HD@<D0PhG/000@Q@ @ % Q @ R @0S P`@HD@@@<0S<0D0% S <P <Q P`@HD@v< DH,80S, FDPD< P DQ D RoXPR@LtH080?@9H DD<@P/@)H0DDD@@@L t 0SqH 0<0<0H 0;0H0;0H 0T0V PPL0S0S0SH00000@H 000 H000H 0000H00/d P@lI 00l 00l0Pl00l Ph0l$!l0h0$1l l@4hG/00000HS 0STH 008 4 00 $0PR P8Qd Q& @Qs00 0 0 0H00 R'4 P]@WD@NPH`B@<HD@L@0P*`$@HD@L@@ D@@H0DCP@lP@+H@DH 080@DH0D<@D0@0n@D@yDZp8M: -LM `Y8QI 9L< YD YP1=@0(S@ U'Y0PS@Y> 0 YXX  Y0 SH3<303$33x3l3`3T3333 3< |YtYp  Y`V.TYPY 0S780SNTQj$Y0lorux {@~    dYX`V 0  \Y0S S UYpRY 0S hLY 0S@PD\ 0<#0C 4=Y 0PS@80S 3Y80SPp<@D@Ÿ^0" T0C@Y80pS PTQ YpY0  Y0 xY0 hY0 XX0 HX0  8X0@ (X0} X0 z X0 w X0 t X0 q XTXX`VoXU? R6(KX-X*X'X$|X!tXlXdX\XTXLXDX <X 4X,X1 0@PXXU (KoX<0S SXXM:DN:dN:_:`9RtN:N:,N:|O:O:O:P:dP:O:O:P:xF: PB T h 0Bd Sh333833333333333ԋ3ԋ33ȋ3Pf|3@"!10@Q^T d00\$ H R$"R; UQ0U PX2QL PJ ,0S<2 RUXX P X@ T@ }T0X1V/0\!,0  YP d @P d J00\ pP \ JX0X p \1P@01 U\! P1s@P LPDP LPU,p1=@0S@ WU0pS@U\ [@P \ `J0X0 X0 @0f@U10@p UW88uc8Q:_:`9XM: -LPp`@3 $@ T`Vp @3 $@T3 $PP0033 p-L,M38`K @004 P 2UPKp3 0K40 K0 ` 0PP84 3T38 #40 4T3  400 3 400TPQ:Q: -L,M@QP` 3@pK 400 P T@ K3 $0K40(K0p 0P@ T@@$ 0 <$@T3( @400 3 400Q:Q: 0-QLM@ Q Q 89P@YQ S80L >!9 y8 9@0Q9(," 0-3Ls@P ?PP 03 400 400= 4000 p-@L`Q PU P 1S JP 0$@T$ F? R 0S|0 R 0S0 RT p0 bJP0 Rp8`8 -LM` P#0@TS X@T 0S0 S SX@TpS03(K0 0 S0 =~400pPÕÅÅ ?00 P S3 400$- P υ0P xShS υ0x@P <S3 400 SWZC XZ Y* 0R WZ$@F? R 0St Q X P 1S IPO  0R 0R 0  P6(2("3$2# "32#"30#3Õ 0T3 $PPT 30CSC0!P0S S AP2 3 400y0 ZIP0 RT Q. KPu}0 R 0SR.Kxd0 3#0 3#0 3#3 $pP0 3#x0x 3#R:R:8R:tR:XR:R:R:8D ` < 4 (,"R:R: 5"1"x2"3" p-LM`5Ps`@ Q Q Q xh,,h@Ql0h5lxl@ll( 0Dhsxh,t 0-`5Ls@P& l"PP"PN#l5` 400l%S 400dq l5 400l% 4000 -`Lp0S 0`V! R R 0S@P0!SP@ 00!R uHP UX `Tzczc -LMp `l%0PU0XPU- 00CS0  0SQ400 @P 0QU  8Ŗ<Lņ P 0 400XPUQ0`5$K0͆  400@P1:PgoP} 0D5VΆ Pl 0S0d5 ͆VNX5 @ @~Pd@D%Q 0SX%Rd0082Q0 Q DO0 0  P0 08$Z: p-0L`P00 ,@0 \phqO@Z: -L$0@P 0hx0h -L$0@   0-LP@T  0.| 0t S0C1$$ 00P0#S@T @ @dZ:;pZ: p-LM$0P@P `)@K\ 0N0H P 00P,  $2NKpg|Z:3h9L9Z:[ -L M0tSp!@ dN00 0P 0 N(K0S00 \QJ1"000`p2A@P0@@$(P@0à, < 0<K 8 4@ 0P + QN L0 0704X(`FZ,I9xF:Z:L:M:3${c33ԭ3 0- PL$0$00. $0$0  $0  $0|@l0T $0P@} 0$0$  N'( -LM@P`p uC0 ` p0@@ 0 0-P@L YC 00000 PhiAi  -40LS 0 -80LS 0 0-L<@@T0 \400 D0H 0X0< <0 < @0Z:;Z: p-LP@6`T 0T@Tʢ?T Qh L&Jp`pQ T Wp&+L[: p-@LP04 0 @ 0( ,P ]'PD H

,Kl 00$ x\T[K8@H )0,0 lj88,3333oc@|c(|c`9d434|c,0 R 0s30S,j -L0@$ 4(001 p-L0P8@4 #h(@T008# T08#004 Xp 0-PL0S 0S @ 004(, 0 @04(, 004(0X004 0Xh|c 0-PL R0@T 004$ (000$ 4X R!0@T 004$ (0`004$ X004$ (0 084#8$ X0h|c -x@LQ 0 R 043$ XQ 0 R 034$ Xh|c Q0-L@ Q 00S0<00PUU< 㨿0 04p\0@4 0\5PN?004 \004 , 004 , 004 ,@*t@@|c\: P-L P P 0b@hh]: 0-t0L @I04 L0\0P 04\00500h|c Q-L -LHM044@ 0P h@@hTpcpA4]:`9D0  0S S S 0 S}c 0-0L  0S%P0  ^ ^0 PS n @B21n@P0(0e/"b0 0}cQ0 0`}cQ - L0S0@T L0 T,T 88S 0Y!8h8L#8~4T6 \Dsc@B -@LpႾ`P@ſPUPV0P0 h -sLp3 -@LU^h -0LS@ PPP0lhPe0P 0PR: Q-LA  -LM@31C04`Kq@$PK4 /T T4 1S R$ B1S R* P\1 R 0!@ KVUUU  -L` սZ!0PS @@\UpWPPU T1 eP S@ HUpWPPU@堠TFPX#0S9 0@S0p堠0W  P0Ӥ0 P00 oԾ3P@Q P 0S T  뚺000S0 S@00@@PW QT00D<0h40Bad8:;gfff p-L`aP`@P@U@GT c@HpI@D_mPd T:@呺p -0L @P. p0`0E0:00l:0P :@@/B|hDscg@Oc p-PL`o뱸`h$@ 0 0@phT p-@LPὼ0`S 0S 00p3p00 -L -L 0-LM@seZ 0s0 Z0 X0\ 0 P`0d h P P b\\!@0@ @ <0K0T]:|3\]:d3333 33\g>3534g>PA-tr MP`U`2\2PODl28Ÿ1C 0P ЍR2r 2OD 1C0@l21C@ P1B00c"!B0cP0`0 \0d!S0SL?C  ba"!BA00?000B00c"!B 0cP0`0 \0 S0SL?C  ab"A!B 00?00wH}cDgVUUUj1p@-Q= 1CQ x1Q p00p@T)^&Q# R `VPU1T^QRT Q V U 0SS0SSph  l00p  t0 0x  |00  d00ph@ l 0p0 t 0x0 | 00 d %W A W@ 0-PL{P wP@0dP0h1 -L@Pp`^P ZPTU@ p-L`| PPPUp     @ T 0 d 0PPPXp: -LMPPPK 㯺@ P+Hֽ101(pKa ` 9߻V3T0\ `S( $  `X( $0@@"( $0T``0\ (pK~`H壽 00!00 cCa0 ᫻V d0SlhQ tpp@W (0| 0``{$0 0d( dt$ <00S ``V;QMbH}cpj 0-LP/@p0hp Q0-L@P Q 0L0S 0P00jHC0 㖽0L0S  ㎽H3H+0P00 -@L0I0P0L0 0-LMLP@U K008 iHP 0P0T L0  0H3 0-LM P@0 ZUPܿK׿D0D0 P :h 0{/K$ 0XK0438`9}ch4R 0S p 0P p0 P p-L M8`K@P H/T080K@ 002K2K0 K1 K\08,0 P Dk:2[2[   b:Kp]:0uh]:]:]: p-L M8!@0PSKp8`K /@3@  U002K2K0K1K8 KX08,0 xP @1:2[2[  (:$:0u]:$^:^: -L`8P P@ P P:0pW  P ,..( 6H0@00;00000Evv8!00T^:BL^: -LEM$PP`81 ,8 8# * lpP 8141 0 S0 (@DŽP< w$0!QgƄ 0", 9P<,@`  0O 0 @TPM $" \04!0 ,1Ss0@< 0@P`ȡP `0,A@#T@!Qa ?8#808#8?@ ?8#808#8?08(08$0q !6 P P (1S 4\4444S(K:: :,!0 d,! R(0!8.0OP`8 0(1KJOK,8 <@ l)9h'9\#9T 9L900t}c`}cx}c|}c^:^:_:_:`9^:^:^: -Le -<(00谇 php㼴@و`}c 0-L@P 0 04 Q-L@ Q 818k8`帺8818iD0-n 1$0   '@ ;g -LhM0<1t 8t + 80]408!0 0#  BP]ωmK@ R@ T 00@ (P R00,H58v81S00t ;5{? 2 @ @@ @@;@ 2n/@H_DCHS%0P5yO0@DPKN fTb )088#8 ϠD K8 3KHP (t5tL㍰   001$K1P0C0C0`|0 0h |`@PpHP`#H8P `DSHc0%hyO`40@DPK DPK )08 Ƞ,ȠD0KU ?> K80 KP t40   t) 08 Ƞ,ȠD0K ?> K80 KP t4t40 0 p_DCHS%@ P4a@ ;_:_:`:`: 4 _:p`:`:_:FB8`:8 00000S0C00000 000 0003 4 0  <040 0 8#8@08#80 p-L `@PKH0 8#808#800 0 B4 p8ph p-0L @` P 0(0(08#808#80 8 phKL -L$M# 200l1 0(~U 0 ~ 0 ɸ,0   00S00(~0v P`%%<40!@0P8 40 0P 0@ 0O0 @ $ 0 5P%P0@0,D HP P0@000 Y 01@0 @( \$pڰ0c 0 9P)P (@  3_P08#8= Ƞ,Ƞ @00 0   t3FP<P 0<$ km0,0 V` P,@~00000 ~0@P~0040 ~ 8 {4@@0@  80 P{A ",0 0,0D0 PP0 PPn0S0F 0 4P$P @  2P,0Q08#844@@0@ 80 P@,04 0,0T 0$00\ h 03@T@2<.P000 (Kos0 0P PB Ƞ,Ƞ @00 G,0 D L,0T D Lꏷ  (Ko!  0d@c2\(30 400 (Ko7 003@  4ȯa:a:`:,a:La: -RLM0  `3#40 4 , 4 B B 00i$1P,  0(K@,0 PHŸR00 x00! $Ÿ0 100 b |10004 00i10 > O@ ,0P(00 00! 00 3@ 8^4 0    G$ 2\0 R 0  0014p 00i10 0 >p0400:@313 0004 \XPH~40,ȯ\#4b:@ TP 04 @`=Up20 P( 00  `0@6 0T R P0000r P 0 0000U@ 0@00@000v$KP 0  00 000000`000W0$ P` 0 0@  0@$ 000$ bQڰ0Q\{P000  0 @@01ȯa:b:b:c:hb:b: 0- L0P@K0h%ȯ p-PL@8`gP+ 00 00000 0 (0 S0$0@00 @ ,00( 40 ,0, ,00 400ppP&4\#484 -LMP \`Qp @p @T V4 0`D @/f&T(  /}c}cxF:G9XM:(c: - 0L00S@ 00S00 00S0 0  -L M<`Kp@ P]$0<0K0 60K@?4 K7@KSK00 5 KP3[8#8 K -L M@pK0@ `7$0  @ 09 K!@0K080K4  v*PP 0l3K0P ,` P@ '* K ^0@0K18 K40 9 K3[8#8} * $09 S" 6 04"40(Q(A 04"40Q. 04"40P)3(( SS) 'NEFX -Lⱪ1 0 h-9@Oc 0-LMP@T |.)!wd0d`0a98Lp% 0K8P@$0$.}c 10; S V \P\ 0l@L00Ta @]P ;C; S"  0 @0E8 U:S00P 2UP 30E8S0E8#X8UP 00Q1n08#XQh0Sd00 @0 0U~ y0 00 00 00 00 00 @00 00 <0 <UD 0 ;\P  40 9 PUV ;a  `=0SL00 RLP SBl0V ;   0`(0Q 0Q!0S  p-0LM R3 00S 0S, @P`0S0C00  0AoQ*0 R>;  S0S0C00K K 4O 0 KpLgPg~cHgTgPH 0P 0Q `0SX0S  O H~c -00 0LS@ \ @> Pg -|0LS@PQ \`V p\`Vp 0U\0 pP\P\`U     pf:f: Q-L f:,0 (("1XP H~c-00 Ƞ Ƞ,1XP H~c -LM\P`  &4\ V40S @ h4\$ 9\4\y aP4\ H4\ @4\ t  0p@3\ 4\ 3\ 3\P< Sl$0< S<1S`P 7 @h3\6  0C\ 0\~ \3\PW@ 0C\03\ 1$3\ 3\ 0R 1  i?2\ 0\K 2\20S20S @ 0@0 0C\0 0 0t  0p@s  00p!0 U>@PK  _  0@0  R@PpL0@     00 ?l @$0109t 0@       00 !Ӿ@P   l$ l 0@PlW W W W @W@W @W WWW WW@W @jj~cWp~c -LM\ 0\ 0\ XP, ,1 P0\ 0p XQ 00S00XP ,1 r 0, Q}f~fvt|f 0-LMP@@0@0CS08O8@- @.@H~c -h0L Ƞ Ƞ,A0S 0400 00CS0&H~c 0-0 (("ALXPU 0 X0 G`0S 0 0 P P uH~cf: - (L(" PP#0AT PP 0SP `0SX`VP 4p0H0PP X`PH~c p-X@LT` 0 ! PaU  " 10`P+0S0Sp0, ph, ph000S f: p-0LS@P`(0S  lRPP\P l0 $0iQ Pph U pQ 0P`0ph00 0-@LPQ 0S \P l0 $7Q0hk l p-`0LSPV0SH|0Sl1  X@T% 0S" ㋜0`0CS0000 R00_+0S80S/0 31C ,P!ᱝ 0Q&ڬ 0 S00 S P0 ᑍp00PP0, 00Pg;f:mc; SP 00S 8 -L@Q xv4v4v4v4Tv4000000<000000000000000000 -<00000@ L! pW`V 0S \ R P0 U*\ ,0`Sc PBQ *0S  0 SQ:(( d>0Sh01100 p0p0 Sa`(d0WP00@0$,00( 0d 32aS 0(0d( 03,nR  B,$0 <, <00<0l010p0/P<(< -L@Q ı444h4(0$ F<0 $0(0@hlh -$0@0(L\P  ҧ0\0`P  ʧ0`0P  §00P  㺧00P  㲧00P  㪧00P  㢧000T G/h蘧j p-PLM@P`@- 040 ħ\ 忧0d0 ` 㸧  㳧  㮧  㩧  㤧KpG ᘧP    0 @j -LM, 0 @S~BTP8<0@I`0K 0  ,KPF `00\8@X$1T\0 P 0 (KP P T,00 0 B,0 0 <0@000( d03$ P ( d03$ P0J0c -QLM@ Q Q d( 0D3>b$>.D $ 0 (0Dd $02  -LM@P`p 0@000 P! 0@@` 0@@` 0@ 00 000@p@` Q Q Q!R<00<0 ,R<0<00<0 0-AL@<0)Q9P4D4D4D4D444D4D4D4D4D4D4D4D4D4D4D4D4D4D4D4D4D44D4D4D4D4D4D4D4D4D4D4D4D4D4D4D4D4p4!R@P ,R @PU (0@$ 0<00!R0 ,R0<00!R0 ,R0<00!R0 ,R0<00!R 0 ,R 0<00 -0LS@ S 00\P  g^ :!0000C9Q^0/Q\\0 0 C^\\0 0 C p-QLMP@J Q: Q `P $ 0S0d0x 0( 0CR0d0(xd( 0D3>b$>.$00a`CV D0`P $0  D0`P  $\(0D d0 1 `P $ R  D0$ -X `Q`ppPgUL@T 0D0T `0S UT V`0T ` R $0 R0d0 0( 0CR0d0( -@X`Q`ppPgULT 0T D0`\ UT `T ^` R $0 R0d0 0( 0CR0d0( -L$M0Q 8  4 gRP ڀ;R /t;R: h;R `;R X;R JR APR oKR& MRT`X@0$S 0 `fS0!aL\XT xX@T` KnR3 ڸ:R <R rR0S 0S0!R CRllQ<0 0 0X$0( TBR GDR HR<@_ T0RX 0CR00$0` RN $0 RJ ( 00CRd(0d0 >3R R !B0<0(cR fR XRd( 0.@Ro ARi $0TR a`R !0bP$0V 0SS 0( 00CRd(0o8RI 8R 8RE4t `lR ;hR:0S@`5ژ! `0`S@K0S@`$0@SAژ! bP` 9TX0 $0R0`` 0CR00Q$0 0S d"4h ad 0 3<(R nR`1`!@ dR ,$ <, d(D0$0,<7 @T4 '( d02!`S0 BS(0( S<0S0!c@<@(00CS񟗡484 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4444 4 4p <0($ T0$  c<`K04%/p  P 1 #44 z\QV R(0 p/l0SH4 \0S$ ^! p@\00<`KSX$ TğWP4 0@p  P 1 #4 p^0 @4 |77 Y30S@` 0@S)ژ, JP` !H`PLPpA 01S744,4,444,44,4,4,4,4,4,4,4,4,4,4,4,4,4,44,444,44,4,444444444,4444444444,440@S `pQ $K 0(@K@P$0( Pp@0D H`LX`p`(pCW``C````````0S@`Âژ, 0`S@d ><(@R dR`1`!p gR ,$ <, d>,fD0$0,<r d0 S0S0!0C$0RB d]W0, DL P0@H0Ow$K?l?p$?h?p!c>J?u&h:h:i:8i:0i:(i:i:i:h:`h9xF:xb9h: -0LSP`" Q"@0! 0@T2D 1C@p`@D 0! @00T88 p-0LS@P 0! 0PU0S`P 0  0P U0SH`P 0  0P Uph88("Ƞ,L(oR- :  S >;  S F/ <0 < <8SL$ 10;C  3=8S$ 10  >08S# 10  <  >8 S # 10   3\ ~0C\ 0C\ h0C\a 0\- #0%2$` 2`0 V@P -@SL  A0F10#8 - R0L00@ DH10C1 !ṙ h贙 -LM@p `PP H D0aP  㙙 0P000 00@@1 0s030  \ DH0  !1A/0S1PQ 101H0D Q   0 0 HD  S p-`P LR 0S0S ROp@  w 00@p00pPc 0-@L0PS 0\ 0cS0?000P -`L @v}P 00CS,pX `00 T00 Z  8@$0T8< <08@  S<D h@0S@8 m ^IH$<ZID1c!@0LP ($ 1X0$ \0$(0T @0`d0h0 @0 1c<0@ a00 2 Pl9IhI2Id c,2,"0(2 $"0 2 "02 "0Q0 0I,0F1 0 0A Sl4444`444444444 HD$<HH,0 |,p~v,p  00!0 (1(!0 1 !0 < ,0}0 0 `  `<P @@ 004  b<@P `0 <" `|  ,p p,pR<F44H444448444P4P444H4j: -LMP@Up`0 S_ 0 0Sb,0 \ 0 P 00b PPK,0 pkQ,10!48<Q@qO ( 0S% 1!01 !01 , K0 0 HD0R   0, 0 HD  S FUK  0 K( 0P ʨ,K K$ K(0KP 0h 1 `0` 0 X0X 0 P0P 0 H0H 0 4P4 4|44D4j: k:44 4444444@-A0Sm 1 00!#1  1""00#$48$0,0c80\DL 1  00 ! #1  0""00#$48$0,0c80\L 0 00| |#1  h0h""00#$48$0,0c80 \00\cTcUUUU3333؂c\c#G- \ 0 C8! 01 0 R$@lʌ2 0T 0 00 \0 0 a 0VQ 0l0c 0@T:V0 0 0p 0Q00S1 0C U00 00\c؂cTc@-@`(0 \$0q<.1 0 R$Pʌ2 0U 0 0# Q0`0`  1  r00#@0p00#0PEu\c؂cTcG-=4Q *@$?4S0>48$P0R 0>4=4@4?4B4A4D0\0X0 0$0(0,0004080<0@0 0R` Pm p 10W,0  WI@ 5, 5 5L 5< 5p`P@HD@ ,0S 5*0JS55 5 5H 5@,0`S Z 񟗶(545<5D5L5T5\5d5p5555j!a 0R@S Z 񟗓5$55555 55555H@Dt@0,0 10,"A @,10,#RA4>>0 0@4A$A4JL 0RP0 0BL00 h >(K0P0T4T \04X00=4( Q0=4ȅ0=ȕ\0!L0 0P HL0,$0  h 0P0T0P0TB4W0B4 0$B4S!??Q/$ (0R+10,"( ,#?#B4W0B4 0(,048<@DW 0?$,?R10 ,?$ȕ,0B480 004P ^0W ! 0^P RN \P0M ! 0PF RD \0`0044<40C R<$21C01 dA`@0 0 4Ĉ!l@d <400S<4@ h l04X04\<$21C01 0z10` !10!` n h 0P`\X #`0 @-@\pP \ `1 `#01^0P5@10L\!N013 fW00S3 00P Џ p-P`L@ @8d0PpD -LhM ` PpK@P <0S SZp0S D0Sl@P$K -LlMp0 t 0  `KP@P @0S<p0St0 SZ80KYZ@Y @(K -LhMp Pp@`KP p0S<0SW,p,4 00*pPcg0P$K`1S`-T1S0T0 R \ 0S0S  QD(K0 0F?C, D \\ P \ 0S 0 S  QD( K00F?CD \ D1S BT\1S q`DP ]K0 \  D@Ts(KK D_W - 1LSPp @`1" h 1 S`@ !~b1S 2S i/_ pYiU 0-a1LS@P \PPP  0XF 0 k:j 0-DPLMXa@ $K 0$ P  W\K0贡cd4 -@L`pPP @TV0, Xb10Ya1P c9j5H 88 #Q 01S 00="Rܡc p-<2LS 00pdBP ` 0S  ,00 S 0C$0!0v03 K$ R PP0S pp<4D00D0$0S0H R0 0P ph9100$0S,0 0S  D0%0 000S <0@ Dϲ 00C0S 00S ò -0LS@+0S  R000 0  B , P8e 㧅 0- LP00@P 8Pl *0 -80@ L<0HPD0< 0D0 @0 -`L@>P P#$ 0SPD  1 0%0 000SH ,0PPD01 U 0 <0 PPD1D0<bD00D01ip$0S 0 <2S!l RPP $0SU0000<0@  YjPIm:xm: -LMP@ST08@ `@0p @pP@@yK75 p-LM@`P>0 0K K`K`K 0`K0K`K`K*P  K0Kp -L M8@#hPP @pP@ 0Č.0 TP%Y0@0P +(K`} 02K*K2K1PK0PK/PK.PK-PK,`K+PK` `P~P*0[  @01K `2`K0K/K.K-K,K+Kd -LM@0K p-LM0@SP Kp `PPV e B0  K 0K0 B0K K 0 KPKPKK0KP 0-LM@P0  K0KKK0 KKKKKK0 p- 0LS@ ,` P 31C  / 0Sp;m: p-LM@`^P 0S 0S 0S 0S P Kp  0SK0P 0R 0 00  @00 -LMp 0K`P@P KPP@   0` @z 0 P 0$  0P`0 @ 0$@@  -LM }u -80L 3( 1C@ᚱPh;m:m: -0LM@ 0K0KK0K@K@K@K@K@KK p-LM~@ATCd KK KKKPK`K@K0KKp p-L@MPAd K!  K KK0K`KPK@K@KKp -L@MpBTAd#0 $K$0K#K!PK`K"K pK@K@KK -L@MpBTAd#0 $K$0K#K!PK`K"K pK@K@KK 0-L@MAT 0  K0KKPKK@K@K@K@KuK0 0-L@MAT 0 K0KKPKK@K@K@K@K_K0 0-L@MAT 0 K0KKPKK@K@K@K@KIK0 -\0LM@A0KKa0K0KKKKK@K4K 0- 00B1 0LM8_@#\ #8KKKK@K0KPK@K@KK0 0- 00B10LM8_@#\ #8KKKK@K0KPK@K@KK0 -LM@ _0K0KK@K@K@K@K@K@KK -LM@ 0K0KK@K@K@K@K@K@KK 0-LM@ KKCTK KK@KPK@K0KK0 -L@m0 4 R: Q 0 Q05:0!S S p-LMP(@`T   00x -@L[f40(0S (0,0 @,000hgcc -L$0S h 0@07f$0S0 0 0@ hsgc -LMP`p!f1@T(@T 0S0S: 0S:( pR,0,0,0  B Lg@Hg0e ́@P 0 P` p0  0,P e v(K 04P00 0 P 0P@  8 0cc -LM@R@QhB` u@P 0$0@ePp R-@ 0Ka@P+ 0$@ 0 00@S00  P  00@Q 0 0 0f R 0SfcP0 S  0 S   S0 S00p@-0`4 \P*0 S @  ^:0S ^ 0Sp0S@@VU  -L@p`PP 0S 40S P P P S P S:\  R @0S B40Pe g p-PLP 4P L0`V@@V4e KLP e EXP e ? 0 10 e< ph5 p-`L\0SX0P P@X0P@PUpP -LP`p4e I@PP pP`0 0p0( p00 PP0@ e -qLMP@` -K 0pP @$K&`P  0TTP  @,[Z* [+0[T  @ 0@{P  @ p-LM8P 0`Ph@P>Px -LLPp4@P@ 2`@TE  e 0DP; L0 T$0P pRS 0S+ S \0 \*S 0SP e T000S 0S@0 R 00 P T0 p 00@ S 04S!4000m:m:m:m: -LM@A 0 K0KKK@KKKKKK-<2S\0 R 0@i404 ,/ #30@Oc;gMb n: 0-LP@P 00h 0-LM@A0 K@K0KKKKKKK@UPP K0 -LDM 0`Sp L0PU@@0U4e ~Le ~0 040L0w* ;K 0QPP: [R8[90[e~PP @ 0<PP@ T e i~(KLP0SPP00  0 \+Y P @   08P P > _020Kh02Kb K1K/K,0K+PK0PK.PK-PKP_0[  PPp e 0~P4P L0W 0@@W  lPP @TJ@TZ*KP*0[ (n: -L ! 01 R101 01XQY QP@S G y0+1X P@0Q0U0SU2G? P0U0T R 1\\ T 0\  0S 0 4 \\T 01[OCH 0KhP!  -L^KBM@KPEp `0 0  PV@ p = p<0d @E0;:PD`d  Td@d !PeP @ d` 0 $Ko:$o:4o:xb90S S\f 0wPF V8p ` 0  p@0Sd  }? 0  00>0S0 S !00`00\pp8 0'pV8  P ( 0T"0 R 0D0|q:0q:n5 r:q:\q:q:p5(r:q:Hr: -@L0S 0 S  - 0Lq 0Q 0`00d 0-LMPP\0@ @X  @ @:X@PK0P! -L M@04 PP@$ X pp 0P" X Gy8@! 0K4 DTGd 0K0/K.K-K+PK)`K,@K*pKP (K ^ -L M@04 PaP@( Y0 iP'  5vpP! 0(8@^0K4HdDT 0K X0/K.K-K+PK)`K,@K*KP(K u ^z5R00R0 Sp-LP@` <0 @ Q``F 0  uph5 -LMR@80 pp u8`0^3K04KFT,KGD4K 1K/PK-@KP2K0`K.pKP00P00S0,0 Y G8 ku,(K -L MR4 @p ` ` up 8P!0000K40EFD 0K )@K/K-0K+K.K,PK*`KP @@X 6u(K -h1L MQ@ P1Q& 1CQ K01Q800Q. Q< Q@00 * 4K K0 S;#0 0 JQ Q Q@00  D00 8 040P D00 8 04;0PH00 H00 UDUU@ 0-90L4@* 090p PBUpP#TP MTPXP HXP@P C@PPP PPP<P < 0@S<0S =Q X0S| S~ 004 D0PS4< @0PLX0St 00`@fP`@> VX 0BSjP2 X RW .:R,1T0Y 0BS7Ꜳ55555d!`!}@!{T!yP!w0Y0R0Y0N0Y0J0Y0FP< @ii9X@Y@\@`@Y0PX0.B+iwi$ >0SN=}`0T04> H0P u:u:,9u:u:u:9u:u:u:A:4v:r:v:u: 9 -@L0 0 4JS00X0ĵX0ĥ -L@40S 0 0$ R 0R  R0Y00Y0 0-L M8P?00ED0KB0K KK@K0KKKKPKK04 -8LMȠ,Ƞ#85 $9 -@LK00hL -@LK0S00@LS000(0RR00(0(00 (0SP( P0(0  0(0 -LM@Q` $pSJ|555ض52 %㼠 w00 " 0>00 01 0@0 T0%(KQ( 0 R* 0Q'0(00 (0SP( P0(0 (Ko) `0(00(Ko20/0 0!0(00(05Tv:80S8803h -LM@P4`0;P3 pW00 00 0! T@  0 P0(Ko0+ R  RW\0(0(KoT@$ 0AP(Kh5|v: 0-LM4 P0S K00K @K* P,KR)@K0R L( @0 ,*xv: p-ALTP` P㭦` e01p p-PL !f@`@ @0&02408P40012` 902`p贴55c p-LM`2 <2PK0@!2 00004  00CS0x(x(i2 p-LM`022 < ;PK@ 2̿00004  00CS0xx(i2@-@0 , 00\#^? p-PL`_?(0,@ $ p 0-PLP"24  BT b0@Tz_0 0-LM@ ?P  K0  ?P  6$ \3> @KPP | Tw̠P(T34/ PPnv:v:5v:5 -2AML@`@3Pp0 2DS@ 0@#C40<@3,O``  <>P 5 40;aKp30p3'T5w: -@LPhP#43S aV~ᑙP  P e01aLP  20106 -@PL :P h -Lp-P _ H^43S _`0@0 "0R 1 S4#㒞iI0S -PL`p@P HWAI WW" 0 0@0@ hW iI0 0@0@ p1S0\iI, w: p-LMP0 0@0@`Xg\H0 K@<$< 1S2IKp0CGT*K" K)K(@K'K%PK$0K#K"@K!K&pKP -L M`@pP K@0ND)0K?0CHT)K! K(K&@K$PK#0K"pK!K'K%KP -@L {  h p-L M@`PP Kp?0F"0KB0"K K!KK0KPK PKPK`KP [0[ p-L M0P`0K@P Kp?0F!0KA0!K K KK0K@K@K@K`KP[ 0-LP z@@T T ?  ~$ f& ~b? (0hQL~ V*'w: 0-9P@0@L9 YQB >\(P (P5(S,P ,P20,30P 0P003XP w0X3PP 0P3DP k0D3<P 0<30430 4  x:w:w: p- 3LP& ; E9`@O [ 㫛00S 0@|30CS|3Fpߚj -L`   9 8#8  )2S<9 9  h@@ TP ppdQP@@0$mW -LP@P -Ep)n @UT7P# 7P%  B ;Z(3S 9 @09!EFh՚@h;F,h5FFP h.F8x:Tx: -`LP@p2P@ D0T 0CT!  00 @4T$  F0T 0T0/@ @ $@608#8@6i@6@@@ x@i 7i 8i8 -@LpP` & % (@@T ( T hdupx: -LP@`pP ` %@ (@@T ( T &@7H$Epx: 0-PL9 _"0R=  T0@Q  R$  C <]@P? 0 08#8 0haz Sp  0- L P # @@T #W T !0h,x: p-L`@PP@4U0@p -LM@ P2#"`3#娃嬃ăȃ ` 08 Ƞ,Ƞ#8G t?S!^0C @/@d0pS@00S #0@SWP   0P# P$#0@S3S 3S a K [$3S LC&@K=P <G) (1(!9! 1 !1!0` h⻺1!21_0p"2@r 0Θ 0Y–\  ᜒ x)HD 0` љL ꔿ55x:$9x:x:x:t55L5`55 5л55\52S -@PL +P h -(3 @SL0#$8# P( P, (7 -@3 @SLH#<P# P@ PD @7 0-L@P +1P ; 000@ -D2L$M_`'0b97Pi 7P 0P=3( P3 P3 EPl 0K? [0[ [ 0 ?P C X峿?Kp3#4  ?PP C 嘿? )΄0{7P 凿?D3@/ P@}9@0Q9S?>2 R ,c? y:z:ay:5y: -PL@`pE>1T% 0CT-  00␑@4T z?0T 0T0/a@4T6@ @d? @ Y?@608#8@6@@ @@i 7i 8i8 -p  0p00LMP 9@ 0@Q  Ro 0R( R) RS0,3@00?0 A 0R R 0 `P Ph蹾S S?  S S p -@LZ|30CS|3h|3 0|3Z -LMP@p`P̃X $KG4%0K&pKh 0`E&K 0H> @40`7T C! Xz: -LMP@`PsW K"`K!`K 0`"K0|   @d0`T ?!["0[X    tz: -LM`P 0`"Kx 00\ `B[L2BKTR 0< `($4Spm <`K @ 0@n0 @Ke 0@\ W0 @ 0@P H0@G 04@ > 0@| K 0`t(-p3` 0 0 308#8  0 0H`L ( 0`C  " -LM0p 3P0 2 08 Ƞ,Ƞ"#83@o3sCCX3C3sC!3 P,P0P<`3 " 0S;930S@00S #0@SP   0P# P#0@S; χ0p O0x f 0&PK|OP0e 0χXL0qv\(帼᧍峼) { 0ph/1!91!1!1!2!1_0`"2@b 1: 0Q—\A  k, T問< <q K0&PK$OPU0 a0[jpuQO03mJ[0lC 0 t #&95z: 5 `09{:<[955545\55T555z:`z:z:z:z: -@PL aP hA -(3 @SL0#$8# P( P, ( 7 -@3 @SLH#<P# P@ PD @7 0-L@P +1P ; 000E@ -$3L0M8Kp@P`P9@ T& TT(KyPT :@0\;#岱0hŸ     ,0K@A,Q0 0@0@#0Q O"88#QW:8#8SD0 H <@ 0 0@0@D< 0A8#8 D0 < @d1 0`0SE0SBH <@>$(0))?@ [P @0C *2 08RR#820 2 y po0 0@0@dcDHD<D0@  S'985{:y:X{:4{: -LM0S 0S  0 Ƞ8,Ƞ#8 $P'9 -LP h? p-PL9`@09iaP qP6cP hP403P ^P03HP 0H3@P 0@30P 003(P 0(303p C} <x Cv $q Co j{:p{:{: -LM2p 0PS: S S@` S.j 2၁C0 , @0K  ,,30  0`DP 0s (,3/  `(.P _(Kl,00 19,0 ,  `\3 0\3{:'5 -PL3@S aV ~|P  P RLP  #v0106B01 -pLP`$P 8V VV$ 0 0@0@ S x役V i9ia : `1S 0 0@0@i90@{: p-LM0 0@0@P` X卹80 K@(J( 1Sp9Kp|: p-x3LP5P`P]PZU8|3`0CS|3f9@O N M00S 0@c|30CS|3Ly9p⁍p p-PL`%N?(0,@ $ p 0-P0"L3 BT Q0@TMP0 -LM`PpOP @0?0(0K(0K:CJGĠHC6 (K%K#K"0K!@K'PK&pK$K P K -@LU|30CS|3h|3 0|3T -LM*pK@d ᖭP K"K4 0! ["0[48 !#8 ! (  "(2S<8" #8( "h908#h 0p&Ġ 0!K"`K{"08P#h PP㱉 0K Q 0 U A'9 ! -LMPY7p`K`l (0Ia7PB B7PD {s@Kx 0@60[[\Č Ƞ,Ƞ Ƞ, ,Ƞ 0KK@%J ?/P C( #_8K  ?@P C N8  H8 B8D3@d/ @a@9@0A9C,8Ὄ !x|:|:8|:X|:85 -PL@`p61T% 0CT-  00@4T 80T 0T0/@4T6@ @7 @ 7@608#8@60@@ @i 7i 8i8 -p  0p00LMP 9@ 0@Q  KRo0@S) S0 ST0,@300M/ 0@S S "40K K{K| "0>@bT PCT T<8#( T T 08#(6!H p-L M@0 !DP_`$K0 K$0K<0C@K#K0KK"K!K PK|@P  VKp\}: 0- @L(,0 $BPP 00 $A0h 0-LM!P00 @ {P:98##8 Å <9)7 373 C #K0h2Sʜ:P3 @@5 "0K! 0TK0`(9 -L M?0!DP^`p0(K(0K KD0#@K'K"0K!K&K%K$PK@P  ϲ 00K}: 0-4pLM@P  KPP1  ((    :PP8 姲8 塲8}:}: -p  4p00LM pH9@E 0.@Q @ 8 ,( KP3,㺏0@ = × @ 0W`!0 ƌ@@Ç(0(000(0 (0   PG( @,@  G pBR2@S ST×(0&ł0@(0 ÇT \~:$~: p-@PL 0kP_ 1`F3 phJ2pk -LMp`P@$K$0 7dT   P@   p-LM @n PP @LٱD ձx  Z  PPPU @ñ(0hiPP `K PP @ 宱@婱0: 0 ,8 (l*$ `P7  /`P01$ 0 G , /`P#,30 3 # #@d VPz@L OPs@4 HPl~::~:(:~:0P::: -LM0P002@3$C(C6 SL2DC83@C0 9!0 1!0@ 0phy~ Hy~+ 0U가:;6=6Ѐ:x:hB6062616z: p-LMQP` ?0@0 0K 0K0@EĠF K@K0KKK0KPK`KNPKp -LM`pnPP KG@0HD (K(0K'K%K#@K&pK$K"PK!PK,P p-L M@`MPP Kp?0F"0KB0"K K!KK0KPK PKPK`K P [0[ -L,P i@0``pk`p@_@P@Pm@P@PoP 0 0@0@ p-L M0P`0K@P Kp?0F!0KA0!K K KK0K@K@K@K`KP[ -LM@ռP K@0  K0KKKKKKKKPmw: 0-9P@0@L9` YQ3~P JP4RP A P102P 7P02HP 0H3@P H0@34P 043,P <0,300# 4  x:w:w: 0-2L@7VS(9P@00S 0@q|v/*07~~ 0-LMP 8#8,2S<9 0@\2  .>8 0@Q2 P @@z++!0T 8d #8 )@< .>Y8,z;;1" "2c -LPٻP9@@ {(p" R)ngd @LT9`   C}7P) @7P z$ 5# 1" - )2S 9 @09!)h~@Ch~),=hx)0P hq)Tx:8x: -PL`@puP@ (01T 0T  00d{4P@ N)& = S, @S @ 6 3@ =)606f@@ 6@ @V 3  `/ ` 3 `" i 0-@9P@0PL9YQ 僽P4RP zP102P pP02P -03P 03P !02P 0200 4匨 冨 倨x:w:w: 0-LM@ ->vP p kK0 ?gPP a L\̠3,/ P帺Sv:v:J6 -2QMLP`2@p0 B"_ Ϡ,͠0 ?  lC4B0b2\\  儺P  0<K303G6: -PL@JPaV ~uwP  P KwLP  d0106;w01 -PL`p@P &WAI WW" 0 0@0@ h嵧W i'0 0@0@ , p1S0i'< w: -LMP`߹pP K0 0@0@\僧x&0 K @@ 1S'h1 /7p; 00tw: -1L M0Kp@`0P$0 cP 9@ V VV K$30$3ܺP2VN ̠@A0 L @\ $0K`尹$ R @岛0  $$ $0 S0 0@0@$C 0lƦ$0 0x h7P %@0yt&N )9J6w: 0-@PL S M7P 3S {P ㈻P 070 p- 3LSPpy%`P f A029@ 00S 0@xr0 3&p p-`@LP P 4phUb! 0  P/PphI가:Q6 -LM0S  0 Ƞ8,Ƞ#8! 兹P (9 -L@ P/P  hw: p-LMQ8#H`@0?0 0K 0KP$4& KPK0KKK@KK`KKp -LMpθP6 0 4S ,K0 KP !0(Kڥ,P ӥ ̠8Č#Č"̌ 0P d ᾥ ,B@ <̠ČL8 ČD"̌#D!L  0@P P,<4("!4l̠ <($Č"Č%̌ 0fP | P  ,? I<<:@::p:::: -L MpBaP WK KB@P &0PS00S"0@S P   0P" P"\-2S 2S8# ( +0P 2f 0N@P& #+N@`uP ) 㾙|0| 9!t0t 1!0@ 0philsw0 3%,ؤ:Ѐ:x:z:0:x:V6G6H6X: -(L"M"(@0K K0KKKKK K K׺ K -LMP 2S.0$!08#8  Kh..00Q0" "2p488S@`  UT` "2p488S@ 0!B!.N0,0•)0 0PK Kh -LM9P@` KG#@)΅ 0p@.9..  00 00 n@ j7P 7P w2S 9 @0!9Kh_$@KhX$(KhQ$P 8x:Tx: -PL`@pPP@ "@1T 0T  00?v4P@ )$& = S+ @S @ 62@ $606w@@ 6@ @g2  .0L   2 .>  ("(  i -RLM R R K0K _5 p-`LPڵP p0 0@0@ph~Z`P T OKph"2/ `婴D9@0a9Kphs"τd +> @P % , KphZ"v:Tx:8x:v:\Z6X6: 0-@9P@0PL9YQ ŶP4RP 弶P102P 岶P02P o02P 02P c03P 0300 4Ρ ȡ ¡:w:w: -`LP@pP@  0T 0T  00s4P@ ! @@!608#8@6 @@ n@ i -邡ႂLM0j`@P3p R/00 \  @00 0! Q " $K0j 0 @j@c0"!B 3/LL  妳AP !$K303)9'0c6 -PL@qPaV ~pP  P rpLP  C]0106bp01 -LM`pPC@P KUAI UU. 0 0@0@߿ ڠU) !$K 0啳 P P P$0S 0 0@0@1S0 0 0@0@L w: p-*3LSPp9`@ 00S 0@sl0*3 pv 0-LM@P ZPP  0 Ƞ8,Ƞ#8D  ƳP 8P 80 SS8,)9 -LIMp`rP3 08 Ƞ#8,Ƞ 堳P?8@KᳳP pS ܳP 0$S0S? 0Sp˳Pw (0S@(0@SP$0P 0S$0!"i(0@S2S ڲ02 `R@0Sڬ2sͲP  @ 00S0"20S帲@峲ٲP0p@P婲 ""0`S0@0S"0S嚲Pg   0@0S"0S2s 2spW2s 2s Z` =K0K0C 姾PKX 2$K)N0` VDKi< )$8 #44"<,K ,0 G02hp@ r1!9!1!1!0@ 0Phmr0*3 Z0Sp O$K222SCD ?;90 $00B SAB Qa0B7 BSW B? 2"0 P2)N TH<,)9*x:4`6b6X6:0:H: ::x::̃: -@L ";30CS3h3 0 3:P0 p-PL@0`*P 6@ =  0@ (0,@ $ H3S 0@ 0$@p3?(0,@ $ p 0@ 0$@(, p 0-PL0P= H# 3  CT 60@T0h\30 -qLM0PT3@0` bXC;QA40+ @T/0T3PT3H   ϰ303Pg3@0CS3T W dR0⃭ KT< ah<0>N|30|3o6: -@LP0~P#H3S aV~mP  P {m01wmLP  HZ0106 -PL0`pO@P WAM WW" > 0@1A W i B? 0@1 A ^ p1Sxi3H03k30CS3Ҵ w: p-LMP0 0@0@`X屝0 K@PnP 1SfKp   7 p-LM@PP` 0ŭPU x @      K0 kY [0[48#x -pPL 0噭P_ =-0 }@0HP p mr0_` 0@0 , 0Q 0#00H#R00S 1 SH# xR0 p-LM@0VPP KpA `K  = 8#8  -2S<=( =  0 0[<<P0K PPk K?0 Q0 U A 0-LP0@P 0 \ TT @ 0h' 0-6@@0P6LQVPnDP uD@P+DPHP lH7P0H0lP 0l3dP }0d3XP 0X3PP q0P30H30W RQ Lw:w:x -LP`6p0/r k0 7P$ \e7PQK C ; =  H0S D0S 6@@06A%Pn.IP 8x:Tx: -`LP0@pP@ 0T 0CT!  0xl@4T$ 0T 0T0/n@6 @ @608#8@6K@6@@@ @i 7i 8i8 -d0L@x`%0ȧ0ŧh3p0CS3y=@= _  `nx0S kwePm_ . -LM0S 0S  0 Ƞ8,Ƞ#8  偬P-9 -LMp  P@`23 0@s圃堃}424`3s布弃 0 Ƞ8,Ƞ #8 V=4ث080@0<0 PR>@S/ 0@S4ɫP* 00S@8<0S80s" <0s @0s *@K 0`P Ƙ@弘0$Kx嶘id尘 x  xp,<1` !90p h≋|0@0@p0 0P x1cVZ04 $谀:Ѐ:\66܏66x:z: -LM0S  0 Ƞ8,Ƞ#8 P Tc 0-@9P@0PL9YQ xRP qRP jRP *02P 02P 02P 0200 p-`LPԦP p0 0@0@phxFP @ ;K0 ?7P 1 , ? @PP  T̠24/. Pq v:v:P6v:46 -2aML`P"00p2@" • 0•C40 •B( 0"C<02 0B 2o\\  /ʨP  0弓 K 30 3 6`: -PL@PaV ~ cP  P bLP  O0106b01 -PL`pȥ@P mWAI WW" 0 0@0@e h`W i0 0@0@ p1S0i w: -2 @SL"" P 'P A7 p-LR`P D ; 0 0 @ @p@PL7p+1 7p; 00tw: -L2L M8K`@pP,p ;P9@ X XX(K3203嶦PaXn ̠A0 L @6ѧ ,0Kp劥,pWP084 0LT 8 ᱒T ,p084 0Y0 ធY  @ f  J b7P  @0K`0 0@0@Cw 08qs $k,.946::w:x: - @L#/-7P 2S 3P @P 7X7 0-L@判P 0-P7P 7P 2S 9@09c010@0hZP 0hS0hM8x:Tx: -`LP@pQP@ 0T 0T  00@d4P@ * @@608#8@6 @@  @ i 0-@L9P@00S0]0 -LM0P2R`ሤ0pS@00S"0@S{PI   0P" P"0@S2S4 2S1 2S. z0)NPK0` G) B02cb@ m0 10)1x x01!0@ 0`h_ d8S (N*gx:6p66x:z: -LM0S Q  0 Ƞ8,Ƞ#8 Ppc -@L K-30CS3h'3 0 3%- -@PL 0YP 0h9 p-PL@0`JP6@H0@ 0$@(, p%?(0,@ $ p 0-PL0*P# 3H  CT (0@T0h%0 -qLM0@P `T3㜾XC ;R' @PT3H /  303P娥3@0CS3T ᘯ T哐0ğ KT<bR<ᓧ|30|3괦6؄: -@LP0âP#H3S aV~_P  P _01_LP  L0106 -pPL$ 0啢P _ 9'%H3S _`0@0 ,#0R 1 SH#PdicxS -PL0`pc@P WAM WW" > 0@1A W i4B? 0@1 A r p1Sxii"3H0330CS3 w: p-LMP0 0@0@`Xŏ0 K@P傢P 1S5Kp0@").@ {PU0@00 QP. 0S 00CS0:"00k0\0 00@0,000$0(ڟ'.ct: ; 0,"|6 -@LP p`Po00ht. 0-0@P00LoZ000p. 0-P@LQ  0 S 0  000S:R   BN}. <0 8  0hO.  0800hO4.8. p-L^ @`P  ^* ^&0 ^"1 P 0S }pl0P T0 ^ 0 R 0Cp 0P'L.P.p.t. 0-LQh@PT0  0CR0 |00 \'\.L. 0-t0LP@MPT TT T 08@8 000珝00CS00h4''X' p-0PL@)P pT` TT Ц \ˇT phph<@< 000]00CS0Ğ4' w:'T' -LM0` 0 2Pp@P"T" TT; T9 TB 1QA 0%͠ %L @000勜00CS0%K  0K@> R0 QF Q? 9CSd6T6D646666$6`0 Ze@ 00000CS0VD@ ; d4'X''h6w:|:: 0-L@ 0P0 0P 0x h P00CS00P 0D O, P0P Z ( C0?`% V Pq%-ÅW$K0S2*@KP0RK"K2K2R7 0R0SR2K?2K*@K02K00C SF 666666666660D"02K0"K*@K2K $20Sf 20SZ S08#*@KK!PK0`20pLK&6zW?F K4K,ztP`V000000 R  Bzh z1! M 0 @.\ 8P `圗 0@P @ d0 R08#Q 0*@K2K0"K2K?      '$h':&(L#P#d'T''68. -2LM ?Rp` 2RS 0RD Bf2"p 0 00@0yT2T"@]0 P8B8Ÿ   @'.,8 0@? S+ 1 R 1R4 -d0CRD 0RI T1 @1 3$K0S@? *pK2K"Kl1 *pK2K"KT1PH!0S01R 0R0AS06$66 6666666666660 00 00p p <8# $ h'4.8.d'T'6'(& -QLM0`(!("$K1p 0 ?% X00DP\Z,0 @  xexxP 0-  WP 0( L 8%=ۃ/9X:P.D.H.h'd'T''6D:: -LM?p`0 \`,0 M \@1Q  A1(A(Q0  70 10Q @,0 p0pᴠᶐ,0@000[x0 ]@0 P@  } @ _=@P@ (K(Ko='L.P.h'<.d'T'6' -(2L PRb  R 00 0000S]B?pP Z00`So 0@U[O1 ` BR Ax1Q 0A!da TAP 00 10Q $AP ՗P*00@P ʗP+00@P 翗P006/sJ?p X D܂ۡ 0ւ'.'L.P.\'T'X'|:x:w:w: -1`PLϑx 0`@ 0C X!X1PT!ˌ@0@υ@ᄕ0pS 00S1 0@SwP&   0P0  P0@ 0Sʴ0  4P h}P P phqd hlThhH0H  h4'8''x.|.D'H'L'L.Tx::x:8x:'6 -LM0S 0S  0 Ƞ8,Ƞ#8' 单P.90@ 00CS66666666 P P@7P,@nPX@l`0 $H0AhSw6666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666660 0 R Q Q0-L@P   0@T  08#0`08#0@jPj\6T6d6T6T6T6T6T6T6l6t6T6T6T6T6T6|6T6T6T66T66T6T6T6T6T6T6T6T6T6T6T66T6T6T6T6T6T6T6T6T6T6T66T6T6T6T6T6T6T6T6T6T6T6T6T6T6T6T6T6T6T6T6T6T6T66T6T6T6T6T6T6T6T6T6T6T6T6T6T6T6T6T6T6T6T6T6T6T66T6T6T6T6T6T6T6T6T6T6T66      -(L`P@""4"̠00S0p a0V V 0  04Ƞ8,Ƞ< *;"*#"#? ## 000 0 000000BFV Ƞ ,4V 0 7000L0Ba21C0aT  Q  R ,{0 0 颋.P66666666666666666840,($ ,9:Ć:̆:Ԇ:܆:::04; R0-LP 0h<0 @0C 00d@.0@ 4ukP 0B <0hT: -LMpWP"_?`(K $K(KCMP L0P'K@N#K0&K%K"PK!Kl%囔 K6 0-JL(@P0PS 000U00 -LMHP$lCt@$H(K(K'K%PK$@K#`K!pK&PK"0KؕP   K8: -LMPH.l$|.@0 $H(K(0K'K&K%`K$@K#pK"PK!PK崕P   K8: 0-0 @$(LL"(P0 $("(( 0$("(0h 0-0 @$(LL"(P0 $("(( 0$("(0h   0 R   V p-X0'  Q@P PL0@`[o~ z phu -X@L j48#<,"(c, _'R  hWfdh -LMHP$lCt?$H(K(K'K%PK$@K#`K!pK&PK"0K P  ~ K`: C-0- PL@0Nht[@Q \00HS X00 0R B0HSQ4 P 0B <0hS p-L M?0P.L.`"K K"0KB0!KK@K0K PKPKPK彔P[Kp蘝 ~`: -4L@9$   08 #(hD -4L@7$  08 #(hT -LPp`@  @ThhW~T @46%CA($H"(0H$(1 0p: -?LS@ (0 )0 @ h $) (0-"(LXPm@Mb @T(~0T S0: -LPp`@ME @T,h}T $("(h:꼇: 0-@LPT  T  ?0C0S 0h p-`LPV@ V@@/0B0RS@ L@  ("(,$  ("(ph p-LP@@dT mP dT8}p,`@0 @}@Tp؇:809 -L@0p#`P00V0SNPF0</Qp1p#R, 6\66666 #3!3yDp V ""2! "7S 7S FV  F"NoBi<2!\  "" 2!#)D !!1!#@ !1!#)D zVH! -tL!oH1!j#@  c1!^#)D X0V  Q L H0!C#)D = k -70 340!. * -X 19X191929x09090919 -LMHP$lCt? $H(K(K'K%PK$@K#`K!pK&PK"0K勒P i d| K: p-LM@K 0P[0 0a[0aKA[ $$$ $ Ƞ! ,Ƞ 0e.`@ 0@/o0,  0<,0x40 0-0h 60LSP0CS006 0h&l(|00 @0@0<9 0-PPHC* 0 ß  P唍/P [(K!= PW 0!R R8S S0 | <q"D04;20 00\qW 0r0@@ j@@ b@H$H@H$(@u4 8 41S#8z ^7 0@'E <'Ό< Q00/.000b 0q @B `PDJ0@00DL!040 ヨ84\p '.0 4P! 0 P P爏P@  T 00@@i @@H$@8a 4 < `00/.0ʠ< 00b0(D$ l6: p-LM6`@P1S x00 0P  n6 P;0  060 R/zl@P7SI@P LP  N6 K@P 0P  B6 YP Q0-0 0@0@x01xx -pRL@ WW yW$ 0 0@0@0P` \ p 0@@0 @ q ppiVD: -LJMR`p \\ \7 ˠXB0L  @ᜎ(K ,0KV, #R0 0@0@0@ TD⠐ePPh +~1oy @! P hQ  0T48<#8@!:#:0 0K< 0S( 1  14p 0 p0C 0E=0 01 1 0 ,1 (0KⲐ@!SdTW  3"/9PP@  K488p04(OpMC-0 NH  0l&21C! c%-  P0U傌P@( ?=0 㚎@P  wxw@?=0 ㇎@PG@P 8zwy $twpwP hw@@ ˠ0* ĉ_P@7S  6 n ~ 6@@06A70S  e `@4wY/9"VS:8:ȉ::d::d7D: -`LP@pgP@ lh1T% X10SL1TA 0H@4T@ $1T 1T  ш4P@ ,墋6066@ @@ O@ Ḉ4P@7S 6A0AS@@ 0H@6A0AS89@i ϖ1i i i -L@j4P 6A0AS 4@ p-PL0` +0 .700S 0@kBP 0?P k6P e0tpB $J0  B <J -LM ΓP (KoIv. 4@P //0PSʡ0@0S/0S P   0@0S/0Sʰ?s ?s 2B ?$ 䯊쏊,I` 0B ?<o#I M 1PpOF0 pu17 ggjd j @eL1`/VN>0@,1,!9!$1$!1 0@!0 hjNDk0"20/2 gE  X0i- 0 D0C@&-<0D BD0(K(Kou| (Kouh(Kou,:|776:H8X8B 76667l 7(P:t:x: -LM0S  0 Ƞ8,Ƞ#8 巈P 829D p-H0PS0`0LS4 U @T@T 0 R000S PH@ppp000SHPp -@0L<@0D0 -L0` 4#APp0Q 7,7777x7 7 P2\@P 00@PPPe PP 0 $iP00P 00 0$0S000 0$S0C40+ 0$0S0000S0C40P  0$0S000 @P pi 00 0C 0  00  00  @ 0$0S0000S0C40蔡g p-LM0@`R@ PP0 $RL  Rb R 40Sf 00 K]p2RGH0S0\B@@ @ 0 4 R 0S0C40  0 @T@@ @0@8 0 (@a@<8 N0@@1<UKpHP 0  $("( RL 0CR K$ t0P 8t0R1 R@@ 0 4 R # 0S0##40 0R 0RwHP 0  $("( 0$0j~,@@ nL@ c$7܊: c c 0-00@L@P0S R000H0 0  0h p-L`PD@T R000H0 0  }PL0S  0D  .<bP@ <@8 e` b0 @K0Pb 0 P KP4$7 0-@=tP@0PL=]Q tP0 0-LM@P T0қ LDT0DD  LPtPmK0'@87: - Lm 蠋: -@L= @0!=h p-`0 0@0@LP,m016@D*ph@P 0l(l͠PHX0   @P/Pk0OPK0` ` `02<k0 =!0 1!x@ x`\b_:>TЋ:܋:D:Lc47::0:L:l:::17:*g،:0737407 -LP`pt@PMA 2t@V > 0@1A1S \?hB? 0@1 A 0-)@-P1L`QAp#('&%$"Yxh97 -)LP #p3 - 00 LR s  0 p-,P0@ UL`80<@@D  0PU T0 P pp 0-,@LTP T0 0@T0 p-,P0@ UL`80<@@D  T0 0PUp 0-,@LTP T0 0@T0 -LMQ@ 0?.C""0j j:: -PPppL*(0 ,P `U 80S T V0@T404040@ETW H0 ST404040@ESk : -LM0p00Pc(0|   0, (0QU< , `R0 R 80Q`<0XD< , R H P00P0S  \00 S< H<8  H(  4 @Kx x0, @P 0 HP ,000S, 0040,0,40H`00 0@004@(K j;7:7H: -LT00S 0 3@Ń 0S 0 S ?>#R 0-\0L @" 8X0 $HX0P $8H\0Q;+S  ; S0  ;0R 0 S00 -L`pBVL@P B/0㉸P0T |0T d0T \0T ULW@ UAU!U\00\0p=LXz> -\0L@p= -LM\0Xj `0 Y I 9 ) d0   ~   ``0 L 0L\` 0 ?L 0LB_` 0>L pR0Ll0 >`0L 8R0L`0 >`0L R0Ll0 >`0L Q0L`0 >`0L0a\p 0 @>\0 @0l \0@8` L0L^l 0>\L QL0 `l \ 0 >d0 n \L PL0 ll \ 0 }>d0 \ \0 @0l \0@8` L0L^`0 c>d0 D   -XL80 $p@@P`]=k0Sx0 k@ S x|  0@0 ,@P`@00@@@@P`|0S -X` @0PRL$p @$P@ 0T8 02@.hs D0R 80R P00 <0R 0-(0LP0 \0@08\0 X0$HT0X 0hA p-\0@L$!;98 XL}PdU 8 X0$H` PL P0  \0  p8;X$Lp 0-\ LP@$ d0   @08#  P=8#0X$8 LX$8 <LTD\04R 0` <C308#(  ;8#(d0 ;8#(0X$8 L\0@ d0X*, <8#(0$8 LX$8 <L0 \000 \ 0H0@}T 8 X0$H @ @000p@\0 j:}<0;p:F7 0-LXP$ 6& 0S 08 $HX0@8$ H@l h0R 0l Sh0 T0h@Ap0 -LMX0p0 ,  7 0  @P`@0 0 PA W gXk)00K0@0Y08$ L0X$8 L\0@(K80X$ L$8H  \0  (Ko29x: -LMX0@80<@@Dp8X0 $0 HX0@8$ H,   80P`8P<`X0$8 H   @0P`8P<`@D(K  0I@@D  ,  0@@@D00@0D@8 X0$HX0P8$ H\0@@ ` : 0L@@D,0@ 070@ST  8@0 @@0D@d0  8 X0$HX08$ H `'  % 0L@@D  0L@@D @D 0L@@D    0L@@D@ 0L@@D  0L@@D0@@@D -X 0@80<@@D p8X0L $HX0@8$ H  80P`8P<`X0$8 H   @0P `8P<`@D   0I@ @D    0@@ @D 0@0D@X0$8 H8X0$ H@' 0@@ @D 0L @D 8 X0$H8@X0$ H  0L@ @D 0@@ @D   0L@ @D  0L@ @D @ 0L@ @D  0L@ @D 0-@L8X0 $H8PX0 $H<#38X$ L0 -(0Lp % 0HShT7T7U7\T7P0S7$0& 8X0 $HV>0$X8 L^/DL`0P&P * DL`0P&P 8 X0$H8;X$ LDL`0P&P P0SP0S0p -L aP p39 -pLP`T  [d00L0P@l0TX`800 \0l X$8 H0 `hp39:d39 -LMX 0@@D 80<@p8X0 $, H0 8 X0$HX08$ H  80P`8P<`8X0$ H   @0P `8P<`@D (K  0I@ @D   0 0  & 0@@ @D  0L @D ,0@0D@0@@ @D 0L @D 0@@ @D -(0Lp  0HS X70Y7Y7X7P0S($0&9 DL`0P&P * DL`0P&P 8 X0$H8;X$ LDL`0P&P P0SP0S p -L <P 39 -pLP`/  x6c00L0P@d 0T X`800\0X$8 H0 `h39:39 -X0@ 80<@@D p8X0L $HX0@8$ H  80P`8P<`X0$8 H  0@@P`p 8< @pD  )@0P`@PD`    @0P`@PD`0@0D@8 X0$H8@X0$ H@P`]7[7[7[7<]7[7[7[7[7[7[7[7]7[7[7[7\7[7[7[7\7,@0P`@PD`,@0P`@PD`,@0P`@PD`,@0P`@PD`,@0P`@PD` -@La8X$ 0L -(0Lp  0HS P^7^7^7D^7P0S($0&0.DL`0P&P * DL`0P&P 8 X0$H8;X$ LDL`0P&P P0SP0Sp -L P 39 -pLP`  xa00L0P@d 0T X`800\0X$8 H0 `hW39:39 -X 0@80<@@D p8X0L $HX0@8$ H  80P`8P<`X0$8 H   @0P `8P<`@D   0I@ @D    0@@ @D 0@0D@8X0$ H "  0@@ @D  0L @D 0@@ @D 0L @D 0@@ @D -(0Lp  0HS b7(c7c7b7P0S($0&DL`0P&P * DL`0P&P 8 X0$H8;X$ LDL`0P&P P0SP0Sp -L P 39 -pLP`  x`00L0P@d 0T X`800\0X$8 H0 `h.39:39 -X 0@80<@@D p8X0L $HX0@8$ H  80P`8P<`X0$8 H   @0P `8P<`@D   0I@ @D    0@@ @D 0@0D@8X0$ H0@@ @D  0L @D   0@@ @D 0L @D 0@@ @D -(0Lp  0HS g7g7,h7g7P0S($0&eDL`0P&P * DL`0P&P 8 X0$H8;X$ LDL`0P&P P0SP0Sfp -L P <49 -pLP`  x_00L0P@d 0T X`800\0X$8 H0 `h<49:049 -X0\`@80<@@PD`p8X0L $HX08$ H   80P`8P<`  0I@P` P`@PD` 0@P`@PD` @P` \0 0@P`@PD` 0LP`@PD`P`U!   7 0@P`@PD`0@P` @PD` L0P`P`@PD`P`UV8 X0$H8@X0$ H   @0P`@PD`0@P`@PD` -(0Lp' 0BSl7l70m7l7P0S9$0& 0S 8X0 $HX98$ L S$DL`0P&P * DL`0P&P 8 X0$H8;X$ LDL`0P&P P0SP0S%p 0- @L8X0$HX98$ LP}U pX0$8 H P8 X0$H@ R\ &RZ \0`0B%S&n7n7n7n7n7n7n7n7n7n7n7n7n7n7n7n7n7n7n7n7n7n7n7n7n7n7n7n7n7n7n7n7n7n7n7n7o7n7 &R& 0X$8 L8 X0$HXp08$ L@0&S 8X0 $H:89X$ L0 < X0$8 HPX$8 0LT -L P l49 -`LpP  ]00L0P@1T08 0XP?>C2@0 0 \ $ L@0 SA S T0X$8 H0 ` X0$8 Hdh\0  8X0 $HX@8$0 L8X0 $H=8$X= L0X$8 L\0 X0$8 H0 S@09X$8 L@0l49:`49 -@L:8X$ 1<L -(0Lp0 DL`0P&\ P0S t]X X X $0& p}8: -P`Lp\00L0P@0T80XP00\04 000 Xh\ X0$8H  `hc`:\59: - 0LT@SP0 3@50  S R ? 谐:Z -L M$ X 0@0, 80<@@Dp8X0 $4 HX0@8$ H0   80P`8P<`X0$8 H   @0P`8P<`@D(K  0I@@D  0  0@@@D40@0D@8 X0$HX0@8$ H    2 0L@@D0L@@DD,qRP ,0lRP!8X0$X H! 0@@@D0L@D 0L@@D8X0$ H 0@@@D@ 0L@@Dr  0L@@Dg꼐:9 -(0L $`PL0@%S P0S \Z Z Z  R$0& 0@ X08$H $0&S X0$@L`8P0 0X$8 LT: 0- 0@ LhP\P 00 3@5 ? 0QP  QP00t599: -LP`p7P"  <[00L0P@t 0T Xp8000\0X$8 H0 `h[t59:h59: -X 0@@D 80<@pX0L $8H   80P`8P<`X0$8 H   @0P `8P<`@D   0I@ @D  0@0D@8 X0$H8@X0$ H 0@@ @D  0@@ @D   0L @D 0@@ @D 0L @D p-@L8P$`X0 L@H0 p -(0Lp  0HS }7}7\~7}7P0S($0&TRDL`0P&P * DL`0P&P 8 X0$H8;X$ LDL`0P&P P0SP0Sp -L  P 59 -0L `3 LPPp* 0P?> S0T0  Y00L0P@ Xp8 T0\X$8 H0 `hn?( T 0 3L5959:59 -(0Lp  0HS ꔀ7Ȁ7077P0S($0&S$DL`0P&P * DL`0P&P 8 X0$H8;X$ LDL`0P&P P0SP0S%p -L VP 59 -pLP`I  xPY00L0P@d 0T X`800\0X$8 H0 `h59:59 -X 0@@D 80<@pL8X0 $HX$8 H  80P`8P<`8X0$ H   @0P `8P<`@D   0I@ @D     % 0@@ @D   0L @D 0@0D@0@@ @D 0L @D 0@@ @D -@L$8X 0L8X$ 1<L -(0Lp  0HS 87l7ԅ7,7P0S($0&vt*DL`0P&P * DL`0P&P 8 X0$H8;X$ LDL`0P&P P0SP0Sp -L -P 69 -pLP`  x'X00L0P@d 0T X`800\0X$8 H0 `h69:69 -X 0@80<@@D p8X0L $HX0@8$ H  80P`8P<`X0$8 H   @0P `8P<`@D   0I@ @D    0@@ @D 0@0D@8X0$ H0@@ @D @ 0L @D 0@@ @D 0L @D -(0Lp  0HS ꨉ7܉7D77P0S($0&ZXDL`0P&P * DL`0P&P 8 X0$H8;X$ LDL`0P&P P0SP0Sp -L P L69 -pLP`  x W00L0P@d 0T X`800\0X$8 H0 `hL69:@69 -X 0@80<@@D p8X0L $HX0@8$ H  80P`8P<`X0$8 H   @0P `8P<`@D   0I@ @D    0@@ @D 0@0D@8X0$ H 0@@ @D   0L @D 0@@ @D 0L @D -(0Lp  0HS 7L77 7P0S($0&><DL`0P&P * DL`0P&P 8 X0$H8;X$ LDL`0P&P P0SP0Sp -L P 69 -pLP`  |U00L0P@h 0T X`8000\0X$8 H0 `hd69:|69 -(0Lp  0HS ꔐ7Ȑ7077P0S($0&S$DL`0P&P * DL`0P&P 8 X0$H8;X$ LDL`0P&P P0SP0S%p - 0pPL`^U 0?.C""VU00L0P@ 0T X`8000\0X$8 H0 ` `0 d0  h4h/UX0$8 Hd0:`:69|: -@L@0S 8X0 $H08X$8#8 L8X0 $H 08X$8#8 L8X0 $H08X$8#8 L8X0 $H$0 08X$ L -LMX0@|80<@@pD8X0 $0 HX0@8$ H,   80P`8P<`X0$8 H   @0Pp`8P<`@pD(K  0I@p@pD  ,  0@@p@pD00@0D@X0$8 H0@@pp@pD0Lp@pD0@@pp@pD fL0P`p@pD -(0Lp  0HS ꀖ777t7P0S($0&$"DL`0P&P * DL`0P&P 8 X0$H8;X$ LDL`0P&P P0SP0Sp -L P 69 -pLP`  S ?.B"@ 00L0P@ T8 X`0 \0l X$8 H0 `hE69:69 -X0@ 80<@@D p8X0L $HX0@8$ H  80P`8P<`X0$8 H  0@@P`p 8< @pD  )@0P`@PD` 0@0D@  @0P`@PD`X0$8 H8X0$ H ) 0 >  ,@0P`@PD`8 X0$H8@X0$ H    ,@0P`@PD`,@0P`@PD`,@0P`@PD`@ ,@0P`@PD` -0BLp S(7x777DL`0P&P 3P0S0$0&{NDL`0P&P P0SDL`0P&P P0Skp8X0$ H8;X$ L -L P 079 -pLP`  |R00L0P@h 0T X`8000\0X$8 H0 `h079:$79 -LMX 0@80<@@D p8X0 $, H8@ X0$HX08$ H  80P`8P<`8X0$ H   @0P `8P<`@D   0I@ @D     & 0@@ @D   0L @D , 0@0D@0@@ @D 0L @D 0@@ @D -0BLp Sꐠ77T7H7DL`0P&P 3P0S0$0&a4DL`0P&P P0SDL`0P&P P0SQp8X0$ H8;X$ L -L sP 79 -LMPe  lQ00L0P@0T80X0 \0l  X$8H0\  ``0 mL \P0L`p 0p 'L ,PLl 0p'79:x79 -LMX0@80<@@Dp8X0 $0 H8 8 X0$H4 X0$8 H,   80P`8P<`X0$8 H *  0I@@D , 48 0 - ,0 SK S0 S0@@@D,E0L@D  @0P`8P<`@D(K0 0@0D@0@@@D @0@D X0$8H  8@@@D0@@@DL0P`@D@ -(0Lp  0HS ȥ77d77P0S($0&RPDL`0P&P * DL`0P&P 8 X0$H8;X$ LDL`0P&P P0SP0Sp -L  P 79 -`LpP  P00L0P@0TXP800 \0l X$8 H0 `X0 $8H 0 `;``@0:` d0  h`X0$8 Hd79:79 -LMX0 Sp, > 0@80<@@D !8X0$HX0@8$!H  80P`8P<`0S  8P`0@0X!X1X0P!OX0$8 H  , 0@0D@ ! rO8 X0$H8@X0$ H   0@@ @D  0L @D 0@@ @D 0L @D 0@@ @D 8c7l:b9t:79\: -2LM, Qp@'(0" , 0BSh7Ԫ77X7D`L0P&P $P0S!$0&,@!@No$P L0@ %S  D`L0P&P P0SP0S$0& 0 @P8 X0$HX0@8$d H@hPh0l 0Sh0T0h@p8c 89\:7 -Lp`PN0 R'00L0P@0T80X`0 0l \04 000 phN X0$8H  `h lNꈔ:8c79:89\: -0 3B5L  ,0DP ? \: -@0LSp D0S8X$ 0L$8X :LX$84 L$@8PX0 L`H; 8X0 $H:8$X#: L$8X 0L$8X 0L$8X 3LX$8: L$@8PX0 L`H; $@8PX0 L`H; 8X0 $H:#:$8X: L$8X 3L$8X 2L$8X =LX$8w0 L8X0 $H:#:$8X : L$8X `2L$8X H2L$8X 02LX$8< L8X0 $H:#:$8X : L$8X 1L$8X 1L$8X =LX$80 L8X0 $H:#:$8X: L$8X 1L$8X 0L$8X 0LX$8< L$@8PX0 L`H; $P8@X0 L`H; $8X 0L(h"e A` -L@h 0-@0LSP D0S@X0T 8 X0$H@ 0$X8 ;L: -@LT0` \0,B# 0<8X $L8X <$L8$  \0N(K$P L0@%S < DL`0P&\ R 8 X0H8;X$ LDL`0P&P P0S D0R 80RF 0 R00 P0S$0& 0@@ APX0$8l Hh0l 0Sh00h0oP0S$0& T08 X0$H@P 0Pv< 0ST877777777777777777:,0 0LA0S@ T> 0@S S+ 08$X L, $<8X L0X$8 L#T  `, @ , X0$8 H ~ h@T P`0@0 0@S , 堀,, T  9 -L P 889 -pLP`  J00L0P@0T08 0$?>C2@0 X` D 0 0l \0 BH0 ` `0 d0  T0X0$8 Hd889:,89 -L P 00 0Q400P 0- PL004@@0 p-LLMD0`SP Q S 0R d@KL>0+8H0 0( 4KPDPKpDPd@KL>04KHP (P DP -@L004400 p-LLMdPK@`L>8004KX0(0 0+8H0 0( 4K P80D0#80Kp0 p-LLMdPK`@L>L0L 0SD0# (0 0H 4KoPD0[#SKp#0 0-LLM`@KPLd> 0$0 04KTK0 p-LLMdPK@`LQ>D 0H0 70R4K08H0 ;(0 :PD0  1Kp p-LLMP@`x80-@Kp(@P d@KL>0H0 +0( 4K@ 0-X0 SL@T \P0  X0S0Д: -h0L@\K8L P00Q00S 0$ $ hh1;@B@Ocؔ:l7 0-L@LTP+  @T 80 0P80  P \H @TLP P 00H800:: -80L@L0S #80 q L0SH: = -@L s  @ !! p-@00L4004PP H`p004PP hH`Q`PP80 400,PP80,:H:a 0-80L P  080ZLP @T0L H0P L0@008080 0-P@LL80 080P 0H0hRP p#HP 80 0800h,H8080`:x:=9 0-L00P4 P 80 080 0@80s80 0800h"08080 0- PLU@  0R0 0000`0 0 0h0 p-PL@00`  `0`@0`\0 P3phl0Sd -L`T0PS\p P\@T0  ;T0S 80T0s80 080T @T0s @X@댕: -@L$X 0P hSG7: Q0-L@ Q 0h~!}!80P0T00u!P\0 0-PL@2G000 L4 080 < 0\ 0` d0d Pd0| L\lph@@y80080 0h>`9777 -0LJ=p3 80R00  ( ,100 !0 $1(!(!xF:::: p- 0LPFF`1>@0S@ VF0`S@F!1|Ft F Q \FHphFLF10 ` FV$F괕:dN:_:`9tN:N:|O:XM:̕: p-0LS`  p  P @ p -L MpFB;0S (KD2*@R` (gFYQ_FP`P@m PP PPf T1 !T TPYTP,P ,@P0 U 00f  P0 @ P!0P ZP, 0B P`Y FP`P`P@PD@P@{PD`@LEP`q 0 E ho:8:X:x:: p-`L @PT   @PT400 ph00 R0S| -LLMQp0@0Π; ; lK$PL `c:;00 50P@800808400 0 4P P 83B8 DP8 'B:: -LLM`@pPP $KpKL6<180 @p P`@\ 0 00aP0cS0c^T@4pD1X@\ 0 00aP0cS0c^t@PLqP@\ 0 00aP0cS0c^T@pMQH@\ 0 00aP0cS0c^t@PNq@@\ 0 00aP0cS0c^T@pOQ8@\ 0 00aP0cS0c^t@PPq0@\ 0 00aP0cS0c^T@pQQ(@\ 0 00aP0cS0c^t@0PRqS1 @\ 0 00aP0cS0c^T@0PT1@\ 0 00aP0cS0c^T@4X1 P @\ 0 00aP0cS0c^T@0\1Pp@\ 0 00aP0cS0c^T@0PD1`@\ 0 00aP0cS0c^T@8#8PH1X@\ 0 00aP0cS0c^T@pLQP@\ 0 00aP0cS0c^t@PMqH@\ 0 00aP0cS0c^T@pNQ@@\ 0 00aP0cS0c^t@POq8@\ 0 00aP0cS0c^T@pPQ@0\ 0 00aP0cS0c^t@0PQqR1 @\ 0 00aP0cS0c^T@XQܗ: -80L0P`v@ Pv@\ 0 00aP0cS0c^T@ RP0!6 @\ 0 00aP0cS0c^T@zP'z'@\ 0 00aP0cS0c^T@0 0#P8!H@\ 0 00aP0cS0c^T@@@AP004DT@0Q</8!81\ 0 00aP0cS0c^T@ 0BS0!tPr@\ 0 00aP0cS0c^T@0P416 @\ 0 00aP0cS0c^T@zP'z'@\ 0 00aP0cS0c^T@0 0#P8!H@\ 0 00aP0cS0c^T@gR ;400@ev;0P00(@\ 0 00aP0cS0c^T@4505 81@2:$: -LLM`plKL0100 05K<P& P$80KL RH @ 08R#HuP@ LK/4P6H0pSHP P0 dWPP L@T#000 @T L/ 05K0,8P0 0 P LKcP ]P @T K@:+0P:-40 ^ 1 <18 R80 0-P@LT0$0 0(00hҎ 0-@L㲹0l 0RP0 d0h -PL @40p`嘹0  04  ~P0(0iͺ04  -p`TL P x0@d0h`l@p@k|@ | 0`00娺0 m dm(7x7 -L;HFS0eC=Gry=iG}<;~G݊<<РD3h&ǂLǠ6 %?aextent_freepool_p_freepr_find_pageheadpool_do_getpool_init@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~!#$%&'()-0123456789@ABCDEFGHIJKLMNOPQRSTUVWXYZ^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{}~Ͼ󨷵ǎԐѥ噞᷵ǎԐѥ???????????????????????????????? !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????U'|''h}'%'}'%(}'|'N'%|'$($(#(#($(0$(08n; &C vkkMPG&"֊/aK+d 5ӆ1 q^h,`@yFgKrޔԘJk*OņךUfϊDx%K]?!HpcwucB0 mL5&/ᾢ5̈9.WUGz+2ўfD~T; ʌ)k<(yv;VdNtے lH]nCĨ917Ӌ2CYnڌdҜI%ϯʎGooJr\$8WsQ#|!>ݖa B|qؐ_jiX':'8+3"p3-"< IxPzY e1ƄÂ)wZ{m:,PPPPPPPP49@9L9X9h9t99999999ċ9̋9܋999999 9999 9ieee80211_newstateT:$9@:3(90 @9G(,99$09!4908890d<940@9`D9RDH9ULL9pP9TT9|X9 95Xv9X\9R`9d9h97l96`:7Px97p9 t99\972x9p97|9697xB996 m90,9@9X9!T996\95hb9tԔ:7x_9dw9p9l49R`97|979A9H9C9J9K99Č9@Ȍ9Ǐ9Ќ9EԌ9E،9܌9995z997V:79$n:9[:0'99!99.997B97* 9"Xq'Of ɴ:}Jc1`3QESbwdk+XhHpElޔ{R#sKrW*Uf(µ/{ņ7(0#j\+ϊyiNeվb4ъĝS.4U2u9 `@q^Qn!>=ݖ>FMT]qoP`$C@wgB谈8[yG |B| H+2pNrZlV8ծ='9-6d !\hT[:.6$g WҖO aiKwZ *C"< Nj򹨶-ȩWLuݙ`&r\;fD4~[v)C#hc1cB@" Ƅ}$J=2m)K/0R wl+pH"dGČ?,}V3"NI8ʌ6 Ԙρ(z&ڤ?:, xP_jbF~Tؐ^9.Â]|i-o%;ȧ}nc{; x&Yn쨚Oen~ϼ!ٛ6oJ |)11#?*0f57NtʂАا3JAP/MvMCTMўjL,QeF^]5st.A ZgRے3VGmaךz 7Y<'5ah,4$8_@r %⼋I<(A q9޳ ؐVda{p2t\lHBWЧQPeA~S^':k;EXK0 Umvv̈L%O*D5&bZI%gE]u/LFk_眒zmYRڃ-!tXiI)ɎDujyx>Xkq'Oᾶ f:}Jc13Q`SbEwdk+hHpXElޔ{Rs#KrWUf*(µ/{ņ7ӥ(0#j\ϊ+yiNe;b4ĊS.4U2u 9`@q^nQ!>ݖ=>ݮMFT]qoP`$֗C@̞gwB谽[8y |GB| +2HprZlN8Vծ=9-6' d\h!T[.6$:g WґO aKwZi *"4$8,@_r% I<( A9q ؜Vd{a2p\lHtWBQPA~Seä':^;kEXK0 Uvm̈v%LO*5&DbIZ%gE]/uLFk_mzRY-tX!I)iɎDujxyXk>'qᾶO f}:cJ1Q`3SbEdwk+HpXhEޔl{Rs#KrWUf*(/ņ{7ӥ(0#j\ϊ+yiNeվ4bĊ.4SU2u 9`@q^nQ!>ݖ=>ݮMFTq]oP`$֗@Cgw谽B8[y|G B| +2HpZlNrV8=-6'9 d\h![T6$:. gWҖOa wZiK *"$8,4_@r %<(I A9q ޳؜Vd{a2plHt\BWQP~SeAä:^';kEXK U0mvv%LO*&D5bIZ%gE]u/LFk_zmYR-X!tI)iDujxyk>X'qOf }:cJ1`3QbESwdk+pXhHElR{#srKWf*U(/µ{ӥ70(#j\+ϧyNieվb4Ċ4S.U2ኤu 9@`^qQn>!=ݮ>MF摵Tq]o`P$֗齉C@gwٰB8[yȡG ||B 2H+plNrZV8=ծ6'9- dh!\T[$:.6 g WҖOa ZiKw *h8,4$_@r %(IKy xZݨ31Y'_`QJ -zɜ;M*q//^SShѹ,` @ȱy[[jjFˍپgK99rJJLLXXJυkл*媪OCCMMU33fEEPPD<KKܽa ppB>>|ĵqffHHaa_55jWWйiX':'8볘+3"iip٩3-"< I·UUx((PzߥY  ڿe1BBhhAA)w--Z˰{TTֻm:,ccƥ||ww{{ kkֽooޱőT00`PggΩ++V}׵bMvvʏEɉ@}}YYGG AԳg_Eꜜ#Srr[u=&&Lj66lZ??~ÃO44h\Q4qqثs11bS*? ǕR##FeÝ^0(7 / $6=&''Niuu ,,Xt4.6-nnܲZZ[RR;;vMַa}))R{>//^qSSѹh, @`y[[jjԾˍFg99rKJJLLXXυJлk*OCCMM33fUEEPP<!KKݽa܋ pp>>|Bqff̪HHaa£55j_WWiІX:''8+"3iiһ٩p3-<" ·IUU((PxߥzY e1BBhhиAAÙ)--Zw{TTm,:cƥc||ww{{ kֽkoޱoőT0`P0gΩg+V}+׵b׫MvvʏEʂɉ@}}YYGG AԳgԢ_Eꯜ#Srr[u·=&Lj&6lZ6?~A?̃O4h\4Q4qqثs1bS1*? ǕR#Fe#Ý^0(7 / $6=&'Ni'Ͳuu  ,Xt,4.6-nܲnZZ[RR;vM;ַaֳ}γ)R{)>/^q/SSѹh, @` yȱ[[jԾjˍF˾gپ9rK9JJLLXXυJлk*OCCMM3fU3EEPP!KKaܽ pp>|B>qĵf̪fHHa£a5j_5WWiйX:''8+"3iһi٩pَ3-<" ·IUU(Px(ߥzߌY  eڿ1BBhиhAA)-Zw-{˰TTmֻ,:ƥcc||ww{{ ֽkkޱooT`P00ΩggV}++bM櫫vvE@}}YYGG A쭭g_E꯯#Srr[u·=Lj&&lZ66~A??Oh\44Q4qqsbS11*? RFe##^0(7 / $6=&Ni''Ͳuu Xt,,4.6-ܲnnZZ[RRvM;;a}γR{))>^q//SSh,@` yȱ[[ԾjjFgپrK99JJLLXXJϻk*O媪CCMMfU33EEPPxD<<%K㨨QQ]@@?!pH88c߼wuBc!! 0mҁL &5/__5DD.9WU~~zG==Ȭdd]]2+ss``OODf""T~**; FF)kӸ(<y޼^^ v;dV22tN:: II Hl$$\\]½nCשּׁĦbb917yy2CnY77ڷmmd՜NNI੩شllVV%ʯeezzG鮮oպxxJo%%\r..8$WsǴQ#|tt>!KKaܽ pp|B>>qĵ̪ffHH£aaj_55WWiйX:''8+"3һiip3-<" IΪUUPx((zY  eڿ1BBиhhAA)Zw--{˰TTmֻ,: @6؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHG"(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDlɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~[/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxqg jgrn<:ORQhك[ 1Ѭߘr/Ḗ~&jE|,G$l iciNWqX~=t XrX͋qJT{YZ90`*#`(yA8۸y:`l>w'K1/x`\`U%U攫UbHW@cj9U*4\̴ATr|*oc]ũ+1t>\3֯\$lS2zw(H;Kkē!(f a!`|H2]]]u#&܈e>#Ŭom9BD . Ji^Bh!la gӫҠQjh/T(3Ql n;zP;*~ev9>YfCoEå}^;uos D@jVbNw?6r=B$7H ۛIrS{y%P;LylO`@ž\^c$johSl>9oR;Qm,0DE ^J3(fK.WtE9_ ӹyU 2`yr,@%g̣饎"2u<kaP/R=2`#H{1S>W\o.ViB~(2gsUO'[iXʻ]=!lJ[-ySeEIҐK3~ˤAb Lw6~д+MەqՓkю%ǯ/[{AI~-%^q h"W6d$ cUYCxSZ٢[} Źv&ϕbhAJsN-GJ{RQ)S?Wƛv`+t恵oWk *!ec.4dV]-SGjnpzKD). u#&İn}ߧI`fqilRdVឱ¥6)L u@Y>:䚘T?eB[k?ҡ08-M]% L&pc^?kh >\D}W7: P tAu8/;21>8TNmO Bo ,y|$ryVw.?rU$qk.P̈́GXzt}K:zfC cdG27;C$CMQe*P:qUN1w_V5kǣ;< $Y,n<pEㆱo ^*>Zw=Ne)։>%fRxL.jxS<- N=+6&9`y#RnfE{7(2åZl!Xeh;/ۭ}*/n[(!pa)uGa0a4c\s9pL ު˼,b`\ndi#PZe2Zh@*<1! T_~}=b7w-_h)5ǡޖXxWcr"ÃF T0.SHُ(1mX4a(s<|J]d]B> EꫪOlOBBǵj;Oe!AyMjGKPb=bF&[$ti GV[ Htb#*BXU >ap?#r3A~_;"lY7|`t˧@n2w΄PU5ai Z .zD4Egɞs͈Uy_g@Cge48>q(= m!>J=+hZ=@&L4)i Av.khq$j 3ԷCaP.9FE$tO!@MpE/f m1'A9UG%ښ ʫ%xP()Sچ, mbhiHפh'?Oz|Ϊ_7әxB*k@5 ٫9N;VmK1f&tn:2C[Ah xN جV@E'H::SU kKмgUXc)3VJ*%1?~^|1)p/'\,(H"m?H܆AyG@n]Q_2Տd5A4x{%`*`lc´2Of#k>3b $;" r(-Exb}doITH}'>AcG t.no:7`L knU{7,gm;e' )̒9 i{f} ϑ^و/$[Qy{;v.97yY̗&-1.Bh;+jLu.x7BjQ满PcKkؽ%=YBD n *Ngd_ڈ鿾dW{x`M``FѰ8Ew63kBqA_^;Z4ٷ,Q+:Ֆ}}>(-}|%rZLZq)GW;()f(.y_xU`uD^mm%adâW<'*:m?!cf&(3uU4V<wQ( gQ̫_QM08bX7 z{>d!Q2Ow~㶨F=)iSHd$m-if! FEdlX [@X̻k~jEY:D 5>ʹrdfGof,ҏ"W##v215VbuZ6ns҈bIPLVq z2E{Sb%ҽ5iq"|˶+v>S@`8G% 8vFšw``u N˅؍芰z~L\HjiԐ\-% ?2aN[wߏWr:j?$.Dsp"8 1).lN!(Ew8fTl 4)P|ɵՄ? Gy ~tn,fy3jXDD1Zs"*ˁc8:$zi HIĀ@8HުL H_%A@N$A UeQr% 9jyMc@hV 틕Z Vqק)N-fcqw*7 5Wa"ɠBր[t!h!hl iwW~@PճMװx QV$AV ʔUWnྵa$ XK'aU{whkldMDfd~i/IO70j5,s@IvM;B(HDLns) _ɋ}oaOw.+rץ<}+FYYEEهTNoHm| ǥcs_DVj͈prͳ]ny` E`1©\1BN"r\,rN@%/N2g@#x\n܃"ukMxnXO DH?{vw#Vu*F_( +8=6 JRft;QZylu eX&hJpFS(l\v0k)h76*g$ k%ֿh,DUueI40" WIbuU~bڨv^FESGml,gHL|3ەCh\SU2` ߝWc9^28aI37~^b<#NygCHKJf-ۄoH Ja)Yfc(` 0qt&@3/C~A^ l( ؒ0~of˜os*`ژ46K-%#= %IH6Jo8C@TzWOpA:Z„TU|5YŗZ:G:%Sj~=eI&TwQ[P]vlDȨ!帊iX`[ŗY)L;]J5ULkD$5鰽bעT/I18T(q)9H[/u@g+3-fVo*ɛ`( ')dMP˲,\26K_A !PNhذy\CPIMAC8wn\e0Rԋ@+>`xT7}02m-yyS"wuXȃoxkcZ\3]ùzv٣Byqj3ƚ`'PC=+mvN%ύHf6AN( aϩI=߹_d: }+p?PO+Zbbyj.H@,Z@"ғ-ES4n)olIIBr~V>olbfLTq*+9)XLVRf.S9v.i硦>iFt+LVvuOx39]O#2]2=&K/~~<O^?vf)o=E4ӷ+4grN=U"g`k8=ü0}8QcÐӝXyTGָaYwSW-XVcNx.F~eyUڑ0@5㶼P?!@=LXI6QpӱڍyKoqK 0ݻ맕d5w$,ϩ/ tцB*v:-7ޚ, )p@ :$7ѴyN] h1 HZ޻Bf1畏?r 3uQB}\cmd!@ WS1zݨ]3CoFq"8ԚέiGb[UgfN G[oLĎnrWxzdD]Ջ` l_9 ]c2֋~ pIPӻߘ)* mS~H~X.t;/RG'~[!<8zvOB9`55'{ɸ6g {pqT3^-ZId, =4pBwbO&Ҹ$d%FN`7>͕xE_{ ۫v"{.1ן%$r_m L=mPO%os#(ĴyI%4aĘnzn|l6AT޾'VAJJ{` ,8I%vK$%Gv XY f 0NndQ& #Phꃢ@0 /kz%?/?!M@`Iɟ'Կ@uИcnafŽ"o;h(Yy#P_w@CV/|-ҢɡHl4ma/T"2*kT:V"AӢ@f/9/Mҹ-?JDvR7,YQoz Zh{.T"5Y/mKdPIf-徐"3;䎴]4K@E?1.eUʱծ-mԢP @"8On ׿r[O/LVSTIiFXEŅc]ՊSW9j7=T*_}x:vbj Bz)^'rgP8ƌDŽZ*'JkѢ*V`C u\B&Ʉq-ls5&5 M{n0f&%HVV^c ϲc|E pPr(pH# yM;-AB G&LjMG\^ |Y#јr8S#/nqFnEV 9q +A|iCHy}B{BIZݿe\ [ ~iC?9zaz UQry吝5rNcZպ60ę _}֡{/6Y DYD̃Aѱ* ;{ B[A%zzӤ0XޘN?wiy{$[Ĭ%5P_aT1bcKU !h]Yfsc=4·~!+g\ab906;Wd/`:5F- 'zy㠌l0^7%oo;j tE'4:NiOM>dY58EfCr3c%N? (Υ'R¦սTUdpfM w&ۄgC!`X0TroSUGڿ]bVhkʃ;n-Ӧ\= wL3{9+^S_aodC x^c"&gI{ڷ"%-U^7rRyL H[k0 cq/޹ S E!5(T<)c)A|-nRPf4,0P1`sY&D\dwR3A+ٺ|o!PaH?ek«dv&4{^% ;MM1$~I,;jx`]sVz\/1Co0TyXR^/2zj0>՚1B°I #ڸ(0q_`ɣaM/Ǚ."płNؼ40y;'ƸaiH?;(ZC/v7ܱӧßn>ƼB7Q(heRwj-K'5.n\ )^XOX{iT̨g&H`K`8# ~8lI `s5GƱVL>#8d^BFzk Od^AE#\;]>rC|m~ll9`qpsv#E@]%=`GK6DήPQH<p}}d^(O= &g.yr?U+HԼ?^!@WNFRWs3NɷdŸW1O g_?@k{C=K۵cUȗn-J(JqoCCl< _P/~׿PZG.Q>pX.0_|r *,]I鎸P'WIoyR}}Yr@EEt]>uOiVA#. '`vteyvvwHNma}/ 4H<0(Ow Vܒ M"7)}V'|@|硴f^aÝ <є`AFv\;x,WGl"}NC~8<=Q8d{h'فI]j~vh]9K9 ;#Im<Eub'z\aBΒ~Brrp }ȡ[(Ob<51)BSjO[}m(Ki\j#MŌ?,-ҖXRg[HJI \EkӉ7`:SRqDIK @sg4|~q6UO/Т`?mPьGnU?墼38Wg} =3{r3O̫]ňv{{uWBdBc+ri/n+_mazgaq%9̸L!gуb>ܷν8\ =Dmn`I:T`H'W+8$ ږ%Eh;}E `P/(b4 ٠m+1+dZ0RXBA\1>26F3S75 {s{OJWdCQz(~c5_ yCdcdJ$_(͸O@C " 0 O7-{$MgQLq_-_d !S^>'_aB%rqK=;&o~~TLmDl߫I&Ǡ36~?Pa w8Pr.PwWFgOT3ɏ1 i5M\=fȦ[]oڑo/"F}F9mOCCN!и  ?X(>nH&p׋wt|% - y#;(8itb߷@!{7Ȋ@ YVvO@/{U MVi35'#WȯVeka^u˅nwU2?-ɿ[%;з$;mc fÀ(82 Tɪס2Zb,gTzuw11&o6F HjyZVLj~CRv/ t,t* M|k .TA5B=!&|,aRe1i%& !\1cr ^Iy p1 d>>̶Ոî 0rlqn/kءDVÈ9/ű1(x⤣2}o~X$Ū{s0a!-!)۳*)e\,0?Б\,ԩT _w:^VxV޾\!uQųåҶw#)Ei/z毲p[v F98/gsD)k)/Ifingӛ/~p%Q^$Slj>!DYܷ)eyCy9A+MWN )zkS< ~U3rŅ?~                               A@@@A@@A@@@@A@@@A@@@@@@AAA@@@@@@@@@@@@@A@@A@@A@@@A@A@@A@@A@@A@@@@A@A@@A@AA@AA@@AA@@@AAA@A@A@A@A@                              @@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@                                        0 0 0  0 0  0 0  0           0  0 0 0 0  0  0  0          $$  $ $ $$  $ $             $$  $ $ $$  $ $                  0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0                            ((  ((  ((  ((  ((  ((  ((  ((          """"   " " " " ((((((((    """" ( ( ( ("("("("(  ##%%&&))**,,//1122447788;;==>>@@CCEEFFIIJJLLOOQQRRTTWWXX[[]]^^aabbddgghhkkmmnnppssuuvvyyzz||66666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\Z H!x-ML.RN8D( `hz=Skc|j9{Б/Uڅ?AZX_f ؐ53eiEVmv° GJBnI[#Q")yq~ ruo7ӎbwO$26󦻬^lW%㽨:Y*Fexpand 32-byte kexpand 16-byte k?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@ ,\, ,d,H,$,0,8,,d,,,\, ext2fs_blkfreeext2fs_dirbadentrydq-\, h-d,H,e-@d-(_-P^-\-hw-\-\,-8-<--̤9`--ؤ9D-@-9uao_find_swhash_eltHc\$cHc4Oc4Oc4OcHcWivmmapbsy\nd6_storelladdrnd6_outputnd6_rtrequestnd6_lookupnd6_init0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-     A@!  @a`10  @`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O      A@!  @a`10  @`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O @@ !1Aa  0@` #+3;CScs,1(1(1 (1"1 "1"1 "1 "1 "1 99xF:(949D9P9d9t9xF:   L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c            (08@P`p   0@`  0@`_bus_dma_busaddr_to_paddrA<98AD98 AL98`AT98A`98`Ah98`At98`At98PT98A98 A98D98D9@8i98 i98 i98 $i9@80$i9@8 ,i9@80,i9@8 .i980.i98!i 98 !i98)i 98 )i98-i 98Ai98 -i98Ai$9@8Ai49@8AiD9@8`AT98`A`98PA p98pA 98A 98A 98/A 98?A 98A 98A 98/A 98?A 98OA (98A <98A L98/A `98?A t98OA 98A 98A 980A 980A 98pA 98pA 98A 98A 98,98949@9L9T9`9T9l9t999999999999999 99,9<9L9\9l9|999999999999999 999$99,949<9D99999999 999$99L9T999999\9d9l9 999$9|999999999999 999$99999 9 989L99999 999$9|9`99l9x99999999 999$9|999999999999 999$9|999999999999 999$9|9`9999l9999999 999$9|9`999l99999999 999$9999999999999 999$91(91<91P91d91x9919919 91 9D91X9x9199@````` ```99999,9<9L9\9h9x99999 :999 949\9t99999$99H9\9x999999(9H9\9t999 9D9p9999 09 `9 9 9 9P99999H9t999949p99999(9P99 9 9 9 9 9 9 9 (9 T9 t9 9 9 9 49 d9 9 9 9 9 9 49 `9 x9 9 9 9 9 9 H9 t9 9 9 9 9 $9 H9h999999 9L9999999@9\9t99 9 9 9 9 49P9|99999 9T9x999999 9L9x99999 9D9h9999949`9999 9 P9|999 9(9D9l999999,9L9h999999 :$: D: d: : : : : : D: t: : : : :!8:!\:!t:!:":$:$:$:$:$:$4:$P:$d:$:%:&:&>:&@>:&:&:& :&8:&T:&|:& :& :& :& :& 4:&X:&:&:&:&:'L9'$:'@:'h:':':':':(:(4:(X:(x:):):):):)(:)@:)l:):*:*:*:*:*:* :* :*< :*p :* :* :* :* :*  :*0 :*D :*| :* :* :+ :,L :,d :, :, :, :, :, :,, :,D :, d :, :, :, :- :. :/4 :/\ :/ :0 :0 :0 :0:0<:0d:0:0:0:0 :0 $:0@:0X:0t:0:1:1:1:2 :20:3L:4`:5t:5:5:5:5:6:78:8L:8h:8:8:9::::::::<::\:;:;:;:;:;<:;L:;X:;t:;:; :; :; :; :; :;@:;\:;t:;:;:;:;:;:;$:;D:;X:;h:;:=:>:>:>:>(:>H:?t:?:?:?:?:?:?,:?T:?p:? :? :? :? :? :?:? :?8:?H:?l:?:?:@:A:B:C:D8:DqP:Ep:F:G:G:G:G:G0:Gd:G:G:H:I:J:K(:K<:Kh:K|:K:K:K:K:L:N:P$:P8:PT:Qx:Q:R:S:S:S:S:SL:Sp:S:S:S:T:U:U:U0:UT:Ul:U:U:U:U:U :U D:U `:W:X:Y:Z:Z :Z$ :ZD :[d :[t :[ :[ :\ :\ :\ :]!:]0!:]\!:]!:]!:]!:]4":]h":]":]":]#:]<#:]l#:]#:]#:]$:]4$:] p$:]!$:]"$:]#%:]$P%:]%%:]&%:]'%:]((&:])\&:]*&:]+&:],&:]04':]1p':]2':]3':]4(:]5T(:]6(:]7(:]8(:]90):]:h):];):]<):]@*:]AH*:]B|*:]C*:]D*:]E+:]FH+:]G|+:]H+:]I+:]J,:]K4,:]L`,:]P,:]Q,:]R-:]S8-:]Tl-:]U-:]V-:]W.:]X4.:]Yd.:]Z.:][.:]\.:]`0/:]ah/:]b/:]c/:]d0:]e<0:]fp0:]g0:]h0:]i1:]j<1:]kp1:]l1:]1:^ 2:^$2:^H2:^p2:^2:^2:^2:^3:^,3:^ T3:^ |3:^A3:^B3:^C3:^E4:^G 4:`H4:aX4:ap4:a4:b4:c4:c4:d5:d$5:e85:fH5:fl5:f5:f5:g5:g6:g46:gL6:gp6:g6:g6:g6:g6:g 7:g ,7:g T7:ht7:i7:i7:i7:j7:k8:k8:k88:lT8:mp8:n8:o8:o8:o(9:od9:o9:o9:q::r0::rH::rp::r::r::r::r ;:r@;:sl;:s<:s,<:s;:s;:s;:s;:s;:s$<:sL<:tX<:th<:t<:t<:t<:t<:t=:t8=:t\=:t =:t =:t =:t =:t >:t4>:tX>:t>:t!>:t0>:t@>:ta>:tb,?:tcX?:td?:tn?:to?:tq@:ty(@:xB:B:B:B:B:xF:B:B:xF:B:B:B:B:C:xF:C:C:xF:$C:(C:xF:C:0C:xF:C:680~9o:k;lL|=>@ApD FPQSTXY] dK28<@333S44S4ABCDEFGHIJKLMNOPQRSTUVWXYZ㡱vt100444h4̱4<4@[\]^_`{|}~|^_`#@_^_`#_#^_`^_#@^_`~#@^_`~^_``#_#@[\]^_`{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^%% $ $ $ $ $%% %%<%%$%4%,%%d"e"`"  " %" #!#%# # # # ""*#d"`"e"+"4"""""<"C"!!a"""")"*"'"(""!!!!i:i:i:i:i:i:j: j:j:j:$j:,j:4j:@$@eaQ@X@W@@0@ w@Q2@U@4@F s%^^Hv5r5,q5Hv5r5,q5tH555555$5=9Rf9 9] 9 9 9IN 9 9J 9R 97(9 9 9 9 9K99@#999999 99H@9 N9 _9F99\@9 9 9 9E&9 9m9K9A89[9p909 99j99?9n9 ^9Jr99abcde f g h i jklmnopqrstuvwxyz1!2@ 3#!4$"5%#6^$7&%8*&9('0)( ) *!+ , --_.=+/[{0]}1\|2\|3;:4'"5`~6,<7.>8/?9:;<=>?@ABC D E FG HIJK,L.MN-OPQRS T/U*V-W+X Y1Z2[3\4]5^6_7`8a9b0c.eh i jklmnopqrstuvwx yz{|}~ mMqQ@zy2" 3#6&$7/{%8([&9)]'0=}-?\./0+*1#'2#'345 6,;7.:8-_d<>| .'`0+*~5^q,?azw&12~ "3#!'4{"(5[#-6|$7`%_8\&9^'0@-)].=+}/0$1*2*3m4%56;.7:/8!d<> bBeE hH iI jJkKlL|,?nN~aArR,sSzZyY2 "3!'4"(5{[#6$7%!8&9%!8'0-)}].-_/0$*2`@#3mM4%5@#7:/\8=+g= aAkK~xX}iIpP& eE ,; c d tsrqQ'?ljbB|oOuUv.:yY{!\"12< 3>!(4[")5]#@6$+7%-8&/9'*0, _-=^.%`/z0w123n4m5$#6gG7h8fd/ 2"@ 3#!4$#6&$7/{%8([&9)]'0=}-+?.|/01'*2'*3456,;7.:8-_d<>\ .'`|0^~2" 3"5%#6&$7/%8(&9)'0=-'?.^/{[0+*}]123@4#5\|6,;7.:8-_d<> 1!2" 3!4$"5%#6^$7&%8*&9('0)--_.=+1#~2#~4'@5``d\|2"#6&$7'%8(&9)'0--=.^~/@`0[{1]}2]}3;+4:*5\_\|-+?\0345d<>| .'`|0^~.\0345|d<>.\`0^~xje.> u i d c htnbrl'"poygk,<qf;:-[{.]}//?0=+3s4-_6w7v8z9: ;<=>?@ABCD E 1!|2"@ 3#!4$~#6&$7/%8(&9)'0=-'?./[0+*]1}2}34{5\6,;7.:8-_d<> q,?azw&1|2@ "3#!'4"(5#6^$7%!8&9{'0}-).-_/[0$*]1`2`3m4%56;.7:/8=+~d<>\ aAD$bB8cCA!dD2eEC# fF0 gG? hH@  iIH( jJ>kK;lL4mML,nNB"oOI)pP7qQ9rR:sSK+tT5uU3vV<wWF&xXG'yY=zZO/#6^6,$7&7./[{E%0]}J*3;:64'"M-6,<17.>N.8/?Q aAD$bB8cCA!dD2eEC# fF0 gG? hH@  iIH( jJ>kK;lL4mML,nNB"oOI)pP7qQ9rR:sSK+tT5uU3vV<wWF&xXG'yY=zZO/#6^6,$7&7.--_V.=+T/[{E%0]}J*1\|W2\|W3;:64'"M-5`~6,<17.>N.8/?Q eEzy1+|2"@ 3*#!4#6&$7/%8(&9)'0=-'?./[0!]1$}2$}34{5 6,;7.:8-_d<>\ -'?.^`~0!]/[34{2"@ 3##6&$7/{%8([&9)]'0=}-'?.<>/+*012345\|6,;7.:8-_d<> .+*/2\|4eE a`~}kj!1@-2_ /3#!;4$":5#,6^$.7&%=8*&[9(']0), -?+'.xX%//.{0wW}1qQ|2qQ|3sr4"5`~6   7fF 8\ qQ@1!2" 3##6&$7/%8(&9)'0=-'?\./0+*~1}]2}]34{[5|6,;7.:8-_d<> 1!2@ 3#!4$"5%#6.=+/0[{1]}2]}345'"8;:c.d\|/? 1IqQ@2' 3^#!4+$"5%#6&$7/{%8([&9)]'0=}-*?\.-_/0~1,;2,;3_^4i05"678.:d<>| /1,;`2,;`3_^'aAcCeElLBAnNDCoOsS[ZxXzyzZ|{ bB{cC& fF[ gG] iI jJnN}qQ\vV@wW|xX#zZyY>1'~2" 3+^!4!"5%#6/$7=`%8(&9)'-./QP01qp2qp3$4506,?;7.:8-_*d< bB{ fF[ gG]kKBlLAmMnN}qQ\vV@wW|zZyY1!~2" 3#^!4$"5%#6&$7/`%8(&9)'0=-'?.+*/a`01~}2~}3  456,;<7.:>8-_d<> mMoOpP1!2"@ 3/!4$"5%#6?$7&%8*&9('0)--_.=+/[0']1<>}2<>}3;:~4{5#|\6,'7..8d /^^[0]4``{8aAcC  eE gG#" iI+*kK76lL<;nNFEoOMLsSa`uUkjzZ~} cCmMrRsSxXzZ1!2" 3#!4$"5%#6&$7_%8({&9)}'0'-/?\.'/0*|1<>2<>3+45@6,;7.:8-=d][ .~/"^4'`eEqQ@2"#6&$7/{%8([&9)]'0=}-\.-_/0'?~1+*`2+*`3456,;7.:8d<>| 4^    ܓ555D5855 5(555dd55dd5(I*LBCDOMPJQNRK(I*LCDEOMPJQNRK5L55ܪ555О5X55(  2 v      W 1 Q `  D5@  0 2 A@ A   @  @ @   P0 P  A   h }  } } } @  85   5  L+ L t5L2 D   O  {85o  A f F  @@@ @ @AA@:F:FP 43W  !      @ @ @ @ A n@n n@n @nn@0Df @  * Q k k"k"k"k"k @^z BF 9 |t5H55 B  w *w +w +~ W UP  < 1b0 0rk {&"79n= wF@W wn a- t55H5  JK0 r56T6,6<"6)6$$0$0$$$$$$$$$$$$$$ $7676>6@ 'W W@ @EEE }WQ  k"BFFeeeZZ Z 04N6M6L62V{%1" `"'`~%ZP `,e6e6d60w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-66(6hF F hF fF 6đ6p60 6D66T666url_int_miibus_writeregurl_int_miibus_readreg@@9WP P Q@:5g hahh! !(3P@3vK #(-2>'()*+,-./@ABCF'()*+,-./@ABCF/@ABCDEFGHIJKN'()*+,-./@ABCFMNO`abcdefghik*++,,--../-@@A&''(())**++,,-   Pp < %dcould not requeue I/O%s: sr_wu_enqueue_ccb got active wu%s: sr_wu_init got active wu%s: invalid target on wu: %p%s: i/o error on block %lld target %d b_error %d unknown optional metadata type%02x%02x%02x%02x-%02x%02x-%02x%02x-%02x%02x-%02x%02x%02x%02x%02x%02x%s%s%s: %s: %s: invalid chunk state transition %d -> %d%s: sr_startwu_callbacksr_schedule_wu: work unit not in progress (state %i) sr_sync%s: invalid optional metadata checksumunknown old optional metadata type %u %s: no in memory copy of metadata %s: could not allocate metadata scratch area %s: could not write metadata to %s %s: save metadata failed OPENBSDSR %s%03dsr_shutdownsr_down%s: roaming device %s -> %s %s: sr_scsi_cmd NULL discipline %s: %s device is being deleted, failing io %s: wu %p not on pending queueunable to allocate work unitsunable to allocate ccbsvolume %s not found%s has unsupported sector size (%u)could not allocate memory for metadatacould not allocate memory for foreign metadata%s: sr_rw: failed to allocate vnode %s: I/O error %d on dev 0x%x at block %llu failed to get DUID for softraid volumeinsufficient boot storagefailed to write boot blockfailed to write boot loadercould not save metadata to %s%s: sr_meta_rw: invalid metadata pointer cannot clear foreign metadatanot enough memory for metadata buffercould not read native metadatanot part of the same volumenot all chunks are of the native metadata formatsrc_dev_mm == NODEV%s%d%cdiscipline does not support rebuildrebuild already in progressvolume not degradedno offline chunks available to rebuildno online chunks available for rebuild%s: sr_rebuild_init: can't allocate vnode %s partition not of type RAID (%d)%s: %s partition too small%s: %s partition too large%s partition too small, at least %lld bytes required%s partition too large, wasting %lld bytes%s is already in userebuild of %s started on %s%s: no offline chunk found on %s! %s: %s volume degraded, will attempt to rebuild on hotspare %s sr_hotspare%s: pending I/O failed to complete on failed chunk %s, hotspare rebuild aborted... %s is already a hotsparesr_hotspare: cannot allocate vnodeHOTSPAREcould not save metadata for %sunsupported state request %dchunk not part of arrayinvalid foreign metadatanot valid softraid metadatainvalid metadata checksumcannot read metadata version %u on %s, expected version %u or earliersr_meta_native_bootprobe: cannot allocate vnodenot enough memory for fake disciplinesr_meta_native_bootprobe: cannot allocate vnode for partitionnative bootprobe could not read native metadatasr_meta_probe: cannot allocate vnodesrdiscould not create discipline taskqcould not initialize disciplinechunk %s already in useinvalid metadata formatdisk %s is currently in use; cannot force createfailed to clear metadataone of the chunks has corrupt metadata; aborting assemblychunk sizes are not equal; up to %llu blocks wasted per chunkvolume level does not match metadata leveldisk %s already assembledtrying to bring up %s degraded%s was not shutdown properly%s is offline, will not be brought onlineno free target for %sscsi_probe_lun failedvolume %s is roaming, it used to be %s, updating metadata%s volume attached as %ssdwd%s: failed to allocate boot volume %s: failed to allocate device array %s: failed to allocate ondisk array %s: failed to allocate hotspare %s: found duplicate chunk %u for volume %u on device %s %s: not all chunks were provided; attempting to bring volume %d online sr_locksr_hs_lock%s: controller registration failed%s: bogus rebuild restart offset, starting from 0 %s: resuming rebuild on %s at %d%% %s: could not create read io %s: could not create write io sr_rebuild%s: could not save metadata to %s sr_yieldsoftraidsr_concat_rw%s: %s: too many ccbs queued %s requires two or more chunksCONCATsr_crypto_rwcannot open key disk %s%s has unsupported sector size (%d)%s is not a key diskCRYPTOKEYDISKunknown crypto algorithmunable to allocate CCBsincorrect key or passphrase%s requires exactly one chunksr_raid0_rwinvalid strip sizeRAID 0%s: retrying read on block %lld %s: sr_raid1_intr_cb%s: permanently failing write on block %lld sr_raid1_rw%s: is offline, cannot read invalid volume state%s: %s: invalid volume state transition %d -> %d %s: %s: %s: invalid chunk state transition %d -> %d RAID 1%s: permanently fail write on block %lld sr_raid5_rw%s: %s failed to get read work unit%s: is offline, can't read %s requires three or more chunksRAID 5sr_raid6_rw%s: can't get wu_rDisk %llx offline, regenerating Dx+P Disk %llx & %llx offline, regenerating Dx+Dy +Q singleDisk %llx offline, regenerating Dx%s old_state = %d, %d = %d, invalid new_state%s requires four or more chunksRAID 6RAM diskfictitiousrdattach: out of memoryrd%drdattach: device name too long%s: insufficient message buffers %s: %s /mnt/etc/firmware/%s%s: device enable failed : failed to clear NIC buffer at offset %x - check configuration , address %s dp8390_start: no header mbuf%s: NIC memory corrupt - invalid packet length %d RRIP without PX field? SPIEEE_1282IEEE_P1282RRIP_1991ARRIP with incorrect NM flags? RRIP with incorrect flags?isoinodefhtovp: lbn exceed volume space %d fhtovp: crosses block boundary %d fhtovp: bread error %d fhtovp: directory crosses block boundary %d[off=%d/len=%d] cd9660_vget: alien ino_t %lluCD001%/@%/C%/Ecd9660_mountroot: can't setup bdevvp'scd9660root_devicetag VT_ISOFS, isofs vnode cd9660_strategy: specOpenBSD#!/dev/fd/%d/dev/consolewarning: /dev/console does not exist warning: /dev/console error %d initexecinit: couldn't allocate argument spaceexec %s: error %d init: not found no initswapperfork initcfpendcannot mount rootcannot find root vnodepagedaemonfork pagedaemonreaperfork reapercleanerfork cleanerupdatefork updateaiodonedfork aiodonedzerothreadfork zerothreadscheduler/sbin/init/sbin/oinit/sbin/init.bakbqquiesbqqueuebqwaitbqdestbufq_init: type %i unknownbufq init failbqinitinitclocks: unable to register softclock intrfdlockfileplfdescpldup2: fdallockqreadkqueueplknoteplwaitinit died (signal %d, exit %d)thrdeathcpu_exit returnedprocprocessppwaitunable to allocate kthread_qWARNING: thread `%s' (%d) exits with status %d %d,malloc: allocation too large, type = %d, size = %lu malloc: out of space in kmem_mapmallocarray: overflow %zu * %zuphysiochgproccnt: procs < 0procinit: mallocprocplprocessplzombieplucredplpgrpplsessionplplimitpl%s/../%s(%d): syscall %d "%s" %s(%d): sysctl %d: %d %d %d %d %d %d sendmsg not allowed sendfd type %d %s recvmsg not allowed recvfd type %d %s ni_pledge/tmp//etc/localtime/var/run/ypbind.lock/dev/null/dev/tty/etc/spwd.db/etc/pwd.db/etc/group/etc/netid/etc/resolv.conf/etc/hosts/etc/services/var/yp/binding//usr/share/zoneinfo//etc/malloc.conf%s/%saudiocpathdnsdpathdrmfattrflockgetpwinetmcastpfprot_execpsrecvfdrouterpathsendfdsettimestdiotmppathttyunixvminfovmmwpathVNONVREGVDIRVBLKVCHRVLNKVSOCKVFIFOVBADprotexeccpu_switchto returnedfork idleidle%dsensorssensorsuspendpauseissignal sigaplsigwaithashinit: bad cnt%02hx%02hx%02hx%02hx%02hx%02hx%02hx%02hx%s:%s,sysctllksysctldlkthrsleep%s%s(%d)Timecounter "%s" frequency %lu Hz -- Insufficient hz, needs at least %u Time stepped from %lld.%09ld to %lld.%09ld dummynanosleepdenied attempt to set clock forward to %lld denied attempt to set clock back %lld seconds boredunexpected %s tq state %dunable to create thread for "%s" taskq unexpected %s tq state %utqdestroysystqsystqmpsrpfinipreempt: cpu_preempt not yet implementedsetrunnablefailing resume cannot be handled resume %s config_mountroot: can't allocate defer structureconfig_defer: can't defer config of a root deviceconfig_defer: can't allocate defer structureautoconfconfig_detach: forced detach of %s failed (%d)%s detached config_make_softcconfig_make_softc: allocation for device softc failed%s%dconfig_make_softc: device name too longexpandcreatconfig_make_softc: %sing dev arrayconfig_make_softc: duplicate %s>>> probing for %s* mapply: no match function for '%s' device>>> %s probe returned %d >>> %s probe won >>> no winning probe %s at root%s at %sroot device %s not configured not configured unsupported /dev/%s%s%ccannot obtain vnode for 0x%x/0x%xcannot open disk, 0x%x/0x%x, error %dcannot read disk label, 0x%x/0x%x, error %droot filesystem has size 0filesystem type %d not known.. assuming ffs use one of: exit %s[a-p]dkopendisklabels not read:root device (default %sswap device (default %s%s)root device (%s) not foundnetbootroot on %s%ccan't figure root, hope your kernel is right (%02hx%02hx%02hx%02hx%02hx%02hx%02hx%02hx.%c) swap on %s%d%c dump on %s%d%croot device (%02hx%02hx%02hx%02hx%02hx%02hx%02hx%02hx) not founddisk_unbusy: %s: dk_busy < 0 disk_detach: disk_count < 0dklkdisk_attach: can't allocate storage for disklabelwrit%s%d%c: %s %sing fsbn %lld%lld of %lld-%lld (%s%d bn %lld; cn %lld tn %lld sn %lld)extnt%s: start 0x%lx, end 0x%lx %s: region not foundextentpl klog%s: %s: page empty%s: %s free list modified: page %p; item addr %p; offset 0x%x=0x%lx != 0x%lx%s: %s: page header missing%s: %s: incorrect page%s: %s free list modified: page %p; item addr %p; offset 0x%x=0x%lxphpool%s: too much uptimepoolsdma%d0123456789abcdef%llo%llx(null)0123456789ABCDEFbug in kprintf: bad base%s: table is full panic: splassert: %s: want %d have %d spl assertion failure in %skernel %sassertion "%s" failed: file "%s", line %d*FOUND**UNKNOWN*%ld0%lo%3d free slot (for add) %3d %s count %d disable (pseudo device) Unknown devno (max is %d) %3d at ??? %s flags 0x%x %s [] ? Unknown argument command args description [count] number of lines before moredev add a device8|10|16 base on large numbersdevno|dev change devicesattr val|devno|dev disable devicesattr val|devno|dev enable devicesdevno|dev find devices this message list configuration leave UKC[attr [val]] show attributes (or devices with an attribute)[mins [dst]] set timezone/dst toggle verbose booting don't know--- more --- %ldError unknown state already enabled %3d can't enable free slot %3d %s disabled %3d can't disable free slot already Unknown routine /%c/ Value missing for attribute Unknown attribute change (y/n) ?out of memory. flags changed %3d can't change free slot count%3d %s changed Unknown pseudo routine /%c/ %s ? Not same device type No more space for new devices. Device not complete number or * is missing No device of this type exists. Clone Device (DevNo, 'q' or '?')Insert before Device (DevNo, 'q' or '?')Unknown command, try help Argument expected Dev expected 8|10|16 expected DevNo or Dev expected Attr, DevNo or Dev expected timezone = %d, dst = %d disautoconf verbose %sabled Unknown command User Kernel Config UKC> Continuing... addchangedisableenablefindhelplinesquitshowtimezoneverbose?pollselectpipeplpipelkpipeclpiperdpipewrttckoutqload: %d.%02d not a controlling terminal no foreground process group empty foreground process group runningrunnableiowait cmd: %s %d [%s] %lld.%02ldu %lld.%02lds %d%% %ldk ttyrub: would panic c = %d, val = %d m_copydata: off %d < 0m_copydata: len %d < 0m_copydata: short mbuf chainm_copydata: null mbufm_copym0: off %d, len %dm_copym0: short mbuf chainm_copym0: m == NULL and not COPYALLmbuf prepend length too bigmbufplmtagplmcl%dkm_apply: len %d < 0m_apply: off %d < 0m_apply: null mbuf in skipm_apply: null mbufWARNING: mclpools limit reached; increase kern.maxclustersrequested tag size for pool %#x is too bigm == NULL in m_pulldown()soaccept !NOFDREF: so %p, so_type %dnetclssoclose NOFDREF: so %p, so_type %dsockplsbcreatecontrol: message too large %d sbdropsbappendcontrolsemi-panic: sbcompressnetlcknetiosbappendaddrnetcon2netconacceptunp_connect2unp_attachuipc 1uipc 2uipc 4piusrreqinconsistent bufpage countsbiowaitbufplbiodone alreadyneedbuffernobuffersbuf_get: dup lblk vp %p bp %pgetblkbuf_needvabufinit: can't reserve VM for buffersnchplwtf? leak?vop_generic_revokeallnameilf_findoverlap: defaultlockfplrelookup: null namerelookup: lookup on dot-dotbrelvp: NULLbgetvp: not freevflushbuf: not dirtyvflushbufvinvalbufvinvalbuf: dirty bufsvinvalbuf: flush failedvwakeup: neg numoutputsoftdep %d vclean: deadlockvclean: cannot reclaimvclean: not cleanvgonemissing aliasvgonel: not cleanmissing bdevvgetvnodevfslockunmount of %s failed with error %d WARNING: some file systems would not unmount retrying syncing disks... giving up done vnodesuvmvnodessyncer vnode syncermount: lost mountunmount: dangling vnodeNon dma reachable buffer passed to VOP_STRATEGYvn_lockspec_badop calledspec_ioctltag VT_NON, dev %d, %d spec_close: not specialspec_fsync: not dirtyspec_fsyncspec_read typespec_write typechkvnlockdead_badop calleddead_write: lockdead_read: locktag VT_NON, dead vnode dos2unixtime(): month value out of range (%u) detrunc(): can't truncate root directory, clust %u, offset %u deextend: file too largedenodedeget(): pcbmap returned %d extendfile(): attempt to extend root directory extendfile: pcbmap. .. doscheckpath(): .. not a directory? msdosfs_sync: rofs modRRaArrAatag VT_MSDOSFS, startcluster %u, dircluster %u, diroffset %u (LOCKED) dev %d, %d, %s msdosfs_strategy: specmsdosfs_rename: lost to startdirmsdosfs_rename: lost from startdirmsdosfs_rename: updating .. in root directory?msdosfs_write(): bad file typebpfattachbpf_mcopybpf: ifpromisc failedbpfbpfszunhandled af %difa_update_broadaddr does not support dynamic lengthegressifihrmifidxrmtoo many interfaces%s: can't handle af%d allsoftnetunable to create softnet taskqifqbarlooutput: no header mbuflo%dunable to create lo0loifmedia_add: can't malloc entryifmedia_set: no match for 0x%llx/0x%llx ifmedia_set failedcan't establish softnet handlerrtmaskcannot initialize a radix tree without memoryfailed to initialize the mask treern_delete: inconsistent normal annotation rn_delete: inconsistent mklist refcount rn_delete: inconsistent dupedkey list rn_delete: inconsistent annotation rn_delete: couldn't find our annotation Mask for route not entered rn_addmask: mask impossibly already in tree %s %p at %p rn_delete: Orphaned MaskNon-unique normal route, mask not entered raw_usrreqactive node flags=%xrt_timer_remove_all: rtq_count reached 0 rt_timer_add: rtq_count reached 0 ifafreertfree: %p not freed (neg refs) rt_timer_init: already initializedrttmr%s RTM_RESOLVE: wrong ifa (%p) was (%p) rt_timer_timer: rtq_count reached 0 rt_timer_queue_destroy: rtq_count reached 0 rtentryroute_init rtable_addroute_outputunexpected mode %uunexpected mode %d%s: invalid channel freq %u flags %x %s: invalid channel (NULL) Bad IBSS channel %u%s: bad channel ignored; freq %u flags %x number %u Pairwise key expansionPMK Name%s: Michael MIC failure %s: %sassociation failed (status %d) for %s %s: received %s from %s rssi %d mode %s 80211scanfreeing bss nodeunable to setup inital BSS nodepassive%s: end %s scan %s: begin %s scan invalid group data cipher!invalid integrity group cipher!management frame too large: %unull node%s: sending %s to %s on channel %u mode %s %s: no node for dst %s, discard raw tx frame %s: station %s deauthenticate (reason %d) %s: station %s disassociate (reason %d) %s: received msg %d/%d of the %s handshake from %s group key4-wayEAPOL-Key frame too large: %u%s: sending EAPOL-Key request to %s %s: sending msg %d/%d of the %s handshake to %s %s: open authentication failed (reason %d) for %s "0x%s: no recent beacons from %s; rescanning %s: bogus xmit rate %u setupassociatedsynchronized%s: %s with %s ssid channel %d start MCS %u.5 start %u%sMbshortlong protection enabled HT enabled %s preamble %s slot time%s%s assoc_reqassoc_respreassoc_reqreassoc_respprobe_reqprobe_respreserved#6reserved#7beaconatimdisassocauthdeauthactionaction_noackreserved#15INITSCANAUTHASSOCRUNauto11a11b11g11naeamatauazbebgbhbnbobrbybzcacncocrcyczdodzegf2fifrgrgthkhnhrhuiqisj1j2j3j4j5jmjojpk2kekpkrkwkzlbliltlvmamkmomxmyninlnzpaphpkprpyqarusasgsisvtntrtttwuaukuyuzvnyezazwAPL1APL1AAPL1_ETSICAPL1_FCCAAPL1WAPL2APL2CAPL2DAPL2_ETSICAPL2WAPL3APL3WAPL4APL4WAPL5APL5WAPLDAPLDEBUGETSI1ETSI1WETSI2ETSI2WETSI3ETSI3AETSI3W,ETSI4ETSI4CETSI4WETSI5ETSI5WETSI6ETSI6WETSIAETSIBETSICETSIEU1WFCC1FCC1AFCC1WFCC2FCC2CFCC2AFCC2WFCC3FCC3AFCCAFRANCEMKK1MKK1_FCCAMKK1AMKK1A1MKK1A2MKK1BMKK2MKK2AMKKANONEWOR01WWOR02WWOR0WWOR1WWOR2WWOR3WWOR4WWOR5_ETSICWOR9WWORAWWORLDarp: ether address is broadcast for IP address %s! duplicate IP address %s sent from ethernet address %s arp: attempt to overwrite permanent entry for %s by %s on %s arp: attempt to overwrite entry for %s on %s by %s on %s arp info overwritten for %s by %s on %s arp: attempt to add entry for %s on %s by %s on %s %s: %s: route contains no arp information %s: %s: route without link local address %s: %s: can't allocate llinfo %s: %s: incorrect arp information arp%s: bad gateway value: %s %s: pool get failed %s: no mbuf invalid argument to in_lifaddr_ioctlin_pcbinit: hashinit failedin_pcbinit: hashinit failed for lportIPv6 pcb passed into in_pcbconnectinpcbplinternet%u.%u.%u.%uicmp_do_exthdr: m_getptr failureicmp_erroricmp lenipqeipqip_initaeshmac-sha1deflaterip_attachrip_detachrip_usrreqsyncachetcp_pulloutofbandm_pulldown malfunctiontcp_output REXMTtcp_outputtcpcbtcpqetcp_inittcp_usrrequdp_usrreqipip_input: should never reach herecryptocryptopcryptodesccuio_copyback: off %d < 0cuio_copyback: len %d < 0cuio_copyback: empty in skipuio_copyback: emptycuio_copydata: off %d < 0cuio_copydata: len %d < 0iov_copydata: empty in skipcuio_copydata: emptycuio_apply: len %d < 0cuio_apply: off %d < 0cuio_apply: ind %d >= uio_iovcnt %d for offcuio_apply: ind %d >= uio_iovcnt %d for lenSoftware crypto device cannot initialize!3DESBlowfishCAST-128Rijndael-128/AESAES-CTRAES-GCMAES-GMACAES-XTSCHACHA20-POLY1305HMAC-MD5HMAC-SHA1HMAC-RIPEMD-160HMAC-SHA2-256HMAC-SHA2-384HMAC-SHA2-512GMAC-AES-128GMAC-AES-192GMAC-AES-256DeflateLZS1.2.3start = %d, len = %d, fs = %s ffs_alloccg: map corruptedbno = %lld, fs = %s ffs_alloccg: block not in mapffs_freefile: range: dev = 0x%x, ino = %d, fs = %sdev = 0x%x, ino = %u, fs = %s ffs_freefile: freeing free inodedev = 0x%x, bsize = %d, size = %ld, fs = %s ffs_blkfree: bad sizebad block %lld, ino %u uid %u on %s: %s bad blockdev = 0x%x, block = %lld, fs = %s ffs_blkfree: freeing free blockffs_blkfree: freeing free fragcg = %d, irotor = %d, fs = %s ffs_nodealloccg: map corruptedffs_nodealloccg: block not in mapffs_clusteralloc: lost blockmode = 0%o, inum = %u, fs = %s ffs_valloc: dup allocfree inode %s/%d had %lld blocks out of inodes %s: create/symlink failed, no inodes free dev = 0x%x, bsize = %d, bprev = %lld, fs = %s ffs_realloccg: bad bprevffs_realloccg: bad blocknodev = 0x%x, optim = %d, fs = %s ffs_realloccg: bad optimfile system full %s: write failed, file system is full ffs1_balloc: blk too bigCould not unwind indirect block, error %dffs_indirtrunc: bad buffer sizeffs_truncate: newspaceffs_update: bad link cntsoftdep_flushfiles calledffsinodino1plffs_vget: alien ino_t %lluupdate: rofs modffs_statfsWARNING: %s was not properly unmounted WARNING: R/W mount of %s denied. Filesystem is not clean - run fsck ffs_reload: dirty1ffs_reload: dirty2WARNING: soft updates isn't compiled in ffs_mountroot: can't setup bdevvp's ffsffs_fsync: not dirtyffs_fsyncffs_write: nonsync dir writeffs_write: typecheckpath: .. not a directory First bad Second bad %s: bad dir ino %u at offset %d: %s bad dirufs_direnter: newblkufs_direnter: compact1ufs_direnter: compact2mangled entryi_ffs_size too smallufs_strategy: specufs_rename: lost from startdirufs_rename: lost to startdirrename: EXDEVufs_rename: same fileufs_rename: lost dir entrychown: lost quotaifree: range: dev = 0x%x, ino = %u, fs = %sdev = 0x%x, ino = %d, fs = %s ifree: freeing free inodebad block %u, ino %u %s: freeing free block: dev = 0x%x, block = %u, fs = %s mode = 0%o, nlinks %u, inum = %u, fs = %s ext2fs_valloc: dup allocext2fs_alloccg: map corruptedext2fs_mapsearch: block not in mapcg = %d, ipref = %u, fs = %s ext2fs_nodealloccg: map corruptedext2fs_nodealloccg: block not in mapext2fs_indirtrunc: bad buffer sizecheckpathrec_len is smaller than minimalrec_len % 4 != 0reclen is too small for name_lendirectory entry across blocksinode out of boundsbad directory entry: %s offset=%d, inode=%u, rec_len=%d, name_len=%d i_size too smallext2fs_direnter: newblkext2fs_direnter: frag size%s: nonsync dir writeext2fs_write%s: typeext2fs_vget: alien ino_t %lluext2fs: wrong magic number 0x%x ext2fs: wrong log2(block size) %d ext2fs: zero blocks per group ext2fs: wrong revision number 0x%x ext2fs: first inode at 0x%x ext2fs: unsupported incompat features 0x%x ext4fs: only read-only support right now ext2fs: your file system says it needs recovery ext2fs: unsupported R/O compat features 0x%x ext2fs_statfsext2fs_reload: dirty1ext2fs_reload: dirty2%s: file system not clean; please fsck(8) ext2fs_mountroot: can't setup bdevvp'sext2fsext2inoplext2dinoplext2fs_mkdir: blksizeext2fs_rename: lost from startdirext2fs_rename: lost to startdirrename: linked directoryext2fs_rename: lost dir entryext2fs_rename: mangled diruvm_addr_invoke: address selector %p (%s 0x%lx-0x%lx) returned unavailable address 0x%lxuaddruaddrhintuaddrbestuaddrpivotuaddrrnduaddr_rnduaddr_hintuaddr_kbootstrapamap_unadd: offset out of rangeamap_unadd: nothing thereamap_lookup: offset out of rangeamap_add: offset out of rangeamap_add: replacing null anonamap_add: slot in useamap_lookups: offset out of rangeamap_splitref: split at zero offsetamap_splitref: map size check failedamap_cow_now: non-resident wired page in anon %pcownowcownowpageamap_wipeout: corrupt amapamapplamap_pp_adjref: overshot targetamap_pp_adjref: negative reference countanonpl%s: can't allocate entryuao_set_swslot: uobj = %p uao_set_swslot: attempt to set a slot on a NOSWAP objectuao_flush: strange, got an out of range flush (fixed) uaoflshuao_flush: weird flagsuao_detuaoeltplaobjpluao_create: kernel object already allocateduao_create: asked to enable swap on kernel objectuao_create: hashinit swhash faileduao_create: malloc swslots faileduao_getpageuao_getudv_faultudv_detachudv_attachuvm_fault_unwire_locked: address not in mapanonget2flt_noram1fltamapcopyflt_noram3flt_pmfail1fltagain2flt_noram5flt_pmfail2uvm_init: page size not setkm_allocvauvm_km_pgremove_intrsafe: no pagekmallockmthreadvallocwaitkm_alloc1wkm_pgrmuvm_km_suballoc: unable to allocate space in parent mapuvm_km_suballoc: unable to create submapuvm_km_suballoc: submap allocation faileduvm_km_init: could not reserve space for kernelkm_free: unmanaged page 0x%lx uvm_map_clean: weird flagsuvm_mapent_addr_removeuvm_mapent_addr_insert: entry still in addr listuvm_mapent_addr_insert: map %p entry %p (0x%lx-0x%lx G=0x%lx F=0x%lx) insert collision with entry %p (0x%lx-0x%lx G=0x%lx F=0x%lx)vmspplvmmpeplvmmpekpluvm_map_splitentry: split address 0x%lx not on page boundary!uvm_mapent_alloc: cannot allocate map entryuvm_mapent_alloc: out of static map entries vmmaplkuvm_map_setup: rw_enter failed on new mapuvm_map_protect: kernel map W^X violation requesteduvmspace_fork: no space in map for entry in empty mapfork: encountered a submap during fork (illegal)fork: non-copy_on_write map entry marked needs_copy (illegal)uvm_map_teardown: rw_enter failed on free mapuvm_map: kernel map W^X violation requesteduvm_page_physget: called _after_ bootstrapuvm_page_physget: out of memory!uvm_setpagesize: page size not a power of twouvm_pglistallocuvm_pglistalloc: Upper boundary 0x%lx not on pagemask. uvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX uvm_page_physload: can not malloc vm_page structs for segment ignoring 0x%lx -> 0x%lx uvm_page_physload: tried to add RAM after vm_mem_inituvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: pmap_growkernel() faileduvm_pageboot_alloc: out of memoryuvm_page_bootstrap: no memory pre-allocateduvm_page_init: lost %ld page(s) in initsize 0 uvm_pagereallocpagersegpgdaemonuvm_wait emergency bufbackoff pagedaemon: deadlock detected! pagedaemon: wait_pla deadlock detected! pmrwaituvm_wait: failed to free %ld pages between 0x%lx-0x%lx uvm_pmr_split: lost one pmr Flags: 0x%x, will panic now. pgzerowarning: resource shortage: %d pages of swap lost swapdrum_addsw_reg_strategy: swap to sparse fileswstrategy: vnode type 0x%xswap_off: swapdev not in listswap0x%04xdisklabel reserve/dev/%s%d%cblkdev0x%xuvm_swap_init: can't get vnode for swap deviceswapmapuvm_swap_init: extent_create failedswp vnxswp vndswplksbrk: grow %ld failed, error = %d uvm_deallocate with null mapuvn_iosyncuvn_cluster: offset out of rangeuvn_flshuvn_flush: obj=%p, offset=0x%llx. error during pageout. uvn_flush: WARNING: changes to page may be lost! uvn_flushuvn_termuvm_vnp_terminate: io sync wanted bit setuvn_attachuvnsyncuvn_getpageuvn_getNULL pointer passed to ip_ecn_egressNULL pointer passed to ip_ecn_ingressin6_prefixlen2mask: invalid prefix length(%d) in6_are_prefix_equal: invalid prefix length(%d) in6_purgeaddr: failed to remove a route to the p2p destination: %s on %s, errno=%d in6_update_ifa: valid lifetime is 0 for %s in6_update_ifa: failed to remove a route to the old destination: %s prefix ioctls are now invalidated. please use ifconfig. invalid argument to in6_lifaddr_ioctlin6_ifawithscope: output interface is not specified %s: got interface identifier from itself %s: borrow interface identifier from %s %s: interface identifier generated by random number %s: failed to get interface identifier %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x %s: no ifid available in6_cksum: mbuf len (%d) < off+len (%d+%d)in6_cksum: out of datainternet6(src=%s dst=%s tgt=%s)ICMP6 redirect sent from %s rejected; must be from linklocal ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) ICMP6 redirect rejected; redirect dst must be unicast: %s ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s ICMP6 redirect rejected; no route found for redirect dst: %s ICMP6 redirect rejected; neither router case nor onlink case: %s icmp6_redirect_input: invalid ND option, rejected: %s icmp6_redirect_input: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s icmp6_notify_error: in6_embedscope failed sanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d ../../../../netinet6/icmp6.cicmp6_reflect: source can't be determined: dst=%s, error=%d ICMP6 checksum error(%d|%x) %s icmp6_input: unknown type %d(src=%s, dst=%s, ifid=%u) ENOBUFS in icmp6_error %d icmp6_mtudisc_callback_registerip6_nexthdr: m == NULLip6_input: packet to an unready address %s->%s ip6_initcannot forward from %s to %s nxt %d received on inteface %u cannot forward src %s, dst %s, nxt %d, rcvif %u, outif %u assumption failed: hdr not splitndopts == NULL in nd6_optionuninitialized ndopts in nd6_optionndopts == NULL in nd6_optionsuninitialized ndopts in nd6_optionsduplicated ND6 option found (type=%d) nd6_options: unsupported option %d - option ignored too many loop in nd opt unspec%s: failed to lookup %s (if=%s) %s: can't allocate llinfo for %s (ln=%p, rt=%p) %s called more than once nd6ln->ln_rt == NULLrt_llinfo(%p) is not equal to ln(%p)dst=0 in nd6_timer(ln=%p)%s: something odd happens %s: %s: incorrect nd6 information ifp == NULL in nd6_cache_lladdrfrom == NULL in nd6_cache_lladdrndp info overwritten for %s by %s on %s %s: failed to join %s (errno=%d) %s: DAD detected duplicate IPv6 address %s: NS in/out=%d/%d, NA in=%d %s: DAD complete for %s - duplicate found %s: manual intervention required ifa == NULL in nd6_dad_ns_inputnd6_na_output: source can't be determined: dst=%s, error=%d nd6_ns_output: source can't be determined: dst=%s, error=%d nd6_dad_timer: called with null parameter nd6_dad_timer: DAD structure not found ???nd6_dad_timer: called with duplicated address %s(%s) nd6_dad_timer: called with non-tentative address %s(%s) %s: could not run DAD, driver problem? %s: DAD complete for %s - no duplicates found nd6_dad_start: memory allocation failed for %s(%s) %s: starting DAD for %s nd6_na_input: invalid hlim (%d) from %s to %s on %s nd6_na_input: invalid target address %s nd6_na_input: a solicited adv is multicasted nd6_na_input: invalid ND option, ignored nd6_na_input: multicast adv without TLLA nd6_na_input: duplicate IP6 address %s nd6_na_input: ND packet from non-neighbor nd6_na_input: lladdrlen mismatch for %s (if %d, NA packet %d) nd6_ns_input: invalid hlim (%d) from %s to %s on %s nd6_ns_input: bad DAD packet (wrong ip6 dst) nd6_ns_input: NS packet from non-neighbor nd6_ns_input: bad NS target (multicast) nd6_ns_input: invalid ND option, ignored nd6_ns_input: bad DAD packet (link-layer address option) nd6_ns_input: lladdrlen mismatch for %s (if %d, NS packet %d) nd6_ns_input: duplicate IP6 address %s nd6_ns_input: src=%s nd6_ns_input: dst=%s nd6_ns_input: tgt=%s in6_init_prefix_ltimes: preferred lifetime(%d) is greater than valid lifetime(%d) in6_ifadd: wrong prefixlen for %s (prefix=%d ifid=%d) in6_ifadd: failed to make ifaddr %s on %s (errno=%d) nd6_prefix_onlink: failed to find any ifaddr to add route for a prefix(%s/%d) on %s nd6_prefix_offlink: %s/%d is already off-link nd6_prefix_offlink: failed to recover a prefix %s/%d from %s to %s (errno = %d) pfxlist_onlink_check: failed to make %s/%d offlink, errno=%d prelist_remove: failed to make %s/%d offlink on %s, errno=%d prelist_remove: negative count on %s nd6_prelist_add: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_update: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_update: nd6_prelist_add failed for %s/%d on %s errno=%d, returnpr=%p defrouter_select: more than one router is installed defrtrlist_del: negative count on %s nd6_rs_input: invalid hlim (%d) from %s to %s on %u nd6_rs_input: invalid ND option, ignored nd6_rs_input: lladdrlen mismatch for %s (if %d, RS packet %d) nd6_ra_input: invalid hlim (%d) from %s to %s on %s nd6_ra_input: src %s is not link-local nd6_ra_input: invalid ND option, ignored nd6_ra_input: invalid option len %d for prefix information option, ignored nd6_ra_input: invalid prefix len %d for prefix information option, ignored nd6_ra_input: invalid prefix %s, ignored nd6_ra_input: invalid prefixlen %d for rfc2374 prefix %s, ignored nd6_ra_input: lladdrlen mismatch for %s (if %d, RA packet %d) rip6_attachrip6_detachrip6_usrreq invalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchincorrect data checkincorrect length checkneed dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionmainbuscpuNo support for this CPU type (%08x) in kernelUndefined instruction in kernel real mem = %lu (%luMB) avail mem = %lu (%luMB) Warning IRQ's disabled during boot() WARNING: not updating battery clock _bus_dmamap_load_raw: not implemented_bus_dmamem_map: size botch_bus_dmamap_sync: mix PRE and POST%s: curaddr %#lx not in range_bus_dmamap_sync: ARM32_BUFTYPE_INVALIDunknown buffer type %d _bus_dmamap_syncProcessor failed probe - no CPU ID %s %s (%s core)%s: IDC disabled IDC enabled DC disabled DC enabled IC disabled IC enabled WB disabled WB enabled LABT EABT branch prediction enabled%s: %dKB/%dB %d-way %s unified cache %s: %dKB(%db/l,%dway) I-cache, %dKB(%db/l,%dway) %s D-cache %s: %s does not fully support this CPU. %s: This kernel does not fully support this CPU. %s: Recompile with "options %s" to correct this. unknown CPU (ID = 0x%x)ARM810ARM920TARM922TARM926EJ-SARM940TARM946E-SARM966E-STI ARM925TARM1020EARM1022E-SSA-110SA-1100SA-1110IXP1200i80200i80321 400MHzi80321 600MHzi80219 400MHzi80219 600MHzPXA250PXA210PXA27xIXP425 533MHzIXP425 400MHzIXP425 266MHzARM1136J-SARM1136J-S R1ARM Cortex A5ARM Cortex A7ARM Cortex A8ARM Cortex A8 R1ARM Cortex A8 R2ARM Cortex A8 R3ARM Cortex A9ARM Cortex A9 R1ARM Cortex A9 R2ARM Cortex A9 R3ARM Cortex A9 R4ARM Cortex A15ARM Cortex A15 R1ARM Cortex A15 R2ARM Cortex A15 R3ARM Cortex A15 R4ARM Cortex A17ARM Cortex A17 R1ARM Cortex A53ARM Cortex A53 R1ARM Cortex A57ARM Cortex A57 R1ARM Cortex A72ARM Cortex A72 R1unknownCPU_ARM8ARM9TDMIARM9E-SCPU_ARM9EARM9EJ-SARM10ECPU_ARM10SA-1CPU_SA1100XScaleCPU_XSCALE_...ARM11JCPU_ARM11CPU_ARMv7wr-thruwr-back**unknown 3****unknown 4**wr-back-lockwr-back-lock-Awr-back-lock-B**unknown 8****unknown 9****unknown 10****unknown 11****unknown 12****unknown 13****unknown 14****unknown 15**rev 0rev 1rev 2rev 3rev 4rev 5rev 6rev 7rev 8rev 9rev 10rev 11rev 12rev 13rev 14rev 15step Jstep Kstep Sstep Tstep Bstep Cstep Dstep Erev 10step Gstep A-0step B-0step B-1step B-2step B-3step B-4step B-5(IXP1200 step A)(IXP1200 step B)(IXP1200 step C)(IXP1200 step D)(IXP1240/1250 step A)(IXP1240 step B)(IXP1250 step B)step A-1step C-0step D-0step ?step C-5step 0badaddr: invalid size (%lu)userkernelFatal %s mode data abort: '%s' trapframe: %p DFSR=%08x, DFAR=%08x (imprecise), spsr=%08lx Fatal %s mode prefetch abort at 0x%08lx trapframe: %p IFSR=%08x, IFAR=%08x, spsr=%08lx r0 =%08lx, r1 =%08lx, r2 =%08lx, r3 =%08lx r4 =%08lx, r5 =%08lx, r6 =%08lx, r7 =%08lx r8 =%08lx, r9 =%08lx, r10=%08lx, r11=%08lx r12=%08lx, usp=%08lx, ulr=%08lxssp=%08lx, slr=%08lx, pc =%08lx Fatal abortUVM: pid %d (%s), uid %d killed: out of swap data_abort_fault: Misaligned Kernel-mode Program Counter Non-emulated page fault with intr_depth > 0 uvm_fault(%p, %lx, %x, 0) -> %x Vector ExceptionAlignment Fault 1Terminal ExceptionAlignment Fault 3External Linefetch Abort (S)Translation Fault (S)External Linefetch Abort (P)Translation Fault (P)External Non-Linefetch Abort (S)Domain Fault (S)External Non-Linefetch Abort (P)Domain Fault (P)External Translation Abort (L1)Permission Fault (S)External Translation Abort (L2)Permission Fault (P)mmrwpmap_map_chunk: no L1 table providedpmap_map_chunk: no L2 table for VA 0x%08lxpmap_map_chunk: can't find L2 table for VA0x%08lxpmap_alloc_specials: no l2b for 0x%lxpmap_bootstrap: No L2 for L2 @ va %ppmap_init_l1: can't get PA of L1 at %pCannot allocate L1 KVMCannot allocate L1 physical pagespmap_bootstrap: No L2 for va 0x%x, pa 0x%lxpmap_bootstrap: out of static L2spmap_bootstrap: WARNING! wrong cache mode for L2 pte @ %p pmap_bootstrap: WARNING! wrong cache mode for primary L1 @ 0x%lx pmapplpvepll2dtblpll2ptpplxscale_setup_minidata: can't find L2 table for VA 0x%08lxpmap_map_entry: no L2 table for VA 0x%08lxpmap_map_entry: can't find L2 table for VA 0x%08lxpmap_enter: failed to allocate L2 bucketpmap_enter: no pv entries dump to dev %u,%u not possible dumping to dev %u,%u offset %ld dump area unavailable device bad device not ready area improper i/o error aborted from console succeeded vunmapbufvmapbufglassattempting to switch console to lcd screen ffuartbtuartstuartbootfile: %s bootargs: %s unknown option `%c' cpu not recognized!%08lx -> %08lx @ %08lx OpenBSD/zaurus booting ... initarm: Configuring system ... physmemory: %d pages at 0x%08lx -> 0x%08lx Allocating page tables freestart = 0x%08lx, free_pages = %d (0x%08x) initarm: out of memoryinitarm: Failed to align the kernel page directoryIRQ stack: p0x%08lx v0x%08lx ABT stack: p0x%08lx v0x%08lx UND stack: p0x%08lx v0x%08lx SVC stack: p0x%08lx v0x%08lx Creating L1 page table at 0x%08lx Mapping kernel Constructing L2 page tables freestart = 0x%08lx, free_pages = %d (0x%x) switching to new L1 page table @%#lx...bootstrap done. init subsystems: stacks vectors undefined page pmap Attempting to power down... The operating system has halted. Please press any key to reboot. rebooting... reboot failed; spinning Diagnostic Failure on Component 0x%02xTagged Overlapped Commands (0x%02x = TASK TAG)Decompression Exception Short Algorithm ID OF 0x%02xASC 0x%02x ASCQ 0x%02xCDBParametersError in %s, Offset %d, bit %dActual Retry Count: %dProgress Indicator: %dprobe%s(%s:%d:%d): %sCheck Condition (error %#x) on opcode 0x%x AT BLOCK #: %d (decimal) SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO: 0x%x (VALID flag %s) COMMAND INFO: 0x%x ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s DEFERRED scbusyunknown error category (0x%x) from scsi driver scsi_done called twice on xs(%p)unexpected xsh state %usyncxspendxsscsiiomvscsi_xfer pool exhausted! scxsplscsiplugscsi_cmd_rw_decode: bad opcode 0x%02xNo Additional SenseSoft ErrorNot ReadyMedia ErrorHardware ErrorIllegal RequestUnit AttentionWrite ProtectedBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare ErrorNo Additional Sense InformationFilemark DetectedEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnCleaning RequestedErase Operation In ProgressLocate Operation In ProgressRewind Operation In ProgressSet Capacity Operation In ProgressVerify Operation In ProgressNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Not Ready, Rebuild In ProgressLogical Unit Not Ready, Recalculation In ProgressLogical Unit Not Ready, Operation In ProgressLogical Unit Not Ready, Long Write In ProgressLogical Unit Not Ready, Self-Test In ProgressLogical Unit Not Accessible, Asymmetric Access State TransitionLogical Unit Not Accessible, Target Port In Standby StateLogical Unit Not Accessible, Target Port In Unavailable StateLogical Unit Not Ready, Structure Check RequiredLogical Unit Not Ready, Auxiliary Memory Not AccessibleLogical Unit Not Ready, Notify (Enable Spinup) RequiredLogical Unit Not Ready, OfflineLogical Unit Not Ready, SA Creation In ProgressLogical Unit Not Ready, Space Allocation In ProgressLogical Unit Not Ready, Robotics DisabledLogical Unit Not Ready, Configuration RequiredLogical Unit Not Ready, Calibration RequiredLogical Unit Not Ready, A Door Is OpenLogical Unit Not Ready, Operating In Sequential ModeLogical Unit Not Ready, Start Stop Unit Command In ProgressLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorLogical Unit Communication CRC Error (ULTRA-DMA/32)Unreachable Copy TargetTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureHead Select FaultError Log OverflowWarningWarning - Specified Temperature ExceededWarning - Enclosure DegradedWarning - Background Self-Test FailedWarning - Background Pre-Scan Detected Medium ErrorWarning - Background Medium Scan Detected Medium ErrorWarning - Non-Volatile Cache Now VolatileWarning - Degraded Power To Non-Volatile CacheWarning - Power Loss ExpectedWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedWrite Error - Recommend ReassignmentCompression Check Miscompare ErrorData Expansion Occurred During CompressionBlock Not CompressibleWrite Error - Recovery NeededWrite Error - Recovery FailedWrite Error - Loss Of StreamingWrite Error - Padding Blocks AddedAuxiliary Memory Write ErrorWrite Error - Unexpected Unsolicited DataWrite Error - Not Enough Unsolicited DataDefects In Error WindowError Detected By Third Party Temporary InitiatorThird Party Device FailureCopy Target Device Not ReachableIncorrect Copy Target Device TypeCopy Target Device Data UnderrunCopy Target Device Data OverrunInvalid Information UnitInformation Unit Too ShortInformation Unit Too LongID CRC Or ECC ErrorLogical Block Guard Check FailedLogical Block Application Tag Check FailedLogical Block Reference Tag Check FailedLogical Block Protection Error On Recover Buffered DataLogical Block Protection Method ErrorUnrecovered Read ErrorRead Retries ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block ReadNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite The DataDe-Compression CRC ErrorCannot Decompress Using Declared AlgorithmError Reading UPC/EAN NumberError Reading ISRC NumberRead Error - Loss Of StreamingAuxiliary Memory Read ErrorRead Error - Failed Retransmission RequestRead Error - LBA Marked Bad By Application ClientAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRecord Not Found - Recommend ReassignmentRecord Not Found - Data Auto-ReallocatedLocate Operation FailureRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorData Sync Error - Data RewrittenData Sync Error - Recommend RewriteData Sync Error - Data Auto-ReallocatedData Sync Error - Recommend ReassignmentRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data Without ECC - Data RewrittenRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With L-ECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteRecovered Data With ECC - Data RewrittenRecovered Data With LinkingDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationMiscompare Verify Of Unmapped LbaRecovered ID with ECCPartial Defect List TransferInvalid Command Operation CodeAccess Denied - Initiator Pending-EnrolledAccess Denied - No Access rightsAccess Denied - Invalid Mgmt ID KeyIllegal Command While In Write Capable StateObsoleteIllegal Command While In Explicit Address ModeIllegal Command While In Implicit Address ModeAccess Denied - Enrollment ConflictAccess Denied - Invalid LU IdentifierAccess Denied - Invalid Proxy TokenAccess Denied - ACL LUN ConflictIllegal Command When Not In Append-Only ModeLogical Block Address Out of RangeInvalid Element AddressInvalid Address For WriteInvalid Write Crossing Layer JumpIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBCDB Decryption ErrorSecurity Audit Value FrozenSecurity Working Key FrozenNonce Not UniqueNonce Timestamp Out Of RangeInvalid XCDBLogical Unit Not SupportedInvalid Field In Parameter ListThreshold Parameters Not SupportedInvalid Release Of Persistent ReservationData Decryption ErrorToo Many Target DescriptorsUnsupported Target Descriptor Type CodeToo Many Segment DescriptorsUnsupported Segment Descriptor Type CodeUnexpected Inexact SegmentInline Data Length ExceededInvalid Operation For Copy Source Or DestinationCopy Segment Granularity ViolationInvalid Parameter While Port Is EnabledInvalid Data-Out Buffer Integrity Check ValueData Decryption Key Fail Limit ReachedIncomplete Key-Associated Data SetVendor Specific Key Reference Not FoundHardware Write ProtectedLogical Unit Software Write ProtectedAssociated Write ProtectPersistent Write ProtectPermanent Write ProtectConditional Write ProtectSpace Allocation Failed Write ProtectNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedFormat-Layer May Have ChangedImport/Export Element Accessed, Medium ChangedPower On, Reset, or Bus Device Reset OccurredPower On OccurredSCSI Bus Reset OccurredBus Device Reset Function OccurredDevice Internal ResetTransceiver Mode Changed to Single EndedTransceiver Mode Changed to LVDI_T Nexus Loss OccurredMode Parameters ChangedLog Parameters ChangedReservations PreemptedReservations ReleasedRegistrations PreemptedAsymmetric Access State ChangedImplicit Asymmetric Access State Transition FailedPriority ChangedCapacity Data Has ChangedError History I_T Nexus ClearedError History Snapshot ReleasedError Recovery Attributes Have ChangedData Encryption Capabilities ChangedTimestamp ChangedData Encryption Parameters Changed By Another I_T NexusData Encryption Parameters Changed By Vendor Specific EventData Encryption Key Instance Counter Has ChangedSA Creation Capabilities Data Has ChangedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedCurrent Program Area Is Not EmptyCurrent Program Area Is EmptyIllegal Power Condition RequestPersistent Prevent ConflictPrevious Busy StatusPrevious Task Set Full StatusPrevious Reservation Conflict StatusPartition Or Collection Contains User ObjectsNot ReservedORWrite Generation Does Not MatchOverwrite Error On Update In PlaceInsufficient Time For OperationCommands Cleared By Another InitiatorCommands Cleared By Power Loss NotificationCommands Cleared By Device ServerIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledCannot Write Medium - Unknown FormatCannot Write Medium - Incompatible FormatCannot Format Medium - Incompatible MediumCleaning FailureCannot Write - Application Code MismatchCurrent Session Not Fixated For AppendCleaning Request RejectedMedium Not FormattedIncompatible Volume TypeIncompatible Volume QualifierCleaning Volume ExpiredMedium Format CorruptedFormat Command FailedZoned Formatting Failed Due To Spare LinkingNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorEnclosure FailureEnclosure Services FailureUnsupported Enclosure FunctionEnclosure Services UnavailableEnclosure Services Transfer FailureEnclosure Services Transfer RefusedRibbon, Ink, or Toner FailureRounded ParameterEvent Status NotificationESN - Power Management Class EventESN - Media Class EventESN - Device Busy Class EventSaving Parameters Not SupportedMedium Not PresentMedium Not Present - Tray ClosedMedium Not Present - Tray OpenMedium Not Present - LoadableMedium Not Present - Medium Auxiliary Memory AccessibleSequential Positioning ErrorTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyEnd Of Medium ReachedMedium Magazine Not AccessibleMedium Magazine RemovedMedium Magazine InsertedMedium Magazine LockedMedium Magazine UnlockedMechanical Positioning Or Changer ErrorRead Past End Of User ObjectElement DisabledElement EnabledData Transfer Device RemovedData Transfer Device InsertedInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetLogical Unit FailureTimeout On Logical UnitLogical Unit Failed Self-TestLogical Unit Unable To Update Self-Test LogTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has Changedcomponent Device AttachedDevice Identifier ChangedRedundancy Group Created Or ModifiedRedundancy Group DeletedSpare Created Or ModifiedSpare DeletedVolume Set Created Or ModifiedVolume Set DeletedVolume Set DeassignedVolume Set ReassignedReported LUNs Data Has ChangedEcho Buffer OverwrittenMedium LoadableMedium Auxiliary Memory AccessibleiSCSI IP Address AddediSCSI IP Address RemovediSCSI IP Address ChangedRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureATA Device Failed Set FeaturesSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorData Phase CRC Error DetectedSCSI Parity Error Detected During ST Data PhaseInformation Unit iuCRC Error DetectedAsynchronous Information Protection Error DetectedProtocol Service CRC ErrorPHY Test Function In ProgressSome Commands Cleared By iSCSI Protocol EventInitiator Detected Error Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorInvalid Target Port Transfer Tag ReceivedToo Much Write DataACK/NAK TimeoutNAK ReceivedData Offset ErrorInitiator Response TimeoutConnection LostLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureErase Failure - Incomplete Erase Operation DetectedCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedMedium Removal Prevented By Data Transfer ElementMedium Thread Or Unthread FailureVolume Identifier InvalidVolume Identifier MissingDuplicate Volume IdentifierElement Status UnknownSCSI To Host System Interface FailureSystem Resource FailureSystem Buffer FullInsufficient Reservation ResourcesInsufficient ResourcesInsufficient Registration ResourcesInsufficient Access Control ResourcesAuxiliary Memory Out Of SpaceQuota ErrorMaximum Number Of Supplemental Decryption Keys ExceededMedium Auxiliary Memory Not AccessibleData Currently UnavailableInsufficient Power For OperationUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change InputOperator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedFailure Prediction Threshold ExceededMedia Failure Prediction Threshold ExceededLogical Unit Failure Prediction Threshold ExceededSpare Area Exhaustion Prediction Threshold ExceededHardware Impending Failure General Hard Drive FailureHardware Impending Failure Drive Error Rate Too HighHardware Impending Failure Data Error Rate Too HighHardware Impending Failure Seek Error Rate Too HighHardware Impending Failure Too Many Block ReassignsHardware Impending Failure Access Times Too HighHardware Impending Failure Start Unit Times Too HighHardware Impending Failure Channel ParametricsHardware Impending Failure Controller DetectedHardware Impending Failure Throughput PerformanceHardware Impending Failure Seek Time PerformanceHardware Impending Failure Spin-Up Retry CountHardware Impending Failure Drive Calibration Retry CountController Impending Failure General Hard Drive FailureController Impending Failure Drive Error Rate Too HighController Impending Failure Data Error Rate Too HighController Impending Failure Seek Error Rate Too HighController Impending Failure Too Many Block ReassignsController Impending Failure Access Times Too HighController Impending Failure Start Unit Times Too HighController Impending Failure Channel ParametricsController Impending Failure Controller DetectedController Impending Failure Throughput PerformanceController Impending Failure Seek Time PerformanceController Impending Failure Spin-Up Retry CountController Impending Failure Drive Calibration Retry CountData Channel Impending Failure General Hard Drive FailureData Channel Impending Failure Drive Error Rate Too HighData Channel Impending Failure Data Error Rate Too HighData Channel Impending Failure Seek Error Rate Too HighData Channel Impending Failure Too Many Block ReassignsData Channel Impending Failure Access Times Too HighData Channel Impending Failure Start Unit Times Too HighData Channel Impending Failure Channel ParametricsData Channel Impending Failure Controller DetectedData Channel Impending Failure Throughput PerformanceData Channel Impending Failure Seek Time PerformanceData Channel Impending Failure Spin-Up Retry CountData Channel Impending Failure Drive Calibration Retry CountServo Impending Failure General Hard Drive FailureServo Impending Failure Drive Error Rate Too HighServo Impending Failure Data Error Rate Too HighServo Impending Failure Seek Error Rate Too HighServo Impending Failure Too Many Block ReassignsServo Impending Failure Access Times Too HighServo Impending Failure Start Unit Times Too HighServo Impending Failure Channel ParametricsServo Impending Failure Controller DetectedServo Impending Failure Throughput PerformanceServo Impending Failure Seek Time PerformanceServo Impending Failure Spin-Up Retry CountServo Impending Failure Drive Calibration Retry CountSpindle Impending Failure General Hard Drive FailureSpindle Impending Failure Drive Error Rate Too HighSpindle Impending Failure Data Error Rate Too HighSpindle Impending Failure Seek Error Rate Too HighSpindle Impending Failure Too Many Block ReassignsSpindle Impending Failure Access Times Too HighSpindle Impending Failure Start Unit Times Too HighSpindle Impending Failure Channel ParametricsSpindle Impending Failure Controller DetectedSpindle Impending Failure Throughput PerformanceSpindle Impending Failure Seek Time PerformanceSpindle Impending Failure Spin-Up Retry CountSpindle Impending Failure Drive Calibration Retry CountFirmware Impending Failure General Hard Drive FailureFirmware Impending Failure Drive Error Rate Too HighFirmware Impending Failure Data Error Rate Too HighFirmware Impending Failure Seek Error Rate Too HighFirmware Impending Failure Too Many Block ReassignsFirmware Impending Failure Access Times Too HighFirmware Impending Failure Start Unit Times Too HighFirmware Impending Failure Channel ParametricsFirmware Impending Failure Controller DetectedFirmware Impending Failure Throughput PerformanceFirmware Impending Failure Seek Time PerformanceFirmware Impending Failure Spin-Up Retry CountFirmware Impending Failure Drive Calibration Retry CountFailure Prediction Threshold Exceeded (false)Low Power Condition OnIdle Condition Activated By TimerStandby Condition Activated By TimerIdle Condition Activated By CommandStandby Condition Activated By CommandIDLE_B Condition Activated By TimerIDLE_B Condition Activated By CommandIDLE_C Condition Activated By TimerIDLE_C Condition Activated By CommandSTANDBY_Y Condition Activated By TimerSTANDBY_Y Condition Activated By CommandPower State Change To ActivePower State Change To IdlePower State Change To StandbyPower State Change To SleepPower State Change To Device ControlLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackPacket Does Not Fit In Available SpaceIllegal Mode For This TrackInvalid Packet SizeVoltage FaultAutomatic Document Feeder Cover UpAutomatic Document Feeder Lift UpDocument Jam In Automatic Document FeederDocument Miss Feed Automatic In Document FeederConfiguration FailureConfiguration Of Incapable Logical Units FailedAdd Logical Unit FailedModification Of Logical Unit FailedExchange Of Logical Unit FailedRemove Of Logical Unit FailedAttachment Of Logical Unit FailedCreation Of Logical Unit FailedAssign Failure OccurredMultiply Assigned Logical UnitSet Target Port Groups Command FailedATA Device Feature Not EnabledLogical Unit Not ConfiguredData Loss On Logical UnitMultiple Logical Unit FailuresParity/Data MismatchInformational, Refer To LogState Change Has OccurredRedundancy Level Got BetterRedundancy Level Got WorseRebuild Failure OccurredRecalculate Failure OccurredCommand To Logical Unit FailedCopy Protection Key Exchange Failure - Authentication FailureCopy Protection Key Exchange Failure - Key Not PresentCopy Protection Key Exchange Failure - Key Not EstablishedRead Of Scrambled Sector Without AuthenticationMedia Region Code Is Mismatched To Logical Unit RegionDrive Region Must Be Permanent/Region Reset Count ErrorDecompression Exception Long Algorithm IDSession Fixation ErrorSession Fixation Error Writing Lead-InSession Fixation Error Writing Lead-OutSession Fixation Error - Incomplete Track In SessionEmpty Or Partially Written Reserved TrackNo More Track Reservations AllowedRMZ Extension Is Not AllowedNo More Test Zone Extensions Are AllowedCD Control ErrorPower Calibration Area ErrorProgram Memory Area Update FailureProgram Memory Area Is FullRMA/PMA Is Almost FullCurrent Power Calibration Area Almost FullCurrent Power Calibration Area Is FullRDZ Is FullSecurity ErrorUnable To Decrypt DataUnencrypted Data Encountered While DecryptingIncorrect Data Encryption KeyCryptographic Integrity Validation FailedError Decrypting DataUnknown Signature Verification KeyEncryption Parameters Not UseableDigital Signature Validation FailureEncryption Mode Mismatch On ReadEncrypted Block Not Raw Read EnabledIncorrect Encryption ParametersUnable To Decrypt Parameter ListEncryption Algorithm DisabledSA Creation Parameter Value InvalidSA Creation Parameter Value RejectedInvalid SA UsageData Encryption Configuration PreventedSA Creation Parameter Not SupportedAuthentication FailedExternal Data Encryption Key Manager Access ErrorExternal Data Encryption Key Manager ErrorExternal Data Encryption Key Not FoundExternal Data Encryption Request Not AuthorizedExternal Data Encryption Control TimeoutExternal Data Encryption Control ErrorLogical Unit Access Not AuthorizedSecurity Conflict In Translated DeviceXS_SHORTSENSE scsibus at %sscsibusprint: qualifier == SID_QUAL_RSVDscsibusprint: qualifier == SID_QUAL_BAD_LUdirectsequentialprinterprocessorcdromwormscanneropticalchangercommunicationenclosure servicessimplified directscsibusprint: device type T_NODEVICEvendor-unique targ %d lun %d: <%s, %s, %s> ATAPISCSI%dremovablefixed %d/%s %s%s naa. eui. t10. serial. wwn._ offline: %d targets, initiator %d, WWPN %016llx, WWNN %016llx%s: unable to register bio scsibusPLEXTORCD-ROM PX-40TS1.01MICROP 1588-15MBSUN0669DEC RZ55 (C) DECEMULEX MD21/S2 ESDIA00IBMRAID 0662SIBM 0663HIBM0664H3171-S2KZ-CDFRSS2FQUANTUM ELS85S iomegajaz 1GBMICROP4421-07SEAGATEST150176LW0002HPC3725SDCASSONY SDT-5000 3.WangDAT Model 1300 02.4Model 2600 01.7Model 3200 02.2CR-2801TE1.07CREATIVECD3630EAC101FX320Sq01GCD-R580B1.00MATSHITA CR-5741.021.06Memorex CRW-26421.0gSANYO CRD-256PSANYO CRD-254PSANYO CRD-S54P1.08CD-ROM CDR-S11.70CD-ROM CDR-N161.25UJDCD87301.14ATAPI CD-ROMSCSI CD-ROMcdNEC CD-ROM DRIVE:260SCSI opticalSCSI disk%s %s(unknown)%s: %lluMB, %lu bytes/sector, %llu sectors, thin, readonlysoftintr_establish: unknown soft IPL %d addr 0x%lx intr %dWARNING: using filesystem date -- CHECK AND RESET THE DATE! pxa2x0_probe_sdram: impossiblepxaip_attach_critical: failed to attach INTC!pxaip_attach_critical: failed to attach GPIO!pxaip_attach: failed to map CLKMANpxaip_attach: failed to map RTC: CPU clock = %d.%03d MHz pxaippxa2x0_io_bs_free(): not implementedpxa2x0_io_bs_alloc(): not implementedcouldn't establish interruptirq %dintr_establish: bogus irq number %dintr_establish: can't malloc handler info: Interrupt Controller stray interrupt %d pxaintcpxagpio_reg_write: not bootstrappedpxagpio_reg_read: not bootstrappedpxa2x0_gpio_set_intr_level: bad level: %d%s: unhandled GPIO interrupt. GPIO#%d %s: failed to hook main GPIO interrupt pxa2x0_gpio_intr_establish: Pin %d not GPIO_IN: GPIO Controller %s: Can't map registers! pxagpioclock%s: Cannot map registerspxaostendpoint %d already used by %cfifo full when trying to set short packet pxaudc_read_epN: ep %d, no xfer ep%d: fifo error : cannot map mem space : USB Device Controller : unable to establish interrupt usbc: unable to establish connect interrupt pxaudc%s: init failed, error=%d %s: Unknown depth (%d) : failed to map registers %d%s: unable to establish interrupt at irq %d%s: battery life expectancy %d%% %s: AC off,on,backup power,unknown, battery is highCRITICALchargingundecoded (%x)bogus new frequency 0 for rate %d maxclock %d pxa2x0_apm_sleep: can't map OST pxa2x0_apm_attach_sub: failed to map POWMAN apmlk%s: failed to map CLKMAN %s: failed to map MEMCTL %s: can't map GPIO %s: failed to create kernel thread, disabledapmevapmpcmcia_function_enable: function not initializedpcmcia_function_init: function is enabled, (manufacturer 0x%x%sproduct 0x%x function %d "%s: error %d detaching %s (function %d) pcmcia_card_attachpcmciapcmcia_parse_cis_tuple%s: CIS version PCMCIA 1.0 PCMCIA 2.0 or 2.1 PC Card Standard %d.%d unknown (major=%d, minor=%d) %s: CIS info: %s: Manufacturer code 0x%x, product 0x%x %s: function %d: unspecifiedmulti-functionserial portparallel portfixed diskvideo adapternetwork adapterauto incrementing mass storageSCSI bridgeSecurity servicesInstrumentSerial I/O Bus Adapterunknown (%d), ccr addr %lx mask %lx %s: function %d, config table entry %d: memory cardI/O cardcard type unknown; irq mask %x; iomask %lx, iospace %lx%s%lx; memspace@ %lx%s%lx%s%lx; maxtwins %d; mwait_required rdybsy_active wp_active bvd_active io8 io16 irqshare irqpulse irqlevel powerdown readonly audio%s: %d errors found while parsing CIS %s: CIS checksum failed %s: using CIS quirks for SVECFD605 PCMCIA EtherNet CardV1-1%s: can't alloc mem for LAN iobase %s: can't map mem for LAN iobase %s: can't alloc mem for enet addr %s: can't map mem for enet addr : unexpected I/O space configuration : can't get subregion for asic : function enable failed : can't map NIC I/O space : can't map ASIC I/O space port 0x%lx/%d: can't match ethernet vendor code , %s: no suitable config entry AmbiCom IncAMB8002TPMX PE-200DIGITALDEPCM-XXPCMCIAUE2212D-LinkDE-660DE-660+RPTI LTD.EP400CISV100RPTIEP401 Ethernet NE2000 CompatibleACCTONEN2212ETHERNETW89C926Seiko Epson Corp.P/N: EEN10B Rev. 00CNetCN40BC EthernetNE2000FastEthernetLNT-10TNNDC004743118001TAMARACKGVCNIC-2000pR01Ethernet CardiPort10/100 Ethernet CardFast-EthernetETHER-C16Fast EthernetPCMCIA LANCF10Base-EthernetLinksysEtherFast 10/100 Integrated PC Card (PCM100)Ver 1.0DE-650I-O DATAPCET/TX-RDFE-670TXDLINKSYSE-CARDPCLAcorega K.K.corega Ether PCC-Tcorega Ether PCC-TDcorega EtherII PCC-Tcorega EtherII PCC-TDcorega FastEther PCC-TXcoregaFEther PCC-TXFcorega FEther PCC-TXDSMC8041TX-10/100-PC-Card-V2XircomCompactCard EthernetCFE-10: can't map first i/o space : can't map second i/o space port 0x%lx/%lu,0x%lx/%lucannot allocate channel queue : %s: can't handle card info Digital Mobile Media CD-ROMPortable CD-ROM DriveNinjaATA-EXP PnPIDEF1SHUTTLE TECHNOLOGY LTD.PCCARD-IDE/ATAPI Adapterwipwr: can't alloc i/o space : can't map i/o space %s: can't establish interrupt %s%s Wireless LAN PCC-11Wireless LAN PCCA-11corega_K.K.Wireless_LAN_PCCB-11WL PCCL-11ISL37300PWLCFL-11INTERSILHFA384x/IEEEVersion 01.02SMC2632WNANOSPEEDNECWireless Card CMZ-RT-WPVersion 01.01NTT-ME11Mbps Wireless LAN PC CardAddtronAWP-100 Wireless PCMCIACabletronRoamAbout 802.11 DSIntersilPRISM 2_5 PCMCIA ADAPTEREval-RevASymbol TechnologiesLA4111 Spectrum24 Wireless LAN PC CardPLANEXGW-NS11H Wireless LAN PC CardD-Link CorporationD-Link DWL-650H 11Mbps WLAN AdapterAllied Telesis K.K.WR211PCMpxapcic_mem_map: bogus kindpcic_attach_card: already attachedpxapcicevpxapcicss%s-%d%s: unable to create event thread for %s : %d slot%s pxapcicmmclk%s: data not a multiple of %d bytes mmcmd%s: unsupported bus frequency of %d KHz : can't map regs mmccd: can't establish card interrupt : can't establish MMC interrupt : MMC/SD/SDIO controller sdmmc%s: can't attach bus pxammclcdzkbdwd0: failed to map %s : PCMCIA/GPIO controller scoopscoop_pcic_set_power: bogus power statescoop_pcic_write: bogus registerscoop_pcic_read: bogus register%s: invalid CF slot %d%s: can't map memory %lx for scoopscoop_mmc_set_power: unsupported OCR (%#x) zssp_read_ads7846: not configured zssp_ic_send: invalid IC %d : can't map bus space zsspapm_acapm_bczts%s: standby command didn't complete %s: standby command timeout %s: standby command: drive fault %s: flush cache command didn't complete %s: flush cache command timeout %s: flush cache command: drive fault ST506wd_get_params: bad return code from ata_get_paramswddump: try againwddump: polled command has been queuedwddump: device timed outwddump: drive faultwddump: DMA errorwddump: %swddump: unknown error typeST506/MFM/RLLESDI/IDE disk__wdstart: bad return code from wdc_ata_bio()device faultdevice timeout, retrying %s: soft error (corrected) %s: IDENTIFY failed : <%s> %s: %d-sector PIO, LBA48, %lluMB, %llu sectors LBA, %lluMB, %llu sectors CHS, %lluMB, %d cyl, %d head, %d sec, %llu sectors %s: enable look ahead command didn't complete %s: enable write cache command didn't complete %s: freeze lock command didn't complete %s:%d:%d: bad state %d in _wdc_ata_bio_start _wdc_ata_bio_start: bad state%s:%d:%d: timeout waiting for DRQ, st=0x%b, err=0x%02x BSYDRDYDWFDSCDRQCORRIDXERR%s:%d:%d: not ready, st=0x%b, err=0x%02x wdc_ata_ctrl_intr: state==RECALpiomodedmamodegeometrysetmultirecal%s:%d:%d: %s timed out %s:%d:%d: %s drive fault error (%x) %s:%d:%d: bad state %d in wdc_ata_bio_intr wdc_ata_bio_intr: bad state%s:%d:%d: device timeout, c_bcount=%d, c_skip%d %s:%d:%d: intr with DRQ (st=0x%b) %s:%d:%d: read intr before drq error not notifiedno media/write protectedaborted commandmedia change requestedid not foundmedia changeduncorrectable data errorinterface CRC erroraddress mark not foundtrack 0 not foundbad block detectedwd0aboot device: lookup '%s' failed. boot device: %s wswaitwswait2wsdisplay at %s%s: screen %d-%d added (%s, %s emulation) wsdisplay_switch2: not switching wsdisplay_switch2: invalid screen %dwsdisplay_switch2: screen %d disappeared wsdisplay_switch2: giving up wsdisplay_switch1: not switching wsdisplay_switch1: invalid screen %dwsdisplay_switch1: screen %d disappeared wsrestorewsdisplaytty() on ctl device%s: screen %d deleted dmuxwsdisplay_common_attach: no memory mux %d: console (%s, %s emulation), using %swsdisplaywsevent_read%s: connecting to %s %s: disconnecting from %s wskbd at %s%s: can't attach mux (error=%d) %s: event queue overflow wskdetwskbd_detach: %s didn't detach cannot load keymap %s: cannot load keymap, falling back to default %s: console keyboard%s: attach error=%d wskbdwskbd_get_mapentry: %d(%d): bad entrywskbd_load_keymap: %d: recursion too deepwskbd_load_keymap: %d(%d): bad entry attach error=%dwsmouse at %swsmdetwsmouse_detach: %s didn't detach wsmousewsmux_getmux: no memory for mux %d wsmux: attach out of memory wsemul_vt100_output_c0c1: ESC in kernel output ignored [>24;20;0cP2$u\P0!u%5\[?62;6c[%d;%dR[?13n[?21n[?27;1nOIOMOjOkOlOmOnOo[28~[29~[1~[2~[3~[4~[5~[6~[7~[8~OAOBODOC[11~[12~[13~[14~[15~[17~[18~[19~[20~[21~[23~[24~[25~[26~[31~[32~[33~[34~[35~[36~[37~[38~OPOQOROSOpOqOrOsOtOuOvOwOxOyrasops_init: fontwidth assumptions botched!rasops_init: font table is empty rasops_init: couldn't lock font fontwidth not 8/12/16 or RASOPS_SMALL - fixme!wsfont_unlock: font not lockedno usable key codes array%s: was console keyboard usb at %sendtaskusbatskusbtskunable to create usb abort task threadusbtaskunable to create usb task thread%s: root hub problem %s: root device is not a hub usbpalock: USB revision %s, not supported %s: can't register softintr pre 1.01.12.03.0usbusbd_desc_iter_next: bad descriptor usbd_desc_iter_next: descriptor length = 0 usbd_desc_iter_next: descriptor length too large usbd_start_next: error=%d usbd_transfer: not doneusbsynusbrefusbdetusb_detach_wait: %s didn't detach out of dataiface desc0 lengthusbd_fill_iface_data: bad descriptor(s): %s usbdly%s: device addr %d (config %d) exceeds power budget, %d mA > %d mA %s: port %d, set config %d at addr %d failed %s: No free USB addresses, new device ignored. usbd_new_device: cannot find HS port%x.%02xvendor 0x%04xproduct 0x%04x"%s %s", class %d/%d rev addr %d port %d configuration %d interface %dNORMAL_COMPLETIONIN_PROGRESSPENDING_REQUESTSNOT_STARTEDINVALNOMEMCANCELLEDBAD_ADDRESSIN_USENO_ADDRSET_ADDR_FAILEDNO_POWERTOO_DEEPIOERRORNOT_CONFIGUREDTIMEOUTSHORT_XFERSTALLEDINTERRUPTEDXXX%s: connected port %d has no power %s: port %d reset failed %s: device problem, disabling port %d %s: illegal enable change, port %d %s: port error, restarting port %d %s: port error, giving up port %d %s: hub depth (%d) exceeded, hub ignored %s: unable to set HUB depth %s: no ports, hub ignored %s: bus powered hub connected to bus powered hub, ignored %s: no interface handle %s: no endpoint descriptor %s: bad interrupt endpoint %s: cannot open interrupt pipe %s: port %d power on failed, %s uhubuhidev_intr: bad repid %d uhid at %s reportid %d%s: could not read endpoint descriptor %s: unexpected endpoint %s: no input interrupt endpoint %s: no HID descriptor %s: no memory %s: no report descriptor %s: iclass %d/%d, %d report id%suhidevuhidrea: input=%d, output=%d, feature=%d uhidukbd%s: got polled xfer %p, but %p already pending %s: CBI bulk-in/out stall clear failed, %s %s: CBI intr-in stall clear failed, %s %s: CBI reset failed, %s %s: CBI bulk-in stall clear failed, %s %s: CBI bulk-out stall clear failed, %s %s: Unknown state %d%s: Invalid CSW: sig 0x%08x should be 0x%08x %s: Invalid CSW: tag %d should be %d %s: Invalid CSW: status %d > %d %s: Phase Error, residue = %d %s: transferred %d bytes instead of %d bytesBulk-OnlyCBICBI with CCIISD-ATARBCSCSIUFI%s: using %s over %s %s: isdata not configured %s: command protocol=0x%x not supported %s: bus attach failed umass%s: Unknown status %d in umass_scsi_cbumass_cmd: large datalen, %d %04x%04x%s%s: open rx pipe failed: %s %s: open tx pipe failed: %s %s: open intr pipe failed: %s %s: aue_send error=%s %s: usb error on tx: %s %s: watchdog timeout %s: %u usb errors on intr: %s %s: no memory for rx list -- packet dropped! %s: %u usb errors on rx: %s %s: reset failed %s: close rx pipe failed: %s %s: close tx pipe failed: %s %s: close intr pipe failed: %s %s: tx list init failed %s: rx list init failed %s: MII read timed out %s: EEPROM read timed out auemii%s: couldn't get endpoint descriptor %d %s: missing endpoint %s: address %s aue%s: usb errors on rx: %s axe%d: close rx pipe failed: %s axe%d: close tx pipe failed: %s axe%d: close intr pipe failed: %s axe%d: usb error on tx: %s axe%d: watchdog timeout axe%d: rx list init failed axe%d: tx list init failed axe%d: open rx pipe failed: %s axe%d: open tx pipe failed: %s %s: media change failed axe%d: write PHY failed axe%d: read PHY failed axemii%s: couldn't get ep %d no valid PHY address found, assuming PHY address 0 AX88178 AX88772B AX88772 AX88172axerxeof: too large transfer invalid buffer(pkt#%d), continue checksum err (pkt#%d) axen%d: close rx pipe failed: %s axen%d: close tx pipe failed: %s axen%d: close intr pipe failed: %s %s: not supported usb bus typeaxen%d: usb error on tx: %s axen%d: watchdog timeout axen%d: rx list init failed axen%d: tx list init failed axen%d: open rx pipe failed: %s axen%d: open tx pipe failed: %s axen%d: write PHY failed axen%d: read PHY failed enable auto detach (0x%04x) unknown uplink bus:0x%02x axenmii AX88178a AX88179axen%s: warning: Failed to write register 0x%0x %s: warning: Failed to read register 0x%0x %s: warning: failed to read SMSC_COE_CTRL (err=%d) %s: warning: failed to write SMSC_COE_CTRL (err=%d) %s: warning: failed to read initial AFC_CFG, error %d %s: warning: media change failed, error %d %s: warning: timed-out waiting for reset to complete %s: warning: timed-out waiting for phy reset to complete %s: warning: failed to set the MAC address %s: warning: failed to read HW_CFG: %d %s: warning: failed to read HW_CFG: (err = %d) %s: warning: failed to read ID_REV (err = %d) %s: warning: failed to read MAC_CSR (err=%d) %s: error: smsc_chip_init failed (err=%d) smscmii%s: warning: MII is busy %s: warning: MII write timeout %s: warning: MII read timeout smsc%s: cue_send error=%s %s: read MAC address failed %s: setting config no failed %s: getting interface handle failed cue%s: kue_send error=%s %s: warm boot, no firmware download kue%s: failed loadfirmware of file %s: errno %d %s: cold boot, downloading firmware %s: failed to load code segment: %s %s: failed to load fixup segment: %s %s: failed to load trigger segment: %s %s: loading firmware failed %s: could not read Ethernet descriptor %s: no memory for multicast filter buffer %s: usb error on rx: %s %s: too many errors, disabling %s: open interrupt pipe failed: %s %s: close interrupt pipe failed: %s %s: extra ethernet descriptor %s: no data interface %s: no descriptor for interrupt endpoint %d %s: interface alternate setting %d failed %s: no descriptor for bulk endpoint %d %s: could not find data bulk in %s: could not find data bulk out cdce%s: udav_send error=%s udavmiiudav%s: upl_send error=%s upl%s: ugl_send error=%s %s: bad header (length=%d) %s: bad packet count (%d) %s: bad packet size(%d), length=%d ugl%s: url_send error=%s %s: %s: bad register %04x urlmii%s: failed to get interface, err=%s %s: couldn't get endpoint %d urlwiusbthrwitxlwiIDLwi_usb: received USB_BUFAVAIL packet wi_usb: received USB_ERROR packet %s: %s error=%s wiTXsyncUGH TX UGH RX write_record buf size err %x %x invalid packet len: %x memsz %x max %x %s: %s: error=%s %s:%s: invalid packet id sent %x %s: already detached %s: open pipes failed wi_usbRT5222RT2522RT2523RT2524RT2525RT2525eRT2526%s: could not retrieve Tx statistics - cancelling automatic rate control %s: could not write MAC register: %s %s: could not read MAC register: %s %s: could not write to RF %s: could not read BBP %s: could not write to BBP %s: timeout waiting for BBP %s: could not read EEPROM: %s %s: could not allocate protection frame %s: could not transmit buffer: %s %s: could not allocate rx mbuf %s: could not allocate rx mbuf cluster %s: could not allocate rx xfer %s: could not allocate rx buffer %s: could not allocate tx xfer %s: could not allocate tx buffer %s: timeout waiting for BBP/RF to wakeup %s: could not allocate AMRR xfer %s: could not open Tx pipe: %s %s: could not open Rx pipe: %s %s: could not allocate Tx list %s: could not allocate Rx list %s: could not queue Rx transfer %s: could not set configuration no %s: could not get interface handle %s: no endpoint descriptor for iface %d %s: MAC/BBP RT%04x (rev 0x%02x), RF %s, address %s uralset config activated %s: can't create task thread %s: can't establish softintr %s: usbf_new_device failed, %s usbf%s %s, rev %d.%02d/%d.%02dusbf_start_next: %s encap error cdcef_do_request %s: usbf_transfer failed OpenBSD.orgCDC Ethernet Emulation: usbf_add_config failed : usbf_add_interface failed : usbf_add_endpoint failed : usbf_add_config_desc failed : usbf_end_config failed : usbf_alloc_buffer failed : usbf_open_pipe failed : usbf_transfer failed : address %s cdcefOUI 0x%06x model 0x%04x rev %d at %s phy %dmii_detach: phyloc and offloc specifiedmii_attach: phyloc and offloc specifiedmiiautmii_phy_setmedia: MASTER on wrong media: %s, rev. %d nsphyDP83840 10/100 PHYnsphyterDP83815 10/100 PHYDP83843 10/100 PHYDP83847 10/100 PHYqsphyQS6612 10/100 PHYinphyi82555 10/100 PHYi82562EM 10/100 PHYi82562ET 10/100 PHYi82562G 10/100 PHYiophyi82553 10/100 PHYeephy88E1000 1 Gigabit PHY88E1000 2 Gigabit PHY88E1000 3 Gigabit PHY88E1000 4 Gigabit PHY88E1000S Gigabit PHY88E1011 Gigabit PHY88E1111 Gigabit PHY88E1112 Gigabit PHY88E1116 Gigabit PHY88E1116R Gigabit PHY88E1118 Gigabit PHY88E1149 Gigabit PHY88E3016 10/100 PHY88E3082 10/100 PHYPHYG65G Gigabit PHY88E1000 5 Gigabit PHY88E1000 6 Gigabit PHY88E1000 7 Gigabit PHYexphy_service: can't isolate 3Com PHY: 3Com internal media interface %s: ignoring this PHY, non-zero instance xlexphyrlrlphy_service: attempt to isolate phy: RTL internal PHY rlphyRTL8201L 10/100 PHYRTL8201E 10/100 PHYIP101 10/100 PHYlxtphyLXT970 10/100 PHYLXT971 10/100 PHYmtdphyMTD972 10/100 PHYicsphyICS1890 10/100 PHYICS1892 10/100 PHYICS1893 10/100 PHYsqphy80220 10/100 PHY80225 10/100 PHY84220 10/100 PHYtqphy78Q2120 10/100 PHY: Generic IEEE 802.3u media interface, rev. %d: OUI 0x%06x, model 0x%04x %s: no media present ukphybmtphy3C905B internal PHY3C905C internal PHYBCM4401 10/100baseTX PHYBCM5201 10/100 PHYBCM5214 Quad 10/100 PHYBCM5220 10/100 PHYBCM5221 100baseTX PHYBCM5222 Dual 10/100 PHYamphyAm79C873 10/100 PHYDM9101 10/100 PHYDM9102 10/100 PHYDM9601 10/100 PHYAm79C875 quad PHYacphyAC101 10/100 PHYAC101L 10/100 PHYAC_UNKNOWN 10/100 PHYnsgphyDP83861 10/100/1000 PHYDP83865 10/100/1000 PHYDP83891 10/100/1000 PHY%s: %s: enter down%s: %s: link %s : RTL internal phy urlphyrgephyRTL8169S/8110S/8211 PHYRTL8251 PHYmmcdiemmcdly%s: i/o init failed %s: mem init failed %s: can't identify card %s: can't supply bus power %s: can't supply clock %s: can't enable card %s: no functions mmctskSpectecSDIO WLAN CardSDW-820%s: CIS version %d.%d wireless network adapter%s: bad CIS ptr %#x %s: CIS parse error at %d, tuple code %#x, length %d %s: bad CISTPL_FUNCID length %s: bad CISTPL_MANFID length %s: CISTPL_VERS_1 too short %s(%sat %s%s: can't read CIS %s: can't set I/O RCA %s: can't select I/O RCA %d %s: can't supply voltage requested by card %s: can't send I/O OCR %s: can't read EXT_CSD %s: unknown CARD_TYPE 0x%x %s: can't change high speed %s: can't change bus clock %s: can't re-read EXT_CSD %s, HS_TIMING set failed %s: unknown MMC version %d %s: unknown SD CSD structure version 0x%x %s: unknown MMC CSD structure version 0x%x %s: can't set mem RCA SD/MMC Drive #%02d%s: can't allocate ccbs %s: can't attach scsibus 4jd'({^~: h89p89y9t89|89898989898989898989n:898989898999 99 .0-)('&J% !$" 53d;x; ;;TNchNc ;;|NcNc ;;ococ ;;ococ ;;pcpc ;;,pc@pc ;;Hqc\qc ;;tqcqc ;;qcqc ;;qc ; ;;qc ; ;;qc ;$ ;;sc4; ;;ucuc ;; ,zc ; ;; @zcD ; ;; zcx ; ;; {c{c ;;|c|c ;;T|ch|c ;;T|ch|c ;;|c{c ;;|c{c ;;|c|c ;;|cDsc ;; }c4}c ;;L}c`}c ;;~c}c4 ;;\~cH~c4 ;;ȁcc< ;;8ܡc ;;\9 c ;;p9 c ;;9 c ;;94c0 ;;+9hc0 ;;+9|c ;;&9c ;;'9c ;;'9Тc ;;'9c ;;h(9c ;; )9c ;;|)9,c ;;-9@c ;;-9\c ;;.9tc ;;8.9c ;;/9x ; ;;/9c ;;cc ;;,$c8c ;;,Tcrc ;;hc|c0 ;;-cc0 ;;-c̤c0 ;;-cc0 ;;-cc0 ;;-0cDc0 ;;-Xclc0 ;;-cc0 ;;-cc0 ;;-Хcc0 ;;-c c0 ;;- c4c0 ;;-Hc\c0 ;;-pcc0 ;;-cc0 ;;-cԦc0 ;;-cc0 ;;-c$c0 ;;-MD3GVH#JV n yV px QiViVj!u!iVj!u!b%iVQf "iV:&iV:&iCOiVj'iV/,jV{eGz/riV;L,iV|Ƚ2jV{0d2iVV3jV'jV' (08@HPX`hpV^by10 ' uů^\s^aMiilQ:ӥe6esZ%.,#^Nx{hN Yb1UXBZ*U4x,@ѳS^@oD$3ɇD |d6bȒS=O 1a"hנԵÅ%HK(#ۆHqi7,: /sc8 OAnjm=6CEoI{D j[ iFr"r:#)FF4btL5B?ƧA^yYa``6JiosX?)wUw&[34V VA =,z3¤~.eIUÄZJ4 Xeĭn#$M(XRO[!҆ƃBbu?}l^ @%ZrRNh@;BR˺d/W~p(j:Y<_%T<:-DwlGy IBzMNz/~_J3VU, nԪxE_ /E=s+K-3 u  ... export VNAME=$(sysctl -n kern.osrelease) export VERSION="${VNAME%.*}${VNAME#*.}" export ARCH=$(sysctl -n hw.machine) export OBSD="OpenBSD/$ARCH $VNAME" export PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ umask 022 set -o emacs set -- $(dmesg | sed -n '/^root on /h;${g;p;}') rootdisk=$3 if [[ -z $DONEPROFILE ]]; then DONEPROFILE=YES mount -u /dev/${rootdisk:-rd0a} / echo ! : >/etc/rc echo 'erase ^?, werase ^W, kill ^U, intr ^C, status ^T' stty newcrt werase ^W intr ^C kill ^U erase ^? status ^T cat <<__EOT Welcome to the $OBSD installation program. __EOT timeout=false timer_pid= if [[ ! -f /tmp/noai ]] && { ifconfig netboot >/dev/null 2>&1 || [[ -f /auto_install.conf ]] || [[ -f /auto_upgrade.conf ]]; }; then echo "Starting non-interactive mode in 5 seconds..." >/tmp/noai trap 'kill $timeout_pid 2>/dev/null' EXIT trap 'exit 1' INT trap 'timeout=true' TERM set +m exec 3<&1 4<&2 >/dev/null 2>&1 (sleep 5; kill $$) & timer_pid=$! exec 1<&3 2<&4 3<&- 4<&- set +m fi while :; do echo -n '(I)nstall, (U)pgrade, (A)utoinstall or (S)hell? ' read REPLY if $timeout; then timeout=false echo REPLY=a else [[ -n $timer_pid ]] && kill $timer_pid 2>/dev/null timer_pid= fi case $REPLY in [aA]*) /install -a && break ;; [iI]*) /install && break ;; [uU]*) /upgrade && break ;; [sS]*) break ;; !) echo "Type 'exit' to return to install." ksh ;; !*) eval "${REPLY#?}" ;; esac done fi #!/bin/ksh MODE=upgrade . install.sub get_rootinfo while :; do ask "Root filesystem?" $ROOTDEV resp=${resp##*/} [[ -b /dev/$resp ]] && break echo "$resp is not a block device." done ROOTDEV=$resp echo -n "Checking root filesystem (fsck -fp /dev/$ROOTDEV)..." fsck -fp /dev/$ROOTDEV >/dev/null 2>&1 || { echo "FAILED."; exit; } echo "OK." echo -n "Mounting root filesystem (mount -o ro /dev/$ROOTDEV /mnt)..." mount -o ro /dev/$ROOTDEV /mnt || { echo "FAILED."; exit; } echo "OK." for _f in /mnt/etc/{fstab,hosts,myname}; do [[ -f $_f ]] || { echo "No $_f!"; exit; } cp $_f /tmp/${_f##*/} done hostname $(stripcom /tmp/myname) THESETS="$THESETS site$VERSION-$(hostname -s).tgz" enable_network startcgiinfo munge_fstab check_fs umount /mnt || { echo "Can't umount $ROOTDEV!"; exit; } mount_fs feed_random install_sets finish_up  . ..@ bin dev etc mntAmnt2ƢsbinB tmp usrvarinstbin.profile install.mdupgradeinstall  install.sub MDXDM=y md_installboot() { } md_prep_fdisk() { local _disk=$1 _q _d while :; do _d=whole if disk_has $_disk mbr; then fdisk $_disk if disk_has $_disk mbr openbsd; then _q=", use the (O)penBSD area" _d=OpenBSD fi else echo "MBR has invalid signature; not showing it." fi ask "Use (W)hole disk$_q or (E)dit the MBR?" "$_d" case $resp in [wW]*) echo -n "Setting OpenBSD MBR partition to whole $_disk..." fdisk -iy $_disk >/dev/null echo "done." return ;; [eE]*) cat <<__EOT You will now create a single MBR partition to contain your OpenBSD data. This partition must have an id of 'A6'; must *NOT* overlap other partitions; and must be marked as the only active partition. Inside the fdisk command, the 'manual' command describes all the fdisk commands in detail. $(fdisk ${_disk}) __EOT fdisk -e ${_disk} disk_has $_disk mbr openbsd && return echo No OpenBSD partition in MBR, try again. ;; [oO]*) [[ $_d == OpenBSD ]] || continue return ;; esac done } md_prep_disklabel() { local _disk=$1 _f=/tmp/fstab.$1 md_prep_fdisk $_disk disklabel_autolayout $_disk $_f || return [[ -s $_f ]] && return disklabel -F $_f -E $_disk } md_congrats() { val=`ztsscale` case $? in 0) echo grep -v '^mouse\.scale.*$' /mnt/etc/wsconsctl.conf \ >/tmp/wsconsctl.conf 2>/dev/null echo $val "# see ztsscale(8)" >> /tmp/wsconsctl.conf cp /tmp/wsconsctl.conf /mnt/etc/wsconsctl.conf ;; esac } md_consoleinfo() { local _u _d=com for _u in $(scan_dmesg "/^$_d\([0-9]\) .*/s//\1/p"); do if [[ $_d$_u == $CONSOLE || -z $CONSOLE ]]; then CDEV=$_d$_u CPROM=com$_u CTTY=tty0$_u return fi done } ELFa(4@1"4 (44444< bR KR MR GRkR gR  mR wR $T0@ (%T%@%T!ER00 !T00 @0xS S *ST8,0 (rC800" \. @ -0L00(@d@ -0L0~0(@,@ -Lu0 -Lm P00@ -Lb0@ -LZ 00d@,@ -LM$`K✠p圀&} @PP @Q` 0 D C 0R00 (0S(@@؟0 R0 ,@d@ -L B -L B -L B -L B 0-t0LP d0  a0R00BAq 8@0P 0R0 : 0@,@d@ -L1P``8q8L  8PP  / GU0S jP00OU0@0V 0000 00 0U0 0 0 0S0|0q 0  `]Be0 f` R*Rb 0 00d@@$@0T 0-LMPK P \0: S D4 K@aP0: S S000K0m @ -  np0 0bASPIKAApP  ,0INK0@D0@D0  t0K8` 4 p , 5P Q0-S 8> 0, 垧p_- -LM@pPg y`P 0S nS0oS` =<PP00 @$P @Q  0U0P P00 00 X 0000X  ^>U 0 Q00 ,Kȱ, ?R0S@pQ0"S4 0?>@P؟ld| -LMp`፬P@( P(K,K  0mP(0S%$KMЍ  -LM0S S SL0 0@0(( Kh0hd< -0L pl/ -Lp,P`@P 0 `$00$ (0@ -L`PVpֹ@P  0IYp0=  m譶 ( -MLMFPa `P N@ 㟹P $@TY  1\'tP tJ@ $@TYK(PEPE)0YpP10S0#3P <PPPUp ЛV@PFP$@T VҬ@唐PK 00 0`/VT ,  $@T(K.@@/P/dd -L MH |Zp 0 K, d$0@@0 000 ?P  bP@@  H4$ylp($00 $D < 8 4 0a0@ShĪ̪ܪ0ScB@ eP R r@P00SxRbRbRPP,`pWP 0  s00 2U" $l0@ 0S7P $@T 0KVwPPhBldP PI " < 20D0 80080 4 H!kps1 pR10 Zp$48 0DR0Q  RQ`Z00R00SI< R ,10SB00SP1APḘP ,@P@ @0r0 0K.<Q 00S  00 $0SVPH PA0pK  0KXP  RP`Fv@`~kU(Kt`-t_p_d/pMЍ -0L Ѥpl/ -LM@P` 0`J!PpcN0SWZN 0  婤4l/ p-LP@)`PL@ P  /P@@V/p -2LdM0ŸS2@P |x2T ,'P < 00X@80 4@ 8`K0`pL0 H@ @r`0` ,p  8K\ X  0\K 10 , @T T * @  0ᥘD @ 5(TD @0 9#@0 T * ( 08K 80㐃4`T㐖) T *  0LKd `  L@$H`d `0 6&`` TD`K0d`Kp`p0`K ` p p$ p&<_< < P0Ro(KdPD\Y@ p-LM`K @Pp & |&KpO -P 0`㓅p @E$0L0@!0 @ !k -L8ML L@P  0N& P`L@L00U@p80 4@ 8K2Hp D 0pS@p <  LLL @T T * r 0ח g㐅T㐖) T * ] 08K—`p R80c4T|' T * F 0HK@P ;H BD0S%P 0P@ P%@@P)pP$ @P ~P tyPPhXfToP8jP 4 0Gf -L 幟l/ -LM(`K@|p&PC Q -Q1@1@)P@TVq0P@|؟ p-LM`PP 0S @@@|P < , 0P @ ᰤ@Zx 0-8@PL 0S@0S0 -PPL 0S,6nS0oSP  0@ @,`P T0P@D p`Pp`,Pdl 0-d0L@PT 0P<00s300S @00S0ld -0PLM` 5 PKp%`  <`p`3p$@0v03T0Sɮ؟ -LMp$K'$`PbP ]P U@oP@ -L0MPp^!|70S NOZ aPTQ!t 0DK!07 0DSH '>!``W 0S`V   +!0@PT 0S0D&6` 6V0!\V0S N@K4Kl 4 00 0P60K!DP14& 06V@ T P aP `V  5Q`% 5V 1 `|5lV%\ D50S `L5V4l%0 1@ ` 5V <% 1 `4V% 1 `4V$ 40S1 S 4`Vx$1 P40S1 S P4`V8||$1 40S1 S 4`V<@$1s 30S1 S 3`V$1c 30S1 S 3`Vx#1S P30S1S P3`V8|#1C 30S1S 3`V<P#13 20S 2`V(#1& !" !  !P4K,K>`X2P4VPB@Q0"P |PQ0S1S2S 1`V`Ÿ\X"1P10S"82R 1`V "22 `l1VXP!2 `@1V,$!2 `1V!2- `0V!$pP 1 `0V@!1 `|0Vh`!1 `P0V8 40V(Kdv :ț  (0@L`XlxLPDx% 8 -)MLMh KA A`P@娒P+ #T@U0SSP@ỡNK@D @D``P LnP:8`50S2 _KamPɑK Z P K  pP20S @K_KZ PŸ 0 @ PPT @(K@! <0f~K, h pG0 pGq2, A0S @@,0T aL[ p@ P 'c߫ݫMeNK@Dpa @D0h!|@x\yE0S< H0SoE0S ? ṫᷫ0K eP1f00#4 P KA A+bUX00S NK@D @D_KlPE(K s\dvd|C(0<Lt -AMLM`D!Pp 00Vp@4 `oP* aPW AP NPRdP fPMtP+ rP sPE"vP5 ,wP?44D <%@:LPx/ 2p5#0S'*T<P@ "8@0%0S$ 2'P 4@ Pp$~ap40PcAU`` U UYB X`9PDP DP <P)0S S  P  PP PP 4 0 !0  0)P `c@P,K`P P@ dv,tP,POU20SBKAA繐P@ݤP T B^KPEPPE) P@, C 0  Pzc@P pP\ ,0@t00,000,0 ,0$ac@P tc@Ppc@P PP P P 1H! 0 0  0`10S @0lP<P@ 0@@|`P0V0X0S UP\PP 0 KP@ 0P OpC0S=r|p_dpel\d -$ D@̂XMЍ -L ™l/ -L0GM@K0$<1 4q41`P oP !`p0 0bAS`GK0 A A0 岏P S GK00 A0  A0K &PCPl -Pd P\ CEG>K 0C 0C8 K0.-p_t_T,|`0 -LM@pPg k`P 0S nS0oS` =PP00 @᲌P @Q  0U0P P00 00 X 0000X  /U 0 B00 ,KV, ?R0S@pB0"S4 0/@P؟ld| -LMp`P@( P(K,K㔘  0mP(0S᳨$KMЍ -$0L0S xel/ -0Lp<0p3 P``0PP @@ kP sP aP @h@ P ^pL00S <0U8 0#p\$e-MЍ -L✐MЍk0@-XP @0 S S 00 ӑR\00 \00| - 0S Br Q-0L(  Q: /0 -LMP`pA $K!@A0S 0S $00TS#T 0.@ -0L pl/L -kMLM@Lp0) B0@3S(TTT8TTTTT TTTLTTTTTTTTTTTTThTTT4TPxT$$H>  <> 1 v~> PP P " =gd? T?`PU@ 0!0T PP U0U0T0Sx M.?`@fPP >@u8=.5(=b$= .=[ ='= < << <<8.<@ <<. <6<-P 0S@0K,p@P4|( mP``: S00V0S# 0rS0P@ VP@Y 0T *P %P 0?00 X*0: SL,   S< ,\K@ 9`V% @P@TDP pPT D0㔃#K0p0X0 h0pp hp T0 9L9\8` ,9P 9d @Q RX T90\0 V\ P Q R T,p/]P 00B0R SQR  00B SQ `RpRaPBP0S.S d t300 X0S 0S d0S `0SWOK Lp`&RM kl`P&d u8PU 9 @@00@0 Q00 \00\0 X0S0X0 0S(|&v d0S,&nd `0S0h&f` d ?R`0??0` d0 0B R53<3:5Z50S 50S50S50S Z 50S,6e   50Si 50S k 5rH5 Z0S00 S0t0 5P 0@ P015 13V:3P P* 4 R 0BP 40S|0 4 R Rx 06T40St0 h40S \4 Rl 40ST0 40SL0 40SH0 30S6 0p6 v D /ぽPgNK@D @D6`$*P * p  KQP0: S@K0`p 0| W V8hU 0T&K 0h x0S0x0 ZS|`tXP3V>P  XpZ x6 0<Vv & 6 @ r *0D0 & ~&F0G@$v6@C#&R 3R:Z6XV2 ?b|2\@LW6vC#00W #*Y/ L0S 2嬆X H0XL  Lp2Q &R@FH RD2TH@ (2R R H 2R T@F|0S~ Z P3T@1|@ wpedeTeLeHeADe@ehQ:d` \05XQ1h0SP T*(LTD P  H Q B,5`VDKD0K8K80 4@ pZPP h g>KR0C6 |T x0"& A c% Z``0S00S H0S &R X :@X  0ҧ &@ &0ST#3* np&H'0P &0' <X ZH 6R X0 # 00V0|$!40x00t!40p!4 0l0 0h!4 0 d!40 `!40\0#̠##0X0###Ƞ0 T $0""Ƞ"$ P @""̠"  L!$ H!$ )0 `(00S480 @0 <D0v> $ 0@0 (  4 p(08Q& 0( 70S 00 o0(08Q @$T U01U01hL04S X R 0XU0 RaAr1U0!1!!!!!!!C| X030#X0#S hbQTPl0 0 Z0S0 00 V00R:&Xd:Q (0 0 520#$ 00 0 P B240#$ 0 &p, 尐0P , 0' Z600X:@+C(KMЍ` -LM04PKpa@d 04 `] PD 0`U PG p00@TWP`uU3<U-P 0(0' 0FS(K P@ V(00S xV00(@ ^U 0(P?P@ -P 0(0 0$K P-L 5'2'p -LMp0 :ҸP0 000K0,K00 e aPPc 0S` =㾸@P l `cVT廸PC,00HiV0屸P,00? 媸P2 ,0$03lV圸P$,0 0)oV咸P,00 勸P ,0(00S}P0, 0  @P@Q0Sy 00S(K" 0-LMP 0XhP@00 b 08S @O@/ 8hS  $ 0 0~0 +00C -0000$ 0 0~0+00-00S $::  00 $ 00S <<  00 0$ 80 0= 0  K$00  0$@+0S  $", 0 0 $ -LM0@S00 K0 mE0 0`t -LcEPot $  -LVEPnt 0  -LM K00"EEPώt<  -L>/h?0$H  p-L ML@`0KP u0S 00KpP  p-L ML@`0KP u0S 00KpX  -0LS@ hK 0 << 0 p-L M@0K`P }u0S `4C0 0Kp`  p-L M@0K`P au0S D^0 0Kpl  D0  D0 -LM0Pp0`-S000P(K 0(P @P 00S `Tt0 0 0S0(TfKx Ŷ p-0PQ`L@ 꼶P  00 0 0 0: P0SP ꨶP  000 00& P0SP ꔶP  $00$0 0$0 P0S`PꀶP  000 00 p P0Sp $ 0-,PL0@S '>000@0pete -0L0CS0 MQl M00-00Q0^   ?00Q@0 0^0 000hê p-l`L@PTX0 P-~HP8&0# ppeteL|C -RLMp`P 0BSp x    PL@|-T Z@ @T =h @WZ P8 Z08Z 8 Z7wZ 7nZ 7eZ 0]Z t7TZ@ T7@KZ  47 BZ  7 9ZPP? 1U 6(U 6U 6U x6 U  X6 U 86(@U  6 U 5 U@ 5@U 5U  5 U p5 U  P5 U 05 U 5 U 0U4U 4U 4U t4{d@4UL0pU04gU 4^U@ 3@UU 3LU  3 CU3:U p31`@U H3 %< S S$  S  S2  U  2 U 2 U  2 U  |2 U \2U <2Z R`K 0 P0d!@Ty.vaPKZ  \ 0wP0t! UK2 0P `A0Kdpd0\4!U K!K(KP`lx     < L    t  , < L x  < l L \ |       ,       4D 0     @ P      ( -0L 徊㐳pl/0 - h3hL\Mp| x a0@S( @ p p Px  p"0S|`A|PU"Pp2x@K |01x |0 @Ppxr@PXX!D xL@PDW `00|00S?p xKD0t  >pZxKDt xpK0|K`,Kl0 h0 >P6qP1P,|0@000C S1 q,0@SP |0 > ˲Pl P2|00|0 |0Ql0S x` K?Pt㹉h0S x\4 K$@PP[(K-p_-`ht@p|ht@gtMЍ -0L 0Ἁ㎲pl/ -MML Mh20`S@PP2P"K\D20P0: S IT2"1Q0T KP0: S*=pPbNNK @D@D0!p P`1: 0?xH*KⷴP'@10S#414!Q(1K0P: 0R 0R  |0R 00S, O'00S ᏴP20Sp00S {2 T0c\ 0Q PP  ~Kee|e (xe8 -LlM`@d=pPЈfP LP PP@ nP sP hP91P P PP萟蠟pP YOp00 cR1P R R 1@KGP d0: S`  P`P`xe|eeet-DMMЍD -LP(@`pB@D 0T( p 0@8P 040 ,0 $0  0P?>>p= *Q-LI7< @@0Pຈ`p 0@0  VUP`Wp(0 4p 0QPK 0ثQPM  0̫QPGTQ000ӑ|  -@L|tld`c T TއH@88 ԇ㦰l/@+++,P,,-,-L--- -LMe_~K@ oK t K l0 d d0 \ 0 D31 2 ,1 2$1 2 1 2`1 2\1 K`$& -LM(Qt ,Qd N0QP 4Q0 8M0 80S00, < 807@@00@4 80CW@<PM0PP0P (EPMPM0``0` (6PpMQp 4p ZP M9 @@004@a00,0 9 @P@`0` ,M9@@<0P ` 0@VU,M0pp0p p9@p@W0<p `p `P0@XW,nM00 44 84 R20P `0`@p 0p`@P@ @@P8 0DM84p\a W4 00S(K--- . .4.d.x.../8/l/ 0-LMP@P%00 0 00A0a A S WAR A0A0S7 A? K Q02^0A@ 0K K0 M-LM`0 PP@T t 0 00 06m@K. 0-HLP჋0@S @00,0S0/ - L@0P/ -BML:M 0D 0'Ƙ0P@4   @Z``@@TBKLL4d H 8d HR8$P0 8$ 0H#㍮P 00P<  0/S 0<4 H@Pw :zP( 8dLl00PxP,UY Ty9PPI@`P JyP90cC10P @T,K9 D,00 PS t 80L#[ 9\FP0  "Q@@<P000  5P00000  8L44044 PU 0S00X0P` @ ,K0 ,00 S|8 K00\0`@PU 00S0V0S(0 KIP 0 0BS(ʑ8K4$0 4$ 8߭ǟU PP խP G˭P P atP0,K ,00 SP;;S( J婭P 0,K ,00 S, 7喭P 0,K |,00 S8w $僭P 0,K i,00 S0d DpP0,K V,00 S4Q  08@K4$ 4$ HUPC PP> KP9 FP4 AP/ <P* 7P% p2P  `-P 0aC0S0S 8X :X08ʑ 8J44044 U8J44 ,K`0 ,\  8J4$ 4$ "V8dJ44044 ,KP0 ,\  8J4$ 4$ "U2`P1 C`XpP wP3"0cC1 @T000C S000 0,K 0 ,0S00S 88J000 00"02pW Wr+Vo ,K@0 tPP`a TL ,K0 e000 P  @@A@2EV0 q,K@0 FPP`3 T _,K0 p4000 P  @@A@2PWp8J4$ 4$ 9,K0 <$R Èx0 8I44 HD$iPd 4$@T$@8 @T(KxldH////D/ /00 0,0H0X0pQx000000000001 1,181X1p1111 -1LM99: -LM4P @@0`d0p4T @@0P<0@0 ,00S 0 Pjj k@: -LM@ p 0P`P, imBT 0 @f|4 -LP`LpW 0@-+ 0JP 0d? 0LLL 6@ T0 0@j:j:::L5/ -@hpLP` @RT`7< @@`p@`{l p-LlM`KPpL e@P4" , s0Py@Kp ;xrdA5 -@LP`ppP dP @@Tx -Lh ;4; -d2LJM0S @K 38Ÿ 0S00Q0SP @10S 1@G`A BCDEFP  P`@P@TJK0!@g'@ tၢP 0rSJKL!D1@T/p@P@ PrU<000JK0@ ?PJ~KpG(0K@K 0LaI0`P P$K2\a0 tuy@T ^ PkyPU(Kllkmk?0R??-0 CR 0R0 S]@00 0-LPH z0S S 9 @@00@0 20018\Q  0Px0fL@ -LM (R  P`P`20 @P`x0 @@0P` V U`,` 1Z,  0 @@00@0 @P0`@P@0` P` P`ZY P `VUP` R 0 0 @@0 0ZY  S Q R Q,P2 `, \,P 0 2 jej -R`pL`b9 @@p S R  QPP   0  p-L;P`00S@P`0 0 p -MLM, 0Sfhp0@p@P0p `p ` P0XFWD,00 c 0c#r"Raa  !, 0y, 0tBNK@D   (Ku^P 00S  >'4[($[ SSa B RR,2ࠐ, ^\(K @L54/H@./ M-AML M@ @DB^K8@PEfĖpx@P D(K 4R SB@,4[?Sw ,$[?R *R+4[S p RT  pD(KP$UR\500 ӑgRT bR %Rc &RcRmRB tRI kR@$D80 p084 4D @D(08 4 @sp$E@(0 S 0Pr`0Ox?   !5;BE Ú0(@K$ p8 4 4Bc@( @( @( 0㨚0p8 4 4EJ04E,t[BK@-W+W@00p  l3'8 4 @7< @@0@BK@4#P0@P04E,t[BK@-W+W@00p{  2@8 4 BK@ 0"@@B8 4 p,d[BK@-V+V@PP(@KP$`. 00R @P& 0"Sp0 ,00S  p00&Z Y ᡛ 0y☛ 08$44+Vpp-V pR@w00 x  @ YZ< < 0j@80 0$ P`  0j' 0 jp5A$ 0S @ T S5!"p@\  pW R0D 0 (K./t@/x ?Y@@l@ -1L(M04 S8 k 2 RfP 00C C  P/0 , ȟ 00 ,0 @P0,P@ @P00!4 PP`vpwu0vwu4 ( @PU 0Tj xu0t 7#@  @@A@@4P8 2@(Kk@@ Al/ A0AxA -L$M4 0 , 42 PP 0@ `p@ P@0 $$! @P0@K00ppq pq>u0P 40"9 @@00` p0W V 0 R 0|l0u,@Q0PP0 K H4u40@"(KLA A Al/AjBB -LM"9@@0`p\0!@Pp @P ppqZ wxxU t1R Q\0S 0S<08 400t? B0P 0P,T)S& 0S"0S ༉9@@p0P` PU`PU` 0@TS@ "Pi   0 0$t(K5B A Ajjl/CC -LM⸁`p7< @@00@P xt!, 0 `pp,q. < 00@ T S7< @@0p pW `PU`p0 p `, cpP`,q(Kot< 00@ 0S @VU P 4$0 `@`dTPP弤(KjCCjCD Al/ L1-LDa@pP@ U$!  bZP"0S02 WPP 00S0`00{0@T ^ :ỼP@0 S0?SU S+ 0?S f./\D/ S-Lp!0Pc UP DP\dP uPWX 7< @@0(P4P8`p@ !R  `Pr uf@PA @QT მpP @T a 0ttr0/S @@ǂxP8 (0rlld|E Al/ExE -LM2, pR,A,!(P( @P` "fP`, 2 @2 @ PXV& `@P 00 Ppqr pq``yr, 2  @,0" 00 (KEF@F,F Al/ AF -LHM2P L R+P@ 50S| 00C C`p  G`@P0@P @PDPH0P$Pkp@Pqpp%rtuPPr"QP( rWVVW X\TP @Q< R XY  0q0 Kf9#@  @@A@@PPLH 2@@@#0NSnS PL2  )8 \0 40 @ 0 0C C P0("@P00@ ,P S0 S( 0 K f0pK0pWP   W0X 00 L P0 @@0P`PU` p `P弉pP0L@r0@@0P  ` 0@0 K e PU``P9 @@0Y@PZ 810S0,0KP PL 42 80 P@@` 0@ST 0@T00K`0O&'"< 0H D Q@ঞᆁ@P X0 T@ D (KkAF Al/ AG@GGGtAjlGH -LMCDE@FPG`@A B0ptP@ P`` \0P 0S<<Khp/P$$ pK@HHx0 Al/H -L`$@P 0rS@uq0`0PP` !0S`Pla00C8SS PLPHQ@@KT@44pT(10S * ~7젟p PP cP00@cP@@T|ip@dT@XX`pT0S< , H7T8HIL I://I I/hII -LMe/oKcH5H044!06 P!   (Ko&pcP@P u@` P@ PT`U" cP`@ PUTo@ PTpUhT0ST D 6 |2`p,@ $P0 0 `ppq pqo,`p0@#P0 0 `ppqi pq@ho0`p8@T#P0 H0 `ppqM pqo8`p4@"P0 0 `ppq1 pq`woꘒ484 7b@< @0pQ@PP@P`p `p0 (("p0PppP` qIo oKe/n[uvx=o7< @@0pV  U x0S)0S&h+#R Q0S0S 7< @@0p 0 R0SRn 0S0S`dTP@C 0C` F   ! \1SU 0SSPPQ N 0@@0@0  B 0P@`@1p p p,Z#Y!0!@`@v_K`0@0@ TḀp S P `PU`A `P klkoK ~  !1 R! oKe/(K|NM@Ll/NNNN Aj,OeQ] X:gQ\qQ mQ` iQZ lQsnQ\ pQcuQ] rQ sQxQ zQ wQi P Ke/r 00000C0y 9u Qr n x P l&0<1Y@B WP Ki 4 P00 !40 @_ 0qM 7 0K0, 0 KrP ,0J7  ,0 `0WPV(KTTTUmUU8UXUVU4Vm 0-0L@T 500S SgPڼ 0P0# ;;S 0@ >gPp0 @ L0P@TPy0D 6 06@0mmmXV|V 0-T0L?M0S@00S ?KK0P@D?+gP 0K0 -lb0LPPP2 P@8"000"0P002PU GUE&Pڀ;;SB a 0!zQ8pPď P01@P1+0S! 0S 0ESP 0 SD,6 $1 0S 0S 0S  0@TT0 0 00TSPP T0 5 |00t 66 l00Q PL585mVV|VW(W`W -t0 0LSd0 \@ 0y RxP $ 5W -3LM0S2 2 2mP2y 20S 20S 2"2Q 220R0S d2BP 0: SH0D@@d2@X20S L20S @BP001I2P K T- 0#4 1 10S 10S1 t1 X1 0S<1 41 R(1 DhQp0S1X!p0p00000S2 @0S 0 vp`V 0 0 ,PƋP0 \0 B00 @00@P0  0|0pKmmmm4nx%Whnmm8n0nWmWmX p-LMP K`@P1Pb T q# 00S 00SS( pp T  W#T#@O#L#d@ trT=U 0 $P 0jbKp\XlXn|X9XXX -L M0U@pP 5 005 5 5 5 5 4 Qd`HTT$4@  $P 0$y4h4pG 4Q !ATTS00#3 #OP 0#64#x3 3 830S tCP P 0P#4BPUPWX00S( a=0,ST!40 RTSa=08ST TS0 &$Q a=080QR@0h a=0,0QR404  RRQ KLX-0 CR 0R0 S&00 -%MLM0\D,0 (K@@D$刨 Pp0[/S !nK`F`F0XC/S/0000Kp+gKP<%0#o10: S $1&PPq%Pl30S &P1%\K(PEPED0,0 !`P$0S30S$ :K<5/Q  +K<P 0@KK @RP` x"0" P-&PPNK A PG42P(20S 2 0Pd0S 1 1 00 R!0 qP4ڠ<S S 0CSMP$$!(  P, K@!(=0$(@P,`K.  ,% # 0S 00S 00S  t%|0 PB t n'#t(KLn \]<]Dnm ,P <00(` "# (KDnm00K`PPU`P`ఠp 0 0bQPXQ0 QP0PU`00VU(Kmmmm -QL0S? 10S?(7P;P1 0@@Ȁ`Pp0C PڔP0o0 @ R@TP(P P@`@`mmmma -$2@0PSL |"0S0000Ps1 11 a0Ÿ`0  yF1#PYX@PPN@T PU+T)P1H818!0(0p0P7000 0R`:``P&0 0 0 0 00000x0h 0S @l 0@P P0 @q'0n0ammmmmmmda -0 0LS0 0 R ? R?;ʂ;;S D 0 0 P2 00h$0cc -LMp`, T0S000Z PP0e00S @@T*0S Tw /0hQ 0 $`&w* w@'RJeP$ g0p mP  0P G$` eZ,0c @pW dpndPdctn -@L!LP 0h"$`d -*@L"*c0IP 0h $`d -L@ TPd0d|zP }0SD00S)P p0 #hnmd -LM@0 cfPd0dMzP N0SD00S(P A0 #hnmd p-LM@ 0KR`P$K T00S0(0 D00S00 0KFP0 #Kpd -LM@\D00S 8;a- 80 00 n -LpM0@p10S1P@l cp` W 0!H#@\K⣳pP WR 0\!9#@K 0R 0R$ 0R W<  "7Z 0 *:"*#:R  X00S  t0R p0R l0RXt00S  h0R d0R `0R 0 <@@(Kde$e 0-LMPQ@70P 0 00 0P0Q0S 0;0Q0 00St00S a-; 80VP.0 0K0h"8`n,n\e -LM(KS@0K \00S0 0 L00S00 c( K0FP0 u"Kd p-LlM`@K{Pl0PU\0 0R |0R  x0R  "Kpne -LlM@0/S pK/00/xPP3 ``0/S S+ K{P J{P/00ŵ| 0S  0FuP2{P 08 *(K`n? p-LlM`K@{P&0PU0: SP V `d 0!|Kh zPN 0Kpnee -0@0Lk&kP P!0P pppp P"0pS  OP0$ ! m,0e -GML M`$0K{I0P 4 '{ I `4 $00CS\\d#wP#0S d( Kp@0 0#0H!lC `KjzP x#0: S bz$R+ pLzz43 |F >  wP@ KyP:x!0 4sP0L0 S 0   1 0K 0S00S00S 0+ 0K 00S0P +a8 0p(KhnXne4(f\fm,f`nnff? -LpMpPK@nyP.D10SI 0R  0R 0R 60: SP K PyPX'0  ꔐc 0P 0`S P X 00 @(Knffmf(0 P0C 0 p-LKpM @`KPxPU000p 0: S P~@ P 0g@P@PxKpg8g0 R00 -BLP 00儢r"@Tfx"0Sp2pP` &`"0S 00CS00@Ӥ03@t0Xy /S0`: V0`0H 3Pc  uP@'!0S0  0P ``qHA0S 00CS00Ӥ0B3P p %U(20S@ 0S0* 0S 0P  0Px00x  H0 ` < K0Pc .(nm /hgg@n4_gm -#LM0PS 009Pb { p 2P P0S L"P40C S(\L0S H > _0 "]"0!S0@@L LHl ᗒ0 `: S'  S"  S  SGC S'  S=  S@h1  H10S8 01a-0 8 ˅(1  ( $ "0a-  000+aP 0 0<f0 L   p0 L@p 0  P;00 D0 (Kmg ngg h(hp \*0/S0C7SC-p 0RP`C!CR00 Q0%2>&B P`L 0S W*` P0@ 0P!00*0@00P*-S0!P \P0307 p-t0LM0@SP }TP`K 0,3J0S *JKp/ -LTMp)a=0`0@0@TSVUd@`@a mpPK 0@pr<0PpK0@K) 0Khii-0 CR 0R0 S00 -LlMDŸ@Ÿ^ \P`p^q Ip28Ka=0  RQTSAAa Fm 0@xKr1PxK0C@#t1P 0P8 KP PI8100CS (1 ,8,$8 #4oIa=0 hIxKqI00S y Z0 0BSRWI  h00S [ <1_$K(nmhi,0 i48iDi/LiTi p-4L0S$1`@ PP>000-S 00 00 00S  ph 0P0P! P qP00:U0S ll00:SLQ10 0 $(0H?Ppmp_m-l/\iti P00 Q-L0BS 0ZS 0hS 0qii Q-L 0S 0S z0pqi Q-L 0S 0S Z0jZqii Q-L$ PXHqii 0P-L 0SMpPАРP(>,p`P=p@P \[ P|,DX@P0VPPS0    Up 0S,XjjHj -L /Hp`jl/ -L %Hpkl/ -LlM@P㐀K/p@EM`0@P 0pSFsP  P0: S 0( Vp$Ks -LM K`/ 00s@PIrF 0SC kR bR&mR wR!$+%$+*$&U*T'0@P 0 !$/UT0 0 @P 0xS S *S d1#pUT@P@P 0-LMK@]NPP00S0#3 K+Pp0@ 00S S00 iZ0P@80     B@ᅍ0 0 C8/m -?LM0O8 < 0oPo匟p 0 4 00@JS' 'T'T'('0'T'<'H'T'T'T'T'T'T'T'T'T'X'H&T'T'T'T'h&t&T'T'&T'&%&T'T'T'T'T'T'T''T' 'T'T'T'T'T'T'T'%T%T'd%p%T'&T'%T'T'%T'%%%%%&% &&(&T'@&0 (^(NP  040 = |$? = 0-S0Spm ph=Z=  =0  -00-=  P=PUS X-00L= (-00-0E,=1(,0 00==  X  4 PN P4 [`40 C<00< 00< < << <0|x,t<ph, `<0#8<L, p=WPK0S 0S pP 0S;0 -S 0Sp W\;0S+ +;8 8; 0BSQXn0B< SaXa40HT040 3HnP/@TL *`pnP[  UMPP   P fPnPkL0S  @PqnP  R `00 )09P` XPY à9909Q) 9P ` P\qZ4 H@T 4 6x4nP2@T `P PW8#nP P (LPP  TPBP nPK0S"  =@PmP Pw P"0`00 P`w@0XP]88儧P0h00@JScT1h1h1h1h1h1h1h1h1h1h1h1h1h1h1h1h1h1/h1$040h100h1h1h10h1h100h1h1h101h1h1 101@1h1h1h1h1h1h1--H-X-h1l-h1h1|----h1---h1...../-h1/p膟@}P6PP   6P 6P 5P5 P %h6@P \6P 5\ ?P\@xlv`*a0BS!D....L........h..p.|.`00000 ` 00$00x_\@ R[[uPZ85Z ,5Y p4Y X3`P lP @ T 4X` -PTDd@ R8AD@@ T GDp#3lZl4QPP  <4@84@00 $,WQ4W K@lDdP0V0C ,K 1*, R6 1PV-+U0 U0l0T0"PTPSlS0#R0R00"Q008<"B pB @1"2 P  " R  2R|  B P/l @1Q ) 1 HCDr` `0 Sp,5\CP20ST00CS0 0  0 t S00S!1 h00S񟗐44554<4P;000Yphnmmp_mmiln`nn8nmDndnjXn nTnimmmmn nn@nl//Hn.@LnmpnnPnnn,nn n 0S80S50S-10S(  0R# 0R!  0R S  0R 0R   0R 0R\pp,=0 -L@᱅p  Q.SW|p 0S0C ;`W` PᚅPl 0##!>C=S0Hbp0H S]OPOP|OP@OPOPN 0 <#d !>Cv.B B 0@<#!>C0  0#"@!>BDS0k?B0  0!!!.A0r03 R0S )0B0@ 0#"!.B0r03R0S @ 0##!>CS0@ 0#!>C;S0^pq -pPL 0Sd&/W3`P00  S,UXB .UQ   w PR00EU0N@P ZV 0SP00MR CR cR mR00000X $0` R  0S P 000X% 0S" P  K#000  0R  0R 0pp K\0P P0@@@@,\ ttu0uTupuuu 0-@PLD 0SA Q0SNP4 0#S \S0#S@tP@  + # @s|2p0Q0 R 0S  ?NP 00@ 00  0=u vHv 0-@PLD 0SA Q0SMP4 0#S \S0#S@vP@   # @t|p0Q0 R 0S  MP 00@ 00  0=lvvv -@Q@0@L@ M@!Qp$`K 0^0\$0 QT 0 K0.00P:$0 ጛ -` LM0S PHp`0@T  0`;(@PU - LM0pS) 0娐P,0,`C0@ 0S 0"S2S0pW OJ ,`FPU*W0HJ  00 0 n0@-t0P0S `0@ P $0S 0S0S0 00@$J,^0  -` L0S `Lp0PU p@ JJTP` V$' -0LpW, 00S(00S$ 0CS!; 0`ݚ@T h0S0S 0R 0@S 00IiI$(  -L@LP @08, 0AP mv -MLMx10pS`V `10S 0/S BKAA/P`0 & $1$Q0QX YAP 0@K,K ㅷ00 0}0开 ,0%>P  K ,0 0000@K$00,K:2 ẒW00 0P(Kw m,w -L M@PTp5 '`V- 0S0S$0S (0(`S Q aP P0 0@KP(K00! (00   IH(K= -1L@`Tp  !Q@@T aPPaP' H&>P  K@P >P >P @0 00@HH$ hwww -@@L0S 0RKP~ =w -@@L0S 0;KPg x -@@L0S 0$KPP $ Dx -x0L@`TPp X AT `P  fP:0E0@ -1L@`T^ 10S\ |10SX; 0d  P @U, H0S0S 0R 0@PS  ! +0  S;00 S00000CS000GGKPP D=P p0+0 0L00040 00PG( $(  px -0L: SpLD H0 H@00!$%3,10a:0S60S30S0J@PT  00S 0/S -PA0x  <P5T  G00@`V=xwx -<LJ00P   =x -"LtM0S K, `KәPi0: SeP L0 a 0S] 0SY 0SUbP 0S XT!K LZ p c  0LP9 pcP X9W1|1pp!`* +d!@0S | ?PK -|0LM0 K NZ@P$D0@ @7t@$0 -tKxnHz-0 CR 0R0 S00 0-LM@Ps0 !P))  0 ##PhQUTPE@H00S< K0h( K0h,4xP>// -@L0 0Q 0 $0Q0 $ h -L@Q񟗤8888T` LWQ6HPX`hđ̑ԑܑYWUS0SO #SHFDB@><:864;0Q (0xtUlhdN #T!Ph蝮H囮0 $#$(,"(h: Q Q  冮0S&hC <8#"h  <\Ā܀ Hp4DXhЂ4Tl$4H\t -2LMM $KP 20S  A K$@*sK2$HJK0$@D"|r*shb0d"r*s0D"r*s(20S "r*sP% `V!yr@P 0y 11{ 0z 0!`r KK$@$A*sK$J \*sT10S: ,1K 1$HȒP0 @ yp ` 0y @P0z 0y 0UĔ 000 @Pr *Zs zs  㪷$K// ЄY@<x%dlT\P -@L"T  p3p3S -LMP <K@ p* T P  `VY :0  0010 0U :0  ! p@Pg0SP 匀 \ 0RL*U0P00`6T@K0pPK0@  ` 0  @`0  0`K  9@ 0 !P l ѬOyE 0xu lP`E jP`Ȍ0#p5 ᬉ` R0 H0 0 B@0 00 @040+  ֵe  04!48#8@ <0S 6T3DP0 ER5,;px4` 0 S AH4t@P0S, $@P∀T#*0T: Q* Q:d30  @P0010U P` *p|@Q `1:Q2 QHתPU@`L*pL 0@$4$Ū < 8#" [庪PEU`FnVQ 0S s 0 @R !PR`AV 0U TX SP !08卪00@`c@'U Pm0*pC 0@$4$r < 8#" gPU`F V`l0S` P TQ`HM0D C`b@`F` @Q^d0000S  wl= 00  (K茅oďԏʚ;@@.AdlT\0o< 0488DLx|o//ŏԆ܆ -,5LM 5R00  50S#<*004 @("(04"400$ #4   !00040S 4Kp`& , X0PoP |` 4`K`p` p KpK<pPK` P0K 0Ll$8@`KX 0K@0L, p`#D!$<ᔐ 吠 Tp0K@K 0D$P#L!,4`pK0K0 @#4!<$D"$P0@l0 @ K0K0 @#BSt4  & 5dF 40KW00@000' 0)[R0@  0Q0 0 x0& 05 00(50 ! 50<2S6@K(P ၅$K K0 KPsWPL40 l4@ *0K@aWP40 ,4@ )0K@QWP@40 3 x0KAWPwC DKPx$<0KDP /WP`i< 80R<$80KP%WP,[0;CS0R(cDP#|0PWP 3QP#P`#0S0XS@: 0t o20||_pp" h60Cs6 P@H20@(H2KK 20S 2"_KJ؂ JŸPU  0Ÿ0bCP00|1 |20 Sp HŸ@T 0P0S '@0  P@0\K\0 EKAPl0K0 00 80P0 T0K0 1p0 `K$6 T0 @ 堠 P0S | $D0 R 0S:p3J(8p_4/\?xD.A''4؇!P4L-pԏď̈oo8l؉tTt$ oo@@l/ MЍI -0LS1P`@t( 0S3T 00,ᜂ`T'%X% L0S `00S 0 T$0/S 0S : 0 S /S R茛 - @L R000 ܛ -LM0 ,  )H P`4 0CL 100R 00 `0001  L0 S  `0 X1  00H 0P,1p(0@S0  Ug0001{U V   q0p m'@0 00C0S  \ 0000S Pq0 p 0000K101E(K M-LK0C 0Cp4  0pH.`<$  PA(0S| 1x Pu (0PqlT (0($4@_ 0(000@S@,3PPxx% H$If 0@S 0*$;fP/P(0@S4 0*fp00S pP 00DdKlt1!(Ph@((P$00b04pPÏ 0 0C0(K茛@l/P|dp p-4P0`L@h0P7 mHP10 0L0S' `0$ 0 000C S xxxxxp0 0 000000  00ppȚ p-8L@ChH1PS  0D P6ph 0S 0 R0 0 : SL f|00S V `\BL00SHP10f1phpxx|ċЋ -ML Mp$ l4 dK< J  0: S00h4 h$5R@T 0S + 0S mP! T  V0`00 0,0K4pdK`0 \` Xp oT0K;8DP0S@JP1 44 0S ?P $ P 0S 庡0TU 10C1Xl3x#0@S0 X3 @@d @3i0: S= D^@P 3 Ÿ0 "@_P`0G"0 PP:R0,0K\p X 2 `0 @dKA0<"',2 X200S HwE~KpG82 pG0p@P 0EKH`G H @ PG 0 0f@PV 0dQ# 0M@P|xBP1 h4S00C08 HA   p|l$r @(@101>00 00 p4sl| GK儠000S 1(K耋|؋x4| ,XxDԌx%t\ -ML Mp`@Pg AK @ @0W  V V0W 00 0S:0S:Q@P A.KHH0 Q B B4<AK AA 6K4( -LM0  -LMXb0$p, 0 (@-~P4$0S0 0S-,0T*0PdPP#0So -,@(0 TP0PPP0(0 0(04PQo0@ 0$@O$0SJ 0SG(,`YC00 P`  (0 PU` P$`0}P1 ,0Z00,V)U' P"Pd(P} 0 ``0SOPR(P 0$@ L,@D0T00000(K< -QLp/PnE8Q,0ST 0E0 @0 o 0 E@5!"@ 0$@$!0$ P 0 0SO 0$@ h,5( `"P b0 (0@  eb`tl0` A,P :,$0S 0Sxl/P -0L`00qP`00 0S0S 0 P0V:T 0Q 0 0S Q Pؕ 0-L@4d,!PL00S' `0$ 1 000C S X`PhPpPxPPH0 0 0000000S0 0 00 aR08#80 0cP 0 4a 0Ț 0 00ԛ 0-LM@P0`Pl P00 0AS 0008 8x 0-\0L @?PD000S0S P 0ԕ 0-P0L@T 4CP T00T0S 4 0S0S: 00茛 p-0 0LR@`PU p 4Ta40Pp 0-h0L0S XX 0 0CAP+ T@D*@**0000ԕؕ -@LP*00 -!LM0P`@0@U V!0S:0S* \ XXJWG@Q@(0@ 8 4 0@ @%$0" 0 {$P, d0 0P0O0 0P0O 8 K   ?00, Dd@d0 0 L0 D0 (K0(8,$ܕ  - q@4$8 00P``0 0L`0X{(@0PPQ{`pp;{0P@00 00PSE-PTA(@QP$0($,8܍ -QLMp  P W0X 00!0S:0S* hHd10 R QD14PoV;U8 a(0@P 0 H42 0R,0 0d00  0 A ?5, 0`To 0 &5!"@0 @@ <0<$0@?@ 0 茛$ԛ -0p0LWP/`$`z@3 # U*W!00S 70 t2"@#0WH00S @%0 42" h(<Xp -0LL@Tx-d0 X00S LDP $ 4@d00d000| -0L: SpP` R@l  q PRq hP p-0 : SLP`l0@@0P`Vup 0-PLM @夛U  T T0U 00- 0S):0S%:@军7ၛ|~t00S `v Lp0K@ k< (fK0,8@D|~P\ -Lp`81$0B?  P4+PP? 1 ? 0V 0 P0 00W0 0@0@0@ 0$@`p \!(,0 (4^h0h 0R X@d0 0' P8 $(00 Q ԕؕ̕t -ML MH 8`\0< H( <(  H8PPBHE4`F#@ 0h ` 0`p08 PA0 ZY8 0 0@ @ 0g 8 H42 R'8Q$*@(0D 0S H8BK!@00@P_BKAHP@  D8X:1@@K8(A!A4( L L R 08HS H<H0 0m5 @(0;H80S00  ) H(L@00 0$LtPPH8p@~  Q X啚|0@Pt0 0  P Y4X:@(000(Kx܏ԛ -KML M0S000,0PE $0: S S  S S8Q;P@K p],RKK$H0B?   ,` Hp Rg80(S00Q0S+ @0 040( $P@1$C1/!0@@ S  Idp W`@PK@pK.K4 B$ `4\P 0CD PŸT 4  R    0 , <80S00  ! @00 0C :PP@ Q xx嵙t0 l0PP@P 4 #1@`pX(K܏ԛ -L`p@\TP  *0 R  = u@0SxP0Sdo` 00C0H \<00  ,00 | ̚ԛ -Lpl/8 -LM@` <%<<0S4 0000 p$000000D$p044P0eSPC0S   P 30S 0S Wp P30S  0S L0S| Ppld30S (30SL HC0S4 F0S$ܗ 0Sח 0Sҗ R6 B 2  0 |20S 0" 0 0bQb@20S6 `rP@C P4`Uh2 0 j0bQHE B0S 4?(;@T B0S 0,@T 1 1Q |1 G0S 0KsAH10 @ 0 00T1L$1I$x1F$0S$ 00SXT T10SLOZ P <KHP " (0K pP X00S5 j 0P<p_tDph ||Ȑ-:|.Ԑ(ĚLlБp0DXЕ؛s|< -@LP@P !0 st: 0  P$` P, 0   00C0 P 0 0000C0@0 @$P0P%X:-(KȔxHԔ$(ؕXH\|ċЋt\ -ML M,0S0 R0 0S-0.S*0@ST H)0@ 0 P8  8 )L0Sh `0e 0Sb (00 P89089 U(0L 01 R0*1K `000JK )1KX0*a[S @d7P T8 / 0@`T0%TK8(K @T8(K` T,0@f0,07 00C0 p@6 P8  8 ,0S.pP L0S0! *K `0)K0)1K(JK W,Q0 0 0PF0b(K0 ,00,06 00C0 p(K@@@T4 `V .7P+0@ 0$@L&L0SW `0T 0SQ @&`  P8 8 EV%0 S Ɵ  0 S ş  0@ 0$@0 $ş |\%(K>K$ P88 ,00,0P4 5 00C0-0S(  R(0.S%,0S"R$00v P8 8 8 0.S$00@d P89089 8,0X$0,00S`p0S: QQP ğ 0CSsc< 0 0AS      ,0Sڴß0% < ,0SQ 0S 0T P< h0 : S0000 0 0 ) ,0S&ڒ~KpG pG@0 00RnK@`FP `F 000xx""T20S d]H P< p ,0S00@!L0SU `0R 2 0 0B S      (  0  8   0 0 000000Q, 0B S            0 0 000000 00Hpp P8 8 |0  00C00(<Q89008 (K贕$ЕDMt\(Tl̖ܖ|4@hȚt -HH1 0 BLF`PQ>  0  !000S4 000S. p@00 000S 0Wp` Yl 0@ 0$@X0  00C00 0 0 0J 0Z*ؕ -Ԡp`L,P$ Q00S8 0S 00@00+T  R<0 08, 000C0`pGW Ěp -L@@B R R(1(!!  !>j P 00C   ippWto``Fe`h@G!_v3 0@4l DTh`0@dh褙ԙ/ P-L@ ,00S fh|~D -L M3X㠓,  ;+@P|c+ M#`3R,XpW,D PU,, +'4 0@c00 oh4@A ?$4@2 0$Ć4堤404Zh4Vh04(QhX?004Z0d2  0 TB+?0S2PUy0 000 0 00 000 ,0,00 00000 330 330 330 330 @0L@00 D0QD00 550 550 55 d00d00d0d 0 d  ` @d0 00Sd0\,%'@P+PfP 00S p`P@ 0R@| aA| T,` 40 (KtܕS\ph̚< -6SMLM@V`@6K`iP9nN l0: S TaLP ᰋ46P UN ,yF0S$ 50S㖋P0`S850S  %0@Ue5pp ppppO L0S PP5HED tP8%(0<00PPEPԺp xP @:D0S40S4-K B B0P PP@  ,%854# 20TP@0T0T LğLHğH$DğD4D埈44@(40S 4 43ST# 3R0S c$(0#@3P8PP m3#VmC2PP83$ R TxB0S 20Sl2MB7PPT`p4 S  ӸĔ   P VHP `P4UL2 00B10@L2P@U B(2P 2P>1P0@/!0PP04 21004Qx1 l1 XA0S@1 P1,=곇$Kx|Hܕ|ě̛ܛ8edAltDȜh0 h0<Dlĝ?ԝ@4ȚX|ؕ̕ԕ@-`0 X0 B@ Q<0<4 0000Pp -L9@e㋭㈭/@ -(L0 㿑0  hw < -LDMRl S V0W00l  PU10000C0Sl  cMX@< dK@fl0 JP0d0 l0X ,@Kh Y0 T P 1`0 100 \` Xp dK$ 0T@K0`0 \@ XP T` Pp 0 dK #Mh0 @` DJ D0R/0h 0D:\`KVWH0 V W h ?00bh l0h  a&J(Ks\ 4t\ -L,<pPp0S 00CS00@Ӥ0S᳨@t@00S0#3 PP 0h0 0S0 0`00<00SL06#3 0PP</\hd`/.PL.XT - P0ĐL0`p@T z'PP 3PP|H00U T 0S0`00 G0SX.T@/ -L`x:Qpe 5b0@S*FFFFFFFFFFFFFFFFFFFFF@@@@@$1 1@@ 0Δ @ 0 f1Pp萟蠟@ p0 0R000S00S h00S\00S`00S U4P LD0'묨hP/pl/Ld\`-TMЍ -LL0 L \ 00 (0 $0 0 pt -0L0 t -0L0 t -$$ 0L00  ptQd d00A00d0ᨤR0R  p-L$M<@K$ a] C p a0S0 ]0S*,P%[ P( w p(@`ph<#P VXM} T`I}PE@TUV ( Kp|i$d|C -@L E#l/ij -40L0S$00S  0 茤x 0-L M@P 00S00S 0 QP K<& RP P *@KD HC80 0QKnp$ K0茤x$|i< -L M K,0 AP$0`Sp 0X000 P00RPPU@  2\ -\  @A0SS c020 K\P p-L MK,` 0 AP0S 0V000 P00 R0S P0  [ PBL0S S c020KpLP -0L8M0H@K8 [ Bx0 p̯P.0STRP 80K@0@<0@0$ ` Kl|8i8`(p -L M0@(0 00D렠(K0 `4(p\  0`1<@ 0@ <0<@0@ L0@$Kl(ش p-Lp00d `<@P`0@`@@P@80`D0@P$<L@0pl( -`L MPp@Kp P$ B1 @P 0S 0ԏ,0 $$P[Kġ|i $ -,0L00Sh嵏t08 -LMP, 0P ,`p0  R100 ӑxRP 0G`p@TR X 5!PPJY t H0 0D 0s 0D0 V Y P8 P4Y 00D ST00ӑW0A 200B SR0000ӑW0C00P\T00X0S  0PP0,0 @cT dZ@(Kx .\t -QL(M5K ! qZ00 0K  # eP D@0@ 50K8A00 (50K0]PKġ|i  -QLM@ K DZ ?4PP冾 K->&@K4  A(0 2pi K贵|iȵ -|0L0@S h ? R00S L00  >,0T, @00 0 0 0pt -\1LKMp@DK QY0W@0 < /A P RoK`F!@AP /2 00v0@pD K$0K+P  0s$0 R  k=0S 00S Q  R ("(04"40$$} K\.ص-0 CR 0R0 Sa00 Q-L X6 p`@ -0CU3@% R 0S,,(0SR00ӑR00Hӑ@ 4 R @0 S0S/x / -@RLP 0S 0y yTC 1@0S<p `(<0C3@ R 0S,x ,н0So|ǽ@ l R @0 S0S400S(>hT>h謽// p-0LxMPK`@ KX00 @PPK1P1 K0400  @T0S Dk @K< ?00 (嶬P@Kp|i@ 0-LHM\@KPH XD p? l?(0 哬PK0萤|iH  0-LHM\@KPH {XD O? K?(0 rPK0萤|iH4 p-LM*@KxPx` YXh @XpP  LX0 01KJp Kpġ|i Di P -L M K0, @$0 x\p  0ό06@K|P`x  `Xd @pL  @rK p0 Kp\lġ|i Di P -LM"@K WTT0 L@p [Q"0[S "0[ S TxKġ|i lt -LM0@KQ W!W  P >0 徫P - 0+x`p@P0S  x0  x 0S-|-U0lS  PKPU@Kt|iĶ̶/ض/ -81LM@8Kq`P  hWV@! V/gP  0`p@ 'PK 0<P !,400`BP#@P 0 ); P t Ջ$KL̂ص -2ML M`K`K@KH  W@ WH =K0C 0 Pn` K0 Q( K18 PTwWKPw10S 2 劻0S ^KPE`@pH`4@K"M1P<J 2W[H[w[ᴇ[ᰧ[A1[[f[ 0 `w ^w$ 0S  M@HP0T00S xTw@`PKh@v8T WLv(Ḵ|iHi@4//DL(ط p-L M.@K `WVP0 @Tp'  =00SA[T>0K 0SK XߊT001K,0H ,p4Kpġ|i DlT pi P -L M K@,0 $`\p  0媊 0@0P0S phQP\0@Px`h@lP @EP,0@Pp@tP|` K@BLt`||ꄸ -LM` p ,0 0  0 ` RS,P P@P p-@P`L@ 0p q0 >p -LM, 00/0@`< , ppq, d 0@ T@ @L0 D0@$<L0@0 0@l( p-@P`L@ 0~p q50 p  -PLP0Sr00K00 t͉d` <@`p D@$<L@0 0@(l4( -@pL`@1P=P@T< p-L$M@`P x <@K$ dPT` ;T ըP@ 4` ̨P$UKpd|i$i$ -LpP P`< 0p q0 LHD0D@P` 0̻@P HD؟ -LPX00L @"80@<`p 0lй(0 -LP~X00L @80@<`p 0l(( p-L$MIPP& p`@ /0P و `b@TȺ@TB{KD@K$pG@pG B[R R 0P ,p a9 剦P "4QMsBKK$@D`@@DP 0 r0xS  \#P@40LUZ@$K舤H|i i 0/AT1S1S0SQ !000C S0:S Q  Pq`T 0S,l,QT|V@P T1S0S @0SK !R*0S' 0 0mq0 h0^qHm0h1Sd0Sl`Lq0` ФP01S <10S # {|0010S  tl00S 00S `p@f(Kġ|i i8i4iiii$D/PXdixBp؟ļtмܼi /x -FMLMP| pp5 5%5Qp5Qp5Qp50St  `U 0S 0SS0*$p`@K:e!8 +P 6 'PW vp0Pd[P  x, PtlzpPK 08 P0R4 L0R% 40S O 姴30S(D(圴 08K30S)4)匴t30Sh ) T側L6ppT30Sp\`34ꈡ< $ @Q R Q R 4D0@0 Whppp 0z 㻝00X,P0`V Up 7|4SX20SPBPR 4T0@$0$@SGNKP@D/`RK`QK\O 061 WPU_4[S nK`[ <PP)P,6_[1_[|!Q``P6>K@ P@6NKx@&^K`[6K <)P,50.KoT$o@P Po  PQxo )(K萤~ 0hܽ,//|8i8 po`0(<8tpġKiP8Xti xi  0-L$M8@KP$ N 50S 50P00C SX8@K 5P8^00 (客p8 K0萤|i$ 0-L$M8@KP$ N h50S Y50P00C Sh8@K W5PH)@0 8ypە0SK0萤$|i$D -LMpK@P4 ZNtH A ` RNA0K0 $51 K@PC5BP 00S0xS 0K`# -P 0 S 80A7S$҂A0[S K Ό@ KANP00@KP 0 4 Ph@K$ M\ 4t P`0X X0 P@Kġ|i TdԿi4i$i$ -LM`pK@8 P`KM@ M0tP0 L0 0P0 b P1 P0 0 L H @ 8 T  Px1PP0 00 C R0:S@L P$pK@` 80$ PD $0@@T0P0S+0(0 N4P000S00S  (Ksp(P崱`K $0K$ \@(T $0D` H0 `@KX +4L0 DRp< K蘼 ؟ 08@|i8X 0-0LM0Q ށ* bJPKPP  @0Sl{P 0S 00StPU<㳁 0o8t`Ȥh 0-TPL0@S s<0wu " 0P@0000t| -LMpp0S70+S DZP`IOK`` <(a'P,3,m307 OK.L |3K 垠P 01S@K L032K4BKOKI_K4[ <%'P ,P3l_K.pL D3K2 ePǓ01S KlOK.ML` !3K,2L BP01S ,t42l42l42l42l42l42@l42lZ l10ST OK. L\ 2K(1 pPc01S: T37,"(2 4"02 / 㿺@ PalK0 UTP!PlMlKlK0 UTP :l7l $K|"i %i Ii  ,8DP\h|Qi .8 0-LM0>0P<0S 410S(10S 1 0B?: ` !8 -80 ` $0 R00X,0PU @ 0 S |娤@40T\ 0SP  <嘤 Y aP(K<`x// p-LHM@` \ P00000S@P0`P``KRQRQT@P@`KXPK0 @PXK$ `Kp@@fhi -LM0<0S |30Sp30S d3 0B? @_CK.KI B BI@( 0S #Hp0S$  _"0S 2L 0B? 0_<K:a( 0<K@_"0S0 _  p _h"0S \_0: S S <"8"8 #$ 0,`SD@0 0f"0_10S  :p  {_ 0u_!0S 10S8,L@"l10S`10S 0: S0: S'<0S0 !5$0@0  -$ @ cp(]$0 x(0K 08B,_@N00S  cZ=(K蜥`x$,8dDpLh Ll/Ti// -0L 9 pl/\-0 CR 0R0 S:00 -DDLM@pE,1,K -pP 1 -X 0S0S?0S?pP",]p`X 0S 0St?d?ߢ H0\pX (0\p@0St/./MЍ -pL@P`nP`  -p00pT@P a@Tol0 P @ 8P@0㕓#PU`pW*ꨥl/`- 0-LM@P  K0K PPp (00S^ ^K0訥? -L MP@ `$K 0PP{p $VpP 0 PPnp ,00S ] G^ K訥MЍ#P P P   000ئ ܦ@-@ T 00R  0)S0/SR 0 0^P@-@ T 00R  0)S0.S R 0 0^P -L l/ -l1LM0l  y 0D8q YhK0 0(0 0,00$(0480P@`p $,00< 0 Pp 4@`pPPp e @ ; 1Q0^l0  L00@ @4]l4/]@T ݊(K.~~$(P>-0 CR 0R0 Sm00 -H0 ML, 0 <+ 0P K$\  -LP .0X4Z EPH.  8 )ZPUK  ,\ < -LM @0a0ZP0K4K,K8pK )0KPu$ )0[S S 048 l<8#" 04 2[8#!Y0 Y(KHd 0-0L S@P@$0)S02S #S 1S3S \XY HY W0 000 R@@T0 -LM  <K px P Q  @TPU @80 8 R 80  h @p 8P  `p0pSp 0 G$04"4 8#Rǟ7 0 S  `p" 0HSH+TK`K P  0q0@ 0pKPi 0@c 0S {P hY\LpK 0$L 0Đ TK   @0L#D P< dK  0KP H` !   @T0D#L4PK`,P`P ` A?K!$P0@ P1 A `0D #4@<$DPK`$P`P ` A?K!,P0@ P0 @ l0@ #<@4!$LPK`"$P`Q a 0KP0@l0 @ @ 0 hP  `#<4&$LA_K`$PK  @ 8ğ$<"P0K @ $<40P` PeQ 0>40 4P  F50 @6@8@  5 80K,6 @0R80 5) 80Kp, LQ80K )8 * p )+ 8 ps 4K0 2000  2D:  0KPTYx40  )@& P0KP@ pPHDD0s 5Pg4  )000 00 0PW30 S 0P0 |@P!4 r Kd$K0*K  ) 0/P$@#0s 0) PL0S D4#L0KPPKP \PP KP|ZdR8`K@p)$ 08@ pP@,0)% pP #20  Pp H2KR10  K6AR01 9RAq uxtrxD10@\kxL1xKlK ,20S 2"OKI ̀I!PU 0 0bCP00 10S|@T 8dP`!0S_ fH1@4p_$(4/0\?x8.A''@ئ(؇!D4- x<Pl̈<؉ 4Tt'u 8DPp 0 ئܦ,4@l/4 80  - 4`P0`K`0 UKKPfڔ0K0 00 40T0 X0K0 0p@K 0 X P oPHx0SL peG PB0 ? GQ; 1 R3 0S0p3NMЍ 0-8P8@L4 nz  0g9l/p$ - LhT -LCM`t% pE0luPP4 40 00 =rP dP jP8şP4 aP1 uP zP) tP*0P0 $4P!T4 p'0,K ,04 S d0P4 l$偔p40SX4@00S 4K=P 0Ypq 1 dR 0+S H@TPp00F S.VWpkP`VdoW0P 0p `PZ 0RR!>C 2#=S0Q@ PR (  (  ( l ( 0 (  @ Td0 T?#C0 2#0@0TT!>C 2"0r03 R0S 00C0@0TT!>C 2"0r03R0S @0TT!>C 2#S0 0RR!>C 2#;S0/1@PQ0Nt1pW*h10S LKptL @1LPK`@K0S@@0 <@ 8p Op8/ @K@@ 0@-b=D 00APPQ=-C0D 0 L0@R 0 -0L Spl/` -H0LM<0@K*00$$0 宂p X\LWl -L@0@ 0s0 000嗂P !0hWh`T$W x -L}. p-LM@ K``"yp @ 0P0T@pL .<0P0*KKp\LWlX -L`M0P@pla 0uR 0\ nKX XdT`  ͠\0Πx L(K\T`%W Ah$W xtXVl?@{Gz?~@MЍ -0L pl/ -LMp@P= 0S<0S S5  1 P) 0B?S%P (KP P`$KP  $0SP(0V`U S0S P00 K -L 0KM#+ -L@M0pD[ ,0 ZP,`@(@PP :"@PP  00SP @P0 #3 RD K∣L P T t3 hh0o,PH 0  0S004P PH 0' r0 S@ 080 4@ 0 0S ,0K尵 40K,K80 GPP0L帴I@P 0`D0 @@ `0L"<0 T@ 0 "@P" TPP 10S L  0`P 0S nS0oS` =PP00 @P @Q  0U0P P00 00 X 0000X  ]U 0 o00 ,K, ?R0S@po0"S4 0\@P؟ld| -LMp`IP@( P(K,K  0mP(0S$KMЍ -0L pl/8 -KMLM  zzp EpP`̄ Ȅ Ą 弄 帄 崄 b0@S񟗎T+X*,(*H*0**8*,,+,,,,,,+,@*+,,+ ṳ sȤ qĤ o k$7 ,Kl, R ğ <,KX, Rl4 0A< ?0,KB, R4p ,K0@@/, R #,K0 @@!, R 0 \ 30@0  0lß AH#囋pe<3$@0dS4 S20SQ $00 YR W S\ 0!瀢p oKK PPt[JNK@D@D0 @PvP 882 R (2R "7< @@0@T S FW jypyU$RK, IpPOK |'l, ,@aOt$@`  T $0w[$A 0K @h4S 0 \   Q .K mP X 00%O(K p_   x |4 -H EFI PART` x   0  @  -LJKIM@PJ/KhJ`p$ /KIpM 0K @0X P )#GP0 S0 SGX* kt G:0 S0 S~xFxF 9@P 1SS0N0`p4, R (K` EFI PARTțp |   -IMLM#K` p@Ppp JKH0 H  0S \ %)%>P FJKJttq` JP1Q * TKFP,K0K ,`0SP0P PBTPP2S 0 S  0R20S!F20 P P P0 P000S P  P HYF 00C0(KD x /\ EFI PART  0@-@P 0 ,0  L0|#^0 D 000S0  $R $R 0 # @0 S0 $Q $Q 0 $H p-1L0S pE00S 00CS00@Ӥ0el@`P0S 00CS00Ӥ0Pl Ppp  t00 (YYTyTp|x//. 0-LMP@`KP8 00S S0B0 0S0D"0 %  0 8. p 0-@QhP 0LX09E%P<fY00s03T0S%  0謨\D M-EMLM00d S450X4 0 PU0@D4 @D \PD @$ X4 ?`$ \4 r0<$ 84 8T0O?   <48D !5B^K;PEBEPE44 0D P hT l d D @00DD@T@ PDhfPX,4[S *S+4[S  h (KP@0$SRC00 ӑb0BS4999999999p99999999L9: PHT KP(K0ȟc (@K0bP<8-(K0s H $C5X4 S40 F.K (@K0kPF.K t(K0mF.K i(@K0gPHT C F.K [(K0t CH$ ,[-Z+Zl4hDT4 TD TT ,P /kT,KSk`p'kYL  X   0@P x 0@P`p+Z D@K) 0@P -Z D@>) 0q@P`pL"P 1) 0|P() 0mP 0fPHDT4dt @ ,00S HTT4dL PCo?D @ D@(Kxx  -LlM@p`PK,K0KCCdGPW0[?S%V  $P W00SL   ,P =,0 S@@R HC @T T(CT(K0 -QL|M@ pPQPP ? 0 吠Kȟ 0P[C dPhW0[S`,0  K,K0 v, `R( 0AC,0S(KH\ -l`LdpPL_WH`KP@4@ WKPp/ p-PPL8`@P @2S @px -0L(p匀0O S#@` 0PQ  lMp00PP i00 -0圀(pL0OS##` 0PQP P ]p00P0S P -LM@`B0@ 蠟0 , @B0S* '@PU  0;@P  0 0 dyB, @R00 V0S8nB000 jB$B(Kx -鈡LlMP 0! pp  K"p 8[0: S S pVQ up#(0 @Q0@7< @@40Q0, 00  \0 Ƴp5F$0T 0S 0S 0S 0S 80 00$-V$KrdA$x0 p-oLHMP`@ `K]\0[00SDL0[00S?<0[00S:,0[00S5@P0  K@ 0R  0R ?! @P  K% D0R  80R $! KpEFI PART 0-LP@P0,0 -L`@PpP, p0 tsd -LP`P\A =DXA B@,p@ 9Tp -PLM@x U01U01`,0pK0po` V K -LXMtKP @p,4`K0p`]W@ <7P @`@P`0ptK@0S S@ 0  QRs000 0S\T^ $K M-LHM @0 `< `1!o$h@K = @ .p@, Ό @0 @LTp(K -PpLQ$RPR\ < )0 ,! = (Kx4 M-LMP0Y ` ZZ Y)0SSp P 00 0,?0"100000 $0,?0"10 00 X>(00)000S@00 ,@ 000000 ,@ 00 0 (K Mp-LM 0(000?000 1<000)00) 00RR?0$00 1<0 0  0P`0@ 0@0 @ 1Kp -L Mq>`Hp8F @U.DDSD B L N @0P @@>_W 8= kp`W8`$K(D 0-LM ,dPP | p0R dK_p P{@P D0D 0;z d8PPP$T -LM( (Knj  2 `R 1R@ @_0$pK ̡$0S $(`\8 1R  1R@Q0   $K0 娡P$@Q (( r=?1 R 0R030@4P ,0㖃#A 0[=( 0R 0R0 @Pà P04 0@4PP0 ,0㖃"0S0S,,1= K/EFI PARTPp -@L$$  = o=@U -LM0 0K00SZ=/1 R1 R0 0@_ ,K0 p,`Q X0 0 @,0Q(0 S <70 R 0R@`KSC 9 5 1,㜞.\@Kp蘜%^`\K(K/EFI PART$ -@`堀pL0S0S0S lPiP`   Lo< 0h<@0S|EFI PARTPTX -Lo 0-LM1P%"SQ2RS}2SQP: OK3< p 0 R  0Rx<Bp߮00S 7<@@ 0  KKP/K0dEFI PART 0-LP@P @@0 R 00Rr0EFI PART p-L MK0P @0S  ;,0S#!N0RR d;\`  00H< <; 0; Kp,Pp -L M K0 pᷟ `@VP  ;&0sA 4@KgPʱPoP $KE$0S ,;Kț -L M 0Rp 0R'$K0 `$@PT`  l); ,0P W1P KEFI PART -LM(K0 p.(@PT`  :j1娀K– hU nP nPO bT8Lq (@0<0P0@000p(0`p 0@P @Q 0pW@ P$`P` PU`8(P,`a@#P$:  030 S HP K KP$K -LDMŸ 2RP 2Rb,K0 唞,pZ  0]:,@\ `>XKN@ `@ @Q /0[Sc , `;:\pP✁< 00C  00C p 0\0!0CD1S 1  0!0C,0㔓,!1R1S!  00,0㔓#\`@P00p0pp0@x0v``XK, P(KEFI PART(Ldx -Lp P d@ ;XA  0H@l 0KX5 _5 \< 80R00  80 \<0@@ 1< Lp0$00@ 0A05 ;(%(0 %04 @4 4 *4 ' 4$00#4 $0@P P0P00xGp4 `4D0p`S`D0 @HL<$<4@HwpP4H 0c@<0T X3P)`p@P 0 S 00K◷P0S0#3 ᅔPP  \m*PU@ @R@X00SX00SL0  :H2x304 SQv$20Sl"000 20S L2 0 S |wxBxpR`2p` D"H0QP $"0B1 30S:S0S6R) 20SQ b 0R20SR 0p2 2R T"p2HR 0R08 KTK:a D2b TKR8 K-X00C020S 0S0`KH Z` 0S00R0S QTK000d` `d` dP 0S!0S D10S`10S h10S`@0 Xd0d0P  K0 R0AKP  -L M@P  K0e R0eAK`  -L@OMpKx ,@ xRE `,@K6mP) gP! lP 9P,sP oP& uP xP! 00000 0000 e k  X !ppta00 SM0K1PAA@AP08! ,0P( 01 0 1 5 ! `#0A YLK@D@DK p ƩU00 V00 Y0;;0 KAA, >K(7PSPl -Pd P\ }SKP0C!0C 4/+@*+@T Xe-p@ P 9ߝ[YQl10 NK@DhQ@D0`!hQ0S Y , ῝ờ0SQ0S KAYA 嬝婝#! R@,K qP喝 ,0#4 P Q  Tn(K |؟  |C( < t -L,ML HK⥌P4P0AH0 D@ @0 <@ @0KH0 D@ HK^PS|\ppD h$hhth-0+0K)Kl\> b\* N\ T\Gd\ f\ t\f n\ p\ v\ y\ #00#000#000+K *Kt}4K ЍpxZ4 e4}l1 0K`00(#S^ ]>P0SV :P 002`@  P 4=@T hI5XŸ0S p1> R8  0SLnS0oS0,"80 00Ÿ00"$8KxP 1 1 L!mpJ1XL QJX1!X11CC@| P P pP`%o0P p0PY  ` p@`pyP tP oP =  0X* (K!  p_(!0! XQ%;lQ dQ fQsQ uQ pQ ,0S00A >., $ " P@ p`0` p0@P|x垢Q<0`80p40@00P,0(0$0 0LHh@Dp|#l/ -霐圠L`Ppp |0 0@R 00CS00Ӥ0ቈK P0@`FV/ 0-T0L@TDP0S 800 ,4@$ 0hBX0t/  7Xx -P00 P0LMS@ PP P@0?0 <@R/4 000K @aI/ 000 -0 CR 0R0 Si00 -d0LP T00SD M@00S4  h0 L H //  -TTTL`H"0S0 S0$@{@hvP U0S0S 0FS 0@_S0Sc 0S0_S] V__U0S 0SW0_ST_UP`F@p0W! 0' U00S 0S 0FS 0_S0S 0S0_S W 0 p U0S00S0S 0SJpGhW p 00S `0HHL < p`VrZ@pt/ L/X\ 0- 1L0@S= 00S 00S . h*P 00S  h00S0P t eP0TP0@d0S 0g@DT  0 0 H //P  -LL00S @00S 400S( h hgP // p-0 P0 UL ` @ᳳ@P ,T44妠Ik0@`p|d`/# -0` 䠟 LPpB V:`0 0pC@0 0 @R 00CS00@Ӥ0ኆI@ T t00@P 00d|/ -<4LMp040ğ ,4P`0@ ^, B 00CS00PӤ0RIP300S0 U0S ß3P` 0@^ 00CS00PӤ0-IP8``P W:<p0 0Cu "W00Dž0,, 0c0``00 U2@P u UP1"0S 0V'p0S#d"P X2@T0D"`* @2pG @ W`:p0 0C @0V 0`U00V0S`F U !0S ^00GL000`00UU`p10Vd10S$1 0@P 00CS00Ӥ0ᒅH Ug PpGd b00VS00S 0000V 00 S `0R  00S p00S 000, 00c000d|/ D H P Dtl@p@  0-0L0@S 0 < 0 \  tP0S T r T 4 k 4,( 0000P  < /  -LM`PKp*%\` \\ !\" 0S0 0(K@e0S ( K|@e PD"Pp0!S%S0` \ K(K8 T #$! 0-PL@0S\e0S 00CS00 Ӥ0ᰄH r0//00S tse// -ML MDeDDDujTPP0 0S0 R 0 ]+@P%!T LTP BK@ @6 Pʬ4 P 0 KzTPD  |43[S0X 2[PDS0< (D0S( P 4   P$000#0SP003P 30S P #000 3$@K 30$3 3 |3t p3h d3` \#P00L P@ P 2 (@K v P3S0 n cP g 2P00S20S0 2 2R "2 t2 2 t "P00(@Kl@ P `2` 9 TRP 0S8/ 42P  B( @(@K 1 P!10 P  P 1 P!10㐧@1 p 3 @S=aKPP#P30LL!#10#PhR bR QRdR fRqR nRz2sR zRus &Pk60S  K%6V0`S  ^x60Sl  X^T60SL6D&U@V, 60S  ^50S5%950S  ^묅 0u0 şS`a@P`F 00 ᾟ 0(+V<5` zRV05`$5vV`fR4040S  ^\40S z w^|40St4l$'VDTs 040S$ ^ [^ 40S4#30S K$ H^ p  0@R 00CS00Ӥ0 [} @ P0@`FPSpV83V` 3`2pWc#2pW1bŸ00 022}h xx22j 000 (2V0`S//]82@@ɬ!0S   $ ypKN/ P>P #  P|10C5p0S8屖%*p10S" `1P TA0S 8囖41 1 卖0 s #Z l00S` m Lj]0   (K  8 //P H%Th<X% l%@ 8< |%X` -sLMP`@,Kp@g "0S ,0S0S0 "0S,00 20S 0 S0S0Sh2`"y\2,<0T00820T,20S + t `FV0S A0S 1!S00֫1 0@P 00CS00@Ӥ0{T?@t ,10SE \1(!+0S 0S01   0@\0@@@&`P" 00S 0So˼00S 00V 0S 0P  00 @P0t H,%P dl@x%t//PH hl  0-LMP0 @iP 8K 0@yP0[ [$t0R0CR0CX0R P0R H0R<›8 0>8 Ee % -LlMK`p \X10SP1H!ᜆ0: S$P?1P@q00^PP჆/P0 0@P 00CS00Ӥ0{e> P00d0 0@#\H0K@ 1@ K/P %@/$% -L@|MPp4@ @@ 8@ <@ ZIp3u'7@07@P7p#7'0?00CS0000P@ 0S= ;P 000-St4+S80/S<00KP <0 &80 080 0H D0 00E S H0KP`$"  H D PUH0K0@H0 D@ /pL00CS0H60S <60S 0S $60S 0S 60S 0S 55 %0S500C05 0 Q40040 Ŭ50SQ 5@5T,0 %H %=8 !=( = TK=PT@T =  = =%00040S 40S 1P4ğ 0@P , 00CS0,y, 0p0,D=p W T$P`0@,[40Sw 30S 3$ <0S K P 30S000C00 80SHK0Ct3@@T40t#0@40 0@KM, ,0S D#@00 @@0S <0@S ,K `P20S000C00 80S HK,0 0R20S0,0 00Sf H20S@0S X"0s0S 20S 1"340S; 20S10S1!10S˜10S  YHA0SD1`!d0 0S14!YL@ 00  BS0 0PU ,8A,0000Pƨ,^ 0@0 @0 @00000p8`8夀t 0R?dㆻ% 84 h<%lP h8 ./T$%,%%/  & T  -@PLp@ 000C S 00 B00C S 0.S 0  00B S00EP@000C S0*S@0@SU T0 0B8 S8< 74`c@T@D0%"#2% p-LM`0`@K KKK`KcrPP +E0 000Kp -0L: qP -$0LM KqP -82MLM@pዼPPtPPIK @@$0/S hPIK @@a P 0S IK @0@! P :IK @@IK @@+I>K 0C0C K 0 :S S S:S0SR B"*0S0U0 0S /S rP'`K`  K_uPPT00S +:׈P 0S` T00S  0PzuK*****  P-LpQ 1`@@ f%S``03S .S5 %SW +S-2SiSK rS dS TcT U*dOd0000@ U* D0 U* #0y@+ @)0@TT TY 0S Y 0Q   P@ T U*@p@ U*00S8@@e P** 8%4%$VMЍ -L@P  / -PL` f@Pp 0eS ;P  0'W + P#%'+@ FpPt  00  CP H ' 8 P, e/ 080L0p000 -LM04 p P@@@PP` @ 4 @ 0 0K  p0G'0S f N L(K000 p-LlMP@`PDp@  gp@` `00 PKp 0: S   'Kp 1Ph101 -LpM  KP 0: SPKQP@@Pp`T 0SR &5P@ph&   6p D P Po@` 0`(KH14\1 -MLM`p @f^KPE\ p Hy $0KN 0  f$K\1 P-L   0 减Y됶l/pl1 0-@PLPh$P @T 8P@P  ,U&(* 00h11111 -LM Dp 0CPp`8 8 )BnP% cP" VPeP mPqP pP sP xP V p  ꨨ P`"UpŸ 0@m%P ڎ0FSpW Y X囷P LHDCp 8S{0u03Y0S 儷Pp INK@D @D! 0{p  PP1:%V]Y[ W~KpG pG0K⤠KZK< `J0 p P/00K0S@ 00 ,@ ,00  0 K 0@K0 !KPp  p ] P@`TၞQ m0@ J  0 K i(K1p_2-/$2t,2P2X2h22@-@|0  " 0|0  "4\ 0 ^|-0,0C/1Q0#0C/00CS00 c0 0c|0x0\0nx0A0 0b0 01 R|00|0 0-LM@K P: 10 RK0 p-LMPK`FOK % ! 0RQKp -b 00"00#0\ -LM@K K00 !0 S0 0S-0 00\N-0|v?M0|0 1?01 R  00b0QЍ.A-0MP`  0S3 0 ##\0 ^+ @0!" |\|0|0@|0  " 0|0  "4\ 0 ^  pAЍ -LM⤀KR^KPEJNK@DpIoK iK K oK |`@@ TOK/Kf@``V/KQ`@@ TOK/K;}@y@u2TBNK@D/K%jg@`b`^dVB.K BTQ`M`I2V/K@=:74 i/K$K -LM`KJNK@D# I_KiK  oK P@@TOK/K@@ TOK/K@PPU/KP@@ TOK/K@@2TBNK@D/Ku@PPdUB.K BePP2U/KW  M$K -LM@K 0| 0C00CTK -LM K0 0 R0 0S K K0@- MtP @0 0 c / QB @ 00#00# Q0 Ѝ0l+ -0L!M`PK  0BS0KK 0SK 0S| 1##@0!\!P?1!K#$1! "41 00 R5 T 1##@0P ^+JKK0 #$ PKKK0 0`0b/40Q$K8协Kp@ KKKnK@*l+ -LM CK01 R 0 0SCKy K 01 R -LM CK01 @R c K 00 @R0 0S@  10 R 0 S R 1 BS R ! 1LR*|-0 00\ "4\ 0 @-@  00b0n  #4\ -0LMP@K  0 S  1##\0 ^>K0 #$ 0K\ K~K` p-LM@KP`d Kp@-P`pP@0000100 "#  010 " 00000#200 #  000 " 0#1000 200\x0@0P0x010P0x "# R |0100#R0|0340P0|0#20P00000 <- 0@0#1C0T\T00T00@-@P0000 "  010 " 0#100 #  000 "  ""  020 " 0000 "#  010 " 0100\x0000x " 1 |0100#10|0#10000000 <. 00#2C02\200200@-@ 0 010 0"!#1 010 0""#2 010 0"##3 01|\0| |0 01|0| |0"!#1 01}0| |0""#2 01~0@-@ 000  |\#|0| 00|0@-@0 <0b0  |\#|0| 0b0|0-   00|Q"Ġ|0 00|0|  00|\"000G-Pp`& !0\.@0 .Q@ TPG@ G-@pP`&! 1B$0l\:  !0LJ$ ^: 01 @ 0 0:#P`@G0@-P 0@C0  # 0"00 "  \0 -ML M HK00 R)0[H [0 @0;KH K)0K A 01 R;K KA00 R02 0/K0S0H4 =K0C/KSY0HK 01 S20>  KK-K?K@A BMK@D% KK @A#mK`FK A)}KMK@DpGK A'KHK A+K- K%KJ@A1]KBPE >/MK @D%-K B 3mK5 K `F@ K%rOK-KA  RK04ş,"00|Q"$L1,"0  RK  0 0|P"0-MK@D0 K]K0 PE+-K B K K@rK!MK@D5KA;mK`F K@K  KI 0@K yXK H00 Q9}K`KpG_KROK rK oK !MK@D p`@@ TMK@D!-K BX}z@v@rT-K BChe@a@] TMK@D!-K B,QN@J@F2TMK@D-K B:7@3@/dT-K B%"@``2V-K B  9MK@D;mKr/K`F7 K @@ 10 R7 K@p rL=K!00"0 0#P1 1@0 R(KA+ M-VMLM@00 Yp @h?XfKPa 00 P 0 Q 0 @ @P 0 0Q R@K 0B_KQboK` @ K 0@KH@K`KA 3P ?  ?  ?00RP` 0@Q5 R 0@Q(Kl, -LMpK@JK‐joKP 늏K J= C HP C 3  ;  7(K -LMp`ᨠKPOK  တ&  "JK  =   j_K 0-OK+t ',#  2  2 2 (Kl. -}P`L@    h 0-L@P ,0h -LMM KK(@2 " P" K(@ K(@}K! K(pG(@OKzK,(Jc R 0 0K48崤-0 CR 0R0 SC00 -`QLP@9 p$0CV3@ 0P,<S B0SB@  R@0 S0SP ,00S>i>iB/ -QL@B <j84!010S  BpP WP Pp0 CS   ^P` W Up. t40  CS @` VP<00S$ W cBmWH8//|C p-LPL`@LD8 T0$ N ph/X8d8 p-/QL M`Z QW "Q Q;5QP 20AS4K7Q1H@K0P b1\%  0K1 a@PP 0 0 Lt0 hdd0 0 S L00S $ 000, 0S00Kp4p88847d5 -LM` @ Q (KoLAQ GA P  (Ko=A 0\ p P , 5p P,p @ % Q Qp QP Q Q,   Q Q 0S0S0S0C000  ^ P @U@00R  | T pB0P0 XPW 0  0 Y $X  , R , @,    Q! Q! !5:Q! Q (Q! $Q 0Q! 8Q! !|!x!xtpl! y*ZX0@00@P K@TP, (8<0 L L0 00S (Ko 0    00S (Kot (Ko@(K7889H9`9X5t99999x7@dd7@ 78p7799/::4:4L:/ -T L0R S S0RS  P0 :86P1 p-2L M0`Sz Q  @t0A0S11.0 0CS7<[<[Zl[[(@K CPt`XX!P <D!R =( Q Q  )+  0 .|00S 0@00@P 2J@TP8 <0 L L(h0 Kp48|X:t::::/::::H4:;8; -L@p"&.`'aT cT gT 80S, 0 0000T4(ß0 0c3 @  p 330 @0`0$ 0 0`P h3lC0\S0C0PP ̾D3P0S(430 30S0C0@@ ᶾ2P0S20 20S0C0@@ ᠾ2P0S|T20 @204S0C0@@ ኾ<2P0S<10  (20S0C0@@ t1P0S10  10S0C0@@ ^1P0SL10  10|S0C0@@ H41P0SLL1`0@fS@t$10S-Q <P 10Sqm Yp@&.IzP 0S 0R 0RpUmh5444X14xH87854d;l4l;t;|;4;05;$8;774;4; -L$M@8 8`K pK4  0( 0@ ,@ $@ @@ʡP P PPp`w0 @@嶡P 0@@`0@T:rK;; -MLM,p 0 0S0  /^K PEpPE$`K+yp@ 0S Pw[H$   (<747c$< 0-LM@QP0S  0S 0S0S0S A 00 S;(@K S P0@実P* 000$K0 ]\  0p 0` 00CAQ BP0   K0.\D<47 -LXMTD0S` :`P00$$000004X  3P X XX X  s sssPs30P0;@PX Xxß0 00@Ug Uu UlU !Ud~K 2 ㉿1P#/ P0L@K0 L  ,0KHP D fP  ,0KL ]P, R p 0S\ s,0S 00SS 00S S 0S 8#8 $#$0 0L0SbX^ ]k RT $00KZ00X*\1@T& 0 P: P  < 8#" ᱠP P  #00S  <P P Z0000 p d  (K\5t47l484H<487.صX<x<4<<< P-L((<$0$ uui<p<l/,= P-L@ D0zp4Uu 6 j%P~H8l= -pL@P`00-S*P P P P P +P P ` ``x0@T  @Tp!`@DT 00 0T5H87 -6LM 0R`@,0 z0gS&弆{8 < 4 0 6>P0-S0@ F6S0ohpHohphpohp8phpohp8p oXonpo nmmnhpopmohpoohp0pmm8ppohpnhpLnnpPp8o@on8p(ohp8p8pm8php8pPon% 000t%0000\%000H%$000400%640 000`R 0SS  v*`R 0!S`R 0!S40S v0!St \4 0!ST 0!S< ,$C{q{o$0>$0;$7pezcyay_|]{[`RA  `R;  lN`R4  e080 E`R+ , K\ < ;`R! 6`R  M(#000+`R <%w#`R `R 0 "0, K) >8>`5d57474P>p44$h``>l>l4v|>>>< -44L,M@PT`* 4<DpL 30-S.P P p&P" P +P P! PU hPL  T PUUPEU3 0H0 0D0 0p80 0 @ < 4 HK,PK@ 0@@p# ,Q ,P p 0@@pq0 S T,0Do'p4r,20S 10S fWo 쁟@`f0Sa0S  10SW U1 0R 0SLL R 0SFZ 0 SA0S> T!0S:0!0` 0  0PP g!) `0S 0S 0 P 0S0C000xtQ0@ T:5(K4x=7\5>H8;4><4>? 7,?D?4\?h? -PLMp';3cS@ nP TP dPtP vP qP22@ 22@@"i8p|2`剹t2A/Ih2PP (2@0`fSZ P z1 q PF5r 31pL T0y,0  0-S]Z@PVy<{<{yyy,p `FVl1 ,0KإpL& 10SZ (1 0ǥp  T 6T 0  &."$&p?qT T T T T `0 0%p_H877X5444p?-44x?7??<$00S P"!P X50@-p0Q h@ .P0 a#2 B0L0R00PL0L OQ00B0\16P|||l|t|| B\ C CC P-L   <4("4#6 吸 勸0Kl2 -LQ 0S 0S Sh蜭hF0 lCl2 -LJM2CP8@K Q B08PKS7`K00[S/0[0SS/0[0S S  Q"[-K04"48#8 0 .K8KT"SH <0 {K\l38l2L2xC -L-KH $M0R 00S \:0-K0p K6 p-L`!\P@+0R0S  Z pS XM0Sxhp0,($  ph8p$B\ C CCC p-L^P@` !^p0S 00SS 00S S 0004"48#80   "10Q0S T@ph800S (ph0 phX5$CP P P !P($ CCCCCl-0 CR 0R0 S500 -PL$M !P   1f!1 R10S PA !P B P !P" !P6 P   S S0  T00SN00S Kh~ Kh4"P   KDC DC\CDlDDxDDDD0DDDDX5DD4|CD// -Lp@70X p@K &P0̰ 0,@T  A / " 3g0S t7 0j0P儦0oK<0 B00000 <PD, ǟ0S&, h]< <0s# < P0S <0@ȥ0@<0  00p@K00@ 0ᯥP|PU0~<0S X5^0<H*6  0S5 (h嵱P`@ P@PU{P@Pbh" P00  0)@PUPP8@T& 50S 58 Tqh"R D4Dğ ($ 0 ?R4ğ # 02Eß # 0*P #2':ېP m@P %ѐP"0  l#)x #0X <ǐP ,#02 2 #30St3 . x 2S }p@~]P  P KP K0B"P0 P R 00 S S  |P P,@K LK> NL0SPKPP 1P !0 S00`ڸD.`w!0@LK P KP d0BP0 P R 00S S S R  /[PP`@lPP0 iNL0(!S `f$F0FEEETFpFFFFG0GHG\G(â/GG<GGHGHXf$HhHHHHHH\HH3L8IIHK0C0CLD `4 PD ,0X$:.P PuLu,0X$jP|u x #YP d YP T6@ D\$@5pLD  ( Y@PH$R  \$$pLD PD $,0LD PD Wp/:`@@P00T00S4 T2*P0#03V0S+ H40@0ЍP@@ˍPTT* +W 0S ,0X$+,0 L$ P$ ;P 8pL 0L4 P4 0[S]㢍P P0#03V0S @T 0:S+0p0@T$ :ቍ/Pᅍ U P00S P:R V  R0305P1 : :n ` pPP$ L$ PW 0S V @@V 0S /\P@@@`@#0S0#U0 @0 )00 -Ld0d0S  )80x0 0(00 00/g@m@lhLa -L 0 @0S0S @xf -0L(M`0@0V$0 #DK$ K7PPpPW00C0[PS (  (0KP(8W0# K`$ldKK -AML M< BK+@$|,$ )0Kl8 4 p@4 `BKP$AP0 `T!44 @P񟗰ꄺD  0#C  0nacwt<4S d  30S dCxcaLwh#H3 TP/ @ RR5V(U&4TV 0V04V0S30S0S U UR2 (a"0S(U 00D S\2X 000C00W42 0BSpRdppU00W0S 00D SW T)T,000p ,!pQ,45@4,4 5dW(TpU-T4$R4$1 4$ 04@V`S@404 5T!<  P@?H0SS5V4V010S 0!0S  'vXBK04A a R+#é4Q 84@T S8D 8D1V00    P d0 TR t00S 0ZZ 0F(K\gkDmsKaK akPa5/`o\h p-AML M"0, S P 1Pf&10S1  | nQ `BK0@!P10S|10p1"BKA 0PlUDAd 0`%vD10SD1081",$R( K 10S,4," !K(K PU00S0  . ,4S 1[ BNKP@D0S,$,_"+UbP@P800S9 7KpsnL@mkK/@8LDm' -@L0S) # 0 P`P?SRdpd0 `@ `_&u0S40  0x|s --LMP@p0T0`&0 P !0 @ 0 ?t_ruh0 `p30PSTiKshDLkdH\hL p-DL0 M0 4 0 8 0 P$@ 3#3Q0$0 3@T 30S 30S@@S0S:P 36_t30S \3d+_T3 0S44rP(PP7 c008 0 bP@ gb 00 0 $4 NP`B0004P0I<24 \80P^}82 0oP 20S 20S +Q0S  @T$4 PO =1Qp30S @T $4 pP 0S5 $2PA0S81p30S 10S10 1 0,K , 2KvPS00S0   00S00SD0  VKppLlfxLL`\kaLgLtfLkL\@llLg\/Dm'@@m -4L!M 0R,0 0S 00SS $ 0KDpKK 0p؜ ! 1 q ̟P <  y<P S0S S A)X<0S L<0S@L0P8 0K0< 0P0CS< ]!R ; qW, 3܋ ȁ  -; 00CS; ]\   ^ x[@T K  8K DK0 K40KpK2 P 00Sd40Sa80S^ e [0[[(,[ D0[@[$Č<4 4 "<, 0 K0 p @P`$,0( 0( ,00 K0KK4 80< 8K4 80<p@LDKX0 K40KpK@P`$DH֟P 7\00S40S80S  [[0[`[ [P[[p[@[h1 [唠[lXᤀ[[[\`@p[D0[H[L P [T d4@1 D|<, ă $x q  1,(p,4Ɵ&<.  01*$t$%,.t0pOD@Po86D@ 00CS, Kq4L K1@VP 05`\-0[ [R~[Q}0[S o5 @ Ƞ,Ƞ0 4,400S le@T $ 00 tQ`'D  PP0S((0K  # NPQ`K` |ğt\hğ\pD d8$P,jQV 0t0t0S `,0KPP4ȓ0S S ß,  ,0KP |, ) ,0KP3Q 0RS 0S Q00-S ? xxZ R?hrZ`>0S D0S   E4> 04 S< 0@ D00S0H0 PN0StNP00<0S<C80S8>d= d= *|4t0<0 /08 SP̂PQ 00|SM zP>0S 0 S  O<8 l= /MQ@P000T  T TT/00P<0S0 S-PT<0S 0 S 0<0S  0S DQ<0S  ;;0S ;P YPUD0S ;0 PQ  h \ PwP 0 00S7  R'7P;,0 :)00|S @ l, ,0S  L*0S00D:: `, ,0S:@ N40 h:0S,0,KڻP0S;0 ,j0 SJDiTlP0P0 NP0: S P)0S00L9  90S <*9T90S SD9 00 P90S,0,{90nQ N40 S8 8舟0蘟phy0E @0S,0,W -p Z@`T;(0/S' 0S 70S0S#'T@K00/@0T0 P@ 0TKS#0S*n0S0007 [PPZ``u00p Epl70S3 60S 60S+6R&Q$60OTS 60S7#?7#s60S6 26 f6ZnU W%0@VF Z @P>F  , aPP@",p50S,00#30#,<p3P 00 P@T@, aP0S M40S4 4  40,. TL00L0 Q N0S#mT0K 0OT0 P@ 0S $0S 0S 0TKS#0S*0@0; P@H0S 0S,00#3 ,;PP)0S, , T t T 0S,o,0@R`圣ܒ`p0p@830S000@0k;P 30S,00@,^;P "PPL0S BL nWwW20S. 20S 20S&TK0S0S *<20Sl2#X2#H20S82 $2 ;2/m10S000#3 0;PP U!0@p10S,00#3 ,:PP 40 S0 040,<8@0S@ 0P]AQ00P @0S9P@Cgf$F`fxf\dfpLaOOgkm4KsDMlfa`pO@/P?/dO`Ox|TaOOOOsZg(Pf\\dkxf4VlD 0 000T@X0RtD0Sq RQa00Sf 4 0Rb p\ X qY '0l h lK\0Kd0 `@ pK(1\K@Pz| 0DaV?@0 S\1 d1@ VS10S1<  #Q01@P@ @40S ,0S40,00S0\!0S0S<$8!(K -\4LWMPpP` X@K8P L$4X  00KT P LP p!xPK~P ~P#xK 0~P#xK P0㊝x0[S xKX K00KP pd - PWH3 004`Q,,֞#30P ^K E000S  <㒒P,0S2 U`P( mP;0S* 0S 0S  hPQPOK@D^K!0!+Qp$t?PP)SP PU  0rJt mJPd!0P TO(0KP@x0[SP0s0Ax`KU `@ PWCpPT9@P 0x03T0S P V0xPS ` h00S`0  (Kf!@WLWPW`W.x%glWtWWWWWRgtf p-2L0PS 2|2 It2 ph2 R`2`2PR L2P 0S0P} 20S 4Pt10S 11 I1@ @ؒ1 @Ғ1 @̒1 @ƒ1 㿒10S1@1 (!0`h0PV P )r@P< $r@PP 0T.S@D0P00 !|ITP =rP00S00  V 80 eI R00  00`ptfgWPak\akgWXaX P. p= p= p@= 52/TW\@KX0 0X0 d!T1PZ 㳩0K S10S 00#40Sj@(K@! g`P0S <,X? (@ Mp0S @ T !8t0p@ pth0Y-`8YXYhYxY_|YYYYYY2YYYMЍ -L GoZl/ -L0GM@K0$<1 4q41`P oP !l p0 0bAS`GK0 A A0 =P F GK00 A0  A0K PsPl -Pd P\ h坎G>K 0C 0C8 o-p_t_Z, [` -LM@pPg h`P 0S nS0oS` ="oPP00 @ :P @Q  0U0P P00 00 X 0000X  DU 0 00 ,KP, ?R0S@p0"S4 0%@P؟ld| -LMp`sKP@( P(K,KE  0mP(0S V$KMЍ 0%@-PQ @p`0N S3. P P 0 CS @ Tp@-PQ @` Q 0 CS @ Tp -L MPa0K00K!PU`V\2P`@R0 @(K(,<4("4!<@;S0 @<0@0 @ 0S0SP `0/  @a0P0@ (K⺋@0(,<4("4!< 0S 0R@P0 R 0b 0O? š 1>A\0@ (K⌋@0(,<4("4!< 0S 0R@P0S0S* 0KppP`P0`0@0@p P`$K Pp-L@P8 PQ7 0R34 40R/8 80R+((P P% Q# mP ,,P`@PP Q mP @0@PS DD`P`@ Upp -\LMP` #p 00P  0f# 0@T K -LM0 ̠T# K -LM` 0K'4p00BP0@ T,Q a0"<4!4"\P ,KƊ0pW,00,0  ຊ0 R, (,0# R:(K -LM@   @ K@ Kܣ00P' 0"K -LM`P @}pp# o  }p } P 10151v ;mp0 Ti   Fp  0Z odddd$e -L M@T<Khk @D0 .@KLe% -@̠Lp`.0'.TP! .U.S Ut! 000t0 00000s03-T0S _T _TX0, 0`@T.he -L M0@SHKh $!P @L0i/BKee -`0 MLȠ ,Ƞ0Lp(] KhK %ef -`0 MLȠ ,Ƞ0-p > Kh, %f8f -LAMJ_K, ,KOKብp`P#0S @ 6P @T T v R 0SR( K0ACp <`V440 JKp, D(K:\Lf) p-4@LTP(R,R0R`@D`R V@phRp -!LPUpP`D (408 $\408 0 0 @0`$0@  HP(" ,P HP, 0P HP0@Q @cUPD D@ @TP @@4@` -LM, pP( BR00S ,R0G,0pR0S (~R0G(0P<4S 00`<S$0 00S`ADdR@D 0V 0V^18SYH8D7l77a@DJR01@00Aa@D@R, 01@@TPD@ 0!h0D@ D.ꅁ`D$R,0@1@@TPD$ D@ ND @ 0!a@@0S1S @00TPD 0!1PU `W040$phf)\`f -LM@ P:)GP@  P pK \d0S P PU0`PQ0ESVf/ -LMP`p4K @T WT@Pp7 0 ~pPF  K@ 'p0 0 Q0S  3 K'p @ F 0S  0S  4@K$ $`K P<P 0S 'px @T `Pg4pK@0PS `@ UT (1 $1P T@>Q`40(K  }'p (CPS`P ( (#Q   Q@4pK0S  Q@ T@0 <0Q KfffHVgg)X%4gPglg -L$M@iPPT `xppd} @@K$ %D 8 !p 0Si ~峈c0`|SP, [  pj埈O,P@QIPUT@D0 ‰PP先`5,Pl@0 ⯉P,'Kggi$gggg%h0h p-0L0S00@T,``0@;p Pp   300\aP^D[8X,U phQp%Hhh( -L Mp@>p P HD-p< 828F :S@P R0Ka, 000 0 2Kp 0S P 2[ 6p 0#S ݇li`P $0S @A&0S  p K@0S0(K0(0 ,!PU00@0  86@0)0@e嚇 tIH0s 7Th$KPhs\h%hh(th% hh%h)h)hi -L M`*͡28 P2R B@7rP0"0"p P*J`P$60"pP*,0``Sp! `" pP0*,@P``h0 pPv*@`P"pPm*``p(0Sj !pP0`*(@P``C0 pPQ*@`Pl!̆pP``0p0H:E1=U@0 @0S ,1 A0 !屆pPp``+*P Ub0 sgP @`Pb0 hgP @`Pb0 ]gP @`h 儆pP 5:L P(Kt% iiHi\iXihi\xiiiii) p-0LM0@S`* ZKPE*P *㕇 Px%*phP  K@*ㅇ PD%*<JK@DᝇKp%ii jHjTjj 0-LMA0S  oTaFK0P0040S 0R  0RP h>00@Tl@HTt00S0@ @%`k[[ -LM, (K`}?P o处0P#(@唠P,Kp Q 0S (P   kePPP@T(L?$Ktk% -LM!>O@Px3`x < p 0SR T#0S @3D =eP 00<0 0 S: V"  V.$(V" wV) OPP 0 10S" p dPx"?LZPh< MP42D 0 D @0 ` VpqP` 01@0S<`P0 0U18PK0T0 0G 2P 1 dP t3 \c0<0DQ1 SX0$0 10p0S ANP(L0<0@ p( ( 0@0(P(;0<01S 10P00S NP,t&0<0 ,, 00(Kk\kkfk) l%% lpE|d044+LiGHEP@ 0,G(EP  5PP %]=00FDP 0P 000P 0 0 _4p| oP 0S0p0l$Upd Y T=pp 0SH { K}p{70\K@0@T-s*c@FS00S{h0\ 16pv{`[ PT \0SX0S 4NᇾR2.p`@X{ < ;2P@H}{ ,$Rc@880S0  jtBp,a{X(0K* #` `gpP{0<0 `gp A{ap Ip  &p  %p  &p| l0Qhdp\ @PLB4?08 R 000 Qs(Kp)p_%Do%`o-%loxooo(%od)oPT %op p p(p0`X0D0.P }4 ;U PKp)% \`u p-LM@`K 0PP 0oWP  {PP l ;U %xPF 0s4 x}S g xt%uu 0-l@L \5@P PPR 0s S ( $0h50@ u p-bL 0<$0 <0, @ 0,4 @0@<<0 K?,,  0]- @ 0, @T1 H DQ 00 0   000   000   y00 0@0 @0   000   w000   00 00 n5@P  p ph4p)L@0 )0   ) p-L M` RepPuTj 8@K  v (p@(@Kpui -LXM` )epPF <@K  v pLu 0 2[A0AS$p0@0t@K8 Џ v tp @00@0 TK 0@0@0 D@Kvi (v%8i8 p-@LP`w0@P0`p) p-L M` dp@ 8PK ቏ ]v pu2[0 2Kvp u\ 2[ 0@2Kgpt$f Kpvi Hvi |vv 0-LM@K,Kp|P@t@ \l 0000000S 4  0P00 [(K0%vw -LM$K/Pn $@崀`p00SPsUP `0S0S  R0r @00@0@TV0B $^/8w%xo -Lqa MHKX0S 0K0 K Q P0@0PBPQx1Pl/2``0 X0@ H0 0 #K#K$K80 0 S03Khp 0#S 0S 9t 4[@3[3[ 3[ 10P@U 0S |00L |$d0s r$@T(K%)  %%LwXw%dwi -LMPap@K 0@ 0 1d [P {@ H$H08#8d K#d[0c0K0d`K\0K 0 [0K0dKK6K5K5KX T @H$H Ġ$Č Ƞ,Ƞ(K 0K$t0;x`,$3KC<  2K0K2K \P  0@K  0(K!x0K`t0x@tpxPpKP0 @K TP0K 0 0|0 xp tP  )p@ro(K%%tw p-LM0 0 bbp@rz` 0K`_prTkPP0<0@ `_pvr [0@Kpww%!w -LTMPnpK02 [r `PP U0S Qrt6lP<@K s LP @<qr@0 Kww%lB w p-LM(R0 0 @0 KPNr1[S1[SQ @K0 P7r0 P*rp0h$ KPrD $0$0@$B= 0S$ 0@(@0!,@0D0D0,`K, (  _Pq0< 0, Q0( <00 HPqx0 h;P`Kp%qB@x8xpBpxyBxfB@xxXgBy\?wBDyvB ly -H1LM@Po., N/, , oj0S9 1 "860 006. 05WS PŊ0 P% 0` ,U@@p@  oPd0` ,U  @pWNY, 0 @ 0·p@%|y[7 - LM, [W0W , S *P0S :\1 TD1HJ,!100tS  RPa 0 BS a0S00 ;@P   ro000@P;@Pt   _o Zo0 00 9@0p,0WX:(K\yyyy -MLM2@F pR~2`wPx$ H0Rt1 10Wl Q^KPE+( ]PMM.\P x6S 6S 0  MP 60p@ Dx6S 0S S SP``P`P`P PP` D0 S0PP0`` @me 0$Kp' VKA$ $8NK@D[@8T K%%)P|y_zdaz<^(z4z@zPz -L M4 vqP`p44 @0T00 0 0  S%)*00 4S,0 04, K0p0RpPhKq`0 0 S Hhn0.  `U $p(Klzzz{0{ -LM0 :@P 0(pK0'`q\   0pP7V7 ,0`S: 0p7(KX{ -L$M`Pp@K2@00B1S^3\ c+, n,G  pX  0Km0;t Wp00d @[opp 0H`p P*P`SU ,KC(K:{ -LMpZ@`P & 4op. P!P`0`01:(@T PP0  0-Kwt -0Kop`p P *P` W@:Z  op(K{{ -LDM0h PD)舉U,EhQ ,yU`  U 5%1 @ pX`Kd@ \ ` 0>p P!$W4N dSSd 0A BS@ AS?IS6 LS:3fS5 XS eS26lS) tS-#T d p Bd '3 0s \ 0 QQt0:p@p0` p @@@\3h; 0 ST(38 0T00w0S 2 0WᾇpWڔR 20 Wbp @YX J SQD IQ LQ0 BQaLfQS XQ[JlQ tQVh 0Q 0Kl0 "0  4Kl4,<4("4!!<n@5 8Kl8,<4("4!!< *Kl"[04"48#8T!m@@!8!00$!$S!0m'pP$d0`:\Z`P` mpP`P`dZxY `0mpP`P`Y)<(K蜔{\.{{(|L|t||̂0K|8t@t|HV<l -0L0S 00CS00Ӥ0 ^ P00% \ 0S000d 0p0 00 | LPQ(0  B000 /T))D@ -PQ@`Lp χ ˇ LJ0|0 `t0Pp0pl0 h0d0 `0 \0 X0 T0 P0 L0 H0P\@))))DTPLHX))) -83LM0 ,,p` 0Pb@`p 0  0#\Qp P 2"\@2P5"f@㔒嘢`"U00ST P@`\U@@ V +pP0$T(2 00d  "Ou 2P!1 -\ Qc|a !0 00Z 0 00刡DPP`@0 -P_P p 000  $1 T0  p 000DP@ T0%r 0000D@PE@000-S0 ! 0KPBBP00U0S hd0D 0  TD@.))8\||X }[  -錠0LSt`tP 0lpl@ 0\P0 H0  0 0X,0000P))LH))X -L@\ pp00S`0 \0 X0 T0 0000 (0 T(0 00P)L))H)X -818ML,A,10 !Qqk   PR^0ӑ00S) L@ l@`PH D@ @P <` l 8 PR4@ 0P  ʐ 0 S0Qd0 B,0 \0( $0 0 0  LK,<0 K)e!) ~))0~x%!4~) --LM 0 T lH@ A@00S (l  ܰ ذ Ke!x% --LM 0 T kH@ @00S (l  㸰 㴰 Ke!x% --LM 0 dd@ kXL 0S 8dl0 㔰( 㐰0SA9Le!x%l/0p@-@P` 0S400 0 CS @ Tp p-P@L`lP0#S p 0S100 S 0S j 0phv00Sp%%8~ -00|0L0t3@00 0 -p 0S j(0Phk%h%P~h~ -LM@P!  KpP 1 pp `P@P\jV pX0S K~ 0-L" @P߄00P>j 0T =jp<qj40P0 0~~~ -LM YpQj@q귯K&. ᧄa0( K`p2K1p2 ڂKzS1  1@8PK(K Lp Ђ P 勄( K0(K 00 0PK 70K@P <@ 8@KHP D@ p 0S7 j'i P@ &.$pjP2[S2[S2S2SP i\u|KKT,P@ @ Ȭ(K~L%T ,Hh -LMP 00 X0  K0夀piA K% -LpMh0 K 0 倀p\i K%% -d0ML K .0_p;pi` K% -LlM@d0K@ .0<pMi=K%% 0 -L$M0  h0  $ $K  0p%i K%@\ -LM K00.T0 0pi K%h -L@M pR0 0!5  |Xph`@K@ <0 `010P ,` h00KPK,p `@h 0Kᨫ 0 K)%%i@ p-L@M` 8XpPkhPX@K@ 0 U0 @0000\H0Kp M01S @F{h cKp蘀%i ̀ p-L M8@K` ł0 i0 (0 WpPShL @p@Fh .Kp%i  p-LM K#P /hl @d`00S  P0SHP00  @T "Kp% -LOM` Wphlp 8KX XKT HKP`@ W_KhKJ F 30 Z1KYK삟2(KL! P @ RK@P p ix@K 8Ki $( K0 0(K0xpKp t @ wKp0 N@ PKHKh "(K00000K @Kp@P0 1@ PKXKh !(K00000K @Kp@P0  @ PKhKh ́,!(K0 0000K @Kp@P@KP (KM@0P!"00+"0P! p0@@8KXKH`KhPKK pT ;g  `0P 0S 03S!@T (K$%D -02LhM0 X0 0T0 D P L H <0P@0 XK,`K@ 0@@NIpA ,0S l2pP0 A @@c8PF 80AS<`|(3[S$u/3[S )$!&3[S$3[(S$3[S$3[Sl @00@0`h8Yy K%%\ȒܒMЍ\p@-<@< `P 0000PQAp) -$0@LP v! 8FC) -d@LP h!PHb DA0,0 F( 0@ 0 )ԓ)) -L 0LR RP 0R ) |00-PPp0Ll Pdc\Ep@ LH0P 0( ,0Q33) - L08ӰP$0$ 00000 S.)) -X!XA0L0 P0<1< 0P  R 1 L\00P  BRʤ00 0 0 Qd0T0H0  B 0S @00S000SW03) $ 0-DP@L0000@@0 0 0 053 -`L,pPo N0 SPfu% ࠟ0S @ ?#PV &00000 ᖚ`PV p 0@> \)@P`0 @0Oxh)),)D1 P-L`l 1 @0Q0S 1 00!P lHh` Q4TAT0 QP\00,pP $00C00S710S00S. +0P0C00pS 00S00S@p00 'PP `, 0O00)))),x $\@-t0p`l0@FPd0 0 SR R \P 0 **+ p-P@0`00|0L@t0@l0@h0@(0@0C00S D00Sg400S php*++*+ $ -PL M@0 4 2XAPB ,K0@P 뼒弢0 Rv 4 P"0S0`00  P, 000S SPP P(*APn P  "APT v2@E,KePn q,0 Q3Aa0 QP\00+ P 00C00SR10St10SI F0P0C00 S 410S$10S@,  c^@0@ P( P $0ZPx 00S0 0P 0 P d0 FT PW(K3x%x3./tx $5+** -LMQ0, @ T TKmPj 崡0封S0A0iQp`U0@PW |0S  0  0t, p3P<4!00S10L0 0u P/ 00C00S+00S*00S" 00C00@S  0St0S0 a`pH 0W(K3**33+x $3-0 CR 0R0 Sc00 -@0LP`rPe`Z !`0Vh7`c0SUJ L0SF I0S\\@U`T x?P 0`!Sb/*0S@,0@00US80800US00`zUPX*\00S` lP  U 0@0^S00\P0S/Ԕ4Ĕ/Ȕ -XXbXXLp@0S 00CS00PӤ0$PuJ  Q20 Q@L00) P00C00S`10S 10SW T0d0C00@S L!0S<0S0 S0!00 Up!00000 +0S0#3 #PP 0S0`002p 0S0`00(W @|W00 00 0 @0 p/.33x $353 -3LM, 0 0 SP`UAP, d3P, T00U@C@0 U`l004)pP 0`0C00pS 20Sg20Sb2 [0 0@E0R㘂  C@DpP "000S S pL2`V30 VP\00(P,$ 00C00Sw10S'10Sn  k0!0C00PS !0S!0Sx1 [WAP 0 0@FR0 @D C  R4@0 RP\00(pP00C00S%00S00S 0P0C00pS X00SH00Sp,000,0`(K3  $3tx -L M!\@0 40 cP |#00p, $Y`P L!P0W<0S 0!0S 00P@ PdC4`@T *)40W0W0S, R0!S m KP D|x0xt0P, h00S40 0b,00p,0 (K333  ?l/ -LM@ 0D !SqeP`@ WD500 ,0 0 80 < 5DU倥4 1000rP 00C00SD850S0 4 Q0  44 {P4  00C00S ğ0S0S|*$X0 X@L00t' PY 0\ğ0C00@S 40S$$0SV0 R0ß C000S 00CS00pӤ0~pw#0S0  Pxß0S0@ P W8 Q30 Q@L00' PQ000C00S20S K20S 0Ÿ0C00@S t0S6d"0S W0p DŸ0S0#3 nPP cX 0  000!00S 0SXHX [D, Q@@Y00SP <08S\pp 810S T $1<0@4X1Q 0$ R00SY0  U0< 080 80 Y 0@0!SP @ 0 |0Px\,0D 0b(K@<3335 + $+/xTl/l?@-P0 H  @0S@ B0R0\0S0 3T3 P-L 0QA\Sp3 -LMtL@ K P ![R,0 B ![R0 B b@Kht@04 -(0L0St 0  *($4 0-L@F(0P0S0   <P0$ [(+ -`0L0ST0P0D0 @0RR,00Q3333 p-0LM0Sp `0 Q  0 APx0Q 0/SANK@D+][LPP @+*[P0 &st(3 P3 0-L@һ(0P0S0   ȻP0  -4L` Q1 A 0[00_%pPu00C00S200S00S) @0P0C00pS00S|x00S\h '0\S0S0`  R038<x $ -PPLp+x00pPO`L@ P 0 P\PP@T35 -@a0p0L 0P00C00S:00S00S1 .Р0HP P 0@0SR@P0 0C0|0 B@ gl0 T <00S000S  $3353 1-ȁaȑLp!0S{PP` 1@00S S 10S0`00U@0SK 0 R0PdU0.S0 S= 0P00@P W  ,pP0  B 0S 00S}00S ,T0t 0C00SP 0Sg0S 53$33/. 3 -L0M(K0 5Pd u,0 QڄEe0 QP\00# P 0P0C00 S 850S%(50S 5 Tp!00!S4 %S  Q0 Q@L00# P 00C00@S x$0Sh0S00@0 0\S 0 0@ X' #@T0 T`l00# Pq 00C00`S #0S0Sp0  p#0S 0SXL0( Q0 Q@L00Y# P< 00C00@S "0S0S;"0  0p0A R:Ax0Sp `X82 , Q$0 Q@L00# PS200C00B00C00@S !0SF0S 0P0p,00Cs,0 @00p 0 SX R3A(a0 RP\00" P00C00S.00S 00S% U0P0C00 S |00Sl00SP0X@ UL0 p000%S!S3\` $@/H/L/xD/ -"LM00 S2 100 r 0 R R$K!P` 0!S 00RPXp1$ \1$0 SHp< Q20A0q0[00F"`P}\00C00S100Sx00S( '0P0C00`S 00Sc00Sh0H0$0 $ 00$  Q0003.Е@/TXx $ -|4LM p4ppp 00 ;SD$00@H$0,$@0,0 r00 R@0P.UR 'U $UL  U U%U,U +U 9U0U1*D?UB ^U ;U`#0   r 0 R00B S  1@s^U-U`@u 0^U-U00@S}  1@svSs .U00"d2@@Si  H2P@f /UH"@0T@@T(2E@ET `kpPQ "0S  0  0将P !0T;T: 0U00dS0 000p0 `!000\"X!1@PMS !;U0 00 00 @ 0:,0P) T 0S@ 0S0S0 00S x0 h0 ` 0X 0D @ 0<0@0,S;S @t(K53333.33 T3 -LϟM @ t 000 Tl iT U &WT& HT ET !T< =T T u GT QT VT PT PeT cTM aTv  gT} /rT mT  kT` SpT nnTb vTi tT xTi :zTU `@0 nR pR lR 0`0`00`P =  Q  `h`6 T>0SU L>4\>bP) `0 nR pR lR 0`0`00`P $=  Q  9` =0S& ==&P=||=*P`0 nR pR lR 0`0`00`P D<  Q  `<0S <<Px,0 0SS0x<0S <0S` (<0S ` r |;000 ` @P `@0 nR pR lR 0`0`00`P :  Q  ` `vD;PoNPkP`h0S!S +9U0S 0S@ `UPOr: ::F|:0S8 p`> r 9000 c`1P- 0!S Y`'`x0 nR pR lR 0`0`00`\ 9  Q  6`0S+@ T8 ͎d9`V $`49$PGTPPgTPVTP! X0 nR pR lR 0`0`00`\ 7  Q  x``h(000<480S``0 nR pR lR 0`0`00`P ,7  Q  `'0S B h70S``v0 nR pR lR 0`0`00`P `6  Q  `V\&00cS0P 8&0SL ,, H&`0S000 nR pR lR 0`0`00`P 5  Q  R` 50S? 5@5JP`$0 nR pR lR 0`0`00`P 4  Q  D!`850S ,5(50Z,0  4u0刔P98 6@GP4  T$00S500000 SP\ P 00C00Sl40S\40S `00C00 SP $0S0S 4P0@8 T4 R4ڠCs0 RP\00 Pd00C00SnP30S@30Se p`b0P0C00 S 20S20S\Hr D?P ,oPDBR0 J0 0P  . P00C00S-L20S<20S$ /`!00C00S110Sk10S  0!@ 0R`|1`0 nR pR lR 0`0`00`P 0  Q  `19t L0000d`XaD1SH 0003.ptx+l/P+x%T33p_@L3H.\L/Ԗ,LHD3330333x3 $5 0P 0 nR pR lR 0000P 0  Q  `m0 0]0P`@P`tPY410S@`RpWX10Sdy`GUP`Wo`=`0 nR pR lR 0`0`00`P 1  Q  L`20S9 $202@ P2B0T@ W0 W00\RS000 [ X2P I  P 2 0R  P00C00S20S320S `/830W (@%P!P @000P003@ W3 00 b 3 30S R#00C0 3R40S 40S $4Ph 0 nR pR lR 0000P 4  Q  `g4 4W4PZ 0 nR pR lR 0000P 5  Q  j`85 5(50S\`*`0 nR pR lR 0`0`00`P H6  Q  \9`60S 6 R6 6 60S"`0 nR pR lR00P 7  Q   ` 70S x70SqT` ` r 7000`70S7 7 =@P `0 nR pR lR 0`0`00`P 8  Q  ,`880S 0S0!S+^P0S0S@`z8Pss 80P8  lHxX`0gS  S &:00C S#pS rS`!0`0`0`0 n1@s s`00?0`00V e`3V 00 S90S W`%p:  : 0 S 0 SL G` ZV000h:@  @P00C00Sd:0STt:0S `ZT P : @ :  B 0S :0S3:0SVP PPD;h+0X S0000W0+00#0+00# 00 0nS pS lS0 00 00 0 0\ ;P`,0 nR pR lR 0`0`00`P <  Q  `v<0S <<< <PcLwP\(=0S4 `UPUL=0SX |`J`0 nR pR lR 0`0`00`P =  Q  W`%=0SD M{>@= TPpdU0pde<000 c000PP Qp000C00S  0 0 @0Q0 P) >0S>>0S `> P0 ?  B 0S,?0S"00CS:ʂ/K2 6 0f Q0 QP\00 P 00C00PpS d&0ST0S(6 0Q 0" 0S)5`V0 VP\00w P 00C00PS %0S0SXd5 0 0X0T0c SJ,5 Q0 QP\ 00E P 00C00PS $0Sv0S&4Z 0 0   4p$bpW0 WP\L00 PP 0$0C00PS $0SF0S#0S  03 EK0S 2S 82  4  ?KDxP B8#0`i p0Q/C QP\000 P00C00S20Sdd00C00BSP 20Sx20SV"1 8T{("0S  052B  fE `E QN PUaJ !PZ!@0`00P*@P Uh  @PPD1  B 0S;410S  10S1 ?.T0  B 0S 00S{00S+0(B0@,2 (B 00 x@0 h0b0"R(2,BS@8l38" ,P(K53333 $33xؗx%3  -LM, ,0  0 Z3   0%Sn0 SjC 0S| p Q'0 Q@LD#00 P,00C00i00C00@S "0S0S" 0 S0` 0S+`F,\S&0 S0 `h0S0S0`00 144B{P $"000S SPtqR`00 Sȁ R4Aq0 RP\00_ Pu00C00SRd10ST10SI @0P0C00 S 10S|10S,0 0`00R+ 0 R0! R00 10B0S +1@s /,00,0 gR 0000333Ԗ3x $3/.3 -`吀L p Q0@P @ T00Cs0,0 (0000 0|x53pt -\2L M0sL2H2 @20s4(B0S2  2"pP E  @ 30S*KKKK0 000 0 0  00 0L 0 0 0 0 0 00 0  00#0\L 00? BÀ@`40KW @DpG ` ʰ00S x0|0C0@d0  X0T `00SuP00S $(Kp53t|3x3 $ -PpL0` S d0 0@P  0 P @E 0 5$?0 % 00)( @@|xxMЍ; -/L@P0S @P :0/S @P:0/S -LpM  Pp  40CSlO|OPO|O|OPO|O|OPO@,D +P/ <0S P$ 0lc$P0$ `h D3/Q@ 0T/S/00(0a0S h"0000K^p4S :S0: S0S HP0S H0d6H0 S 0S 0S 0 hH00: S / h0: S 0: S  H: S  S<  S S  SC  SF*q3+D!0S t0Sh3  60S &P/(!k0: S' !0q} 0S q3 0S q3 Q -QP p PP 0S P4 n(K|t\,5(P5(5 -LM`d7`0\#\Sp@1 04RP" LP PP HP*iP fP$pP3@ rP p! 0p1  pA " 00@ [00"@p"pP2 \2RP @2Q@妯p4 @eT20Sp 10S!00p ɑ10S 1SpZ 0pz1Dz1a uQ@+C P !#p%+CdP 0. 00 00000K,]p@J0S  l0: S$ Y8t00S00S !  K ]K%1: S<00S800S @#묨 555,5(5-И5$5L 0-,@,PL( Q M#l/p` p-LM 0PK*"* 0 ,@`Q$K c\0PPP @8PV  PP 0S P0<0VG}c 0PP sP㜣0V0XgcPX 0PP 0-SX0S $VPKpЙ Q-L@ \%PTH 8P 8,9(0P hi,5 Q-L@ X$PPDܓP 8,(0P hG ,5 0-LMPAK@A `p 0K U04B h$P \TA^KPE<ᵢP0,0PHK0,<,5 -LM0D0S W P  D0S P  g~p !HRB30S y$30S3 x#30S 00CS00@Ӥ07꘢@+>3 3`V KJ3@T $)Kd!KWP0D#:  SK RP P'`)KD zX20S K  0$`x }P p20Sh`[K(PEPE9K) 4@P `?V00S 10S 0S < 唻볞0S`` K DK0$P Vt10S d|``d0S X1 R D0S0 @,00@ 0$@4 ( V g x P V-00S)F%V00S D0)KS,0D0 D K d00S<0@K08K0 9K4VS `(Kl9P9`9ܦ @d9T9p9,L9 -ML M 6pI 9 9, 0igS0,0 Y,@ 0P P( 00P 0L( 0 0uS0nS0 0, 0,@XP HP80L8 ,9 0@KT8 [= P, 2 P 0@K 劽P`@p@Tk PP+ ,01 r, ,0SU 0 0!0@S08CK $8A 0@pK0gD8 A 0\ H( `8 dTL STu 1T9T-LT NTYaT- VT}bT* cTnTI gT4 fT.hTz lTz2rTp oT? qTrHtTY vTm_L lT <0@DPH eAbF,K ,00SX 噊00>&G T< P( I 0 0000 >4&P;(007H6\+< P 3H( 5.:8o0F,p 00.S.0@0K`8,0 , g b<0,0 0 0 0\000 V%000%P P D(t5Pp@PL8SX5P @e850SH0p TP4 4@0H(R 40TS4T 0HST 00 RØŎ($0s400s030 sP CK.KI B BI`X( (L(00 @0-S 0SH8SCC000S40C S;Du v vu v^E0PEU\EPE@- 0S  00 0 0cRÌ`@0  0"0Q1 P0 0S  ҚL5 -0L0S L5 -`QLp@00SP(0^ ^0 01^ 4# # !^#$""1^"4##!^#$""1^"4##^#! ! !@D!$""1"#T T $0@T0 01 # L5 0 "Q p-L`P@@Tp -pLAM0`, . 0J/K(1 |00R0@KJ_K   Pf@0    pd`0,1((K 0@-@P $^ 0 SΎ809P  L0  ( , 0 8 < lPP0P@-@ $P Q < ^ 018 0C0,0<8 0 Rp-PL@4 0@Q1S``.Pp(0 `S00`(0,0S0 ,00(PpUE20Pe$00E`S0,0$0p040$Pphpܥ0%0  -@PL $Q ,0S 4Q00$,0$0P $P 00  00 0@-@P \00^ ^l\P:0 -LMpPL $`VI 0S<0S0S < 80 0(K08< 80080< #4 B80< <0 S0 h0 hh0  `h0S @ 0 0P 0@P0P $P 0 S<0s3 -P00@Q0SLT$PUQ (\N ,0SK 0(! `P 4P $ 0(P0,p 2LS.Q :%<,0Q P0b0bS.00 L P0l0S.0b0S>0Wl0 $0 #424p$`0% -$@L40pS` $P0 (P47 (Q$ 02,(000( PcU4:b 2 (0,00 0e0`U`1`!  2PU 4e x2(0,00P00( 0S00, (00PR:0,0 -pPL`P4 $@T1 0S 0 S+0 S  > ;0P P 00( 4Ub42(0,0e ,2,P0 0 -L0MPP  $PU 0S 0S0S0 S00D < , 0H0 8p<`@ 0S񟗗̟̟̟̟̟̟̟̟4hД|d̟< y< !  ;< 0S  0  Z  0RJv`V0'|LP0S'r0$ 0SH͟`F 30 `  0 0p8Z  0RJv`V'4<'<,4<0`80 00p 0S < H  D00<`8p k 080P\ 0S  07s`0Z  0RJv`V 0 SDL 0 0T0 0+X0 00LP 0; 000!q`F<07s` Z } 0RJv`V@˟("('8,Rc`0@ 0p@0Sg DQ01 S@1 @!T`  H1@0D H0d d dD H @0Z M 0RJv` V"'5t  0 0Q\0`d 'w`FR0 0h Z + 0RJv`Vʟ00 0'hq`Fh\0Q* h00h0S S.0L T0l T/p l0PZP< 00<0h0T03L@ C 01QZ  0RJv`P Z  0RJv`V:7q 0`ah UP  Z  0RJv`V:^`a7q< 6 0n00'q`F(P   Z  0RJv`V:71a q`AZ  0RJv`V:71a  s`AL 0S \7 000 h0 0h P*d `0h ^L x:0S! S>/΅T 0 l@L0T l0p` 0P< Kl0`P00X0X 0  p0d P0< 0 h6 05T030CL01 P0 Z . 0QJv`S4  03 @C403<1 R0 Z  0RJv`7|`lS``@ 7p0  0@ L% 0H000HQ Z 0RJv`V:1H0C07q@ `a @ 00X030CP01 P0 Z 0QJv`8 03 @C803<1 R0 Z 0RJv`7|`l@``7p'0H00D 0HQ Z 0RJv`V: 1H0C07qD `a D @,0DD 00`R00< jD Rr @D0 bSH @c 0 bR a(00b@40bRD@0 Q10l@0D0H0lD0 0 R0@0HS 0L H DQC @0H AD 0H 010S4  Z 3 0RJv`V@0Dl00@0@0Q00 H0 a8'4<,'<4 <S D@  00D`@ p0 0< H00D(08pS<`0S 0@P @P0< 09,0@ pc`b0 00@ 0@0 0RV0 f q8 QS@00<`P  \ 00R40 <P<  < <(K0G-|M⠀P00\ 0 S |@0 2R02BQ0`\ @00S@T@ \0@ @@@'@\ 00S@T 0 sJ QR0Q0P0S< # 000 Q | 0S4Q 0$A\0P P 3ß(0,  (,0 3ß(0,00S0!Tp!p1' PP#0 \00LS`$P08 8  8 800@0i^040@(,Ŏ0@`@0ià0%3l l 041 R @0@# R@0B00|0 02S0C8#(@  P P@@a800@|0T"C$ \ YPi0 \00cSPR :  0<Q00SA 0P0 0pa 0bC1 0wY $ 0S0`4 @8914 @00Q  0A0000S@010p|ЍƣB  0`ᄤRQ vMЍl -|0L t0Rl0 h00S`0\0\ X0Q0 LL400S04 0~P|9p t9 x9l/ԩ -L M0@S P  K0E R0E}K`  0-L M0@SP !P K0' R U0 %} K0P  -L@M` !6@3/Pp@`Lp Pp Hp W0&oS0000&gS0000l&mS0000X&fS000gU) PU HU LUAXU fU RU:uUrUhU% oU1w0ES- pppP@ L@ 50S `V1@.@0TS0F0H@ `D%=pP,5` 0bSP0SH00 HQ|YW00HD D0 4APU< Hp 080 000C0S3004K 8Mo@+0SP8 ;400S0 < X @ 0@ o8K0K, KöP 8 ;0<0 ,00X @ ,0 \3pW/ @000C0S4KP oPP"000S d 400S 0< TP X0 @ 4OmP\ < XP + |20S P: `Pp. @P <  p0@ <0  `< @ < @   j`P  p d mt40C S*@XddxxP0S ̮ 0SN Rp 0S  |I?HQd R:Z <0S00D0 0S X0PSTH0\;l D0c9 0S D0c0@ <0RP LQ X RH00 X0c0,  D0{P xpȱ@P(0S PKᅮI 묨px99|9t9-Pdx8 MЍ -0L Z, pl/ -0xbLDMPp@,0 gP uP@00,0 0S $"帪p20iST`P,K!`P  :P h0S U{ kP z (K1D P lֵ@PU0 l倭PD/lK\P0('X  |p A$qPPhP  'V q@{+T hp zP P / p9@P 0SX@X 0& Dp_Ȫ-Ъ0؟ rDsT2MЍp@-`0@S8 <0S9\6 00S0C;ౣ;0 `\'P <3 ß0#@P0"0 PY@0,0K2D0 T` Pp /&lKA&&0TŸ0D2&0S \{F~KpGL2pG0 p@P 0FKH`GH @ PG 0 0f@PV 0Q# 0$@PRa %p$0R0C0= `A   x4st| @00000%0 00 x$rt4s xt$`xt%000400S 㚎(K耋؋PE(DETF   ,Xx&EԌx%t\ -ML Mp`@P gAK @@ 0%WV 0S:0S:A@2&P 0A.K: SD0P B< B4AK AA KE4( -LM0  -424 0`40L  8 ;;S0 0S,0S) R'PP!<0Si & @b80 TPp<00PPPlA 080P<  80K 0SF0SC8 Z@0@0p0 8;;@TPS@ P1 \.U+T) P$80 < R B+ౢ+ \b 00SOQ8 0 @ H& @0Tp0000 0pE< -LM@pQh 0 t0 @0 P `0O?  4D;$+4 0A40 4P 00SO0 @/8/늟KP #,(  80@ e #X0  P 0S0S(KPE 0 0 0E 0-h0L0S XX 0 0CAP T@D*@0000CCK `vp0CXh Tx 0Cp`0( P8 zB0\œ\00 S 0 0 R \00O008(LRLHL8 0C 0PLH@0S00ZY 03 LP@0, 00^P{] P#L00\%0R0 0S @0 @0 0S @0@Z00 0  XT(0(p 0( `08DHS000(KETPELE܏FE -LM<0@S0<000@50\%5R000 @|5`0\: S SU SX5^00(Ŗ /RHQE\ 5^h0S< 0 74^ JKAK,JK:FK0 J?K45 0B?hFoKRNK@DX T K< 8 4@D`E D @e 0 X%0H@RP5 (@ \5DS8% L0/T 408040#0\P0(00s03t0p  0S. @0TS>@0` 0T0iL`DhP/0\%00RP%O0 @PEO0@YŸ0 P0%(0/p@0S ( R050 X05 HH08040 \5SU\0?0 0 A1 0<  0j0C V 0 V  V00000002@ @2P0\%2RA (= pt20\%2R(00s03t0p  0S p00<00820\%@2Rpꐫ 20\%2Rtꁫ10K0\%1R00d0X0A10\%1R00000K 0$@10\%1R000D0d10\%l1R00000K(0,@810\%@1R000@010\%1R00 000K004@00\%0R00$0H000\%40R0O0 @0O0@00\%40R4h04O0@tt0 0@0 09F60p(KTEEE0EU T|EE -L MW @RS| 60S 0So|p P60SqFp [^00Fp T^000 ST6@P6 H6H0VP4V0V1(60S 50S 60S ?pVJE0SjV 0SeV b 0S`V , 0S[V  O080B R OT dR b \ 0#K`P``0H`"d0B !} 0/R0O?0@l&@@c0 0 07B K2@U<40S 0;0 @d4 Q PLU30ST 30,OPso/1"p@0@_004@3p8/3`"<KP@  hhU$C0S TbU_U@@T 0C0S $SUPU@T 2@@2@2@20S lR@唣004 020S- <" 0S&P`PY`/1"@ 0Od A 0ZPap ,0 X1倁0qSl1  `1@014@0 ,0TQ@*@'0@L#!p1P10S+ 00SL+U 410S00S(!U-P KP " (0K B_P $00SU <(KPE _8EԐCLE CE(4E(DLlБ@E|EЯE,E@XܟlCEE,DF0EEDs p-L@M P`K0S 0S  x  -0L tpl/X -L`p"R0@0XdS3 YSM NSODbS cSJnS= fS& mSB&pS yS=7!0 0 0|0" 0l `1P%PL!000000 >0S1 S 00000000 寗p00@0dS~'zP#z\00SzJ0 ^`0PExEEp_HEPEDp,D8E  ̰-pmL_4F -L M`4 pP,  0l"`bd"0@0@Q P 0,20SM S0 }4 0 u,0S  P0 a!0 0S1 0 @010M0x!`p1l0 @R Q @e 10S S 0 : P cEP000 .`0 R0000  0S0S R0S0S p 00 @0@P `JZ0(K茳9 PE<E@E9ܰpHE4E -LMp-0 O !S0`¯  ï^ 0Po xΟ1>0 20 P`ZY 0p>,0W4HTLd@ 1͟p 1>0 2 P0 `XWD lK 2,>- 0,0Kp=D0 h=h͟d=  0x@mɯ P0pO`xp.0 0 ` /l} 0T0̟\% R`` p 0x0OWV0 @ / l,0S< `L0S8 DlP| K0@S\0/ 00@1>  0S P` p0@00K0@ aP0 @ `K`p` p  Bp p 0@`  @0p0  AP @  ˟0 t p 0 e:ZY P ,K0\%0:0 pWFʟ R(0 .P!Xl .P0S 0 $ R(p4` t.P   n.P0S 00   P   A,)0\5S , ! D009I000PO@? O/ i0y\Ő@ \00T"S\45S:05S:  R8\ 0S 0 0S0s H0S Hh\\x0S \@9P  h0\%40RO0 @O0@70,hǟ`|` \u W|00 0B?QpP tG0SO S C| Bt0R 1!(0p P`@ W00S0  0SP %0S 5W1(0/1pP ^ @@|`@t.P1!X0 PW00S0  0S $0S 4W1X0/1@TP Pd 0@ 000S00S P XV T8PDD <$00  RDDc0\5S 00   0S 0 00  r 00  pß'603@P00lKT P \Kl404Oa#p\` Xp \%Rh0O0STG 2Rh0@_@00lB  P 0S PP. _b(r0\5S\0h0\0K0@ `  ]00P@  S @ > Ÿ0\5S , 0@t`K`pt` pp tp WpPX10 @P!00`0/Rr Q pnYZj x ?SR@P@TP0` @0 00MT UJ  X`P1 _ RE@E9|ETETPE(DU TCCDE pC0DE8E4HHlC99PГ@0EE 0U pT唠! i .L00`0K@  |0@ x@ ,0Ta0 (K p-D0 ML08, `L0$ 0`PKpE9 -LDMl@KD I.0 0p 0 0,0K0D0 $ U0TQ`P T@ PP [0lKS  0@P0 g0Rp0,0Z@P0 (K4EE9 9 p-D0 ML08, `L0$ 0`YPKpE9ȱ -LM4 萟, . f,0PP0,0 0S \   p@0U PUT0 R 0S  0`pHX0,0 ,(K9E@-0 ,,0PQQ0P0 -UML M00CS@T PP% @ <P 0P/  P ş 0PQ c Pji0:0090MoJ itU pE l5l`KǚD +- 0K1bt5 V>K0C0Cx5 $5A| %5 0,0K5D0 [oK000p00 0S S$< 0-;;S< @00 x0p0S <0ttx% 0 <0\Tx% 0p LD0SDM 0?0?0 00SQP0 \5 S0@0 @0@0@,,0\5 S33( K)ɠ(K 0 \5 S 0@d1 `A P0@\1 XA 0\5 S,0(0,0p0t@P( R01 0#\: R 0\5 S0X000@|5 R0T0 P@ lK0L0 H@ tD" XT: 200\\"2 P0p00P`G 0SD 0ST> st: 0  P$`lP,  ]00C0P M000G0@!0C0@0 @$P0PTtX:0 P00a0 @ 0S0S ]0@0PU:T(K谔ȔxHԔ$(C00P89089 0 0@0@0 @PR0Sß5 10128:scPI00CS񟗱X!#""!!0S0S $ß0P0S0S"0S  0S"0SŸ 0_PP @0: S00S000 , 0 - 0S)0S&~KpG pG@0 00RnK&@`FP `F 000!*x10S dJ<XPP7 0S0S00@@0S 0(00P89089 00C0 0hU8008 (KDM$Еt\(Tl̖ܖEETPE(D4@pt -1 0 B!1L S|!000PPQG  0  B0S?<0S9 `00p /0S  0V``P P 0@ 0$@00C0J00P@00;J 0Z*0 Cp0S:  0S 0S @00<T RX  0:0D 0@, 0@P`HX,4EE@E -LHMl@KD W(1! 0,0K1pD0 j0!Pop [VSUQTP P` k 00CS?)(H)(T))] Q  A 40S 0S00 R# +@ 0\5S00  00S   #  0|0@P`d@p 00Xp40 ,0W 0 (K \*lC&xET0E 0-80 ML, (000& PK09E -ML__M>Kp0(HCHHK \1'X>0S`XKPayX0S$5S(N0S %0SP  K0P! $5 KPXQZ$UUȭUTURʴQQ$PE``0P3  BaB00B $"11000 0S 8 $U.M0S P& 0S  $QPEP`0\3  BQ@5 B0$   B110L 000< K P!Lq QV0hK  B0 20 P`ZY\: HK ND 0, <:<*d: "XKLaZ`0KO Hat,0 0 Po/0 hK\aɟ0 S 3 S(K L0XKL!OL8<KHS."KL` `XKTa`P`KLV` U8K=CHK\AhK0 0ta `,00CV$KD!Xa$5S8$p  $  HK\A(0, S0Q (0Q,`,`0\58S K\x0  R0R0  !HK\A x00Rx x00Qt0Q04hK  %0S\08Kl!%L5XKsGCLQ0aXKtO a3 Po 00CS322222000 0ǟ0C R 0\0R\0000 P20 Y  0tfK0 0ZKt^@T6 LVR\0R\0000 20 00CP 0hKnFKP n5 1> 0 S2$ ER`0K@5ARK!! `0 0(K(K1 0K1 ! 1!2(K1 0 0`8 0iS^000$5S*8#l  0@00^$0 d0R$0`0KU0018a^! BB.A.A BS8K!080ïPHK@A ThKDa V `$5S+l0h P0@` Q $%Q  !0000SPp0PQ $%Q  !000$ P0K0OP0 L@ `0K K0O`0 \@ X0K `0OX0 T@ h0K 0Oh0 d@ L3L 2%!P MK P0 0KPP K\ ~(K\p!!P K P HKp!\l2 a0S K\  M0HKS\0\A8K! Q0 SK\hK\010 0 0 S5 1(K-BP`05" HK\A40 SK\K\010 0S58KLL/1 KH!"@(K-B0@ 0P@`UVHKdAZXK\QψoXKag,DPEвpT0E99<T0Ex(DسU TE TEK\$0,PS(K\!K`0@ 0!S`0hK10 0 0 S1 1(K-BP`05 0@S`0K10 0S5KLL/1 KH!"@(K-B0@ @0P@`UVHK`AZ0\QhKS\0\at0 SK\\0 8Kl! P K P HK\AQ0SK\\00S\08Kl!  2 KL0`@P``K,0LPtL2@@L5?^s h!h`KP% P MKg P 2 @@ (K -,0LM 0 0P9900 0    0 0  -L'P  RQ-L@ P P-L P 0-/LP@P000+0 /00$+ + 09( p-LlM/`ط@P K#P0: S 0PrS@  Kp p-`PL@P00S 0 R CC>V \00S pH0H R 8C,C(0(Bp   ,~p8 --LM0 0  --LM0 0 K --LM0 0 K -L@i hHz -41LQM pK  "P@`KC8`t"P10: S 0R 000(YK@a"Pd1: Sp lBVPP S00S )@ЈP U@ K sdt --LM0 0 dwl/ -L MP3@P 0Ta0C0S0T00C SdjZXe T00@ Sa>A, , , R R3#!R #!, P 00C   s 4,  Q0 0C#0 0 004800000,0 0 B4 0(PH T| ,(P0@@T0p`?!࠳8<0040(0, 40(08 40 ?" 400 000 000R ʤ |`0B000@ 8@0D Pp0 ,0 @@0 ?W0E ?Q ,d d00d0V`$@QPU`0P3  BB00B %"11000 0S Rڬ0 0 0(K褙ԙ\/d P-L@ ,00S YAhyPE~D -5LM Rppp= h5huPoʠ 0 @PD0(\%$5RR1 T04Poğ4ʠ 0 P(4 \5 S S ST  S 3S3S |ğ @p?t0 T4*` ,P@ڴQ0\%4R  S0@Sh` VŴ0 0B RR40AQR00QT30S0 @ O0TS¯0   0S3 0R[ 0RW 0RS 0RO 0RK 0RG, ,0RC0 00R?4 40R;8 80R7H H0R3L L0R/P P0R+T T0R'` `0R#d d0Rh h0Rt t0Rx x0R 0R 0R  0R 0R\%\5R" 10S @`!1@h00p`P   \0PaA-@@T4:010\%R& 0O044D $0O84d  PLqp} (nKbP ,@f ?G0: S , @PG=0S , w?,+P o?= R0'D=P L= 0S$= T P Y?$=0S m 8-0@0~,(=P` ` `  0 S P ,: @ ;0S; 0>;00 T\* :R 0S  L*840Sh IP8 y00 Hq @ J0H0 bH 0S >0S -Px8 hy04 Lq .0H4 bL 0Se>0SP8 00 PR h@w0H@P0S0G>0S$P7 儈04 TR @0w4hH@T0S*>0SP7 x,5SʐSQR d0F0U4e0S >0SP6 pg0\%(7Rx@<@Q 0V(E0S=0SP6 V H08<%0OQR x0EH/8<%0S=0SnP|5 lV L00OQR j0EL/@D%0S=0SKP4 5$pQ@PU``0\3  BaB00B %"M011000L O 0  @_TU2 ',5$@QPU``0^3  Ba@5 B0%   B110L 00C00S C=0SP#0 0t$ 0l44\%0Rx DCQ @d0Sx@0S"=0SP2 33\%0RtA AQ c|0Rt@0S=0SP|2 lB 0S |20SL3h 1(S@L L3S   /80HLd 0OLS|0P 0h\P P <PfP$$ F@"@0F 00(p`Xx1P` 0O?@00@@0!@ 0O?0@@@c0P@\1PP 0,<1PW0,,wLEDCEh?PE<|HěvE̛ܛFDE=edA8@00@ S2,@ @P @ P 00S>@ P,0H0PwD@ P o 00O D,D@0p 0 Po/D`0j0!0S 3S1 0  p?P0 `t!1>,@0 200L1 DR0@`0R1 0 >`0@  0#0p@P`H@ ,\,  H0O0080Q0 0@0$0HP0C0e0$0L\Y8K@ K 8 4 40W8@V (KTEEEEU @E -0Lp@P` d n0S0S @ T @ 0 @Tpr 0X L000 0 0000 @  @EEԠDFG-P8嬐 稠p`@10CB>A>A0B0W3! Q 000 80\@80P <p@-8PP` P P 00Sp001 #@e0000 #%1?FA00 0Sp03 0 Rpp@-8PP` P P  00pe@0@0A#O 1p"1?0FAp1>0 !A pp@-8PP` P P  00pe@0@0A#O 1Ìp"1?0FAp1>0 !A pp@-8PP` P P! 00s3p@e00@@00A#O 1# "1?0  0@ #p1>00 S20#ApMЍ# - @L( P  P  P P  P  P  0 X $0 000, RLF0 PF 0 \  0:0\  -@LP  P $h 0-L@M0PP HP{P@@P{P0耹 -\0LM@(0K( 0 @ K$ K0 P K$KTF -0L@HP  hd謨 --40LM K 0   K脹 -`0LM00 0@0 K P @Z KTF -t0LM $0K 0  $  K K0P $0@Z KTF -0LM0S P ZX@0 @00P ZTFй -LM  K K0K p@kZ dK 0-LM 0PS    KK0p @GZ|0 >K0 -L@Ҩ3bGL 0S00`  -p-LM@0`P0 RZP0200  0S CKp --LM0 0 ޤ K p-PLP` HF 0刖p P@2@p0S *{P@ Pp{P@$0  @pp\p` - 0LP`p, 0S) 0S& 0P 00p@xt 04pd⾯PP(@ V0,0,0(`@,@(`@po\pLF -T1L000,Q,p5@p 0`_P0 ,@T"0 0R0 0Ep 0 0S 000FP 3000e {n.PPD.@000e ,@TLF` 0-|0L@0S,@TH0@_PP 0MP@>.P P.0LF --LM0 0 أͣF K -LM@84p`PK! 4-&4P4$0o$0 ], -LM@*0pP0KPpt P4p`lP Uh ,90!K YP 09`\09!0[ 1S000SU% 09@!4pPX0S X0S ~X0S ,<,92 , <,99EX W WQPLE 0S fE0 (K(0 ,0Do0 ,E` K\.Pe p-`L0S+ @P(  140P00 (0, S , , R(0(0phJp00 ps ph1pLFX  -LgE0@000,@T Np`P?dpW0S P凣 xp0SW0 SW0 S @ T LFxY_`PFܻ 0-0L0S 4PQ 0 @0 PU0sh0   0  ,@Twp ^@0S 0X LF -L@ WD 3p$ px   -X2L$M0  D2$ ,0 (@  $K,K0pVW0-SE1@0000c,@TD!p/ 2p`+ P#8@K P 4` 0` 8P V VP y+<0!$14`Po,$!1 KDw 0 @p`P#40S 0:0RcpV0S P嚢 $wp0SV0 SV0@ S TP0K\ xLLFxY_YY2hlPFܻ -LMCnKЁ+~K*+&3PP2PP%(K 0@K(P + tt0p ,P mX<0 ,P m<(C=u vP 00p$`K vp@ BTtV0S b$0[S[b0S p@T$00 SXTHC@0  K2YdX DhT  -L$M1pP*0@K P ,p (p 0P U U10aS1 @0 8 <` 4p q*@Km |w PK h\P! 8vP,C2 /vp@ TU0S  0S' 8bQ 00S0$0 $@Kc1\ |p "4 H0ppp "Q00 SKYT Y2ܽ0X TxY` -0-L$@KM0 0 00P@$0 S000 @ U 00 0SK0 -LDMPgP D @˫lP ,$Ы J0PVmP P fV@ sV@ F́q@ ! rp`10S6  P 0 P0P  P8 {(@K `$ ` 0 p , $(p`0P 8@K[)   4P 0P 8` qT mT66600?xꐾl/Y4EоT X -p~<~xTyMЍ;8 200 "P: -LM@pPg |`P 0S nS0oS` =PP00 @P @Q  0U0P P00 00 X 0000X  AU 0 lT00 ,K#, ?R0S@p\T0"S4 0A@P؟ld| -LMp`P@( P(K,Ka  0mP(0S်$K -000 0LS    sEGp(l/̿ --LM00 @*P 80  ܞp#p p-\0L0`SP@8 ,`P嶟php Hgd 0-t L@hk`P\PP P 000@P 4,咟$@0XFedA$H Hp(8 0-LM @ K4 0K0 @ P $PéK0 H -MLM0@<0 8@ 8>,P > > > P ` =t* P-] p4`Kh* dz -N0@&S:<H@țHȜ  = +0 `r40S<0t:  t Lp RQ<@0@0  |< 8 `D4 P<RD 1 `44 <R  1 `"4 ;R 8 `4 ;R 1 `4 h;R\ 1 `4 0;R$ o1 `4 :R _c0 `ҏ4 :R O80S *8F@yP| |000:hnPT*T:1 L S-ɟ00)<K$p 80S<0S ? 0s 0d  0Sp<P 0d h* op0St9P ( 0e 0bS 80S \@K1PT0K\0 X@  p(1 R0`: -W bpP& P! ^KPEeNKPE@D@D(0(8Pphp(t8ph P 70S- 8PP(OKe/k r?K: 8x* (K |J lZ p <42 =C02 =$2 7P00C,0P 0 1K," ("  6 Rp A 00Kx Pp Q  H,K0TpP#Q  y,@ PPP~P yP,  `,0?,0   P ``rpWZ50S EP YP| PD |  x l* r  0 Px IQ~  -x K P=Qr  !40S 0: S  0: S n`00Sx `@ P@`Rl `0R00B S4x 3@4| Q\p* l |*00A Sa>@2 : 0 @@00@0`   0 S`*l:   |(0@S`Xd <`KP h30 0 0F 0@ 0 @@*0 @@0Y@P X 20Sl` 0\P||2|`0O?   4D;S##t`3^`V u2 (2 R P 00C   R |*(0 S;30 R 0S1  0#R ʄ101 S90!0S`1010p10S xA0S d10sm00!0S00S00#1ѣ10L@Kp:  x*`00S  P |*p ,00Sp %1 x #1'pGLH4Lp_$lG$H,0H( @$D@H`4|d Hl<8X.-LH>n<p,Pp H`80@SȨ000 10B 0# 0 10pl80@SpP8,000 10B 0# 0 10Fl -L80LS$0XXXX0S01S 00  00 #A10 #1 0S l -0LPA@`|  `   0BOpcP VB?㖃! p    G -LMp`Q pD4K iP00SDDT[0 P2P 0$ GHH8H -LMp|`Q D@X4 iSTP8D0 P!P 0"GH4H -LMxe@D lUd 4 0 L5QD60S 0@p4 00 pk@040 0@ 70PS`08 `?4K P04K80Po4P 0` 0P0o ?S4 RlEk 4 0 @4@84 `R`0_P 4K踨 ß 0S0C0 ?0@3C  00C0 000 ?>0@3C 000t30SvL3 Q`0P0 20D080U00@ d 0 0G4K(K0H,HU 4Lt\\0?0 80(R0! @ d 2 0; 0@4D1 00C04P ,0OT8`S8 K :0O,0 (@ 8K 0ፗ0 O Pop@P <` @S!.Ǐ@ 0@W< !@p`p, K 8Kux `?h` 0d ,0 0@P0 0S 08Kx ?[00 08Kx ?P00, $000 (00$Kkh$0H,HU 4 10S70܀80P)0p@pl@`x0W0HOH DpP,0 /0Od 00 0 080P0x `RzU(K0HG H4HDHpoTT(Hht@GG@Hܟ/LHG$00h0 h0 S:h0@2 0<0L2 0\ X2 0 0R0PT0XT0P0P0HU 00 000@0PP40@0, 0a84 0 =(0 H4LD0 ?>0 ?0 ;0 4 D0,40S(d@8t<%4P`) 4  4d UO0O?`@P$+4ξ K ̤Pp @p4Pz`wU 5aP`8, 0@KP58K0U@ P T 56,P P `F8P A0`@ @c0 0@` R pQ 0嬐娠 J)F#Z **0P`@70S@P'6*0+\%7R7\5*0OG*0P7,(48Q0\580SPL $8PP x0C|8pp@ KlPp [P P 1 PP80X0 h R01:0P&~ H =*o`p㤐K:P0K`0S-H 0O ,00 /0Od  )P0d PvcP@c@t 0 S 2J  { യ@P`pZ0J0P,0V0S J T:0S `:Pz l:0K0S (P  ?>0 ?0 ;0 4 D0P  p0J*0`PTH4LDVDKd 00 f0 R P000`P pV`0 008P40 & @@&A@p; 008#80(K -LMB40@,0, $0$04B@0H(H@HMЍ7 -0L pl/ -LP`p' @@P0/S /IP@0.S0S .S 0S `V4x_ p 0S0 PPXH0 -1LMXp ttҘ'l10SR 0: SN #PJ mB0 SF3`K* [1 RA@LPL 0P婘垮00S 00CS00@Ӥ0~$B@`P0S 00CS00Ӥ0~B PpYTyT$KPHPl/LHHV\/. -LM0@P, U`pT` p,  %P @TPU T -L1M@QPKPpPQ@0: SI0S H^M< YpP; KP7 0S  0S 0S0: S Ap00#KAp $3 S`!k3 P ˗ pD0`P P" p4`"(0  ק KxXH -LqlM`KP4P$0: S0SB^#0S P 0: Sp 0S\P 0S CA0S ,P@T(KDHXHHHTH -@2L0S 020S$20S ePPv g40C S0d,$0!;Z( 0S 0SO @/ l]A0SDH aP> 2a p8 0S0SH OP, $0BS4444. 0S R HiP 0S @0S \册pX<`pFd@P@0S ,ɖoaDHPHLHTHXH -LP`PL0H!Hp@0dP PP RPiP@ rP fP p0@0@ 9]p00Q@bKp~ 0dS`00S AP0S P0W  00d묨DHTHPHHH-LHXHMЍ -000 0LS    rDtpl/(-0 CR 0R0 Sq]00 -@RLP 0S D 4TH UF 0@SB 10S<p `(<.]0C3@ R 0S, ,]0S|]@ l R @0 S0S400S(>h>h\// 0-PL@0S(0hBQP xt d\00SP e <\ 0 (0hxPp// - L KPm @\H Km" -2LM`@|BPp2 lR dpXT2T"PPPfP tP [p2 10bSP PP P 0@SX :P210S Ya@a,@ apQl 4  PP `@a0<S 00K@P >0S 1 0S0ᬊ+0S% 3KP ,K ㈟ 04 P,00S ,040 8KdP @00S dڔ 0XՔF ӽpt0p_@nm-@ppMЍR -0L 㳽pl/t -LlM`p@/@  r3X0 @P0W4P]>KP7P V> P0: S N>0 0X  (Ks -LMp`c<KKሁ0,0 mP pP,  PP Hd+ D@l$!Zp1P Ip0 1 PR ԀP`p)i @P0/S ,0S  b ጿP00T00Sv4P@媉`PP묨p_8 -MЍ -`LV@pPq \V VfH b[RC[VS  0 ^S0 0]S0 $0[S0.P =P:P 0SE  0]S0\\S0nS  0S ]S00]S*@P" \R0[S  S nSP \SW0R0000P R @ -`RLp00@P0@ s0@0S S ;S s0@0S S\ 40gPV@ @u. -L`?0rS aS bS6tS {S1-000, XP & 0R0 S 0A 0Sp ͻP 0  @T0S04 Z ` VXSH$ p-L`@P @P 0S0 T X0 R 'P 4 '0$ 0S5ڢp0S<\S 0-LM0 9SP0S*$S /S\S @PP 0@00 00 K}@@8Ll -LBKCM@M @ 50KP T L$ X4 Lt XXGP@, LP8P ?@,PLt ,0S , ,0 r x000,0 R#R ;R Pp0000Pt 00,0PPL ,tP,  , ,0 r 000, 0,S0P0-0S,0  , ,0 r @000,BP, , ,0 rP 000,00SB ,0M00,R @0 S20U,  P)0 SK0,,8XP@ ,00S,0  , ,0 r 000000,00S,0  , ,0 r h 000L ,0P$ 0S  0L0P0 L0pL4 ,00S,0  , ,0 r 000,0 ;R  R   ,00S,0  , ,0 r H 000,00\S ,00S,0  , ,0 r 000,00S< 0P`0K00 )G 0eS * e 0`S01:`   \S0S S@000S0lQP 4K@P0n00M,00S,0  , ,0 r t 000,00S* , M 0S00E,(p>,@~: 04,00S,0  , ,0 r 000,$  ,00S,0  , ,0 r 4000,0S 0 , K {,00S,0  , ,0 r 000,L, K 0S4 `  0b0 S&01@ 0S 0 P P  @T0 @, 6, 0,0 0\SSx ,3P, P| ,0@,0 P< Q<H l 0 0  `84 @4 D4 38$ 0hS * h 0`S8 01:@{@ @4 P<D$\SQ# RD `@T`FD + \ᕸP \  0 S0@B 0T$.0S@\T&T\00<Si@D`Hd  S 00`0S}`P0iH$0, P4 ` 0p40S 4 40 r L00040 gR 9R1R*Rn R;RcipR wR^V`YpWV44K 0@s@l`@0S40 4 40 rTD<000 S XT#%+40  40 400ST$0T0 T嗔P0ST@@"sp 8$0T$u40Pp40040 sS,0  , ,0 r 000, 0;S|0,0@,@ 0\SSK ` @P=jD PPd0 LP0s 0@T F \000 S 0 0Qᾞ6 SH|HH(T|4S pQ L$SlxHH HXl$.PXS\SPSTS቞ᇞPU,P  , ,0 r h000,0 ;R0,0 R @ `P0  \@TP U0 0 11(K p-0`PL夕@P 0S 00CS00 Ӥ0\t7 r UḔp赔PUpJ/@ -0L0S002 qPP 00S 00S  00CS0 t 00{7p <00S p307U/HSpP@6 0$A,OPM 5!0S0UO 嗏!0S0KO!$1 l1t1X!0L1041P@s6T P1 00#30pPP 0@Z60S U6 0, R 00S S B0 0,  }P00 00,  x 000(KHSJS񟗲, , , , , , ,  , ,  P , , , , , " , " , , , , , , , , , , , , , , , ,  L \  , ,  @ p , , , (" , " # # $ l* , , + + <, , * [k0S:K 000P 0 0 0l@0 0 lp@ @_Hll R00l000S  0S#P@ l`+ 40S> R 冏P0030` c :  J  0 0 0  0 l`z 0P`p?ʟ0UH P@Vt 000 \T *NP# T 9$NIPNɟ\{N@VeP L)0hoNPt9 $弇P`0VSLI$_N \N80S00#3 ikPP 8@G10Sb _80S 0S x0 i 0S 3N PZ 00 D 0u PvK0Sr,ȟ0G 0S&g0Sd  崎P G`0  @ - 0Sg M@Kw0  0SB  M>X70SF0S  l @. 0r3 R0& t@  `4Pt4q P0SPl0Q 00A@p1 l@@l@ l`V10S 0S q0  0S KA P(KMЍVd00 0-PLP0@@T 0S <0H0 S   R000h賔0 0-@LP@婔T@0 p0-L@P<H⬗@P$H 0R0 @@08 -PPL@ph q@HE`Pї@PH V@@U@8 RQ3-LP@`p:Q eP35H; h8 -p`L@P lP mP ?PP%p hp01@PP0 $'P ʬP` 0'PP`0=SHT -TRLML"@h?P 01p@W eH`PV 0S ㈅0S RH100TPH0S0P 0 1S0S@T 1T\PA ppGhPPP? P  0+00KKpKU?0K0KR 000@ ;0 , 0]0Q {K h0@0S  0BU} t3KHXt 0-PPL $0$@QfPP0茈 -LM`P2 0-S/ @00B Sr( \3000"  PP P $P plP sP ?Pp ~PPGPp "gp @ W U 0SWpp~qkGRY S Pr@(PKdjP< ( 0BS B( (0"0CS0S8G@0S`l1 R Aa[$ R @$GTG#1Q00 ,@ 00`@0@ B~P,0P,  PV`U,H 0!00Ke`3\ppP(K`&0%STMP  iPF(p`\8P 5,j tF`P@T`$K.XHDh?HVx%6 d -tpLM@\`P 0@  `—0  `rKh p-L@0`0SFP f?P 0PvP31 @R TK 0S@@JK U00S pH -`䀟L@pPnP ?P lP  pP p zPP `p`l ^fp01@PP IPPPIPP0S @H 0-LM0S@PK HF >P 0s3 \0@8 -PaPQPPLM@pdP ?P aP tPp;` ` fp0pQ&z uz@Pp 000 000P@TY 0@KzP 000 <000z@P(KH4X -$L M 08 , xxx0@P`p@ 4 0 0!0- + pP0  UP dP ?PtP@  xP,p  rP 0<0 @ 4` 8` #ep00  P +\-\0S0 X3@QX Y 0S 80E < c(Ko80S ,0<0 H @y, Rp`=00S40Sll0+Q H0S Cl@0H @0 _ddD@T=D`P <2e  i`Pv3p)Cy0 ,Q- @y@P! 0 4 Rll00+S H R=lt B@0H =  @0 d\DDTD < >0V0 @D0 yDY00@0  8 R000 vY 0 0E0P00 g0 000000+QH ,000D RT0RPUw<(KHX4(x%0 -L,M0`0rS tS eSƟp Ɵp< Ɵ0p<0 xƟ{< l& 0 0 P8 4 0CiP/ UP' LP RP ?P#gZPP(( fPrP+" lP( pPuP' xP  tP P)P) '  @,4@  8  X0p+p-0E P dpP@U,@  ,KfP 4 0@ R 0KfP 0 1S +R-R0S00Z 070S dCT400S w y9S,4y0S4 0Z`.SZ w@ / P ` Y0D000  3# 0 0,0PtCP@T P3D08s@ wPV 0 -Y0    bKC\T@T20 H L wx 0 R pV 0j 0P a H R24C0 (C0C0 C0C0  C0 C0C0B0B0BB0 * .80S L0!SB06 h B\B-Y0 iP8B0< SB-b BW @T@TTX|``<0*{'9P0 `@0 D 6 00Spq(KDHXTx% -L M00X#wSPPL3 UH@pp `0 pP ?P VP vP0`  bp0U0,0 00 S0?0,0 00PS,00,0 4P 00p#40SP v Hv0p03P v vPP 0 S ,.PV 0BRSB00CSULJ I J pJ I I pJ V'MV 0|1|A40ShA Ua<V: PA0DA08A0(AQAA$V" 0 00 V A0S00A tVAA0*`A`Y`0*0 @Te (KH$,8LX`ltx% -L$M0`0eS U,pKd4p0S Px ̥Pps pnS eS ESf 0Sp R\ 0-SY0SV pP eP ?P RP/ nP, sP uP rP%0 ?P,>A@P  L@P, *A Eap@0 PP <cP0000C020q2 0 40 0 40P0<0 8 a<0  cR<KG_P\V00 S =  fR) aR 0R \R1 R@\ - *bR cR&rRD $ nRtRH  vRL     @@  00C0S! P\00 @ 0@0 0D0 0H0 0L0 0`V0S 00@T 00 @ 00008Z980P,08@0S Sbv``8p@dPV P@`p UKv%0SwU Jv`T  9v(KHl -1aPL@p LP PP ?P-PP N`p0aV &@0@0S U Wf@T PP |^@PPZ%D@4?00茈H8Ј  -3L,M0CPp`P0 LP PP ?PP` Pp d#_pL30S D?8ARH ,OD ZH@ 3P H`V P@D02P PL  70S2P0S  @P H` E@e@`2p8ŸP Z V"0 @O P0L0 PLP 1 ; 80 4 a80 0@0 < ~ށ0K0 @K,pK0 pdP `R< ,0@<6d<@P00SV 4=?$ 5?1^?+00SD <0/SP0S Ye@P<@T {eH Tte<@L p>T0(K茈HD`d*l8ЈP\0fP p-PLUhd0 0S `|@|T @T >pHp8d -p@QL@ mP@wpP@ N!^p001 PR@'@1ST00pS@` T`W  nV  \ \W@ n00 , q>$o>@H3@ - L0 0S p`@0P 0@P00s03T0S 0 00S @ T0 0 0贈 -LMD@KPy\0D0 ?P pP :P  000<T> 5^pD0S pp`@@D0T!0S00S 000P(K -LMQp@ 0V`  0 gl0V< 0 `5< 0a ,{  0g(K謨' 0 -L^MPp@K`ᔭK7COK4CPp` #0@@@@ +p0S0LK``rKCcKC@K0- 41`ßOK P`( $ 0@ =9@( $ =C 0 0(!K 0K R4 0 , c0=)B@ -B4 0 , Y0K`Q P( $ 0@ =9( $ = 0 T 0 PŸ (0K R( $ 0@=9B( $ =C 0 0 K c0KPR4 0 , 0@=94 0 =,0 ,0  40K R4 0 , 0@=9B4 0 =C,0 (D 80LK c@0KPRL H D 0@=9L H =D0 L K 00@( K4PK @0@l 0@ dL0P4 0:pp0S`pHh  -`L| @FZ?P@ dpG01 0D0P0S80 40 S@H8 -L eP  S> 0S@R R 8H p-aLM!@X?P 0QUx0 0K$P P `8x00 R  x0000000S0RPƻ =8xHV p-0LM`0 P@IX?P 0AT K00\X80 S@8x 00  0l x贈H$ R4 5:0QPe -0PL| Q@@\p`0S (P000CS@0S| - LR@:Q0AS Q$0p3P000 -LM0@`  P PpP3t0p P 0Pc `P^t!PW0 0S* zP PP  pP%   pP P+ PP  P P 0` 00 D ` PP0H p-L@`i0PP`  P PP PUPp p-LP@0`PP  P P``V`p 0-L@0P  P( 0 0u30d p-LlM`P—@PP00S KP@ : S I@@Kph -LM`pP@P 0A#S񟗕$x 4x Dx x x x `y 4y y y y ~ y { 0z Pz z x |z z z x x H{ x{ { { { { { { { { } | ,} 0Su0s3q0!SPPU@hWP05U 0p03 0 KWKtKOPE0: S@KDP:0: S5K9P/0: S*K.P$0: SK#P0: SKP0: S K P0: SKP05 KP0#5 KP040#0#KPL0SP0SR  KXP 0 00{ KP3 0PKP|@HT0  VX0  JXp3ݙPיlәPÉ$K 0.P (K 0 .P000v0GS(X| p| | | | | $ (0Rf$ (0Ra$ (0R[$ (0RU$ (0RO$ (0RIKnPCKiPd 0R8h 0 7K\P1KWP  d0R&( h0R$ !KFPKAP 0R 0R 0R 0  K茈hL-0S70#0Q0 4 4 -1L M40 1 00 1@,0 1P(0 @ P1SPPE P 4+U180 < @`KNR4@POU! 0p4@P  0 0  ,@0 /<00C<0 U 00p0SƘP P 0, p3p3 4P PUZ< @Kx$Kr q ~ $~ @ 0-LM@P$KT$K Kpq$$4 ?Hd 4K04 -@LM`oP@Q $K 0,P. $ R000C S4"0C4pKgT4@ 0P ,@ (P )cPI@ PT<3?t 3 K -0"L0@S rP`"H00 000#00PA0A 0R SP ?Pc HPaPPPl!Sp01S X3MDQ8a@q SR ?RB HRaR0S 0SW30Q  TP (+ Sp Z@ \3@0tSQ@T  80P$`SH 4@0 Ȇ0@-@ R00#SP 0 S 0#S 0 00 S00Q00 SP\\࠱# 00Q SL 0qL 0^Z#000000 -L@`.r~upP@5P 0P Pl 0`pcPPW40W0P0S{ -LM@S00ä?P`@W@D@TP00 'Q "Q `Q =Q :QTʌpP 0P\S \Q0SPPU00 'Q "Q `Q =Q :Q1 D0 BR 0QAs 0寖P`  0/S @TT``Pgp0`UV Vlh  ,0K P 0S`,0 00 00. X Q-L@TA@P 0/S @P0/S0/S0S1d -`PLP@pὶ  0RQ\ -DpL`P@@Th괈 -pQL`00  V0`P0\T0 SP[T*T ?T $T 0(STP/TP@T0~SX  *00@贈 -RLxMaApPj?0pp0A P tPW1@S0 0 PH1,K8!$ ( , C,@$0T :(0@`DA0 A0@$@ ( ,0 ,@@(0 `A0 , PaVP@ K?P00SJ@P<0 TPU ;@ K贈  0-@ 0PLiP 0c0 -LM,@KpPje뜀SP @0T :0@`DA0 2A0@@0@T@ NeP` $K贈 -L,M`L P PᏵB 0 40 0 H 40`0T` <0 8 n:P8@t YD  <0  cR <KO@0S000 P:/00D  D H0 <0 cR<KN@LH qP 80@ @c6P0DAp0hC1a@0 0,0 P,0ST PRQp D0@% ` 6`@0Z, KP 100S PU80#(K贈 -RLM p<0 8 a @S` 0 0 j4@K0"00 40 , " " 0PTPU 20 -torl2P0 #0`400fC180 < 02~@; 1080 'p@00Z 0P KP P @80Y l1K; 0 1 80R 1(!8P8 pBP @PApv P X 140 8 4@,0T:0t0@`0DA0 A0@,@ 0 40 4000000 `0A 4 <08(K贈$D L -/L`YbHPDp`@P糓P@  iR T -d1LHM Rp O P@AF <@K lKX0[l0`0 Y@[WP[T`[Sp[\[b?`0 l K0l K0KLK0 `pNKMK 0 S0S 0S0 S0S0S@K #P $0  p(KxS̆p 0-LPL@ x0S C0Vx  Tp0 p0@TP0D(x R`Vp0 Bx p0 -@RLP`PMX `P@TT;`FV000S/S A 00P pR :@e0DA 0A P1p00WR :|0@e0DA 0P!0@0@ T T 0o3贈TD p-Ld`MPK0S Te L@P0S T[xĈ -L M0S, 0@ 0@0R$0 K P1[S S|ࠁ ࠓl 0@yqP[o1[S < 0lqP[zoKȆ܈pht@$( 0-L@PX 0S0S > 0S@ }@0茈d0 -L ! 44tcP, 303 0 h ̆Ą hȆ Pp ( 0 00 0S. 0-L@PP0@S0 0 ,d<0 40 ,0(0$0 000cccccc0@-p 0P@0^R0>S@?S00 0 @ R0}[0 0 cc -p0L R`0PpX0`T0@TPT *U@(0  000ccccc -00 LP`p@?  r 0  ^000@S 0@00 @PU:.|SD2p -p  L2 20R2{:1@1P10S 1 1k:a威P@U0c00D0c!S000p1HA jG41@0T@1 <10RpW1 1a 1P0S0d@cp@`PU 0 0CR0 00R0 0R>* 0R <CP@?@TX0XP@t,0T0 cccTcc0@0 l0 \0 L 0<@ *0(@0  C0@ f0@ g0@0 0  ?0@ ?0@ 0x@0 d0 P0 @ .00@ _0@0 z 0@t0 o0 j 0@d0 _0 Z A0@T U0t@N u0\@H0 HC0 4>0 $9 y0A@2 [0B@* [0hC@" [0h@D [0@ O0l@  O0@ O0@D O0|H`@ [0h`FP@ [0P@ O0,`@ O0H1pP@~ [04Pp@~ [0 @ 00H@0 0@ 20@30 @0 @ 50@ 60@ 70@ 80@ 90pP5`@ [0 p`@~ [0 p`@u [0 p`@lD [08p`@c(Kcccx 8 X \ ؼ X  T t `  ة أ D p  D x 8  D $ D l h p  -0L0@`0 @hy!0S U q!Phk! -0 S,0@  0L0m h9c -MLMP`Qp|[!SpB_ Q 0P8! @TP82@ @TNK @D@D0"僤U1`@yPP@T! !^0S1`@S@TN WPP0V,A ,1`@ @T CP0o.K B B"0S @ 1P0^K PE@PE_ @T  P0 0.KH0 B B`9V< Kc  -3ML M3|3|x3@p3pSl3ld3 \3 T3@L3,K.,04#0hP0(s(3(#P`@@ 08`CV<  CV$2`[~ [~CV`@@<@TU jVhhbjVA FV;%SVu{SVu{ :zAFV /+FV /+FV /+aAFVee/MVMVb:AFVS9jV%MjV%McHxAFVS9FVS9FV39d;AFV39FV39FV39eeCFV39FV39FVԄ:fSVNVNNVN Ym!OVaNOVaNOVaN:!OVOVOVc̈́!OV ۰OV ۰SVu{R!OV !z!OV !z!SVvz!OVv"OVv"OVv"w@ !OVx#OVx#OVx# NGh!OVΦ%OVΦ%OVΦ%D!OV&OV&OV&bIF!OVG (OVG (OVG (D1!OV)OV)SV4v!OV+OV+OV+!OV5,OV5,OV5,GmaOV+f-OV+f-SV1&,!OVI<0/OVI<0/SV1tbdaOVK=a0OVK=a0SV1o9!OV4*2OV4*2SV1aOVr\3OVr\3SV1=!OVs4OVs4SV1[aOVt5OVt5SV1,";!OV17OV17SV1.aOV8OV8SV1Ws!OVg:OVg:SV1aPVPVSV1=!PVSKPVSKSV1%7aPVqPVqSV1G!PVsEPVsESV1y^,aPVvvPVvvSV17{!PVMPVMSV1r maPV rPV rSV1޳;!PV PV SV1umaPV6 PV6 SV1 *@!PV gPV gSV1 ЎiaPV`1PV`1SV1 4!PVbbPVbbSV1 ouvaPVePVeSV1 d!PVz]PVz]SV1 -:aPVPVSV1 q!PVPVSV1 laPV۰PV۰SV1  wK!PVݱPVݱSV1 (E!aPV*PV*SV1 {!PV+PV+SV1HYaPV5PV5SV1劤t!PVm`PVm`SV1PaPVoaI PVoaI SV1XgB!PV"PV"SV1#aPVZC#PVZC#SV16c!PVxe %PVxe %SV1aPV̙&PV̙&SV1Ͼ!PV (PV (SV1 aPVW)PVW)SV1 !PV&4,PV&4,SV1jz8aPVy-PVy-SV1^"V!PV<\3PV<\3SV1zaPV=4PV=4SV1bq!PV>5PV>5SV1PaPV7PV7SV1a!PV.t8PV.t8SV1O9.aPV0u9PV0u9SV1!QVOhQVOhSV1aQVJQVJSV1.!QV{QV{SV1\\0aQVEQVESV1,!QVvQVvSV1faQVQVSV1!QVqQVqSV1haQV֢ QV֢ SV1~z'!QV QV SV1,aQV! QV! SV1b 2!QV$ QV$ SVtaQV[ QV[ SVo!QVyQVySVEY aQVBQVBSV!QVC,QVC,SVR k@aQVQVSV{R&!QV'QV'SVLB!aQV zXQV zXSV v!QV)7"QV)7"SVWaQV,8SQV,8SSV0Nf!QV.9QV.9SVY\aQVLMQVLMSVM!QVnQVnSVleaQVoQVoSV}G!QV,z!QV,z!SVraQVܤ"QVܤ"SVu!QVau$QVau$SVjEaQVo'QVo'SV{p !QV!(QV!(SVjNaQVT)QVT)SVU0!QV=ߛ+QV=ߛ+SV[aQVuW,QVuW,SVc!QV-QV-SVR1aQVʌ/QVʌ/SVGf!QV͍0QV͍0SVįaQVJ2QVJ2SV T!QVK3QVK3SV *aQV%%5QV%%5SV dž3!QVC6QVC6SV V{aQVE 8QVE 8SV 9!QVGQ9QVGQ9SV paQVf@;QVf@;SV C3!RVRVSV ÔoaRVRVSV !RV5RV5SV r~!PaRV$RV$SV?A!RV%RV%SV&WaRVRVSVt'!RV RV SV!RVP\; RVP\; SV6 ɶBu!RVn RVn SVgj x-BuaRVp6 RVp6 SVK(!RVRVSVaaRVO1RVO1SV[!RVPbRVPbSVOʟ!RV ,RV ,RV ,?i"B!RV]RV]RV]?Ax|aRV RV SV.B!RV>DXRV>DXSVoaRV@ERV@ESV!RV^SRV^SSVzuFaRVaRVaSVo!RVMRVMSV۫ MaRVRVSV!RVH RVH SV7{!RV"RV"RV"<!RVC#RVC#RVC#=s!RV %RV %RV %"!RV1.&RV1.&RV1.&"@>(!RVi(RVi(RVi(4Rn(!RVc)RVc)SVfM!RVd+RVd+RVd+(!RV!,RV!,RV!,(i!RVߙ-RVߙ-RVߙ-(Q!RVV/RVV/RVV/(f?jVôyVTyVT EVi- ' thv2Hӑnfm#WEWN\^=tr;R,md . ..MAKEDEVconsole tty memkmemƬnullƭzeroƮstdinƯstdoutưstderrƱksymsƲklogƳbpf0ƴwd0aƵrwd0aƶwd0bƷrwd0bƸwd0cƹrwd0cƺwd0dƻrwd0dƼwd0eƽrwd0eƾwd0fƿrwd0fwd0grwd0gwd0hrwd0hwd0irwd0iơ ... . ..chown<bioctldhclient- disklabel-dmesg<fdisk<fsck< fsck_ext2fsfsck_ffs-ifconfig-init<mknod<mount< mount_cd9660 mount_ext2fs mount_ffs- mount_msdos mount_nfs-newfs< newfs_msdosping<ping6<reboothalt<route<sysctlumount . .. dbƥemptyƦ tmpF run.tzlist ... ... ...30c0 B0E0b02 -0S0 0C02BQ 2\"0 2 a00cCR@00>Kp0CllŸ48 00 4`A-(K4 UpPo0(K s`0xB"C00!00S1 @ PV 4 :PUX@T@Z@X00S 0l\ R T0S   XVP P PT0 000@ t0 `00cW490 -8KR0``00(Kccc ccTcc$ccc8dcc괈 -L$M< 8 P`@-P  0  0{S0 R  {R0 }R0C ,RS  RS0S0Z0S# < <08 +(Ko@0T :1@`0DA0 A0@08@ `@JQ 8Pj `p @ DP 0p , H 90S5 0{R,0GHl4 , ( }R,00S,0  ,,R\ s@ 8@P`L0 H D D40D<0  b0 p W(K贈 -pp`0@Lp*@@PPt, P0p 0m괈 -LMP HK U   .YP?0 \/0S 0S0S @xO0  00 , 00( 0 `Kpp P  80 4 L   80  cR 8K5: Rt @ H < 00 \ f  , L D m p 00 L   D 0$  (00 80 cR8K9ː0 00S0 p)0p-]\)0@00`xO@͟pJW`R 0S*00S&0@T" 0S 00S 0 ,HWx  00PG`P< @p3@ K G`@|P  | 2 ! 0D` 0   bp p 5@ 0$     80 cR8Kc9ː0 0 0S0 )0p00:0 ?C|0 d@K 0K^-PKk]@ 80  cR 8K69000SPp0 P 0`Vm #V Q@pTM 0Sb[~P 0@S*S0]S@X:Z9 0@S@0P@T*T)@00!Z]9@P@H<ɟ00S0Q0S T,  8H)00 = p ( Q00  0 :S  0  0S    00 0 00     @ 000 0S  00R   R 0SQ@V*V@@%0 #0CS #70S0 0SY@Vp@@ 0@V```  @0p D0 y[E~Pb 0@S*S \0]SY0#0CS #60S 00 PrWlY@p`0 V :&@e0DA0 A`P@M\pW e0S L60@S@@<(V :BA00 Pap  DP 0@@S000 0=S00800F S5Y@p\ 0dş 00@ 00s03Lş P00S -R=R ?R+R@ 0S 0ş SQP+R QPHQ @0P@ d$9U\P 0  SC0S D9  00\0 40 0c0ᴐp 0 0 %S #S=S ?S 00?0 0 pA%0 (;P d1 g `=@@T@0S0S   R000 @ p40 p  0@PU   CYZ0Q   0 0 [ 0HLd 8*`d440 P@ZX@ Ҝ  |R 0 0 0 | p 40AZ  0 0 P   A  00S0   zQ 0 S  D0\ D0  @ ! R 0S/ \      X0S S PH DD@T  * 0S  R0 B  0?B Q Q Rq A00C 0  |BP "0t0300L  0  0   R 0S\00 S P|#000 0S 0 00#20#\00St Qq 004, `K P@ 40 0c0 ,C0 + <@0T:p@`0DA0 BA 0@00P0@0T:@`0DA0 )A 0@0᠛0 @S@PQ D0 ( 00 , pp00 0 80 4 0S9 \ 000   0S(\#40Z WPPz @0T:,@`0DA0 A 0@00 P0 pR 0=SC ,S2 !S *S"-\ :\:]P ?P [P}Q ~Q0 {Q 0 0[R0 0    000 00@ {Q @ 00000 < pp > SpP(  0  x0 t #x0`0 @ 0 | 0  cRڀKn40`00S0/S T :S000SS@/|P0S +S0S -S0SvUnX 8J  J0@ #P@ D80 00 @\)T@|tT@  80  cR8K40TS00T@00TSV 0Z00 ` P 0 00 0 0S0000   ) 00 0  .(K 0-0L M0@P0  0 K 0 0 C 00`0S0@@:K0贈 0-0L M0@P0  0 K0 0   00`C1@@ S@ @0 K0贈 -L M0@Sp@ Q 0 0^ P$ ( :00 S $ ( (0  (`K(0 PU @(@ 0T:$l0@`0DA0 6A0@ @ $ (0 (00P$0 `A0 ( %@K贈 p-PLM`@ꖙPT@^0 P3KpD` -@LMp`{@V`1S0PvP0 S ,$ (0K(p $` P 3KD -@ L1 z@ -LM@0 h@K p-LlMPK@`ᩲP@xu@PU  : SI  S @PV 0SKp -SL0M@< /0xP < PRD1  000 , 200P080 4 ::mxpP4@ܘpW `e80  cR8Kr2@ 0/  @80  cR8Ka2@ 4< |P4 `,  PP PU4,(K贈 p-LM @KPl>H`  U 00/S 00 (000-H@PKpX p-L@`P0=S\ *SZ +SZ@H H000 `0pD -0L0p@`>HPT 0r03X0S  H 0 0 @ PT 贈 -LpG2/@wP@pV   H`P`P 0  P!   @P 0P$RU2PPP  00  U@ a @T00S@ G@P 0 ,tP 000 l0000SM0JH TY  H0@0!00@00 00` 0PP 0T P 6U 0000 djRbU\0P 0 P @0 @  '1茈D X@d -`LpPG  @0`;000 kJUFv3rK0 00P;00W -x0t`00lL p@0PPy>0D00 @90000@ȈH 0-@LPF $F@P  0hD0PR000AS  0-PLM0( 0 , mAF/$ 0 0 0S   0S$0 Ph1RdA@`啕0 D 0SF y=C(100 B+!@P  0  *e0, R ( 0P( 0 0" P0 0G 9* C=p =$0@J 04wK0IY -0LM  00  P,0 Y 0P,K  0 00S  0VD*?0SH00SF? PP?  A<4 0 4K8?#0S# 400S $PS O p;o 404 0S00a;P400S7400S 400;0 0 0S00S 00S T^ @ 0\ 0 @ 0 0S 0` K 0 0 0pX` \>$Q `X(#0S\0 

+@ P' -pP@ p&TD  @'0S=0D0  D , 01 @R$7`P  pD H`< <0S <00S  PD PW 0S <0S <00 cQU <0S <00S <00 D&<0pS7 şP#0S WLO, 6H ş0%00 S 0 6H000S 2  0OY  T 0OpH A0PPU5 <0S40S /pP   0D< <000CSD! T! % h$ % % h$ < <00@:<00S<00S <0埏`0 P <0 0&P <0@T剏 0 H@ MP 0< <0 0  8 <00 0 03 00` PUhC B00 <00  0D# 00 00#000 <0< 0#20#00<40 < 0<00@P<0@  2@8 t20 2<<#04 <00<00< S<00 < 000<0<  CC< 00T 04M  10!S$TO$ 2 F<00<00S <0ގ0  ~0h  0,0 -@\  <<N<0 -L@0 3@0 0S @@ @H <0  @  0`, @0 , x0 q$,(K茈H\V dX K @Dx%HV 4d8V`dH -LM0@ R0Q-0P 0Ap3SP! KK0 0@0SP00 K Q P 00op3P000K -8@L ?0000 贈 -LM0@00Q4' <( L( \( l( &0@S' ' ' ( 0 L 0K00K0 0Kt0 0 h0 X L @ 4,  #p, -LR 00(R0S0S040 2"0  0 2"p -P2`0Lp `@t 0T`(02 00  ,@00`00A S[T%GP`!H 0S H040 Q ` .@uI&00J00D S0=@_T 0000B#T S쀟PA f .@0<0 000 @ LP `'0T  P㚕% nP0`  0S`)0.p 0-L$M@8 0 0K, 4 $@ @ @ "0@P  R050[" T40S* "0PK8(0(S'0(0  i(0(S 8 0   [KK4 87J+"K0贈 -0LS@P 00S  `KP0u @050K0 050p@ -`Lp@T @P00D 00   XK fJX @ - QL MP4 O@T``!0DS00ST4!T 00 "T 00s03V$ 00c 0 #T  0$S 0%T 0&0DSz4 Q0 0m(40p0C00 ``Y @  H@ I R,   / YY Y 01`0IYSY  0S 0S0 0# 0IS2 2 3 1 1 81 d1 t1 1 1 02 @2 P2 1 1 1 1 1 1 `2 2 1 1 81 d1 t1 02 @2 P2 3 3 0 P 0sq  P 0sp Ťp 0p 0pc 0s 0Rs~ 0Rppx 0Rppr 0Rppl 0Rppf 0Rpp` 0pRp[ 0pW 0p"S 0pO 0S 00 00` P 0p^ 0pSp: 0S 00 00 0`S 0pI 0Spp$ 0SX 0 0 0X 0@0C 00%S tX 00 0 X`@ 0! p,  R 0 p   I H@Y p0IS < 0##4 0S 0C 0 (KT`pp -L0 M@0 00K, $00K0d-<0<80 0aC!P00? 10 d - @Lj400d -L P  -LMP0* 4 ]kP0A0PUU D4 0gX!`p P' EP 0@0=tpP8 d!0 R Jt/DA i0 0C0N 0:t1`@H̠H0-K HT-0K,K+K*PK)K4僋4 0X03~0@P 01Q:H偽00 010CQ:4 0 (K脈ddd  -LM` p, D\ ?7 48 7 8 8 8 0VS50V|10Vx-0Vt)0Vp,` $VX!0P0U: 0GS 0aC1BWW@bAT',De)pp, "J`Z  -GMLM3 0S 3 3EHCP t;)KJ JX-PPKGp @lT q3P3;32 0]W2P2P ڨ2 0@P0.spp 0S0S \2:slP 82Xm `P@R: ; : ; ; :  0S     0S @P1\CP PEU0SU.  RU(PEU$41,!0 o1 -f`PUP@g@d iP  vl Z9PllP0r)BX0 H\0rH@20 V(0(K茈dd|d dd܈ -<@LP }( $0m0 @   p-0L0S `P miP hPP X0@T@@D0@ <0 B40 @$0phpddddd  -PPL`0U TpT`0`CAU!b@,0 1P0  0-L0LPD0@y P 0dCRB0R00  -LMQP,0 ``pf @gDAU00?PAa,0S iPhP 0gC@T : T  -<0L 400R:PR B}   p-LMPK`@U'P,  1R 1000c00PU QW0xP U xJxV PAx0hP?SX0 b@@0 @k P0$ 'xx d - @ 0LSp:P`0 S 0B00պ0 0C000吀`P;h@P  P0S@0P\T 0`0DV ,P@J@ d -d8LM$0 SP HxH`     CgP- 0P>9P2?P eP8nP 2 lP/rP ) sP'PgP N @ p( x "  000 `  <K/Z Y'#p00 VaP 0^S   z0@T 0S =gpP |6P`&00c  㰀 ZZPY0SZ   P@r XU7&h؇ Շ 0 00 , 004 080 pP8  bR`!P@ ߄ ۄ 0 PpKgP`g 0  )8K ^00SY)ᗇ80@  cR8K0!P ᰄ4`, Q 0 dZZPYYP0S ,Z^  8P p @Q@Y %P Y   R Pp X0~3p Q5 D#D3^4Q``$#$0 0 fB!C |,@y,@ fPP0 d k,0S00`V@3@#V@T(H2F/PU@ L8z^@@ A,Q00@T`3`#T`V-pl塅EA C ARPvPPL 0.PPx@K "P`0,10 0(08`K,0 00@080 4 8 @0dS 400c0bS . @8d ,P $@R ;- 8-004` 4(K茈H8L8h| dlt0     l$PQ00l  -0L`0V`Pp,@@pP,@ p0PP G->h P -$00000 R܈ -@@L -0 - -0 d P-L h 0S0S L@P00P00@P00l -$@L0SP00l -4@ LP0SRs00l -,@L0SPc00l -@LYhV p-L`00L S@$ R!PᠼPTP0$%0&P00S 0P0&10P0` T \ \0PP0 p\0SphT 0P0Pp,@Xp -LlMxKPx0: S K --80LM0S 0 0 ( ' KdD -@PL 0P P 0dP l0l0h -R  q*T <@Q R 0$S0 b* 00D~ --LM8@0 0 B( '&KD --LM@DD8*0 00 )($ '&TuKD --80LM0S$ 0 0 ( KȈ --LM 0@00T 0S r0 R)0 h0 ' X'Po&P0  D00S   0  )KȈ8@D~ --LM` 0@0T0T 0S 70 (0 ' g':&Ȉ8D P-L@  fP 0 S Y -LM@K7P@0P0PK 0-LP@P0 S U 0 P0-L@P4% UT  0h0D0  RRR00Q QD 0000  R 0S d -LM@K 8ø00 R000 㹸 0ddd -LM K4嫸00@  @RK㠸dd -QL\M`p  R<P  (0@003 Q3# V+x p  0V 0-0p0 l 8@hK0SW 0SB P70P`8@ aP V` W,@TPUV"]0@P 8aPU W 0 P@T UW 00 Kd -LM`Pp4$ K&V`U (K:@P  $K( 0!g20@Wp Wpp,40#00 V  @ [ 00CS0<0U@TP0@0P <5@T$K ݵ KdDd 0-0 0P0 @L R 0S^ UPR 0SQ\ 0@@<00\, (h0d܈ -LM`00002p0嬢SpP괼0S @ 0020@00U 01P0@`00 8Q X Q  00[ 0010S+ 10S' 0S$ Q1NP0p;0QmP P@ 0|C 0S0D 00-H1P 0S0S0  ! 0S0;0 <0 R 0SPP 0202,0 0P@ d00S 0S l Pd! 0S $00S U 0茈؈dpd0htD -LM0@K 4 p4ƴ4,KPP  ⽴, 34! R㱴@W`8@Ē S2 `R 0 @Ty!V @W S= 0S1H20S 0 42D ~20S" 0 2pP0 1!j0K `0 1p@`@2~0 0!0000U00 0S6P1W`" 00 10S 1!500S @PPP @P} 0&0K }4 e^W@ h00S0p >0i@0K (KdDXpxx%dp|dd -LM$PK@p ۳`T`00 0S 0S# P $K  KP 0 S  㶳 㱳 RX0!P@ @ $K@ 㠳T0d0Kdd܈D -LM K⌳x0P 00 XLK y}@, K@ odd, p-8@L`P P XPP@Tp -LM$pK` PJ Kd@P  A 0!@ R 0SUU P@| (t@$K KdD-08 00\ $< 0S0d܈ -LM@K 400 R000 dd -LMp0  {@7, KӲ$`V00@`0 0000 D0S4  $P0``:x$PU00tHPT4 R 0S A0@ 0$@,00@ 34 (  0000003@ 8`P3`0#004눣@0@S =눀_P 0#ST ,,K V{23 0S 0S 00 `820SX 2a Y0$'33 TR  @,K %1T20S  HBHHb .@DT 20S   10S - -O &`P  Ṿ>1@p!@l1 @@@4. 0d5+   @TRFh0 X00R TPQH0叿6$ 0S 00id܈p p-|1LM0S hAhQ`!KQjPz4 S6P z 8$@K 0PK` @ @ $@ `> 70S 00SP*6Pyd  D0(Py, @2Kpdpl -LM4 4 0S04   R|@KlpK,K @P0P8` 0S `VPU04 , 0K3R,04 0@=9B,0 =C40t04 , c|0KPR,04 0@=9,0 =400(  0K(3R $( 0@=9B $ =C(0h0(  cp0KPR $( 0@=9 $ =(0P w,00, 0S0 0SS000 8 8`p0Sm R Q<0  R R0#400000 00CSA0S00Q @ R 0R00CS0S 0@  0S, * 0S 0S# 00S (1  0S 0SA R@ >! F0 0S*0S   0S 0U  , 0p 0000X`(K P vd܈d?Blddd p- 1 ALP P㙮0Ǡ) *U 0S00 !0 R @`P 0S …0 00j*@DT @ 0S ph 0S phE1pd؈dx d`Ph -!MLMPd h( l8  `}K!-KpG B B0pG` p( \ X8 0 S ``d \Q d(P P P  0`8 T8  P XQX8T8 `T( 00`8 d(P\80#\8 T  T( \P~PU H7@TUdUL (HU} 7U0U/*!U #UG AU DUD @U@WU TU VU8]UX PDK7 [U+ \U-$aU*pUk jUU eUE hUDlUQ nUVtUl rU_ sU`vU 1 5^:wU 0P4K0K0KUS%0Z`}=X@{@T@P@T+pxp}/XP@0K0K8S0p(X}!X0.X]0õP P ` 0P4KODKODK0S#0$0 0`H 4+mx0Kg0KR$0W0K]0KRl$00KT0KRL$00KK0KR,$0 WP  WP +9x WP@v25@25xPWP/25WP~0P4KOKX \25 WP0/S(25(#00B25P25WP~0r ~"0002 0 00b"00A0S @00B0S3>C1P"Zv PTK0O4K0X8 P4K$"0KvwX@` X'@hlQ!6\(X0"Q TQ`( `( K!P(0!S%  0x!0PK0PKwX@PK Xd4PK@hl(R,! \X0 & T(R`80`8  XH`X00SHlQ 0x Re Bp0x p0\(0" T8S`` P lQ`#h(R`(K茈h0(4t`*s8̂<{D 0 0 0-0LMPP P/)@14k0 0 yPPp@ x0 t0 @VP0M<0 ,140K0@D<TH p-@L@`0DSl0P $<(` <408`B 400,, p p- P0@S0C0 p0LPT`` 0P0@0 (0@`000<0 00pd --TLM<00 00CS,00N0 0 D -0@=C0 0 L ~]贈 0-80P0@L0  Ԩ@= 00贈 -4L@p R  ܎ p4h0P 0S R$00` ` `, ; bR,P0V0PP 3P 3 R"0S0S M0PP03Z0003,, e P   0  $0S0S -(0R S 0 ,0 b cRtPLP0S  V@ 20S2  "0000c0 U0S \ 0Z0vZt X0S  0S 400S 0S  mX 0   0P 00S!000  C$0 <00$ $ $@F 0 0S T Pr P000 <@@$00$01<00$ $ $P@ $0 0$000 0<0 0R  T<@@P`0 0$0 p&h0Q0 0S TĈx%HV.D 0-0LQ 0 0P0@0- 0SP 0000P0@00h0 0R@0@\T 0 0R0 P 0 0dd -0LM p 0(00 , 00̐0ȠP80 4 `8K @T\T 0S00 @80  cR?P[T@` ]T`FTV T004, `v3(K贈d -LMCK K   ?@ 02 A0 <0 2KH4 00 8 B 實<00 D0 ?@@ p@ ; 00 |" 2"< 02 h? P\P 4ϟ0S00 1 P P #P000/ P\P Ο0S00 P P00C0e> $0 0$0t>0S     K D0  cRDK p" R \  Ԥ  0  ܧ <  =0S ͟!Z  0$01  CK  P\P x͟0S0@0 @ TTc Ta !TPG00D-T S tV ,0 00Nt ,0 00CKR AK`, P\P ̟0S0@0 @T T T T@UYCKC/K0P;0QU 00!S  0(000 0 0< S 1[S CK_sC/K0@P@@TPEZ[Z92`6 @+P ,K{P  0 ,@pP D0  cRDK p0P  p0Sʟ,@ 0(@,00 000<0@Z*Z ?Z+Z !Zp* P\P <ʟ0S00 (P@ 00 A'Z \ZQ "Z' 50 Q0S009 00ɟ X 4K|0p2 0000 X4Kn0\Z `Z $Z>H  P\P ɟ0S0@0 @$T "T  \T `T0  @p   0@0pD0 cRDK4 pT~  \00p@tL( P\P ȟ0S0P0 iP(U3 P\P ǟ0S00 X(P @00T4K0 @00c0000T4K0 000 00" .{U0  `PPp @T\T Ɵ0S00 @VMP \ d | #T`T h0  `N00D S `J:400B00D S?[T0,K7P @,@ D0  cRDK P000S%,5 @T\T ş0S00 @00D SV 00pp P\P D0  cRDK_ P@ş0S00 :P@00 P\P ğ0S00 p%P#P 00 X4K3 0 @ PP00T4K# 0T4K0 00@1 0  Q  @D0  cRDK @#P P\P ß0S0P0 EP @0000B S0  P p #00B SD0  cRDK p 000XPp@000  #  pb00 X4K000000H20S4  0S0 0 BR CC'Z40 HX4K{  R" v 000p0C00  3"Z 40 HX4K_0 0S6긡 4 < 4 ` (Z "Z 'Z*)Z \Z%0000C00 0 000000C"Z00 \Z0 'Z0h 000C0@T40 HX4K02 @q괈.LXldԇd$ (Z000 )Z00CS0D P\P x0S00 F)P 40 HX4K0 @`P@ dᴆ00%000 0p00 " g}Z40 HX4K  }Z40 HX4K0 2 00p|Z (Z 0@00000 X4K 0p"`Z 0040 HX4K \Z" P\P P0S00 $P "P \P `P0S P 0\ 6)Z0S0C P\P 0S00 )P00 (Z000d\Z< P\P p0S00 P 0  'Z00 X4K% 0 00" 00i"Z 0 0p" _00pZ"Z0 0" R\Z D$ P\P x0S00 E$Z "Z\Z `Z Z 0  [  p0  p))Z  0040 HX4K p|Z 00(Z  0@00000 X4Kp 00 % P\P 0S00 Z P P0 00 D0  cRDKp =KX \W"<Z>Z R " @@g Re`W Va0S^000C SZ6V0P00C >Z0006 P\P 70S00 Z >P00 S>ZP$D7 P\P x70S00 -P0 0 &PY000 |P00X  S @0000 0@8吠7EP[WP008僠(Z  Z &Z;Z |ZGx`8 P\P 80S00 ? P ;ZȠ1 |Zㆠ. 8&ZK)|Z&PF% "p , 0,,0! 000B01 m1 0 1 P0,` 1cX T 0T 1  cRCKP@`9 P\P 0S0@0 @T0S TT 0`!H0. 1( T, L 1  cRCKuP@  P\P 0S0@0 @ T 1  cRCKYP@ 00C04+ 0\m:L;0 )\;0SP; P\P ;0S00 (P㠫w u0@8 `K0ASb  @00P  PU LA  `U000SI " F 2P d  G@P  <R }R<<d 1&  -@P 0 ,  0S < 0S (N 0 @000 <00 0= 9`S0S (K0d -\1LlMP`@T< 0PUAPQ `9:yLpP0T\Sl X%jL@PPD 0S?`L@P xK@`P@P0: Sh0K 0@  `00PV(Kd 0-LlMP@t從d 0T KP0: ST0K 0@  0@ 0@K0d -LlMxP ` `d PRN0SJ41`PU$:'PA 0Q= 唠KpP1 Ѕ`P-0: S)P L0 0hKS0S p0St0S& @t(P 'X{%h0K 0@ pPU(Kdddd 0-,PL@ 0RTN @T0܈ - 0L@@T贈 p-l0L@` 0S P 0P@P㩭@U  `@T00@p贈 -(@L0 01h 괈 p-L1L@`0S  0R+ 0S P 0QAP U 00S 0S$PU0 0S0 00@CTT =00Px z{VF@0GKV?0   ph萝괈D8h -P`LpG㮝P@pPx0 P000Q0@贈 P-@L 00S PP@ P 00S00SBN@lpl`P0S 03n᝟T000S00ꌈhĈ -LM< @ <0$ 2   0Q, 00   @0 S 204 80 40S2  2g@P1 T&04J40S TT <2 0S <00S,0S< 00<0"< 8 1 R8 1  aQđġp!0S<0<0S0S< < $0$000$040S l1/<{<@P5 0S4,0S 0S 000C00 00S F<0 ,0S 0SP <0p@P <0$0   40S 0S000S0S80 0$0(K茈Ԉx%8ĈȆ 0-00P0@L^@PP0h괈 0-L M, 0 40  00 ( P$ k 0Q10 0   00 0 0 x1℞@P) P0 =0S < 00 0 0 T4E  1;  40S 00S2 0Q 000, 0 P 0$( @( 0@ 0S 0 0 0 0 K0贈8 -/L@P@P?IP @:IP 05IP  0Ip3 -LM 8  OK᜛G/ᲂh8(K K⒛T8TX@x)l-)8$ ,   @ PPW@PTTg7 0刢P @xኛP }P$ t%<'l7@   XHP HHP %iP0 D HP7  '7  6 @6T! P 0P'@PgƟƟ@0 @'#`&0@/SK_PXKZP 0R 0R 0R V 0S 0S5T  $%U@#u%# $P0S0S|Exx#0 0S` i&P5P8U <h45Q0% ,5, ]#0@ 0SN&# HP40SD&HP4 $ 40P)@T0 0Dp  0pR`PH0S 3p1PS00, `!RI  2V @T`3YP  00P  3p @f 2` $2 s@@8l3P 0  J)P F)P @$@$0 0$00000 0KlP1: SX2 0SDBppP4 0SL 1 F@bI 1*V1 00 00Q "@0fA :1!0`p@@P 0SdA 0S  0t@T 0j1@T 0  0S |h"`%0S  0SP@X"P%PV $f0  Wt0  h 0S00 uP(K輈 X4D0d 2( X ܈dl`DMЈth 4E\ <@D808dt -@L[P@e l -LM0@0cSz bSz+ PK ħ 0`R R  巧  0R PU  40$Ă,40S,((0 "4S \. EP@pe 2343P3 T 000  R0000000S  -L4<0<Q808 RT T;0;@80 (@ h (,P 0-0@pL@`PV~00ea~@PRe@ 0 0     p-0`@R0 000 LP⯘0Pf 00 p p-`PL@l0l⃘@}VPP8` /f  ph芘@p贈 - L@4 P   ,P -LPpZ 0#S@Pʐ@ B`P - @L,$Pp``V 0S  f$@P@Pf C|p`V:00@j -LM\p8 < @0 @,14 8 }PPPH}TX` UU0PP``ї `}PUp0 ,p W4 80<@ |0,  0S `0 \0 @pT }Z p@04(Ko聗괈$T\ -L 0  P`̠̐@p#0 So~'SU  xPUtrPH0S CTX>H  T@0 @0@0TSU o[d` -L@p`P0S)QPU:|Q00V0S U DPP@T: -pLMP`, G0SC@*T< ?T: [TV:0S 0!RP0S.0 ]S `P) ']TV% X/`! JDP Vp|T0V0X0S )T V X*WpG  `P,0U:V P w3 -LM@Q` 010PU40!0R-P00-S Q  0 0, 0 R -P 000#0+P0SPU , e0 -P0 0:U?Upp ,U;U #U ,P CP0:S0?, 0Pv 01  1P+ 0g od:P ;P- 00 0R0! R0 0;P :P,000, D 01  1P 09 A?, 6003,P0100'#P) 00`PV 00F SmCPPPU 000C SL]CP0`P000? , ,(K謨\WhFC p-<`LP@1S ;CP @%T@p0 b -PLM8 pR  R< l8< 0Q858 5#4 %4 5 S8 \0S8 ?S *SR[S SMSJ:S0CSE4QM 0SM0!SI , 000 0S0[S0 D[SB0:S?0:S@@`BP 0S *Tf BP  0S4P P@T  0S  r R0  r 0S0[S0:S 0S0]S= 0S Q  Q Q4[\1 (0S0-S R0]S R  R Q 40Q 400\00S 0 0Sw0]St0 ,0R pW4\ W 8@A< 0P< T@*  P 0W8S`L< 0PGP@   x@p@P < 0P<@  0qV Pl@< T 0WP_   Q`PX 0W8SA< 0PNP  ><@ Vp@@ P < 0P9@< T 0WP,   P% 8`AP  @ 0DPPT `< V 0W4\ W:8< Q  0,0 < 0nP (K -pP00`Q0L@MS@%aPaT@P0f@@T\PKT0&P ᒾmAp3 05K贈 0-LM@P K#0S  P00 R0Sp008 0-L@PP 0 p-`PPLP a@ߓ Pap -\L(MT2K R 0S %Q$02K00 K p-LMD`@4 P0^0 Kp茈!Ht -PLM`U0p`QR: UU UR0000` USQ R@K$  } l0 U00R0S80   U 0GS 0 00R0$`茈h܈ -LMhT0Sp! P( a`K=0S QP%Ut- P@Ÿ0U% 10<<}WsP00x   0P0  %Q  eDK|!p40D !R 0-S+S00S 0SQ ,!0S#0D0 !R t1S0P0D010S00tQ 0S 0S x!R D  0Sb ]t1S D  !D0 D0!0RD(K*e,e tx% 0-@QLP0 00h 0@-0PSH /S``V@@ /p/\ \R.00.\!/\\ .\0/SS0&R00S Rp0 R  BR0/SRp0L0 S/S -Q4LM0 /Qp@0`0g.Q0.S0S/S00#0 `V Y ,  0S:S00SQ000 f0, , RY 0/S Z 0S 0_ 0 bRP@  I\ 00S@/S/00,0YQ 0c0` , 0 bR@, *\, 00S@/S/00`^ P0 bR@ \Y00(K -LM00lSp@ xpPUP@/T TQ /V>P `e^`V.T@V .T 0.S  0w/S4 W1@/000 0 bRE@ [  BKA| j*P@.0Spp( K0 $C(4[/S0jB.K BpP PU(K -LM@q^0 0 0  0 寐00 K 0  yP 0Q/0000 `ಐK贈 -pPLP0PPPA^p`0V`@X `嗐D0 W[U 0U $0h@DЈ 0-0L @ 0  # 0S)0[ $0 0 :Q0a/0 *0 0 P  0h 0` -0L Pp 0S0+ w$00j  d0:00  X = SU ,0@@0  d0d0 0 8 @0`d!. סP;0S0 0;01 0T$000  t000``@ V 0 90 0 0 090t -P Lly X` t R 0PXX@@ rZ0 0 d@d0 @T8Np4 T$Qp up`` aPŽ0S0 0;0廽 00$ `` V @gT  5Z 0 0d0  0-@PLP \ 0h0 p-LM @P u8 0& 0PKS0 `K t$0P0&Pm0S0 0P;0b0$0 P0SpP 0 0C0P x -QL0MP T H H D P %PP0pL0 k  R 0 B 0HPP H .X *X  X #X7 +X -X2 hX- lX# 0X+pAp?p=p; p8|5T T0  D  T D,DQT D p bT L L "0lSP0@p0 pP0 p00H S  0 0R00C S <SL0  AD L P PPPP  XP tA0H0S 0c0HT|̟S񟗷, P P P P P P P P P P P P P P P0 p{@T00T0 `  TiXdX T iXdX T PoT P`oX; dX iXuX xXC pXA (KXV0D0 (KPu`D  0X *X0l 0X  P`XuX7 D0S-0 +00l. *(K1>A P0 0` l 0R 0l# (K%2> &B P0` l P Lx0X000LBB( K l YрpL T00\ X T0 h[X T 0 |?KT ?0K?K?K'40#0 P0SL0 S`qL`i l= S`fH-P+P P0S X EX0C0 0 0H  IH 20P00S X /X0C0 0 0H0I0YH0  0xS0S X X0C0 0 0HIH  00V 0pP0S C X X0 0PUH  fH `Y P0S C X X 0 0PU*H0 0H0 VP0S C 0 0PUHH P P0 H00H0 H(K@ --LM0 0 K 0- L@P u  50 + 0R 0S$  p  0R00 0  0QS 0*A0 0  : A0 PA 00 0P0 -0L @; 0Sa0   3 ܺ$00/  Jp' 0 :0  P ĺ0S0 0S0:0 ;0峺0 00$ 0 - L@L 0Sp 0S 0 0C 0 , -P L@ T0pD ` 0S p' 0S V0`!  P0 00c0S@@ VpW0 X0 dP0 ``D -P Lp W`  0S?p 0S @V@@ V0 `d0 dV0 W0;fXl 0-0L@P  Pm0  00 ,r0 0- 0LS@P ,P  0P 0P 0 0- 0LS@PP PP0 ,  ,A0 -L^\Pp`@.T00\T@|0W0,B0BSV@`F[p0 F 00p $0(`pp ``` --L4MD@K0B 0 0 -dK -p-`P00PQ0 L4MSP 0L@K0 0 0 PCKp -l`L@pP  㽏PP@ P P@@ U 0S (0S`0< `0``0$ p    -l`LPp@  {PPP P PPPk T V` 0[⎊00\↊00@0d00 0,0$ (` p ` P = -@`lL0pX00 0,0< (`0P )@P T00ӧ2  `ᶙV@, 0 Q00 o0괈 p- @0`SL0@0M P p 00P@0T:h0@`0DA0 < A000 000 0 00 ptexe -<0@L  @     贈 p-LP`@@P`p -L"p0LS<2@Q00@A2 P 20 S T1 T1P``BTR5 166T(P``2T)P``,0DSTEPd100LS T1\L1LK `R`? !党`P1  R`06`p`3V) 0 T $ X00" P@0T:t0@`0DA0  A000 000 00texe -1LM0 PPP0@  Q EQ Q P0P40 0 0 0K 0R S P0AS@KKK0@  0xelete$0HPT -0Q0L0 80 00  0 0bC1!0 texe 0-< <@0PS0L0P0texe p- L0@S 0ES00EPPP `0P@ @T@@T000 0H 0D00S000 ,0RP4 5 %+ptexel -L(@P) P㤀p` P/ U0{@0uPP 0`|S00v|P00S 0 texe -LM`ءp, PP  P 1T0BPP1@Gl1@\1T 0T P<1005$1 P,0S1  $0 < R 0S UU* &P00FP  R S0P;P@ @V` W0 `p 0pT 0  texe 0- LPsP @0S00,t0P 0P\@P d@T0 @@0texe 0-l l@0LS00 D0P {P}P :^, @0texe -\0\@00Lp`0 P 0mele -LPMN0P!0 i0t 0 b0@0 , 0 4 W@.@0@S0h P0,EP >U0CUAU {U  U. (U=U 0UVEU! ʨ=U 0U=U 0U- \M\= tⱆ0⭆ ⩆ x B]@@=x 0 p0m0x00 40Q0b0 @S<$0R@ P EP (PpYt  0Y0' 0g0S#400 0b0S(L0S0S  3P 3P 3P 3Px, 400 0b0SK 0S x P h Z :D @g0DA0 㐆A@ph@ D+004@,0T:0@`0DA0 zA0@,@ 0 40 J40  40 o:x004  c0S 0g0S `: YM0BSJ 0g0SF,:) V00 x t A p () x }  9x 0`0094@`,0T:0x9@`0DA0 A0@,@ 0 40 @Yx 4@ 4@ 4@,0T :00@`DA0 A0@,@ 0 40 )40 p  40 8@@0P0 40KL0 8x D0 8PK@0 8 p<0 880 HU  @x  X8 P\8UXXG 쇟x 4ȟ7 0@PT@ @0 \@ 嬅'@0S00 7P`Xw@@P;P@7  6U :@f0DA0 ㆅAP`@ '00Ps P P;PppdU :6@f0DA0 e`Ql6p0fA0 Zx0 px@6T\  ,6l&0`P0@ 0x x0 p(6x `@ x  45x@0%05xş0PX0 0S@X0`@ 0 5P {P}l  l%l 0p0 d0 lD0 0`0pS0@@0 (PP U :l$@f0DA0 ڄAP`@p00P00|P  U :@f0DA0 ⼄`Q@#@0f0 Aᰄ);0S0 0l@P dQd pp pdp 0S00l@P xp L3 X@` p @02C0`P0P 0Hx x  pyx0 Bk `P P0@P 2  0 0/ px  B1 p x Y@DPYltⷃx@ t  0t0 x0 x@0SS84@,0T:00@`0DA0 A0@,@ 0 40 4``P00 `A 04 hx Z : @g0DA0 ߃p`0 g0A Ճx0(@0gcx(K贈texe  H @ Dle | -LPw@| 00 =RX Rk<1@P0U0`0 { 1  岠00Pp-O0 0@m0@-0P00P00 :00000p00p@00p0P 000te 0-0L0@  PP x0R00PH@0S PP00ԇletexehe p-hLd \P`0US  ,0`000U 0P@Tp$ !2"0S0000 00 0P0 000CS0 p-00`L0 㷂P @1S0 0 R@00 Q@eDA 01p贈 h$ / -0LPpP `0@0A 0R/P0T@@DPU -@ 0LP pe0` !0S0P gW `#QU 0 c0 C!R  B0SP00C0 ρ  Xmȁ -LM0pS, ,  @0H0a  0R (/P' V ``FPU0Sxh |O@000 @0 0P  L00C0P(R    l<  0S 0  0 RhX0S R 0S0  R Ph 0-0L @PX @ 00 Q  Q Q  000 0000008 p-L M@`!PPP- 0  $ K$ 0R   0 00  p0 0S 00 `0D`S 0` $K$` 0 0 Kp|e. P  -P@L1 11!R h 0-4@L]0!  @T0h1 0) 1h0 -qaQAL!Q0 0 $T(D"Q @ TtPa4p唂000㜠0P@`| 0  T@tPa4p唂I  `E  A  o > = |? > ? 0? d? ; ? @T0\t%@`%@T0\0%@(%P%0%0$v4R0 0 $h$cP$]@Z00\x$@p$d$0K0 SL$0D 0S 0$=@:0\#@$1$0 f#0'p#!@\)|0\#0 #pW#nl#0@pP0S(#  00#@T" 0S"0" "0"= R20"""0 "& x"0p"d"X" 0D0R<20 0 "0 " @TL0 S@ P00S0S B1 !0v @PTR'  -#0  ;P&  !@@DT T @D W  p,0P(K 0<@HT\dpx|( -- LP4MD@KB  0 0 xEK -- LM 0  j K -pL@TTP` T TT  T30# 0R 0 P00DS0B C @C B C PC !   !  @     T 0S d  \ 0H  <0  0i[ -@LP00p -L`pP P>@P@@宨F J PPPE P@th  \0PFD W0U h訉訏~0pP-0S0 00\00 C00 RQ\0[S 0S0 [S ]SQ -L@P0s3 -L@P 0S0=S0 [P 0P]P Ra -@PL 0` 00  R0B0 0 PQ [RP@ -PL pYG0W:0000`$`V 0S0P@  y@  AG0 A?V0@0 p`P -[L@&P 0 d h?贈z -L@ $P 0 e -L@@P=0I `I I I I I I I I I I I I I I |I I @x09h8 0 x@P Xx00hh@Z ,P h\  e -0LPp x 0w03&@  0` xx@T@ $0W<0 0 h! -@`L yFP vF0p0x @C=00 0@@0c 0 C ovx -L M`@SF0P  0SP1x p ? 1 00 @P0Ps 0d^0a@ 000C Sd!`!`0n@C@0s 0@00S  0 @, $C7 r 000 R00ӑ R \p r 000 R00ӑ R K贈.t| x  -LM@ p0 4P`+ 0[S(P% PP @  @ᘤw g p0 ,Ks,  R(00 w(K贈 -LM4Q0( K!Kp@`0 !00 0P02 WP 0T@T  AP\ 0 0 0 0000!0[S (P000#P0<0 K贈e -LMLR0!K( Kp^`,2 00@Z!@[T00 AQ R0 0@@ Y@ᚥ0S0T0 2ې!0p;2100Sp1$Q0 !Q #Q!-Q ?Q 81p P  p=0p?08p100p 000p00 * 0p0%P pP !0[S (MpT0S@ !0[pS (=p000P0<0 K贈Pe8 p-LpM`n@P񟗯S @S T `S T T T T T ,T PT X Y `Y `Y `Y X X `Y `Y `Y `Y `Y `Y `Y ,Y 0<0 00c0<0v 0<0l00<0X00<00<0,0 (00<0ee -LM0@ `Pj   Rd 000|1U 00S0 S XSxS   00S  p p10 0@  ,0 --R) #R \00S)$\' pP0000A S00B S r ,P0W B 7 BR00?,, R^l. 0-LM@ KypP@ L00S00 [t 0S0P 00? 08 -L(M0P 0I    0D !1 `o oF@T @ T$T @0!0K!pKY00gY`P T #00G Y 0G T CpC Y00g0 0S-00g0   08 K -L MA00@ Lt0pPB 4 000 84 `V1 0 0 S- O, T@P000T@T , 0  o0<0 U : @g0DA0 tAPp 0040040 0  R0 ZTX U :P0@g0DA0 spQ$00gA0 (Kos괈 -LMK @p( -LM`, 00 P@ 0[SP  @000C S R@0=S3h  TPPX30S H P 8 P ( P  &0e pk 0  , RZ0S vZt2s,00t ,P 4@ ,0D0 )< @4 80 < _ ! 0T0Z0S 40S  <\80S    0 0000,8\0 0D 0\  R@ 000 0T0Z0S 000Q  P0\0P0 r0P00Pr@TU Z 0   \  ?S 0S8  p(K贈d p-LLH @P` 0`0@PTpe p-0L @T0`0PP 0  0 `PUZ 0 40Ar0phr괈 0-@LX=r0 0P r00S0000L00@0 0L@P@z v 00T00P0贈pP0 0 .PP p@-0@`0 0P. R0 q 00000A S  RJ0QA0C00 \ R J^N000A \q 0  RP*p$f.G-`W\@ B\D ,\ $\ \ \ %\)0\$ ;\$F\ T\ E\h\ e\M ^\ b\f\t\ l\ w\ |\88 0 BR700S GpR700S 770P: 0s 0 PJ0 Bs 0 P@T*R,7 0 0S7wP7 0N1 P. r 00000B S P0 0C00 QP  000B Qr 0 @P@T*V P.R5 0 0Ss55 0PLP 0s 0  P0 s 0 @P@T*VR PPGH5 @5 45 ^B 5a^  ,\ 5 "\P 4R  P.P,J00S@T*F^f^ R@PV00S Vh400S T4000dV44 0 0S40 P 00SR3 0 0S3̃p30 P`= 0000B S0 00C SPr0  000B Qr 0P 0 s 0 PP@T*R2 0 0St2p20 P0 s 0P 0 s 0 PP|@Tz: Pt00sp 010 0PPe @10 |1 P00[S (S )S {S }SG ]S     P5 pP@bRP(P&J00[S0 (S0 )S {S 0 }S 0 ]S 000S SAQVR $f.@v (0 0S00PP0ገ P-L@0 p-@`L0@ PR a~S e 00b 0p$f p-PQL`pR@ 0 Q" 0Q   0S0 aUS 00 08@ 0 IS 000pp$f p-p`pPL@ R  P pT8@D00 0S0C0 0 p4ntv,f$f 0000 S$f~v 0-4@4P0L S0 00 0 0$fv~ `$0R 00R@P0S x0`00ῇX @000D00 S  00c0(Kv$fvvvvvv -`0@ X0LP0  ZTT 㕇 㓇$0 0 0 vvvvvv -0@L0S #m h5Tv -Lkh 0- P@L m0hmꄈ -H0L 0@S  ,7@TT^J@@$hFꌈ 0-@P L7 0 00h p-X`@LmPl 70 0 p脈 -LM@Pq0S aQ 1P@@]QP 00hA 0K 0$0K0p(0K0 p0 `PwPB1 $W 0P0(0APc: ᣂP U VPUPP|00  $0c0u03Q0SP0 000H0 @0 <08040Kf$fq HVvxvtvvHv -L M K0 KK K 喂@P 劆\K -L M@PPr0S 2P 00S hbQ \2@@LP MPD H 动DΟD>8> 0>P (>(N$>$n > > k.>Ο >HD0 ^#PP@ P PPP,K?= ,0 LP0b-Pմ]0 a0bM 0R 0LR |M0Lt-0f\-f@MD]  nM jM = =0  c= B = <唬<匜< ̟Q  P 0 S< pP Ro L 0P 0P  U0P  Rl ;0 0SP RtX Ț  $ ` P ˟^ P+000^PP``0^HKH; 0Q0AS0C0 0Q0 0 0ӷ0C 00· R 0S0C0 0BL c0  J0P|J0Q `  aJ0 ` a |:`0P @0S 0 p aI 0 g0b 00S0b`0pt0 S P00Sl9` P7 P/ P6 Pl 7 P.  P2*P P-|9R` `P800O T)a0Pɟ000<)0cSsS CS@9@<B8=8!0S 5H0 0CR,8` ^` 0  cxI 00 0ȟ0 `0S 0P0 0 8 "P P pr0S7 00C0t'P P P@@ 10@'S7@@ǟ00@007`` P#7/U0 X P @@P}0 S56@0 @@2 &00xF  0y0 PX]0000@ Sl6hƟ 000C00D&00<6P>10@<&S0000@000?&0 0P0R %00( $00@ S 0 00C005 5R00tşp%000d% 0P0, Xş00 Y0#P0%005 P P``s4@T0S  @ğ0 ( 0200h$0PP@T |4 D3 @ 00`0 0E@s0U3 4 0UxCp@0KS`0$ R0 0 0r؏ -|0LRM~Kl pX `@P@  0@ih Ktd@A -PL M|,S 0,SS0 afS nS 0@K .  q|0PS K -FML MP KHp H@`㔐K1,,,Sp* 0,SS& g r. 0FpP ! Gp@p0 #gpx01` Vڀ'|@0TS1!S00Q0S<QP (K( p-L M`Ph{ 0(0PX0,P04@000000J00$0(00 (KpD -0LSd0@``PpH  gP U0SR{  pX -LMMOKMH@/pKGP ^KF F KF K-0`0 8b 42 0r P*04  0K0 ~0 082 042 80Kl02 ?K00 8 4P ,P ʚ @ F KT  H(K(BxDh 0-LMOKP/FH00 2 t-00 (囚P%K^K0$'BŒ -PQLM Hp P  TP T CT cT00{0UCTUpJKH/RFT2CT D2$K<2W`` 0 @V0 ! 1 2 nK G_Kp3F /F1!01  01 Q q '@PW1S 0! F>K1 01 01 0W00 S+  08EpP   K8Fp[@}n0 evn@t0^K 1 E0 1 0! Q A 1 ! A p0J^KPEd ә@KtTX ~$K$4&B t 0 -VML MPphp` 2 OK/E $P 嚙@P t0?z]K PE-KY/E\0 KT0P ᳀ r 偙P4 Dn K@\GBL$F$Bl -LMM/NKp/`^E0 2 \@PK^^KPEPE2~K`,FE0x 5 @C CP `X  P @00T(K$ Bx"BÀ -LM@/KE 0 d0C" Sꜵ 0 0 000 dy0 \0\/KPHzK0gS ,0R((WeK$#B¤ -LM MOK f /UD0 3 Ø@P %0S l(K~띎KHkKHA/I I  ) WkK,@D\şhe0T6 9(K4 00PKk.K B4PLᒘ@P $ TQ K P.)Rğ4$d09 (K0\PK8C8sp@K\K$)K0QSpK$)4S@ H P X 0 ` pd ldhddd`d\dXdQPt L$L4QppB?KK 0$)3s3Sp< s3Sp4 3OK00 KS .?0@#P)C^ c^  K\KKpK0Kd K\K pKHK0K prdp/C"Ÿ09 06 06 9 $7 PQK@7Sd l t | T Lb Hb Db@btb0@!P)!(K1 0!8K(6[ SHK_*6[ SKX*&0rp0K\0K0\Kh!(6SpK (8K0K HK4KPc(10S K\K pK 0c3Y\) ) 0\(K$ Bx$"BÀ $08@HT`lhp x!B$    $ 0 < D T h   -L\M`pp@KP pp).b P p.@\ PPpT 1 K  0S U 1 K  00K 0-LM@/KB1 0gR 3  aR dRmR sR000 0 \ D P00 8dw\0 0aS KP0 Ww0P0 0L0 0/K⣖PP-Kf0gS*X0DPKS S S H0L( cDK P0'T0S@ St@ Sh@ S`@ @@XD KbLbK0$   *B L/ (   $  p-L\Ml@KP P%):P) @@.`P @K< \@K< @\Q<`p0S.S  .SP @0S 00C S000C 㓕)= TP 00C S@0SX0W0Y0 4K4p 0 , P (K\ -MЍ 0-,@,PL(  l/p   0-L M PK0 @0 @ 0P4 @ 0 2P  >K08 D  -L Mr0H S`P T00d2P@@ HaPH}$-apP, PD  0D0 _뼑iP 1 @P  HxPdgfLfD0S 0  ( ᧛0;010S   [_P00XᇛP 0-SX0S ~@K 04K,@oPpofP 4H=P Ha(K,(P \ P     -rMLMpCKP 2QbP^20S  P %20SL PG K->PB3`K_* [P2 RDB@ߏPy 0Pp20S 00CS00@Ӥ0 @aQ0S 00CS00Ӥ0 PpyTYTN PI 0S  @1 1: SsNK@D @D uP ͡! KQPKPKP0: S9^}PP  1: S C/K j$KPXHl/THV\/.    -qLGM@`PfP`P iP`P1!gp10cQZ$+1pI aK^=P 0: S ZJMK@D @D+# !P q#p0W`/S/00p`.P/P@ 0S @P :0/S @P:0/S@#l 0S\  :IKAPZRXP-T  p-LM 0PK*"* 0 ,@`Q$K c\0GPPP @8PV  5ePP 0S P0<0Vw]c 0PP P̃0V0X嗙cPX 0PP 0-SX0S $PKpЙ -VMLMp@ᣕ9D9AiP+# P !#%p+"P 0. 00 00000KV<pPt0S $ !0: S  X H  uK1: S  %  P|  8VK0@p5 |8|0@t5 05  5 |40CS @Z!  C5SK <0S&P$ % ! @/P 0S @P :0/S @P:0/SdT P 0$ ``/Q @ 0T/S/00p0a0 Sp崟 %  v00px[K;p4S;~Sl1: SxHPq0Sp H0HykHh1 S d1S `1S  zH00: SS| ݢ0: S l1: S ldAH@: S'  SL  S S  SV  SY0X%@pH# (K 0TD5B P7P H$ 0S P$sl1: S p$`4yZ0SLP< PxP0SP DrP0 -$@0Sw3P 0S P  ]p@ H Tx% ;p5S 5l"?d0S 00CS00@Ӥ0 [ ề@0S 00CS00Ӥ0 G ᧁ PpyTYT bz< x5( ,;]p`S:P,l5: S&Z  " e7P /0pq 1 ep00T0S L<Mp!()@PpT00 S 0m STP/Wzbxbx.PppbnbP |lW 05 |ڤPP:0S ]tPDu|員(K8DLp`l/<@.|t\(P,< 40poH/ -L`Pp( @@P0/S /P@0.S0S .S 0S pW  0S0 P@T0SN s@1 ᏥPP? 2$0BS P x P% @ 叝0 X 0SR RZHP 0S `h`@p`*@P0S ,0H0LMЍ! -0L pl/D-0 CR 0R0 SƝ00 -@㌢L8M`PpNPP sP p MP@@"pp<W&R@K0KP< , K 00 @P `P,00,0 "@P]m W0S< , 0 0 ``P x.l p` XK pL0T PR0T0 T0@`5K,0T@X >\P <\00S \ 0   \PP+a40[S  5[0S^| X`@L0VU L00S@ I ,(Kp_lt//MЍ -0L pl/ -LM@Pp`sPp  Wp00`SAT -CP`G_K@P @W .PP@GKXKț- -@LM `P7 700 Q03*,  0,, pW00P0 U 00 @ep 0 P02@0P5 :0P *0@@,0 PdW p 0-LOM@P;' @\@0P00 Kt.~D10@1P0  :9K0x]\l -LOM@'D\@0P00 SKO.~@10<1P0  :nKx]\l -Lp`-P*@P04`0K0C*K4M8.K BK( KL:K*KQ=K(0C8 LK( (aK0B8 8 C0(I LPpI( 0 SU 4 h 40S 0000 0 0E0S'000S00 0; V)p 05  (00?0bS fS)0S00 b< 4<̠Č8#Č:K"̌,K(l4, `-K 08&880S}0 0000 0 0X*K0P8 Z0`<`K8ßXK /)p}0`06PZ@T@0  0KI3P T X KQP @T`P X p@ X0Kp @T T@ `M}K@1H}V@8aC}0SA o8,P 080(x0 0S$v $`@PV  XK,*KXKV.(b/(K00C0:K(K0XKS5XK .1 R)0S S S"Z  fZKp0S   p ,<4("4!< 0( K00C0a( K0S'@$$T|0 0000*0S<0 00S 0S 0S8A 000 00 000 00S081 0-0 000 000 0(K? p-PPL|@00m+`(@P L00040!P0 ((@+p -L@M` P4 40 \13000 55:W00000 0 S,0 ,, pW0000P U>*0  0 @ep 0 P02@0P5 :*0 P $*0 @@00 PdW p0@ TP3 : 0S 010@ 0@,0qU dP"(K p-LOMP@`&$0 |P0P00 UK^+{H10 D1P0 @@ :f@ "T  00{@Kpx]l 0-LOMP@#u P{@K*+{D10@!\0P PP :1@T (0 {@00SK0x]l -L@#000  Ph|]G-M T 0 $0@(@ P,P`0`p 4p@0Tp  <0P<` 0Ԣ($ 0,($0P00P4@ h ! @(`$, <@0g\ P. 0@!g.,P(@T<@`0$ 04@, p$0( 04$(0Dp4pHXLP @ @0 ! 0@!0@ Q18 P!@`!@08P! LPpHI$PDHpf.. 0 p 8D0#Hpj!E$ 0#j 0P%@@X@ 0H @^LP@D PpX  `DHL@PPT@00P0 00 pD0 00H000000000 L@000 PP`000ЍG-M0@ Q0@0@0@0@0@0@0@0@0@0@0@|0@t0x@<0@@408@,00@aAq@P `(p08! AQaq ,0d481Q   0p^P0Qp nt ^Q nt 70tP@ t ~ -0tPp t '0t0P0L0#,0 #(8 , 4 #@ H0 < D H #",#,L P H .(#T X H "D0\ #<`0 D d "(h D0l #4p0 @Dp.\..40[8[T@[?  08^P0Q8 n< ?^Q@ n< /<P@ < o8 x/<P8 < r/<0P0D0#<00 , D04 #880 @0D#\#.pT.l0[#4<8[0@0 @P劐pP0(Ko; 0-PL@ 0#<00#800#400 R00hr -pRLPw D@A1>0O `cWP: @1@ T@D SH0 0@H0L@pf.@1 0S@DBR@H0 0@H0L@@00 @TpG†@0D@ S H00 @H0L@`W W  P@1 0S@D RH0 0@H0L@ \00-PLP .@0@0D@H0L@0 -RL`? D@A1>?0( @PcXPp: p@0!0@@0D@eba@0!0@@0D@V@00 @@0D@@H@?X X  PE@0!0@@0D@ D00-PLP 9.@0@0D@0 -LOM@P`uTp 0 0+Pu0 S 0u 0p WK$H1 s000tuP10H1 KQ`0 S0$00DS$0 0!$0D -PRpL 06$_!`]!@P 0W0 P0 X P4 U\  + -@0`P\0!!@L$, -L0M`PpP) K.0 PM 0S u0"S UD@K -00 K_MP(@u("(04"48#K -鈑LM`, W0RSd0 S SMZK hP0U UP SBU U8p UpK*K0CcMKL8b=KRKp(0C(L8 A((0B88 L,CP 0 S]  , ( L 8 8 8 8 8 8    0 0R,040S0S000E l0St0S~p0S{x0Sx\0w"0"S000/`0SS S000&d0SS S S000S4 Py\0@3 ,KP0,@80% R! 0S S0S080S 0S0S0S 0S 00S 080Q,`0S S d0S S R  h0S S R  r 000SS\ 4 <h0SS\ 4 88q < r qr h0S r q0000000S2TfTFP\0  0&06 HK#HK 0P0p0SV,0SSP0 #p HK nP0sHK0S=,0S:\0 000Gp0$0 00?$0` R$01D0s),0S000 0-0( 0?0bSJnK@`F|$@`Fm|@0 4H p} P000P 0|00 00(00?0bS fSe'|P0 0  `0S$01D0S0 S0  0 0fP 0r0 S 00P7 `dKX0$ 1DK8`ß K _p` @ K0唼P  "p@TT \0"   P r0 S 000 0 0 }30!P 00( r0 d@K$,"K#$:[0C:K:K:[S4b44@MKdKJ$KK :QRA(K 0R<K *K^ 4 K  K |0 'K ^(KxK0K0KK\0 :K*K@!K(K0 K(C{z:K(P  | K<P@:[T(r0 S 000 0 0$g0 000 0 R,0000,1,1 0 -0 0 000 00\0(KLDX&\?| 0-0PL0S q@00q@0訸 -@L6h6ꤸ -4@LP uP訸?h 0-L@(|6P0P@ Pw60褸 -Lq@q@ -LM8 Y< pP qx4 2n hP!X20S002 垫PP 20S00#30#埫p3Ps aq0m,`  LP00CS00 Ӥ0Э R r ,Kxm80SW00S 7P<,K]0,KY@P 0K MQ00S p00RQW00S < P,0S  ω R ,0,SP SS SP00P,00,0 00p04  0(K訸/D@ p-LM@d`P5P@ 0  ;,0@0S 5TKp褸 rS-@L`P"@3:pppp 0P@p@p p-LM@d`Pn5P@  0  ,0@0S _5TKp褸 rS-@L`P"@3:|pzppp 0P@np@lp 0-@LP 0055,@r.0 /5 0hmꬸ 0-@LP 005,@r.0 5 0hꬸ p-LM 0`|50tr.@l4PX4\00SYP  0`P@4Kp謸 p-LL4p@`P 80R@P Po@ph4ĸȸ 0-0@LP4 0 0P40ĸ p-LM@oTP 0  0|@\ l 0P o0P <`PU0o@o0@00x4ȸ44 -LM\P`( Kp 0 @P F$0(S`Po"0 0;0S0P0S0 @⾛  㺛 㶛P0P@S0P0S0 P0S0$P0S0 (⛛(0$ 0cR00   Kȸ -LM@Pp,@ 4:o8o0@0SUPp% 05@KU`300K ,`K50K0 g0 @K`@@ < s0P`ppV o\@P0` oP0SpW@o@n 3(Kĸȸ̸ 0-L MKPP,0, ;@P P n@K0̸ -LM K 0-LMKP0P,, ;@P P n@K0̸ -LM30PP x@K0 00 200K H KD+@0 @ P,@@ e3Kĸȸ̸ -L4M@p<`,@ M3}nX zn1@0SPp, 0V쀟,K PP@1@#TPK 10T0K@⢚  4K04P 0@ Ppp0`V Ln`@P0`DnP0SpW@ -XL@P OπT 0 0 4@8< -MLM`P0p0X p#W( #W% R BNK@D F  K0CrP P 8@4!0S *1 9 81081 K -MLMp`WP$R ANK @D@D   K0tCrP P 8@4!0S *  81081K -LbMF>K0C*KM8.K BK( aK(L:K*KQ=K(0C8 LK( (P 0B8 8 4C0( L( 0 S? F @ F F F F F F F F C @F `F 40P0 P 0000 SL0SRL0S 000 00S00S00  0 .V S:V|` 00FV08 Kv,Pr40p@P  Xp 8K p4Ai0 00ep 0r (00?0bS fS0S4 0R  0$ :K(4|5<*K 0880S 0L DD)*K0P8n L YK04`<( :KşpK8 ppVi0`0>PY@p K )P@pH K,P T pH K+P:KHK (P`P l p@pKp @T HK 2pg`i*K@ iV@4ai0S 8nP 080(pw0 0S$G0P04 $`?@P  pKpKHKnK`FO4[0C4K4[pKS:K"Br_KpK*K(2`VR0S SL- S SG6Z:K "<K史P8:K$"2Z0*K偲P*K Ep#:K ZYK 4*K Z Y :K &K p 4[0C4K4[S@$Teh0 000090S <L rp`Rh0 0+0S00S 0S4A000 00 0P0S00 00S041 0 -0 000 000 0'`(K\? -L@`pP 0E@ -`PL@gP00p PP d0T04@0 T0L0P0 daP>   -L@P 0@0B -PLU@p U]-0S 0P.S 0 0 05 00 .S0S00P 00 0  P/* m`P0U0  U.rP  0!0 000 0m 00 0 0  P* m -LPp`i@P 400PP<4p8`r@ J -LMBKMJ@PJ `p 0 ShJ J L L L L L L L L L LK K J ]<00S0D00@RT1 < Gp 06 P0 0 0 48 P@ 0)g0 0f0Sp.0+@cP/ @0S) 0S&$> 00D0 0 0S00< S00<000 0D0s00   00(p$-0 0p `(K -L@`pP 0S@0 -0-LPM@a?KC/_K@0 Q Q 406Kp@ `@ ,0 pK\ L0 ,P l  K0xL -L1M`0pPKA4 8 0 p 1S01 R rP P 00000C00S'P0 r [000%R@QgQP'eQG*GQEQC*9Q0Qk*%QA *QP Q7 AQ6 DQd[Qv OQg XQl LQBcQLP aQ!pQ jQ3 hQ4 iQKnQ MlQ1tQ6 qQ1 sQ xQF zQ. uQ?PP0SP 0S0 0C rK@@0hS@@0lS@@L@@ 000C@P  P0# z@KP0pKp"KP0 n0^S  0J_C0 S RJ!- JK0P-S ]S S@Q00]Q0SJ_K0 RLP9"K @P3 0p0p@  0p p @p p 0Oq '000 @P 003 P 0 0SP  00CS0P0 r T000U񟗰R PS hT U X X  PT0*0PdP # 0hP P 0KP 4p4 X P0P0CU  SP U/0(K 01SSU$@P0X0C000  0SP Ti (K001SSPTd 43p043 BX @ 0@ B0T0  RoP 0 r U000 !P@ 0C00X0  0SQP 0 r 000 4 0d p4 dT0HʏKS8SJS0 9R 8R%*0R +R+ -RH(XR+ A0BSAaR>:fRxR:0PI0 J"00003 J000S03 03 S  :J   60K0UI0 0 0CS0000PU  ?K0CUU᳁UXPxPPE ;-0 80#w:80#=   0p@  0p 0p @pp4# 4# 8 0`Y H?K8RPPJ,0 9R 0RJ#*-R .R +R!ER eR  J  J9S:J0 0CS0000ePX   _K@PEt6T-xePEP ,x);0 8wc0p@ 8c0p8 70p4# 4# 8S 0e4P4 4(K. -DpL0`S@P@j 0@S>j/ -L M0`ჀpX0S 0@P0p \@ d0P0p@   @  b$K -Lpp p'  @0S1'*p7@ @0S1 8CX0 8CXp@  P 1 A PD70  c`D7 p, 0RD000`D & 0㹥0 0d婥P`V U00DD 0DO/KD' H %2 D>&B aP`D D'O?KPbdU87P7 5Z 0K⠡K)0KP7 D P)0[Pp'PS*0[L L SLL  t' ,<7L@lT`$H` \0 R0\0 ` xdK PK@DT 0@` \0 0R\0 ` xdKPsK)0[S )0K000`  \0R0\0 ` xdKP]K*0[S 00+0K+0K000` \0 R0\0 ` xdKPEKtP,<L'@bTT`$H` \0 R0\0 ` xdKP*K@DT 0@` \0 0R\0 ` xdKPKP7@eT`$H` \0 R0\0 ` xdKPK@DT 0@` \0 0R\0 ` xdKkPKp D!` \0 0hQ,v5h d'R80S\:000`  \0R0\0 ` xdKBPK87Sp 00h`  \0R0\0 ` xdK)PK80@cTjP$(` \0 R0\0 ` xdKPK@DT0`@` \0 0R\0 ` xdKP{K8808 a<0D'\G0bT@T` \0 R0\0 ` xdKP^K\? @cTkP$(` \0 R0\0 ` xdKPFK@DT0`@` \0 0R\0 ` xdKP1KD8\'PD p7 00h`  \0R0\0 ` xdKPK<0D8G0`T@T` \0 R0\0 ` xdK~PK8?@cTlmPʡ(` \0 R0\0 ` xdKfPK@DT0`@` \0 0R\0 ` ҂{8'Rp7U Dh01K01K>K000` \0 R0\0 ` PxdK7PPKDX'0B0` \0 0R\0 ` PxdK"PPK87X@iTܮ`2H` \0 R0\0 ` PxdK PPK@DT 0@` \0 0R\0 ` P D00`  \0R0\0 ` PxdKPePKXK`` \0 R0\0 ` xdKPRKp'* <7L@lTaP"(` \0 R0\0 ` xdKP7K@DT0`@` \0 0R\0 ` xdKP#L'<l1R 0aR \0Sl  xdKP0㤐K`0 \0S xdKP0`0  l' xw0@l X 00l TPM@P 0KP D8 Pl(K -DpL0`S@P^ b0@S^/QRP000S0 -LP  (0SX00R001S `Ԁ@p@  \@0S R&`P0VWpl 0 `00T_X00S @0@@ X 0 0<|]]/ -LM}PPX 00z`10>CNKTa@D @D 0P3KHH  p* T0S \PT3 4`K Xp"EK0D@K0@3[<3K03K\ T  (0!"(&80S #W00 @3[P3<8lὲP@<0X0:P(Kt  p-L@ pP  +:p` V0$S V@8VP@p p-`PLU@`GP`0h`  h0S0#*P0h``0p -AMLM8pK`d Pl(K,0SF"[3RB2[S?2[p< : 8 CNK"[ @D0@DD0H  ,0S+#[<0R'#[80R#@wP2[  VW0 02["[[AmK0`F@`FaT@D,Pd 00S  uV00 K -L0MP`XK p?  h0R d0R7 MpP4 h0K@P# A K@08@ 友0P0S020# `p3PPu A=K0C80C  pXPpKe?/ P0-L@(0 0PS 0S00@P v0S P |p 'Q?@T0[ 0000P -0L@S4 X X l l l l Ĥ p1TP 00  `P @@P<8P0 PP,0P4P|P `Ph p-LP@P`P@ P`p -LMpPxP`(K0 S00( 2K #pgP0S @P ^P` K0 00 0 -QLMD H0  Qz H<̠Č8#Č"̌,,H0 @,̠D!1d , 0 @ P ` p @0  < 080  4 000 .2 0$20%20&2 0'2(0(200*280)2@0@0#2H0<0@#2P080P#2X040`#2`000p#2h0"2p0,0 #2x00 , @l  D<,  L8  T4 \0   t DH4 d @P`$p,4<(K -QL MPp` Q QiPc  a$ KmPZ@ >$00@PP%P @@PF  f008 KPP :ܵ8 KCP0@  80K@ X 80[S70[0SS 70[0S SfP @0(KP 藌(0S K p- `LV@P p 0P*(0 0p000p@ -L M`Ạ pḀ0@P `4 ĠDT"4!Č'(D*T0K 2KKKBKRKcK$K -LMK![K04"4 1K -`LpHX\$H %X P p- `@VLP p0lS*(0 0p000pL - Lp @P`p 0$ Ġ4%.$$&Č'40  - L@p ,<4("4!<0 - L@p 04"40 -LM 0pSU 4 0 4 \ 1,0 5P1)::0S 40P3 0T U.*X104 PU%0F>S-!@ T @!  8 ,8 d, X100,0 00`VZY`w 0S0%5,0 r<040R(0 0ZY (KXh -LMkP"{`@p{xb"Kq 0Sn"[0hS*1 0Q Q Q QD1Q Q6 Q=  O4!Y;   !O! J&" 00S   0S   [`0 $000 0S 0"[0hS,0 0 0SL  0-< LP@ P0 -0L.S@P#P*QR00)XP00X0`dS F>R`V@1@! /WP P0@0S.pJU000U -h3LM00< 00 0s 00 S P R P u@0+S  -S00  ` Pp8 4 !R ZZZ Z5@ I$`VL"0I845@A$  8 4  0L.\  0 S00S@ P 8 0O4S "8S 8P 4` `4` \<@8 K  V d1d0@0\ 0 R \Ap 0P0 L00<110 0`pJ W  0Vd9#Zp `p X 04085# <0 @TdL00 (K.x  -?@p##pWL$MX< 0O?   BE!5;t l@8L"0 01`V#U!42T100  8 4   0ᦊ8 4  01T 18K1 '8 4 @T0 8 40 000 8 24|A$p0OT?@ 00@@#U[ UDe VZ00@@P` @ <H 30 0r03Z cY 0zdyVUZ00@@l 0@ 0<X  D 0 0<4 ` (K p-H<`LMP@0Px0Sx -LMP@ R@00 00ű -LM@,pMЍⰱ- 800Ms00Ѝ p-(LM"X`  p@xx -LM   P)K@"00S0  @0 $ !K00 @P $K p@K$ -LMP p@ 0^ Ƞ,Ƞ0@P` ("(p V`00 K p-LM ` Ƞ,H@PP  p 00jKp -1LMpPW@: @0`A("S*J"0 0+Q(0V  ` P  000 `0 P*@` b$0@0    ? -2L+@` T0L 00P00 R p LT0 Q dp  PpWN ,0 dS(K4   0-@LMP$0 v(0P0CP0@008 $0 R0MЍMЍ0McЍ 0M 0 Ѝ000M00000ЍMЍ -LM@P h 0-LM R00 0P0@p*00C08h -LM@0S -LM `@p 0QP@150` !!@c + RT -LM0MJK1@D00@D`* 0  LK0K P Q  0000 0b00@sPU:K0C00CUD0 @ 0s 00K<0 0 ,0 00 (0 8 0$0 LpK  p@ I0S I07S I#00PI@ U p *00| 0 SK4 -LJKM@DM@D`*rp  W@  0p000 0b0QZKPEPE Hp@ H0S H07S H#0 0 PH @/ K 0-LM 0PQ@H"0 0>P0 0 0 8 0-LM0 0S@Pp80  8 p-LM0P 0S@`p 0 000x p-LM` W0PP PᯱP@ᗮP0 `0`x -QLM@*P T@ -L$M`p@0 $H 1! /< P +#@,5P@& +t#p@ 8PK  00 000 Z00000 ,1080 4@ TpP )G@Yt2G0S. a< 0p P*T#@G?00tG0S<`l d0p P*8<#@G?00@ R00(K謨@ wd 0< -LpM`10@W,0   @K᳖@PK ႝp@K@  s`P060#0P@U@Kᕖ    a  sP0\0#0P@U@Kx   ߜ D0, 0R =(K4D -L\M` @ V^PP, p t x a 0Cs^0l0 冰PX   hKTpK| :(< 0|0(((  lp t0@iD0@00 hKp t0\X0D0 @0A 0@A0#Q 0@ T:V@1@# x@Kkx `d x V@@PKl $hK@K ,0 S (K4P -L`R0M0@Kp0 0n P 0S dXnP 8nP @ ,KP0 ҃, R 0S!V000z3Z 0Sj0KnPd @ ,KP0 调,  R 0S tFcSV0000K<n0n@PB #0PVPS00S000mn@P0 #(,0S00S000]nYn UnP@$ Z 0S $PTbP0K =nP $b$Kx4E| -LLM0 0rp$0 4K f0 0DKs Z @ P$`DK 4KP@ P$`@0 @P<(@0@P'0$ 0R K430K` 0-LMPE0@pRE@8 0MP ЍXЍ p-LMDQ`@PI KzPh d0  sb=1 08 @0 0<0 0040 V 0K! 0'0`0 K1' 00p PP00Sd@K_\ K ep 0#4 KpT  -LM@0pS>EP00@x`- P@]2L- P?T00S@ !E0S #  -LM/@ᰒ0 P0 K塁pK  -LMP\@pT` U 8ĐV a80 60 p-LM,(%$1$0S 00CS00@Ӥ0JD@`P0S 00CS00Ӥ06D PpNT nT tl00S``00CS`0X bX0  X0 a x@//. p-P1L$MQ8K< @,1@TE G( (0$KS 1 (0 ( 0p7 $000 0p P $峪*<0S 2d\V18KS[$太P `K dp@ 0S  400 ( 3Kpx222 -MLM@\`K, Lh P*K0P`0 ,\:KPd` |\`P zK(pG4pGK:K(Hl*K(0Hp0w2 P P*K`` Z:@P:K``` ~U*Kh P :00/PH kU> :00 Pb :K\PV 0RR 0RNPI 0REKl0 R?( (0R;:Kp0 ,0R5P0 P+$$P&*Kh|p$ :Kd aPZ*Khlp 00S0@ }PᲯP :K`d=` KK`婩< ,0 S,K(K46@dx/p 0-LM(PK0A(0 $@ 0 @   @0(0 $@ 0 @ tBqBnB kBhB4PdB$aB0SK0$  p-LMX`@PP @0TBᓞ,PP @7@x -LM@(P pOp YYYT#at -0LMM0,0 APPWoKJ%T1[S   @P UK9,MK5 j0 h塮 ,&.FPp # ,0 S(K4 -LAM0 , 4$ 84 `@ PjB?0004A\pP 08P XB0Sdd!0E48$PD JB0S@ 40B^KPE@DPE (0K@tDhP?p%0 !%@$P P 0+4J^ PBhpl 004$84YiP]g ,0 S0(K4DMt\ -LM< @ ᤟Pf p0`KV8 D0 Sp @PQ 8 b80@p#Pp0S> 0 saPP8  P@ ha@P7 00S4 KP 4 R ;;S Sa@P!0 哌<P 4h =aQ@  0 8Kɞ@Pا k$@(K@04xRMA Q:0S Ѝ -LŸMS 04 < `0 80 @ D Y00K00@匞PPU 004SQ@04 S  P<0eS\00 @000T:0 R 00S S0B00 08 QR 0E 80R P000C00 0<pqp3\pW  ᰪ@P<S<@ Q 0 00<@  pX00V00S< < R9 ׿P4 0<pP@"0B 0S S 0S 4S8  S4 S S 8S S R`00 0S 00<D R<(KF -aMLM20$0 pP" "p` ]KPE[NK@D #+ 0K 0 E 5 U\e MpT!cKRPXGk06: S  S [NK@D+ K@@P[NK@Dp1l!L 0K@@X@9@UTSaD[NK@D`P7@0S  K0UC`PX% !n/KLPX[KAr< 000D6 W @`  Q#00ӑ eiPhh#h3e00T02@0 pW: @QP q "000DTpG- u00A SrТ` @ 4j Pv"2$TaQ 00A SpWa:/QQ@ .QQN00A SKP/Q!D00A S00V0S< @ j P$ T9Q *00A SP&Q@"V t0S SS0h1P@@0h!0Q  0T2=@0(^PK2 =1P=@(0/ᶼ@P00 }PT@ dK0 zd0S@ =@00=/00@ ,0 S,(K4.\x p<P, -L M 0ݓl/ -LM0 ѓl/ -0LMP`0pK00KZP i 0 ##SVPU`0.T00S` U @ TU 0K (K4 -h2L M0P,0 PD  PD<@K 0:S0:Sr ` p@ H >PP1P 1@ RY0cr1WT @ %:TXZ I0SF H 0SB'$0 p`p@ .T5`,0KV1 hP,@TX  ,0KR!0'$ p`Z<K 0Vj  0\0 l^A0VD<K ></00 ,0 S(K4T@( --LM0 0 C KG-$1M0 ` p00S0 XSxS  R!! \s  D A0a00c0PP@S @0 C .S^ s 0 0m C Q171Q Ѝ. - LM0 K  弼p K -L M@P4K0`px $@ PPP00P0#S <00 } $0 S K4h -L`M\,  0  \ |K ~! BB/A?/A0(K B 0bT 1#QT ` |K1Sr @@r v T` Qr v T`v Z`ZK p. ;v W 0WW10SG*:*W @T>*: W VZ Zh0L S   dNP@ @|KPd!1pPPpW00P0#Sv 0S ,0KR*:00ZK .0R:S;0a @S@J;00 @;/00 ,0 S3(K4tMЍMЍMЍ p-L M@P`P0fC @\000C S 0 HxKp -4L,M TK@KT0 P@ uPLe/D4@D0 D D R*0S0 |S :S00: pP#X0@0X0H KppH0C<HPK (0@pH0 00@pH0 ,0@pH0@tD K40:qPD\  @@ppH0 8#(3 H K @pp2B, 00H0800H K7@pp8 40H 2;?C0C,  4K2 D4 0 0#2>;3Sa SC S- Sy'S- St4So S Sj Sj:SL Sb Sa^S\ S\: SW "SVH&S SQ 0 P!P1WWIXF4!W,1W? W< W8>32 0 00 0->400 2&0aPC E 00>  >3 0>3 S0 >01 >3 S00P@ UsЍ -LMp8 Q04 Q@0 0Aό  D0Zl` X00 X00LR,@P@ V00  V 00"U00P@T T 0  @Dʰ1U  XD x 00 000s03_X0S  V vd 0  0 _V00R08!SP X" x 0  0 _X00R0S U  V v 00  000s03_V0S PA?E0CS 0  0<04 80 Z\0 04  @\0(K. -L MPp0 0A>#R R R >3>3>3 SR8  R R R R RR RWp0 0@0  000 DPP`I 0`P 0 `pw0 0`0  000 FP@IpP 0P  P00S0@P R@ 0rpE0 00  000 JP0 E0`0>3@ 0` 1>3@1>3"S@D0 @~ PP0 @<p 0 >0c"O 0 >0c"O0 @ P U/(KG- M,0@H`pIP>3Sg SD S. S'S. S5S S S} S=SW Su SvqSo Sq@ Sj "SkV&S Sf0X !1XX]YZX!XSXP XL>32 00 C 0 > 0>0 0 `0 S004S0``C/ 0>0 0 0 00$ P >3 0>3 S 000 0>0 0 01>3 S 0     0 0 0` V] Ѝ -LM8  0p 1>#R# R/ RR4 R R~ R&R8 RT |8WW 0RS8 WO 8WJ >32 0 0A pa0W0[ 0W6*0W0W0P -,*0 S)0H% W0 0W*0W S0 W Wr 0_R  0W * 0W0 * R0r 0_R 0W Wr 0 _R  !>3 !>3 S .Z00S\R 8W 0J000 Q>3S9 SF SM SS Sd S0>S4P "0st `@S dR 8 0dW  P040 !0S   8  0P>3 $0 1p 1WA  >3 q 0c 8 P\ @>30 @C1>3@1 >3"S@D0 8 @P<0 1>3 S5 @>3@d_8 0 0 P0 0 @>3@d_8 `@ P 0 ~P0 0` p(K. -LM8  0p 1>#R# R/ RR4 R R~ R&R8 RT |8WW 0RS8 WO 8WJ >32 0 0A pa0W0[ 0W6*0W0W0P -,*0 S)0H% W0 0W*0W S0 W Wr 0_R  0W * 0W0 * R0r 0_R 0W Wr 0 _R  !>3 !>3 S .Z00S\R 8W 0J000 Q>3S9 SF SM SS Sd S0>S4P "0st `@S dR 8 0dW  P040 !0S   8  0P>3 $0 1p 1WA  >3 q 0c 8 P\ @>30 @C1>3@1 >3"S@D0 8 @P<0 1>3 S5 @>3@d_8 0 0 P0 0 @>3@d_8 `@ P 0 ~P0 0` p(K. -L MP< @0 Q`40(@08 4  V%@ 000 0Aό@ @0Y|p Z00 Z00b,@`@ W00  W 008"88V00`@T @T0@ @D1V  ZD z 00 000s03_Z0S  W w 0  0 _W00R0S` Z" zP! 0  0 _Z00R0S 1V  W w 00 000s03_W0S `A?F0CS0@ @0@\00 08 00 < YP  4j0 8e@ 40aO0(K. -L MPp0 0A>#R R R >3>3>3 SR8  R R R R RR RWp0 0@0  000 DPP`I 0`P 0 `pw0 0`0  000 FP@IpP 0P  P00S0@P R@ 0rpE0 00  000 JP0 E0`0>3@ 0` 1>3@1>3"S@D0 @h PP0 @<p 0 >0c"O 0 >0c"O0 @ P U/(K -L|Mp 0 \  >R(00  p S$0 0    0 !Y:<`V Ph@ 0R0@ UvP @PE Tʠp0 ` Xp 40 d \0 H0 T P @0 <0 80 T0AϠX0d  `Xl0h t P0tXph|\ Vh d00 V`0d0\,@P@ Wd00  W `0<U, d0P00@T d T 0  @D\ U  VD vP 00 000s03_V0S  W w, 0  0 _W00R0SP V" v  0  0 _V00R0S U  W wx+00  000s03_W0S L[A?E0CS 0d   6<>  X00S  0td  &`ZhRL  x\$HPH0S dPKL 0@PL00L0  ^H0Sf \Pd0 DՍ\ \0S  \02  d0D0RH0S `0 dKL 0>LQHP 㪍H L0SH0S\ dKL 0>P`dPKL D T 0 -J@P 0 % L``%PP" XL0`0`O/\ @P` d0D0T\02P`P`@T\{H     0  z  ^*<`V @Pi 0R0@ UP @PE Tp@ d ` Xp \@ H@ T P  P@ P d0D0 < 0 0D 80 0 0D 40 0 0D0 0  `T04Y80<@x0 d0|  |pYR00AϠ0 d@>d0 x6l P0d`Yx olP  Wl 0 W`0,@UP@ Z0  Z `0XXşX%U00 P@T d T0 @DU  WD w 00 000s03_W0S  Z z$ 0  0ğ _Z00R0S P W" wp 0  0 _W00R0S 4U  Z z  00 000s03_Z0S SA?E0CS0d  0 Y00R0Sd0 |d0 xd |0 pNlL 0S y\@H>@<Q H0S dKL 04@PL00L0  ^H0Sj \Pd0 D\ \0S0  \02  d0D0RH0S `0 dKL 0!LQHP ËH L0SH0S\@ _dKL 0PPL D T0dK F@P0 dK> LPPPP" XL0`0`O/\ @P` d0D0T\02P`P`@T\吓H厓@匓 L0 SL0S(KeE.* M0-LM0 0 0@ PK0 -L M0  K -L Ma K -LMp`@ P@D`@0c%T 02 MЍmNA900 M Ѝ 000MЍ -@0LM0S)  0 :900mNA* --LM0 0  K -WMLMp0@P  C/$0 KN?K`5 8 4 0  PKⳀ0YnKⳀSKl0NFK|E E t d5 @PᵘP@$ 0R\ K45 MЍ 0-LM 0KK L0PS46 <6 X6 l6 t6 <6 46 `6 @  0$0%K@3,"00@@ AK01 xB 02 #4xB 024=> 0y|@-*@d4xB 02d @-M$Ѝ@4=> 0TW -LM Kj K -L MK  K,P K -L MK  KP K -QLM@ 0K00#0  *+0p03T0S00#0K -Q00P00LMS 0S1ó0 K` KM Ѝ"g* MЍ/ B[* 0-LM 0@PP d0P8p8 (0P88C -LM 0P`Pp h0~P X0@ <0 0pC=M&"R!" Q\R0"S0Q0 #Rt0 00 R R R L0 000 S S S  R00LЍ -LM(@Pȇ00 -LM0@P 凈P? -LMC0SP S gP  㡩P0t00CS00 Ӥ0"g R r  r 0R#R S3 k0@S0 d0@S0\@2b P  ㍩P  r 000 00T }P  r 000 00 0] kP  r 000 00 [P  r 000 00 KP  r 000 00\ ;P  r 000 00  +P  r 000 0 0 P =Q P@pWyx00#S #W0 S SHP@0 S0˨P0  0 .|Ht!@   0-LMP巨P @P8P4M<P81#8181:P02410!0 < 8#" Ѝ- 0-Y+ ̌!0M0@  0Ѝc*\_* -R00LM?@ D $R D R@00i)0 < 80 00P2@p0 @t 0-T0@40  +T @4 4  z 3Z00S 0T0XSxS@p R 0T  Po 0s 0s 0< 80 0 00D S t8 @!0002 W070c P,\(80 S<@T <0\8  R00@P00S (0 < 80 "00 <0<@8<# 0O<0 8@ @40\00S < K r0< 80 D0S \pG@p @D@<K(K. -RQ3LM@`P :Q P*(W000@@00'@$ 0,` 0(p S,0K80 040 0p /0 R r 1S018K"80`0S/V 0`@ K/ p-0L$M0PQ`0 AߑP P<@Kh 0#20000 Q0 0@0> 0 SWKp4< -LMT0@K`P$0 pᖲ J$ 0R 9 K4  -MLM@lK, l p`wP@ VKAp @ ;$U eXW 0Q . )K V U PUo0 ONK@D@DV  U ᢀpP'@ 'W@lKV ,0 S (K4, 0-@ MPL 00K0 -- LM 0  -PLM\ p` PP@~U  00$ ~  }ʦpl/~\W -LMp `P\処P@ꂦP 0S@W uP ဃP @TP S@ -LM 0 0P|` -LM@P4lJ dJ dJ dJ xJ xJ xJ dJ dJ dJ dJ dJ dJ J xJ dJ dJ dJ xJ xJ xJ dJ dJ dJ dJ dJ dJ xJ J J xJ d R0 0D<4 '0 0 脼Ph*_* -QLM ,0 (@ 0 0 @ 0$0 0 ,KKL*Q* --LM0  0 K/ -PLM `h.3&00 -L MD K -LM`prPP`0 T $r 0@Tr&00` -L M0 㢮 Ky* -L M@0 0 S00@ (0 0$0 00K 0 00 , hz-d0 R r 1S018 K|$0@0Sn-T K/x%/.|B* -R00L MH /@ D H$Q D R@00K& 0< 8 0$3@0 pw 0-W p4  +W0@p40 4@ H | 3\00S 0W0XSxSpH  R 0W  H 40HSQQ ȟ@@ 0d0   0`4PQ 0 R0PH0@ c`0 0@@d0@  < 8 00G S w_ !000Y W070cH0PR\N4@T" 8 V<U < 0R8@T00 P00S %!!<0<@8<# 0QO&8@T<\ <0Q8 R00@P00S %!< 8 " <0<@8<# 0O<0 8@ pD@T \J@ @D<K(K.W*=R*: SMb0  Sc0  Sd0  S  Sl0  Ss0  S-0p0?0 0r0-00w0-0 00!=@S S-0  S ! Sx0S0s00 r0-00w0-0 00 \ \-0  \ 0\x0S0s00r0-00w0-0 00t \ \-0  \ @0\x0T0t0000 00Ѝ 0-LM@P/p Pk%p Tl U` Vp@ ;;;T888sp ** 0-LM@0S8h00S &0S00@Tzh0PP@ 0S@T@ 0S@T00S8//S*oN*M3P3pV V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V W W (W 8W HW XW hV `W A 10=009005001001,0010014#001001Hp0h00\00L00 <00 ,0(00L 0PЍᬨ.0- 0-LMP@20TP8/* -LM`@qP: KPP50z WeVB H 0P˵@P 0@p <0 @0K80 040 8K00 K PP, 0FR 0'/qI@P*#1 0R& 0R"0S H" UPP 1R 1R   1RH pFFK`JPH$K 0-LM@HHA/0"PP PA/o@P B#P@8M Ѝ`-M 0LS\\ 񟗙Z Z <\ d\ |\ \ \ \Q00aQE 7Q 0Q,*$QM  QJ "QR!-QOMQ$ EQI;\Q ArQ# fQ0 nQ bQ<tQ& 3 03:vQ400G00A00000 0 00600 0 0 00"-Q0 ^Q0 0000?Q0000 0A0S010000A0S0001000Ѝ -LM0p`@(K(0  0?P] p] x] ] @@00 PU( K0(P@Pg K -0LR M p`C@-K4K4  C  0 P x^ 8^ L^ x^ T-0[505@ T-0[505@T00ĕPU-K4 K0PT-0[505@T00ĕg(K@-AM@0gS -S0 XS1 +S50oS uS0=#80  0 30100  0301000T 0ЍI@@-gQM@  =Q +Q -QXQ1 oQ uQ, 0R0- 0+\ 00\00  00  00000+T00 -T00 =T000Ѝ -L(M@T! l8@K04K 40 Hl`}l @uP 00 00C S`L  <` P`@ * 0K |00`0S>0S ᤇP! "00hL0U@1:  m@PP <0p%=f0 0Qp0gS aSoS uS ~p'}C~pp+Y -Y=Y h! 0D0=Y0D0 H | 0sS gS# XSoS rSuS :wS xSyIW  W 0 |ꒀIX L U:@  @  ~@P 0f0P@0 D!L `<0  PH +Y00R0D=YSD  L U:@00 @0 ~@Pc @0f D0!PL `< H0X PH L0U:@  @ ~@PE 0f0P@0 D!L `< 0PKXD =YRLD0=Y0 UD0 :@  @  ~@P 0f0P@0 D!L `< 0 PH R$ L0U:@  @ n~@Pᔆ [0f0P@0 D!L `<H0X ]PI H !0S ,SpX+-0S2 `0+S -SXS@0-S0 @ +S0 @XS0 0`T@p\p^p (K -R00LM?`p$RW00`1P0 @t 0-T@ +T@ v 3V00S 0T0XSxS@`P R 0T ``0 00D S t 000 W070 cRQ00\00 R00S,, y"  @Q00 SlW QE (K.G-1M0 `p00B Sn0R  XRxR   P00B@@ S<, Е^ Q r 0D A0a00c ƒ.R`VC  R Q;r9 06 0mC10S%k `k j j $k \)*0Š$\"*0S R<8\0SP R<84 Z ,< $8 #$,, Ѝ. -LMKyP K* -QLMP`pPp`pF00 S@iW1A*-M  S 0S@nЍ@-\QM@  HQ*Q?Q [Q#Q p @3000#"10# Q00S10# Q00S"20# Q00S  0A QSp 2000 "Q \Q@\0000S Q Q# Q> JQ QF& Q*  Q Q>*0\  n00\  r00m0\  b00\  a00\  v00\  t00\  f00\  s0\00 L0 R00000Ε< P   ?Q*Q #Q[Q \0010"#0 000 0@\00M00| `0000  0^  Q?0@00-  00Ѝ. p-LMP`@0 0 S  e0x -LM@pP`T0PEU0 @U 00g0 -LMp@` {PP@  @s`PPj` -LM`8 8!#1 " 0# 0@ @1 K Pp<0 D ]\Q  GQ*Q?Q [Q#Q q 000 <0 Q00S@0 Q00S&20# Q00S   0A QSq !000 "Q  \Q@ Rp#*\00Pp01K XD0pc@ T1K ႹPHXHQ U:8\000 S@1pK08gP0S i(K.*b* M0-LM0 0 0@ PK0$MЍ p-LM`0@PP  200x -LM K6)P Kwt@t* 0-LMP@*00 0@ 99U,0,0 08 -LM K  ) KvtM*=I*E*A*` `      pM L0000 P40 P000Ѝ.x | 0 S0M00Ѝ -@LM $$ R*00 C R00T0SQ00T0S  @-0P`p @M 00000l0P20C^  00C 0Ѝ0S M1>3 01Ѝ p-LM0@S`x  yPP x` Px p-LM0@S`P 0S0?0 P  0 1 x -LM` R*P*0S0]SY`pPhꜚP0Sp@T U?d 0-LM @R#3+ R!*0S*0[S.Q00 PR *0S*0.S0]S00 8 8 -LM@ 0SP* EP &  <P ^000 `0 00Vp(@@ .yP> 0A0 $yP00Q0 1#"0"Q00g y0Q P V001LB"A2A` B,0V 0000@0@00 @o R*0^S00 R*0]S 00 ]00]00]0 -S00 -00-00-00-S [SR: z0:S =Sv 0S0!#L+00-S]SE R*q Ɵ000ujzP0S p@ T #/ 000000Pꢹp @P@ 傀 @  @  gሹ00S R!#+ R*0S*0:S0]S. ] 0S0!#+00-S]S =Y 0000 R!#+ R *0S*0=S0]S00/l pR*0-SQ*0]S -P00W@ @ 0000000SQ*0]S  R*-S0]S  -00-00-00 R*0]S  \0Sb 0 0h@Cp0 t 000 'P 000000@DT Y 00C  0N@@000`00^00  00 00 0C0p 0 0P\ 0 0PWo 0@0S00T0S 0 0 00Q\ \ @T:`0  bB"o.~$. p-L KM0P0^0 0K 00KS0`0K 0@0KP`Kp -LM0` @8P pw 0000 lP #0KP 0]0@ "0K0#pK!0Kn@P 0S04  4K. -LM`RP@p P 0! 000 -LMP\`@ 0 q$0S0$0L0S0L0 Q   fA! B1 0p -LMP`@p0 ST TW0 W000Stꬆ 0 0 0 0 0 @ < Ї 0 0 0 0 0 0  `  f00   fU  f," L B a#  .@0 f|  f8  f" / B a  & HpG`@  f0W  fi5@DpG/@D`vi -LM0 \@0 :P(0^S00  (00(0 ,00,0\Qp0P!#d+0 0|4W$Wk[W! *W .WJW' 4W $W OWwt4W l$WpL00   i)f& a  70D  D 0DP U 1  R *0S*0\S0)S \) x U 1H  r R *0S*0\S0)S00% !<0`CQH0S  U H v L0 H U  - R*0*Q 0 0 hl  h(   h0`  hPSv*\Qt0{Sq00 `R*0,S0S0 *000C SVP \P 0V R *0S *0\S0}S00  R*Q*0\S0}S \ YP R*P*0 S0 SQ 0 0C0 (00(0 0000000 S(Ko1$W (K91)>{} - LM@0 8 R ?U pe +U*U`*$UM (U.U\^U7 [Ud \Ud{Uv |U|HR!#+0D  D 0DP U 1  Z R*0)S ) U 1H  I R*0)S T   ; (00(0 ,00,0D - (00(0 000006 .00P '  "R!#+0<Q0 >Q&  R*000C S  R*P*0E0?US{U0S*000C S0Q0 b+U *U?U' {UzB 0  g  g   g0  g    g0  gT 0  g  g  gn " B ae   `R*0,S00000C S\ VP P 0 R*0}S00  R*0}S  Q* *0B0?RS{R 0S*000C S 0S*P|U 8 U0 S R/*0|S,00 0R    j 0V 4 0   i04 aC0" 40 t4  a  i (Ko0 R (K -0LxMS` 倀0  PPa *)P}@P % 00 0 rP  z 0K0 @ `   P(0 PHPP0|P40 pPP P(P,P0P3S S SS S SP`B B>3!>3S S "S (00(0@0P@P >3S@P }P<@@  >3S BR000S   0>3S SPASQ(00(0d0L0D 0 L0 @0(0KK0S p(KEe -LM \0R @T D0R 000yyy<yhyeE -RL MP` ?R0Spb10S.H00P @0P}y0 000 R r0 11@ppplyNZ@ ,K0 KWsV@,` Xn|Pp,0Vp `d|pX@ 000C 00 0 t00S(~ ,0VKZ@0@`0  f00 `00S$K/` -PLM 0@ 0 @ K0,K0 bP0@,0 (@ ,K --LM0 0 -H0LM@`P4 0hT  /đpl/~u*3q* -L,M@P 0S (Ko8R000 ޱ$P0-0-S*000 P ` p  0 @ 0t@ P`p寫 P0 0S 0S Y0Y 00(K(! -LM@ T00 -(LM"x H!X` P y ht HU -LM0KW2 2R ,0 S 00S20X_ }2n" 890t2 fh (08@"#HH208#X*@ 2 @|r X`k@ T  X\!A 0S1p1 " {P"R<K<Kp00@ $ S9001 1 Q1 0@ 0.00 !@I0 \ ( <@ 30B320 0 R0#@$@X0@@3 Kd/uy`!hfMЍ 0-=PLcM X<PUP+PQ P%] P P P2Pd P P,P GʕPF  P C ;>P6 P1 PP) P="P+ P P "# PPP P2P /P 0P  1P 8P5P 3P  4P9P+\P+[PIP CP @P APFP DP EPBPP  NPMPKP LPXPRPYP ZPqPoPfP dPr. mPlPgP kPx|PvPtPsP 3P }Pj2P 0P 04 040 0DKKPDKpq QpDKKPDKpq} Qpa W0dQo Pm: "|040 0[040 0W4 4K# K0K0 ɐpW PT Q< @ 5@ P UTJ,QA/O4 0 4K( K0K 墐p0 (@K0肐 ?+%@f/K0 UϠ4K0K 4@ 劐p!&040 0 0000 K4K0Ktp   H <  +!+K0i  -L8M\$ p`<@ 幎P @ PU@V@K 02R R @ RV@K 2 ` 2㘭WP  $0 S  K4lx.̂t!h!MЍMЍMЍMЍMЍMЍMЍMЍI* -LM@000@00 0 R10K' -LlM Q 0 000?/0 S @|?P046S \  P  0㌀ 刐 kP0  H YK4 K00KPT O ):**R K46oB`FX 4 000C Q@0a3 A 0a8CnAs`FAX `>k\.\>寵X.X>x@PὰD.D>奵 0l@PGl 0dP l娰 0PlAl l R0h0 l=K1 KPlࠣA h l h 00l0fS0SaBC` U|0 U| E` E^` ` \ x |0l0ll|0 x \  R @R0@0C0 Ő@\ \ \ T H t p d # d 0  `t  p d 0d0 \ ` t p d l 0`V0Ft` p0 `t` 3PH  t\00S/ l^+; NB1`p;K @@ P`lT p  0ҳ"l @bT ; 1 KԴDbP@p` ȴ@PV ph0S :  ェtP00\00S@ P p^  H:墴lp A< 8 t0l80 < ᨯ 0ᐴ 9Y8`^ p@ UA 9 : 0`pOP 1BPd8Qh)1A 0 hV 0HD @o 00@ 0@`PDPD  0< l  0 P 8 D8\S4 t8-`p0 0%  Hȴ@1 0в 0`P8P 8 80@ Z 7@ 7K˲ 0ͥPjʄ K 嬲 0ỦP 0x0S <l P`pꌀK4 l0?Q0Sj t R00Ӭ61 R 6Ƴ 0BP࠳L p @H P 0ᣲ]Ʈ 0᮳ 0b000 0@P$P 86 t Y' 0a 0@PcP<l  0P HXl 00 l 00x9S 000o@Pd0S|PL0  X\00CN@6@cPL  `|` P| `0RS``0|` S 0c` Pc `cxQd R L屨0PL0  T@P TT@ Tx壨PT  `pP \\ ᗨpP d@^00S X 46S $40 S `P` \ R0 01Y 0`` 00 0cS0C` S`0` P`UTᑧPT a `QቧpPZ h R TIPT  PT K T L  PL B l0p0Cl0 t t^)ʐQQ% pP0 t RTP0L0 pH l P 8< L l pH100l00l0 T VL6PL  ZLLH@ P L L V@P L0  ! ?PTPTץL`Ầ@P 0SPTʥP0@ \ U00S Y9T* V1@ V00S YT0S0SUTۦPT ឥP @:T @U9T0{900t'.?aCoc?`(?yPD?@WV?$@@@?@ t0@RC T  APT w PL\  6PL l P P  -PP c L  &PL \ @@ nHPT`0@T@T0  \0SP ,t UPPT = P TdPT 4 'P  H X100l00l0 0x9S 000x0S UL\ P^ ^MLKTI 0lS00 H H(K -LMp3 -LM@ 0 S@B !0 0@0  8 P< @0 4 / pP`0< R0@ 0@s 80Q PP`0 @p ! 00S0  I40 BR0S @ ᔤP5<p4< 0 0P0 ` 0@0s@8 00Q @S0 p ! 00S0  I40 BR0S <(K 02@M Ѝ⛤ - LM@@ 0SᬤP@ 0-LM@PP  0S0U 8 -QLM@< P@0 R 0 0MsP8 < e yꕘ$*`@ P@&@0P  0Q0p <净XJZ p< e║!0 4 4 080 R4  0 R0<`A< ꕗ$*@ Pp@! 0 R0`<0pWV㕖' `ᕖ$8@ P 800 R  0 R04 <00Q 4 8o (KB*(MЍ p-0LDM0PQ`0 rP P\@Kh 0#20000@Q0 00 0 S,Kp4 $# -LMT0@K`P$0 p გ$ 0R  K4$ -MLM@lK, l p`P@ VKAp ;$U eXW 0tQ )K BV U PUo0 ONK@D@DV  U wapPʼ@ W@lKV ,0 S (K4$ 0-@ MPL 00K0j{*w* -0-L MP0U0 @0 0 倦0Q a0=0 q|P@T( ,K K$0K$ @, @P 000(   K0p~8 /* -L MhpPA 0S> ,K hP6,0 R% 0SMR GR KR R kR mR gR`PA`VK $` @ `[F`Q@Pڌ$ Tp$LX`0XX `P0P00(@$K4$@$L@X$t$$ -L M`Q0 8@ 4P `< @0 p8KAp2PņP  P!0,S@嵆P 00K D00S<  @0 0 0W00 (K$$\ -0LM0 Q0  0S0S $S02S P  K0s 00 0 S d K4$p@-PM@0#!P0 "0'0%"*0V#" 0 !0'0%" *0##?0 0 0Q` :Ѝp% -BML,M,ğ@(PK,@ TK @<T0$S0@2SaY bYv0*K0oHPH#K 0$S00@ S 00B S0$S B 0##0J0S0ʠ*KM0?S<0KsK@ 'K` @300S  P 0 1"2*K DQ0D* |PUy 0< 2"10DK0#Tp 0h @R`c 030DKT`  @*K T05K@TpKV`KpPK @TB]K(PEPE@p`K@ g@TTKpP `0# #$# 0PUK 0!_:K0<@K K B K(@@,)&#C00BMK(@D@DYKPK`p  @P 0 @P㗍 0 S K4% -0LM0K0  K0K0  c0`t0l 00PS?@08 PS 0 SvK4,&@B`(% p-0LDMY`K =0P /PŤ@¤T @P T 00=* 0 S BKp4<%:G-0PP%%8%L01%@4a0@,@$ @$$8$Ġ$ 0 q1ß` 00#0 P%P%%8%Ġ% 0 q1ß` 00#0 @$@$$8$Ġ$ 0 q1xß` 00#0 P%P%%8%Ġ% 0 q18ß` 00#0 @$@$$8$Ġ$ 0 q1Ÿ` 00#0 P%P%%8%Ġ% 0 q1Ÿ` 00#0 @$@$$8$Ġ$ 0 q1xŸ` 00#0 P%P%%8%Ġ% 0 q18Ÿ` 00#0 @$@$$8$Ġ$ 0 q1` 00#0 P%P%%8%Ġ% 0 q1` 00#0 @$@$$8$Ġ$ 0 q1x` 00#0 P%P%%8%Ġ% 0 q18` 00#0 @$@$$8$Ġ$ 0 q1` 00#0 P%P%%8%Ġ% 0 q1` 00#0 @$@$$80$l$Ġa0 qA=00. P%P%@$M@PЍ  $(,048<|4G-0PP%%8%L0%1aA=0@,@$ @$$8$Ġ$ 0 q1ß` 00#0 P%P%%8%Ġ% 0 q1ß` 00#0 @$@$$8$Ġ$ 0 q1xß` 00#0 P%P%%8%Ġ% 0 q18ß` 00#0 @$@$$8$Ġ$ 0 q1Ÿ` 00#0 P%P%%8%Ġ% 0 q1Ÿ` 00#0 @$@$$8$Ġ$ 0 q1xŸ` 00#0 P%P%%8%Ġ% 0 q18Ÿ` 00#0 @$@$$8$Ġ$ 0 q1` 00#0 P%P%%8%Ġ% 0 q1` 00#0 @$@$$8$Ġ$ 0 q1x` 00#0 P%P%%8%Ġ% 0 q18` 00#0 @$@$$8$Ġ$ 0 q1` 00#0 P%P%%8%Ġ% 0 q1` 00#0 @$@$$80$l0$Ġa t0 q:0. P%P%@$M@PЍD<840,($   -LM e<&H0@-@MP!\#0  0(^D"ȠЍ0 -(LMZ0p"2K@`.K 0 8#h "V 0AM80 2K40 @4`K8K W8 40 0PU   K4 0 8#H80 T0P`V  `U @(K -LM(j<0 0" x2K@P. K<0 8#X "U 0A]80 2K40 .pKP  4@w 0  40 8@p8 K0 4K80 8 40 0`V . K 4@] 0 . K 40 8@V8 K0 4K80 4 0 8#h80 V0PpW pU`(K -(LMp"h@P08#XU @ -(LMp"h@P08#XU @ -L Mp#0@P`8 Ƞ<̌@04Č00 4 004 ###Ġ""H"T0@P p0h S 0K4 K:(K -L Mp#0@P`8 Ƞ<̌@04Č00 4 004 ###Ġ""H"T0@P p0h S 0K4 K:(K -L Mp`4K/0 0#0P0 8 Ƞ<̌ 04Č 0K 00 4 4 0P-[B["%4""Ġ@0P `0gS:(K - LM@BPC0K4K8 -8<0 400 0 8< 04 40 -0[02[ 000#4 000 010[ 03[ 040#404000 0#0Q@DPEUp  `<8 400 0 8< 04  40 -0[02[ 000#4 000 010[ 03[ 040#4040080 0#0Q(K p-LM`H  PQ$H xh<&HW*@-@M0 0#@\LTЍ 0-LMP@ $K4 E0R$@ 0 0 004003200 $K0 KP0K0T_ - PLMy0 0Q 0S0K010  1  K8A*[=*99*RM 0S0S0  R00Ѝy!*H0M0S 00CS0Ѝ<Ѝ00Ѝ/0M0CS 0Ѝ<00Ѝ 0-\0LM0@S 00CS00PӤ0<P00S8/MЍX_MЍ -LM@>T`p@P  @00#:k0cS:UV@ 0ᠦ`p -LpMoP0p U<0  P'%iP@  %P>0@H0 D@ 8p 8 0 S S*S? +S -S S x 0x0 080 0S,080 @x@ 8 00S| 00XS xS!x@<0K8K@ K@ʔ0S@ Ss SV x < R =PKז<0HKPK@ QC8 080 00S S; | 8 T  t Qt@Ւ4$t@ 00@Q:*080 8/P00@9P0P M0SI RQ 080   @@ 68 @080 0P 10@S 28 T @0P@ 0 PPt0t R  \BSt  0ӓ"t R 0ӓ*@8 080 00@ S00 ᄐ @EPeP:|0 y 8p 8 0+S -S```080 00@ S8 080 0P 10@S8P0@ <,808 /P00@9Pڨ*0e\S 00V0c08p 0XC| R9NP IP4iP nP/8@K$P( 800C 80 P80080 H:D0 08@KוP 800(S P K"PL046D0 P0H0 L0H0 D0 H0x0 8p DX``Q0it X0 Լ VH D 891H C @ PǼ 0ԣH D X,ȝP)X@T T8HK؄1 PhX0\ʤHHK1 X 0eA H D X0s`(X@0##HK ǣX0f @TW  8HK1 ʤH D 0 MSl p h d (8D0 0H0 lQ <mpkhilgde꘧CbpH@K0p` 衤@PV!H@ DP D056CD0 87HK1 菤H D D\'7 R6CR7 D0 560@ H0 @ D0 RO@d  6HK1 _H D DbB V60␦j0p0 H@K0` ]@PV pʈH@ DP \ Dh60#:kcQQ04QH0 A0276D0 H0 1H0 HK 0P l p h d 0@H0 D@ m `5T t0!Pl Y d h l0Pp S l@  ! ԙHK0 K40KP< D 5Ph ? X00\X `4 ࠣSc00CD0aS6b ` $ cRb0 B"00`0 ` @0` @T00 S 0S p pc@c`c^ h5Ph  <堘PP <rS\ < 00`Ws80V:\ <0000D b(KM. ".Q  .RA Aa0A \.\A Aa0ARS 00A S  RS 00A-Q S _Q  QЍ0M*S0.S S ЍЍ-0MS]S.R00 S Q\R !R!0B.RЍЍM]R0S! CЍ0MЍ0 <8MЍ <M 0Ѝ <0 Ġ 8M0Ѝ M0ЍSG-HM@pP0 #2b P"3 UpG1?7 (1 L0LLLWW& 0 00000 R0 S` h.22 1 W00&#!0=00=00P U03107:Ѝ6 -`LM@pPUq ("000L=QN uP| UC  $ x T P< Vp*1 P0c104T Vf*!0 bB2 Q05:PX` PT VQ*P!0 bB1 Q05:PC`P T V<*0 0c  `PQ/ U-||  0000r 0  PR=R  r 0  PRTV*0SU `.6 p-LM`"PPp@0S@ ?PT  0Rxxd* 0-LM@P PU0. @ W@P0/S P /U l0@P  Q0r/S0Pa U:@?00@ X008X 瑩* -dp(㗘#MLMh7 H1`0Pd ,0 .2$0SKNuK NAAP  Br>`؄PQ0  唓00 0Sd7S 0SPUpP0"$#PUhG ,0 Se(KX40K7 -dp(㗘#MLMh4 H1`0Pd ,0 .2$0SBKNEK NAA0  B;`_0Q0  200 㝔0Sd4S 0SPUpP0"$#PUhD ,0 S(KX40K7(MЍ)٭*lխ*0 M!Ѝ -LM@R$  ,  `0A XK00C 1 儠K─K0 h!0!S @PSpP P " ! 00P P L00L0 60[S0 60KQ Q , 1L0 0, L0 *x00x0 00 0 \3 K0 R KN KJ,K F KB K> K: K6 K2Tȓ A p ! # T *!R00K [r d000 1S R@00 ӑ KW [R 00 ӑ K0[0K LP  0[ S S00%L0   , P  up0ST!X0S K ЬK ̬K ȬK ĬK K 㼬K 㸬K 㴬K 㰬1S 1S ԑ0T4P@!TU!R 10 qQ P@p ,0 S((K4~h.x | x%$7M 0ЍXz* MЍ9t,@ 0-0L0M0P0 @ DK<00<0 D KQ Q QT L@t00 0 ShK04t,t,t,476C*P0M00ӑЍx P0M00ӑЍ|  -Q0LM0P p3D; -0CLsM@00 `V_ |1R 0R 10CRG@P! T*0S TG  00P@0PS> 0VS+검VX7 0 pSY@0U 0@ S 1Pp0 SU0Sp#@UpPh0U W 0VS ` TPF:0Vs3(K?*!: -]M0P P0ЍM00P  R*Ѝ p-LM @R 0`QX`FvPX000SP 0XP0UX00x -LMPq0  |   x00  x!`pHA0S PX 0  0S 0S0X@V`@X@X @ qPP  pR 0S '0SpZ 0p =  YPP  `R 0S &0S`ZZ`0 0 0l 0  R:0 0F@0l@l[AP<  0 0l ㈎ 001  0 0S00 c0@00O[`P 0 (P 3X0 0a0 @0A 0  01S @V  (K -MLMğ  ` ,  P8 @T g@ 0  (0 S00:p/0@@0BNK@D@D+P 0K@A ((sP 0* 0U/S' 8: S S!BNK@D@D+P 0K@A ,@P 8: S0 S/ 000>K(0Cp   R0B0S/S@@Q P PU0E0/S |(U@'@K0@S@L+㋐+  0K@@@ $P0Sm B^KPEPE+BPb@0PY 0VW 0p@ ! ( = 0  d0S00p0/ 00 10.S0.S%@ 8T*0 S0 T:p @0{P  D8` pP (P 0@  ppp ,0 S(K4DMp?T; -LM:K(M850,0 K0~P04 <$] 0 Z K@@8$BK^L`P L@0A@ Q p 0S /S000S3qP0qP!NBKLK (ALA B;c BKLKK @(AL@A B;0P 0FV 0`SQ*0S0.K B0 B0K8$nK0`FK`FP44@d?WPu [W *W0u@!TP0S  ]1P!TpPEr!T#@ @ P[Z:0:S7`:P1 0]S.0fds 0RR Q*0S p`V ß0l10 0᳠[Z@P0 0 ]Z 0 00-S 0]S Ÿ 00P@0]S 0h< 0` 0P"< 0 K 0@< V 0 V 2R 20pWp2p(K0S KBKLNL N KKP(@AK@ A< 0 PTK4 0P < SH*K8<$0B P?K4Ipl - @HX`P2 AP 000000P  0W 00 00@QPlU K40 `0= ,0 S@(K4*[! :-]?**/,/\; -MLM0@{S0}S0Sv {Pn >K0C0C@@C@Tp0 @P` [S   0]SSSP {S` }SVゞKIIB `FP0SK@@>0[S ,S2{S }S-   0]SSS@ `V`FV0 CQ 0:0S0 P  00 @T (K -LPMh0K`p@00< 0ph P@ Q< R9q7 r5 10aR1  K0\`2KS   0R\S0@0Q09 B0LP*0 S L000 KK  Kd;MЍlMЍlۦ*p 0 M00Ѝ.p 0 M00Ѝ. P PMЍp 0 M00 Ѝ.p 0 M00Ѝ.p 0 M00Ѝ.p 0 M00Ѝ.p 0 M00Ѝ.p 0 M00Ѝ.p 0 M00Ѝ.p 0 M00Ѝ.p 0 M00DЍ.MPЍMЍM @ЍM Ѝ$0PM0Ѝ1,Ѝ- -LM@QM ЍЍ -LM@P MЍMЍMЍMЍMЍMЍMЍMЍMЍMЍMЍMЍ -T0LM`pNP @kP@> 0P U-PMЍ0Ѝ -QLM@ h00 -h0LMPpT<Sa N@`kP @>0 2 `V- 0-,0LM@P`<SB 8h- 0-00LM@PT<S2 8h--pM p00,,0 ^0 S: R 0n 0\ B 0R2Ѝ- 0-LM@P8[kP(008SkP008<-<-QM R P000SЍMЍ 0-PLMP@   01S S  R 0^0 T0 0 ^  RR11:008-PM Ѝ0S1 P P10:00Ѝ -PLM QT0 0 M QA 0SbЍPM 0s3Ѝ -LM0S 0P ) 6;AS00?Q T00Q Q@T0Q@@ 0lA?0 B<R<00  -LM@\p0+QpT RN \P %WPA0  P 0S 0S0 [ 0S0 X ZT00(0 P|3R`1`!0S?0\:\0l) P6;@ S:P0WP0謨 -LMPP`&RZ 0S00S)0 R  d 0wpD pB P@ @@pT:6SR 0S00Sp@"T00#  00S d 0Dp00 p00 P @pT X1:00 -LM`P4 80  P00LXP=@Pp0K0QQ=  pP6 P@4 T/00SS0&Y p@  0K@t0K 0P0 T P804 q ZU1e@:0 10(K0 0h<40B.΀T<(0  MX,\`00 c]0   0| ;BKJJLT `0SaP &P #0 Sp1KH4 0D4 1A84  0@d 0@S/ L$ P$1!S 0 c@] P40T$BNK@D@D`PL$R Z 0W0SS00 ,0 S,G(K4dDM==2x< 0M ЍA X --0LM00  00  0  0S10 c] 00 00 0  0S0 0 S  K4< --0LM00  00  0  0S10 c] 0000 0  0S0 00  0 S dž K4< --0LM00  00  0  0S10 c] 0000 0  0S000  0 S K4 X< - PLMP@0$KtEpP3  `P- R $00R n@00"R@P 8#$0 <0$0 ׽ ҽ 40P$0,0@,0$0(0 0 0@K `P 0-LM,@0PS20@S4@8/ -LMPQ`PPdp0S0 R r A0t03U0SQ0@S @/e*RM 0S0 0A R RЍџ*; -LM`P @0S 3pP PUP CP -LM 0Pd\_ 0-LMPP C00@M@@M @@8MЍ\_ -L M0`SPPWDP 0K4KC@P 4 R 0#S S 00S# S0B40 4 0DP0d40 4'PPPk 4 40GP@@0 S SPP h GpPP  G00S ?R0Sp 0SNOP PW@Pp)+ S S@" 0@1U ZDP.@h* @00000c0P@LFP p@T 0S0 0 (K$=?/ -LMV0P\_p 0-LM0@SP$$C*D 00 08$=?MЍ\_ -LaM ``0 pP@P@T i-A \00 c 1   ^@P(K -L MDCDß`8 < 4 =@ D0 dPpfp0@P0H0 0 * dP"P " 0Q0W0Sz  H R @0 0R 0R 0S 0 P@T00P00S 20Sm <0:Si  'dzO @ X B R00S 10S <0:S 0|!S 00<00-0BS QP1 R408!,1 10S410S000S <0:S0 S 0000  B < 0:S:?0S 4p0 L d00S <0:S\H0? D R0 S(K- .-p==.p_== -LMR0 4 80 m E0S5  0 s 50S }eP -R d50S+RL-R+R0S858%00,% u0< 0S %00S`04V4$P4u0D @40 0@d0d0@t@0|$`0[40lA@-QPU+HcP'<44,$Q0 4 `@  Pu` @t  40[0 e0b#0000003pw #0s`U l-U0SL0S@H3 t0  4010 g0b00`0"8Q# 204 1R -Q 00:Q bP48 08p`N\rP@`:V@ -V0SbP-V0Sw 0S!00010S 0:S1`?`e8 0R0WV0S" 0;S0Sh!000S4010d1 X1R0248 0`$!1 ;0:S 0S4 000/000S@0:S 000S04 100 0S0  0:S@p0`0:S:`?`(D 80  `(K-.t_8p_.. .-4=.L= -L Mm K -L Mb K -L M 0W K --LM00  K 0-@0LM@P ,,_9T   8hpl/~-p0M0S 0 CR 0R0 SЍSЍ:00Ѝ/ 0-LM0@P 0SO:P 0 00 R r 1S010 CR 0R0 S 0  08h8 p-LM<`0PS@0PSx/ 0-LM0 @RP r 1S010   0S9P vP 000 bPNP0 0CP0P0S  0 U00S lNP P8 -pLMP 20SM 20S:0 R r 1S01010S.d =NP0000000P1 p0S%@0P sKP 00/0;0B0 3A03@03  #@`P @ ~00@`0 00 0B0B0000 0Q0 R0RS0B0 0@0< 800 00B0 B00S`/ -LM@P >00| p-LpM`@T ? lK⃚PP D @0  0: S O0 0 M? P Kp|("? -AMLMt3B~KpG0`c,0 pGIJP3P Y@P <BPPC, P 0#S    P@ Q`P  @K`2PŸ P 1 0DT` P 1 p04S|0 P 0#S    P @ @@P 1 A0DT| P 1 204St + Y 4 Q@0EP'_P0  _P0  _P0  _Ph0 _PP< d ^@T4 ,0 SD(K4||/D@=>>؟ = 0-LM@P _P8PP8 0-LM@P o_P8PP8 -80LM0SP P |@-PMP 0 S \S@0 0SS0D0@SЍ MЍ** p-01L8MPPKA 7 K$ KH 0 ۘ덴p@ P $K И- $Kʘ0 PK)㈘4 K㻘@ Kⷘ(`K pP0S $K 㫘4K 㣘@K 㟘u(Kp> X2;齃*M0Ѝ*7*T*k* -RLM$ 0 0 -LM@@ET p-LM PR @T@E <0SE$0``PEEEvP Ps@o@x -LM$0`pPPfHP@ 0(P004$0@L0000H0 L{ 0-LM @<Q*E00:?0 0 HPPP E P8 -LpM$s`Pc`LP0pKHp @  0P  0PP 0PC  0yP 00l ㋗ 010  P%L 4,00.R80M0S L040. S  ,0S00S40\0   <0S0 P 0  P000 K -LpM$@pP(R`8`PP K⁗PP4 0R, 0R0 0R P00 PW@@K -LM0PR`p ( <@P@D@@0P0 0p 0^10 -L4M\ `)P \ Rs04B00 0w\ R0@0  $ 0S 0@ <0  8 00 c@  < @0\ @S@R  0X H0 L0  0 XP0L H0  X  00404L YH $000S/S$0L 0/  4 <0sD0 D 0 D ZP 0  piP 0 T 8 $0  0.S0S 040. S  `PP Q%: pyP @D0 04$0 :0 $0@ W $0 04  80 8 0piD0<00000 S$0*C0  $$0 :0 $0?00L0S @ R 04 0L 40 04@ R <0S P P $0 0L00$!$0L  0( 0 49 0 0'@0Sڰ$0B8RS@  B@ 00  ST00P PP TP  P @PVfQ00c00 RL00  Q00c000S0 <0LS$0 0P RY400C40 4 00H0S# \ P0SR<0S $0tP 03PP  $$0 :0 $0P0SX R00 04 0P SR0(KoJ000  #8 R 0(Kt\ -pQ00 W@@LMTP 0 0:`@$0 3D T 0 T-P W$0p:$0<0pS00/S $0` : X@P/P ᡽ ᝽ DM 0-LM@P{UP10@S8 -LM`pV $0*0Q40%Q4 0C8S 0P$0ķP4֡ 04ơ20 $04SFQ $@ 4 0R 4 BP s0004P   :$0f000S  0DP 4 04  000 R P$0  `00Q0`V] 0B<0S($0@MP$0`( L$  妑/g)P P0S @"{P ┑(P04 00 :4S S 0}P$0 )P4֡ 04ơ0 $0040$  0R/S@/00(  L] PA<0sAw``60$ `<0S$0$4 $0  P ]@ Y@ z   L0P $0P:$00`S004P`DMt\ -0L M@p / 04 0|(.DPP4P v 4P p40$@4 0$0  P @P_ PW 0`<0(izP00F @P@ L000<0$  0P $W``Vp00`@0` 0@  ATWY L` aP `0 $$0dLP$00$0Y  A AAA040 4(K謨DM p-LMXP0@S$0` 0@0S$0S$@xh豻/MЍ f**b* -LpMKpR`P'0: S qP00(CP PZ80@100CP @P 0@p$`0 @``0@PK 0-LM@°pP  00R00S 7P 00PP 04F  㡰8 0-LM㥵p@P PP7 8-SM " 0\0  0\0 Ѝ -LM`Pp@P PP@@ PP@@ -L` M <0 0f8 D H0 D R0V000  0 80S'# f f40 @ 00S 00  00@ @p@0TP< P40Z* @ p8 0R㖃' (R0B▃*8 1<0P  <0d{ d p<0 eu <0op00S 00  00L8 @0B▃*p P 00S 00  009p@T/< Pf 00S 00   00  fH  0TP<0P4 00  00Pf0hpgS08S㖉) c00 0j PefQ!Q 00 aWT <0$U J e8 (0 R (K -0LM`P0p R p  :P   @!R  000lR0 0  0  00@ 0-LM8P0@S$K0S$K0/cz*?v* 0-LMP$K%cPU$0K$KK0 -@RL0(M0Q 0\ 0  h        0T0p0S00K>$> -Q0L M4 0R004 000 040`0S+ Pp @0WP 㕒"0S %WP pt0 2"0S Z0 00 X0 00PU0K3`P(KX>? -LMP A@P` |` ᨀ,pP 0Rp„S0C \0 ^00\>@-@MP 0SS 00B SЍ7* -LMP0A Q@"` p0 0 B0&&P00R00S 0/S9SV00 V0S` 0-LMPPdEA`88 -LM`Avp  ^!PPP0U`VP -SLM`8  -= = = Kq 0000 00 r ̟00088 8 %Q 8 P  ]P8080 %0AUS  (̍xl8dHŤll((̍T̍$|pX00 Q00 > UPU 0ʟ (U00#U00U0|0U0h0U0T0 0, 0~ 0 -P0 Us4P )1@u0p i P Au _ P0 40 4PUUR P 00 0'UJ4P <ɟ0h@u0p @ P 8@u 6 P0 40 4P U U) P 00 000  0K4Kc0jP 4 d0d8 0K  0[P  00U 0K0U0K 0U0K 7>P 00C0000r 0K;00K 0(P 00C000UXp@C 0C000z a0Kc0PZNU0@ ~TP0$(P00 h rTPT0$00 (C 0C0!000x1@S 0v~ p d㩋P㣋p3 0S\10 2) 00C0040 0!4 004 0R0 0% PG@{G@w@@erP0000 c 0 S 1X0 00(Kl..0@<@H@P@\@n'..//???M0Ѝό* -LM @0`RpP0.0S:00S `0R00""00 0V:00PB! !P 0MЍ .MЍ -LM$0!  0-LM$@P9P9$9P98h9 p-LM$`4PK@.0\\P \P 00000S4KKp -L@M$@ 0PR/ 0`00dpKH` 8` 0LK\ P 4K]40L0 d` `0 Pd@K0LKd0 `00S$K -LwM |2 0(, 2 <P`J }<PP`f9`A(1(! 0$P@ 0@rK]~K 0 oK . ء ԑ >\KP 100@J<P oK koM 10S~K%9#9` ,0 Sq(K4$.`dB -0LbM0K 0 dp" @!@KWpQ^K`TP|00 PNK0 0 ^0 K@g 0 SqK4 .tB -LM`Z$P@K 0[P 800 @[pP@ |[p$K+>*:*O6* -LM   K 0K Rp K 0-L MP@]P  ~_P B]P  =]P , 0PK0 -LMp`@P P U@P -LMP`@)]P7 pWEW0S,T0S S &W$ P=;P@  hP`0`0VU @#3P:0S8`` M ЍMЍM Ѝ`2MPld\TLD<4,$ |xtplhd`\ X TPLHD@ЍBBBBBC0C\C|CCCCDJD4D -LpMK@RP`  : SH  l0S4   3KDDE E -LMP: P -LM@P u7s7q7hn7 -L$M@ Q< D0 R pp mp4 @jp4 @0pB@@0iPI80 L >0\S+ $S7 ^S! ~S2Z0 D @0RT 0T:S(0`/SSP"  OP 0/SSL @ PZP0SPE0S  E@P@ 0/S7SP@8 T::PH 0 @@pP\U8 $U%^U, ~UZ D0@S T 0T:Sy0`/SS  OPn 0/SSj @  o4 bpcZ_  oi pZ0 SPRR0 SN RSG CS( 0SD:7SP#BS=-FS4 NS/ ES6eS bS! cS TSnS! fS' rS! tS"@P @:P0QQ00C Q 0/S7S@P @ P @ P@ P@ PP@PH@80Tj:H00@0  <]@0^6(K -L,MD @0 D0`@@  0000PpDp @ PV DX@YDP @`  0"0S@00T TpN %0 @Tp  pG DKP %0 @Pp T0I0 Sڻ D @ @e0DK as#0"S 4 0D(4444@P(K. 0| t0p h0d @P00p40 40Sc3@P(K@K0   0LK04@K0 |  0lK0*x t K&P0 80 00 pW> @P 00 Pd   @P 0@0'  P  0 P 0  P @  P x0 : P3 Tp K,P2p@p0P#0,S \S S 0 ,S@Up =IPp 0PP p 1u P@T:p1> 0p0 P= dp KP84PPHp: R \R R 0 S S S0 S S  00 R  0]@p00tbA=pP ,0 S`Zi(K4lDFF$G,GPGlG<GGGGGGHHd5dKKN0CBK 0CL|8 LN B;` Tx ( X8 d\  (P U%HfPD%0S@ d  0QZP7 h< g8 ( 0 p P D8 R@ <8 @80C88 Rppj.zgPv1`P-  dP.`(\8`!T%Pd o P |xHx PPH(W:|+d86P\ğ0Sd02@ d@P(Rd$T*).|8H p0 SU 0U@E\S 0X@ U:;Pfi1P .P^ d$0fP@`XX d @T0#SS hPl(R PP0:S@lFP@T80T8 T0S+.K B0 B0CL p( t8 x = HpPm @0S :S@DxptT(d8PPP uP(Rd@$-psU u0:DL8 DLX 4 0S :S08 i b0( 4 00SPG:S:08008 0(0ecX(0hZX;0f p0Ps-P^d$ 'f0f fpPXx `0H a@|40(| Y- DP(Rd#X8f`S0A0 0P`D-p 00 L\(p^p`7-Ypp ,0 S,e(K4HD.?/HH -MLM,30(ß,0 $3$C0 <8 3R048 0@ S0m$P 2X "0S00f  0P BnK`F`F⌢{8h PP8Q(: +0P`8 P"0S00#3@ @P@Teb#1 @00P@Z )$PS8(0 S8( U0U E\S 0U:;@h0P= 0hpP000S#S 8(81f/0$1 h 1 !NK@D@D Pbࠟ(K0pxC0`KA PA@0px@T 0$@l 40PS H0<( [,T$ P,0 S,d(K4?/HH 0-LM@P8h -LM 0  K3 K 0-LM,@0PS0@S8/ 0-LM,@0PS0@S$8/ -RQ3LMP@ :Q |P*W000@00R O @10S0 R r 1S010pS000 P$PU  $Ppʸ00Ss ea0009%Pp`e t00Sb f | `(V  a 0f0 0 0SJ/ p-LM(0`S<@0P0-00S.H10 P@0  0(p@Pq 0 00 0@T_S <0@T_ R 00c@_00Sx/ -LMQpW0 0 }* -LHMX@K 0K Y PK -LMP0P :4 80 @CP> `P0K0 00pZS00@ % *,CPP 000S8   41S  RRR4080@T 0S(K -MLM8 0( t8 t3\0(P,0 x | 0X 4X @P|8@0H @R낎KH H/48S  4 (|(`V 0X  1 S0q03R0SQ p@ x;CP@t(U@࣡0a08 PSP4\X00 S KB.KA BxA B;8 V`PDB0SPwK@@0h(pn h<!PP@ @nK`FH`Fp) BP p B0PY00CS00Ӥ0c PN pL p @BPDt (0@P P t T@<$PjPKt0C(0C8hp@ @<)8)@Q08(0@ ,0 S$b(K4H II?$IH -LM0 @R r 1S01>#P0 0C0  -p-1L]M0PC/0 `>KJK\1 0Q ,Q @{ 0K 0 K,P |  0 cKx1 1 4 bp@ 1P|,P|)00|1 * 00@ 0 SbKp4B4I -LM@QP00J,10S0 R r 1S01D p00S"P W)0P+ '0`X@1@!   0P d  @f 0d  `_00 0 d0X_pX0000S / M-L(M\PK0p@0L0 0 X0 WP`'0K <00PT` 0SPQ0"S XWuv0"S V U@@@@ R( K1(0 0l( K1T$0P`0(K@I -R00L MH /@ D H$Q D R@00L 0< 8 0(3@0 pw 0-W p4  +W0@p40 4@ H | 3\00S 0W0XSxSpH  R 0W  H 40HSQQ ȟ@@ 00   0<`4PQ 0 R0PH0@ c`0 0@@d0@  < 8 00G S w` !000Z W070cH0PS\O4@T# 8 V<U < 0R8@T00 P00S !"<0<@8<# 0QO&8@T<\ <0Q8 R00@P00S !< 8 " <0<@8<# 0O<0 8@ pD@T \J@ @D<K(K. p-QLM@P`p`S@rP$K 0;V $0K0s@$0 @ $KKp p-`LMD@`0PS P@0S x x|_ -LM   K0K Ap K -LTMP`h  0S `0v03@P0S0S v`0x03@P0Sx Xv P0 d0 0P `00U ,0  xh2&P@Txx_ -GMLM50p ,0 Up@V p¿0#S Kߠ]X5P0s SD5@  `0S0@%T5@4ZP00pDT+ 0S4`%>P `Vl(P 0\00`h0KAEKt N C.KtF>K B0C$ $ 4 BN8 B4t x |$ $0CNA B4  $ h@T8pp#3pR] P:X %՚p@" 'pPA0#S 0`4 t4 l4 ht d x`4h$0P QhPMXJfh00S{P<@K wŸp x4K\@0C\\4H AP`zh@ \ p` X\ 00`Z `  ,0 SPb](K4HL.x_III,bH.IIIMЍtP0MЍITJ -0L M @ R R R0ᓗ0 Pa\xh h0 \ R@0@0@ 4\( 0000K,bpJITJJJ -LMhcl/ 0-LM0@$K$ R10t![p PLH1$ PL`R5|| \ 0 [p P# @`R01S 0 [ |  0[pP,T,\PD@ [K0ITJJJ4JJJ Kx%4K -LMhl/P0 !MЍITJl/0(0MЍ -LM0P00MЍ0@-QM@ Q QP0P0P0PЍ0 0-LM@P0S pST00SPy#8hv# -LLM` l p~&PDB 0000hr&PPB 0000x0S l 0G@PJ#H#k04,"400S0 JjGP P0 PA 00ּ00pD "00@0@@8K^G8DP`` lh 04 X \ d@ FhKdEP0S! ѝT0T0L0Sld0T0(DP 0@ 00厼00"" (K,b,P. -LXMP` t  x0 Q40d pP`l0 p   R0d R0h0 4 P0K| 0 P ( l 00C,̠Čl 0("Č#D8MЍ7D 0-LM@P P  P 8h8M@ ЍDM@ ЍD 0-LM@P&P P  8h8 M;ЍE 0-LM@P P 8h8 M;ЍDMЍCM P              ЍP#p* -0LM@P$0  0S 0 S =S00SR '0 0 $0!0S0,pPd$`K 7P K X -0LM,0 0= S S00SR 00>Pj,@K  7P ,0 `@,  ,0!0S0  z7P 00pW0bdCQ @P <`0S!IS1@@ 0p $K X -0LM`P@00 <  0S 0 S =S00SR 0 0[<fU 8 0 K+7P T00K @Q04@K40  40!0S0  7P0 00Y0bpCQ @P) 0S!R1@@0P 8p 0P@P 00! 0S0 =S=00<0S< 0 (K X`o*GϠ o*o*o*0@-LMP@P 0 0S 0Q0cЍ0Mp@-`RMP@ L 00S0\0cR ^ЍpM -R00LM?@ D $R D R@00ٵ0 < 80 00P2@p0 @t 0-T0@40  +T @4 4  z 3Z00S 0T0XSxS@p R 0T  Po 0e 0g 0< 80 0 00D S t8 @!0002 W070c P,\(80 S<@T <0\8  R00@P00S k0 < 80 "00 <0<@8<# 0O<0 8@ @40\00S < K r0< 80 D0S \pG@p @D@<K(K. -LM/ K -LMKy/K K0P M 0ЍMЍR.0MЍQ. -LM0  R K. --LM0 0 K 0P M 0Ѝ.<m* -LM@$ym@P0 @y. -LMp`y@T xP mP00 @ťPyɴ@*T V*(y"GQ y. 0-LMX! 0PyPᩴ!@PP@T00P8  p-LM`P @T0. @S@P 0/S @P0/SP|0/T/ . @  @P0/S 0fP U:d@?00@ P00x8 -0L4M`p8KP K@P8@ 4P ,` (p 00 $0 P <0S D0K 0@D0 @@ DKEm*U m* --LM00  K p-LM@PP0` HHh T  ,!\, k =R xhX pl/~\W -LMpPP`@2P @`V00MЍ. -0L(MH0 0 D0 080 @ < 4 HpK0`KP 0PPH4p 8 00S g@P0 . PP84p0 S #0jpP 0Q@ `00SPPZ `@ 0  (K_l* -2MLMD4@0TP,0 `n`0jV  ,  P 0`< 0/S0000S BK@@+Rp@P ,R `d+RlRBK@@+Rp,#XW00< >K0C< >K,BK0C0CI B< I0F, < /2P PP"@iT  O( K0Z (Cpd  h,0 /S \2Xm/00  ,8[Sr (1Pm 1@P Xf<@/0f@]+R!PIKAs4@P ̲0STZRƲ<0U<: SA, R>01L!PP>( K0LC,<[/S@ X<@/D0@fZ ( K?1 0 @?Rp0@`P@Pl@  F@@P?0S@@:  eoF -0L M0P@ 0 (`K  !>@Tx ~op` 0 P Qn/B(K 0 SIK4NNN 0-LMP@!1 1 !320QH8h10@-RM@P \4, 0L 0l51@PЍ0 --LM0 0 -LM@PpĩT0` LLT  0Q0$G  (pl/~\W --LM0 0 Q K 0-LM @Hx0 0$ S 0K,0 0(0 0 R r 1S01,K 0P0SzK0/ -L M0S@ 0 0SP a 0 0 0p Wp  W 1+#,Pp`00`S0 040 00 dWp 0B<B S0S*0P`` 0PU:P 0 0b00P0P  UP! E0 0e P0 #0PW  E000P o W:,PP e vE0 0g 0 P00eS0[ pe0p40 W 40S   {P00h000 040  0`0V`!PP00V0S  @E000P $V ,PP  +E0 0f 0 P000S00 P4 00eS0 pe0 @00 (K 0-0LM0@S 0P,  00P @0P00P0 $000 0000S0B< S 0  0 0c0 800088`0MS  0S0 0S Ѝ PM Q 10C0 Ѝ -LMQp' %R`@@PU@ UP@  P 0Pg0 B T:00 -LMQPp R`@@ P 0S0B e0@T:00 0-LMP @FD8 0-PLM @:D8 -LR0L0M@@P T@ lR0  0 R B0 0 &` -0LMS00 P@0Y.0D0TST' T%0 `^Ppp``UVZ W@@ W G00 _@0 0  00`(K*`*&`* -LM@0Sp 5P-0Q 0 *P!w 000P0 0P 4`4P4协  @R00PLT>_*{_*MЍG -0L@MH0 0 D0 0X 80 ` @ < 4 HK0pK` 0```'p@z 0Q X~PP}  0``O'p@Ŧ0XP S !XP X00Pp`N0SI0 S SD 00`@ 0` R000 0 Pp0V. @T 0夀' 0 X2 0S000R`  R ` X< R000\RP P \p`0 Q:00S`@@X0 P\ X  ^\0Xp`PPP T 0S0 S3 S 00 PPᶠ0@0 PB0P  ` B0S0@@@@P 0 B 0R #P0 B`00T QZP RL u^ 0LG T0 0 0  \0 0S0  P  PP 00S5 0S0@@U U U ` `Q \^ ``  JB`P U00L0p00X 0Wk: \0HS:00\ ` `0@@\ (K0@-RM@P \4, 0L 0lRQ@PЍ0Rc^* -H0LM@T 0@S@ 0 \X -L MXAP LLPpPJ   4P ~P/ ` 0P 4@0/S4@PP U _P ` 0K4K@px@4| 01 `4r DPA0`Fk @DV0e `(K\N?O. -LM0X -LM(@0S0P00X0M Ѝ -L MP4 P֫YXפ0.0S00 Rr 1S010SP 0@ p8 D4dP0 000c``Z10j RW00/ p0@TT@0D 0#1#2#4#8@=P @ A0 0f Q X00S~W P000@0000Sn(K/-M 0 S S@nЍ 0-LMPC@ 0P@ @@8'']*#]*6 -LM` P@0SV (#P 3pP @TP @ -LM 0 0P`|` 0-LMPP 00@R @@N @@8MЍ|` -L M0`SpP 0K4K@P 4 R 0#S S 00S# S0B40 4 {P0d40 4r PPz 4 M@40gP@@0 S SPP XP P  a00S ?R0S`1P8#8 $#$(@"( @0S  P PP,P/ 00@% S S@! 0@1U Pi@Xe @00000c0P@H@P T 0S0 0 (K$O?/4O -LME0P|`p 0-LM0@SP$$d 00 08$O?MЍ|` 0-LM0@SP 00400S0 R r0 110 0PS PP೼0A 00P @0P: 0 00DP 3 0D0000000Sש8/ 0-LMH0@SP:8Dq PDHP8 -1LM0S@ᰩ0 R r 1S010SwPH  OP Pe0 :0 a100P`PP f-D?TP `,P 0`cpPD >0P0f00PD0P0DPS _ 00SY00P/RM 0S@  RЍ p-LMP K2`P@' @P$   }0P00ı@ S00M'@000L0`$0D0@,0<0(080 0 0 0 Kp `P 0-LM0PrS wS aS<? 0@00eR8 xR +R ; R 008 p-RQ3LMP@`:Q "YP:xhn 00x -LM @(00S0`0000/ 0-LM4P0@S㚨0`000S 8h蘨8/ -L|M@T P ( R  0Nu0SvZ ZG ZE : 0 PP` 0  pP`q0S  ] 0 00 0PUoS <0PUo R 00cPo K  0 0 40S63 00P`0S 30S 3\ 08CJKYP0: S 0;00D ;L 0ZpK KYPTpK K pY0 P  0 pqz 00 0PPoS <0PUo000 S 80<0b q/ 00bU 0R60#0Q  P`VU0 ab00 0P @0P0 000 00+L00cPo 0 pq# 00  P @0P000PW 00 MP R :0 e00 00S0 o- P K 0 pq00S Y00P @0P0 000 0P080$0S B  (K`/`0M/Ѝ 0-1LM0@Sb 0 P0X 000@0D ) PG0P00P00000P @0PS00P<0S0 80080Sf 0 90Z 088  R0  $0X P  8 0080@000088`$h0M 0 SЍ Ѝ p-LpM0@8CP`JKXP00 ; 04  Q00R0 ;0  Q L ( 0R   Kp` p-L M0@ C 00  K$ K` P0C0  0$0 S P PP000Kp -LM uM SB0SPЍ -R00LM?`$RZ100~2p0 Pu 0-UP  +U000 P 0  v 3V00S 0U0XSxSP`p R 0U ``00SAALVbV0 @R Xf@h 00E S u4 000. W070 cR(Q$00S \ 00R00S b ʞ"  \00R00S,, "00PZ QG (K. &3 >MbЍ -@LM%  ;&H900D9 -LMD9@SD9 H 0D9 -0LdM0`P 0 }0p4@K =x@ | n<0 m<=0t H@Kp =0l h0 0d0 `P =V\ X@ T`  0P S<=T <0K P0 0L0 IpV4pP X@x% -L LMQ080 000 0 BS 孎, 00P / -LM` 0PSp R 1S @@bc00  Rt000C Tv:#:3 201 32 gPPPP -LM0PC@T 0 0 b 00刡 0@ 0 `0D @1p0W00   P # 3TX0#0300 0 p (KQ p-LM0P,  0%R@`@l90\ l N@1A.S R00SRPxQ -LM 0`^0 4 ;~PrP 01@0鎐S%pPI@  Up 1@T  0A !0S0@0pW:G%P 0 P0 000@C0  BP0!004  00C 0(K0Q -4LPM|$@0, 00(@pPlKX X X`, ? 1P( K0 `DCP`3`<0C<Sytutuuuutuutttu uuuuuu uu0uPuupuuuuuuuuuuuuuutuutttuuuuuuuuu(u8uuhuuuxu(00 S(0,&9(00(05 P30 00P"p"$P*$( P& p$P"00PpPpPP$P@ ( 00p$(P P pPp1 `V 0SwXXA#P, #pP` 1p`=$P@?    iK:B< 00 1p`#$P 00 0 0R@\,0Z0$%Z Ul)0@  t00SㄌD00S\v 00 ,0 S4:(K48QLQ`PP0\Q/xDP -LM@`,$\p00 l90^ \I>0>0W <@eV'1Zf)2(L%QU" V U1A S1a0j10S + 0S 0 R /% 0 ^ X& P,a 600S   0S 00 0j01R0j1 0S+0S(  S#V P1 S0Sx 00C0ҋh0P @0:#0PS ( 000(KQtQQ/  ->0>0LMRP8 n1"( Y 8)#P8ce10cY c}p`0 1S #PT|01Xa140a1!010`0 X 00( 0B0P40 A:]0( BaVp 0S8  0S  8Z8011 010XAp@@(0X@5 !(0R((Ko,(KQ0QQQQ -3LMp`P *"*R@ R B0B@ Tx;$ 0b S:X\R TL53;83PU $a P R 0S R>0>$ 0+ bR. . $ om0 PST  bRPU:  p 1IV,4 0S% T" P 0*"*R R B00@ S15 05c0 P #0S Q1i`VW _PPdo| @pG !0 1!08#(R!W1 S1@10S00@@1S$ R00 1Sl00S T *1S1100S00@@RR$R0R0^P <0up@X@ 000 pP  H@$Q a Pe0S $ 0b S*0S bQ $0< c:b0P@[ 0SU U\%0SQ<0S$0$ c h bE, 0&Rl90Q |80@S08 R 800C10[ @0P0U40 *0p Y:3), 1 ""p  0 W0 (4 @P0 p0#  0@P 00S0@@00@P 1P R0000 9Q0U 0 *d\Y# ᰑ01 R1J438#811  P  E0S00PP`6:39 )8#8!1Ბ1 !2R0 B101!2 Q 4 @0S00P40P0  0@b 0R1S1@@T0@@p$20!0R@ >8#Ƞ@T@@!00001!0C8#8 ,S!1 R00 00p00c 0!2Qb 1S @@@@a>00 x 0S1S  bpP0@<PT 8 R 0 80 b`P(K$RQRPh -LM`8 @ᷗ0FV X4 P20S$R"0S2 Px"00S0 U0D S 05@0 VT!1 @]$0:CT:@0@>0~ V0@ p:Z i0Vf   0pP^ 0F0 f@T `gP|ePa^PTTM 00!0  0PP   >@0$Q a P 0S$  bO 0 0 BS 堇T p00S x 004 P 80@ P 4  @(K/R  R0Q$Rx -LMP`<1p0Si,1,!@(1T PP>VU3:U 3NP *00SS00SE̖P"@0Q P 0@ Sp05 050@\ 0 0CRP01U 800S 4 맖 00꣖p/R x  p-LMPᔖ0`0S 0 @0T oPP(@00S0 <P0E S|05 05 P0\ 0 0CRP0U 800S 8` 00\`x/R  x -L(MpL,50@ SÆ5%@5T &P9$0@T@ @00G S45T 05p0Z4   @4 uP<  <@$ 0:CW:@ 00.0 N^@PU\$`VPd@ 40D@ 8P D @P4@3D0P: PP 3PQ4!10b1Q@"(0V`:`@D8 2P`@D`P@8@ 2P0@DPT P20S8 $N <` @pnt6 8P1 -*$Q a P$a P e4/0 < @ EW0S$  b gM0P<0 @P5WW0!0S0S00W0S$  X 0cW* gMW00S  @P WX X 1 ! R0  0 c1 o @t`0 0 BS 咅T @00S X 00@``(K/R  QR0Q$Rx 0-PLM@8`1LPZP:+L8KM* 0-LM 0@0 @PK0:M* -LMlYh0Q\@\P\p`0@XPC/``DMUEO,0 htY0`46\046MЍꐗ -T1LM0S @\Y00:S 0P 0<##00:S  0 P0 00K0 0-LM0P-S@ +S@P T00c08 -LM0@JS000 #MS00  0P& 0.S" 0P 0.S 000C S00 [?mP 0/Sh00m  -L MPp@0  dIP000 Ip30 0S# S Sf 100 2" `0F40  1:C=C00SO ;RMX1@H0@!B0ß40 QV@@GdIdPI @ I0 @IT  U0B0C@vI0P S04 0 \@ B1Q \000 O0O(KSQ 0-LMPPdIdEA`I`88 MR10bQ1bQP00Ѝ -L(MRP0 L PP 09H0D LR L=Q:S0T.U50S8 ( 0 5  00S9P0 8 80080 U0L SPE 0S 0<0R 8 0"4 < PUZ8 < DğP 00 H` D @ !@ 9$0  Po0@0S@T SUQPRZ 004K40 \P04pß0Os/< PL$ `GPU`9@H6@`Uį0p Z0@ d|HPvHp3`1 Qʭ P,C! ,368 `zHHD 0n00a<L lpz}HWzG}G2WPd00@# 0Sl lK:>Pl ;0 l0 0 0 ?S p 0O /?0@ @  `cP@a0P`Z@P <` Y@ < VU@p < @K K0P <0S@0SKlKP- @ K R  S ZʐY@ < R S ppSʀR~@p < ZzYwP@ K pіL RKx0SH 1\11`Va  A=0K4 L0R. 0pB=0P L0\ @0K 0O0SO80 4@ 0PlK fPx L0R80K@0 <@  PEW 8KpGJHZ @ K PoSR ?!0 @K8P 4` @P <` P00@K(KlSnSKK -LMp@P`10S 0'K@-p0M@ 09H00 NS N0S: 0C"0\ZЍKP@ -MLM`P8 <( 0 0 0S0 000K 0Pz 0S 18P11Zm B.K0 B B0S =0 B@4 P(0K 4@SD4xp4x 4(KR B.K B BD( ?Dx 1員! 0S@ , 2DP圥% p\! @ H @H L w3Lx dP00 S@x 0 0` cq3 4xX8<(00K4 Y (KKKL*H*P 0M 0ЍY P0 0M ЍP -P?0LMS+? Q0S% R#0.,0 0St0 0Sd0 0ST0 0S D =0 p3H*L*T*X*P* -FMLM90@,0 9Kp& PT 0T00 P 0:S / P 4 P/S . P I0:S@0/S C, P)*B^KPEPE+C,+,+,. P@ @uPHhp@ H(oPmPUIK966,`fV @FFH`fg0`j6fK $ ( @ 2TQ Q\K\P2P)K6SSYY 0##iKf0 2"K0#"F0aS)KV`@v KPK`P@0V0 SH&00@P9KV`0S0o 0PRi@`0V 0e 0 0`R K&F)K0%P09K6Sz K` @P0X9K' IKFT@ 0S0(` 0QK' Y 0S0` 0Q @0 UT00CP0S )K&0j@c)KF 0 0 9K6RIKFTiKf PiK&9KF6TS0 SIKFD0 S}00 SyFLK(@D @D Po0Sl 002Sg,#qK0(A 000 00 0  0  0 P ``V FP*Y`S -RLLM`@ ),6p@ P01h0 @000 0<S @>>0>Sv dp@ h &p@ @d h@ 0Si 0K~@Pd  RpP00PU& <U @>0 >SP dl@ d l@ @dd@ 0S,S ;S 4KVP;00>C40 0 s 3W4 R0;S,SHK VP& 0,S#\KMP PU|ğ @M00@H04 ` h0004 b 0a 0004}0Pp0(PPG0` H0K V4P@ ` \0KMU T  G0  G0@ P 0G G0`00 `dAP`Ap3"1p QʍP`  ` 00KSځSB0`"0Sh20c Q0TBD  0c#0S ,rR( R0 0h!00 0S0 0 n0O0@0 Sb0 \| @M00@00 4h081 b 0a 0 0 00C00͆@00 00 blP  000P0PlPd h0d R d00 0 0 S p(dQ h d0 l x((KSSKH*L*SQ%X* -LM@ P  hNpS p-LM@P`M 0S00lh0PLMP0@0 V40T(0(0x=0(0xLLBK/pS MЍL -LM@  -3L(M\4p 0 H L 0S 0S0S 0S~ 0!0Sx0Su*SS -lLM0SX@0 0R@KP (@ &P?h{LKB -@LMKhKL p-LM,@PxhQ0S P< w&PP,x&P0S P% PQ0  B B,p[& P` 0:S  BP xhx|LKKBP*pS p-@`LM@K  @PKxL P0M 0Ѝ p-<`LMP@yK @tKxL -@LMgKohfKL -LM< 8 <@K0<Ke4`K@_4@ 0P ^<KpTR0@ Qp`4@K0@P4@ 0P H<KT R 0 @ QQR* 4KP'T"S `p4K4@K0@P4@ 0P $<KTZ 0 @YQR 04K@4K(K 0-L M  @K0 K T?K0 -L0M@@Ka/K -LM(@, 0JP hPLK -LM(@, 0JP h<LK -LMh p-QLM@P`p`S@rP`& 0V pKpp@-`M@Pb0 <250^@ 0<0Ѝp -LPM@P`p 4<`^0p(S RP 0p#83K`#[ &8R! X.(,Ƞ3K0#KKKsK3KᾂKSK@PK@\ ;3[S @0K@P\ 23[S*[ <3[H<3[ <Q < <H <$Hx<H <$Hh@0K@P0\0 \6Kll PIl l0 SP i00CJ K 00S BZ J0Kh X X X RX R\0l<\LX 7\0x @l d@ T P0`P p0 t l0d P0 RᴠX Hd?<dP+<d!PPE` 8Rp0t@\x 0  c a"88c !^@NLl00a#0\0 000#Q@DAJlPE000T h0 RT P\ X^ \l 0Bn0X 3><A0 Q@l0#[[[2[x h[$[[4[xh(K/ -QLM`p`ppB <0 +@PB0 )X0AA!+=* -1L,M0PPp(0 `<00 #, 5@KR0̠  R0 0ᤀ# 0P00 00   0@"pP@@ W00p (0 S("$K4TiT9TUTT0T -LM,@H $0HP H h,M(MM ЍMP*0S0Ѝ -LMPp,@KP` 0  !  0R "K4T -LM@`dp:dP:dP ;d@;d@;d@:T00à?PBdP@DU00ä?dPE@W ?T00S  L <0X  %@0 KiUX -LMhȟ@d@ @@ @p|@ @Px@ @@ @ @ @tK@ , %S  zQ(` ,8\<pD||Xl|x0d|0  B e0SE1|/0Sş1`(0 S10! P| 0 0H@KH @0H0S0H0 H 0PR 5  V     .  9P  R M I 9P    |x| P T @0@<  tKm$0@BK5 BK 00o P0Od j9@ @d @ b9 @ d[9PV9P,c(c0 M9@@I90`s00ZZ dV9I 69 @ d/9P*9P|2x2V^V gQ  9 00  0  a$ j0S00Cc99  I 0HKH %6( K 8C0SP0@ U T00SR`1S S S KdP ~0S@@ -?Zp@~0S QP@ ~0S  R ~00@ ,0 S(K4 U -LM 0@jPM 0Ѝa0M Ѝ[M 0ЍU0M ЍP -LM 0@GpMЍ(:7*67* 27*040MЍ -LM0@00MЍ-AM0Q(0(0000Ѝ M-LHM@ 0l p nPB 00~00w00p0l0`ZPPA 00}00ah00`08K0S lp 0|PO 04,"40H1(000@0(0,@000d`\p8l p0`h \ X0 d` ` @@ `0hKbP" D0X 0S`  |j  P "00 00P 0@ 00}00 (K,b0@ M-LM(@ @0 @YK`" 0-LM@P0S p^D00S@8h -LM @p , 0  | 0  0 0 (0 H0 @ 0K DK 0 @0@0XD0 ` 0K00D0P @ 0 0P  P0D0  000 0`0tSP | 0 0S D 0TK 0 |h@@  $C40Ϡ@ 0L$ HK'PP P+ pp3$0@0K XCP0= @@ @Q R P00Y0X00S  C4[  | 0> |00|0SL`K&`PK`T0KXL PU`QZ0=@P`  L2K P0= @@ @Q R@P00Y0X00Sz0<K@ K@  d 0_PI|0SPPfA| 08 40J`0h 0RYx@K h0`Kz P* 440S@0 @ 0P0400800S 0@0 $\ 0 0 P  B xP@x@ xP 4@4{0#S  ,0 S(K4`?BU -'QLM`$rP@ 2P0p@  p1 @240 84 0<00 84 0<0 0 84 0<00 84 0<0 0840< 00840<$0 0 84 0<(00  8 40<,00 00 00 0040000 840<8008 40<<0KMHMexpate knd 32-by -9LrM 9, 0 @,! 0x0 @@ PP `` pp Ā    $00 (@A ,P Q 4`a 8pq <,$ P T H 0 L L?P  HA00 LQlKRH 1`pD1 $14a 8q < @ xP `p0A1 04100 81 (00 <1 00 0,@#1n, 1lȠp `p D@qc8` dH`1 p0P# ,&0b*a0 0 'eZ0` 0 (0 0#@,0n 0#1 1dLc̠1`c<1 0&00 000 1p0'P#0  #0\00 0,00 000 10(1 0 #0lȠ#0n@#1dHc8`1 0p00 0'00 0a#0` P#0eZ041 0 &081 0b*0<1 10(1 41 #81l̠#<1p@#1Dq c<`p1 0@a ndL`p@1& #D1P'#p0, \0Cp0 p0SF01( x0 01 t 41匀80|0 0< 0 ऀ ̀P P  P  `p1 ` p aq@!DQ P! Q  $t| @p !",q A X \ `! 0@P`p؀(!#<$L%\&l'|(,̠. !",d1 hA pQ |a q 唁   ! 1 A#p?$(,(0!4 180 A<@,QPaq0V4p00L@@HL Tp(\(#0P!0@  "@ PT@(@( @t100 ?00, 0R(K4MM V p-L,M`0 0R0 P 0SD@K(p x1 0S((bp@DK(0\0+@81 H0040 0S00e0 0 SKpM4MjV p-LM`0SiP00S.`0 @0M@c K 1 00C00Sh Kp/MM -0LM0@S`h뤀夠p00S @VP1P!M@c  0 p0`e0e00P V00S mh/MMMЍ 0-@LM P08h0*0* 0-LM 0@0 @PK00*I0* -80LMQ< 0( MMЍMЍMЍMЍ p-LM@PU@P" P<\04`Kx0 @ 0 0(00<000SKpM`00MS S. R > R@   ( 0 8 0 0 0 0 00 000 R0 R000000 00000S00 S S000 00 00Ѝ 0-0LM0000PS@P P P  P 8h8 0-LMP@P 0S S P 8h8h8 0-LMP@P P 0S 0K000M Ѝn 0-LMP@dP  >K0hh8 0-LMP@P  NP 0S S 88ZP 8hT8-$$ M @ ЍH0l0MЍ-0MSࠓ 0C0,<4("4!<0 00 0Ѝ0SM0C0 ,<4("4!<0 00 0Ѝ0 McЍ0 Q0aM0 Ѝ MR %3 a 0 0% % ЍMЍ 0-LM0@SP*80b0  00 08 0-LM0@SP*80b0  00 08 -LM0@S0C0 ,<4("4!< K0  00 0K 0-LM0@SP0C0  K,<4("4!<0 00 0K0 -1LFM0PQ,0 p@ K_K<N/K81 gpR 8!+A[h.T081 4A `T041 081 `)u.005@81V0OK@  >KK%K?KU N/KPu@ ,0 S y(K4,VMЍhT.* P.*vL.*iH.*CD.* -L0M `o<000 @0Kp 庢K 0PP% 0@@ PTRP@ L RPE8?0@T0 P@ 0H0 80 Dp D 0 S S*S +S -S S  00 0D0 0S 0D0 D 00S0XS xS DKH0KP8  P  D 0D0 00S S     D0  X0 QՒ<,Є 00@Q:*0D0 D/P00@9P0P M0SI RQ 0D0  @@ 6D @0D0 0P 10@Sࠃ 2D X @0P@  0 PP0Є R  \BS  0ӓ"Є R 0ӓ*@D 0D0 00@ S00 ᴀ @EPeP90 y Dp D 0+S -S```0D0 00@ SD 0D0 0P 10@SDP0@ <,D0D /P00@9P`+0e\SVlDp YDQ:NP IP5iP nP0D@K"P) D00CD0 PD0 0D0 0 80 D@K P 0 D0 80 0(S  O 8 080 Dp   h 0\  R080 00c0  R   r 3 Y ``Q  - VT P ڤ91H C 5@ P- 0T P 5^Y[\P 0TKF4\^ T  9RQL LK @ 5@`P06L0 : @`\ 8TK1 T P 05\TK!Pi\0^(ʈHTK1 \ 0eA  \~L8 2#TK T P 0TK8K<P 80S4F\  0f@T=  7TK1 T P 0y GCb46 56,ʠP0 LLTK T P `FVHǟPp4656P0 T@K0` @PV >F@d  6TK1 jT P 09 FCb46 56,ʠP0 LLTK dT P `FVHƟPp4656P0 T@K0` O@PV 5T@ PP 0#:?C0C PPTK@ K<0KF PH  <0@a@0T0@0 g@0 0< @0 @<0 Pn0U\ U0 P 0 4@lT H P<0H 0<0  R< r H0  H0 P080 GH 0<0 00dH( Q@  0S00 $4X 0Px P \`  x P| A x0 ! H0P 4 H  ! y "00SC S40X b040 8 <0R<0F0ZCP0f0CI X 0 S S R0S qPP000'S S SQ  R0pbPP@@RD0P 0P @T0U 0g R#1 0@00S5PP  0 0CP00@  q0Rh ^000Q@ @dDA@`Q@hP D21 03pQPppW40040 @aPP 4 d4 0 p04Q>i룠/4 RE40`cV) 0S S SVX HPQ  R 0000D bP0@0i iP"00`W@FpTp0 20 2p0f40 W? 0S S S70 2 000, 0bS( `PP* Z 00CX21 030S@ 1 0dP40Q4 p D P4@0 (KM`0M 0@RZR R\00Ѝ0A10M 00 R0: S:Ѝ0 \M 1 21R  10 02SRЍ -L M@,KP0K0p0 c,0`0b2SzG  0 $K -LMp` @ 00RʾP! 0 V0 0@ P @@ P 0 B PP@ U @ @0 B P U P p@-0"RM"1@ 0`  00 3$ Pd05003$Q:R 00Q :0 0cC1S00Ѝp -LM0 10@ @R*0 S K0 @KM0S. 10          $  (  )  *  + , ! - " . # / $ 0 % 1 & 2 ' 3 ( 4 ) 005 L0S @04 0000 00 Ѝ00M000@-@PM 0Ѝ0@@- bM@ l 3. P:Ѝ -2LM00< S@ 0 2140 040 8 4 00<0BP0 S SP00S p @ 0p W0 XSxS0 SP"`V< S$00S T0#03P0S  T7`$0p P0 S0S+0 XSxS&0 SP")S00W0S< 00 )Q<0B 0 S= PpT  $ 0200SW* T0#03P0S  `T  0 T000 R 80S 8 0 b 21040ASQ00(K`- M 0SЍ -8@LM,    h`TV -LMs` -LM(` -LM0 PR0P``@PH 00010p 8!#800"( (!( 0( \"x:0 0b 0("( #8!80#x \:W  0RPP@  ! @0 1  M 0"108#8S"("$"""!   Ѝ 88S00000PM 00Ѝ-0 MS10 0LRA 3#\Ѝ -LM0p100`@PC 0` P0 `6>03U<U@@5 P 256 b42Uࠓ>  0-LM@P 0 S8hD0C05 `0 C>@0C01B@`@ K -LM@P`PwP00`?0P@``kP6 p0!1  0 ``0 @P0Q Q @ ^ P@:0t @  P@0  0V: pG02S p(K -LM0@0 P` VpP 0!R 0010P n0>00R3:Q`0R0:0F0 -LM0 @R0@PP` pWP9 10080 0 8S:1 ! 00 `P00 4 Z 0 @:4 0@^0:@P`00U:8 pGW02S p(K -LM@ P00@ -LMpPoȟ0@)"0@ \0P`0 0Zv@Pp  ! _Lp 1P  -LM@` 1 1`P@ Dq> APU0SPUPP+ 000S ?@P `p @T0S\@T+P@ 0S tP`WW/0q p-R00P0LMS P?P*0SR *0S0,K  @0 0!00^0S0c 00 R L0Pl .a @0Q010C  P 0Q0KpXXPRM  Ѝ0M0Ѝ -- LM 0  K - ML0MßP0P K, P$T4 jKPdP#VL3#0D#P[%[ 0 S2 bKL 0 KK(@DP@D0"0 P   0pPPR2K0HT0Z`\P "0PEP`p0 0`"PEP`p0S UPEU:00 00PEBKHHk1%T+0KmSD PQ!L4KL!0}P*KFD``%S00V0S 0@@:KD`FV@`F@TB.K@ BjK BT4P KE(A0A @ab@DT0R S 0  KHZK 0aTHdc0 K(PK`(L0L00   0a K(@@ d ,0 S<(K44X8X `XphXpXx%(X -LM00 K* --0 L^M0`QP 0 paM_KPE`@M?KC/KKd1 4A 0A l0F`KppX0 peKQ Q < ]1@0 0RK4|X -@LM c W -LM @T#PPp` 0 P2* P)*?UQPdP0@ 0P@ZP*0`@@ 0f PP@DZ-00" -LM0@!  0 KbX -LM`p@TaP0PP@0  p@DaTPPKZXX -L]M@ PMKpKKC/` `4 0 TAM_KPE@h0D@KX0 KQ | Q 1 0 0RK4xe 0-AMLM00AKA@APA 0  04 +[0,*+&+"BB^KPEPE @ h $D D (D  X4epep* -@LM\:0S@d0d S0!* R0 B\0`M 0SbЍRM0S0  R0S 00a@Ѝ -LM0e 0MЍ0QM Q0!0a0PЍ-RM \1,0l00 ?\0 00Ѝ-RM 0bR12<0 RQ ?R0̑030Ѝ@-SM@ 0l\4<0̠ \ ?\ 0 0@\ P R  0 0 0Ѝ-MR ,0l0>ЍàS-0c02Ì.1M0 00Ѝ0M S 200 ЍM0 3# R02 R02 0ЍM bQ B2c00 Ѝ@-M @0cR#3n P0C2Q0C2 d  l 0Ѝ0@- H. !Q, H@ ,P2\Ƞ3# MЍ0 -LM@,pK` 00K(PK 40K(4 ,000 ,( 0 K -L(M8pK4`K@H0  <0KDK 00PK@@K4D 80e  00@ 40`Z H 0@D 80O04 @0`I0< 840 000(K -RLM@`P&"xZ᐀M4 K80Kf,@K0PK4 800<h0H0, Q02[Z.$KP1#3P1 <2MЍePQMЍPM3:00QЍPM3:00Q#2ЍQPMЍ ;; ;SMЍp@-9`\@T0 QMP R ,@00@0000#Ѝp p-LM`P@@@`@x -LMPP`p P0`B53A0Q B"A0E0U00` EU0 u @@ 0@dpQ@$K0@-@_Z@@P  @PMЍ0 p-PLM 0 o@a@I PP5Q 0 U0S$0 UZ$K e 0KAe $0Kp0 000M ЍЍ00 -LM, T"`@pt3Z00 P T  W TTV1("SU*0U,!00QsKPI T 0W0T0SWT  !0Vt0RU/u P ,08!0P,K0K 0e,0|X 0SZ0P W T T0SP0S 000P ,K 0,0K00000  000 00, 0P, 00$K00 -,1LM0( s3Xp@` S P SS``(8?S@!Q vZ)?45VC"QqP0P_a( K(0@Q T< 000(0@T  030? K00 p-LM`P@'@!axh -LMP`pZ00 T0 G  0sRq0P00 0G (K -L :@KDK T0Z@ D0 J)@0 6 `H @0 0@K<0DK48 0 @0`DS :`@KDK@HKDH 0IH@ D0e (K -LM@p`U@0S0S00SU -;LPp45gc M3^@(` ,0 0U0/@@UPpS3:V:00S00O2WS0"?DE)U1(0 n(( K,01,0 , (0( cUV W1,0 N,, K~(01(0 ( ,0 cA@ K0 -;LP`45f M3 à^@p$0 ( US8 V2N(0 (( KM!V\?DE% U2$0 n$$ K:U GU 1?"C   $0( 2 N$0 A A4@K -顏OLMX`p P$K -顏OLMX`p Pp$K/RMЍЍ|/RMЍvЍ -LpM| x x 0 ,JPJt@ %Jt優Cʠt \oOp&tP|@㪪<@ 8 0P D @ 4  @ tPZ t   lCZ  !  0$Z @tP0P 0DK4 K@0K00S 8<0 hT@KlXPK\`K8< d0@ P` HXLH @\ D@ P`T 0RX\@ ;#;SL 1lK D@h0KpK lX@Kp\PK``KX\ h0@ P` @\D` L @ P`X0LQL`0\ 00 00L0 HKLKHL 0PK-PH L0I(K -LPM` \ \h d0 (JJX@ Xd@ʠP`X $Jㄪ\X@p8RToOP&`@X<@ h@㪪0 8 D@ @ 4 `` XZ 0 0  AZ c0XZ  0X R  0 ` X) 0(10S$1 0 ! 0S 0UP * 0P$1 0$10 0S0CP 0 `P0 8#R dN`00 4 0 4`(K -LMP@`QPPq  Q0 Q000a0P^ 0 8ᲀ#xP`=0 R  0S0 ` pP(E000Y0n0@ 0S$10 (!$1 50S 0P ) 0(10P%$10$1  0h8(#h"x 0 0p 0S M00  10 -LM@pAQ 4  n`0 PP- 0 QP #0 0S0lP  0PP0 8#R MP00 4 0 [P(K 0-LMP @p10K0 -L M@0 D <0K4 K `@P^40  @KPvP 0@ PJ 0D pUpW 000ᴠ08#8 P(@"(0ᱠ00 @0@0@ D0@00Q@0A 8#8 P0 00@PP W000(K -L M`H0 00C< H8 H 8 4 D g< S0@8@#8@cH$H 00    8#8 @@0 0@ 0@00 DyP <0P< 0+p@4T # TH0X @ T@PH$HPdX%X r0PC4 4 0d0d00@ 0P00B0`008008 000C8< @ P#88 00;R008R#XH 0X0E8#X0 0@@eH$H.X 8#8 B @0 00@ 00 DP `04 0 4 00000C8X#(p4(K -LMP `  a("Hpd0P pP`PP  0 0b8#H0T ʲ0S T0 P P -LMpP`@LQ\QQW@pPT0X  Q00SP ô 0@00!0 0 0C2#00 0 0T00#WW800C80 0 0C0S2M-S0!1!Ѝ0 00M100 00 Ѝ -LMAPTpm%& R0 W 0 0yPX@ P  厱 00 刱AT$K -L$MR` X 0SR D @ 0 13 B1 80 0D0 @ 010s03@0 < XQ 1U   01 0Q0PQ!0Z000 R00S 0S S0101S 1U<0P  Ph 4P ]1S0C1\0   P0R 0S00S40 0 0Ps 00<3 Q B  1 001% p # 40S0S00S40  0pPC p00 p 10!00@0@@T00Q00001P0Q =U0 P @ 0 Z00 ,PZD< 081  01 0ā0P(KR B 0\R! B@-Q:@- R (2 R R -PPPP RrPP B PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R@- RP1P P1P RrP1P  B P1P B@  R010 1  B R0q0`0q0`0q0`\0q0`0q0`0q0` R 0\6 R B0@-81, Ġ%̌T$\D#L0P  R0@ Ġ01#̌  R R B0@-81, Ƞ%ȌX$XH#H0P  R0@ Ƞ01#Ȍ  R R B0@-81, ̠%Č\$TL#D0P  R0@ ̠01#Č  RQM@  0R:(" 2 02 02 02 02 02 02 02 0Q Ѝ@-M Ѝ@-MЍh! !P: ZŒŒ#! !P: `B!,aB 0>ZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0  M00S:Ѝ -LM`K 0 0 @N PK=   @ > >.-R0 0c BSR48 R p-@P`x BRpR0 BRRRM Ѝw*.*10 *25*&* X_*x*Π*MЍMЍMЍ2*1* -LM` UpP@H1B@A01 y P ds 0200 0 0崜8q -AMLMŸP, p p8$ .P\PPBnK`F`F08" P:F?0xBNK@DBK @DA0A 04 kpA `1sa 1 <4 1R& Y 0CA 004 -4[.$[/[0[0L LLL^0H 0Q( K0/4[0$[0A A PZ<` W @00%BT  @ F : : 8$P0@<Pj)p 8$P 0FO00 ,0 S !(K4sRii -LM`pyQ 0P40 00 0 ? Q< R h@00%BT Z@ H : : s4 P0@ Pp G P 40P EO0 0<Z 0S 0 0C0pp/ 0R* Z 0CA 000 -0[. [/[0[0L LLL^03K/0[0 [0 003K/0[0 [0  P (K p-L M1@QP aP8 0,0ZP8 8īKp p-LM 0P8-`#1@::0C0$ 0\\1 8!$ BP@  T00~AB2AA 0B 1 0xh -L M404  SP0 00S400404 000 `0$0!QD AQ! 1 BN?p @%PP T 01C T 0 ! 0$ 10C0S  "0|X 0S@p T!D0V$0@00@c TD `Vu F!D1DD0 `0CD0@ 010CX$0Sc pPi!D0@0 TD0"`V1 R(DR F!D1DD0@0CD0 ` 0 B Q~AB"AA 0B 1 05:    RQ00~LB2A0AB <0 0$ 10Q0A $0PD0 QP1@0c0Q51 'dD008#8#H! 04 $40P 00P00 00000P0C0@P0 40(Ki -LMP0@0P@cH$HX`p %X0@@bH$HPX%X0 0C@0P0@ -L M`PD OXX 0S0?pQH NR7 0< 00Q8 -:@0@0F@bH$H0 @0H @cH$H4 @000<0H0@ 00 0c80b0C 0< 00@ 0@G0 SD0PU `尀X 0R@0 00S0S 00 0S `4 DPP1 0S 0 0 0S H 4  0D ~P040 0400D Q808(D40P4D(Ko#(K -LtM@ 0  PP` > 0Ph 6 `(0P 00h"0 p 0@ `| 00S`@d 0h 0C 8hpx #X`p 00C8Sl   0\KPXX \p0W T`V @p d` (^#x0`0C8#8 I 00l0ἐ 0`P~ dPP @a8 @#d` x  0P8#8t0 Ut0D  b@ 00L0 00 0lH t eP0S H @00 0S DKZP; 0DKL K\000p 0S @0H 0 0SpDK<pP 0DKp0 L K>00008#X0S0S UH:dP dDB4 00c 00  0f P4K< K8|#8  08# l  0 0b00屐 00<0 00l80 08#`p0W0h8#8 I! 000ഐ`000h 000(K -LM@0pP\oR 0080S#80l G8U#h 0  b000 R C CCC0^(1U0E(10 00G000 000B800C80000 -L@P/ 0r`p( 07A 0P-LrnD 0- L@0@PP $000A -@LUT 0A -OL@ PO  -0LM@ -LUsage: %s ..., where is one of: instbin%s: %s not compiled in mount_cd9660md5sha256sha512dfmountmount_ext2fsarchsyncnewfs_msdossttylnpaxtarfsck_ext2fscatifconfigsysctlping6dateztsscalemount_nfsfdiskgrepegrepfgrepumountmount_msdosfsckmorelesssignifymknodpwd_mkdbreboothaltmount_ffsdhclientcpgzipgunzipgzcatchmodchgrpchownchrootfsck_ffsnewfsrmmtejectmkdirksh-shencryptbioctlsleepmvdmesghostname0`4H@@ \،@@ unknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs cannot be zerocbs meaningless if not doing record operationsbuffer sizes cannot be zerobuffer sizes cannot be greater than %zdseek offsets cannot be larger than %qdnonenoxferunknown status %s%s: illegal numeric valueunknown conversion %s%s: illegal conversion combinationcbsconvibsifobsofskipstatusnoerrornotrunc%s: end of device%s: short write on character device%s: short write on tape devicefiles is not supported for non-tape devicesstdoutinput bufferoutput bufferstdiopledgecase conv and -DNO_CONV%zu+%zu records in %zu+%zu records out blockblocks%zu odd length swab %s %zu truncated %s %qd bytes transferred in %lld.%03ld secs (%0.0f bytes/sec) skip reached end of input $(0<|DLT\usage: mount_cd9660 [-egjR] [-o options] [-s offset] special node session number is %s: %segjo:Rs:realpath %scd9660%s: Filesystem not supported by kernel%s on %suserquotagroupquotarwnetautoaccesstimeatimeexecsuidrdonlyupdateneedsdoes not need-o %s: option %s a value-o %s: option not supported%s: illegal value '%s'%s (%s) = %s usage: %s [-bcpqrtx] [-C checklist] [-h hashfile] [-s string] [file ...] error encoding base64cannot open %sstdout: write error%s: read errorstdio rpath wpath cpathbC:ch:pqrs:txbase64hex%s doesn't support %s ,stdio rpathunknown algorithm "%s"SHA256SHA512usage: %s [-hiklnP] [-t type] [[file | file_system] ...] df: %qd: %s 1024-blocks 512-blocks%-*.*s %s Used Available Capacity Mounted on Filesystem%-*.*s %*lld %10lld %11lld %5.0f%% %s %7s%-*.*s %*llu %9llu %9lld %5.0f%% %7llu %7llu %5.0f%% %s %-*.*s %s Used Avail Capacity Size1K-blocks%-*.*s %s Used Avail Capacity iused ifree %%iused Mounted onempty type listonly one -t option may be specified.hiklnPt:-h and -i are incompatible with -Pretrieving information on mounted file systems%s is not a local file system%s mounted as a %s file systemext2fsnfs:@ufsffs%s: fstab uses outdated type 'ufs' -- fix pleasemfs%s: fstab type %s != disklabel type %susage: mount [-AadfNruvw] [-t type] mount [-dfrsuvw] special | node mount [-dfruvw] [-o options] [-t type] special node -o%s,%s on %s type %.*s%sunknown flag%s %#x, ctime=%sv3v2udptcpsofthardintrnoconnrdirplus%s%s=%dwsizersizerdirsizetimeoretransmaxgrouplistreadaheadacregmin, %s=%dacregmaxacdirminacdirmax%s%s=%lu %smsdos%s%s=%u, %s=%uuidgid%s%s=0%onowin95direxecnorripgensextattstatfs %s on %s type %.*s: %s already mountedexec: mount_%sfork%s/mount_%sexec %s for %sno mount helper program found for %swaitpidstdio rpath disklabel proc execforceAadfNo:rswt:uvrqnoautogetmntinfounknown special file or file system %s.root_devicecan't find fstab entry for %s.%s has unknown file system type./var/run/mountd.pidsignal mountdasynchronousasyncexported to the worldkerberos uid mappingNFS exportedanon uid mappingexported read-onlynoatimenodevnoexecnosuidwith quotasread-onlyroot file systemsynchronoussoftdep/usr/sbin $(0<|DLT\usage: mount_ext2fs [-o options] special node o:specified device does not match mounted devicefilesystem not supported by kernelmount table full%s on %s: %susage: machine [-a] usage: arch [-ks] machinezaurusarmOpenBSD.%s%s @@@h pp p ` @  $%s: no default %s%s: illegal %s%s: bad %susage: %s [-N] [-a FAT-size] [-B boot] [-b block-size] [-c cluster-size] [-e dirents] [-F FAT-type] [-f format] [-h heads] [-I volid] [-i info] [-k backup] [-L label] [-m media] [-n FATs] [-O OEM] [-o hidden] [-r reserved] [-S sector-size] [-s total] [-u track-size] special [disktype] stdio rpath wpath disklabel%s: bad FAT typevolume ID"*+,./:;<=>?[\]|%s: bad volume label%s: bad OEM stringbytes/sectorsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsfile system sizesectors/track/dev/%s is mounted on %s%s: block devicewarning: %s is not a character device%s: unknown standard format%s: can't figure out partition infoioctl (GDINFO)%s: can't read disk label; disk type must be specified%s: unknown disk type%s: partition is unavailablebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %u-%c is not a legal FAT%s optionblock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectorstoo many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs=%#x bkbs=%s: can't read sector %uNO NAMEFAT%uBSD 4.4%s: can't write sector %u160180320360720120014402880  ` $,0 8@ H P Xx  `h:      ( 0 8 @ H  P  X #` 3h #p 3x 2 3 3 # @ @@ @              $ , 4  <  D @L @T \ d l t |   pn                 $ , 4 < D L T \ h t      @ @ @ @          $ @, @4 < D  L  h C$T C\ C$d Cl x                 @@$,4<Doption requires an argument -- %sundefmaximum option value is %d -- %soption requires a numeric argument -- %sdiscarddsuspeofeol2lnextminquitreprintstartstopsusptimeflushrprntillegal gfmt1 option -- %sillegal gfmt1 option%lxcflagiflagispeedlflagoflagospeedgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d TIOCSTOPTIOCSTARTTIOCSETD%d %d rows %scols %sospeed %sispeed %sillegal option -- -%scbreakcolscolumnscookeddecekeverythingextproclcasenewoldostartostoprawrowssanespeedcs5cs6cs7cs8cstopb-cstopbcread-creadparenb-parenbparodd-paroddparity-parityevenp-evenpoddp-oddppass8-pass8hupcl-hupcl-hupclocal-clocalcrtscts-crtsctsmdmbuf-mdmbufignbrk-ignbrkbrkint-brkintignpar-ignparparmrk-parmrkinpck-inpckistrip-istripinlcr-inlcrigncr-igncricrnl-icrnliuclc-iuclcixon-ixon-flowixoff-ixofftandem-tandemixany-ixanydecctlq-decctlqimaxbel-imaxbel-echoechoe-echoecrterase-crterasecrtbs-crtbsechok-echokechoke-echokecrtkill-crtkillaltwerase-altweraseiexten-iextenechonl-echonlechoctl-echoctlctlecho-ctlechoechoprt-echoprtprterase-prteraseisig-isigicanon-icanonnoflsh-noflshtostop-tostopflusho-flushopendin-pendin-crtnewcrt-newcrtnokerninfo-nokerninfokerninfo-kerninfoxcase-xcaseopost-opostlitout-litoutocrnl-ocrnlolcuc-olcuconlcr-onlcronlret-onlretonocr-onocrtabs-tabsoxtabs-oxtabsonoeot-onoeot tablet disc; slip disc; ppp disc; strip disc; nmea disc; #%d disc; ispeed %d baud; ospeed %d baud;speed %d baud; %d rows; %d columns;lflags-extprociflagsoflagscflagscchars%s = %s;%-8susage: %s [-a | -e | -g] [-f file] [operands] -aefgaef:gTIOCGETDnot a terminalTIOCGWINSZgfmt1illegal option -- %stcsetattrTIOCSWINSZusage: %s [-fhLnPs] source [target] %s [-fLPs] source ... [directory] %s/%s%s: disappeared%s and %s are identical (nothing done).stdio rpath cpathfhLnPs909>89D9P9X9`9p9x99/99999|9 999RS|SS/8888/88899999 9(9S8,6/(S S8HJ8$S89(S,S(S"!5E)[o8o8 ,ޅ/x{ыs5^ŗP ] ը3܃0ޝFՀާQEmtG,H$JcU]:N3sUrj:woz]Nj~&PIFQ6euQ3iM_>9=ʧ>LG)EwET>Nh;0,QBo`Hˣ8ͣI? uo;I>G!4F%QG9l ,:%]ؑ{l,m"1:2 S<^B㲊Weͷq  .XTU8㉬/x`R|^V+Ug8uV6&KUUf,1dv u<9 Y`Hetqmj9`tQǙMh#q`R,bú6_ldvD,<ǀ0Y_aj y٢,fЪlf=3I&yd(Ć<$U6ӆP /&K@E"cPM]t^VW^@eBܐ(8T'|vπ-nvŘ=sz8+a%>@Cx7vfN m1l<.aDVL pj0?)N-|$>!32;`48 ,96 a'Wk]>`A`L_\t¾Vp344>NitIitiC {K`֙7 > aOڍgV 5$Xo-^}EɪX:ۨ*C}DleQ81lI \(\e`("53l!BBw,Y:juoEyWke OzpL8$Źy,@F7*=\YצH^ґSG@E Aqm×FW<.FwdԊT ^׀"PC z^*p@w~Wx:FێB/ywb1Xm, C`frLJ6ϛX(ճfpj]m.w8S{¨4 H%MHMlqy,/gf5 e?,Fp> u_Aa[ :Yaɲ~5G!!r !a7WZw0M+AgI>G;Xx]epa6rǧgyvp& SYYl-3.=UWYrK~ⲭIYQ'}3FA2ꂭ7b_$TÀgkߴp)@K@}ԾaD<Ҏ]jQwJB' mڶ޾#A_CqZ~/,h+(^f iVQ\2Kd_ƻ$rkǴ[%&cjCցJGqSs鐮, Q?Xqs5^iѢ { $wH;VIlNk[D@de2 J܄bUC,) -j3]Ck ECQf*I/4k\6e,_ǫPb左$'g$I3IT䪸 x;X%)l xO Qwn #| fzU0#`73{4!#peyCZZQϜVrDJb#&'\ @󛐪\a@AUŰ+{\#&o0 A˦K\n Me@lt4˕;6CZ85SocraFe9Rn16'OȄG:*[~tkx4|C{DE͏kX <\r(jrL"8a}([O:V$WQNS`dǡ6 e7HMl%z@R+'|Lw& eGhWt{2m:{u}56R͘0&٘Kbz=hv4VrLq|K`Fv5|*-UjW,]k:o%e7QIIE\F:Q=HR[B5kFKrمۑ+nw.wǘ$WnTXxɦ]h( )qfXZc@x&YVEӹȘ[2T BIO~Q` /]Aj'l< !v rA(W\ө5EJIOūٽzo{dt(&z>$EuK

w!&%x)oV}u-C^f+X/XeƙLh[Q5փa`x7TY Uiv[xXO3-=5UJpI9s̀oyt?lsj xh#{<(z~룠 iQńVu+L"妇i1f^/ɾ/ffŦ\\-,]6G$MfQ”P &}K~d.uת]0Iِ"TSiVE3`rL_G.T-&L01Zsݎ}D- *r3Cؑ I=PGM] |"&[1%rqb;ܸ|KbfC,6!sOeu+wG*U}j) \pKSU6-m\>!ď&-Vv(+Iڠ=z--߸Dwk[/;홗*el_*X=n?O?E"efٟCnS~NRQӁ!M9OPdE"Rbv&Mi-rksmOBpH6 "?QKS1}|Uzk`"t A+!*%Dmya1(-;A ?^C_ 1 {/ $eS#O=}?asg{m8ƀ:V<uT]j,t:EPYIgs[ޑN݂S |E(H6c믢@$b$oYZmr3b[7@08iW.[HZ}tfI!F; R DA1?=ӥP]O)hij|@ټVRAc &E3Zj:=@HsNJR/pa[6bU8JKˠkxF9bGx-=9h_]͊7qNot5vL۵k*j%vc.bj W Ùژ]ϙc)nC2t5]F1 Nf޽0?w^lm@Z !UڄM˘gi%pg{kUS{k Xq&٩8N}.K΢36z ` tZ-mV'C#1f@Ox8fXLR 5AV?}bA*A#ޝr>&%%3Iڹ%O}%i䤌~ }|^(ݜTz$ .#G =m<- 'ހJݧ?_ ԣef:}ZTH L@=;#%O㡒ÁϾ'Go&_ ^Gwoڻ'dPS* 긷UqLЭ*+{e/`"L~W`چ̏8 |!_S{hs3Q}:mo x5=atBﺋbu_;QAמ͍ICɳGqY$/g3]5o`r?Mi&1`oHq8 qoTx~̾ 瑉BATi'qsP&kmmЎ!6fu%c^+Vte(3Cl'#@ˮ2_#|"_{Ґt! sx0FC`2 ;<-h8 4ArWYQuJB .msU-t/sU ^ԩKmFR f.lvd+m9:8|uwB(*3k1+cSˡA$dje~* a⮽'w~$߻\ljNs[f*\ra=dyVKc'䰰5pH_ɰeע3ԜgR,pZd] UlxQƄ Vnioqxk[cPM{rF? $bJ؆Oa8Lۿ~zy]Ycz=Ov˫m`j~;5\E+HJ/$ Ӫg+јB _R&]oqgrzx{'l3_{4a'95:9{5DZz:'b  1pN0P6+Aذg_>$+ˮabBo%'czl&0T n{LJj'/vx:Tg>Nv@ 6%CMdusage: disklabel [-Acdtv] [-h | -p unit] [-T file] disk (read) disklabel -w [-Acdnv] [-T file] disk disktype [packid] (write) disklabel -e [-Acdnv] [-T file] disk (edit) disklabel -E [-Acdnv] [-F|-f file] [-T file] disk (simple editor) disklabel -R [-nv] [-F|-f file] disk protofile (restore) `disk' may be of the form: sd0 or /dev/rsd0%c. `disktype' is an entry from %s, see disktab(5) for more info. /etc/disktab`packid' is an identification string for the device. `protofile' is the output from the read cmd form; -R is powerful. For procedures specific to this architecture see: %s fdisk(8)sector size %dsectors/track %dtracks/cylinder %dcylinders/unit %dboot block size %dwarning, boot block size %% sector-size != 0super block size %dwarning, super block size %% sector-size != 0warning, number of partitions (%d) > MAXPARTITIONS (%d)warning, partition %c: size 0, but offset %llupartition %c: offset past end of unitpartition %c: partition extends past end of unitwarning, unused partition %c: size %llu offset %llu line %d: syntax errorunknownIDEESDIline %d: warning, unknown disk type: %sbadsectvendorline %d: bad flag: %sdrivedataline %d: bad drivedata %s%d partitionsline %d: bad # of partitionsduidline %d: bad %s: %ssectors/cylindertracks/cylindercylindersrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seektotal sectorsboundstartboundendline %d: bad partition name: %sline %d: too few fieldsline %d: bad partition size: %sline %d: bad partition offset: %sline %d: warning, unknown filesystem type: %sline %d: unknown field: %sVISUALEDITOR/usr/bin/vi/bin/sh%s: No disk label on disk%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of disk %c: %16llu %16llu %c: %15.*f%c %16llu %7.7s%7d %5u %5u %4hu %19.19s# %s# %s: type: %s type: %d disk: %.*s label: %.*s duid: %02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx flags: badsect vendorbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %llu # total bytes: %.*f%cboundstart: %llu boundend: %llu drivedata: %d %hu partitions: # %16.16s %16.16s fstype [fsize bsize cpg] offset%.*s|Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:nc#%u:sc#%u:su#%llu:d%d#%u\ :p%c#%llu:o%c#%llu:t%c=%s:t%c=unknown%d:b%c#%u:f%c#%u:ioctl DIOCRLDINFOioctl DIOCGPDINFOioctl DIOCGDINFO/dev/%s%c%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx.aioctl DIOCWDINFO # Notes: # Up to 16 partitions are valid, named from 'a' to 'p'. Partition 'a' is # your root filesystem, 'b' is your swap, and 'c' should cover your whole # disk. Any other partition is free for any use. 'size' and 'offset' are # in 512-byte blocks. fstype should be '4.2BSD', 'swap', or 'none' or some # other values. fsize/bsize/cpg should typically be '2048 16384 16' for a # 4.2BSD filesystem (or '512 4096 16' except on alpha, sun4, ...) No changes.re-edit the label? [y]: unknown disk type: %scan't get mem sizebckmgtBCKMGTValid units are bckmgt AEf:F:hRcdenp:tT:vwstdio rpath wpath cpath disklabel proc execSMDMSCPold DECSCSIST506HP-IBHP-FLtype 9floppyccdvndATAPIRAIDrdrootunusedVersion6Version7SystemV4.1BSDEighth-Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSHFSADFSNTFSUDF-cparse percent %s: %s%s: parse error on line %u%s: min size > max size on line %u%s: sum of extra space allocation > 100%%Treating sectors %llu-%llu as the OpenBSD portion of the disk. You can use the 'b' command to change this. OpenBSD area: ; size: ; free: # %16.16s %16.16s fstype [fsize bsize cpg] Can't stat deviceAvailable commands: ? | h - show help n [part] - set mount point A - auto partition all space p [unit] - print partitions a [part] - add partition q - quit & save changes b - set OpenBSD boundaries R [part] - resize auto allocated partition c [part] - change partition size r - display free space D - reset label to default s [path] - save label to file d [part] - delete partition U - undo all changes e - edit drive parameters u - undo last change g [d|u] - [d]isk or [u]ser geometry w - write label to disk i - modify disklabel UID X - toggle expert mode l [unit] - print disk label header x - exit & lose changes M - disklabel(8) man page z - delete all partitions m [part] - modify partition Suffixes can be used to indicate units other than sectors: 'b' (bytes), 'k' (kilobytes), 'm' (megabytes), 'g' (gigabytes) 't' (terabytes) 'c' (cylinders), '%' (% of total disk), '&' (% of free space). Values in non-sector units are truncated to the nearest cylinder boundary.%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx.%c%s%c none swap sw %s%c %s %s rw 1 %d failed to sort partition table Error, partitions %c and %c overlap: Disable which one? (^D to abort) [%c %c] %s: [%llu] %lldRounding size to cylinder (%d sectors): %llu fragment sizeSize of ffs block fragments. A multiple of the disk sector-size.Command aborted Invalid entry Error: fragment size must be a multiple of the disk sector size (%d) Zero fragment size implies zero block sizeSize of the partition. You may also say +/- amount for a relative change.The size must be > 0 sectors The size can't be more than %llu sectors, or the partition would extend beyond the last sector (%llu) of the OpenBSD portion of the disk. The 'b' command can change this limit. Sorry, there are only %llu sectors left Starting sector for this partition.The offset must be >= %llu and < %llu, the limits of the OpenBSD portion of the disk. The 'b' command can change these limits. The offset must be in a free area. Starting sectorThe start of the OpenBSD portion of the disk.Size ('*' for entire disk)The size of the OpenBSD portion of the disk ('*' for the entire disk).%s: [%s] [d]isk or [u]ser geometryEnter 'd' to use the geometry based on what the disk itself thinks it is, or 'u' to use the geometry that was found in the label.BIOS geometry not defined. Note: user geometry is the same as disk geometry. You must enter either 'd' or 'u'. Where to mount this filesystem (ie: / /var /usr)'%c' already being mounted at '%s' Mount points must start with '/' FS typeFilesystem type (usually 4.2BSD or swap)FS type (decimal)Filesystem type as a decimal number; usually 7 (4.2BSD) or 1 (swap).Unrecognized filesystem type '%s', treating as 'unknown' Size of ffs blocks. 1, 2, 4 or 8 times ffs fragment size.Error: block size must be at least as big as page size (%d). Error: block size must be 1, 2, 4 or 8 times fragment size (%llu). Align partition to block sizeRound the partition offset and size to multiples of bsize?Rounding offset to bsize (%llu sectors): %llu Rounding size to bsize (%llu sectors): %llu The disklabel UID is currently: %02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx The disklabel UID, given as a 16 character hexadecimal string.Invalid UID entered. Possible values are:"IDE", "%s"Disk typeWhat kind of disk is this? Usually SCSI, IDE, ESDI, ST506, or floppy."%s" is not a valid disk type. Valid types are: Changing device parameters for %s: What kind of disk is this? Usually SCSI, ESDI, ST506, or floppy (use ESDI for IDE).label name15 char string that describes this label, usually the disk name.The Number of sectors per track.The number of tracks per cylinder.The number of sectors per cylinder (Usually sectors/track * tracks/cylinder).number of cylindersThe total number of cylinders on the disk.The total number of sectors on the disk.You may want to increase the size of the 'c' partition.Not enough free space to shrink by %llu sectors (only %llu sectors left) partition to change sizeThe letter of the partition to change size, a - p.Partition must be between 'a' and '%c' (excluding 'c'). Partition '%c' is not in use. Partition %c is currently %llu sectors in size, and can have a maximum size of %llu sectors. partition to deleteThe letter of the partition to delete, a - p, or '*'.partition to modifyThe letter of the partition to modify, a - p.partition to nameThe letter of the partition to name, a - p.You cannot name a filesystem of type %s. No space left, you need to shrink a partition The letter of the new partition, a - p.Partition '%c' exists. Delete it first. partition to resizeNo such partition Cannot resize spoofed partition [+|-]new size (with unit)new size or amount to grow (+) or shrink (-) partition including unitAmount too big Partition %c shrunk to make room No room left for all partitions You need to specify a type for this disk.can't run when there is partition overlap.No 'c' partition found, adding one that spans the disk.Label editor (enter '?' for help at any prompt) unable to get default partition tableThis option is not valid when run without the -f flag. PAGER/usr/bin/lessgunzip -qc|%sunable to execute %sIn no change mode, not writing label.No label changes.Write new label?Write the modified label to disk?unable to write labelResize only implemented for auto allocated labels Free sectors: %16llu - %16llu (%16llu) Total free sectors: %llu. FilenameName of the file to save label into.Original label and mount points restored.Last change undone.EnteringExiting%s expert mode Unknown option: %c ('?' for help) /tmp/var/usr/usr/X11R6/usr/local/usr/src/usr/obj/homelfsadosntfsudfsdFLOPPYxdhdVNDsvndabcdfiklnoprstuvwxBDEGHLPTUXYZ0Cannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specForward positioning operation on archive failedCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Reverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %d pad blocksUnable to backspace tape %d blocks.Failed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDUnable to truncate archive file%s%s: Waiting for tape drive close to complete...done. %s: unknown format, %llu bytes skipped. %s: %s vol %d, %lu files, %llu bytes read, %llu bytes written. could not pipecould not forkstdio rpath wpath cpath fattr dpath getpw ioctl proc-dcPATH=/usr/bin:/usr/local/bincould not exec %sFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed chdir to %sFailed stat on %sCannot write an archive on top of a directory %sUnable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Ready for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again ..Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sUnable to open %s to readCannot identify format. Searching...Sorry, unable to determine archive format.Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot mix current archive format %s with %s%s: Reading archive to position at the end...Cannot chdir to %sCan't fchdir to starting directoryUser specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUnable to append when there are archive read errors.Archive read error limit (%d) reachedCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Write block size %d too large, maximium is: %dWrite block size %d is not a %d byte multipleWrite block size of %d too large, maximium is: %dWrite block size of %d is not a %d byte multipleWrite block size of %d larger than POSIX max %d, archive may not be portableUnable to allocate memory for group name cache tableUnable to allocate memory for user name cache tableUnable to allocate memory for group id cache tableUnable to allocate memory for user id cache tableFile changed size %sFile %s was modified during readFile rewind failed on: %sFailed seek on file %sFailed write to file %sFile seek on %sWARNING! Major Internal Error! GNU hack Failing!Out of memoryCould not set permissions on %sUnable to set file uid/gid of %sAccess/modification time set failed on: %sUnable to restore mode and times for directory: %sUnable to stat directory: %sDirectory vanished before restoring mode and times: %sUnable to close file descriptor on %sUnable to copy %s, file would overwrite itselfUnable to remove directory %sCould not unlink %sUnable to create %scannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCould not create: %scpioCould not access %s (stat)Unable to link file %s to itselfUnable to remove %sCould not link to %s from %sUnable to link to %s from %sA hard link to the directory %s is not allowedIgnoring unterminated pathname at EOFIgnoring too-long pathname: %sCan't chdir to %snext_fileFile system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %sWARNING! These file names were not selected:Invalid file name argumentUnable to allocate memory for filenameUnable to allocate memory for file name buffer%b %e %H:%M%b %e %Y%s%s %s %s%2u %-*.*s %-*.*s %4lu, %4lu %9llu == -> %s: unknown option %c %s: %c argument missing input compressed with %s; use the -%c option to decompress itbzip2compress7zXZinput compressed with xzInvalid option nameUnable to allocate space for option listInvalid options formatusage: tar {crtux}[014578befHhjLmNOoPpqsvwXZz] [blocking-factor | archive | replstr] [-C directory] [-I file] [file ...] tar {-crtux} [-014578eHhjLmNOoPpqvwXZz] [-b blocking-factor] [-C directory] [-f archive] [-I file] [-s replstr] [file ...] usage: pax [-0cdjnOvz] [-E limit] [-f archive] [-G group] [-s replstr] [-T range] [-U user] [pattern ...] pax -r [-0cDdijknOuvYZz] [-E limit] [-f archive] [-G group] [-o options] [-p string] [-s replstr] [-T range] [-U user] [pattern ...] pax -w [-0adHijLOPtuvXz] [-B bytes] [-b blocksize] [-f archive] [-G group] [-o options] [-s replstr] [-T range] [-U user] [-x format] [file ...] pax -rw [-0DdHikLlnOPtuvXYZ] [-G group] [-p string] [-s replstr] [-T range] [-U user] [file ...] directory Invalid block size %s/dev/rst0/dev/rst1/dev/rst4/dev/rst5/dev/rst7/dev/rst8b:cef:hjmopqruts:vwxzBC:HI:LNOPXZ014578TAPE-IUnable to open file '%s' for readProblem with file '%s'-CInvalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multipleError count value: %sab:cdf:ijklno:p:rs:tuvwx:zB:DE:G:HLOPT:U:XYZ0%s: Invalid combination of options: -%cDestination directory was not suppliedThese format options are not supported %s = %s ustarFile name %s/%s, too longWARNING! These patterns were not matched:Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Removing leading / from absolute path names in the archiveRemoving leading "%.*s" ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Pattern select out of memoryPattern list inconsistentEmpty pattern stringUnable to allocate memory for pattern stringEmpty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %s CPU time limit reached, cleaning up. Signal caught, cleaning up. Can't open current working directory.TMPDIR/tmp/Cannot allocate memory for temp file name.Unable to set up signal handlerstdio rpath wpath cpath dpath fattr getpw ioctl proc execstdio rpath wpath fattr cpath getpw ioctlcan not gzip while appendingEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [[[[[cc]yy]mm]dd]HH]MM[.SS][/[c][m]]Unable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory for directory timesCannot canonicalize %sUnable to store mode and times for created directory: %sNo interactive rename table, links may failCannot update rename tableInteractive rename table out of memoryCannot allocate space for directory access time tableCannot allocate memory for interactive rename tableCannot allocate memory for hard link tableHard link table out of memorydeferred symlink hardlinkdefered symlink hardlink pathsymlink tabledeferred symlink removaldeferred symlink%s: %sdefered symlink pathdefered symlink valuedefered symlinkFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sDirectory access time reset table ran out of memoryUstar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sFile is too long for ustar %snobodyUstar header field is too small for uid %lu, using nobodyUstar header field is too small for gid %lu, using nobodyUstar header field is too small for %sTar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sInvalid extended header recordInvalid extended header record lengthExtended header record length %lu is out of rangeMalformed extended header recordlinkpathwrite_optnodirUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.%s: /dev/ttyFatal error, cannot open %susage: ping [-DdEefLnqRv] [-c count] [-I ifaddr] [-i wait] [-l preload] [-p pattern] [-s packetsize] [-t ttl] [-V rtable] [-w maxwait] host patterns must be specified as hex digits%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xVr HL TOS Len ID Flg off TTL Pro cks Src Dst Data %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %s TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Echo ReplyDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set (MTU %d) frag needed and DF setSource Route FailedNetwork UnknownHost UnknownSource IsolatedDest. Net Administratively ProhibitedDest. Host Administratively ProhibitedDestination Net Unreachable for TOSDestination Host Unreachable for TOSRoute administratively prohibitedHost Precedence ViolationPrecedence CutoffDest Unreachable, Unknown Code: %d Source QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect, Unknown Code: %d(New addr: %s) Echo RequestRouter Discovery Advertisement(%d entries, lifetime %d seconds) Router Discovery SolicitationTime to live exceededFrag reassembly time exceededTime exceeded, Unknown Code: %d Parameter problem, required option absent: pointer = 0x%02x Parameter problem: pointer = 0x%02x TimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask Reply (Mask 0x%08x) Unknown ICMP type: %d --- %s ping statistics --- %ld packets transmitted, %ld packets received, %ld duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms clock_gettime(CLOCK_MONOTONIC)invalid peernamepacket too short (%d bytes) from %ssignature mismatch!%d bytes from %s: icmp_seq=%u ttl=%d time=%.3f ms (DUP!) (TRUNC!) wrong data byte #%d should be 0x%x but was 0x%x%x %d bytes from %s: LSRR: 0.0.0.0 %s (truncated route) (same route) RR: NOP unknown option %xping: sendtoping: wrote %s %d chars, ret=%d setresuidnumber of packets to transmit is %s: %sillegal timing interval %s%s: only root may use interval < 1stoo small interval, raised to 0.01preload value is %s: %spacket size is %s: %sttl value is %s: %srtable value is %s: %ssetsockopt SO_RTABLEmaxwait value is %s: %sDEI:LRS:c:defi:l:np:qs:T:t:V:vw:unknown host: %ssize of sockaddr mismatchbind-f and -i options are incompatibleNo audible output for flood pings-R option and -D or -T, or -t to unicast destinations are incompatiblerecord route not valid to multicast destinationsping: record routesetsockopt IP_MULTICAST_LOOPsetsockopt IP_MULTICAST_TTLsetsockopt IP_MULTICAST_IFgetsockoptsetsockoptCannot set the receive buffer sizeCould only allocate a receive buffer of %d bytes (default %d)PING %s (%s): %d data bytes PING %s: %d data bytes stdio inetstdio inet dnsrecvmsg09>89D9P9X9`9p9x99/99999|9 999returning to single-user after filesystem check out of memory NO SPACE LEFT IN %s (EXPANDED)EXPANDUNREFDIRLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTUNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORYlost+found IS NOT A DIRECTORYREALLOCATESORRY. CANNOT CREATE lost+found DIRECTORY SORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu NAME=%s %s=%s DIRECTORY CORRUPTEDwrong type to dirscan %d lost+found%d %s I=%lluBAD STATE %d TO BLKERR cannot find inode %llu bad inode number %llu to nextinode Cannot allocate space for inode buffer bad inode number %llu to ginode blk %d < cgdmin %d; blk + cnt %d > cgsbase %d blk %d >= cgdmin %d; blk + cnt %d > cgdmax %d LARGE FILES UNSUPPORTED ON REVISION 0 FILESYSTEMSSETTING LARGE FILE INDICATOR SET LARGE FILE INDICATORTRYING TO SET FILESIZE TO %llu ON MODE %x FILE I=%llu OWNER=%u MODE=%o SIZE=%llu MTIME=%12.12s %4.4s cannot increase directory list PARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDSCLEAR (CLEARED)-%c flag requires a %s usage: %s [-dfnpy] [-b block#] [-m mode] filesystem Alternate super block location: %d bad mode to -m: %o ** lost+found creation mode %o b:dfm:npystarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system** Phase 1 - Check Blocks and SizesINTERNAL ERROR: dups with -p** Phase 1b - Rescan For More DUPS** Phase 2 - Check Pathnames** Phase 3 - Check Connectivity** Phase 4 - Check Reference Counts** Phase 5 - Check Cyl groups%d files, %d used, %d free %d files missing %d blocks missing The following duplicate blocks remain: %d,The following zero link count inodes remain: %llu, ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW *****EXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEEXCESSIVE DUP BLKS I=%lluuDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%lluINODE I=%llu HAS DTIME=%12.12s %4.4s (CORRECTED)bad size %llu:HOLD BAD BLOCKbad size %llu ndb %d:bad direct addr: %d bad indirect addr: %d LINK COUNT TABLE OVERFLOWINCORRECT BLOCK COUNT I=%llu (%d should be %d)UNKNOWN FILE TYPE I=%lluROOT INODE UNALLOCATEDALLOCATECANNOT ALLOCATE ROOT INODE DUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYFIXBAD STATE %d FOR ROOT INODE DIRECTORY TOO SHORTDIRECTORY %s: LENGTH %lu NOT MULTIPLE OF %dMISSING '..'BAD INODE NUMBER FOR '..'BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' BAD TYPE VALUE FOR '..'CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '..' EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEUNALLOCATEDDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORY (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%llu ZERO LENGTHBAD/DUP%u: %2x summary info for cg %d is %d, %d, %d,should be %d, %d, %d SUMMARY INFORMATIONS WRONG FOR CG #%dblk_bitmap:bbmap:BLK(S) MISSING IN BIT MAPS #%dino_bitmap:ibmap:INODE(S) MISSING IN BIT MAPS #%dsummary info bad in superblock: %d, %d should be %d, %d SUPERBLK SUMMARY INFORMATION BADstrdup failedrealloc failedmalloc failed/r%s (%s): UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat rootCan't stat %s %s is not a character device %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: CANNOT READ DISKLABEL %s: NOT LABELED AS A EXT2 FILE SYSTEM (%s) %s: BLOCK SIZE DETERMINED TO BE ZERO BAD SUPER BLOCK: %s MAGIC NUMBER WRONGBAD LOG_BSIZEBAD BLOCKS PER GROUPcompat 0x%08x, incompat 0x%08x, compat_ro 0x%08x INCOMPATIBLE FEATURE BITS IN SUPER BLOCKsuperblock mismatchesoffset %ld, original %ld, alternate %ld VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATECan't stat %s: %s %s is not a character deviceCan't open %s: %s ** %sNO WRITE ACCESS (NO WRITE)cannot allocate space for superblock LOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO FSCK_FFS TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ext2fs(8).USING ALTERNATE SUPERBLOCK AT %d state = %d ** F%sile system is clean; not checking ** File system is already clean IMPOSSIBLE RESERVED BLOCK COUNT=%d IN SUPERBLOCKSET TO DEFAULTWRONG FPG=%d (BPG=%d) IN SUPERBLOCKBAD SUMMARY INFORMATIONcannot alloc %u bytes for blockmap cannot alloc %u bytes for statemap cannot alloc %u bytes for typemap cannot alloc %u bytes for lncntp cannot alloc %u bytes for inphead bad file type 0%o cannot allocate buffer pool INTERNAL ERROR: GOT TO reply()%s? no %s? yes %s? [Fyn?] (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %d CANNOT %s: BLK %dProgram terminated WRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN: %lld (%lld), %lld,PARTIALLY WRITING %sZERO'ED BLOCK %d TO DISK UPDATE STANDARD SUPERBLOCKSPanic: lost %d buffers MARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEANcache missed %ld of %ld (%d%%) READTHE FOLLOWING DISK SECTORS COULD NOT BE READ:deadlocked buffer pool %6d usage: %s [-benstuv] [file ...] benstuvH PT` P P P P P```H\__P`P`DDhOhOy$x0u@zLTW\WVdH|Jphxpg@8]8]xgfeIIII`r|Pr MM0K<KHK0>KPKXK` Mh MpK|KKKLP P P P P@ P Ptxw \s[ZZDLHH0k(Yi i@x0$aXi i  (48@(LdT\dhpx          , 0 8 D HP\dpx (4<HT\hlxd|      (08@LX d!p"|#$%&'()*+,-. /0$102<3H4T5`6l7x89:;<=>?@ABCDE F,G8HDIPJ\KhLtMNOPQRSTUVWXYZ[(\4]@^L_Xdhpt       @$0<DLT`dlt| G/H#T` $,dd8 $,dd8@LT\drandommalformed link-level addressSIOCSIFLLADDRSIOCIFAFDETACHSIOCIFAFATTACHSIOCGIFXFLAGSSIOCSIFXFLAGS[#%d]SIOCG80211WPAPARMSSIOCS80211WPAPARMSSIOCGIFFLAGSSIOCSIFFLAGSSIOCIFDESTROYmedia mode %smediaopt instance %lld"%.*s"0xSIOCGIFGROUPgetifgroups groups:usage: ifconfig [-AaC] [interface] [address_family] [address [dest_address]] [parameters] invalid channel %s: %sSIOCS80211CHANNELprefix %s: %sSIOCGIFMEDIA%s: no link type?only one `instance' command may be issuedmust specify `media' before `instance'media instance %s: %sonly one `mode' command may be issuedmtu %s: %sSIOCSIFMTUinet6autoconf not allowed for this AFbad hexadecimal digitshexadecimal digits too longstrings too longSIOCS80211NWIDmalformed BSSID: %sSIOCS80211BSSID%s: bad value%s=%o%s=%xInvalid trunk protocol: %sSIOCSTRUNKSIOCSTRUNKDELPORTSIOCSTRUNKPORTSIOCGETVLANSIOCSETVLANvlan tag %s: %s vlan: %d parent interface: %s SIOCG80211ALLCHANS %4s %-8s %s chanfreqproperties %4d %4d MHz passive scan%d: bad prefixlen trunk: trunkproto %s trunkdev %sstrdup trunk id: [(%04X,%s,%04X,%04X,%04X), (%04X,%s,%04X,%04X,%04X)] trunkport %s MASTERSTACKACTIVECOLLECTINGDISTRIBUTINGDISABLED supported trunk protocols: trunkproto %s trunk: trunkdev %s invalid vlan tag and device specificationinvalid %s %s: %s%s not allowed for the AFvltimepltimeunknown %s media mode: %sinvalid media mode: %sunknown %s media subtype: %sonly one `media' command may be issuedmay not issue `media' after `mode' commandsmay not issue `media' after `mediaopt' commandswpagroupcipher: unknown cipher: %sunknown %s media option: %sonly one `-mediaopt' command may be issuedmay not issue both `media' and `-mediaopt'only one `mediaopt' command may be issuedmay not issue `mediaopt' after `instance'wpaciphers: unknown cipher: %spsk802.1xwpaakms: unknown akm: %swpa1wpa2wpaprotos: unknown protocol: %snwid chan %u bssid %s lladdr %s %u%% %ddBm powersave %uMESSIBSSCF_POLLABLECF_POLLREQPRIVACYSHORT_PREAMBLEPBCCCHNL_AGILITY SPECTRUM_MGMT QOS SHORT_SLOTTIME APSD RADIO_MEASUREMENTDSSSOFDMDELAYED_B_ACKIMMEDIATE_B_ACK,wpa2,wpa1,wep,802.1xCACHEBSSAUTHASSOCCOLLECT no permission to scanSIOCG80211ALLNODES none restore ieee80211: nwid chan %u bssid %s %u%% %ddBm nwkey persist%d: wpakey wpaprotos %swpa2 wpaakms %s802.1x wpaciphers wpagroupcipher powersave on (%dms sleep)HIDENWIDNOBRIDGEUPBROADCASTDEBUGLOOPBACKPOINTOPOINTNOTRAILERSRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTMPSAFEINET6_NOPRIVACYMPLSWOLAUTOCONF6 rdomain %d metric %lu mtu %lu lladdr %s status: %s %s: no media types? media: supported media: tunnel: inet%s %s -> %s:%u vnetid %d ttl %dunsetifgroup: group names may not end in a digitunsetifgroup: group name too longSIOCDIFGROUPsetifgroup: group names may not end in a digitsetifgroup: group name too long SIOCAIFGROUPSIOCG80211NWIDwpakey: invalid pre-shared keywpakey: passphrase must be between 8 and 63 characterswpakey: nwid not setwpakey: passphrase hashing failedSIOCS80211WPAPSKpersist:SIOCS80211NWKEY: too many keys.0x%sInvalid WEP key lengthSIOCS80211NWKEYinterface index is already filledgetifaddrscould not determine link local address inet6 %sSIOCGIFDSTADDR_IN6 -> %sSIOCGIFNETMASK_IN6 prefixlen %dSIOCGIFAFLAG_IN6 anycast tentative duplicated detached deprecated autoconf autoconfprivacy scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime inet %sSIOCGIFNETMASKSIOCGIFDSTADDR --> %s netmask 0x%xSIOCGIFBRDADDR broadcast %sSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesSIOCIFCREATEinvalid carp demotion: %scarpdemoteSIOCSIFGATTRSIOCGIFGATTR carp demote count %d%s: no such interface SIOCGIFGMEMBprintgroupinterface name '%s' too longdestroy'%s' requires argument'%s' requires 2 argumentsSIOCDIFADDRSIOCAIFADDRarp-arpdebug-debugalias-aliasdeletenetmaskmtunwid-nwidbssid-bssidnwkey-nwkeywpa-wpawpaakmswpacipherswpagroupcipherwpaprotoswpakey-wpakey-chanbroadcastvlanvlandev-vlandevgroup-groupautoconf-autoconftrunkport-trunkporttrunkprotoanycast-anycasttentative-tentativeeui64autoconfprivacy-autoconfprivacypowersavepriorityrtlabelnwflagrdomain-inet-inet6descriptiondescrwol-wollink0-link0link1-link1link2-link2mediamediaopt-mediaopt-modeinstanceinstlladdrinetEthernetetherFDDIIEEE802.11TDMCARPautoselectmanual10baseT10baseT/UTP10UTP10base210base2/BNC10BNC10base510base5/AUI10AUI100baseTX100TX100baseFX100FX100baseT4100T4100baseVG100VG100baseT2100T21000baseSX1000SX10baseSTPSTP10STP10baseFLFL10FL1000baseLX1000LX1000baseCX1000CX1000baseT1000T1000baseTX1000TXHomePNA1HPNA110GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10GbaseCX410GCX410GBASE-CX42500baseSX2500SX10GbaseT10GT10GBASE-T10GSFP+Cu10GCuSingle-modeSMFMulti-modeMMFCDDIFH1FH2DS2DS5DS11DS1DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72HT-MCS0HT-MCS1HT-MCS2HT-MCS3HT-MCS4HT-MCS5HT-MCS6HT-MCS7HT-MCS8HT-MCS9HT-MCS10HT-MCS11HT-MCS12HT-MCS13HT-MCS14HT-MCS15HT-MCS16HT-MCS17HT-MCS18HT-MCS19HT-MCS20HT-MCS21HT-MCS22HT-MCS23HT-MCS24HT-MCS25HT-MCS26HT-MCS27HT-MCS28HT-MCS29HT-MCS30HT-MCS31HT-MCS32HT-MCS33HT-MCS34HT-MCS35HT-MCS36HT-MCS37HT-MCS38HT-MCS39HT-MCS40HT-MCS41HT-MCS42HT-MCS43HT-MCS44HT-MCS45HT-MCS46HT-MCS47HT-MCS48HT-MCS49HT-MCS50HT-MCS51HT-MCS52HT-MCS53HT-MCS54HT-MCS55HT-MCS56HT-MCS57HT-MCS58HT-MCS59HT-MCS60HT-MCS61HT-MCS62HT-MCS63HT-MCS64HT-MCS65HT-MCS66HT-MCS67HT-MCS68HT-MCS69HT-MCS70HT-MCS71HT-MCS72HT-MCS73HT-MCS74HT-MCS75HT-MCS76t1t1-amie1e1-g.704e1-amie1-ami-g.704t3t3-m13e3e3-g.751e3-g.832e1-g.704-crc411a11b11gfh11nmasterfull-duplexfdxhalf-duplexhdxflag0flag1flag2loopbackhw-loopbacklooprxpausetxpausedual-attachdasadhochostapibssibss-mastermonitorhdlc-crc16pppframerelay-ansiframerelay-ciscoframerelay-ituno carrierno networkbackupactivekeepalive downroundrobinfailoverlacploadbalancedefaultusegroupwep40tkipccmpwep104 %s: %s: %s: directory causes a cyclefts_readCOLUMNSstdio rpath getpw1ACFHLRSTacdfghiklmnopqrstux%*llu %*qd total %llu %b %e %H:%M:%S %Y%s %*u %-*s %-*s %3d, %3d %*s%*qd %*s ls: %s: %s usage: %s [-1AaCcdFfgHhikLlmnopqRrSsTtux] [file ...] usage: sysctl [-n] name %s=kern.osreleasehw.machinehw.modelhw.producthw.disknameshw.ncpufoundusage: ping6 [-dEefHLmnqv] [-c count] [-h hoplimit] [-I sourceaddr] [-i wait] [-l preload] [-p pattern] [-s packetsize] [-V rtable] [-w maxwait] host Vr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->IP6HBH DSTOPT FRAG RTHDR AH ICMP6: type = %d, code = %d ESPUnknown Header(%d) ...No Route to DestinationDestination Administratively UnreachableDestination Unreachable Beyond ScopeDestination Unreachable, Bad Code: %d Packet too big mtu = %d Time exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option Bad code(%d) pointer = 0x%02x Listener QueryListener ReportListener DoneRouter SolicitationRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sBad ICMP type: %d--- %s ping6 statistics --- +%ld duplicates, %.1lf%% packet losspath MTU for %s is notified. (ignored) nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu HbH Options: Dst Options: Routing: failed to get receiving hop limitfailed to get receiving packet informationsignature missing!%d bytes from %s, icmp_seq=%u hlim=%d dst=%s(DUP!)extra (%d bytes %s)sendmsgping6: wrote %s %d chars, ret=%d hoplimit is %s: %sc:dEefHh:I:i:Ll:mNnp:qS:s:V:vw:host %s: %shost resolves to multiple addressesgetaddrinfo failedinvalid source address: %sinvalid source addresssetsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionssetsockopt IP6_MULTICAST_LOOPUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memoryUDP socketUDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)setsockopt(SO_RTABLE)UDP connectgetsocknamesetsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6 %s (%s --> %s): %d data bytes new path MTU (%d) is notified usage: %s [-aju] [-d dst] [-r seconds] [-t minutes_west] [-z output_zone] %-*s[+format] [[[[[[cc]yy]mm]dd]HH]MM[.SS]] illegal time formatUTCcannot unsetenv TZ-t %s: %sad:jr:ut:z:settimeofday%a %b %e %H:%M:%S %Z %Yspecified date is outside allowed rangeCould not get local time of dayadjtime???date set by %sstdio rpath wpathtoo many argumentsconversion errorusage: %s ioctl SMODEWSMOUSEIO_SCALIBCOORDSmmap/dev/ttyC0open /dev/ttyC0/dev/wsmouseopen /dev/wsmouseWSMOUSEIO_GCALIBCOORDSmouse.scale=%d,%d,%d,%d,%d,%d,%d  $(0<|DLT\ , @4<@ H@PL`lxusage: %s [-23bcdilsTU] [-a maxreadahead] [-g maxgroups] [-I readdirsize] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-w writesize] [-x retrans] rhost:path node hostname too longno : or @ speccan't resolve address for host %sNFS PortmapCannot MNT RPCbad MNT RPCcan't access %s-2 and -3 are mutually exclusiveillegal -a value %s: %sillegal -g value %s: %sillegal -I value %s: %sconflicting version optionsillegal -R value %s: %sillegal -r value %s: %sillegal -t value %s: %sillegal -w value %s: %sillegal -x value %s: %s23a:bcdD:g:I:iL:lo:PR:r:sTt:w:x:Ubgconndumbtimernfsv3mntudpresvportnfsv2acunused 00000000-0000-0000-0000-000000000000DOS FAT-12 ebd0a0a2-b9e5-4433-87c0-68b6b72699c7XENIX / XENIX /usr DOS FAT-16 ebd0a0a2-b9e5-4433-87c0-68b6b72699c7Extended DOSDOS > 32MB ebd0a0a2-b9e5-4433-87c0-68b6b72699c7NTFS ebd0a0a2-b9e5-4433-87c0-68b6b72699c7AIX fs AIX/Coherent OS/2 Bootmgr Win95 FAT-32ebd0a0a2-b9e5-4433-87c0-68b6b72699c7 Win95 FAT32Lebd0a0a2-b9e5-4433-87c0-68b6b72699c7DOS FAT-16 ebd0a0a2-b9e5-4433-87c0-68b6b72699c7Extended LBAOPUS OS/2 hidden ebd0a0a2-b9e5-4433-87c0-68b6b72699c7Compaq Diag.OS/2 hidden ebd0a0a2-b9e5-4433-87c0-68b6b72699c7OS/2 hidden ebd0a0a2-b9e5-4433-87c0-68b6b72699c7OS/2 hidden ebd0a0a2-b9e5-4433-87c0-68b6b72699c7AST swap Willowtech ThinkPad Recebd0a0a2-b9e5-4433-87c0-68b6b72699c7$NEC DOS 'Win Recoveryde94bba4-06d1-4d40-a16a-bfd50179d6ac Willowsoft 8Theos 9Plan 9 @VENIX 286 ALin/Minux DRBLinuxSwap DRaf9b60a0-1431-4f62-bc68-3311714a69adCLinux DR MQNX 4.2 Pri NQNX 4.2 Sec OQNX 4.2 Ter PDM QDM RCP/M or SysVSDM TOntrack UEZ-Drive VGolden Bow \Priam aSpeedStor cISC, HURD, *dNetWare 2.xxeNetWare 3.xxfNetWare 386 gNovell hNovell iNovell pDiskSecure uPCIX ChromeKernelfe3a2a5d-4f32-41a7-b725-accc3285a309Minix (old) Minix (new) Linux swap 0657fd6d-a4ab-43c4-84e5-0933c84b4f4fLinux files*0fc63daf-8483-4772-8e79-3d69d8477de4OS/2 hidden Linux ext. NT FAT VS NTFS VS Linux LVM e6d6d379-f507-44c2-a23c-238f2a3df928Amoeba FS Amoeba BBT Mylex BSDI NotebookSaveFreeBSD 516e7cb4-6ecf-11d6-8ff8-00022d09712bOpenBSD 824cc7a0-36a8-11e3-890a-952519ad3f61NEXTSTEP MacOS X 55465300-0000-11aa-aa11-00306543ecacNetBSD 516e7cb4-6ecf-11d6-8ff8-00022d09712bMacOS X boot426f6f74-0000-11aa-aa11-00306543ecacMacOS X HFS+48465300-0000-11aa-aa11-00306543ecacBSDI filesy*BSDI swap Solaris 6a85cf4d-1dd2-11b2-99a6-080020736631CTOS DRDOSs FAT12DRDOSs < 32MDRDOSs >=32MHPFS DisbledCPM/C.DOS/C*Dell Maint SpeedStor SpeedStor SpeedStor BeOS/i386 42465331-3ba3-10f1-802a-4861696b7521EFI GPT EFI Sys c12a7328-f81f-11d2-ba4b-00a0c93ec93bSpeedStor DOS 3.3+ SecSpeedStor Xenix BBT [[oƶ~W ۅK%:pl1vb)BQ#5EҎϷ&:q:.Iq֬m\^s| [~&k^j=CWZ|t:7\U?[\Caă<fa&,r8ӱ-7iLպӹw_V~p{-Cq^x܊K\"Ofb&b6T$SLTY ɏq8ŢBOEJʊ) <63Mk~TD{of‚fڢ=*-:Kq A`XΣzF+/,J?J4\$9@:&Yk9̓y%mlZKTcŖ4<ë۩xϿpM7Sq)O/ `H]LŶd, iyl{$dFNez|V[B$Bsz2HC؎BmXZ\R.8\".Q*ؑsp1Jl ΙyiEQ#uNgN[FU>#lv) P@8| XguJIõp,4녗30!֕;/]IxV.ښP>Y$؇'(KޖZ0eUə8_t* *}H0L9uupu}Z34zF_j,u.3 $tL=wY](( =wYq{]=k]fݡM?GBAP~UPQ2Y,dK8g.өjKUV鿾"ULkvzc"s(mȆEq"k&P~}NH)} “"t\"Z ?s)o8$0Zܡ5|kuws3% +Å/6.[AIj|Hr,;Ԃ._|p^I4^iBMd̩\eDVt+:TKiU1PsQƮG~Tu IHnD(N$8z Pi5Tܦ}H6H2R)MK AI*=l+IIʉlǐ])q:,ihh]zB6Tu]HsG .UO8N Rnd*j7DQ-F05r%a +wشxAދ_/ćkq}!.;NI?.$AS|G.f15IJնSFa׋"ym~,§n$GeXa/vra=˼\vB;?X~ a4&GMQnOq}9?;;=< (d!5~|? 򭼓HM%T5zOW`18:>'7_a|6oZz[^ZpdcR(wvr6 AE]\KlbkۜjV8 6;{Z%\ΣSjLAk Ͳ|Ῥ=r/z 5O;<7 Llgd"|_q©u vje53x)HT(ɨ1)F {H::@Fy;I㜗\Q3"}aV+A &=A:7B>jֽ]`&108¢4ٖ a5YģSn}-WR81-W&ZME6C~Jp.o|7 yDNl8p?jw٦CM-$2ҫ7t22(@TB٨'+"yw2p OgWĿ^)g_#En7ϙ2Ujse"_ /_{+g|Ǚ YZJήcoWmJ~ǟ/믵GNX\/Q^ vwqPƕ@=_tKgTp@>.KQև&HN*Pg*eV|"9K&g$yK[q`~Q2VOm\ƺhݾ(׏RA/>Hywqw)tOyω˻_sd^hpΎ;ef[fGV9*I(KUG~1ߛ`%NKϐŏȉ[;A:w~!zvl+,0)dQ5M)ʅag`,A?q\X?蝠O̬?Y? \I6Ţ/?@or^i|<zr'`u ?:=N`t|_?Z!Q++(7+[%G+Ţ?0G8;ri\y‹_BovS=vu2ъ~s!.n{F\KϏ++(qkT2t9USˁN)}fvm$E#S í<*+i1,T+ggc7Ĝ>%dtkg ?a!cqQ9~9h)@zǝ_֋) d2mg cg& J#ɃUOiaU \ē=' 4xi v[_5 NuD94Yׁ>p, `zxHo kmx<wMP479I1__⾠- UbI?bc*\ o(Bv՜%FX%Ii6S*kfn")h@ucT)S_ȳ ?OȞmn^:ﷶUmo, qWDx&;LǠ6 %?ausage: %s [-egvy] [-i|-u] [-b #] [-c # -h # -s #] [-f mbrfile] [-l # ] disk -b: specify special boot partition block count; requires -i -chs: specify disk geometry; all three must be specified -e: interactively edit MBR or GPT -f: specify non-standard MBR template -g: initialize disk with GPT; requires -i -i: initialize disk with MBR unless -g is also specified -l: specify LBA block count; cannot be used with -chs -u: update MBR code; preserve partition table -v: print the MBR, the Primary GPT and the Secondary GPT -y: do not ask questions `disk' may be of the forms: sd0 or /dev/rsd0c. stdio rpath wpath disklabel proc execCylinder argument %s [1..262144].Head argument %s [1..256].Sector argument %s [1..63].Block argument %s [64..%u].iegpuvf:c:h:s:l:b:yCan't read sector 0!disk too large (%llu sectors). size truncated.using builtin MBRUnable to read MBR from '%s'Unable to read complete MBR from '%s'Do you wish to write new GPT?Do you wish to write new MBR and partition table?Do you wish to write new MBR?Primary GPT: Not FoundSecondary GPT: MBR:Enter 'help' for informationfdisk:%c%d> Invalid command '%s'. Try 'help'. Aborting changes to current MBR.helpCommand help listShow entire OpenBSD man page for fdiskreinitRe-initialize loaded MBR (to defaults)setpidSet the identifier of a given table entryEdit current drive statseditEdit given table entryflagFlag given table entry as bootableUpdate machine code in loaded MBRSelect extended partition table entry MBRSwap two partition entriesPrint loaded MBR partition tablewriteWrite loaded MBR to diskexitExit edit of current MBR, without saving changesQuit edit of current MBR, saving current changesabortAbort program without saving current changes%s [n] %s [%llu - %llu]: [%llu] %s is out of range: %c%s%c %s is invalid: %c%s%c Partition id ('0' to disable) [01 - FF]: [%X] (? for help) '%s' is not a valid number. '%x' is out of range. %s [%d - %d]: [%d] %s is %s: %s. BytesSectorsKilobytesMegabytesGigabytesTerabytesDisk: %s geometry: %d/%d/%d [%.0f %d-byte geometry: %s is not a character device or a regular fileDIOCGPDINFOCan't get disk geometry, please use [-chs] or [-l]to specify.Offset: %lld Signature: 0x%X Start of partition #%d after end! Starting Ending LBA Info: #: id C H S - C H S [ start: size ]-------------------------------------------------------------------------------%c%1d: %.2X %6u %3u %3u - %6u %3u %3u [%12llu:%12.0f%s] %s Warning CHS values out of bounds only saving LBA valuesChoose from the following Partition id values:%02X %s %02X %s %02X %s %02X %s partition number is %s: %s. flag value is %s: %s. Partition %d flag value set to 0x%llx. Partition %d marked active. Machine code updated.partition number is invalid:partition number is %s: %s %d same partition as %d, doing nothing. MBRGPT %s %s MBR contains more than one OpenBSD partition!Write MBR anyway?Writing MBR at offset %lld. error writing MBRWriting GPT.error writing GPTPartition %d is not an extended partition. Loop to offset 0! Not selected.Selected extended partition %d New MBR at offset %lld. could not create guid for partitionPartition %d is disabled. Partition offsetPartition sizepartition namepartition name must be < %d characters Do you wish to edit in CHS mode?BIOS Starting cylinderBIOS Starting headBIOS Starting sectorBIOS Ending cylinderBIOS Ending headBIOS Ending sectorChange disk geometry?BIOS CylindersBIOS HeadsBIOS SectorsgptmbrUnrecognized modifier '%s' Use 'write' to update disk.OpenBSD Area%c%3d: %-36s [%12lld: %12.0f%s] %-36s %-36s #: type [ start: size ] guid name------------------------------------------------------------------------Disk: %s Usable LBA: %llu to %llu [%.0f GUID: 0123456789A:B:CEFGHILRUVabce:f:hilnoqrsuvwxy ABCD E0F@GPH`U|Vxa`bcle\fthiLlnqqrsvwxuinvalid file type(standard input)(fd %d)usage: %s [-abcEFGHhIiLlnoqRsUVvwx] [-A num] [-B num] [-C[num]] [-e pattern] [-f file] [--binary-files=value] [--context[=num]] [--line-buffered] [pattern] [file ...] ^\((%s[[:<:]]%s%.*s%s[[:>:]]%scontext out of rangecontext %sgrep version %u.%u binarywithout-matchtextUnknown binary-files optionwarning: recursive search of stdinCan't use small fgrep with -wbinary-filesline-bufferedafter-contextbefore-contextextended-regexpfixed-stringsbasic-regexpwith-filenamebyte-offsetregexpno-filenameignore-casefiles-without-matchfiles-with-matchesline-numberquietsilentrecursiveno-messagesrevert-matchword-regexpline-regexpunix-byte-offsetsreallocarrayreallocLine is too big to process--Binary file %s matches usage: %s %s umount [-fv] special | nodeumount -a [-fv] [-h host] [-t type]%s: not currently mounted%s: not a directory or special device%s: unmount from %s afh:t:v $(0<|DLT\x@usage: mount_msdos [-9lsx] [-g gid] [-m mask] [-o options] [-u uid] special node invalid file mode: %suser is %s: %sgroup is %s: %ssl9xu:g:m:o:stat %snot an MSDOS filesystemfsck_%snostart %s %swait %s%s/fsck_%sexec %sCan't set resource limit to max data sizeCan't get resource limit for data size-b %s-l %s: %sInvalid option stringusage: %s [-dfNnpvy] [-b block#] [-l maxparallel] [-T fstype:fsoptions] [-t fstype] [special | node ...] b:dfl:nNpT:t:vy%s: unknown special file or file system.Can't open checklist file: %s/etc/fstabpass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s: Unknown pid %lddone %s: %s (%s) = %x %s: %s (%s): EXITED WITH SIGNAL %d THE FOLLOWING FILE SYSTEM%s HAD AN %s UNEXPECTED INCONSISTENCY:%s: %s (%s)%s5MS7) usage: %s [-dfln] [+linenum | +/pattern] name1 name2 ... %s: unknown option "-%c" out of memory! No previous command to substitute fortcgetpgrpTERMlicohcxnxssosgulospccmcdbcti ...Skipping back ...Skipping %sto file %s --More--(Next file: %s)(%d%%)[Press space to continue, 'q' to quit.][Use q or Q to quit]Line too longNo previous regular expression...skipping Pattern not found Pattern not found "%s" line %lld[Not a file] line %lld...back %d page...skipping %d line ***Back*** [Press 'h' for instructions.] ******** %s: Not a text file ******** *** %s: directory *** stdio rpath ttyMORE:::::::::::::::::::::::::::: Most commands optionally preceded by integer argument k. Defaults in brackets. Star (*) indicates argument becomes new default. ------------------------------------------------------------------------------- Display next k lines of text [current screen size] z Display next k lines of text [current screen size]* Display next k lines of text [1]* d or ctrl-D Scroll k lines [current scroll size, initially 11]* q or Q or Exit from more s Skip forward k lines of text [1] f Skip forward k screenfuls of text [1] b or ctrl-B Skip backwards k screenfuls of text [1] ' Go to place where previous search started = Display current line number / Search for kth occurrence of regular expression [1] n Search for kth occurrence of last r.e [1] ! or :! Execute in a subshell v Start up /usr/ucb/vi at current line ctrl-L Redraw screen :n Go to kth next file [1] :p Go to kth previous file [1] :f Display current file name and line number . Repeat previous command ------------------------------------------------------------------------------- TERMCAP/usr/share/misc/termcapTERMPATHHOME.termcap /usr/share/misc/termcapOOPS, )c]!!\cX%`-V%`,i\1Sn6i!XfffffffffffffffffffffffffffffffmRQw }dNfev_gY&V0V$xYMuAAM pywy@so+lRJ'x/C/=M+ O$+malloc %zuuntrusted comment: invalid comment in %s; must start with '%s'comment too longmissing new line after base64 in %sinvalid base64 encoding in %sEdunsupported file %sverification failed: checked against wrong keysignature verification failedSignature Verifieddup failedcan't open %s for %snot a valid file: %smsg too large in %sread from %susage: %1$s -V [-eq] [-x sigfile] -p pubkey -m message verify with /etc/signify//../untrusted path %smust specify pubkeystdio rpath wpath cpath ttyCGSVc:em:np:qs:x:setvbufmust specify sigfile with - message%s.sigpath too longmust specify messagewrite to %susage: %s [-m mode] fifo_name ... usage: %s [-m mode] name b|c major minor %s [-m mode] name p node must be type 'b' or 'c'.non-numeric major number.non-numeric minor number.major or minor number too largemkfifoinvalid file mode.m:stdio rpath wpath cpath dpath fattr-1%s:*:%s:%s:%s:%s:%s usage: pwd_mkdb [-c] [-p | -s] [-d directory] [-u username] file %s.orig/etc/spwd.db%s.tmp/etc/pwd.dbat line #%dline %d: superuser override in YP inclusionline %d: wheel override in YP inclusionwrite oldcan't find user in master.passwdbasedir too longusername too longcd:psu:v_shadowcannot find `%s' in the group database, aborting%s must be specified as an absolute path%s: unable to set group to %s%s: unable to make group readablestdio rpath wpath cpath getpw fattr flock__YP!close edpclose dpclose oldfclose/etc/passwd/etc/master.passwdG/H#T`0123456789abcdefUGHRBD M@dmCLS1@2 3cPT l@bconnectedstaticospfis-isbgpbad label: %s is %sinvalid table id: %slabel too longprefixlen is not supported with af %dprefixlen %s is %s%s: link %s; %s: inet %s; %s: inet6 %s; priority is %s: %s sockaddrs: locks: inits: set_metric mtu: %s is %sset_metric expire: %s is %sking bula sez: set_metric with invalid key route to: %s routing message version %d not understoodmessage length mismatch, in packet %d, returned %dRTM_GET: %s (errno %d)destination: %s mask: %s gateway: %s interface: %.*s if address: %s mpls label: %s %s priority: %u (%s) flags: label: %s use mtu expire%8llu %8u%c %8lld%c sockaddrs: [rtm_type %d out of range]: len %d, if# %d, name: %s, link: %s, flags:, metric %d, flags:, if# %d, name %s, what: arrivaldeparture, priority %d, table %u, ifidx %u, pid: %ld, seq %d, errno %d flags: use: %8llu mtu: %8u%c expire: %8lld%cso_dstso_gateso_maskso_ifpso_ifaso_labelso_srcwriting to routing socketread from routing socketroute-sysctl-estimateactual retrieval of interface tablestdio rpath dnsgot message of size %d on %s128internal error%s: resolved to multiple valuesmpls labels require -in or -out switch%s: not a network%s: bad address%d: bad address familybotched keyword: %susage: %s [-dnqtv] [-T tableid] command [[modifiers] args] commands: add, change, delete, exec, flush, get, monitor, show setrtablemust be root to alter routing table-mplslabel requires -inet or -inet6-in requires -mpls-out requires -mpls-out requires -push, -pop, -swap-pop requires -mpls-push requires -mpls-swap requires -mplsnetmask missing%s %s %s: gateway %sentry in userouting table overflownot in tableno such interface %sactual retrieval of routing tableExamining routing table from sysctl(address family %s) write to routing socketgot only %d for rlen %-20.20s donednqtT:vrouting table %dsetsockopt(ROUTE_MSGFILTER)setsockopt(ROUTE_TABLEFILTER)addblackholechangecloningdstexpiregatewaygethopcountifaifpjumbolinkllinfolockrestmpathmplslabelnojumbonostaticpopproto1proto2pushrecvpiperejectrttrttvarsasendpipeshowssthreshRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics or flagsRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_RESOLVE: Route created by cloningRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_IFINFO: iface status changeRTM_IFANNOUNCE: iface arrival/departureRTM_DESYNC: route socket overflowPUSHLOCALPOPSWAPlink#%dillegal prefixlen%s/%d%u/%d%u.%u/%d%u.%u.%u/%d%u.%u.%u.%u/%daf %d: %s(%d) %s%-6s %-*.*s InternetInternet6Encap Protocol Family %d: MPLS%-18s %-5s %-18s %-5s %-5s %-22s SourcePortProtoSA(Address/Proto/Type/Direction)%-9s %-9s %-6s %-18s %-6.6s %5.5s %8.8s %5.5s %4.4s %s In labelOut labelOpGatewayFlagsRefsUseMtuPrioInterface%-*.*s %-*.*s %-6.6s %5.5s %8.8s %5.5s %4.4s %sIfaceLabel%-6.6s %5u %8llu %5u %5s %2d %-5.16ssysctl of routing tableRouting tablesExtra `@' characters in usernames and passwords should be encoded as %%40 KMGTPftp://http://file::/Can't allocate memory for URL decodingerror in base64 encoding <>"#{}|\^~[]`receivedCan't allocate memory to parse URLurl_get: Invalid URL '%s'No `/' after host (use -o): %sNo filename after host (use -o): %sNo filename after directory (use -o): %sCan't allocate memory for proxy host.Can't allocate memory for proxy URL.Malformed proxy URL: %sCan't open file %sCan't open %sCan't allocate memory for transfer bufferWriting %sReading from file(unknown)Trying %s... r+Requesting %sCan't allocate memory for URL encoding%%%02x (via %s) GET %s HTTP/1.0 Proxy-Authorization: Basic %s Host: %s %s%s GET %s HTTP/1.0 Host: %s %s%s GET /%s %s Host: HTTP/1.0Can't allocate memory.[%s]:%sWriting HTTP requestReceiving HTTP replyError retrieving file: %sToo many redirections requestedContent-Length: Location: Relative redirect not supportedCannot allocate memory for URLRedirected to %s Reading from socketRead short file. Auto-login using ftp URLs isn't supported when using $ftp_proxyImproper response from %sftp_proxyhttp_proxyCan't allocate memory for auto-fetch.Invalid URL: %sCan't connect or login to host `%s'*?[]{}NLSTRetrieving %s/%s mget file fetch aborted. http fetch aborted. Forced abort. The connection will be closed. local: %srunique: can't find unique file name. receive aborted waiting for remote to finish abort. acceptsetsockopt TOS (ignored)%c%c%c421 Service not available, remote server has closed connection. Lost control connection for abort.%cABOR No control connection for command.QUITRETRSTOUSTORPASVproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s use of scoped address can be troublesomeEPSVwrong server: return code must be 229 LPSVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uBad family! %c%c%c%d%cparse error! setsockopt (reuse address)setsockopt IP_PORTRANGE (ignored)setsockopt IPV6_PORTRANGE (ignored)listenEPRT |%d|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dlocal: %s remote: %s REST %lldnetin%s: short writeWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sftpgatehttp%s: bad port number `%s'connect to address %sfdopen failed.Connected to %s. usage: %1$s [-o output] ftp://[user:password@]host[:port]/file[/] ... %1$s [-o output] http://host[:port]/file ... %1$s [-o output] file:file ... %1$s [-o output] host:/file[/] ... FTPSERVERPORTFTPMODEpassivegateunknown FTPMODE: %s. Using defaultsgate-ftpFTPSERVERNeither $FTPSERVER nor $GATE_SERVER is defined; disabling gate-ftpdumbemacssukeep alive amount is %s: %sretry amount is %s: %s46AaCc:dD:Eegik:Mmno:pP:r:S:s:tU:vVUser-Agent: OpenBSD ftpstdio rpath dns tty inet fattrstdio rpath wpath cpath dns tty inet fattrnmap: unbalanced brackets. CWD %sCWD command not recognized, trying XCWD. XCWD %scan't get cwdSkipping non-relative filename `%s' a+winternal error: unknown type %d.TYPE %s %sTYPE %susage: %s [ | Using %s mode to transfer files. %s: unknown mode. asciiimage%lld byte%s %s in %.2f seconds (%.2f %sB/s) ETA: %02d:%02d:%02d %-*.*s%s %-*.*s%s %3d%% %3d%% |%.*s%*s|************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************* %5lld %c%c %2d:%02d:%02d --:-- ETA - stalled -%02d:%02d ETAUnable to determine real path of `%s'%s: not foundunable to create temporary file: %sftpXXXXXXXXXXLISTcan't find list of remote files, oops. can't find list of remote files, oops.anonymous%s@Name (%s:%s): Name (%s): USER %sPassword:PASS %sAccount:ACCT %sLogin %s failed.Already connected to %s, use close first. gateserver not defined (shouldn't happen)PASSERVE %sConnected via pass-through server %s non-printstreamSYSTRemote system type is %s. 215 UNIX Type: L8SIZE %sMDTM %s191Y2K warning! Fixed incorrect time-val received from server. %*s %04d%02d%02d%02d%02d%02dCan't convert %s to a time. usage: %s [-dn%sq] dlnpqhalted (with powerdown) by %shalted by %srebooted by %s~SIGTSTP init/etc/rc/dev/consolerevokesetsidopenSIGTERM processesWARNING: some process(es) wouldn't die(can't restart init):  $(0<|DLTx@\`[@usage: mount_ffs [-o options] special node filesystem must be mounted read-only; you may need to run fsckreload.@'50}"8}H}8P}X}?ؕd}t}}'} ou }&}}}#}`@$}4e}}}} ~  ~!~|9Ȃ܂00<,H0T0`9l0x0ăȃ,8C $,4H9\t9ăĄ܄C8C0H0T`l8ȅ0؅9C$8<8P9h0,CĆC؆0 00@0T0d|ȇ܇0(4@Xdp|ȈԈ(4@LXdp|ĉЉ܉ (@DP\htȊԊ(4@L0`lxċЋ܋ $0<HT`lx̌، ,8DP\htȍԍ(4@LXdp|ĎЎ܎ $0<HT`lx̏؏ ,8DP@lx0DCouldn't open '%s': %sCouldn't write contents to '%s': %sShort contents write to '%s' (%zd vs %zu)fchmod(fd, 0x%x) of '%s' failed (%s)fchown(fd, %d, %d) of '%s' failed (%s)short IMSG_WRITE_OPTION_DBwarning: hostname %s contains an underscore which violates RFC 952short IMSG_WRITE_RESOLV_CONF/etc/resolv.confwrite_option_db: imsg_compose: %swrite_option_dbwrite_resolv_conf: imsg_compose: %swrite_resolv_confInvalid option name: '%s'Unable to clone leaseUnable to apply defaultsCannot copy domain name listNo memory to decode domain searchsearch %s no memory for domainnamenameserver %s no memory for nameserver# Generated by %s dhclient no memory for courtesy lineno memory for resolv.conf contentsegresssocket errorno interface in group egress foundioctl SIOCGIFGMEMB: %sget_ifnametoo many interfaces in group egressInterface name too long: %sInterface name too longdaemoncannot forkchdir("/")%s [priv]no memory for priv_ibufpoll error: %simsg_read(priv_ibuf): %sUnable to truncate '%s': %s%s; restarting.RESTART FAILED: '%s': %s%s; exiting bootp; %s { %s interface "%s"; fixed-address %s; next-server %s; filename server-name option %s %s; renew %w %Y/%m/%d %T UTC; rebind %w %Y/%m/%d %T UTC; expire %w %Y/%m/%d %T UTC; } offeredcannot fit offered lease into option dbcannot make offered lease into stringeffectivecannot fit effective lease into option dbcannot make effective lease into stringlease file not opencannot make lease into stringoptions do not fit in DHCPDECLINE packet.options do not fit in DHCPREQUEST packet.options do not fit in DHCPDISCOVER packet.DHCPDECLINE on %saddressinuse: getifaddrs: %sdhcpoffer: no memory to create lease.option-dhcpoffer: unknown option %dBogus data for option %sMissing required parameter %s%s already configured on %sdhcpoffer: no memory for server name.Bogus server name %sdhcpoffer: no memory for filename.bound to %s -- renewal in %lld seconds.mtu size %u < 68: ignoredNo acceptable DHCPOFFERS received.Trying static lease %sTrying recorded lease %sNo working leases in persistent database - sleeping.DHCPDISCOVER on %s - interval %lldDHCPREQUEST on %s to %sUnsatisfactory %susage: %s [-d | -q] [-u] [-c file] [-i options] [-L file] [-l file] interface %s: no link .... got link sleeping No memory for rtmmsgroute socket buffer overflow%s, not %s, added to %s%s added to %sActive address (%s) deleted; exiting%s, not %s, deleted from %s%s deleted from %s%s downLLADDR changed; restarting%s departuredno memory for errmsg'%s' is not a regular filec:di:l:L:quifi calloc%s: no such interfacesetting routing table to %u: '%s'socketpair: %sno memory for unpriv_ibufconfig callocclient calloc/dev/nullcannot open %s: %s_dhcpno such user: _dhcp%s.%s/var/db/dhclient.leasesasprintf/etc/resolv.conf.tailCannot open /etc/resolv.conf.tail: %sCannot stat /etc/resolv.conf.tail: %sno memory for resolv.conf.tail contents: %sCouldn't read resolv.conf.tail: %sGot no data from resolv.conf.tailShort read of resolv.conf.tailcan't open and lock %s: %scan't open %s: %ssocket(PF_ROUTE, SOCK_RAW): %ssetsockopt(ROUTE_MSGFILTER): %ssetsockopt(ROUTE_TABLEFILTER): %s/var/empty/setresgidsetgroupsstdio inet dns routestdio inet dns route proc/etc/dhclient.confno memory for reject address!expecting option name.too many options.expecting hex octet.string constant too long.expecting string or hexadecimal dataexpecting ':'.expecting identifier after option keyword.unknown option name.expecting string.option data buffer overflowexpecting signed 32-bit integer.expecting unsigned 32-bit integer.expecting unsigned 16-bit integer.expecting unsigned 8-bit integer.expecting identifier.truefalseoffexpecting boolean.Bad format %c in parse_option_param.out of memory allocating option data.expecting interface name (in quotes).wrong interface name.expecting lease declaration.expecting left brace.no memory for lease.unterminated lease declaration.Obsolete client identifier (%s) in recorded leaseexpecting a statement.unterminated interface declaration.Corrupt lease file - possible data loss!get_rdomain socket: %sCan't create socketioctl(SIOCGIFFLAGS) on %s: %sinterface_link_forceup: SIOCGIFFLAGS failed (%s)interface_link_forceup: SIOCSIFFLAGS DOWN failed (%s)interface_link_forceup: SIOCSIFFLAGS UP failed (%s)%s receive_packet failed: %s%s too many receive_packet failures; exitinggetifaddrs failedpoll: %sdispatch%s; restartingsend_packet: %ssocket(SOCK_RAW): %ssetsockopt(IP_HDRINCL): %ssetsockopt(SO_RTABLE): %s/dev/bpf%dCan't find free bpf: %sCan't attach interface %s to %s: %sCan't get BPF version: %sKernel BPF version out of range - recompile dhclient!Can't set immediate mode on bpf device: %sCan't set filter-drop mode on bpf device: %sCan't get bpf buffer length: %sCan't allocate %lu bytes for bpf input buffer.Can't install packet filter program: %sCan't install write filter program: %sCannot lock bpfcScoption %s (%d) larger than buffer.option %s has no length field.Can't allocate storage for option %s.Can't expand storage for option %s.DHCPACKDHCPOFFERDHCPNACKBOOTREPLY%s from %s (%s)no memory for info stringTruncated pointer in DHCP Domain Search option.Invalid forward pointer in DHCP Domain Search option compression.Truncated label in DHCP Domain Search option.Domain search list too long.Truncated DHCP Domain Search option.Can't allocate storage for expanded domain-search %s%s/%u %s"'$`\\%cpretty_print_option: bad code %d%s: Excess information in format string: %s%s: no size indicator before A in format string: %s%s: garbage in format string: %s%s: expecting at least %d bytes; got %d%s: expecting only %d bytes: got %d%s: expecting %d bytes: got %d%huUnexpected format code %ceof in string constantstring constant too longtoken larger than internal bufferappendbackoff-cutoffbootpdenyethernetfixed-addresshardwareignoreinitial-intervallink-timeoutmediumnext-serverprependrebindrenewrequireretryselect-timeoutsendserver-namesupersedetimeout%s line %d: %s%*c^ %s: msgbuf_write: %sRTM_DELETE write: %sshort RTM_DELETE write (%zd) DHCLIENT DHCLIENT %dcreating route label: %screating route label: label too long (%d vs %zu)default route socket: %sRTM_GET of default route: %sget default route read: %sno data from default route readdefault route read rtm: %ssendhup: imsg_compose: %ssendhupadd_address: imsg_compose: %sadd_addressset_interface_mtu: imsg_compose: %sset_interface_mtudelete_address: imsg_compose: %sdelete_addressadd_route: imsg_compose: %sadd_routeflush_routes: imsg_compose: %sflush_routessocket open failed: %sSIOCAIFADDR failed (%s): %sSIOCDIFADDR failed (%s): %sSIOCSIFMTU failed (%d): %sdelete_addresses getifaddrs: %sRouting Socket open failed: %sfailed to add route (%s/%s via %s/%s): %ssysctl size of routes:routes buf realloc:sysctl retrieval of routes:route cleanup failed - %s %s (msize=%zu)opening socket to flush routes: %s%d bad IP checksums seen in %d packets%d udp packets in %d too long - dropped%d bad udp checksums in %d packetspadsubnet-masktime-offsetroutersIAtime-serversien116-name-serversdomain-name-serverslog-serverscookie-serverslpr-serversimpress-serversresource-location-servershost-nameboot-sizemerit-dumpdomain-nameswap-serverroot-pathextensions-pathip-forwardingnon-local-source-routingpolicy-filterIIAmax-dgram-reassemblydefault-ip-ttlpath-mtu-aging-timeoutpath-mtu-plateau-tableSAinterface-mtuall-subnets-localbroadcast-addressperform-mask-discoverymask-supplierrouter-discoveryrouter-solicitation-addressstatic-routestrailer-encapsulationarp-cache-timeoutieee802-3-encapsulationdefault-tcp-ttltcp-keepalive-intervaltcp-keepalive-garbagenis-domainnis-serversntp-serversvendor-encapsulated-optionsnetbios-name-serversnetbios-dd-servernetbios-node-typenetbios-scopefont-serversx-display-managerdhcp-requested-addressdhcp-lease-timedhcp-option-overloaddhcp-message-typedhcp-server-identifierdhcp-parameter-request-listBAdhcp-messagedhcp-max-message-sizedhcp-renewal-timedhcp-rebinding-timedhcp-class-identifierdhcp-client-identifieroption-62option-63nisplus-domainnisplus-serverstftp-server-namebootfile-namemobile-ip-home-agentsmtp-serverpop-servernntp-serverwww-serverfinger-serverirc-serverstreettalk-serverstreettalk-directory-assistance-serveruser-classoption-78option-79option-80option-81relay-agent-informationoption-83option-84nds-serversnds-tree-namends-contextoption-88option-89option-90option-91option-92option-93option-94option-95option-96option-97option-98option-99option-100option-101option-102option-103option-104option-105option-106option-107option-108option-109option-110option-111option-112option-113option-114option-115option-116option-117option-118domain-searchoption-120classless-static-routesCIAoption-122option-123option-124option-125option-126option-127option-128option-129option-130option-131option-132option-133option-134option-135option-136option-137option-138option-139option-140option-141option-142option-143tftp-config-fileoption-145option-146option-147option-148option-149voip-configuration-serveroption-151option-152option-153option-154option-155option-156option-157option-158option-159option-160option-161option-162option-163option-164option-165option-166option-167option-168option-169option-170option-171option-172option-173option-174option-175option-176option-177option-178option-179option-180option-181option-182option-183option-184option-185option-186option-187option-188option-189option-190option-191option-192option-193option-194option-195option-196option-197option-198option-199option-200option-201option-202option-203option-204option-205option-206option-207option-208option-209option-210option-211option-212option-213option-214option-215option-216option-217option-218option-219option-220option-221option-222option-223option-224option-225option-226option-227option-228option-229option-230option-231option-232option-233option-234option-235option-236option-237option-238option-239option-240option-241option-242option-243option-244option-245option-246option-247option-248classless-ms-static-routesoption-250option-251autoproxy-scriptoption-253option-254option-endexpecting semicolon.time string too longinvalid time string%w %Y/%m/%d %T UTC%w %Y/%m/%d %T%u %Y/%m/%d %Tunparseable time stringtime could not be representedexpecting unsigned 32-bit decimal value.expecting CIDR subnet.expecting '/'.Expecting CIDR prefix length.expecting 'ethernet'.expecting '.'.expecting decimal octet.filename must be a stringno memory for string %s.dispatch_imsg: imsg_get failure: %sbad IMSG_DELETE_ADDRESSbad IMSG_ADD_ADDRESSbad IMSG_FLUSH_ROUTESbad IMSG_ADD_ROUTEbad IMSG_SET_INTERFACE_MTUbad IMSG_HUPreceived unknown message, code %uusage: %s [-] [-s] [-p string] [file] cannot close temp fileinvalid address/tmp/ed.XXXXXXXXXXw+cannot open temp filecannot seek temp filecannot write temp filecannot read temp fileunexpected end-of-file& no previous commandinvalid pattern delimiter%d \  \abfnrtv\cannot read stdincannot open output filecannot write filecannot close output filecannot open input filecannot read input filenewline inserted newline appended cannot close input fileed.hup/ed.hupno current filenameinvalid filenamefilename too longnumber out of rangeno matchinvalid mark characterinvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioncrypt unavailablestdio rpath wpath cpath proc exec ttycrypt unavailable ? p:sx ? interrupt? warning: file modifiedscript, line %d: %s no previous patternunbalanced brackets ([])trailing backslash (\)infinite substitution loopnothing to undo%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).HLPRfiprstdio rpath wpath cpath fattrthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too longusage: %s [-fip] [-R [-H | -L | -P]] source target %s [-fip] [-R [-H | -L | -P]] source ... directory update times: %schown: %schmod: %schflags: %sunlink: %smknod: %smkfifo: %sreadlink: %ssymlink: %soverwrite %s? ĨȨ̨~{,y}i      A@!  @a`10  @`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O @@ !1Aa  0@` #+3;CScs$0<LXl|Vusage: %s [-123456789cdf%sh%slNnOqrt%sv] [-b bits] [-o filename] [-S suffix] %*s [file ...] usage: %s [-cfh%slNnqrt%sv] [-o filename] [file ...] usage: %s [-f%shqr] [file ...] OK %4.1f%% -- replaced with %s %lld bytes in, %lld bytes out method crc date time compressed uncompressed ratio uncompressed_name%-7.7s %08x %s %10lld %10lld %4.1f%% %s %10lld %10lld %4.1f%% (totals) .-_tgztazfchown: %sfchmod: %sfchflags: %sfutimens: %scompression not supported%s: won't read compressed data from terminal%s: unrecognized file formatcrc errorzcatzipunknown program nameGZIPoption -a is ignored on this systemillegal bit count -- %s-o argument is too long-o option may only be used with a single input filemay not mix -o, -c, or -t options%s is a directory: ignored: unchanged%s not a regular file%s%s already has %s suffix -- unchanged%s: unknown suffix: ignored%s%s: name too long%s: input: %sdeflate.gz123456789ab:cdfhLlNnOo:qrS:tVvcfhLlNno:qrtVvfhqrgzz1.2.3need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionowner[:group]usage: %s [-h] [-R [-H | -L | -P]] %s file ... %s [-h] [-R [-H | -L | -P]] :group file ... HLPRXfghorstuwxthe -R and -h options may not be specified together.stdio rpath fattrinvalid flags: %sinvalid flag: %susage: %s [-g group,group,...] [-u user] newroot [command] g:u:no such user `%s'unable to get login class for `%s'too many supplementary groups providedno such group `%s'setusercontextsetuid09>89D9P9X9`9p9x99/99999|9 999 @ returning to single-user after filesystem check ?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@%lld %s I=%llubad size: blk %lld, offset %lld, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock.fs_fpg %d cannot allocate memory for inode cache cannot increase directory listbad inode number %llu to nextinode %llu cannot alloc %zu bytes to extend inoinfo CG %d: BAD MAGIC NUMBER %lld files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %lld files missing %lld blocks missing usage: %s [-fnpy] [-b block#] [-c level] [-m mode] filesystem conversion levelcannot do level %d conversion dfpnNyYb:c:m:EXCESSIVE DUP BLKS I=%llucannot alloc %zu bytes for inoinfobad direct addr: %lld bad indirect addr: %lld INCORRECT BLOCK COUNT I=%llu (%lld should be %lld)too many inodes %llu, or out of memory phase 1, inode %llu/%lluphase 1b, inode %llu/%llu%s %s: LENGTH %zu NOT MULTIPLE of %d%s %s: LENGTH %zu NOT MULTIPLE OF %dphase 2, directory %d/%dphase 2, parent directory %d/%d (REMOVED)phase 3, directory %d/%ldphase 4, inode %llu/%lluDELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS UNKNOWN ROTATIONAL TABLE FORMAT %d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %lld MARKED FREE ALLOCATED FRAG %lld MARKED FREE BLK(S) MISSING IN BIT MAPSphase 5, cg %d/%d%s: NOT LABELED AS A BSD FILE SYSTEM (%s) NCG OUT OF RANGECPG OUT OF RANGENCYL LESS THAN NCG*CPGSBSIZE PREPOSTEROUSLY LARGEILLEGAL BLOCK SIZE IN SUPERBLOCKILLEGAL FRAGMENT SIZE IN SUPERBLOCKoffset %d, original %ld, alternate %ld VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN LAST ALTERNATEstdio rpath wpath getpw disklabelINFORMATION; SEE fsck_ffs(8).clean = %d UNDEFINED OPTIMIZATION IN SUPERBLOCKIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE NPSECT=%d IN SUPERBLOCK (FIXED)INCORRECT BMASK=%x IN SUPERBLOCKINCORRECT FMASK=%x IN SUPERBLOCKINCORRECT BSHIFT=%d IN SUPERBLOCKINCORRECT FSHIFT=%d IN SUPERBLOCKFormat of filesystem is too old. Must update to modern format using a version of fsck from before release 5.0 with the command ``fsck -c 2'' INCORRECT MAXFILESIZE=%llu IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%lx IN SUPERBLOCKINCORRECT QFMASK=%lx IN SUPERBLOCKINCONSISTENT CGSIZE=%d INCONSISTENT INOPB=%d INCONSISTENT NINDIR=%d cannot alloc %u bytes for cylinder group summary area cannot alloc %zu bytes for blockmap cannot alloc %zu bytes for inostathead cannot alloc %zu bytes for inpsort cannot alloc %zu bytes for inphead inoinfo: inumber %llu out of rangeCANNOT %s: BLK %lldWRITING %sZERO'ED BLOCK %lld TO DISK UPDATE STANDARD SUPERBLOCK   delete %d: %sinsert %d: %ssession database close: %ssession database open: %scannot get kernel security level: %scannot change kernel security level from %d to %d: %sfatal signal: %scan't parse getty for port %scan't allocate windowcan't parse window for port %sport %s changed utmp index from %d to %dcan't fork for window system on port %s: %msetsid failed (window) %mcan't exec window system '%s' for port %s: %mcan't fork for getty on port %s: %mgetty repeating too quickly on port %s, sleepingcan't exec getty '%s' for port %s: %msome processes would not die; ps axl advisedcan't open %s: %mcan't get %s for controlling terminal: %mcannot disable lid suspendcan't exec %s for %s %s: %m/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bincan't exec %s for single user: %mcan't fork single-user shell, trying againwait for single-user shell failed: %m; restartinginit: shell stopped, restarting single user shell terminated.single user shell terminated, restartingautobootcan't exec %s for %s: %mcan't fork for %s on %s: %mwait for %s on %s failed: %m; going to single user modeinit: %s on %s stopped, restarting %s on %s terminated abnormally, going to single user modeinit: %s init: already running initial setsid() failed: %msetlogin() failed: %munrecognized flag '-%c'sfignoring excess argumentsusage: %s [-b block-size] [-c fragments-per-cylinder-group] [-e maxbpg] [-f frag-size] [-i bytes] [-m free-space] [-o options] [-P file] [-s size] special node usage: %s [-Nq] [-b block-size] [-c fragments-per-cylinder-group] [-e maxbpg] [-f frag-size] [-g avgfilesize] [-h avgfpdir] [-i bytes] [-m free-space] [-O filesystem-format] [-o optimization] [-S sector-size] [-s size] [-T disktype] [-t fstype] special ioctl (WDINFO)%s: can't rewrite disk labelcan't get physmeminsane maxpartitions value %dP:T:b:c:e:f:i:m:o:s:NO:S:T:b:c:e:f:g:h:i:m:o:qs:t:%s: invalid ffs versionsector size invalid: %sblock size is %s: %sfragments per cylinder group is %s: %sblocks per file in a cylinder group is %s: %sfragment size is %s: %saverage file size is %s: %saverage files per dir is %s: %sbytes per inode is %s: %sfree space %% is %s: %s%s: unknown optimization preference: use `space' or `time'.file system size invalid: %snewfs_%s%s/newfs_%s%s not found%s: getmntinfo: %s%s: not a character-special deviceempty partition name supplied%s: can't figure out file system partitionstdio disklabel tty%s: `%c' partition is unavailable%s: `%c' partition overlaps boot program%s: no default sector size%s: maximum file system size on the `%c' partition is %llu sectorswarning: changing optimization to space because minfree is less than %d%% setblock bad fs_frag %dclrblock bad fs_frag %disblock bad fs_frag %dwtfs: write error on block %lldrdfs: read error on block %lldcg 0: bad magic numberfirst cylinder group ran out of spaceinternal error: can't find block in cyl 0ilog2: %d is not a power of 2 fsinit: inode value %llu out of rangeinode table does not fit in cylinder grouppanic: cylinder group too big: %d > %dpreposterous size %lld, max is %dpreposterous size %lld, max is %lldblock size must be a power of 2, not %dfragment size must be a power of 2, not %dfragment size %d is too small, minimum is %lldblock size %d is too small, minimum is %dblock size %d is too large, maximum is %dblock size (%d) cannot be smaller than fragment size (%d)fragment size %d is too small, minimum with block size %d is %ddensity reduced from %d to %d bytes per inodecan't honour -c: minimum is %dfile system size %jd < minimum size of %d fragmentsreduced number of fragments per cylinder group from %d to %d to enlarge last cylinder groupcalloc failed%s: %.1fMB in %jd sectors of %lld bytes %d cylinder groups of %.2fMB, %d blocks, %d inodes each can't get rlimitwarning: fsck_ffs will need %lluMB; min(ulimit -dH,physmem) is %lluMBsuper-block backups (for fsck -b #) at:cannot allocate I/O bufferfsinit1 failedfsinit2 failed%s: initializing cg %ld/%d usage: %s [-dfiPRr] file ... "." and ".." may not be removedremove %s? override %s%s%s/%s for %s? %s (inode %llu): not overwritten due to multiple links%s: malloc%s: is a directorydfiPRrstdio rpath wpath cpath getpwstdio rpath cpath getpwusage: %s [-t] device usage: %s [-f device] command [count] %d: unknown tape drive type %s tape drive, residual=%d erblocksize: %d (%d) density: %d (%d) ioctl MTIOCGETf:no remote support%s: unknown command%s: illegal countbsfbsrdensityeomfsffsrofflinerewindrewofflretensionweofWriteProtectMounted76543210usage: %s [-p] [-m mode] directory ... m:pstdio rpath cpath fattr\ can not be used as a string delimiternewline can not be used as a string delimiterwhitespace after %sundefined label '%s'RE error: %sunterminated regular expressionexpected context addressunexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandfilename expectedw commandread commandbranchempty labelduplicate label '%s'substitute pattern can not be delimited by newline or backslashunterminated substitute pattern123456789\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expressionmore than one number or 'g' in substitute flagsnumber in substitute flags out of rangewfile too longno wfile specifiedbad flag in substitute command: '%c'transform pattern can not be delimited by newline or backslashunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthextra text at the end of a transform commandunused label '%s'-i may not be used with stdinrename()%s: %s %sin-place editing onlyworks for regular files%s/sedXXXXXXXXXX ..."usage: sed [-aEnru] [-i[extension]] command [file ...] sed [-aEnru] [-e command] [-f command_file] [-i[extension]] [file ...] Eae:f:i::nrupledge: %sstdout: %ssed: %lu: %s: first RE may not be empty\ %03o\%d not defined in the RE\abfrtvd; ,R K K @@ B 0 p8 2 p9 @XK P $@@ 0@@ <9 HG P|7 T|7 ,/ X`8o <DV @|~ D8b L\V X8b d@i ldX tc |DV c 0a $q _ h Do i |~ DV h d D` LV dV t-a-b-c-d -e-f-G-g-h -H -k-L -n-O-o-p -r-s-S -t-u-w-x-z===!=<>-eq-ne-gt-ge-lt -le!-ef"-nt#-ot$|5\Ht\flcdslmnYp @8 ؼ X $ 4T @ X pt  D  أ Hx fD  0D  (  $  8 p  ( 4 D Xة h t       $  D l , @Ы H T |p d < | X ` h  \ c8z++--==!== *= /= %= += -= <<= >>= &= ^= |= <<>><=>=<>&& || */%+-&^|? , ~!():IFS= ${PS2=> } ${PS3=#? } ${PS4=+ }da c!let||&&() 0d8s| H 2 2 T`lt|@(#)PD KSH v5.2.14 99/07/13.2 AAA  Q AA A QBafree: %p not present in area %punable to allocate memorylmmissing options argumentmissing name argument%s: is not an identifierc_getopts: no argvarguments changed since last callOPTARGbad signal `%s'usage: kill [-s signame | -signum | -signame] { job | pid | pgrp } ... kill -l [exit_status ...] %s: arguments must be jobs or process IDs%*d %*s %s%*d %*d %sjob control not enabled%%lpnzno argumentsadtdprtUxalias: -r flag can only be used with -t and without arguments alias %s alias not found L#R#UZ#fi#lprtuxonly -t, -u and -x options may be used with -ffunction %s %T %s() %T %s: not identifiertypeset -i -x -r -t -L%d -R%d -Z -l -u -U exportreadonly%s[%d]pvpvV is a reserved wordexported is an %salias for alias %s= is an exported traced undefined (autoload from %s) function special is a%s shell builtin is a tracked %salias for not found%s is *GOK*Rnprsu,-n-p: %s-u: %s: %sLPcan't get current directory - %srestricted shell - can't cdPWDOLDPWDno home directory (HOME not set)no OLDPWDdon't know current directoryCDPATH%s: bad directory+alias+cd+command*=export+fc+getopts+jobs+killletpwd*=readonly=typeset+unaliaswhence+bg+fgunalias-tacan't suspend a login shellinvalid file modeusage: mknod [-m mode] name b|c major minorusage: mknod [-m mode] name ptime: -%s unknown optiontime: -%s requires an argument:p%s%*lld.%02ld%s%s%*lldm%02lld.%02lds%sreal real user sys user system fv%s is read only%s: cannot %s%s: can only %s %d level(s)%s: bad numberugorwx%#3.3o augo=+-rwxugoXsbad masktrap -- bad signal %sprsu,nothing to shift*=.*=:[*=break=builtin*=continue*=eval*=exec*=exit+false*=return*=set*=shift*=times*=trap+=wait+readtest+trueulimit+umask*=unsetsuspendmissing closing parenmissing argumentexpression expectedmissing second argumentmissing expression operatorunexpected operator/operandinternal error: unknown opmissing ]-t-aunlimited unlimitedinvalid limit: %s-%c exceeds allowable limitbad -%c limit: %susage: ulimit [-acdfHlmnpSst] [value]ulimit: %c%-20s time(cpu-seconds)file(blocks)coredump(blocks)data(kbytes)stack(kbytes)lockedmem(kbytes)memory(kbytes)nofiles(descriptors)IFS!"#$&'()*:;<=>?[\]`{|};|&()`+@!fileglob: substitute errorFPATHLINES nothing to yank yank something firstduplicate binding for %sPOSIX%s = %s %s = '%s' cannot bind, not a ttyauto-insert%s: no such functioninvalid return code I-search: beginning-of-historycomplete-commandcomplete-filecompletedelete-char-backwarddelete-word-backwarddelete-char-forwarddelete-word-forwardkill-lineredrawend-of-historyeot-or-deletegoto-historymacro-stringkill-to-eolkill-regionlist-commandlist-filequoteyank-popbackward-charbeginning-of-linebackward-wordend-of-lineforward-charforward-wordnewlinedown-historynewline-and-nextno-opup-historyprev-hist-wordsearch-character-forwardsearch-character-backwardsearch-historyset-mark-commandstuffstuff-resettranspose-charsexchange-point-and-markcomplete-listexpand-filecapitalize-worddowncase-wordupcase-wordset-argcomment*+?@! substituteexpand(NULL)%Rfunny $() command: %s%s: cannot open $(<) input%s: parameter not set%S%s: bad substitutionparameter null or not set%*d) %sdbteste_error: %s (offset %d)shcomexec: %shere document missingcan't %s temporary file %s: %sherein: yylexerror writing %s: %sPS4%s: restricteddupcannot %s %s: %scould not finish (dup) redirection %s: %scoprocess already existsPS3EXECSHELL%s: %s: %sbuiltin: %s: not a builtincommand -p: restricted%s: can't find function definition file - %s%s: can't find function definition file%s: can't open function definition file %s - %s%s: function not defined by %sCFUNC %d%s: cannot execute - %s-rend of expression%s: unexpected `%s'%s: bad number `%s'%s: expression recurses on parameter `%s'%s: %s requires lvalue%s: %s applied to read only variablemissing )zero divisormissing :HISTFILE%s.%dno history (yet)%s: not in history%s: invalid rangehistory functions not available-%c%se:glnrs0,1,2,3,4,5,6,7,8,9,can't use -e, -l, -n, -r with -s (-e -)substitution failedcan't use -l, -n with -e-16%.*s cannot create temp file %s - %serror writing temporary file - %s${FCEDIT:-/bin/ed} $_cannot open temp file %serror reading temp file %s - %sno coprocess%s/shXXXXXXXXbad file descriptorfd not open for readingfd not open for writingillegal file descriptor name%s[%d]: internal error: shl_stdout not validtoo many files open in shellcan't create pipe - try again RunningDoneDone (%d)[%d] %c %5d (core dumped)%s%s %-20s %s%s%s%s%5d %-20s %s%s %s%sremove_job: job not found (%s)notifyj_async: job not startedj_async: bad nzombie (%d)zombiejobsstopped and runningYou have %s%s%s jobs j_waitj: tcsetpgrp(%d, %d) failed: %sjob not job-controlled[%d] | 1st tcsetpgrp(%d, %d) failed: %sfg: 2nd tcsetpgrp(%d, %d) failed: %scannot continue job %s: %sjw:resumejw:waitforwaitlast: no last jobwaitlast: not startedjw:waitlastexchild: XPIPEI and no last_job - pid %dfork failedcannot fork - try againchildexchild: execute() returned[%d]jw:last procj_init: getpgrp() failed: %sj_init: tcgetpgrp() failed: %sj_init: setpgid() failed: %sj_init: tcsetpgrp() failed: %swarning: won't have full job controlj_suspend: tcsetpgrp() failed: %sj_suspend: setpgid() failed: %scheck_job: job started (flags 0x%x)checkjobno such jobambiguousargument must be %job or process id%a %b %d%l:%M:%S%r~/%sPS1\$PS2missing ] no closing quote here document `%s' unclosed MAILyou have mail in $_shell: %dUse `exit' to leave ksh include: %drshrkshrpdkshpdrkshSH_VERSIONPPIDUSER$ -c requires an argumentCannot determine current working directory/etc/profile$HOME/.profile/etc/suid_profileENVtypesetKSH_VERSION-xOPTIND=1evaltypeset -i RANDOM MAILCHECK="${MAILCHECK-600}" SECONDS="${SECONDS-0}" TMOUT="${TMOUT-0}"hash=alias -ttype=whence -vstop=kill -STOPautoload=typeset -fufunctions=typeset -fhistory=fc -linteger=typeset -inohup=nohup local=typesetr=fc -slogin=exec login-tUccmailmakeprviwho |&;<>()*@#!$-? =-+?#% "#$&'()*;<>?[\`|0123456789ABCDEF%-*s%*s'\'\'%s%s-%c: unknown option%s%s-`%c' requires argument%-*s %sA:o;sCurrent option settings -o %s%s: bad optionparse_args: `%c'allexportbraceexpandbgnicecsh-historyemacs-usemetaerrexitgmacsignoreeofinteractivekeywordloginmarkdirsnoclobbernoglobnohupnolognounsetphysicalposixprivilegedtrackallverbosevirawvi-show8vi-tabcompletevi-esccompletextracealnumalphablankcntrldigitgraphlowerpunctupperxdigitshf_flush: no fdshf_emptybuf: no fdshf_write: flags %xshf_write: nbytes %dshf_putchar: flags %xshf_putchar: no fd0123456789abcdef(null %s)shf_ungetc: flags %xshf_fillbuf: no fdshf_getchar: flags %xshf_getse: flags %xshf_read: flags %xshf_read: bsize %dshf_sopen: flags 0x%xshf_snprintf: buf %lx, bsize %dshf_reopen: missing read/writeshf_reopen: bad shf/buf/bsizeshf_fdopen: missing read/writeunexpectedunmatchedsyntax error: unexpected EOF ?%dsyntax error: `%s' %s too many <<'s too many redirections for%s: bad identifier %s: invalid function name thenelseelifficaseesacwhileuntildo{}[[&&||;;((|&too many varssetexecsig: unset signal %d(%s)ERRError handlerEXITtimed out waiting for inputSIGwdscan: unknown char 0x%x (carrying on)%S #no-vars# #no-args# ( %T) %T| %T%;%T%s %T %S ]] select %s for %s in %;do%N%T%;done case %S in%N(%S%c%;%T%N;;%Nesac if %Tthen%N%Telif %Telse%;%T%;fi %s %T%;do{%;%T%;} %T|& %T& function %s %T%s() %Ttime %T< <<- << >> >| <> <&>&No controlling tty (open /dev/tty: %s)Can't find tty file descriptorj_ttyinit: dup of tty fd failed: %s%0*s%.*s%*s%.*s%s: subscript %ld out of range%s: is read onlysetstr: %s=%s: assigning to self0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789abcdefghijklmnopqrstuvwxyzOPTINDPOSIXLY_CORRECTHISTSIZEMAILCHECKMAILPATHRANDOMSECONDSTMOUTLINENOM-grabhist: bad history arrayy$%s %dfc -e ${VISUAL:-${EDITOR:-vi}} --blowfish,%spref too longunable to get login class `%s'localciphercan't generate hashusage: %s [-b rounds] [-c class] [-p | string] stdio rpath wpath ttyrounds is %s: %spb:c:Enter string: getpassInvalid keyInvalid saltToo few rounds: %dinvalid passphrase filecan't stat passphrase filepassphrase file must be owned by rootpassphrase file has the wrong permissionscan't read passphrase fileinvalid passphrase lengthunable to read passphraseRe-type passphrase: Passphrases did not matchpbkdf2 failedinvalid KDF infoinvalid KDF hintKDF hint has invalid sizeunknown KDF type %dnumber of KDF rounds too low: %dDIOCINQ%s: <%s, %s, %s>, serial %s invalid flags listinvalid flag %sinvalid device listcould not open %scould not stat %stoo many devices on device listduplicate device in listNew passphrase: unknown errorBIOCDISCIPLINEOld passphrase: BIOCDELETERAIDno devices specifiednot enough memory for dev_t listunsupported raid levelnot enough disksnot exactly one partitionPassphrase: BIOCCREATERAID/dev/bioCan't locate %s device via %sBIOCBLINKBIOCINQBIOCVOLinvalid alarm function: %sBIOCALARMdisabledalarm is currently %s %-11s %-10s %14s %-8s VolumeStatusSizeDevice %d%% done %u secondsScrubbingInvalidOnlineOfflineDegradedBuildingRebuildWTWB%s %u%14llu%11s %-10s %14s %-7s CRYPTO%s%s %11s %-10s %14s %-7s CONCAT%s%s %11s %-10s %14s %-7s RAID%u%s%s %s BIOCDISKFailedHot spareUnused %3u%14skey disk%u:%u.%unoenclunknown serial patrol %d%% done%11s %-10s %14s %-7s %-6s <%s> %11s %-10s %14s %-7s %-6s '%s'%s%s stainvalid patrol function: %sPatrol %s: %sBIOCPATROL interval=%d next=%dabortedreadypatrol mode: %s%s patrol status: %s target not specifiedTarget %s: %sDisk %s is not in an enclosureDisk %s does not existinvalid device %sBIOCSETSTATEusage: %s [-hiqv] [-a alarm-function] [-b channel:target[.lun]] [-H channel:target[.lun]] [-R device | channel:target[.lun]] [-t patrol-function] [-u channel:target[.lun]] device %s [-dhiPqsv] [-C flag[,flag,...]] [-c raidlevel] [-k keydisk] [-l special[,special,...]] [-O device | channel:target[.lun]] [-p passfile] [-R device | channel:target[.lun]] [-r rounds] device Invalid RAID levelNumber of rounds is %s: %sa:b:C:c:dH:hik:l:O:Pp:qr:R:st:u:vneed deviceneed -c parameterneed -l parametermust use bio deviceusage: %s seconds usage: %s [-fi] source target %s [-fi] source ... directory cp failedrm failed%s: remove%s: set owner/group; not setting setuid/setgid%s: set owner/group%s: set mode%s: set flags%s: set timesrename %s to %scannot resolve %scannot rename a mount pointcan't remove %s%s: destination pathname too longusage: %s [-s] [-M core] [-N system] sM:N:sysctl: KERN_MSGBUFSIZEcouldn't allocate space for buffer datasysctl: KERN_MSGBUFusage: %s [-s] [name-of-host] sethostnamegethostname/etc/networks"(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDlɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~[/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxqg jgrn<:ORQhك[0.0.0.0127.0.0.1::1/etc/hosts/etc/group/etc/ethers%02x:%02x:%02x:%02x:%02x:%02x  0123456789ABCDEF0123456789abcdefnanNANinfINF(null)bug in vfprintf: bad base #;#nameserverlookupypsearchinet4ndots:lookup bind filenameserver 127.0.0.1RES_OPTIONSoptions LOCALDOMAINsearch lookup file %d.%d.%d.%d.in-addr.arpa.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.ip6.arpa.no spacetoo shortbad domain namedomain name too longbad dlen@BKMGTPE0B%lld%c%lld.%1lld%cimsg_readmsgbuf_write/dev/diskmap%s%s%s%c%s%s%shmac_sha1pkcs5_pbkdf2pw_write_entrypw_copy9uid is %sroot uid should be 0gid is %swarning, unknown root shell%s:%s:%s:%s:%s:%lld:%lld:%s:%s:%s %s is zero length-d-s-p-u/usr/sbin/pwd_mkdb%s: unchangedre-edit the password file? [y]: %s: line too long%s: corrupted entry%s: inconsistent entry/etc/ptmplogout/var/run/utmplogin_protect%s: %s: %m/etc/fbtab/*%s: chmod(%s): %m%s: chown(%s): %m%s: opendir(%s): %m%o%s: bad entry: %s\\#readlabelfsRS|SS%sr%s%s: not a device node%s: couldn't read disklabel%s: bad filesystem type in labellogwtmp/var/log/wtmpinet_net_ptoninet_net_pton_ipv401234567890123456789abcdef/usr/src/lib/libc/net/inet_net_pton.cn >= 0 && n <= 15n >= 0 && n <= 9assertion "%s" failed: file "%s", line %d, function "%s" assertion "%s" failed: file "%s", line %d inet_pton01234567890123456789ABCDEF0123456789abcdefinet_ntop4inet_ntop%u.%u.%u.%u-ncdtscsbpxbxfxoxtxdxInfinityNaNvdprintflongjmp botch. /etc/ttyssecurertsctssoftcarwindowSHA256EndSHA256DataSHA256FileChunk0123456789abcdefPOSIX_V6_ILP32_OFFBIGPOSIX_V7_ILP32_OFFBIG-lpthread ^[Yy]^[Nn]yes/var/run/dev.db[:<:]][:>:]]ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ !"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789ABCDEFabcdefNULSOHSTXETXEOTENQBELalertBSbackspaceHTtabLFVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBESCIS4IS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stopzeroonetwothreefourfivesixseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDEL%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhx regerrorREG_0x%xREG_NOMATCHregexec() failed to matchREG_BADPATinvalid regular expressionREG_ECOLLATEinvalid collating elementREG_ECTYPEinvalid character classREG_EESCAPEREG_ESUBREGinvalid backreference numberREG_EBRACKbrackets ([ ]) not balancedREG_EPARENparentheses not balancedREG_EBRACEbraces not balancedREG_BADBRinvalid repetition count(s)REG_ERANGEinvalid character rangeREG_ESPACEREG_BADRPTrepetition-operator operand invalidREG_EMPTYempty (sub)expressionREG_ASSERT"can't happen" -- you found a bugREG_INVARGinvalid argument to regex routine*** unknown regexp error code ***SHA512EndSHA512DataSHA512FileChunk0123456789abcdefBLOCKSIZE%s: unknown blocksizemaximum blocksize is %dG%s: minimum blocksize is 512%ld%s-blockscrypt_checkpass$$blowfish,8blowfishbcryptbcrypt_hashpassOrpheanBeholderScryDoubtbcrypt_initsaltbcrypt_newhash_bcrypt_autoroundsbcrypt_checkpass6789:;<=>?  !"#$%&'()*+,-./012345./ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789$2%c$%2.2u$$2b$%2.2u$testpassword 1Ѭߘr/Ḗ~&jE|,G$l iciNWqX~=t XrX͋qJT{YZ90`*#`(yA8۸y:`l>w'K1/x`\`U%U攫UbHW@cj9U*4\̴ATr|*oc]ũ+1t>\3֯\$lS2zw(H;Kkē!(f a!`|H2]]]u#&܈e>#Ŭom9BD . Ji^Bh!la gӫҠQjh/T(3Ql n;zP;*~ev9>YfCoEå}^;uos D@jVbNw?6r=B$7H ۛIrS{y%P;LylO`@ž\^c$johSl>9oR;Qm,0DE ^J3(fK.WtE9_ ӹyU 2`yr,@%g̣饎"2u<kaP/R=2`#H{1S>W\o.ViB~(2gsUO'[iXʻ]=!lJ[-ySeEIҐK3~ˤAb Lw6~д+MەqՓkю%ǯ/[{AI~-%^q h"W6d$ cUYCxSZ٢[} Źv&ϕbhAJsN-GJ{RQ)S?Wƛv`+t恵oWk *!ec.4dV]-SGjnpzKD). u#&İn}ߧI`fqilRdVឱ¥6)L u@Y>:䚘T?eB[k?ҡ08-M]% L&pc^?kh >\D}W7: P tAu8/;21>8TNmO Bo ,y|$ryVw.?rU$qk.P̈́GXzt}K:zfC cdG27;C$CMQe*P:qUN1w_V5kǣ;< $Y,n<pEㆱo ^*>Zw=Ne)։>%fRxL.jxS<- N=+6&9`y#RnfE{7(2åZl!Xeh;/ۭ}*/n[(!pa)uGa0a4c\s9pL ު˼,b`\ndi#PZe2Zh@*<1! T_~}=b7w-_h)5ǡޖXxWcr"ÃF T0.SHُ(1mX4a(s<|J]d]B> EꫪOlOBBǵj;Oe!AyMjGKPb=bF&[$ti GV[ Htb#*BXU >ap?#r3A~_;"lY7|`t˧@n2w΄PU5ai Z .zD4Egɞs͈Uy_g@Cge48>q(= m!>J=+hZ=@&L4)i Av.khq$j 3ԷCaP.9FE$tO!@MpE/f m1'A9UG%ښ ʫ%xP()Sچ, mbhiHפh'?Oz|Ϊ_7әxB*k@5 ٫9N;VmK1f&tn:2C[Ah xN جV@E'H::SU kKмgUXc)3VJ*%1?~^|1)p/'\,(H"m?H܆AyG@n]Q_2Տd5A4x{%`*`lc´2Of#k>3b $;" r(-Exb}doITH}'>AcG t.no:7`L knU{7,gm;e' )̒9 i{f} ϑ^و/$[Qy{;v.97yY̗&-1.Bh;+jLu.x7BjQ满PcKkؽ%=YBD n *Ngd_ڈ鿾dW{x`M``FѰ8Ew63kBqA_^;Z4ٷ,Q+:Ֆ}}>(-}|%rZLZq)GW;()f(.y_xU`uD^mm%adâW<'*:m?!cf&(3uU4V<wQ( gQ̫_QM08bX7 z{>d!Q2Ow~㶨F=)iSHd$m-if! FEdlX [@X̻k~jEY:D 5>ʹrdfGof,ҏ"W##v215VbuZ6ns҈bIPLVq z2E{Sb%ҽ5iq"|˶+v>S@`8G% 8vFšw``u N˅؍芰z~L\HjiԐ\-% ?2aN[wߏWr:j?$.Dsp"8 1).lN!(Ew8fTl 4)P|ɵՄ? GyؗҜ<3#I9=D2[%Cod(hinityanSipHashABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/group_from_giduser_from_uidreadpassphrasetcsetattr  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~glob2glob0;<<hL< <<< <$<,<0<8<<<D<#L<( P<X<`<h<p<x<|<<<<<5<<<Signal 0HUPINTILLTRAPABRTEMTFPEKILLBUSSEGVSYSPIPEALRMURGTSTPCONTCHLDTTINTTOUIOXCPUXFSZVTALRMPROFWINCHUSR1USR2THRUS-ASCIINONEUTF8tolowertoupperexecvpeexeclpexecleexeclexecvp: : path too long /etc/protocolsunknown option -- %coption requires an argument -- %cambiguous option -- %.*soption doesn't take an argument -- %.*soption requires an argument -- %sunknown option -- %sfstabscanxxsw9%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x???$?0?8?D?T?`?l?t???? ,nosappndnosappendnoarchnoarchivednoschgnoschangenosimmutablenouappndnouappendnouchgnouchangenouimmutablenodumpnoopaqueh@l@p@t@?x@|@@@? 08`CV<  CV$2`[~ [~CV`@@<@TU yV byVAFVʱw$KV0KV0` !jAFV+g-FV+g-FV|.a [CFV"1FV"1FV"1b _ AFVW4MV!#3MV!#3c <AFVX6FV18FV18d dAFVZ"8FVZ"8FV18e A^uAFVԄ:FVԄ:FVԄ:f @7>kE)Rm2Ş>'URE, LE\~,},ǘC"<!iXi?<=w|ѵp_1((G̑P"aawR-R"l'/Bda<lwh !L'1hj\WЏDӹ0Zzz65hZ^Δ)tkiaa.M[ў}nxnq| vʜ* 7L!]}nI.y${/i*ZT,|xh#&]9FpA rcF26ϜRgkb ^nH4d@<wHflhLVb#l' e=K6B`@l_+jnne'WvL5MJ_F0Vyf@xQ6a=E2ITNa:įG5r<tZs|'HIntpD ztycab2Qݟ@ . ..arch< catchmod<chgrp< cpdate< dd df edhostname- ksh sh ln ls mtsha256sha512mkdir<eject< mv pax tar rmsleep<stty<sync<A ...B ...C . ..chrootpwd_mkdb-ztsscale-D . ..EkeymapsmiscE .D..F ...%m/%d/%y%Y-%m-%d%H:%M%I:%M:%S %p%H:%M:%SESTCSTMSTPSTEDTCDTMDTPDT8A?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~realpathinet6_rth_reverseSHA1TransformSHA1Pad/etc/shells# /bin/csh/bin/ksh/etc/services,/ ((((( AAAAAABBBBBB wrterrormalloc_initmalloc() warning: unknown char in MALLOC_OPTIONS (%d) in recursive callchunk info corruptedchunk canary corruptedmodified chunk-pointerchunk is already freeregions_total not 2^xinternal struct corruptmunmap/etc/malloc.confMALLOC_OPTIONSmalloc init mmap failedmap roundmalloc cachemunmap roundmalloc cache underflowmalloc free slot lostmalloc cache overflowbogus pointer (double free?)bogus pointerguard sizemprotectdouble freebogus pointer in validate_junkuse after freefree():free() called before allocationpp & bitsposix_memalign():mapalign bad alignmentmapalign roundcalloc():malloc():realloc():tzloadmnGMT/etc/localtime/usr/share/zoneinfoposixrules,M4.1.0,M10.5.0abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789 :+-._Local time zone must be set--see zic manual pageasctime3JanFebMarAprMayJunJulAugSepOctNovDecSunMonTueWedThuFriSat??? ??? ?? ??:??:?? ???? %.3s %.3s%3d %2.2d:%2.2d:%2.2d %-4s %.3s %.3s%3d %2.2d:%2.2d:%2.2d %s _conv_fmtAAAAAAAAAAAAAAAAAAAABBB$B8A[%ld]Error %dsnprintfUnknown signal: Unknown error: Z4ZLZhZxZZZZZZZ[,[D[X[d[|[[[[[[[\ \4\T\d\t\\\\\\\],]H]h]]]]]] ^(^@^`^^^^^^_8_T_p_____``8`L`\`p``````` a a: stack overflow in function %$sniglet^&__put_page%s/_hash.XXXXXXHASH: Out of overflow pages. Increase page size XXL <\LPX`dl| DlT̤̤> H0=Pt$ p)rrrd @,4,<,DL0T\4|A GRd`hp0$|\(dxXN___Yx||- - - p H P  L  \unblock and -DNO_CONV? l L l E @ T @hx@ @ 4@@LH1м|^t0 Non-system disk Press any key to reboot NB:F:I:L:O:S:a:b:c:e:f:h:i:k:m:n:o:qr:s:t:u:d \ P P  < |  t  `  ` ,    L  2`/tmp/EdDk.aXXXXXXXXXX/8888/88899999 9(909>89D9P9X9`9p9x99/99999|9 999 s >R R @R R@@ R @R(@R %(R@s > `NR@R_s>@ds 4d| (Ђh\lhLu~???>ccpp `8 ǃx8 089 pp<cc8` a`p ǃ0 009 0`<cg8` q`` FLJ0 009 8|cf0`8  p089 `f?0?  ?8 `f0   8 `f 1   8 `f 1`İ   08 8 `8 q`8  088 0` `qxp ap8p  008 pp ~??>?~?> 0 4f xǎv|w0xxD\1``bˌ  .&Ș|`` 00( r @ t `"b`11F0 ~sLJ;??~~c   @@? `mF8|x`a1C  mv<88J|LJϜm~|8Z cc `Ș F@F R#cHX $|B b#c0`Ș ,FF gό9>|a`G8p 9>Xa@@@x Ȏмظ11"t €u6Uu|agPtPS[X!Using drive X, partition YMBR on floppy or old BIOS Read error No O/S No active partition OxU @Y LS( P eX  H^ dd  xa  T \VD$\@>0Wl@X[ ZS0S @ ZH|jlHVt|L@@`LH& `P^   ?7???d7?D ? ` ? ? @h` @B@80o@pQ@$@@I,@8@0> @@!"$#$L@%T@&x7'_(`@)*<+d@,l@-t@.|@/@0@ 1@2@3@4@5@6@7p78>9@@@A,AXAAAAA B4B`BBBB priorityrttvarrttssthreshsendpiperecvpipeexpirehopcountmtuUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CLONING XRESOLVE LLINFO STATIC BLACKHOLEPROTO3PROTO2PROTO1CLONEDMPATHMPLSLOCALBROADCASTUPBROADCASTDEBUGLOOPBACKPTPNOTRAILERSRUNNINGNOARP PPROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD SRC SRCMASK LABEL<NOOP sTxV`9 T9Pr( 0(EHC P E(  0(EHDHC)H#l ... ...\ ````84D$y4hyyt $(0<|DLTx@\@@@......L$     $,4<H8Ph{}abcdDgGhHilnNpPqrs tw xy !:#=JJ Pd*$4DTld89D9P9X9`9p9x99/99999|9 999kh ` /(0T8@@X8HlPX z , 0 4  8 < L P \ ` ptx|9l !"#$%&'((<)P*\+h,p-x-..T /d /0123456789:;<= > ?, @< [P \\ \l ] ^ ^ _ _ ` { { | }!}!~$!!!!!!!!" ","8"X"d""" "" "" "" #x #,#P#\#t#####455@7B9P// /(/0/8,0@\0@X0H0l0P1XL1RuneCT10NONEBBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~<- (08@@XH l@PX --5466X7D687:70<?GMTUTC@t(6 0xH`X<2 OO7O.P `H/P `I l/P `J/./\0// /DPl  H d |     H d |   VVN<.shstrtab.note.openbsd.ident.init.text.fini.rodata.eh_frame.openbsd.randomdata.jcr.got.ctors.dtors.data.bss TTpp%D`+a1bL90j0C44W88\J6!Ez8@ZUFD#I.W1nFb 8W.Mih_ijSe:?7h~e3qJ4,{Hh,@5E^<eVL qpcύ[[€=L;‘@ H !:{](Lkb6ro[bfwU[}s 5&+!;Yå-93vlmp Qo7LP7~A?,aj9fc{=:pc,-STzΝ_IP$>{6- U;wi /y| ,s%k`#ITe& F~_d58e . ..firmware<signifygroup< protocolsdpasswdtmpspwd.db services&asswd.origpwd.db fstab< resolv.conf$ hosts< . ..openbsd-59-base.pub . .. binmdecCsbinDshare . ..encrypt ftpgrep<egrep<fgrep<gzip<gunzipgzcat<more<less< sed@signify ... .D ..termcapuntrusted comment: openbsd 5.9 base public key RWQJVNompF3pwfIqbg+5sxfpxmZMa3tTBaW4qbUhWje/H/M7glrA6oVn root:*:0:0:Charlie &:/root:/bin/ksh daemon:*:1:1:The devil himself:/root:/sbin/nologin operator:*:2:5:System &:/operator:/sbin/nologin bin:*:3:7:Binaries Commands and Source:/:/sbin/nologin uucp:*:66:1:UNIX-to-UNIX Copy:/var/spool/uucppublic:/usr/libexec/uucp/uucico _dhcp:*:77:77:DHCP programs:/var/empty:/sbin/nologin nobody:*:32767:32767:Unprivileged user for NFS:/nonexistent:/sbin/nologin wheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root bin:*:7: news:*:8: wsrc:*:9: users:*:10: auth:*:11: games:*:13: staff:*:20:root sshd:*:27: _portmap:*:28: _identd:*:29: _rstatd:*:30: guest:*:31:root _rusersd:*:32: _fingerd:*:33: _sshagnt:*:34: _x11:*:35: utmp:*:45: _rebound:*:52: _unbound:*:53: _dpb:*:54: _pbuild:*:55: _pfetch:*:56: _spamd:*:62: _radius:*:63: _token:*:64: _shadow:*:65: crontab:*:66: www:*:67: _isakmpd:*:68: network:*:69: proxy:*:71: authpf:*:72: _syslogd:*:73: _pflogd:*:74: _bgpd:*:75: _tcpdump:*:76: _dhcp:*:77: _mopd:*:78: _tftpd:*:79: _rbootd:*:80: _ppp:*:82: _ntp:*:83: _ftp:*:84: _ospfd:*:85: _hostapd:*:86: _dvmrpd:*:87: _ripd:*:88: _relayd:*:89: _ospf6d:*:90: _snmpd:*:91: _rtadvd:*:92: _ypldap:*:93: _smtpd:*:95: _rwalld:*:96: _nsd:*:97: _ldpd:*:98: _sndio:*:99: _ldapd:*:100: _iked:*:101: _iscsid:*:102: _smtpq:*:103: _file:*:104: _radiusd:*:105: _eigrpd:*:106: _vmd:*:107: _tftp_proxy:*:108: _ftp_proxy:*:109: _sndiop:*:110: dialer:*:117: nogroup:*:32766: nobody:*:32767: ip 0 IP icmp 1 ICMP tcp 6 TCP udp 17 UDP ftp-data 20/tcp ftp 21/tcp domain 53/tcp nameserver domain 53/udp nameserver www 80/tcp http nfsd 2049/udp nfs nfsd 2049/tcp nfs bin*Binaries Commands and Source//sbin/nologin1binrdrrootdaemonCharlie &/root/bin/ksh2rootdaemonCharlie &/root/bin/ksh3MHdaemon*The devil himself/root/sbin/nologin2daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user for NFS/nonexistent/sbin/nologin1nobody f]\W operator*System &/operator/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Boperator*System &/operator/sbin/nologin3operator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/ksh1rootA<bin*Binaries Commands and Source//sbin/nologin2bin*Binaries Commands and Source//sbin/nologin3uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucpD6Duucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2_dhcp*MMDHCP programs/var/empty/sbin/nologin1_dhcp^P^_dhcp*MMDHCP programs/var/empty/sbin/nologin2_dhcp*MMDHCP programs/var/empty/sbin/nologin3M@2@nobody*Unprivileged user for NFS/nonexistent/sbin/nologin2nobody*Unprivileged user for NFS/nonexistent/sbin/nologin3a  n}bin*Binaries Commands and Source//sbin/nologin1binpbprootdaemonCharlie &/root/bin/kshs2rootdaemonCharlie &/root/bin/kshs3MHdaemon*The devil himself/root/sbin/nologin2daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user for NFS/nonexistent/sbin/nologin1nobody e\[V  operator*System &/operator/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Boperator*System &/operator/sbin/nologin3operator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/ksh1rootA<bin*Binaries Commands and Source//sbin/nologin2bin*Binaries Commands and Source//sbin/nologin3uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucpD6Duucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2_dhcp*MMDHCP programs/var/empty/sbin/nologin1_dhcp^P^_dhcp*MMDHCP programs/var/empty/sbin/nologin2_dhcp*MMDHCP programs/var/empty/sbin/nologin3M@2@nobody*Unprivileged user for NFS/nonexistent/sbin/nologin2nobody*Unprivileged user for NFS/nonexistent/sbin/nologin3a  n} dumb|80-column dumb tty:\ :am:\ :co#80:\ :bl=^G:cr=^M:do=^J:sf=^J: vt100|vt100-am|dec vt100 (w/advanced video):\ :5i:am:bs:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :@8=\EOM:DO=\E[%dB:K1=\EOq:K2=\EOr:K3=\EOs:K4=\EOp:K5=\EOn:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:as=^N:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:do=^J:\ :eA=\E(B\E)0:ho=\E[H:k0=\EOy:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\EOt:k6=\EOu:k7=\EOv:k8=\EOl:k9=\EOw:k;=\EOx:\ :kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:l1=pf1:l2=pf2:l3=pf3:l4=pf4:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[0m:mr=\E[7m:nd=\E[C:pf=\E[4i:po=\E[5i:\ :ps=\E[0i:rc=\E8:rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :..sa=\E[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t\016%e\017%;$<2>:\ :sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: vt220|vt200|dec vt220:\ :5i:am:bs:mi:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :%0=\E[29~:%1=\E[28~:*6=\E[4~:@0=\E[1~:AL=\E[%dL:\ :DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:F1=\E[23~:F2=\E[24~:\ :F3=\E[25~:F4=\E[26~:F7=\E[31~:F8=\E[32~:F9=\E[33~:\ :FA=\E[34~:IC=\E[%d@:LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:\ :SA=\E[?7h:UP=\E[%dA:ae=\E(B:al=\E[L:as=\E(0:bl=^G:\ :cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:\ :cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:\ :eA=\E)0:ec=\E[%dX:ei=\E[4l:ho=\E[H:\ :if=/usr/share/tabset/vt100:im=\E[4h:\ :is=\E[?7h\E[>\E[?1l\E F\E[?4l:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k6=\E[17~:k7=\E[18~:k8=\E[19~:k9=\E[20~:\ :k;=\E[21~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=^H:\ :kd=\E[B:kl=\E[D:kr=\E[C:ku=\E[A:l1=pf1:l2=pf2:l3=pf3:\ :l4=pf4:le=^H:mb=\E[5m:md=\E[1m:me=\E[0m:mr=\E[7m:nd=\E[C:\ :nw=\EE:pf=\E[4i:po=\E[5i:ps=\E[i:r1=\E[?3l:rc=\E8:sc=\E7:\ :se=\E[27m:sf=\ED:so=\E[7m:sr=\EM:st=\EH:ta=^I:\ :u6=\E[%i%d;%dR:u7=\E[6n:u9=\E[c:ue=\E[24m:up=\E[A:\ :us=\E[4m:vb=\E[?5h\E[?5l: #!/bin/ksh MODE=install . install.sub ask_until "System hostname? (short form, e.g. 'foo')" "$(hostname -s)" [[ ${resp%%.*} != $(hostname -s) ]] && hostname "$resp" THESETS="$THESETS site$VERSION-$(hostname -s).tgz" echo donetconfig ((NIFS)) && startcgiinfo echo while :; do askpassword "Password for root account?" _rootpass="$_password" [[ -n "$_password" ]] && break echo "The root password must be set." done rootkey= if $AUTO; then ask "Public ssh key for root account?" none [[ $resp != none ]] && rootkey=$resp fi questions user_setup ask_root_sshd set_timezone /var/tzlist echo get_rootinfo DISKS_DONE= FSENT= rm -f /tmp/fstab* while :; do if ! isin $ROOTDISK $DISKS_DONE; then resp=$ROOTDISK rm -f /tmp/fstab else ask_which "disk" "do you wish to initialize" \ '$(get_dkdevs_uninitialized)' done [[ $resp == done ]] && break fi _disk=$resp configure_disk $_disk || continue DISKS_DONE=$(addel $_disk $DISKS_DONE) done for _mp in $(bsort $FSENT); do _pp=${_mp##*!} _mp=${_mp%!*} echo -n "$_pp $_mp ffs rw" [[ $_mp == / ]] && { echo " 1 1"; continue; } echo -n ",nodev" case $_mp in /sbin|/usr) ;; /usr/bin|/usr/sbin) ;; /usr/libexec|/usr/libexec/*) ;; /usr/local|/usr/local/*) ;; /usr/X11R6|/usr/X11R6/bin) ;; *) echo -n ",nosuid" ;; esac echo " 1 2" done >>/tmp/fstab munge_fstab mount_fs "-o async" feed_random install_sets if [[ -z $TZ ]]; then (cd /mnt/usr/share/zoneinfo ls -1dF $(tar cvf /dev/null [A-Za-y]*) >/mnt/tmp/tzlist ) echo set_timezone /mnt/tmp/tzlist rm -f /mnt/tmp/tzlist fi if _time=$(http_time) && _now=$(date +%s) && (( _now - _time > 120 || _time - _now > 120 )); then _tz=/mnt/usr/share/zoneinfo/$TZ if ask_yn "Time appears wrong. Set to '$(TZ=$_tz date -r "$(http_time)")'?" yes; then date $(date -r "$(http_time)" "+%Y%m%d%H%M.%S") >/dev/null fi fi if [[ -s $HTTP_LIST ]]; then _i=${INSTALL:+install=$INSTALL&} _i=$_i${TZ:+TZ=$TZ&} _i=$_i${METHOD:+method=$METHOD} _i=${_i%&} [[ -n $_i ]] && ftp -Vao - \ "http://129.128.5.191/cgi-bin/ftpinstall.cgi?$_i" >/dev/null 2>&1 & fi sed "/^console.*on.*secure.*$/s/std\.[0-9]*/std.$(stty speed /tmp/ttys mv /tmp/ttys /mnt/etc/ttys echo -n "Saving configuration files..." (cd /var/db; for _f in dhclient.leases.*; do [[ -f $_f ]] && mv $_f /mnt/var/db/. done) hostname >/tmp/myname echo "127.0.0.1\tlocalhost" >/mnt/etc/hosts echo "::1\t\tlocalhost" >>/mnt/etc/hosts if [[ -f /tmp/hosts ]]; then _dn=$(get_fqdn) while read _addr _hn _aliases; do if [[ -n $_aliases || $_hn != ${_hn%%.*} || -z $_dn ]]; then echo "$_addr\t$_hn $_aliases" else echo "$_addr\t$_hn.$_dn $_hn" fi done >/mnt/etc/hosts rm /tmp/hosts fi _f=dhclient.conf [[ -f /tmp/$_f ]] && { cat /tmp/$_f >>/mnt/etc/$_f; rm /tmp/$_f; } (cd /tmp; for _f in fstab hostname* kbdtype my* ttys *.conf *.tail; do [[ -f $_f && -s $_f ]] && mv $_f /mnt/etc/. done) echo "done." apply if [[ -n $user ]]; then _encr=$(encr_pwd "$userpass") _home=/home/$user uline="${user}:${_encr}:1000:1000:staff:0:0:${username}:$_home:/bin/ksh" echo "$uline" >>/mnt/etc/master.passwd echo "${user}:*:1000:" >>/mnt/etc/group echo ${user} >/mnt/root/.forward _home=/mnt$_home mkdir -p $_home (cd /mnt/etc/skel; cp -pR . $_home) (umask 077 && sed "s,^To: root\$,To: ${username} <${user}>," \ /mnt/var/mail/root >/mnt/var/mail/$user ) chown -R 1000:1000 $_home /mnt/var/mail/$user sed -i -e "s@^wheel:.:0:root\$@wheel:\*:0:root,${user}@" \ /mnt/etc/group 2>/dev/null [[ -n "$userkey" ]] && print -r -- "$userkey" >>$_home/.ssh/authorized_keys fi if [[ -n "$_rootpass" ]]; then _encr=$(encr_pwd "$_rootpass") sed -i -e "s@^root::@root:${_encr}:@" /mnt/etc/master.passwd 2>/dev/null fi pwd_mkdb -p -d /mnt/etc /etc/master.passwd [[ -n "$rootkey" ]] && ( umask 077 mkdir /mnt/root/.ssh print -r -- "$rootkey" >>/mnt/root/.ssh/authorized_keys ) finish_up usage() { echo "usage: ${0##*/} [-a] [-f filename]" >&2 exit 1 } waitcgiinfo() { local _l _key _val wait "$CGIPID" 2>/dev/null [[ -s $CGI_INFO ]] || return sed -n 's,^http://\([[A-Za-z0-9\:_][]A-Za-z0-9:._-]*\),\1,p' \ $CGI_INFO >$HTTP_LIST 2>/dev/null read -r -- _l <$HTTP_LIST : ${HTTP_SERVER:=${_l%%/*}} while IFS='=' read -r -- _key _val; do case $_key=$_val in method=+([a-z])) CGI_METHOD=$_val;; TIME=+([0-9])) CGI_TIME=$_val;; TZ=+([-_/+[:alnum:]])) CGI_TZ=$_val;; esac done <$CGI_INFO } bsort() { local _l _a=$1 _b (($# > 0)) || return shift for _b; do if [[ $_a != $_b ]]; then if [[ $_a > $_b ]]; then _l="$_a $_l"; _a=$_b else _l="$_b $_l" fi fi done echo -n "$_a " bsort $_l } isin() { local _a=$1 _b shift for _b; do [[ $_a == $_b ]] && return 0 done return 1 } addel() { local _a=$1 shift echo -n "$*" isin "$_a" $* || echo -n " $_a" } rmel() { local _a=$1 _b shift for _b; do [[ $_a != $_b ]] && echo -n "$_b " done } http_time() { local _sec=$(cat $HTTP_SEC 2>/dev/null) [[ -n $_sec && -n $CGI_TIME ]] && echo $((CGI_TIME + SECONDS - _sec)) } quote() ( for a; do alias Q=$a; a=$(alias Q); print -rn -- " ${a#Q=}" done | sed '1s/ //' echo ) showcols() { local _l _cdir=/tmp/cdir _clist mkdir -p $_cdir rm -rf -- $_cdir/* while read _l; do [[ -n $_l ]] || continue mkdir -p /tmp/cdir/"$_l" _clist[${#_clist[*]}]="$_l" done (cd $_cdir; ls -Cdf "${_clist[@]}") rm -rf -- $_cdir } stripcom () { local _l [[ -f $1 ]] || return set -o noglob while read _l; do [[ -n ${_l%%#*} ]] && echo $_l done <$1 set +o noglob } tmpdir() { local _i=1 _dir until _dir="${1?}.$_i.$RANDOM" && mkdir -- "$_dir" 2>/dev/null; do ((++_i < 10000)) || return 1 done echo "$_dir" } diskinfo() { local _d for _d; do makedev $_d echo -n "$_d: " disklabel -dpg $_d 2>/dev/null | sed -e '/^label: /{s,,,;s/ *$//;s/^$//;h;d;}' \ -e '/.*# total bytes: \(.*\)/{s//(\1)/;H;}' \ -e '$!d;x;s/\n/ /' rm -f /dev/{r,}$_d? done } makedev() { [[ -z $(cd /dev && sh MAKEDEV "$@" 2>&1) ]] } scan_dmesg() { bsort $(sed -n "$1" /var/run/dmesg.boot) } scan_disknames() { local IFS=, bsort $(for _n in $(sysctl -n hw.disknames); do echo "${_n%%:*} "; done | sed -n "$1") } get_dkdevs () { echo $(scan_disknames "${MDDKDEVS:-/^[sw]d[0-9][0-9]* /s/ .*//p}") } get_cddevs () { echo $(scan_disknames "${MDCDDEVS:-/^cd[0-9][0-9]* /s/ .*//p}") } get_dkdevs_uninitialized() { local _disks=$(get_dkdevs) _d for _d in $DISKS_DONE; do _disks=$(rmel "$_d" $_disks) done bsort $_disks } get_ifdevs() { local _if _iflist=$(rmel vlan $(ifconfig -C)) for _if in $(ifconfig "$@" 2>/dev/null | sed -n 's/^\([^[:space:]]*\):.*/\1/p'); do isin ${_if%%+([0-9])} $_iflist || echo $_if done } getdevname() { local _dev=$1 if [[ ${#_dev} == 18 && $_dev == +([0-9a-f]).[a-p] || ${#_dev} == 16 && $_dev == +([0-9a-f]) ]]; then sysctl -n hw.disknames | sed -nE "s/^(.*,)*(.*):${_dev%.?}.*/\\2/p" else _dev=${_dev#/dev/} print -r -- "${_dev%[a-p]}" fi } disk_has() { local _disk=$1 _pttype=$2 _part=$3 _cmd _p_pttype _p_part [[ -n $_disk && -n $_pttype ]] || exit local _c_hfs="pdisk -l $_disk" local _c_sr="bioctl -q $_disk" local _p_gpt='Usable LBA:' local _p_gpt_openbsd='^[ *]...: OpenBSD ' local _p_gpt_efisys='^[ *]...: EFI Sys ' local _p_hfs='^Partition map ' local _p_hfs_openbsd=' OpenBSD OpenBSD ' local _p_mbr='Signature: 0xAA55' local _p_mbr_openbsd='^..: A6 ' local _p_mbr_dos='^..: 06 ' local _p_mbr_dos_active='^\*.: 06 ' local _p_mbr_linux='^..: 83 ' local _p_sr='OPENBSD, SR' local _p_sr_crypto='OPENBSD, SR CRYPTO' eval "_cmd=\"\$_c_${_pttype}\"" eval "_p_pttype=\"\$_p_${_pttype}\"" eval "_p_part=\"\$_p_${_pttype}_${_part}\"" _cmd=${_cmd:-fdisk $_disk} [[ -z $_p_pttype ]] && exit [[ -n $_part && -z $_p_part ]] && exit if [[ -z $_p_part ]]; then $_cmd 2>/dev/null | grep -Eq "$_p_pttype" else $_cmd 2>/dev/null | grep -Eq "$_p_pttype" && $_cmd 2>/dev/null | grep -Eq "$_p_part" fi } disklabel_autolayout() { local _disk=$1 _f=$2 _dl=/disklabel.auto _op [[ $_disk != $ROOTDISK ]] && return while $AUTO; do ask "URL to autopartitioning template for disklabel?" none [[ $resp == none ]] && break echo "Fetching $resp" if ftp -Vo $_dl "$resp" && [[ -s $_dl ]]; then disklabel -T $_dl -F $_f -w -A $_disk && return echo "Autopartitioning failed" exit 1 else echo "No autopartitioning template found." exit 1 fi done while :; do echo "The auto-allocated layout for $_disk is:" disklabel -h -A $_disk | egrep "^# |^ [a-p]:" ask "Use (A)uto layout, (E)dit auto layout, or create (C)ustom layout?" a case $resp in [aA]*) _op=-w;; [eE]*) _op=-E;; [cC]*) return 0;; *) continue;; esac disklabel -F $_f $_op -A $_disk return done } configure_disk() { local _disk=$1 _fstab=/tmp/fstab.$1 makedev $_disk || return rm -f /tmp/*.$_disk md_prep_disklabel $_disk || return if ! grep -qs ' / ffs ' /tmp/fstab.$ROOTDISK; then echo "'/' must be configured!" return 1 fi if [[ -f $_fstab ]]; then while read _pp _mp _rest; do if [[ $_mp == none ]]; then echo "$_pp $_mp $_rest" >>/tmp/fstab continue fi if [[ $_fstab != $(grep -l " $_mp " /tmp/fstab.*) ]]; then _rest=$_disk _disk= break fi done <$_fstab if [[ -z $_disk ]]; then cat /tmp/fstab.$_rest >/etc/fstab rm /tmp/fstab.$_rest set -- $(grep -h " $_mp " /tmp/fstab.*[0-9]) echo "$_pp and $1 can't both be mounted at $_mp." return 1 fi while read _pp _mp _fstype _rest; do [[ $_fstype == ffs ]] || continue _OPT= [[ $_mp == / ]] && _OPT=$MDROOTFSOPT newfs -q $_OPT ${_pp##/dev/} FSENT="$FSENT $_mp!$_pp" done <$_fstab fi return 0 } lock() { while ! mkdir /tmp/lock 2>/dev/null && sleep .1; do done } unlock() { rm -d /tmp/lock 2>/dev/null } retrap() { trap 'kill -KILL $CPPID 2>/dev/null; echo; stty echo; exit 0' \ INT EXIT TERM } get_responsefile() { local _rf _ifdev _mac _mode _lf _hn _path action= [[ -f /auto_upgrade.conf ]] && _rf=/auto_upgrade.conf _mode=upgrade [[ -f /auto_install.conf ]] && _rf=/auto_install.conf _mode=install [[ -f $_rf ]] && cp $_rf /ai.$_mode.conf && action=$_mode && return for _ifdev in ''; do [[ -x /sbin/dhclient ]] || break set -- $(get_ifdevs netboot) (($# == 0)) && set -- $(get_ifdevs) (($# == 1)) && _ifdev=$1 while (($# > 1)); do ask_which "network interface" \ "should be used for the initial DHCP request" "$*" isin "$resp" $* && _ifdev=$resp && break done [[ -n $_ifdev ]] && dhclient $_ifdev || break _lf=/var/db/dhclient.leases.$_ifdev export AI_SERVER=$(sed "/^ *next-server /!d;s///;s/;$//;q" $_lf) _mode=$(sed -E '/^ *filename "(.*\/)?auto_(install|upgrade)";$/!d;s//\2/;q' $_lf) _path=$(sed -E '/^ *filename "(.*\/)[^/]+";$/!d;s//\1/;q' $_lf) _hn=$(sed -E '/^ *option host-name "(.*)";$/!d;s//\1/;q' $_lf) hostname "$_hn" done if [[ -n $AI_SERVER && -n $_mode ]]; then _mac=$(ifconfig $_ifdev | sed 's/.*lladdr \(.*\)/\1/p;d') for _rf in {$_mac-,${_hn:+$_hn-,}}$_mode; do _url="http://$AI_SERVER/$_path$_rf.conf?path=$HTTP_SETDIR" echo "Fetching $_url" if ftp -Vo "/ai.$_mode.conf" "$_url" 2>/dev/null; then action=$_mode ifconfig $_ifdev delete down 2>/dev/null return 0 fi done else [[ -z $AI_SERVER ]] && echo "Could not determine next-server." [[ -z $_mode ]] && echo "Could not determine auto mode." fi while :; do ask "Response file location?" \ "${AI_SERVER:+http://$AI_SERVER/install.conf}" [[ -n $resp ]] && _rf=$resp && break done _mode=$(echo "$_rf" | sed -En 's/^.*(install|upgrade).conf$/\1/p') while [[ -z $_mode ]]; do ask "(I)nstall or (U)pgrade?" [[ $resp == [iI]* ]] && _mode=install [[ $resp == [uU]* ]] && _mode=upgrade done echo "Fetching $_rf" [[ -f $_rf ]] && _rf="file://$_rf" ftp -Vo "/ai.$_mode.conf" "$_rf" 2>/dev/null && action=$_mode ifconfig $_ifdev delete down 2>/dev/null [[ -n $action ]] } _autorespond() { typeset -l _q=$1 _key local _def=$2 _l _val [[ -f $RESPFILE ]] || return mv /ai.conf /ai.conf.tmp while IFS=' ' read -r _l; do [[ $_l == [!#=]*=?* ]] || continue _key=${_l%%*([[:blank:]])=*} _val=${_l##*([!=])=*([[:blank:]])} [[ $_q == @(|*[[:blank:]])"$_key"@([[:blank:]?]*|) ]] && resp=$_val && cat && return print -r " $_l" done /ai.conf [[ -n $_def ]] && resp=$_def && return echo "\nQuestion has no answer in response file." exit 1 } _ask() { local _q=$1 _def=$2 _int _redo=0 _pid lock; dmesg >/tmp/update; unlock echo -n "${_q:+$_q }${_def:+[$_def] }" _autorespond "$_q" "$_def" && echo "$resp" && return trap "_int=1" INT trap "_redo=1" TERM read resp lock; rm /tmp/update; unlock if ((_redo)); then stty raw stty -raw else case $resp in !) echo "Type 'exit' to return to install." sh _redo=1 ;; !*) eval "${resp#?}" _redo=1 ;; esac fi retrap ((_int)) && kill -INT $$ : ${resp:=$_def} return $_redo } ask() { while ! _ask "$1" "$2"; do done } ask_yn() { local _q=$1 _a=${2:-no} typeset -l _resp while :; do ask "$_q" "$_a" _resp=$resp case $_resp in y|yes) resp=y; return 0;; n|no) resp=n; return 1;; esac echo "'$resp' is not a valid choice." $AUTO && exit 1 done } ask_which() { local _name=$1 _query=$2 _list=$3 _def=$4 _dynlist _dyndef _key _q _key=$(echo "$_name" | sed 's/[^[:alnum:]]/_/g') while :; do eval "_dynlist=\"$_list\"" eval "_dyndef=\"$_def\"" set -o noglob set -- $_dyndef; _dyndef="$1" set -- $_dynlist; _dynlist="$*" set +o noglob (($# < 1)) && resp=done && return : ${_dyndef:=$1} echo "Available ${_name}s are: $_dynlist." _q="Which $_name $_query?" echo -n "$_q (or 'done') ${_dyndef:+[$_dyndef] }" _autorespond "$_q" "${_dyndef-done}" && echo "$resp" \ || _ask || continue [[ -z $resp ]] && resp="$_dyndef" isin "$resp" $_dynlist done && break echo "'$resp' is not a valid choice." $AUTO && [[ -n $RESPFILE ]] && exit 1 done } function ask_until { resp= while true; do ask "$1" "$2" [[ -n $resp ]] && break echo "A response is required." $AUTO && exit 1 done } askpass() { stty -echo IFS= read -r resp?"$1 " stty echo echo } askpassword() { local _q=$1 if $AUTO; then echo -n "$_q " _autorespond "$_q" echo '' _password=$resp return fi while :; do askpass "$_q (will not echo)" _password=$resp askpass "$_q (again)" [[ $resp == "$_password" ]] && break echo "Passwords do not match, try again." done } dhclient() { local _i=0 while makedev bpf$_i && ! /dev/null /sbin/dhclient "$@" } dhcp_request() { local _ifs=$1 _hn=$2 echo "lookup file bind" >/etc/resolv.conf.tail echo "send host-name \"$_hn\";" >/etc/dhclient.conf ifconfig $_ifs group dhcp >/dev/null 2>&1 dhclient -c /dev/stdin $_ifs <<__EOT initial-interval 1; backoff-cutoff 2; reboot 5; timeout 10; send host-name "$_hn"; __EOT mv /etc/dhclient.conf /tmp/dhclient.conf mv /etc/resolv.conf.tail /tmp/resolv.conf.tail } v4_info() { ifconfig $1 inet | sed -n ' 1s/.*/tmp/hosts.new 2>/dev/null mv /tmp/hosts.new /tmp/hosts echo "$_addr $_name" >>/tmp/hosts } v4_config() { local _ifs=$1 _name=$2 _hn=$3 _prompt _addr _mask if ifconfig $_ifs | grep -q 'groups:.* dhcp'; then _addr=dhcp else set -- $(v4_info $_ifs) if [[ -n $2 ]]; then _addr=$2; _mask=$(hextodec $3) ifconfig $_ifs inet $_addr delete fi fi if [[ -x /sbin/dhclient ]]; then _prompt="or 'dhcp' " ifconfig dhcp >/dev/null 2>&1 || _addr=dhcp fi _prompt="IPv4 address for $_ifs? (${_prompt}or 'none')" ask_until "$_prompt" "$_addr" case $resp in none) ;; dhcp) if [[ ! -x /sbin/dhclient ]]; then echo "DHCP not possible - no /sbin/dhclient." else dhcp_request $_ifs "$_name" echo "dhcp" >>$_hn fi ;; *) _addr=$resp ask_until "Netmask for $_ifs?" "${_mask:=255.255.255.0}" ifconfig $_ifs -group dhcp >/dev/null 2>&1 if ifconfig $_ifs inet $_addr netmask $resp up; then addhostent "$_addr" "$_name" echo "inet $_addr $resp" >>$_hn fi ;; esac } v6_info() { ifconfig $1 inet6 | sed -n ' 1s/.*/dev/null | sed -n '/bytes from/{s/^.*from //;s/,.*$//;p;}' | sed -n 'G;s/\n/&&/;/^\(.*\n\).*\n\1/d;h;P')) _prompt="IPv6 default router?" if $AUTO; then _autorespond "$_prompt" && _resp=$resp && echo "$_prompt $_resp" else local PS3="$_prompt (${_routers:+list #, }IPv6 address or 'none'): " select _resp in $_routers; do [[ ${_resp:=$REPLY} == *:* ]] && break [[ $_resp == none ]] && return done fi route -n add -inet6 -host default "$_resp" && echo "$_resp" >>/tmp/mygate } v6_config() { local _ifs=$1 _name=$2 _hn=$3 _addr _prefixlen _prompt ifconfig lo0 inet6 >/dev/null 2>&1 || return set -- $(v6_info $_ifs) [[ -n $2 ]] && { _addr=$2; _prefixlen=$3; } ifconfig $_ifs inet6 >/dev/null 2>&1 && _prompt="or 'rtsol' " _prompt="IPv6 address for $_ifs? (${_prompt}or 'none')" ask_until "$_prompt" "${_addr:-none}" case $resp in none) return ;; rtsol) ifconfig $_ifs inet6 >/dev/null 2>&1 || { echo "No INET6 support."; return; } ifconfig $_ifs up ifconfig $_ifs inet6 autoconf && echo "up\nrtsol" >>$_hn return ;; esac _addr=$resp ask_until "IPv6 prefix length for $_ifs?" "${_prefixlen:=64}" ifconfig $_ifs inet6 $_addr prefixlen $resp up || return echo "inet6 $_addr $resp" >>$_hn addhostent "$_addr" "$_name" v6_defroute $_ifs } ieee80211_scan() { [[ -f $WLANLIST ]] || ifconfig $1 scan | sed -n 's/^ nwid \([^"]\)/\1/p' >$WLANLIST cat $WLANLIST } ieee80211_config() { local _ifs=$1 _hn=$2 _prompt _nwid _haswpa=0 _err ifconfig $_ifs -nwid -nwkey ifconfig $_ifs -wpa 2>/dev/null && _haswpa=1 rm -f $WLANLIST while [[ -z $_nwid ]]; do ask_until "Access point? (ESSID, 'any', list# or '?')" "any" case "$resp" in +([0-9])) _nwid=$(ieee80211_scan $_ifs | sed -n "${resp}s/ .*//p") [[ -z $_nwid ]] && echo "There is no line $resp." ;; \?) ieee80211_scan $_ifs | sed -n 's/^\([^ ]*\) chan .* bssid \([^ ]*\) .*$/ \1 (\2)/p' | cat -n | more -c ;; *) _nwid=$resp ;; esac done if [[ $_nwid != any ]]; then ifconfig $_ifs nwid "$_nwid" quote nwid "$_nwid" >>$_hn _prompt="Security protocol? (O)pen, (W)EP" ((_haswpa == 1)) && _prompt="$_prompt, WPA-(P)SK" while :; do ask_until "$_prompt" "O" case "$_haswpa-$resp" in ?-[Oo]) break ;; ?-[Ww]) ask_until "WEP key? (will echo)" if _err=$(ifconfig $_ifs nwkey "$resp" 2>&1) && [[ -z $_err ]]; then quote nwkey "$resp" >>$_hn break fi echo "$_err" ;; 1-[Pp]) ask_until "WPA passphrase? (will echo)" if ifconfig $_ifs wpakey "$resp"; then quote wpakey "$resp" >>$_hn break fi ;; *) echo "'$resp' is not a valid choice." ;; esac done fi } configure_ifs() { local _first _ifdevs _ifs _name _hn _vl=0 _vd _vi _p _tags while :; do _vd=$(ifconfig vlan$_vl 2>&1) [[ $_vd == @(*no such interface*) ]] && break [[ $_vd == @(*vlan: +([[:digit:]]) parent interface:*) ]] || break ((_vl++)) done _vd= ifconfig lo0 inet 127.0.0.1/8 rm -f /tmp/mygate while :; do ifconfig vlan$_vl create >/dev/null 2>&1 ask_which "network interface" "do you wish to configure" \ '$(get_ifdevs)' \ ${_p:-'$( (get_ifdevs netboot; get_ifdevs) | sed q )'} [[ $resp == done ]] && break _ifs=$resp _hn=/tmp/hostname.$_ifs rm -f $_hn if [[ $_ifs == vlan+([0-9]) ]]; then _vi=$(ifconfig $_ifs 2>/dev/null | sed -n 's/vlan: \([0-9]*\).*/\1/p') _tags=$(ifconfig vlan 2>/dev/null | sed -n 's/vlan: \([0-9]*\).*/\1/p') [[ -n $_tags ]] && _tags=$(rmel "$_vi" $_tags) if [[ -z $_vi ]]; then _vi=0 while ((++_vi < 4096)); do ! isin "$_vi" $_tags && break done fi _ifdevs=$(get_ifdevs) set -- $_ifdevs while [[ $1 == vlan+([0-9]) ]]; do shift done ask "Which interface:tag should $_ifs be on?" "${_vd:=$1}:$_vi" _vd=${resp%%:*} _vi=${resp##*:} if ! (isin "$_vd" $_ifdevs && [[ $_vd != vlan+([0-9]) ]]); then echo "Invalid interface choice '$_vd'" _vd= continue fi if ((_vi < 1 || _vi > 4095)) || isin "$_vi" $_tags; then echo "Invalid or in-use vlan tag '$_vi'" continue fi grep -qs "^up" /tmp/hostname.$_vd || echo "up" >>/tmp/hostname.$_vd chmod 640 /tmp/hostname.$_vd ifconfig $_vd up ifconfig $_ifs destroy >/dev/null 2>&1 ifconfig $_ifs vlan $_vi vlandev $_vd echo "vlan $_vi vlandev $_vd" >>$_hn [[ ${_ifs##vlan} == $_vl ]] && ((_vl++)) fi ifconfig $_ifs 2>/dev/null | grep -q "^[[:space:]]*ieee80211:" && ieee80211_config $_ifs $_hn resp=$(hostname -s) [[ -n $_first && $_first != $_ifs ]] && ask "Symbolic (host) name for $_ifs?" $resp _name=$resp v4_config $_ifs $_name $_hn v6_config $_ifs $_name $_hn if [[ -f $_hn ]]; then chmod 640 $_hn : ${_first:=$_ifs} fi NIFS=$(ls -1 /tmp/hostname.* 2>/dev/null | grep -c ^) _p=done done } v4_defroute() { local _dr [[ -n $(ifconfig | sed -n '/[ ]inet .* broadcast /p') ]] || return set -- $(route -nv show -inet | { set -- $(grep '^default '); print $2 $9; }) [[ -n $1 ]] && _dr=$1 [[ -n $_dr && $2 == DHCLIENT && -f /tmp/dhclient.conf ]] && return while :; do ask_until "Default IPv4 route? (IPv4 address or none)" "$_dr" [[ $resp == none ]] && break route delete -inet default >/dev/null 2>&1 route -n add -inet -host default "$resp" && { echo "$resp" >>/tmp/mygate; break; } route -n add -inet -host default $_dr >/dev/null 2>&1 done } get_fqdn() { local _dn _dn=$(hostname) _dn=${_dn#$(hostname -s)} _dn=${_dn#.} echo "${_dn:=my.domain}" } sane_install() { local _q=$1 _s for _s in $SANESETS; do isin $_s $DEFAULTSETS || continue [[ -n $_q ]] && return 1 if ! ask_yn "Are you *SURE* your $MODE is complete without '$_s'?"; then $AUTO && exit 1 || return 1 fi done } select_sets() { local _avail=$1 _selected=$2 _f _action _col=$COLUMNS let COLUMNS=_col-8 cat <<__EOT Select sets by entering a set name, a file name pattern or 'all'. De-select sets by prepending a '-' to the set name, file name pattern or 'all'. Selected sets are labelled '[X]'. __EOT while :; do for _f in $_avail; do isin $_f $_selected && echo "[X] $_f" || echo "[ ] $_f" done | showcols | sed 's/^/ /' ask "Set name(s)? (or 'abort' or 'done')" done set -o noglob for resp in $resp; do case $resp in abort) _selected=; break 2;; done) break 2;; -*) _action=rmel;; *) _action=addel;; esac resp=${resp#[+-]} [[ $resp = all ]] && resp=* for _f in $_avail; do [[ $_f = $resp ]] && _selected=$($_action $_f $_selected) done done done set +o noglob COLUMNS=$_col resp=$_selected } install_files() { local _src=$1 _files=$2 _f _sets _get_sets _n _col=$COLUMNS \ _tmpfs _tmpsrc _cfile _fsrc _unver _t _issue _srclocal for _f in $THESETS; do isin $_f $_files || continue _sets=$(addel $_f $_sets) isin $_f $DEFAULTSETS "site$VERSION-$(hostname -s).tgz" && _get_sets=$(addel $_f $_get_sets) done if [[ -z $_sets ]]; then echo -n "Looked at $_src " echo "and found no $OBSD sets. The set names looked for were:" let COLUMNS=_col-8 for _n in $THESETS; do echo $_n; done | showcols | sed 's/^/ /' COLUMNS=$_col $AUTO && exit 1 echo return fi isin INSTALL.$ARCH $_files || ask_yn "INSTALL.$ARCH not found. Use sets found here anyway?" || return select_sets "$_sets" "$_get_sets" [[ -n $resp ]] || return _get_sets=$resp _get_sets=$(for s in $THESETS; do isin $s $_get_sets && echo $s; done) _unver=$_get_sets for _issue in ''; do ! isin SHA256.sig $_files && _issue="Directory does not contain SHA256.sig" && break _tmpfs=$( ( for fs in /mnt/{{,var/}tmp,home,usr{/local,}}; do df -k $fs 2>/dev/null | grep " $fs\$" done df -k ) | ( while read a a a a m m; do [[ $m == /mnt/@(@(|var/)tmp|home|usr/@(src,obj,xobj))@(|/*) ]] && ((a > 524288)) && echo $m && exit [[ $m == /mnt@(|/*) ]] && ((a > 524288 * 4)) && echo $m && exit done ) ) if [[ -d $_tmpfs ]]; then ! _tmpsrc=$(tmpdir "$_tmpfs/sets") && _issue="Cannot create prefetch area" && break else _issue="Cannot determine prefetch area" && break fi _cfile=$_tmpsrc/SHA256 _srclocal=false _t=Get/Verify [[ $_src == file://* ]] && _srclocal=true _t='Verifying ' ! ftp -D "$_t" -Vmo "$_cfile.sig" "$_src/SHA256.sig" && _issue="Cannot fetch SHA256.sig" && break ! signify -Vep /etc/signify/openbsd-${VERSION}-base.pub \ -x "$_cfile.sig" -m "$_cfile" && _issue="Signature check of SHA256.sig failed" && break for _f in $_get_sets; do rm -f "$_tmpsrc/h" "$_tmpsrc/fail" ( ftp -D "$_t" -Vmo - "$_src/$_f" || >"$_tmpsrc/fail" ) | ( $_srclocal && sha256 >$_tmpsrc/h || sha256 -ph "$_tmpsrc/h" >"$_tmpsrc/$_f" ) if [[ -f $_tmpsrc/fail ]]; then rm -f "$_tmpsrc/$_f" if ! ask_yn "Fetching of $_f failed. Continue anyway?"; then [[ -d $_tmpsrc ]] && rm -rf "$_tmpsrc" $AUTO && exit 1 return fi continue fi if fgrep -qx "SHA256 ($_f) = $(<$_tmpsrc/h)" "$_cfile"; then _unver=$(rmel $_f $_unver) else if ! ask_yn "Checksum test for $_f failed. Continue anyway?"; then [[ -d $_tmpsrc ]] && rm -rf "$_tmpsrc" $AUTO && exit 1 return fi fi done done [[ -n $_unver ]] && : ${_issue:="Unverified sets:" ${_unver% }} if [[ -n $_issue ]] && ! ask_yn "$_issue. Continue without verification?"; then [[ -d $_tmpsrc ]] && rm -rf "$_tmpsrc" $AUTO && exit 1 return fi for _f in $_get_sets; do _fsrc="$_src/$_f" [[ -f $_tmpsrc/$_f ]] && _fsrc="file://$_tmpsrc/$_f" case $_fsrc in *.tgz) ftp -D Installing -Vmo - "$_fsrc" | tar -zxphf - -C /mnt if [[ $_f == ?(x)base*.tgz && $MODE == install ]]; then ftp -D Extracting -Vmo - \ file:///mnt/var/sysmerge/${_f%%base*}etc.tgz | tar -zxphf - -C /mnt fi ;; *) ftp -D Installing -Vmo "/mnt/$_f" "$_fsrc" ;; esac if (($?)); then if ! ask_yn "Installation of $_f failed. Continue anyway?"; then [[ -d $_tmpsrc ]] && rm -rf "$_tmpsrc" $AUTO && exit 1 return fi else DEFAULTSETS=$(rmel $_f $DEFAULTSETS) GOTSETS="$GOTSETS $_f" fi [[ -d $_tmpsrc ]] && rm -f "$_tmpsrc/$_f" done [[ -d $_tmpsrc ]] && rm -rf "$_tmpsrc" } install_http() { local _file_list _prompt _mirror _url_base waitcgiinfo ask "HTTP proxy URL? (e.g. 'http://proxy:8080', or 'none')" \ "${http_proxy:-none}" unset http_proxy [[ $resp == none ]] || export http_proxy=$resp if [[ -s $HTTP_LIST ]]; then _prompt="HTTP Server? (hostname, list#, 'done' or '?')" else echo "(Unable to get list from ftp.openbsd.org, but that is OK)" _prompt="HTTP Server? (hostname or 'done')" fi while :; do ask_until "$_prompt" "$HTTP_SERVER" case $resp in done) return ;; "?") [[ -s $HTTP_LIST ]] || continue cat -n < $HTTP_LIST | more -c ;; +([0-9])) [[ -s $HTTP_LIST ]] || continue set -- $(sed -n "${resp}p" $HTTP_LIST) (($# < 1)) && { echo "There is no line $resp."; continue; } HTTP_SERVER=${1%%/*} ;; +([A-Za-z0-9\:.\[\]_-])) HTTP_SERVER=$resp break ;; *) echo "'$resp' is not a valid hostname." ;; esac done set -- $(sed "/^$HTTP_SERVER/x;\$!d;x" $HTTP_LIST 2>/dev/null) resp=${1#*/} [[ $resp == "$1" ]] && resp= if (($# > 1)); then resp=$resp/$HTTP_SETDIR _mirror=yes fi : ${HTTP_DIR:=pub/OpenBSD/$HTTP_SETDIR} ask_until "Server directory?" "${resp:-$HTTP_DIR}" HTTP_DIR=$resp _url_base="http://$HTTP_SERVER/$HTTP_DIR" _file_list=$(ftp -Vo - "$_url_base/index.txt" | sed 's/^.* //;s/ //') install_files "$_url_base" "$_file_list" INSTALL=$_url_base PACKAGE_PATH= if [[ -n $_mirror ]]; then PACKAGE_PATH=$(print -r -- "$_url_base" | sed -E "/\/(snapshots|[0-9]\.[0-9])\/($ARCH)\/*$/!d s!!/%c/packages/%a/!;q") fi } install_mounted_fs() { local _dir while :; do ask_until "Pathname to the sets? (or 'done')" "$SETDIR" [[ $resp == done ]] && return [[ -d /mnt2/$resp ]] && { _dir=/mnt2/$resp; break; } [[ -d /mnt/$resp ]] && { _dir=/mnt/$resp; break; } [[ -d /$resp ]] && { _dir=/$resp; break; } echo "The directory '$resp' does not exist." $AUTO && exit 1 done install_files "file://$_dir" "$(ls $_dir/)" } install_cdrom() { local _drive=$1 makedev $_drive && mount_mnt2 $_drive || return install_mounted_fs } install_disk() { if ! ask_yn "Is the disk partition already mounted?"; then ask_which "disk" "contains the $MODE media" \ '$(bsort $(get_dkdevs))' \ '$(bsort $(rmel $ROOTDISK $(get_dkdevs)))' [[ $resp == done ]] && return 1 makedev $resp && mount_mnt2 $resp || return fi install_mounted_fs } install_nfs() { local _tcp ask_until "Server IP address or hostname?" "$NFS_ADDR" NFS_ADDR=$resp ask_until "Filesystem on server to mount?" "$NFS_PATH" NFS_PATH=$resp ask_yn "Use TCP transport? (requires TCP-capable NFS server)" && _tcp=-T mount_nfs $_tcp -o ro -R 5 $NFS_ADDR:$NFS_PATH /mnt2 || return install_mounted_fs } mount_mnt2() { local _dev=$1 _opts _file=/tmp/parts.$1 _parts disklabel $_dev 2>/dev/null | sed -En '/swap|unused/d;/^ [a-p]: /p' >$_file _parts=$(sed 's/^ \(.\): .*/\1/' $_file) set -- $_parts (($# == 0)) && { echo "No filesystems found on $_dev."; return 1; } if isin "c" $_parts; then resp=c elif (($# == 1)); then resp=$1 else cat $_file ask_which "$_dev partition" "has the $MODE sets" \ '$(disklabel '$_dev' 2>/dev/null | sed -En '\''/swap|unused/d;/^ ([a-p]): .*/s//\1/p'\'')' [[ $resp == done ]] && return 1 fi grep -q "^ $resp: .*MSDOS" $_file && _opts="-s" mount -o ro,$_opts /dev/$_dev$resp /mnt2 } set_term() { local _layouts export TERM=${TERM:-${MDTERM:-vt220}} if [[ -n $CONSOLE ]]; then ask "Terminal type?" $TERM export TERM=$resp else [[ -x /sbin/kbd ]] || return _layouts=$(bsort $(kbd -l | egrep -v "^(user|tables|encoding)")) while :; do ask "Choose your keyboard layout ('?' or 'L' for list)" "default" case $resp in [lL\?]) echo "Available layouts: $_layouts";; default) return;; *) kbd $resp && { echo $resp >/tmp/kbdtype; return; };; esac done fi } donetconfig() { local _dn _ns _f1 _f2 _f3 configure_ifs v4_defroute if [[ -f /tmp/resolv.conf.shadow ]]; then mv /tmp/resolv.conf.shadow /tmp/resolv.conf while read -r -- _f1 _f2 _f3; do [[ $_f1 == nameserver ]] && _ns="${_ns:+$_ns }$_f2" [[ $_f1 == @(domain|search) ]] && _dn=$_f2 done /dev/null 2>&1 && [[ $NIFS == 1 && -n $_dn ]]; then echo "Using DNS domainname $resp" else ask "DNS domain name? (e.g. 'bar.com')" "$resp" fi hostname "$(hostname -s).$resp" resp="${_ns:=none}" if ifconfig dhcp >/dev/null 2>&1 && [[ $NIFS == 1 && -n $_ns ]]; then echo "Using DNS nameservers at $resp" else ask "DNS nameservers? (IP address list or 'none')" "$resp" fi if [[ $resp != none ]]; then echo "lookup file bind" >/tmp/resolv.conf for _ns in $resp; do echo "nameserver $_ns" >>/tmp/resolv.conf done cp /tmp/resolv.conf /tmp/resolv.conf.shadow fi } questions() { local _d _cdef=no ask_yn "Start sshd(8) by default?" yes sshd=$resp aperture= resp= xdm= if [[ -n $DISPLAY ]]; then if [[ -n $(scan_dmesg '/^[a-z]*[01]: aperture needed/p') ]]; then ask_yn "Do you expect to run the X Window System?" yes && aperture=$MDXAPERTURE fi if [[ -n $MDXDM && $resp != n ]]; then ask_yn "Do you want the X Window System to be started by xdm(1)?" xdm=$resp fi fi if [[ -n $CDEV ]]; then _d=${CPROM:-$CDEV} [[ -n $CONSOLE ]] && _cdef=yes ask_yn "Change the default console to $_d?" $_cdef defcons=$resp if [[ $resp == y ]]; then ask_which "speed" "should $_d use" \ "9600 19200 38400 57600 115200" $CSPEED case $resp in done) defcons=n;; *) CSPEED=$resp;; esac fi fi } user_setup() { local _q="Setup a user? (enter a lower-case loginname, or 'no')" while :; do ask "$_q" no case $resp in n|no) return ;; y|yes) _q="No really, what is the lower-case loginname, or 'no'?" continue ;; root|daemon|operator|bin|smmsp|popa3d) ;; sshd|uucp|www|named|proxy|nobody|ftp) ;; [a-z]*([a-z0-9_])) ((${#resp} <= 31)) && break ;; esac echo "$resp is not a useable loginname." done user=$resp while :; do ask "Full name for user $user?" $user case $resp in *[:\&,]*) echo "':', '&' or ',' are not allowed." ;; *) ((${#resp} <= 100)) && break echo "Too long." ;; esac done username=$resp askpassword "Password for user $user?" userpass=$_password userkey= $AUTO && ask "Public ssh key for user $user" none && [[ $resp != none ]] && userkey=$resp } ask_root_sshd() { typeset -l _resp [[ $sshd == y ]] || return if [[ -z $user ]]; then echo "Since no user was setup, root logins via sshd(8) might be useful." fi echo "WARNING: root is targeted by password guessing attacks, pubkeys are safer." while :; do ask "Allow root ssh login? (yes, no, prohibit-password)" no _resp=$resp case $_resp in y|yes) sshd_enableroot=yes ;; n|no) sshd_enableroot=no ;; w|p|without-password|prohibit-password) sshd_enableroot=prohibit-password ;; *) echo "'$resp' is not a valid choice." $AUTO && exit 1 continue ;; esac break done } set_timezone() { local _zonefile=$1 _zonepath _zsed _tz _zoneroot=/usr/share/zoneinfo [[ ! -f $_zonefile ]] && return [[ -n $TZ ]] && return if [[ -h /mnt/etc/localtime ]]; then TZ=$(ls -l /mnt/etc/localtime 2>/dev/null) TZ=${TZ#*${_zoneroot#/mnt}/} fi waitcgiinfo if [[ -n $CGI_TZ ]]; then _tz=$CGI_TZ [[ -n $_tz ]] && isin "$_tz" $(<$_zonefile) && TZ=$_tz fi [[ $_zonefile = /var/tzlist && -z $TZ ]] && return while :; do ask "What timezone are you in? ('?' for list)" "$TZ" _zonepath=${resp%%*(/)} case $_zonepath in "") continue ;; "?") grep -v /. $_zonefile | showcols continue ;; esac while isin "$_zonepath/" $(<$_zonefile); do ask "What sub-timezone of '$_zonepath' are you in? ('?' for list)" _zsed=$(echo $_zonepath/ | sed 's,/,\\/,g') resp=${resp%%*(/)} case $resp in "") ;; "?") sed -n "/^$_zsed/{s/$_zsed//;/\/./!p;}" $_zonefile | showcols;; *) _zonepath=$_zonepath/$resp;; esac done if isin "$_zonepath" $(<$_zonefile); then TZ=${_zonepath#$_zoneroot} return fi echo -n "'${_zonepath}'" echo " is not a valid timezone on this system." done } get_rootinfo() { while :; do echo "Available disks are: $(get_dkdevs | sed 's/^$/none/')." _ask "Which disk is the root disk? ('?' for details)" \ $(get_dkdevs | sed 's/ .*//') || continue case $resp in "?") diskinfo $(get_dkdevs) ;; '') ;; *) isin "$resp" $(get_dkdevs) && break echo "no such disk" ;; esac done makedev $resp || exit ROOTDISK=$resp ROOTDEV=${ROOTDISK}a SWAPDEV=${ROOTDISK}b } ifstart () { local _hn=$1 if=${1#/mnt/etc/hostname.} ((NIFS++)) while :; do if [ "$cmd2" ]; then set -- $cmd2 af=$1 name=$2 mask=$3 bcaddr=$4 ext1=$5 cmd2= i=1 while [ i -lt 6 -a -n "$1" ]; do shift; let i=i+1; done ext2="$@" else read af name mask bcaddr ext1 ext2 || break fi case "$af" in "#"*|"!"*|"bridge"|"") continue ;; "dhcp") [ "$name" = "NONE" ] && name= [ "$mask" = "NONE" ] && mask= [ "$bcaddr" = "NONE" ] && bcaddr= dhcpif="$dhcpif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 down" if [[ -x /sbin/dhclient ]]; then cmd="$cmd; dhclient $if" else cmd="$cmd; echo /sbin/dhclient missing - skipping dhcp request." fi ;; "rtsol") if ifconfig $if inet6 >/dev/null 2>&1; then rtsolif="$rtsolif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" else cmd="$cmd; echo no INET6 support - skipping rtsol request." fi ;; *) read dt dtaddr if [ "$name" = "alias" ]; then alias=$name name=$mask mask=$bcaddr bcaddr=$ext1 ext1=$ext2 ext2= else alias= fi cmd="ifconfig $if $af $alias $name" case "$dt" in dest) cmd="$cmd $dtaddr" ;; *) cmd2="$dt $dtaddr" ;; esac case $af in inet) if [ ! -n "$name" ]; then echo "/etc/hostname.$if: inet alone is invalid" return fi [ "$mask" ] && cmd="$cmd netmask $mask" if [ "$bcaddr" -a X"$bcaddr" != "XNONE" ]; then cmd="$cmd broadcast $bcaddr" fi [ "$alias" ] && rtcmd=";route -qn add -host $name 127.0.0.1" ;; inet6) if [ ! -n "$name" ]; then echo "/etc/hostname.$if: inet6 alone is invalid" return fi [ "$mask" ] && cmd="$cmd prefixlen $mask" cmd="$cmd $bcaddr" ;; *) cmd="$cmd $mask $bcaddr" ;; esac cmd="$cmd $ext1 $ext2$rtcmd" rtcmd= ;; esac eval "$cmd" done <$_hn } enable_network() { local _f _gw _trunks _svlans _vlans for _f in dhclient.conf resolv.conf resolv.conf.tail; do if [[ -f /mnt/etc/$_f ]]; then cp /mnt/etc/$_f /etc/$_f fi done ifconfig lo0 inet 127.0.0.1/8 for hn in /mnt/etc/hostname.*; do if=${hn#/mnt/etc/hostname.} if isin ${if%%+([0-9])} $(ifconfig -C); then case ${if%%+([0-9])} in trunk) _trunks="$_trunks $hn";; svlan) _svlans="$_svlans $hn";; vlan) _vlans="$_vlans $hn";; esac else ifconfig $if >/dev/null 2>&1 && ifstart $hn fi done for hn in $_trunks $_svlans $_vlans; do ifstart $hn done [[ -n $rtsolif ]] && ifconfig $rtsolif inet6 autoconf [[ -z $dhcpif ]] && stripcom /mnt/etc/mygate | while read _gw; do [[ $_gw == @(*:*) ]] && continue route -qn delete default >/dev/null 2>&1 route -qn add -host default $_gw && break done [[ -z $rtsolif ]] && stripcom /mnt/etc/mygate | while read _gw; do [[ $_gw == !(*:*) ]] && continue route -qn delete -inet6 default >/dev/null 2>&1 route -qn add -host -inet6 default $_gw && break done route -qn add -net 127 127.0.0.1 -reject >/dev/null } startcgiinfo() { ((NIFS < 1)) && return set -m ( ftp -Vao - "http://129.128.5.191/cgi-bin/ftplist.cgi?path=$HTTP_SETDIR" \ 2>/dev/null >$CGI_INFO echo -n $SECONDS >$HTTP_SEC feed_random ) & CGIPID=$! set +m (sleep 12; kill -INT -$CGIPID >/dev/null 2>&1) & } munge_fstab() { local _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do [[ $_dev == @(/dev/vnd*|\#*) || $_fstype == nfs || ! -f /sbin/mount_$_fstype || $_opt == *noauto* || $_opt == *xx* ]] && continue _opt=$(echo $_opt | sed 's/softdep//') if [[ $_fstype == ffs ]]; then _opt=$(echo $_opt | sed 's/[[:<:]]ro[[:>:]]/rw/') else _opt=$(echo $_opt | sed 's/[[:<:]]rw[[:>:]]/ro/') fi echo $_dev /mnt${_mp%/} $_fstype $_opt $_rest done /etc/fstab if [[ ! -s /etc/fstab ]]; then echo "Unable to create valid /etc/fstab." exit fi } check_fs() { local _dev _dn _mp _fstype _rest _fail _f _passno ask_yn "Force checking of clean non-root filesystems?" && _f=f while read _dev _mp _fstype _rest _rest _passno _rest; do _dn=$(getdevname "$_dev") [[ $ROOTDEV == @(${_dev#/dev/}|$_dn${_dev##*.}) ]] && continue [[ -f /sbin/fsck_$_fstype ]] || continue makedev "$_dn" || continue ((_passno > 0)) || continue echo -n "fsck -${_f}p $_dev..." if ! fsck -${_f}p $_dev >/dev/null 2>&1; then echo "FAILED. You must fsck $_dev manually." _fail=y else echo "OK." fi done /dev/random 2>&1 if [[ -e /mnt/var/db/host.random ]]; then dd if=/mnt/var/db/host.random of=/dev/random bs=65536 count=1 \ status=none fi } install_sets() { local _cddevs=$(get_cddevs) _d=$CGI_METHOD _locs="disk http" _src echo ifconfig netboot >/dev/null 2>&1 && : ${_d:=http} [[ -n $_cddevs ]] && : ${_d:=cd0} [[ -x /sbin/mount_nfs ]] && _locs="$_locs nfs" : ${_d:=http} if ! isin "$_d" $_cddevs $_locs; then for _src in http $_cddevs nfs disk; do isin $_src $_cddevs $_locs && _d=$_src && break done fi echo "Let's $MODE the sets!" while :; do _cddevs=$(get_cddevs) umount -f /mnt2 >/dev/null 2>&1 ask "Location of sets? (${_cddevs:+$_cddevs }$_locs or 'done')" "$_d" case $resp in done) sane_install && return ;; [cC]*) if [[ -n $_cddevs ]]; then set -- $_cddevs [[ $resp == [cC]?([dD]) ]] && resp=$1 install_cdrom $resp && METHOD=$resp fi ;; [dD]*) install_disk && METHOD=disk ;; [hH]*) isin http $_locs && install_http && METHOD=http ;; [nN]*) isin nfs $_locs && install_nfs && METHOD=nfs ;; *) $AUTO && echo "'$resp' is not a valid choice." && exit 1 ;; esac [[ -n $METHOD ]] && _d=$METHOD sane_install quiet || $AUTO && _d=done done } apply() { if [[ $sshd == n ]]; then echo "sshd_flags=NO" >>/mnt/etc/rc.conf.local elif [[ -n $sshd_enableroot ]]; then if ! grep -q "^#PermitRootLogin $sshd_enableroot\$" \ /mnt/etc/ssh/sshd_config; then sed -i "s/^#\(PermitRootLogin\) .*/\1 $sshd_enableroot/" \ /mnt/etc/ssh/sshd_config fi fi [[ -n $aperture ]] && echo "machdep.allowaperture=$aperture # See xf86(4)" \ >>/mnt/etc/sysctl.conf [[ $xdm == y && -x /mnt/usr/X11R6/bin/xdm ]] && echo "xdm_flags=" >>/mnt/etc/rc.conf.local if [[ $defcons == y ]]; then cp /mnt/etc/ttys /tmp/ttys sed -e "/^$CTTY/s/std.9600/std.${CSPEED}/" \ -e "/^$CTTY/s/unknown/vt220 /" \ -e "/$CTTY/s/off.*/on secure/" /tmp/ttys >/mnt/etc/ttys [[ -n $CPROM ]] && echo "stty $CPROM $CSPEED\nset tty $CPROM" >>/mnt/etc/boot.conf fi ln -sf /usr/share/zoneinfo/$TZ /mnt/etc/localtime } encr_pwd() { local _p=$1 if [[ -z $_p ]]; then echo '*' elif [[ $_p == \$2?\$[0-9][0-9]\$* && ${#_p} > 40 || $_p == '*************' ]]; then echo "$_p" else encrypt -b a -- "$_p" fi } store_random() { dd if=/dev/random of=/mnt/var/db/host.random bs=65536 count=1 \ status=none dd if=/dev/random of=/mnt/etc/random.seed bs=512 count=1 status=none chmod 600 /mnt/var/db/host.random /mnt/etc/random.seed } finish_up() { local _dev _mp _fstype _rest if [[ -x /mnt/sbin/swapctl ]]; then /mnt/sbin/swapctl -a /dev/$SWAPDEV >/dev/null 2>&1 while read _dev _mp _fstype _rest; do [[ $_fstype == swap ]] && /mnt/sbin/swapctl -a $_dev >/dev/null 2>&1 done $/\1/p') md_installboot $ROOTDISK if [[ -f /mnt/bsd.mp ]] && ((NCPU > 1)); then echo "Multiprocessor machine; using bsd.mp instead of bsd." mv /mnt/bsd /mnt/bsd.sp 2>/dev/null mv /mnt/bsd.mp /mnt/bsd fi echo "/usr/sbin/fw_update -v" >>/mnt/etc/rc.firsttime store_random cat <<__EOT CONGRATULATIONS! Your OpenBSD $MODE has been successfully completed! To boot the new system, enter 'reboot' at the command prompt. __EOT [[ $MODE == install ]] && cat <<__EOT When you login to your new system the first time, please read your mail using the 'mail' command. __EOT md_congrats [[ $MODE == upgrade ]] && \ echo "After rebooting, run sysmerge(8) to update your system configuration." $AUTO && >/ai.done } AUTO=false RESPFILE= while getopts "af:" opt; do case $opt in a) AUTO=true;; f) RESPFILE=$OPTARG;; *) usage;; esac done shift $((OPTIND-1)) (($# == 0)) || usage . install.md rm -df /tmp/lock rm -f /tmp/update if ! $AUTO; then ( while :; do lock if [[ -e /tmp/update && "$(dmesg)" != "$(/tmp/update kill -TERM 2>/dev/null $$ || exit 1 fi unlock sleep .5 done ) |& CPPID=$! retrap fi ROOTDISK= ROOTDEV= PACKAGE_PATH= SETDIR="$VNAME/$ARCH" CGI_INFO=/tmp/cgiinfo CGI_TZ= CGI_TIME= CGI_METHOD= INSTALL= METHOD= HTTP_DIR= HTTP_SEC=/tmp/httpsec HTTP_LIST=/tmp/httplist WLANLIST=/tmp/wlanlist for _opt in d f l m n p s; do ulimit -$_opt unlimited done dmesg | sed -n '/^OpenBSD /h;/^OpenBSD /!H;${g;p;}' >/var/run/dmesg.boot HTTP_SETDIR=$SETDIR set -- $(scan_dmesg "/^OpenBSD $VNAME\([^ ]*\).*$/s//\1/p") [[ $1 == -!(stable) ]] && HTTP_SETDIR=snapshots/$ARCH MTDEVS=$(scan_dmesg "${MDMTDEVS:-/^[cms]t[0-9][0-9]* /s/ .*//p}") NIFS=0 DISPLAY=$(scan_dmesg '/^wsdisplay[0-9]* /s/ .*//p') CONSOLE=$(scan_dmesg '/^\([^ ]*\).*: console$/s//\1/p') CONSOLE=${CONSOLE% } [[ -n $CONSOLE ]] && CSPEED=$(stty speed /dev/null 2>&1 for _ifs in $(get_ifdevs dhcp); do set -- $(v4_info $_ifs) [[ $1 == UP && -n $2 ]] && continue ifconfig $_ifs delete down -group dhcp 2>/dev/null done if ! $AUTO; then cat <<__EOT At any prompt except password prompts you can escape to a shell by typing '!'. Default answers are shown in []'s and are selected by pressing RETURN. You can exit this program at any time by pressing Control-C, but this can leave your system in an inconsistent state. __EOT elif [[ -z $RESPFILE ]]; then if ! get_responsefile; then echo "No response file found; non-interactive mode aborted." exit 1 fi rm -f /ai.done echo "Performing non-interactive $action..." /$action -af /ai.$action.conf 2>&1 >/mnt/etc/rc.firsttime ( /usr/bin/mail -s '$(hostname) $action log' root <$_lf && rm $_lf ) >/dev/null 2>&1 & __EOT exec reboot else echo "failed; check /ai.log" exit 1 fi else cp $RESPFILE /ai.conf || exit fi set_term p""|"Y: TC"XC"TC"xC" J"ER0l"CEXq"ST(e"SLn"RRl"CEXq"ST(e"NMm"lh"CLr"0PLr"0REe"@RRl"CEXq"ST(e"PX,s"j"TF i"i"PNq"RRl"CEXq"ST(e""̏"l"k&"%R"$l&"%%"_"","T"%"̋""|"L""X"`_"%%,l&%%̊"""%""̏"l"T"'"#' k&$l&h$'T"'&'"_"l"'T"'k&T"'''''|")'T"'T"'`_"T"'T"',l&T"'T"'̊"'T"'T-'@'"P""""$""c4 "cnativedq1Kcе"`1x"<"Ds1Xs1nativedq1Kc#`1Ds1Xs1(_94_9@_9#<#J# T*% @1% &|#\N"K#&&5#&& <&0& T&d/"~#c#h&`&o#\d#pd## 8% l&% & % %&&&&#&(d#&0"&d#$# #d##f#e##ĸ#" *%E$H&\& & p!#D&& &&&`&lJ#)$42$ %$<$$'%L#y. 0y. $w.&`& .Tg#l#Dd#4j#p$&&`m.0$ 3$,$"(*$ t"h&h $H& # & | & &#A% D"\p1 \&%&&#%p&%D# D$#####% # )% 0%# &&#p#r# &##|"&`&0%&&&##'$######dk#&############x&###2#######&8&######m#l#n########&" /`}#l## {.#d& &&#u.u.##i## $%######################################## x.# %d# <&i# x.###### B%&##$&h&##v.v.######## f# v# l?l@2A/B`C`D@GE "F "G_L H@I/JlK/LlM2N@GO2P@GQRST`U@GV "W@GX "Y_L Zu [_L \u ]v ^v _ pp@@@@   j  j  j @ a(4;c;c ((Y(((Y(P(c9(d;c;cd,=cl7*(*(**=cC*\*G*h*l*8*=cl*<***|***=c(^*d\*Z*`*=c0*d\*Z*`***=ch +d\*Z*`*+=c)h +d\*Z*`*=c)d\*Z*`*))t))=c(^*d\*Z*`*^*p9;c=c dX>c>c >c>c>c<8Q @X,t>c>c>c>c;c;c;c;c>cD>cp>cH>cL>cP>cT>cX>c\>cd>c`>ch>cl>cx>c|>ct!h(@AAA==(A*x*e dd%(i @@@@@@@@@@@c?cHiHi@c?c @c@c@c$@c$@c@c@cp9X+$++x98H+++9++l+9 +++9$+++X+9$+++ +9$9 @++$++ȕ9$$HH,H,D,@, {98+<+0+ܕ9 X@$"++`-+9 \@(N++e+9 \@.++L+ 9 @x++`+ 900404H>4dm4l48l4% l4%He4%e44$44%|4%4%4Ԗ444%4%|4%D4055%%'5%%%5505L5D5%5%5%%%%%%%%%%%%%%%%%%%%%%% x%%@O%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%@#%%%%%%%%%%%%%%%%%h"p"x"""%%%@#%%%%%%%%%%%%%%%%%%aiGH@%K@p0A @ 0,@9P<X_2y2x2y2pB:D2̟22D2`E:\22X22S9@T22\G:2x2(2`2H2@2^1<2[1[1[1^1[1\1<\1`_1\1]1,]1_1[1[1[1$_1d\1\1\1_1T]1|]1]1 `10`1@`1P`1``1]1]1`1`1`18^1`1`11ċ111Ć118~1p1܂11Љ111022XH:H2l2I:P23I: 2I:33<32x2(2`2H2@2^1<2333^133P_1`_1_1_1_1_1333$_133_1_1_1`1`1 `10`1@`1P`1``1p`1`1`1`1`1`1`1`1J:3T333d33T33@30343 3t 3383<3|3033!x{x8{L: |03030 -44ddd[[d[2d[2d[(Pdp[p"CRdM:p>?? ' ` ~ ^ "' ,AAA AA'CEEEEIIIINOOOOOUUUUYaaaa aa'ceeeeiiiinooooouuuuyy"A"E"I"O"U"a"e"i"o"u"yA^A`A*A~ACE^E`EI^I`I~NO^O`O~OU^U`UYa^a`a*a~ace^e`ei^i`i~no^o`o~ou^u`uy`h:8~4܂44@~444 4444|44l8p44d444|4<444<4D44,4????@`px|~ 08<>????????????????????????? @`px|~ 08<>????????????????? @`px|~ 08<>????????? @`px|~ 08<>? Boldface.iso1 c`cwfllllllll||| 0 `F8ll8vv0 000000 0 0f<0p000x6 0>p00p>p|`08l 8llF`0| 0|c`$ch1`5!d#, (?.%8L7a6XpOcx\(,b%%0E$0%;(\,$hw0h;cx6(\Z6 <$|,t)* 5h(C08O'DZ35j/pzL$`2Tji|c5(P7P|d)xy72dx>c)Z1,6t!D3V'@h|#\r0>5|.4<$5iHs(A%$V,hh+dk#n)< ,j!2L+ '3d/h@F(\L`&WC0d2c{DDiD)@05T,"2hBc$!h#!, h 4%B/,5\)pH20V6e@r4<t|"@)+d,H!(\1`"(&(60c ''&&l h\ 44h@2`6h0&h4d2c%hh6,J$X<4;GH%$Oh4[Xcp92L~#  $6t'h)$l1.T"t ; + (Y2& @;c0 (#D d"`N 0!T] .lr - )\ H~c 7 87 h\&L 08 [1 P)D d0 $% g3 t( F +LQ 1hX HM)n  u 2 XOc d $ X+0 "8 84` 79  pHc$ - )c 4* i7 iH *X^ i1i t 6tx L)X 75D (}7 d3( W3 3  0+T * t!h b4" .&<, |F%46 0j A )V 8%8] P7p G0 ' h \$X Oc  y# x"h@   6 ,. \0 g .<! Ћ#T. M#07 4xF *cW .9c 0]0q '} %< 0t \T% 3!L " \l'D ,k6 P"h /T h# 0,"#D2L$B2xKl4Z@%ci 3$d{l6( 2P;Xju$HX5X*7X2DL*(3t) )x?#<#PD'9L(!x^$sԡc*~5|'$N2@5lL~$ "h1 #P 8319"@Kh!_@*.vx'-;c07 5/ؠ0\'D3"D\ch42$Ѝ3T2" $)0.D:7dH}'U$d3vN2*,$cd!.\,E5X'L-'Ta#<(*HE)l.5`A%K2,T@.(d@7`rp/3zd#,w"`/h. | .d05$430& /c)<&hh'.L":) Y#@j@ txbhce48 , 8`E.L25@D5h3T ., 0$t2\",)9N,J"8DY3KL0Z8kBc~@.6\i%+plL%<hY4(0'Le1743l\D4hw-|!(-H4m(;#O3\+h,",tXJ4 g\c%5 1DF5t3`-$n1%hY($6l6lj?PjO'8]:0gH#x3T3j#'l5xjh)Ld5(.0T>c+&d'd/Y5EhP0%t[#<k0% y56<5O5$>cH(6ث6?%057` 4<.#>L)J87]7Hn,2Te$d`#O0T4.HU54$'\'8#l/*c#%@2L4hA8L1XgRiu)0'@!x!|c<j`1'(D"X4s7pD5XK)|/cP;5Eo4QcZ7f(4vi5t54Wi$(,d)T$T#! +h&'!T:gC4j#0O#,]gd+tA!tt $$a& "!5(Z-e#L,)20 dSi "38O$p?KcQ$@c`,)sv#H#3N(d2<#2@,/cX hehhP2Th$< -c*@7$:X6D(6MT3Lc@B2trcd>c>c1l. g>)x(c(Ⱦ2 x])x-X%@,4*L@d&XJ$+4W' d'sp$2<7t!.,V44Xix 4 4.dhgE7h $hh&H +(/5?HIi0HgTT6`^;ch7l}1j$$}#n#`2-D6 He4@ . Dc(8 hE $+TU 6c 3q [)$ ( 7 к5 ! C"< 8; c!H$!c!!g,!?#8!L#tC!#L!C"8X!x!h!3s!4G$}! }"!4!L!D! $!#L !Mc!)!&(!7(!P_1",D"%l)"g1"":"T3J")lX"h(h"2 $r"5"8 "b6"S3"^5"i"ph#("4 &"*D"#"-4# .H#=59#8d4K#jY#_1l#TDit#t#P#3#4Oc#hSi#0/x#$v4#t*#P6#<4$l1$4q6$D&$)$P19$\.0D$o*U$8X)xk$#({$c$ #8$1$^1$*$d,L$DP2$>c$p0$03t%G5P%̱4(-% 79%S*C%$0T%']%h$cl%\e$Hx%L6t% $p%/%|3`%j3%t.l%<(%'4% "8%3&@$T &% &"x&&d!5&TI&E&#S&g^&'k&T5@{&(8&L#x&0/&7&h&PN!p&0%c&$"&lg&^1', '!''18''I'1t_'(q'H5P'c'W&h',Oc'4$' '}-'l0('ܪ5'7'|c (tKc(D"L$(TI!H0(c8(pN6`B(|8P(1f(D u(7@(06\("()(.(Dx*( !0(K4@(h )H-.)#.-)l.&d4)Pc>);A) 7,M)008])`"m)#0x)H&) )TZ%) %c)7)j).$)xNi)L6*f(*$+*{&H3*6\@*1TK* \*?7`j*rct*6*X31 *4T*x34*h2$*dk&(*3*%x*#l*\d#+g+8+t"p)+`-4+س#B+PM&J+5W+Б1h+],v+17h+y4+n1+X%8+Tc+dS"+d#`+<.d+HR2<,*(X,ܓ', h',14,KcL,830Y,J#Xb, 80m,@*d|,2,j,$2X,''H,<1,&0,Bc,'t,!h-04t--x*-75d:-]3,J-li V-Kcn-ȳ+z-Hc-z5-t/ -.,-E$-#c-"x- -,j+ .".lJ#<&.1 7.8ocB..pQ.iZ.D;'e.T2q.2.t)@. " ..<.0d.-4.|c.&. /6 /8-5/| d@/jR/,]/t+Ti/\4y/\j/87/h/h/ /,;/؂c/&L/ ,8/DO6\/Mc 0#H0&'075=07,H0t.U06@a04w0$.003D0'0$l&0`$T0 u2`0,0c02@0"1uc1"H 1,/X+1\(HB1. T1t h^1tce15s1+,1X31 Y(14311c1 #1,51Kc2h2 2$3*2w1$@25V2@ 14g2.}2̴#24&2802'2 |&2.<2$%2c2C 233D&3@2l#3"033 %`B3,U#0K33X3- e3 (v3X3 3xOc30n43 3`)(3_(<3:&3P"33` 4 /H4')4G&;4,+lJ4`(\W4%,^4t.u4<)|4\1\4p64$34L384c4@c4|4|53@5.l)5@2c25&E5d+P5t36la56j5`1}5x@(5t)c5"5T#5D45oc5H+50.!@5d 6 .46&L'64j26x -A6V T6X7a6y2`o65|6'<6#6+@6A)86L-6TD/6<&p6 =#x6(\7@/307_1'7)H87'K7.cX76\i7L)d}7Y(07mc757_17Х!7Lg%< 70P79 73&d7d37h7/48t6|8&6(8Hc/8x-@8$TM8&([806e85t8Fc8, 8%8!8p,<8'8,35h8786 869489cB=$0O=S$\=l&(j=!0q=܂1=% =)t=X!(H=إ%=`+='4=L!=.9=%x=43 >!>j#>.@>4& F>`1Y>:.,o> I-~>0 >0'>j>|69 > >8>p1X>.p>@+ >h?L#p ?(4&?<5l7?D(4lB?L(DX?T.@e?,8/`u?P)? ?6?_1?h?@h(?&P? T? ?~6?,R$@@'<@`+%@l%-@-&5@ 7`J@,W@4Hk@x,cr@.@@8B@Hc@04x@1 @(c@%,@2 @]1@5@D0#A|!A`a(@!A"(Ag2AP"p=Ad39 IAHiZA6XcA*cjAD)4yAD5DAh/ A)A2cAh_$AKcA)X B-(B%B'*Bc:BܡcABp34|[B1 fB,b(qB$79 }BhOcB /+Bp#B(N+XB65 B6By6 B Y.B`V4D C@oc`C %Cd P2C3=C24DC0-WCh&cClk6qC # }C(C',C05C*C HC8xC47DCS2CH'HD @D BcDM6x'D75<6D4/CD&tQD"XDcbD̻gmD0$c |D%D%D HD0OcD|-(D 9 D j`D1HDl,Dh D&(EP7E /ET$(Ep#X0Et6lAE4RE)[EL&jE4DrEu-EH(hE8E06PE@x1E8M$E6Eh=3E`.HE8 ,EhB6|F8 F}0P'FFc4F76 ?F2VF "tfF48 pFL5Ft7FH6F/38F̀0xF/F"4F$)xFT$P G\ $G j4#G),/G&L3HHG)LH4%(dH hHp5HO%H7\H*cH  I#2I=# I$;!X6I+&PKI$ZI|Bc$pI'PI3I2cIDG%I%I)IH!I|038I#lI46xI`i  J=!<J1'Jp=.`9J&HJ&tSJh&]J'lJ#\uJ%`|J,q5J7 J((4J!lJ$,XJ4J$~c J=c0J5Jhb2 KL(((Kp0K $.KL#X;KR2xKK#(4ZK36eKy$@tK\#K@&K/40K`*K$(8K!.4K#K#lKT-'4K $cK7 L)L"4"L52Lxi=L2ELgML/p]L5#XcL7sLԸ#HL5L3CY\iWYo*\eY&nY 'vY (xY`'(Y"Y܆! Y8Y6hY}+HY,-Yl1YHR# Y-ZDc(Z|),Z#`:ZD!MZ6XZjiZ|2sZ@c Z#LZ4`6Z4h"8Z HZs7xZI&DZ "xZ8Z$&Z#[8% [5%[+*[l' 1[' :[+!P[7_[5$r[h'@{[lvcd[0*\[|c[&[d)t[-[;[E/[g\XBc$\(p"\d23\@#D>\L "8G\\#4X\|r4xg\js\z5\f#,\T2\l$c\D'\d1\|[#X\"@\ ;\G*\\']x5]T4t*],T5]"XD]&S]h7_]>4hm]&(z] ]P 8]2]#] L]*p]e5$]ļ%4]4^T~*^Hj^W#,+^X25^8 K^/.a^(L n^)`y^=#P^pd#^(2<^L7^T4^3@^}c^>c_ )(_ؖ'L#_e%-_Kc>_y.,I_H7`_ 5tj_Л8r_ +3P_%0_$t_3_j_464$_)_$C._Y'_/`1x`$R!0`:(A`415|Y`3le`H.,t`$%`$$D`@$`xe#,`g"\`|4`24``=*l``h a#a$ "aLc$+a5h6a@0Ca$y2\Ua|%H]ad'ia7a+ahah#aC$Pa<5\ad$ha/Da,$ta#a\(bTNc b'Db<"'bl, =bd# KbT"Vb7 gb"sb(}bL5bԖ4bP&4DblL0hb$%bgb 6bX&b.b\'cg c6cm1-cr2Tot(HVo%ceo7qoD48o({2o(3oPa1o05o*toU.(o6hoď4o03o{.p\42 p=0 p+0p̯4pKphVpg_pd$tnpB4LpK)p6p!-pUiTp4Bc$p"p !p#dpX,\p%,`phJ'0q"Lq$#q-,1q7?q]74Kq%6dUqL+ hq$uq$qP 4q5q>cq-cq(lqg q4Pq% r(c rgr<4,r7H@rܢ-TMr@Ec[r)(drLX& tr(2cr$%Try5 rT.$r,WitrLchr'DrX2,r,30 ris`;cs3D&s4/c0sg8sU0Gs1-Wsd20fsHT2ys.sKcs s\1s-`sp.!LsDw2Hst0sD%Xt,S$t"#tx30:t|4@Dt;cOt;ht8ptп%l{t#tDgt"ttQ2`t6t(;tX6t-ct$\t,tx;uxcH(\hf-yb!xp%Hj.XĀ=$|Ѐ8ـ'|c58&-`#%"8,%H?P!@H,FiW ]p~cut8)$-'@@&Ё`-+TفV445dx"D  &X"8%]394E>'4O"@\V'm0)0lwdi_2Dd$03 w+@h;̂ ނ00g$p5TO58P4l.X0<P^-J !D`О5spz-0-c= HjT.ht6% ʃt$Lۃhc7X$v5@ 8L.t*')%t1ȴ+?0-LpL$WXG5tod21l<.L#  @\!45T̈́$x/݄Dy)@d(x0& D2< \2-x'x>)M#tUD k68{|'r&x0E$h1d- P52 ʅ',օW0" 5@3<L0<).2034?XcFhO3Z`)Ls1\& 7@P7(W#$Æ `1ֆd((j @1`1+`+;Ђ.F|i\TN#ppscP| _534.8R2,ˇtG2 ׇ-ch.De'% 69 7t+T394%F-|R@"xZ&4c3Dm-\{|gc!TC".4$8ˆ)c҈m1 (ؘ(,c\"$$fh+2'8&(CocN6YU54g(h#$n"`u5/lx $(8 Ήp9ۉ*L$D\6Ь4 42 $T<,. M4% X .<u$/4hn-7\е"0s"NJh7(Ҋ.2*cл5@,oc#/#!2c907H7`W-|gD[#8p(5|xn1\'01!s(H‹2cЋr4݋)5tm1 Хc\*,!73$= Lt0DT#a8.d .l '68`%D0!$,he)Ռ4((1D0<T'Dl%0(<7D845K3_HijP"Tv"4~ gDH)x(,1%ƍ#h׍86X4\ 1hp"@*7*4'H85lJ 2WgdT x3 {2 P5<<"640ÎD$ʎ- ӎ$<ߎ3 3T30*?c9|)c G07XY0)pTy(z- D%XM#Li(8jHc$Ə .cΏxP5xڏ'D jgg5d',=2p<4cEg-hW-c`+q)TT#|g~76Đ,xѐ"ؐy0hm'gP'N1\-0D",4+-; y0Rh`[w"higqm#| $,@d3x03,Ƒ#ԑ[131,(t ,X6)(':#Bp!$I)c@$cn$z' ;vli /9$xtQ$Œ>cڒ!J!1,L`(c &&h/,H= +Q )]43 k$yLg|1h0idt"hj3“@ 8ғ#T'|3%xd2Bc$#%-oc54-5B3XPM2aH,n&0z.ܗ8$8/(25$Ŕ jՔ00ݔH&T%0`- e-P't%h#4+0-:+Hb"<Rx ;Z4@f%xo(i2$y$ X# 5L68 &4H}c.(ϕl(c ݕ&)\,cd,(|&'PXj !(/&)Y%2p4?1Ml,Zp,3LlPf,h x&ht0+ &\tqcJ7Ė<7ݖ`2x-l@0<Db'T47(:4L-D/P94MhXD %teh7Dv; ;0o'XC" ( ї%$ۗ,y/̓'<hL5HO40!+.T;pg$KD|6V 2cP(dqTA'X* 7h$Ll&8L.<՘z-f(HT7X x%$L%2d24(9U&<V7d7q/X|,e#<)7t+46&ř25[1x30 h $c7D.a':xC" KU!@S/!<` N)P|c%Z32<1@25Ԛ80$ߚ 2>c\0P|x-H/cH&!t6-%`?!XO]5_'fXscr8-%pD+$ x* U71PR4՛7W4p/-<(lsc("X*1 At58O<,`\1&lh' x@'@xX!d'(5ػ$Ԝ#<ޜ%7], Ȱ$C")g0\5DH.l_2o(b3g()cl$ϝ`$4ݝ8`2c D'<&H(2D#205t@c\A )J "@W,@cgP% o{#ue#"X2/4'TT"Ğ9$D՞-,(% Ƚ7h%@7(2\6;H7`F.1PS` '@^"m0o(T 4'6`HcI'&4ȟ!* ,89 x45l\cDKc0)6t>ā1V+(dl]#u37$7j4t0cà$(Ϡ(0-@4Y(6X5X$[213GdgRT'$^2cu h0-z6X7x(L3(¡@'\С*ۡR)\"6HKi&`(8(4Q8h(^@& e8 !pq o1x$c&4Kc<%Ȣ7Ң(4o46. h 2L\Oc0D/B4c5HN+ _\!mP*w?c\z(!(p2P؍2-c!.DΣi/ףU!@ߣJ2 3\U6@m10:., \(|6`_"XEV6O $X_:$n 40t{-c&t8%,_"L\,'Τ'Hܤ;  3180HX6,p$,(17+t1@D0LUx"aP%Pl02u 0@} +L&l5@j 10̊"̥C5Tܥ0)c Pi P,w(>#|##c2P5B(m1P05_3wm1TO&h&0h08Pl'p*PϦ$,ۦ''&`gl4%H(.tdB5&,=59 +8HhST^3LgXjy4,31)pc7(rc0EcȧH4ܧh$| 1(l^!w5*)c;$gD7H_`G'phyP4$14$6h5<2Ǩ@e-٨4(-cg02P~4t4|+T,,C gJD2T b1[ d6nl6`xc"@ 0``18Tiũ,|ҩh LX& g(304i$1c)4>jOH0U%(^049 j\7L}3DX.Dy% $xc´8c˴w7ٴlh gKcD5&&35T7`\3OD([T&0e.\r5D4H/u.0ȵе-ӵt(T޵'%+p`1 'J)h-W#(:- PI8$Sn5|`6jHiv38'li1Tx%&( 3Ƕt)D(@ 4 D"(D9"D%<QT%Z1iLcx@$$g`/8%cg÷$9зOc׷K+'Tx79 G,P%0"&L.2.>2I,`V)&`8*kP&8v (p_18 $56ϸ)c'&ld$c9  3|5&6l13?iK$cX$hLgq72TL%h4$$;.H?cX ;͹-ܹ-|3x:($00 0Z7=Ȋ7Ij]Eckh")~ D(x#Dcx262$̺$ocֺ4%XߺĶ453Lg#5,H*$7@1%A86LU 8`k]1-cR5L20-!T4jǻ14޻0P"\" Li@)<."(7a$C74$U3ca(wC&&4*-DL2P^1l31¼ !,̼m1Kc@0 a20s&\m(D 'd%x:$<5;8h3Im1\?cjd"w5|$jn1-Ľ@*tν'Я H\2$, Tr7P5\&T3;24B5PPp '$^t"jc0v4`&h >c-c$ #ž26Ҿ,z/0p.c$7g|66\*@!!X53P@NcVxg^("@j3lq*м"*6P3K"gǿ35-$c2chp*c%w2D4l3DMcQ>.dN,sHiDhh,)'| &t@74* c3H1*c ].,]2!](h/u$@2DIG2hVP(-kt2x{Hi4(8l$\  j,26ܠ2 )8`" =6th>(t`i59 !|V53$ ;`)RG(d8"r(2~c2<D`(dB&0f*48e2Hi,"8 #2؁/.8 k'Pt)p#'- 5"AL4Qp/``?#0l% |T"8!8 6;5L0dh/jd,<7\*'D6)@E$D;P1H#@Td7i&sljx"XLk&g4-c@zc63HcM&<^x(0s|NcN6`p1gt5lO.|ܳ%T^#3tm1+<4@344$H24\"Tc%n"p-,424k)$p2̹#\#,+ pdJ% đ6P4-(/@ )ZH>4\lP`1XT6d|3x15gdq170;' 4; 7H60H&dH%c&,85t"`?q&JH!8X%a|4u4$'4T7/xD'XZ*lEc8')47(  )c0$t# 0oc5##Kc2-E !)HWp&8a5op3 2(ocjL%lp##j) pN$"5*H-`<Dc(S.Tbȶ-pp̰,X|cO5&5"Nc(3$İ1$c)x(l.|y18[)HN'V .df@F$p! ~70#4cW4D$84U 4%1@b(D%8j0gh_(t,tC,<`2O3X]t.(l +xw ;0D2Y7(.d?cTE$d7%6`6@4&|0<+$g8#Aci$uЉ1,0p% ;l"7k4\m1(.L`Hc<1'@(5L (5P *x7<<(JH48]&`eH2cpl $~&# j`*H#HL5Td'<2t-,8` 0-0''470 ,PxD HZ)pePgo3`|Bclq&x(c @ch,(P%$,%!-cG!00d824?p&%KhU'V :6x^'4i&Xt$Q!`T5,H01"L#<dg "8D5`X'l(%c 054h?%0J4b#lrG)Pl1H0g@/Hk*LD?'#tDJ!L:4A'  5P3l,f+<Lc DD2(MJ/[ie<)~ȋ%̏")c|7 C4Pd7,F$T'\$Lt 66"8H<TpcJ#T f7(t4I5Pu$`%8c$7dI5\ 't5pi$%c2 l7l1'&2%8A,K5Yhil${c85`!P&Xl1'@dO&9 H239 :7P4H1 0ID34,b'sg{Tg 2Tx!h,'588i",f%HK%H{c-<(#"d3&P2, -l8+J(]&lh|cxx)cTk!,.0g<;,6l1,$P3D?*X&3l)-0"50;>;7`HI)^0cr'gTg+`l148 p|!4L$l1 d746 Y1*(A'N%Vjo'{l%G2d,&4(XY D&8$\-\1K#p*J"442J( 44QhY#ḍcn|*w 7i3Lj$g"&<4@(D;c4$ 41rcDl7R/]>'lhX 't@d-gj6PL+Z&87x# q.@&/6,38! )p-T$<:`_1M|cU4`e0 i $xrH548H PL5m285*' !  p05\@Dc(/h5\F)<N@hW`0]$4j6xe(8~*&8>6'5}1X#d|4/<-*x&(_-@(|) 3 D+ Sd4Tm+Hx#,T|c\15,D3h0v/LW0P.|xe(dV5tЖ h|c(t67L,Dp>cYC6Xb$54v/d008x4\R&8\i($'w"3j/p <8+G ;T ;\/i.@~Fi(,%du1<$/8p&,N)D+h#L7` 4i@*H&<57@JL6T\#0jE$,u3$4.Gch\ X1#8 0481#82(D-@z PQtja hi4 pl-4{.1d-8l+T%,! )9d00c^"\~cz7\cH130.%P:x'<K3[\jm2w# 8L'D,8,A/phk$o#H(4"@c (E5`""58 ,O&V(!h " z{c0e&@!#7\5t.,#3d*XU(! v/,S7:\58CH2HW;$f;kt,c{DD2HO2xp1"PN!l$, 3#d+X | c@c 3+-4"x:\#! G!pOp*a)cq`}#0/H'/)48X# ,'97|$2d,H- (<;%G.!Z 4rPg.PX)t%Dt%L(d{c`24/>c+-c Y$D: '24=8IP!,Xjl-3@?clg`G666(,c, t1(0d L7 l5)l#`5dX7F000Rx,]4Xh"s6't~#'@c3HEc$;c%9787`+ @; `$T k&@$3`, L2859 E+Q#hp `}@7*,@$$\8X+8p$cX7\J5}-0/ 4+4<3--&@EcT46<]/8m !}& 87t`& "@r51(d<$6Y2@c#(P%/|31LF7TV^1h5q4!! ~{5 )84"5d0{2K%/l3  .&9&,j8gHt!U20j(Lx84tpn/it/<68*g $T"t'g<\/& 6 *(93`1F%OxKc_ ,o@#$x.\Тc07(P+_1x2'lxs1 S4X,7  &' @&qc3 &<Q.O*\)4pD3P|Q2Hx-dt0 s,Tg#`,!88>)&4 c6 d\10- 9\,C#N;X4j`(S7ll60u,a6TNc4,x$88i](P e3+\4, \*( # 6' ((5 $5$G /U ,m Xh| \#8 c 7H 'D ,` ;c |!h x!5h x3l (- h$'4 " \J.0 qc: .PQ 0%t^ "8e |cm $Lx g ܢ%x `$\ c %  $8 XG&| #P 2  c 4| !4 Oc# J$, t7(; `%K 85xY 148o 3{ , `4* %0 )c ` @ 4, ! 3 t>c ])h !H. \A5B đ/lY 'f x33{ m*  6 /c u4l 0,H 4` K2 / N5 $34  Hw%' i#3 | pC /pQ \&0^ T6 j  "r + .  $ 6 _1 7 5| # (," "+84X)й4A')UH5 `c4DzOc%79@ $28|;!6dԚ$.8$ p&8F5X+Gc7 @3\Qp7^<#hP6`pl&|5 'xh``00&H5X(X/!Ŀ*l(7 0  >/hh%c,P.I#4[\59 gd'hwL,! @pc k5/$Ui)$39 ة/8d#x -P1$!x\6x3p5=iMd(Y`"Tg(4tF7t*h 30[%,>)<\k&<3Pi4@\J4h/ĸ%:4;J8Z0Cc$v10,dy7T)jl10 8^!/hV$x th)6 ܓ5\( 8(1Gi< P53`.w+\5\:$d@c%`?.8L,lT5T\W.\#)P%8 a(P-h=hI0k6<YT3gĎ&l{,# &4316tn3(H/\F/4|i(d ch2T0 ph&($ h/p0h#$72=h2Ex/XWԯ(l%uc4862+! ,4 L\y1 'DF5T0.2,%\* ;4@,:J ,F#/Rg^4w"$l\ $ v8} A7Y(R.`#d,@ch@c86X HȚ%.8),49Dd)8K+,\' Xf.cuA/p$w.68x2( z$le4/lc)\:&< ( 5t6/ _1A2' L5iYgbk7p\b7~29xF! 4($<@*8gDs1L+1 )|Ы  P .&#p#02@^!@@65TPm1d0N%t$-d2gć+ "D)|A7|iXY&$"+HLJi1\1$84<N#\J Vm)g 3rp/l.*.tilOc 2t.) 'L#cu#;4L#t1#k(#d4$#,3#5#d p#Z)#pj#8 6$F4'$(>$#N$cW$1n$472@{$*x$ +X$ ($x2$1.|$-$h*$9(@$#7  %@^((%84"%p+.2%7-(B%(2'PL%0'_%%l%%0w%{1%E5X%44%4-%# <%؜7%`j%"%g%D" &(!p& $&'2&|"0<&`$H&Ď-dW&(p' 62 '\>$'d3,' "T'1'Y.P'!8'|0','@$ (#0(g (X".(44PH(o1Y( 'Le(5r((Y4,(܃/ (V1(j(-c(p4`(s,|(c(_)@(!)\3 )hU.@.)4*89)S%@B)LiT)Kia)D7s)?4()l1)|/`)l2c )'<)")&D)7p)6l)KcT *:7*44*2<*(7PK*!U*k&@l*$}*&*p%5*Xgh* 0*6*5*ܷ4\*+H*,!+Tc+2+8Ec,+;cC+# M+@ ;U+g]+c/3X) :3$(K3 W3J7\h38s30gz363d75 3X.@3P!\3@(3`m.X3\-(3}c83T#H3"4L"4w0.4>c:4XI% E4X(Y4\9a43k4|)<w4(<4Mi4F)4w(40y.4X84zc4C"5.h5$"H'5h(9.5 /c>5 ?4R5<$c[5%e5"r5'5l85t"5&L5l#L5ĸ#58(5"5x%.5(.h 6>c6f%(6 4d263G6@!3X6!7e6Ecw6.c6%868$6Nc6d/6X-&6j6Hh6 3$6ȩg 667t.x7d2h#7/6,7 l4,77x;7D@747M7\)X71&_7 h-(n7gv727;76L75<7#8744P707*c7N$T8Tzc8|' 86-8@!?8470S842]8ge87:`3%:g.: @:p4Q:0+c:[1x: j: Cc$:%:+!L:s2:u10:X$:| & :4&:h#;0@;48l;3(;IJ309;@,I;(];X"0n;(!0;Lc;h#0 ;$_1;/7@; j;p$2;&;8"p;&x;,/;g< W4H!< j4<?cM<cU<if<2!r< G%8}<d#<"<ȑ1<)c<@6<.<H$c <~7(<t,!x =;=7( =8 +=@i6=(;*8I=V4X=jp=0 =6=I0L=6<=Hi=!(P=%=dT 0=.=|#2@=3(>Cc(!>9*>^1:>'(\F>r&8N>0&Y>c%c> Hv>e#>( > ;c>{$>N >oc>G4|>X64p>3?#8?&!?34?hJ2\>?,3P?01`a?\$cj?Xw"H~?58?lR$$?p_7?5?T(4?<%`?<%c?e6?* ?oc @Li@A(P@h*@2H4@:5,B@,N@|"<X@;\[@6s@T"'~@<',@|"H@`1@;@@7X@>c @T"h$@ P"`A+|A&L+A7%p9Am1HA$w"XA#!PiA*`sALgAX6\A6PA4A42XA@!7dAx4AQ)(AT%cBHcBd.)BX6P3B6lEB5@SBHi]B .<zB%|B8$Bp@cB0"Bԭ3Bd 3B^1B1B4#8C6$@'C"0Cc7Cp6TBC+VC@O%aC%nC\"$~C#tCDP*C#C&Ce+C`#lC gC$xCp$4Ci, D1D$ DcKmcKL}cK;4`KF6 K!K5tK'KPhKL8&K|^#TL̤cLl1Ltj/Lб1@LHc LL.ZL, oLI4L2!L+L7 Li1lL`&L$XL5M.8MpghM24M'DM 2cMM*8\MP)zM!M7DM-MhM`0M)MA" M N7L%N249Nh%@Nl<$|LNB$8WN#lcNA3HzN.lNTE(N.lN!hN9(<N81"PNP6N )N pOءc#OL+l/OV2@BOp1LTOT'`Ot5rOjO&O<6TOT%POT(O@$xO!!hOhO\6O$ Pp!#HP70P"8P.4FP[#dMPT)PYPt72$cP0'PmP#wP$4P|$<P3P1$P@cPhP30PH DP.P- Q0+ Q64(Q38Q"HQ;/TQ(cQ)rQ6#yQT#Q#@QN#8Q55Q83Q8%0QH2Q@.Qx ( Q&R?50RK0T R7 6R^*?R%|HR$(SRM5cR jtR%hR# R5R-HR+R;cR$R$jR3 RD0R+R<#$SX8Sp%S6\!Stc1SH+>SLn6ISD5VS8 gSscrSdHc {S#cS3St S42S+S,$Sp7S5S@t*XS79 T+T+TH%)T ;/TMc=T ST0&_T7oT_3$T(jTMcTKcT5.dT4EcT)<T4gTPl1T 0 Uخ6<UP41xUN+\,U;1UH 7`DUL3TXU)iU̻+wU08U74U'<Uu2U!U@0UL&U40U+V\2V(6VGi%Vg+VZ1`9Vԧ6FV'&8SV%cV$3yV$,V4q!`V,HV*4Vdm3V,jV/tV)V&dVPP)<VD6W(WU38!W-(,0W$8cWh PW8W(W&WX2c Wf7W2X)cXf#X&)X!9X8 JX5'UX`_2`eX hrX"X4|c X\-X\-|Xv0X 0XT7TX&X[%(H[4,S[@&( a["ti[5[@|c[/*[,%T[#&[f0[1"[&[@~4[+[ܮ08\8\@Oc\03(\374\`&=\%J\#c T\2cc\TH"s\@,\hC5\ ,`\ \Ec\|&x\8&\g\ 3(\ \=.T]) ])]" /]X7<D]H2`M]HW1 V]X#_]F%$g]ؠ5|] 44]H>c]-H]$)c ]d#l](]|2]c*X] G7^4>*^"\%^8/^28^D44H^gS^"; ^^D2<p^0'z^r2^8A!^S6\^"(^$L^( D^x7(^/^d#((^d!h_&l_HB$_lc(_dh'/_X#0?_62HQ_|7T^_*`k_H8_Ԧc_2_T1_0*_%_</_.,_'_`&_"`%0`H3"`H)9`p(lM`H`2xY`l*Xi`'$r`-c}`~#D`w2D`8X3`p4`Cc(`d5@` .<`"aQ5aMca;(aH%.aDy,4 ;aX5DGa=7Rac[a\e%0eagna$at Pa8a DaT 5$a'`av6a5taf(a074b4:5b05 "bM4D6b|,@b(4Vb%leb@F0nbKc{bh,c b|#$b&b bl.b0hb;(pb30b$b"7 ch6Tcl2$c$2cLl1Ac(a"QcLA70`cc4`nc\2wc9cȢ6c>ccC"c`8ccc3c!70c8/&$cd j c|8d)c"dg)d$%m 8m*3POmI(^m'0omc{mX8$dm'ml 7Hm4mԨ(Xm('@m'lm.m05Tn nS-, n@B%)nTW4\7nI6BnX.TRn8g^nx$jnp>$snܸ04zn8nL jndcn7,nDin.0n+n.nDc(oAc op#\1o.c@c tp&X)t 6h3t?.Bt0*Ntp3$4^t76`htW( tt2t'8t 7t5t5@t&t2tp j t P$u2@ u/du)3u&=u#Iu 5h[uB%(eul@csuk.}u45du4ju?cu ;u80u)Pu;cuD2uX6 v9 v3*v(d#6v2!8LvHB28]v<@7fv-dwvx+hv'Dv,,cvh7v2@vt1vW1vh$|vhv4|w0g)w\m/(wCi cxd+x hx`cP#x@C5(2xD @xs' Ox']x#lx?c|x&xl:-x#x)cx4-px,pcx]3TxDscxDB2x(Oc yhy\qc!yKc.y-?y450Sy%^yЪ1ky@0vyy+y% ygy'$PyT+4yd#y0 yP!y 4`y4@y- z 'zTY4+zh5z 28CzXhMzB28\z7Pkz4~zl.dz8G(tzlH5TzTk&zk(z.zԫc z)z({H'{/c{3/{8(E{~|8J~+W~h +xa~*%k~d(|~p(~x`$@~F4~Mc~H(~6H~ *x~(^*t~8 X~5P  4P45\:>1D\*Q<7\7r\t6\$X4 4'*#P}&T Tpt7pLOcp/ -cXP#!Z700o0l=4 1H%@RN$8]0,`f;(t7A.\gL"x,K#ǀ"!\Ҁ$݀77@a2p%|gX%" :(040 >$"pHp6Y2kxW#0zh h( j+ %@1dā1ԁ$||1 50( 'Kc/p%l88,4TG)\S'a<jsl8(tg/,"\ l`U7(˂\6ՂXjĚ1`24F!D]Ocx8,ȁc$4#`3`+/lDž3Ӆ,  "h/9+!3P1KcD$V$j<&$tԯ1Ddl-|ľ"5 4`3̆,ֆ%(),#ty&ؒ%87 m7h,l4D:PQ#?#(Q&\h[ ,e3(q3|*,03x /l$Xhm20ÇV&lއx2"PD48@,c Dd#5L'74jRh%\,iu6y$58^1l%$p6`c<ˆ8.Ј7Di<` (4L +mc$$/,0lv1pE.Uc\DP&9.cswap_onwi_set_nwkeypfslowtimonanouptimebuf_rb_bufs_RB_REMOVErandomreadaxe_ticklongjmpwi_usb_rx_list_initproc_freefd_getfile_modesr_crypto_discipline_initvfs_allocate_syncvnodetc_setclockpcmcia_printarpresolvechange_displayparamchrtoblktblcd9660read_filtopssw_reg_strategysys_minheritieee80211_tree_RB_NFINDputcharural_update_promiscuvmfault_unlockmapschild_returnsmsc_cartlabel_unrefHMAC_SHA1_Updatene2000_write_mbufsmsc_startuvm_map_initne_pcmcia_caipsec_soft_first_usenkmempagescopyinstraue_miibus_readregsys_getgidieee80211_tkip_micdofilewritevsdmmc_intr_establishwi_inquire_usbdumpmagieee80211_derive_ptkttyflushsys_setsockoptsrp_v_gc_startsys_ppollcomdefaultrateieee80211_watchdogclock_gettimedefrouter_lookupinetswwi_get_fid_usbcdce_rxeofuuid_enc_beip_reassrt_maskedcopyin6addr_anyVOP_ACCESSusbd_get_quirksip6_get_prevhdrscheduler_startpxa2x0_gpio_intr_stringpmap_alias_bitsuvm_maxkaddrnsphy_cdumass_io_puticsphy_resetieee80211_getmgmtrlphyattachpxa2x0_gpio_intr_establishipmforwardingmainbusprintohci_waitintrzssp_read_max1111filt_msdosfswritesys_closeusbd_do_request_flagswsemuldisplaydevsubmatchtcp_syn_cache_countrtflushclone1sys_pipe2ffs_inode_allocdes_encrypt2sys_setsidieee80211_encapax88190_init_cardzaurusmod__ashldi3vn_statin6_hasmultirn_initmaskunp_detachnd6_nud_hintether_ip6multicast_mintcp_secretrti_find__mainaue_stopufs_quota_deletehardclocksd_vpd_thinenc_xform_aes_ctrsr_raid5_discipline_initsr_rebuild_threadwi_read_data_iowdc_reset_channelin6_domifdetachieee80211_get_authmtx_enter_trysmsc_sethwcsumwskbd_cndetachcd9660_vgetieee80211_inputcrypto_dispatchsr_discipline_shutdowngeneric_armv4_bs_wm_2if_group_routechangesys_fstatatnd6_timer_workpxa2x0_apm_sleepohci_device_intr_closeurl_csr_read_2dest6_inputgsignalacphy_caipport_firstautomii_mediachgwi_txeofaue_devsipsendredirectsbpf_setifbuf_flip_highunp_internalizetk_rawcc__wdstartscsi_xs_sync_doneaxen_initfc_lfcemptyvfs_export_lookuprasops_eraserows_rotatedifnetif_cloners_countyieldohci_endpdm_freemwsmuxattachuhid_seltrue_filtopssc_print_addrfilt_seltruecomspeedlogsmsc_tick_taskvn_writechkin_ifscrubarmv4_tlb_flushIuvm_pmr_freepageqdp8390_media_initpdevnames_sizemichael_updatescsi_mode_select_bigroute_dstsingle_thread_clearinit_execsr_schedule_wuuvm_pmr_size_RB_NEXTuvm_addr_alignieee80211_send_4way_msg4wskbd_cdsdmmc_mem_enablezaurus_udc_attachnamecache_rb_cache_RB_FINDbcmpgeneric_bs_r_1ieee80211_node_detachnd6_dad_startgpt_chk_hdrexec_maxhdrszieee80211_ifattachSHA512Initmmmmapieee80211_clean_nodessetjmpsd_read_cap_16prefetch_abort_handler_addresswdc_disable_intraes_ctr_reinitbio_infowsdisplay_switchurlphy_funcsuvm_deviceopsuvm_addr_align_backlogread_filtopsrasops_cursorvndxfer_poolcpu_info_primarytcp6_mtudisc_callbackcopyoutstraxen_tick_taskieee80211_countrycode2regdomainusb_transfer_completelxtphy_servicepxammc_matchapm_suspendscoop0_set_card_powerswcr_newsessiontcp_attachla_hold_totalwskbd_cngetcbuf_dirtysoo_writesystempageieee80211_align_mbufm_zeroural_alloc_tx_listnd6_llinfo_timervn_fsizechkunp_gcingreaddoslabelbdevswcalctsrubaddynamicportsohci_root_ctrl_closeural_ack_rateuvm_mk_pclusterbswap16domainnameuvm_pmr_addr_RB_REMOVEpledge_flocklockinitwsmouse_detachttywrite_filtopswi_usb_devsnd6_ns_outputbpfkqfiltersorwakeupinflateCopyttyunblocksr_meta_opt_loadbiocloseremovedeudav_miibus_statchgigmp_timers_are_runninguvm_deallocatefilt_procattachufs_quota_free_inode2filt_procdetachsys___thrwakeup__divdi3wsemul_getnameallowpowerdownsys_clock_settimeural_txeofwdc_floating_buspxa2x0_spllowerlocnameshidkbd_bell_fndisk_busyhidkbd_belltcp_pulloutofbandsqphy_statussddetachifq_barrier_taskzapm_power_infoarprequesttfork_child_returnsiginitaxen_casr_wu_enqueue_ccbpool_set_constraintsusb_task_thread_procip_sysctluhidev_closemsdosfs_vptofhscsi_mode_sense_bigusbd_clear_endpoint_stallsetdisklabelbio_registerdeflateknote_removescoop_pcic_writepmap_bootstrap_pv_page_allocbufq_nscan_createsr_hotspare_rebuilduvm_mapent_addr_insertext4_ext_in_cacheroutedomainusbf_interface_numberhid_locateicmp6_errornd6_rs_attachVOP_MKDIRrtl80x9_media_initip_protoxsys_settimeofdaypcmcia_read_cissdstrategyaddloguvm_page_physgetusbf_add_taskmsdosfs_synccheckdisklabelscoop_pcic_attachscsi_mode_senseip_savecontrolstackgap_randomvm_map_unlock_lnffs_clrblockusbd_set_hub_featureif_congesteduvm_addr_linsearchbpf_filterchgproccntip_drainieee80211_tree_RB_PREVumass_init_shuttlesoqremque__adddi3uvm_map_inheritusbf_rem_taskapmopensys_getthridcd9660_syncin6_ifawithscopebuf_page_offsetuvm_pmemrange_addr_cmpkm_freeusbd_is_dyingzts_pollsync_printvnopsieee80211_rssadapt_inputsys_lchownmsdosfs_removecd9660_readieee80211_regdomain_compare_rnfilt_timerdetachwi_get_idzeroin_addrbmtphy_cdwskbdkqfilterwdc_set_drivecyrillic_to_koi8uvm_map_protectusbd_get_xfer_statuswsfont_enumpxammc_clock_stopuvm_map_setup_mdprintfpxa2x0_splraisecdce_devsrandomwritepxa2x0_cpu_suspendprelist_updatehmac_ipad_buffercrypto_drivers_numsmsc_miibus_readregip6_protoxsys_recvfromswcr_freesessionttrstrtwskbd_mux_openrandomif_getkcopysdmmc_mem_mmc_initzts_sync_sendwsdisplayopenext2fs_initext4_ext_put_cachertfreesingle_thread_checkpxaudc_freemcuio_getptrcd9660_linkwsdisplay_emul_detachhostnamelenupl_cdusb_needs_reattachdeflateTuneusbd_get_hub_ss_descriptorzkbd_cnpollcuaddr_hint_selectxscale_cache_purgeID_rngttyopenraw_ctlinputwi_usb_ctl_unlockzkbd_devpxa2x0_gpio_iohbpf_insn_dtornd6_ioctlsched_chooseproczssp_ic_stoplcd_set_brightness_internalphyslockspec_setattraxe_miibus_statchgpte_l1_s_protoarpinputusbd_get_stringfill_prlistipsec_exp_allocationsHMAC_SHA256_Finalbpfcloseusbd_probe_and_attachdirtyqueuesys_writevsys_setprioritym_tag_prependaxe_cmdurl_unlock_miiumass_detachusbd_free_iface_dataip_defttlif_inputwi_usb_attachurl_rx_list_initdopipeusb_schedsoftintrsdmmc_activatewsemul_vt100_output_scs94_percentkqueue_registerin_delmultisdmmc_io_rw_directsdmmc_io_write_2pxa2x0_init_interrupt_masksdisk_lookupuid_findnd6_rtrequestuvm_km_suballocusb_delay_msrasops_eraserowsif_getgroupattribsbpfdetachsys_closefromip6id_pmodttydefcharssigexitscsi_link_openhidirtypagesin6mask128bus_space_read_raw_multi_4uvm_amap_poolin_pcballocVOP_LOOKUPsr_raid5_regeneratesr_meta_readapm_pxaip_caphysical_startbs_notimpl_bs_c_8ifa_delenqueue_randomnessexphyattachusbd_set_idleieee80211_find_node_for_beaconemul_nativeaxe_txeofwskbd_inputacphy_cdsdmmc_printwsmux_attach_sccpu_do_powersaveaue_rx_list_initwsdisplay_kbdholdscreenuvm_km_pagesufs_quota_alloc_inode2ieee80211_name2countrycodemicrouptimesr_validate_ioaes_xts_decryptsocket_poolsr_raid_recreate_wupgrphashsys_setpgidpledge_sysctlprofhzAES_GMAC_Updatesr_meta_init_completeohci_setaddrntp_update_secondcache_enterexec_elf32_makecmdsusb_rem_wait_taskext2fs_bufatoffsys_setlogininitarmamap_listpxa2x0_lcd_suspendconfig_process_deferred_mountrootip6_maxifprefixestcp_do_rfc3390ieee80211_req2nodesys_setresuidpxa2x0_lcd_load_fontrn_deletesd_get_parmsiskmemdevstat_rush_requestswi_watchdogipsec_def_compfc_lmdistancepxa2x0_intr_stringnch_poolphtree_RB_REMOVEsomaxconnsdmmc_card_intrural_readugl_initpxapcic_socket_enablescsi_xs_get_donepxaudc_ctrl_methodsipsec_exp_timeoutip_directedbcast_bus_dmamap_loaduvm_pmr_pg_to_memtypeuihashtblieee80211_node_getrssitaskq_syssd_buf_doneieee80211_get_rtsamap_initffs_flushfilesicmp_sysctlsys_lseekdes3_decryptmsdosfs_pollmsdosfs_accessaddupc_intrdvd_read_bcaamphy_servicevm_map_lock_read_lnwsevent_finiip6statwsmux_set_layoutuvm_pageboot_allocconfig_pendingmii_phy_updatesys___thrsleepsys_accept4ether_crc32_leaue_csr_write_1ipipstatsecurelevelurl_matcharpt_keepsdmmc_mem_mmc_switchsavectxpte_l2_l_cache_mode_ptpool_multi_allocbinuptimedogetrusagesys_seteuidpxa2x0_bs_allocuao_shrink_hashugl_rx_list_initwskbdpolluvm_map_checkprotauth_hash_chacha20_poly1305max_protohdrdes_is_weak_keyural_rf_writezapm_poweroffieee80211_add_qos_capabilityieee80211_cipher_keylensdmmc_alloc_ccbsumass_scsi_attachsr_raid1_discipline_initrandomkqfilterbufpagesusbrev_strsleep_setup_signalrlphy_cdpool_countprocess_newsys_keventcopyargsarc4_reinitsr_chunk_in_usewd_standbymi_switchcd9660_statfsrasops_rotate_fontsr_scsi_wu_puttsleepkern_sysctlnd6_delayin_pcbinitsys_fchmodatsqphymatchbs_notimpl_bs_rm_4Chacha20_Poly1305_Reinitnmbclust_updatehw_prodfdremovepxaudc_softintrigmp_fasttimouserconf_cmdbufwi_get_pmumass_bbb_stateohci_device_ctrl_abortcdce_startapmioctlusbd_port_disown_to_1_1uvm_map_entry_poolcrgetunp_bindtcp_delackcsignalreaddisklabelvm_map_unbusy_lnusbd_clear_endpoint_stall_asyncwskbd_set_displayvirtual_availbs_notimpl_bs_rr_2tcpstatpledge_adjtimea4x_bs_r_2dma_constraintuvm_anon_poolicmp6_mtudisc_timeoutfillmapentrytcp_timer_persistugl_intrwsemul_vt100_output_esc_hashcpufunc_ifarudav_newbufsys_umask_tr_flush_blockpow2dividesyn_cache_reaperieee80211_find_rxnodefilt_fileattachsysentcpuset_addpmap_alloc_specialsbs_notimpl_bs_r_8tcp_setpersistufs_ihashlookupscsi_inquire_vpdicmp_rediracceptmemmoveapmcloseusbd_get_hub_statuswsemul_vt100_detachural_attachip_outputrefcnt_rele_wakebpf_mtapnkmempages_maxfindblknamekue_rx_list_initpool_inituvn_referencelcd_ioctlpcmcia_card_attachuvm_pmr_addr_RB_PREVrt_sendaddrmsgbpfreadbio_errorpxaudc_ep0_intrpool_putm_copym2cd9660_kqfiltersr_raid5_addiobuf_alloc_pagessysctl_structbufqs_stopunhandled_afaxe_ifmedia_stsif_input_localsysctl_rdstringuvn_attachsdmmc_send_if_condlasttimesr_wu_putsysctl_disklockcnkqfiltermountroot_config_queuebs_notimpl_bs_r_2ufs_pollsr_raid5_writepmap_map_sectionmsdosfs_readlinkpmap_devmap_bootstrapieee80211_decryptusbd_get_device_statussdmmc_verbosenchinitexec_mapsnprintfcomcngetcext2fs_readlinkether_ioctlumass_bbb_transfertqphy_servicescoop_pcic_functionsip6_forwardingsys_dup3sr_shutdownural_cdkue_resetrasops_isgray_bus_dmamap_load_mbufwdc_print_capssdmmc_io_write_1wi_watchdog_usbcd9660_ioctlin_pcbnotifyalluvm_pglistallocsyn_cache_addohci_device_ctrl_transferwsdisplay_addscreenbuf_kva_enduvm_map_splitentryvm_map_lock_lnincoreurlphy_cdhzusbf_attachdefrouter_resetcd9660_ihashinssched_exitcheckaliasdl10019_mediachangettyretypestartuphook_listsdmmc_card_detachpte_l1_s_cache_modeuvm_pmr_remove_addruaddr_pivot_poolkue_detachrt_timer_queue_changepool_p_alloclf_initwi_ioctl_usbcpu_attachwdc_preata_drivemii_phy_matchpxaudc_cdural_amrr_timeoutzlibVersionrasops_list_font_cbzapm_enable_chargingsdclosevop_generic_kqfilterzts_attachpffasttimoinitsiginfosys_getuidcomconsunitcpuidsexec_setup_stackuao_createsensor_detachbuf_mapaue_lock_miiidentify_arm_cpuffs_realloccgcdcef_newbufwskbd_load_keymapxscale_cache_cleanD_rngm_clpoolpxaudc_zaurus_cacd9660_bufatoffgroupmemberuvmspace_initscsi_plug_detachether_sprintfmsdosfs_unlockselwaitpmap_init_l1icmp6_mtudisc_callbacksnd6_slowtimosys_forkbufq_implsip_setmoptions__qdivrempmap_deadproc_cache_statepxagpio_reg_readspec_openpmap_vac_me_kpmapmld6_checktimerswcr_sessionsfilt_bpfreadsr_disk_attachwsdisplay_emulinputuvm_fault_wireusbd_abort_pipepcmcia_ccr_readkernelstackicmp6_mtudisc_timeout_qcrypto_initvm_nphysseguhidev_get_report_async_cbip6_randomiduvm_pseg_initsrpl_rc_initproc_filtopself32_os_pt_notewdc_print_current_modesSHA512Transformfiledescopensys_vforkpmap_vac_me_usercomcnspeeduvm_pager_initcpufuncswinChkNamepxaip_matchdvd_read_copyrightieee80211_recv_4way_msg1bio_delegate_ioctluvm_pmr_addr_RB_MINMAXnd6_rs_detachuvm_uarea_freepxapcic_scoop_casys_mkdirdl10019_media_finiaxen_watchdoguao_reference_lockedcom_resumepmap_devmap_tableufs_fhtovpcrypto_donewskbd_translatedumppcbusbf_string_descriptorrttrashtargetpagesohci_root_ctrl_abortmblowatrasops_rmaskgetnewvnodeufs_inactivekue_load_fwnd6_mmaxtriessingle_thread_waitsys_socketusbd_request_async_cbffs_cgreaduvm_mmapanonwi_init_usbwsemul_utf8_translatevm_map_lock_try_lnzssp_read_ads7846spec_close_clonevop_generic_bwritenanotimescsi_detachufsspec_writelxtphy_casd_read_cap_10iso_disklabelspoofpcmcia_cafdfreeuvn_detachieee80211_ccmp_set_keyuvm_km_valloc_trytty_countugl_cdhidkbd_detachdeflate_globalpxaudc_intrraw_disconnectpxaudc_ctrl_closemsdosfswrite_filtopssensor_task_registerusb_attach_roothubip6_neighborgcthreshbufkvmKERNEL_BASE_virtpxaohci_activateremove_coproc_handlerumass_polled_transferdeflateSetHeaderuvm_pmr_extract_rangesensor_attachbrelvpgpio_strobe_pins_c3000msdosfs_mountfsvfs_relookupuvm_map_addr_augment_getsys_utracencpusfoundwi_stopzts_ioctlsync_fsyncsetstatclockratecd9660_strategyuserconf_parserrw_initpxaudc_intr1ext2fs_allocif_input_processzapm_ac_onpmap_cachevivtwskbd_deliver_eventcom_fifo_probeieee80211_delba_requestrtable_walkbread_cluster_callbackfdcopypxapcic_event_processin6_proto_cksum_outbpf_d_refbuf_acquire_nomapAES_GMAC_Finalrtable_matchb_to_quvm_pmr_size_RB_INSERTin_len2maskbus_space_read_raw_multi_2ugl_startpxa2x0_lcd_setup_rasopsscoop_set_irledusb_blk_freelistudp_sendspacerasops_alloc_screenscoop_gpio_pin_readuvm_objtree_RB_PREVifg_headvfs_rootmountallocSHA1Updatecue_tx_list_initaxen_iffbs_notimpl_bs_sr_2netintrpool_wait_freecd9660_openrw_initwsemul_vt100_output_dcsglass_consoleAES_GMAC_Reinitsr_uuid_generateohci_root_ctrl_startvm_map_busy_lnbuf_rb_bufs_RB_FIND_bss_end__ext2fs_blkprefwi_alloc_nicmem_ioicsphyattachscsi_activateuhidkqfilterVOP_ISLOCKEDsys_kqueueAES_GMAC_Initieee80211_tree_RB_REMOVE_COLORuao_referencein6_addrscopebuf_getsys___threxitieee80211_ifdetachapm_get_eventbs_notimpl_bs_wm_4in_remove_prefixvfs_getcwd_scandirmaxlockdepthwi_usb_tx_unlockieee80211_free_noderaw_usrreqnblkdevuhidev_detachbs_notimpl_bs_wm_2sr_crypto_hotplugttyinputscancukbd_consopsbiodonezssp_activatedehashkeyicmp6_rip6_inputwi_usb_txfrmsmsc_encapmaxslpext2fs_makeinodepool_requestsys_chflagsatcue_startaue_csr_read_2ufsread_filtopsufs_symlinkm_dup_pkthdrsr_crypto_assembleufs_mkdirvfs_getcwd_getcacheusbd_get_no_altssdmmc_initural_newassocaxen_attach_length_codenamecache_rb_cache_RB_PREV__anddi3phtree_RB_REMOVE_COLORrt_missmsgVOP_BMAPip_dooptionsvn_lockcue_tick_tasktimeout_add_tsrip6_ctlinputscsi_link_shutdowncdce_caSHA384Initwsemul_vt100_handle_csiumass_cbi_adscsbdropsr_meta_native_attachmsgbufphysusbd_desc_iter_nextscoop_discharge_batterytcp_debugusbd_transferinpcb_poolohci_pollohci_hubdnextralocsmsc_miibus_writereguvm_addr_fitspaceblf_keysys_setegidbus_space_write_raw_multi_4wdc_wait_for_statusnd6_inusern_matchpledge_protexeccd9660_symlinkautoconf_verbosein6_setpeeraddrunp_externalizesys_munlockalluvm_faultscoop_led_setrandomioctlsoftraid_disk_attachsoreceivepxaudc_connect_intrpool_getuextralocsdmmc_discover_tasksharp_zaurus_C3000scsibus_printlinkudav_csr_read1ieee80211_eapol_key_inputohci_root_intr_startffs_dirprefif_enqueuerip6_outputinflatescsibus_cdin6_get_rand_ifidndflushpxaudc_allocxcompose_tab_cmppxa2x0_lcd_start_dmaieee80211_parse_wmm_paramsrn_insertspec_pollif_rxr_getbpf_wakeupfilt_kqdetachaue_unlock_miiwsmux_getmuxipsec_exp_bytesdosendsyslogconfig_defersys_faccessatgf_mul_bus_dmamem_allocm_tag_initbsearchif_attachm_dup_pktghash_update_miif_deactivatesr_crypto_free_resourcesugl_casys_setrtablelcd_get_brightnesssr_raid_read_capfontlistuvm_map_addr_RB_REMOVE_COLORnameibs_notimpl_bs_sr_4uvm_map_setup_entriesext2fs_readdirip6_ctloutputdead_pollpte_l2_l_coherenttqphy_funcswihap_initversion_bus_dmamap_syncuvm_pmr_remove_sizelzs_dummybuf_needvakqueue_initieee80211_wep_delete_keyaxe_rx_list_initata_dmaerrieee80211_bip_set_keyuvm_pagezeroin6_setsockaddrigmp_leavegroupcom_common_getcaxen_cmdbs_notimpl_bs_rr_8mountlistuserconf_histbufsys_getdentscomsoftwihap_mgmt_inputudav_initconfig_deactivateVOP_REVOKESHA256Finalclallocbiowaitusbf_insert_transferfilt_ufsreadrasops_vcons_cursorunixswuvm_objtree_RB_INSERT_COLORsccstqphy_cawsdisplaymmappmap_updateccpumq_purgepxa2x0_gpio_intr_maskgeneric_bs_sr_1hidkbd_inputprocess_zapsr_raid6_wu_donertable_allocfdinitboothowtoarc4randomnsphy_funcstcp_delack_ticksupl_stopttopenata_get_paramsukbd_apple_iso_mungeip6_randomid_initieee80211_tx_ba_timeoutether_ipmulticast_minconfig_rootsearchrip6_sendspaceieee80211_countrycode2nameuao_dropswapenxiosys___getcwdcd9660_specvopsusb_cdwsdisplay_switchtoconsolepmap_enterrtmap_growamphy_funcsundefined_handler_addressRMD160Transformsys_setreuidSHA1Initusbd_ratecheckwi_usb_open_pipesudav_tick_taskuvm_map_findspacewsevent_initl1_sec_tablecomcnattachwdc_xfer_puta4x_bs_w_2sdsizeuao_dropswap_rangesys_pwritevudav_lock_miikqueue_scanieee80211_pmksa_findnet_livelockedusbd_iface_claimedtcp_closeohci_free_stdsd_patternssdmmc_disablescsi_initmsdosfs_advlockdl10019_mediastatusswcr_idkue_attachusbd_free_xferip6id_initidsys_utimensatfalloclxtphy_cdisohashkeydeadproc_mutexml_initpfctlinputcomcnprobephys_mapext2fs_pathconfumass_bbb_methodssoft_intrqdeflateSetDictionaryufs_lockcomintrsys_accessnsphy_statusuvm_swap_iouserconf_initkillpg1url_tx_list_initwsmouse_mux_openarpproxyvputonfreelistwdioctlext2fs_mountrootieee80211_findrateregyearurl_ioctlpage0setrunnableaxen_miibus_statchgpxa2x0_pi2c_closeuvm_pmr_getpageswi_set_ssidcue_ioctlzts_accessopsnd6_prefix_onlinkffs_specvopscue_attachpxa2x0_stray_interruptelf32_read_fromosversionhid_is_collectionnsgphy_statuswi_usb_tx_list_initapm_power_infofind_pfxlist_reachable_routerip6_pcboptstvtohzieee80211_get_eapol_keyphtree_RB_NFINDratecheckpxa2x0_imaskin_rtchangevfs_syncwaitudav_ifmedia_statusaue_crcffs1_reallocblksieee80211_node_lateattachcansignalieee80211_up_to_acmsdosfs_check_exportlf_setlocknbigpipecue_devswsfont_map_unicharin_controlieee80211_get_addba_resprlphy_funcswsmux_srcopslmaxuvm_pagecopyphtree_RB_NEXTzssp_ic_startsysctl_quadsys_readexec_process_vmcmdskue_tx_list_initpxa2x0_pi2c_setvoltageieee80211_tree_RB_FINDifq_deq_beginmbstatuhidev_intrttyinfousbf_transferttyinohci_root_ctrl_donegetnulldevispidtakensr_meta_save_callbackbufcache_getcleanbufextent_destroyenc_xform_rijndael128if_group_egress_buildzapm_pollloop_clonerttsetwatergetcieee80211_addba_requestsr_raid6_intrfilt_apmrdetachpledge_killural_update_slotuvm_pseg_lcksr_ioctl_volpmap_enter_pvuvm_mapent_mkfreeunp_disconnectsys_listensys_mountbpf_mtap_etherpgsignalfirstcuhub_detachusbf_set_addressieee80211_ccmp_delete_keysr_failioffs_fsyncwsmux_mux_openwsdisplay_consinetdomainwsfont_findscsi_devid_wwnifq_enqueuememcpywdc_enable_intrkthread_exitscsi_req_detachpriq_deq_begincue_newbufdisk_constructpledge_sockoptvfs_unbusywsdisplay_paramrip_usrreqifq_deq_commitvm_map_upgrade_lnpledge_failpledge_chownspec_writekq_timeoutmaxsdmmc_inquiryin_broadcastfd_getfilehidkbd_set_ledsmsgbufaddrsdioctlutsnameip6_setmoptionsexit2usbf_set_configdosigsuspendaue_resetkue_open_pipesip6_mloopbackext2fs_cgupdateieee80211_send_4way_msg2tcp_update_rcvspacerddumpusbf_set_endpoint_featurecpu_setperfuaddr_rnd_poolufs_lookupufs_bmapdoasyncfreepxagpio_cdudav_miibus_readregcpufunc_dfarip6_randomflowlabelttpolldegetlogpollkthread_createin_pcbresizesdmmc_mmc_commandwdc_default_read_raw_multi_2axen_rx_list_initlogclosesd_vpd_block_limitsieee80211_kdfgeneric_bs_wr_4pcmcia_submatchinstall_coproc_handlernd6_dad_findsys_sendsyslog2ohci_rhscudav_detachufs_strategysr_crypto_create_key_diskohci_device_requestkue_watchdogphysical_freeendcopy_statfs_infobounds_check_with_labelarc4_timeoutsr_raid1_assemblesd_ioctl_cacheext2fs_checkpathsocantrcvmoreprocess_poolip6_setpktoptfile_filtopssr_raid6_rwaf2idxbuf_unmapmsdosfs_renamesdmmc_mem_initpipe_wfiltops__lshldi3purge_detachedif_isconnectedpfxrtr_addsrp_initcd_load_unloadipq_poolpxa2x0_rtc_getsecsuaddr_kbootstrap_destroyaxen_encappmap_activatebuf_dealloc_membmtphy_reseticmp_input_ifconfig_make_softcpte_l2_s_prot_krunp_discardcue_csr_write_1ip6_outputwi_read_record_iouhid_caudav_rxeofwsmux_get_layoutswap_syscall_lockufs_kqfilterieee80211_newstatescsi_autoconfcheckdirsexecswwsfont_addzapm_batt_minutessr_raid0_createsdmmc_set_relative_addrnsphyter_cdumass_atapi_attachwsemul_vt100_output_csiin6_are_prefix_equalin6_controlpxaudc_bulk_startuvm_pmr_rootupdateleapyearsleep_finish_timeoutsys_sigsuspendcd9660_unmountwsemul_vt100_output_scs96swcr_authcomputertmap_dtornamecache_rb_cache_RB_NFINDtrapsignalpxaohci_enablerushjobpmap_devmap_registerrn_inithead0wd_flushcachend_defrouterblf_decfdcloseexecuvm_map_sel_limitsevcount_attachlimcopybio_doreadwi_do_hostencryptscoop_activatescsi_req_probeuvm_mapent_forkcopytcp_timer_rexmturl_ifmedia_changepcmcia_io_maprt_timer_initsr_crypto_rwuaddr_rnd_createieee80211_next_modeputsaxe_tx_list_initrip6statip6_id_ctxtcp_debxcnpollcd_casdmmc_task_threadsys_truncateesigcodeacphy_servicescsi_xfer_poolscoop_pcic_clear_intrarmv4_tlb_flushIDudav_csr_readohci_add_doneieee80211_tree_RB_NEXTsched_choosecpu_forkohci_add_edwdc_xfer_poolcdce_newbufsoacceptkqueue_pollcdgetdisklabellcdintruhidreadufs_creatend6_freend6_optionscd9660_seeknd6_llinfo_settimersr_roam_chunkssdmmc_mem_write_blockfreqmsdosfs_unmountpool_gc_tickelf32_load_psectionnamecache_rb_cache_RB_MINMAXtaskq_create_threadarm_pcache_unifiedm_tag_nextohci_intr1msdosfs_writezaurus_udc_detachcue_resetbs_notimpl_bs_w_1exec_script_makecmdszapm_resumeieee80211_reset_erpfilt_pipedetachcd9660_rootentropy_add_ptrrgephy_statusiophyattachzts_readposne_pcmcia_get_enaddrdisk_attach_callbackselrecordffs_validatecomstopaxe_ax88772_initffs1_compat_readrip_outputrrw_exitpxaudc_bulk_methodsext2fs_accessmld6_fasttimeouaddr_rnd_insertkthread_qcdcef_txeofimaxwsmouse_matchsched_barrierohci_free_seduserconf_pdevsr_detachinflate_fastmbpoolclock_secs_to_ymdhmsaes_xts_setkeytcp_canceltimerstqphymatchrip_recvspaceroute_initswap_prioritytc_setrealtimeclockrt_ifa_addlocalwdc_get_xferpxaip_measure_cpuclockuvm_vmspace_poolpxapcic_cdpipe_createwsemul_getcharnd6_sysctlpxa2x0_setperfnd6_rs_output_timersyn_cache_putdoopenatvn_openif_clone_createifq_purgebufq_fifo_requeuesr_boot_assemblycdce_tx_list_initSHA384Finaluao_detachcpufunc_controlmallocamap_pp_adjrefauth_hash_hmac_sha2_384_192in_pcbrtentryknote_dequeuesr_discipline_initwi_cmd_usbpte_l1_s_prot_kw__udivsi3tcp_outflagskqueue_statcdce_ioctlcd9660_rrip_analyzeohci_hash_find_tdexphymatchbuf_fix_mappingbio_unregisterip6_v6onlysys_preadvuserretsys_recvmsgpipe_statHMAC_MD5_Finalif_refvn_writesr_hotplug_unregistermtdphy_servicehidkbd_hookup_bellVOP_LINKpcmcia_megahertz_xjem1144_func0icmp_inputumass_cdvcountieee80211_get_sa_queryuvm_vsunlock_devicerd_root_sizein6_delmultistathzenc_xform_cast5route_ctloutputpxagpio_dispatchsched_idlebio_warnwdc_ata_bio_intrwskbd_cnattachvirtual_enduhidev_get_reportsys_getloginpxa2x0_gpio_intr_disestablishbuckstring_initdetrunccopyoutpfindbufq_peekcomconsaddrip_ctloutputif_ifp_dtoruhidev_set_report_asyncwsevent_readufs_dirbadcd9660_readdirvfs_unmountallrgephy_loopwsdisplaypollsys_renameatohci_allocxcopyrightsdattachsched_peg_curprocwdc_default_lba48_write_regtcp_timer_keepusbd_devinfo_vpsbsyncwsemul_vt100_cnattachtcp_mss_updatefree_pagesrw_enter_readvunmapbufgpio_sense_pins_c3000uvm_map_pageable_wireroute_outputrti_deletefreepidsys_geteuidpxa2x0_gpio_set_functionsdmmc_mem_single_read_blockrasops_masks_initapm_attachzaurus_main_batteryicmpmaskreplin6_pcblookup_listenmsdosfs_mknodttkqfluship6_defmcasthlimsys_munmapsdmmc_io_write_multi_1axen_stopkp_nonepxa2x0_lcd_initializefilt_solistenvsnprintfpxammc_intrpte_l2_s_prot_urwsemuldisplaydevprintarplookupuvm_map_pageablechainallocsw_reg_startpmap_copy_page_xscalesr_ioctl_deleteraidifmedia_baudrateusbd_setup_default_xferzssp_attachuvm_pagelookupsoshutdownuserconf_hist_cmduserconf_listproc_cansugidcd9660_rrip_getsymnamewsemul_vt100_scrolldownwsdisplay_getc_dummyip_mloopbackbpf_iflistKQREFwdc_downgrade_modeip6intrqaxe_newbufnd6_rs_inputscsi_activate_bussoabortif_ih_unrefusbf_clear_endpoint_haltcast_encryptunp_inocanonpathtaskq_threadhidkbd_attach_wskbdlogkqfilterip6_init2uprintfsensordev_installsysctl_ifnamesmainbus_caif_rxr_initcoredump_elf32softdep_flushworklistsys_issetugidinitclockssdmmc_decode_cidcd9660_mmapif_detachaue_watchdogwsmuxopenwdc_ata_bio_startnd6_cache_lladdrcatqsession_poolugl_txeofunp_connectuvm_pagermapinif_detached_startpool_serialugl_ioctlxscale_cache_flushD_SEscsi_probe_lunaue_ioctlirq_entryvfs_mountedoncputypefc_lookup__bss_start__usbf_alloc_xferif_downndqbtaskq_sleepVOP_GETATTRieee80211_fix_ratea4x_bs_wm_1ip6_mtudisc_timeoutieee80211_node2reqwi_usb_matchelf32_check_headergf_logeephy_cdinphy_cdttytstampural_set_txantennaieee80211_node_allocieee80211_crypto_detachpmap_unwirepool_lockuvm_pageunwirerti_fillHMAC_SHA256_Inithw_seriallcd_pxaip_caieee80211_mcs2mediawsdisplay_resume_deviceauth_hash_hmac_md5_96autoconf_attdetapm_thread_createufs_chmodbufq_nscan_resortsys_o58_killcdattachuserconf_devicepledge_syscallsm_resethdrsys_sigaltstacksdmmc_cisptrsoisdisconnectingdevice_mainbusBlowfish_initstatesched_steal_procwi_media_changenull_decryptrttimer_queue_headarm_pdcache_sizedp8390_enableexphy_cartredirectnsgphy_casoftintr_inituvm_pmr_pnaddrttymodemwsdisplay_defaultscreensmtx_enteraxe_devskqueue_poolvntblinitbuf_rb_bufs_RB_INSERTcpuset_intersectioncd9660write_filtopsAES_GMAC_Setkeysleep_queue_initax88190_mii_bitbang_opspmap_preferin6_ifattach_linklocalVOP_REALLOCBLKSsys_setresgidsr_crypto_encryptsdmmc_mem_read_block_subruvm_pmr_freepagesieee80211_input_bamsdosfs_sync_vnodesplassert_failarm_picache_wayspriq_freetty_initaxe_ioctlwsdisplay_clearoncloseuvm_km_freesys_killuserconf_numberperflevelcomconsiohpmap_set_pcb_pagediruvm_pmr_addr_RB_NFINDrt_setmetricssys_getegidusbf_config_descriptoruvm_objtree_RB_FINDsw_reg_iodone_internalrasops_vcons_copycolsumass_init_insystemfrag6_deletefraghdruaddr_destroydirchkexphy_resetipip_outputpipecloseVOP_REMOVEconsinitsdmmc_scsi_minphysurlphy_statusext2fs_dirremoveuvm_vnp_uncachesysctl__stringffs_clusteracctconfig_detachmtdphyattachifaof_ifpforaddrcryptop_poolsensordev_listsr_checksum_printuhub_port_connectminidatacleanrt_timer_queue_destroysr_meta_probezkbd_syncieee80211_input_ba_gap_timeoutwi_cdsd_cduvm_pseg_geticmp_mtudiscipport_hifirstautoieee80211_tkip_delete_keysys_fstatlcd_show_screenufs_itimesenc_xform_3desrgephyattachuserconf_enablepte_l2_s_prot_uwext2fs_vinitumass_bbb_resetffs_alloccgbuf_object_storesmsc_wait_for_bitsgeneric_bs_w_1sa6_anysys_getprioritysysctl_diskinitsr_concat_discipline_inituvm_km_valloccdcef_watchdogieee80211_send_mgmtcue_getmacscsi_xsh_delieee80211_add_wme_infoscsi_plug_probesys_unmountsr_meta_native_probewsdisplay_activatebootdvapmkqfilterelf32_probesin6ifa_ifpwithaddruvm_pagezero_threadvgonelcrypto_taskqsofreend6_dad_timeruaddr_rnd_destroyinphyattachcpuset_unioncomsiraddruuid_dec_beeephy_matchpmap_removebpf_mtap_afusbf_free_xferhidkbd_parse_descicmp6_fasttimouvm_pmr_addr_RB_INSERText2fs_removemtx_initif_clone_destroywdccommandcdcef_ioctlwi_pcmcia_wakeupvmcmd_randomizepxaintc_attachbpf_setfuserconf_historyuvm_page_unbusytk_noutusbpalockext2fs_mountpmap_collectBlowfish_expand0stateukbd_enableuvm_map_addr_RB_PREVwdc_xfer_getgeneric_bs_rr_4cpu_sysctlcd9660_deftstampzlibCompileFlagsip_randomidaue_tx_list_initsdmmc_io_function_disableieee80211_recv_disassocnosuidcoredumpukphyattachrasops_load_fontcddumppxa2x0_lcd_alloc_screenastusbd_claim_ifacetcp_disconnectuvmspace_execwi_usb_detachwsmux_createpxaohci_attachsys_mmapbootnd6_is_addr_neighborblf_ecb_encryptwsemul_vt100_output_normalunp_rightshostnamedisk_closepartwsdisplay_emulbellieee80211_ba_delupl_outputext2fs_bmapuvmexpenc_xform_blfbufq_donesr_crypto_dev_rwsensordev_getufs_diremptySipHashreinsertfinishdupsleep_setup_timeoutuao_grow_hashukphy_serviceqsphy_resetsmsc_stopdeflate_decompresspool_destroylogwakeupdl10019_mii_readreghidkbd_attachip_dosourceroutesoread_filtopsieee80211_media2ratedmapoolsrasops_show_screenbdevsw_lookupperfpolicydisk_changewsemul_vt100_resetopsdmmc_create_threadamap_lookupsdoreallocblksifq_initcache_revlookupbpfread_filtopssoinituhidev_get_report_asyncuvm_mapent_isjoinableuvmzeroin46_addrVOP_MKNODpxa2x0_update_intr_masksnd6_ifdetachin6_ifaddrroute_protopxa2x0_lcd_geometrysync_vopshw_uuidnd6_isneighborext2fs_truncatecd_play_tracksscsi_do_mode_senseuvm_pmr_allocpmrip6_maxfragpacketsax88190_media_finiprefetch_abort_handleruvm_km_threadsr_checksumscsi_probe_buslminm_leadingspaceconfig_mountrootsys_fpathconfscoop_battery_temp_adcwsmuxpollarpt_pruneohci_device_bulk_methodskp_zerosoconnect2pledge_syscallknote_poolcnopenscsi_test_unit_readyural_set_bssidnmbclustural_get_rfsominconndma_freepoly1305_initsoftraid_cdpcmcia_matchbpf_d_unrefuvm_vnp_syncusbf_end_configusbf_add_configwsmux_set_displayieee80211_get_disassocarpt_downrdgetdisklabelarm_pdcache_line_sizebpf_tapnthreadsuvm_pmr_addr_RB_NEXTnumnegmii_phy_autouvm_pmr_addr_RB_FINDuvm_mapent_free_removewsfont_rotatemsdosfs_initohci_device_ctrl_startrtmap_limitwi_write_record_ioext2fs_writelf_clearlockpxaudc_writegeneric_armv4_bs_wr_2uvmpd_scan_inactiveurl_memip_srcrouteuhidioctlpte_l1_s_cache_masksys_setregidpcmcia_cdusbd_device2interface_handleurl_csr_read_1cpuset_infosusbd_dopollvinvalbufmii_bitbang_writeregsys_ftruncateaes_ctr_cryptm_splitsoftintr_disestablishentropylockbufcache_getdirtybufurl_stopzts_irqtcp_timer_inittuagg_unlockedpool_multi_freend6_maxnudhinttcp6_inputsosetoptkp_dirtytcp_mssrt_sendmsgifa_addcache_purgeudav_stop_taskusb_detach_roothubbpf_mcopyax88190_mediachangepcmcia_3cxem556_func0comconsrateauth_hash_hmac_sha1_96pcmcia_intr_disestablishfork1vfs_hang_addrlistcue_tickdead_writeufs_dirrewriteinsmntquettreadtk_canccext2fs_blkfreeudp_outputfind_last_setsoftraid0pxaintc_matchsys_chmodprelist_removeuvm_objtree_RB_NFINDuao_shrink_arrayffs_vgetaxe_encapsr_bootuuidip6_getpmtu__umoddi3bcstatsin_pcblhasharm_dcache_alignvm_map_downgrade_lnip6_log_intervalnull_encryptdevice_mpathsched_idle_cpusugl_newbufscsi_activate_lunwsemul_vt100_nextlineuvm_atopgmaxprocesssyn_cache_timervt100_initchartableslcd_paramieee80211_auth_opensolisten_filtopsprocess_kernel_argsin6_update_ifa__wdcerrorSHA384Updatecdce_detachpxa2x0_intr_disestablishrt_msg2suser_ucredcom_is_consolemem_noext2fs_buf_allocdp8390_startbufbackpagesuaddr_kernel_functionspmap_free_l2_bucketRMD160Update_intrevarprequestrrw_enterkernel_mapwi_init_iodumpdevwsmouseioctlcd9660_lockusbd_ref_incruvm_mapent_forkzeroieee80211_mgt_subtype_namegf_powuvm_pmr_splitvfs_mount_foreach_vnodekqueue_kqfiltertimeout_add_usecsr_raid5_set_chunk_statewi_mgmt_xmituhid_do_ioctlzeroin6_addrstrncasecmptimer_filtopsohci_device_bulk_starttcp_mss_advSHA512Update_intzts_cdcurrent_spl_levelnd6_optionwin2unixfnmax_hdrffs_readifq_enqueue_trym_freepool_allocator_multi_niphtree_RB_FINDpxaudc_ctrl_startne_pcmcia_dl10019_get_enaddraes_key_wrapurlphy_attachieee80211_get_assoc_reqsr_meta_attachsr_meta_native_bootprobescsi_inqmatchfdesc_poolpool_page_allocsr_switchin_pcblookupm_tag_delete_chainfilt_pipewritecd9660_pollugl_detachbadaddr_read_4Chacha20_Poly1305_Setkeybzeromii_bitbang_syncumass_scsi_probearmv4_drain_writebufswapdrum_addufs_closedefrouter_delreqfixjobcsdmmc_matchuvm_pmr_size_RB_REMOVEusbf_set_endpoint_haltscsi_devidin6_addmultirn_newpairbioszts_enablesys_obreak__udivdi3sdmmc_intr_enablepxapcic_attach_cardpxa2x0_gpio_set_intr_levelblf_setkeyusbd_set_config_norgephy_cdieee80211_pmksa_addlastddateuvmfault_unlockallsr_meta_getdevnamem_inithdrpmap_curmaxkvaddruvm_pmemrange_addr_RB_NFINDuuid_dec_lein6mask0bpf_validateusbd_get_string_descvaccessuao_set_swslotsys___thrsigdivertsys_getdtablecountmbinitsr_errortcp_secret_ctxabortwskbd_default_bell_datascsi_readsafe_cmdieee80211_set_link_stateamap_allocVOP_LOCKbuf_rb_bufs_RB_INSERT_COLORMD5Finalwskbd_matchaxe_rxeofcd9660_vget_internalwi_intrvgetrd_attachkd_nowaitpxa27x_cpu_speed_91wsmouseopenwinChksumbufq_requeuefreeclusterchainmld6_initswapmapscsi_get_linkdisk_initpxapcic_intr_establishSHA256Updateohci_bus_methodsohci_hash_rem_itdrip6_ctloutputdisk_readlabelaue_sendusbd_getnewaddrrasops_erasecols_rotatednd6_na_outputext2fs_fhtovpsr_validate_stripsizeumass_cbi_transferext2fs_createunp_deferredwi_sync_mediapte_l2_l_prot_maskuvm_map_teardownpipe_pollpool_reclaim_allnsphy_cabmtphyattachsysctl_dopooluhub_matchuvm_mapent_clonetcp_respondsys_readvcrypto_getreqamap_cow_nowroundrobinusbd_get_hub_descriptorsa11x0_intr_establishbadaddr_readuvm_map_createissignalwdprintsr_attachfilt_uhidrdetachin6_selectrouteieee80211_recv_rsn_group_msg1rtmap_initcdevvpscsi_pending_start_setsoftintrmsdosfs_kqfilterigmp_joingroupuiomoveohci_device_isoc_donewi_usb_wridrespmsdosfs_startlf_allocsrp_finalizecpu_idle_leavewi_intr_ackscsi_iopool_getbpf_reset_dnd6_dad_stopdiskmapioctlhid_start_parsescoop_pcic_socket_setupinflateSyncPointuvm_waitfilt_apmreadnexecsmclpoolszts_avgposieee80211_regdomain2namepmap_referencesys_bindax88190_mii_statchgsdmmc_done_xsloioctlrw_exit_writebs_notimpl_bs_wr_8ieee80211_eapol_key_micrt_ifa_addusb_abort_taskspmap_bootstrapbs_notimpl_bs_wr_2blf_cbc_encryptsys_mqueryarm_picache_line_sizekmeminit_nkmempagesspeedtablesusbd_new_devicewi_pcmcia_detachuvm_pmr_size_RB_REMOVE_COLORscsi_iopool_initscsi_io_putunp_gc_taskuvm_pmemrange_findfillinusemaprecvitbmtphy_funcsusbf_get_descriptorscoop_suspendfilt_sowriteuvm_kernacccnpollcsys_linklcd_blankuvm_addr_initlog_opensr_rebuild_initfilt_randomdetachuvm_pmr_size_cmpfragtbl124userconf_totdevxscale_cache_flushIDieee80211_plcp2ratert_ifmsgrandomread_filtopsrealitexpireipstatunix2dostimedounlinkatscsibus_caurl_newbufusbd_delay_mscrfreecnputcuhid_do_writeip6_lasthdrrefcnt_finalizedl10022_mii_bitbang_opsohci_device_isoc_abortuhub_uhub_catcp_reaperpool_sethiwatwi_read_record_usbwsemul_vt100_output_c0c1wdgetdefaultlabelmicrotimeuvm_pmr_addr_cmppipeunlockuvm_pmemrange_addr_RB_MINMAXuvm_swap_getrasops_free_screenext2fs_reloadurlphy_matchelf32_copyargsisochariophymatchuvm_km_alloc1cdopentcp_usrclosednsphyter_caaue_ifmedia_stsphysmemuvn_flushsr_bio_handlerurl_cdnsgphy_servicesdmmc_del_taskuvmfault_relockinferiorukbd_attachxscale_cache_purgeD_Eclusterallocsr_raid_syncrt_if_remove_rtdeleteif_input_taskwskbd_attachin_pcbbindumass_cbi_statexscale_cache_flushImtdphy_caudp_notifysdmmc_app_commandendtsleepwihap_check_txstrnlensigactsshareuvm_map_freelist_update_refilluvm_map_addr_RB_NEXTbpfattachugl_openpipesml_purgeitimerdecrieee80211_get_delbaether_outputpmap_bootstrap_pv_page_freeinflateGetHeaderbpfilter_lookupm_copym0sdmmc_io_detachaxe_miibus_readregpxapcic_detach_cardvm_physmemiso_shipdirrdwriternd_timeoutieee80211_setup_htopieee80211_parse_edca_paramspipe_ioctlfilt_timerexpireural_set_chanwskbd_enablepmap_devmap_find_vacd9660_mountrootusbf_devinfo_allocbpf_allocbufsaxen_tx_list_initset_stackptrmsgbufmappedohci_device_setintrpxapcic_attachcomprobe1cdsizeumass_lookupsmsc_attachwsmouse_mux_closewakeupuao_growgetnanotimewdc_pcmcia_disk_device_interface_callbacka4x_bs_wm_2pxaudc_ctrl_transfertcprexmtthreshkprintf_mutexusbf_alloc_bufferieee80211_ht_negotiatert_getifawi_get_fid_ioenosyslockmgrrtlabel_name2idhidkbd_is_consoleuvm_vnodeopsvfsconfusbd_detachVOP_OPENcompwroffwsdisplay_console_inittedbuckstringusbd_fill_deviceinfoscsi_interpret_sensesqphy_cdext2fs_flushfilesunp_headdes_ecb3_encryptieee80211_send_eapol_keymallocarraycomconsattachedlxtphyattachwi_usb_txeof_frmufs_readlinkrdopenin6_ifadddoscheckpathsyslogfpcbmap_tr_stored_blocknd6_option_initbufq_quiesceext2fs_setsizein6_init_prefix_ltimesnchstatscd9660_fhtovpmsgbufpsys_setgiduserconf_common_attrfilt_ufswritezts_activatert6_flushpxapcic_io_freepledge_recvfdgeneric_bs_r_4pxaudc_epN_intrmmrwieee80211_media2mcsffs_bufatoffwi_usb_rridrespfilt_msdosfsreaddohooksgf_invieee80211_rssadapt_choosenprocessespool_p_freeif_detached_ioctllocnamppsegswi_usb_causerconf_showconfig_suspend_allip_mtudisc_timeout_qsr_raid5_assemblesr_scsi_cmdaddress_exception_entryffs_fhtovpitimer_mtxgetvnodefilt_ufsvnodecrypto_get_driveridin6_pcbhashspeed_to_freqpool_setlowatkmembaseswi_entryrip6_inituvm_aiobuf_poolisofncmppcmcia_card_detachseltrue_filtopssys_sigprocmasksysctl_mqfilt_pipereadpxa2x0_intr_establishenc_xform_aes_gmacsoreserveconsoleusb_activatepxaost_attachscsi_report_lunsufs_quotactldosymlinkatuvm_map_uaddraroundin6_pcbnotifyif_ih_insertusbd_clear_endpoint_toggleexplore_pendingstrrchrgetdevvpm_clgetdefrouter_selectamap_unrefext2fs_statfsbpf_mtap_hdrcrdupamap_wiperangecuio_copybackisodirinocfrootswsmousepollchrtoblkscsiprintuserconf_pdevnamminphysukbd_matchurl_ticksys_fchownatztsavgloadedether_addmultitimeout_mutexieee80211_recv_actioncdce_cdffs_vptofhvfs_isbusyifunitirqstackbawritetputcharwskbd_detachpmap_postinitffs_fragacctpxa2x0_lcd_resumeffs1_ballocsys_fchowninflateInit_SHA384Update_intvwaitforiopxagpio_camii_phy_ticksdmmc_io_function_enablecd_read_subchanneluao_shrink_flushflsextendfilelortrequestwsdisplay_resumeicmp6_inputwsemul_vt100_outputbuf_valistuserconf_addsdmmc_io_write_4ohci_device_intr_methodswi_func_iocreatedefilt_randomreadieee80211_michael_mic_failuresbreleasein6_selectifmsdosfs_islockedmax_linkhdrumass_attachwsdisplayioctluvm_unmap_detach_intrsafewdc_xfer_iopooludav_resetget_stackptrsysctl_rtablemsdosfs_reclaimwdc_free_queuesqphy_serviceuserconf_hist_eocsys_readlinkatuvm_objtree_RB_REMOVEext2fs_getattrrtlabel_id2nameusbf_setup_default_xfersbdroprecordinitconsbufpxaip_searchwdsizenamecache_rb_cache_RB_REMOVEsdmmc_io_scanacphy_statusip6_sysctlsuserusbf_devinfo_setupdiskconfural_tx_datavn_syncer_add_to_worklistusbd_get_interface_descriptorgeneric_bs_rm_1pxaudc_activatetk_ninsysfilt_opssdmmc_io_function_readyclusterfreefilt_randomwritesr_warnsr_raid_intrieee80211_alloc_node_helperrootdevm_tag_firstpxa2x0_cpu_resumecdmatchpmap_map_entryusbd_get_config_descriptorpfxrtr_deldumpsysicmptstampreplrip6_sysctlext2fs_fsyncdoforcesys_fsyncwi_usb_stopuserconf_add_readsr_crypto_writeusbd_reset_portifconfcpu_apmwarnamap_wipeoutuser_configcast_setkeytcp_outputnsphyattach_bus_dmamem_mmapwsdisplay_emul_attachsdmmc_mem_read_blockupdate_ledsext2fs_updatert_ifa_dellocalpxa2x0_memcfgtcp_timer_2mslne2000_writememaue_openpipesffs_reload_vnodebuf_putmsdosfs_setattrVOP_RMDIRsr_ioctl_installbootif_addgroupieee80211_setmodeuhid_matchpool_allocator_freefilt_proceopnotsuppsdmmc_enableffs_reallocblksphtree_RB_INSERT_COLORrandomcloserootvpaxe_miibus_writereguvm_pmemrange_addr_RB_NEXTpxagpio_intrlowieee80211_eapol_key_decryptpcmcia_intr_establishrt_plentosauserconf_maxlocnamespool_reclaiminitdisklabelusb_quirksbpf_insn_gcbpf_sysctlvflushieee80211_bip_encapcddetachpmap_clear_modifytcpctl_varsarptimerbufq_dequeuetcp_reass_limitm_copymruaddsys___set_tcbrdstrategybcopy_pageip6_freepcboptsif_upcoredump_notes_elf32timeout_add_nsecuvmfault_lookupif_idxmap_insertm_extfreene2000_ring_copysdmmc_set_bus_powerrgephy_resetupl_intrural_matchdeflateBoundVOP_BWRITEbufq_fifo_peekrt_timer_queue_createwddonemsdosfs_ioctlupl_matchno_constraintmsdosfs_dehashsys_opensr_crypto_change_maskkeywdc_alloc_queuergephy_funcsusbd_match_devicerasops_pmaskinet6domainural_enable_tsf_sync_bus_dmamem_alloc_rangeether_crc32_be_updatepgdeletepxapcic_intr_stringsdmmc_io_initusbf_do_requestwskbd_do_ioctl_scdead_vopsifq_q_leaveieee80211_media_changeuaddr_hint_createraw_attachural_set_rxantennahidkbd_cngetcscsi_ioc_cmdmax1111_adc_value_avgastpendingifnewlladdrether_ip6multicast_maxpipe_pooluao_initudav_iffsdmmc_needs_discoverifa_ifwithroutescoopattachspec_kqfiltertcp_notifyieee80211_match_bsscd9660_tstamp_conv7ural_free_tx_listffs_dinode1_poolieee80211_set_keyieee80211_bip_delete_keyrtflushclonegetblksr_raid_turdl10019_stop_cardxscale_cache_flushD_rngmaxsmapwdc_ata_bioip6_mcast_pmtusoconnectural_initrasops_use_fontwskbd_repeatuvm_map_fix_spacenobuffers__lshrdi3data_abort_handler_addressin6_delayed_cksumusbd_errstrSHA256Update_intsr_scsi_ioctltcp_identtcp_rst_ppslimrtrequestifinitsd_cmd_rw10cd_load_tocunpst_recvspaceuvm_map_mqueryget_ifidsr_infoscsi_io_getne_pcmcia_attachkue_initxscale_cache_purgeIDuvm_map_kmem_growraw_inputcd9660_reclaimkue_ioctlfilt_logrdetachtimeout_add_btnd6_ifattachunpdg_recvspacedofaccessatpipe_closecd9660_inactivesoftdep_mountmsdosfs_rmdirmsdosfs_fsynccfdatadeflateInit_ffswi_usb_tx_lockufs_checkpathSipHash_Finalcdcef_rxeofpmap_pte_init_xscalepfxlist_onlink_checkdiskmapreadm_tag_findinittodradler32blf_encvputaue_iffpte_l1_s_cache_mode_ptvector_page_setprotcd9660_setattrusbd_get_configpool_allocator_multiuaddr_kbootstrapufs_quota_init_rtallocallocpidkqread_filtopsusbd_setup_pipexscale_setttbaue_csr_read_1pcmcia_check_cis_quirksxscale_cache_cleanIDbuf_acquiredolinkatbioopscpu_classesbpf_setdlttcp_flush_queuepool_setiplmsdosfs_statfsbuf_adjcntlboltpipe_inituvm_wait_plausbd_open_pipe_intrusbd_request_asyncaes_gcm_reinitsyncerprocpcmcia_card_gettypepxa2x0_clkman_iohufs_ihashinszcfreein_setpeeraddrinphymatchpxa2x0_a4x_bs_tagwindow_inflatewsdisplay_delscreenpool_multi_alloc_niether_ifdetachsr_meta_native_readuhidev_get_report_descuserconf_histcurrndstatssdmmc_mem_write_block_subrmsdosfs_inactivepanicstrrasops_wronly_copycolswsdisplay_kbdinputupl_newbufumass_scsi_cbscsi_delayext2fs_sync_vnodeif_startunpdg_sendspacesession0viscpywsmouse_do_ioctlrasops_wronly_eraserowsChacha20_Poly1305_Finalhw_ver__umodsi3copyincomparamural_stopudav_sendcd9660_defattrohci_device_bulk_closebs_notimpl_bs_sm_8uao_swhash_elt_poolufs_ihashgetne2000_read_hdrdovchflagssigacts0scoop_mmc_attachfindblkmajormsdosfsvnode_filtopsrasops_vcons_mapcharpte_l2_l_prot_urntohlsorflushiophy_funcsusbf_create_threadlcd_matchuvm_mapent_tryjointtioctlvprintfslpquesr_raid1_wu_doneohci_root_ctrl_methodsttycharssyncdelayuvm_vslock_devicewi_usb_infofrmaxen_ioctluvm_pagealloc_multisdmmc_io_read_2hidkbd_enableffs_mountwsmux_mux_closechacha20_setkeyif_ifp_gcicmp6errppslimbadaddr_read_2rt_plen2maskmsdosfs_vopsdp8390_mediachangeconfig_process_deferred_childrenbufq_waitohci_ifcdwsdisplaywriteieee80211_add_htcapssdmmc_decode_csdxscale_cache_purgeID_Ebs_notimpl_bs_sm_2ifq_q_entermsdosfs_rootmii_bitbang_sendbitstqphyattachbpf_getdltlistm_tag_getuvm_map_freelist_updatesb_lockohci_root_intr_abortrt_labelscrypto_unregisterHMAC_SHA1_Finalupl_watchdogsuid_clearttwritedma_alloc_initifq_dequeuebuf_rb_bufs_RB_NFINDbuflowpagesrebootswapdev_vpdp8390_resetpool_gc_taskpxa2x0_bs_mapaes_xts_cryptieee80211_deliver_datadead_readkv_execusbf_reallocpxapcic_socket_disableufs_pathconffile_poolohci_timeoutunputcendpcmcia_verboseVOP_CREATEcpuset_firstSHA512Updatecdce_stoppledge_nameirasops_copycharnd6_recalc_reachtm_intervalin_ifinitohci_device_ctrl_closewi_pcmcia_activatein_pcbhashlookupsys_mknodatapmread_filtopskp_dmaural_writehid_get_data_subVOP_ABORTOPrasops_vcons_eraserowsdofchownatsr_wu_done_callbackfilt_wseventreadsys_acceptnsphyter_statuspxa2x0_pi2c_writeuvm_map_entry_kmem_pooluvm_pagerealloc_multiieee80211_wep_decryptrtable_lookupwi_inquireuaddr_bestfit_pooltcp_rst_ppslim_countieee80211_recv_assoc_respieee80211_parse_rsn_bodyukbd_detachaes_key_wrap_set_keyif_clone_listtc_windupsys_futimessdgetdisklabelwi_do_hostdecryptinternal_commandumass_scsi_detachuvm_map_boundaryin_losingaxen_rxeofVOP_SYMLINKgeteblkusbd_set_interfacewsscreen_detachscsibusmatchinflateBackInit_vn_ioctlwi_usb_ctl_lockufsspec_readaxe_cdpipespacehid_get_udatafiqvectorget_last_resort_ifidohci_alloc_stdip6_sendredirectscast_decryptukphy_caitimerfixpxa2x0_apm_attach_subip_stripoptionsieee80211_add_xratesusbf_errstrnd6_timer_chugl_rxeofne_pcmcia_ax88190_set_iobaseuvm_pseg_releasecpu_resetudav_ticktcp_ctlinputether_multiaddrstart_cleanerffs_blkfreeexit1ohci_detachwsmouse_add_muxihashkeybdevvpifa_ifwithdstaddruvmspace_dusedudav_ifmedia_changein6_nigroupscsi_mode_sense_big_pagesys_mkfifoatpool_get_doneuihashpxaudc_read_epNrijndaelEncryptscsi_ioh_deltcp_keepintvlifq_priq_opscdwriteufswrite_filtopsttybgconfig_searchzts_samplesphtree_RB_PREVusbd_printscoop_set_backlightuvm_km_valloc_prefer_waitsyn_cache_poolffs_allocaue_tick_taskeephy_funcsinphy_funcsrgephymatchbswap32ipsec_exp_first_usecdcef_cdrlphy_servicenet_livelocksplimit_poolip6_defhlimumass_setup_ctrl_transferunp_connect2usbd_set_pollingpxa27x_frequency_changern_walktreesys_chownuvm_pagewireukbd_apple_iso_mba_mungerasops_putchar_rotatedin6_joingroupsys_munlockinflateBackuvm_anfreert_ifa_deldofilereadvipip_sysctlbs_notimpl_bs_sr_1vn_statfileieee80211_iterate_nodesrw_exit_readwi_intr_enabletablefulluhub_exploreupl_txeoftcp_maxidlescoopmatchvfs_getcwd_commonset_cpufuncscttyioctlsys_lstatscoop_gpio_pin_ctlieee80211_recv_wpa_group_msg1ieee80211_recv_addba_respohci_timeout_taskohci_hash_add_tdieee80211_tkip_set_keyiso_uiodircttykqfiltercttyopenpmap_link_l2ptinet6ctlerrmappool_runqueuedisknameslenicmp6_redirect_diagdisknamessched_queued_cpusumass_quirksdumploRMD160Updatemsdosfs_mountacphy_funcsffs_clusterallocmq_dequeuenullcnpollcuvm_km_inituvm_objinitbzero_pageffs_sbupdatechillbufsudp_sysctlsys_openatax88190_mii_bitbang_readbs_notimpl_bs_wm_1vmmapbsyusb_add_taskurl_int_miibus_readreguserconf_histlenbufcache_initnkmempages_minukbd_accessopspxapcic_io_allocusbcloseudav_matchpxauart_matchvector_pagekq_ntimeoutssys_sched_yieldvmspace0scsi_decode_sensettywaitwsmousedevprintuvm_map_setuptcp_syn_cache_sizewdc_default_vtbluao_grow_arrayuvm_uarea_alloclcd_set_brightnessetextifa_ifwithnetmemchrohci_device_ctrl_doneqsphy_statussqphyattachpte_l2_s_cache_maskcomp_algo_lzsieee80211_recv_barrn_link_dupedkeysysctl_cptime2sdmmc_capxa2x0_bs_unmapscsi_mode_sense_pageboot_argspipelockvt100_selectattributeumass_scsi_setuppxammc_clock_startproc_poolaue_intrudp6_inputsys_writeural_set_txpreamblesharp_zaurus_C3000_blgeneric_armv4_bs_rr_2sb_maxusbd_fill_iface_datacd_set_pa_immedsr_uuid_print__bss_end__wsdisplay_maxscreenidxip6_insertfraghdrresume_randomnesscnstopihashtblieee80211_set_shortslottimesys_dup2gpt_chk_mbrwsdisplay_switch1wd_get_paramsrtable_init_backendbread_clustersys_readlinkext2fs_size__ashrdi3bs_notimpl_bs_mmapzErrorohci_intrxscale_cache_flushI_SEip6_auto_flowlabelcrc32devid_copylf_splitifafreeVOP_STRATEGYtimeout_add_sectzpxammc_card_intrxscale_cache_syncIrip_sendspacecoredump_writenote_elf32uhidev_writeusb_generic_tasksxscale_cache_cleanID_rngamap_addtcp_freeqif_setgroupattribscom_attach_subrdvd_authSipHash_Updateexphy_serviceumass_scsi_cmdscoop_gpio_pin_writecdreadrasops15_initspec_inactivedp8390_stopwi_func_usbwsmux_do_ioctlsys_sendtoicmperrppslimgeneric_filtopsrefcnt_initknote_dropcue_watchdogin6_selectsrcuvm_mmaplockrd_casdmmc_read_cissoftclock_siwi_usb_threadugl_watchdogsr_ccb_putzkbd_ioctlnd6_rs_output_timeoutalldevsdp8390_rintwddumpicmp_do_errorvmcmd_map_readvnsmsc_initpxammc_exec_commandrandom_startcomconsfrequsbd_get_interface_altindexamap_extendsigpropvmapbufumass_scsi_switchdehashtblsocketopsscsibus_bioctlpcmcia_activatend6_maxndoptuvm_map_clip_startffs_fragextendtcp_always_keepaliverawcbtablespec_readunp_markacphyattachicmp_mtudisc_timeoutnwsmuxa4x_bs_r_1pmap_zero_page_xscalettyread_filtopsuvm_mapgetinoquotascsi_do_ioctlrtable_existsdisk_lock_nointrcd_resetscsi_ioh_addext4_ext_find_extentscsi_detach_busudpstatroute_inputsetrootcsr2cd_read_tocural_amrr_updatecdioctlieee80211_defrag_timeoutbufq_switchcue_stopifmedia_addfrag6_queuelxtphy_funcssr_matchusbd_set_config_indexlogopenieee80211_add_rsn_bodyrn_del_radix_masksr_raid6_initcd_buf_donescsi_devid_pg80rtable_insertbreadntcp_hdrszscsi_devid_pg83tcbtablefilt_cd9660detach__xordi3frag6_drainuvm_objtree_RB_REMOVE_COLORdosdiremptyigmp_slowtimoifpromiscrtl80x9_mediachangerasops4_putcharip6_setpktoptsfork_returnsys_getsocknamecd9660_lookupsr_concat_initwi_usb_intrusbd_alloc_bufferinflatePrimemask_rnheadsw_reg_iodonepte_l2_s_protoufs_rootsdmmc_detachtcp_sysctlVOP_SETATTRsmsc_chip_initsrp_update_lockedpmap_kremovesigactsinitsdmmc_io_rw_extendeddomknodatcpu_kcore_hdrexec_elf32_fixupvop_generic_lockcomconsiotuvmfault_anongetconsttywdc_pcmcia_caural_bbp_readpxammc_host_resetsr_ioctl_diskusermountext2fs_dirrewritevn_closefile__ucmpdi2umass_discoip_mtudiscvfs_free_netcredmld6_start_listeningcpu_mainbus_cakue_matchpmap_kenter_papidhashtblaue_matchuvm_mapent_forksharedm_pullupenterpgrpwdc_pcmcia_lookupxscale_tlb_flushID_SEcrypto_freesessionwsemul_vt100_output_string_escwsdisplay_kbdholdscrpxa2x0_rtc_getalarmcnbellm_copydatabufq_nscan_requeueuvmfault_initcd_setchanieee80211_get_probe_reqpool_p_removemtx_leavefilt_signalsigactsfreewdc_default_write_raw_multi_4ttymallocupl_attachrasops_copyrows_rotatedicmp6_notify_errorieee80211_recv_probe_respwsdisplaykqfilterbs_notimpl_bs_sm_4kue_setmultizapm_acintrmmioctlumass_matchsched_choosesendsigsdmmc_print_cisohci_device_ctrl_methodsbpf_ifnameohci_cdural_ioctlsmsc_iffvfs_busytimecounterfilt_ufsdetachbufq_initlf_getlocksr_raid6_xorpsolistenwskbd_compose_valuespec_getattrip_ecn_ingressmsdosfs_bmaprip_ctloutputffs_vtblif_getgroupieee80211_parse_rsnether_rtrequestpool_debuguserconf_morekqueue_ioctlmax_processessys_wait4rip6_recvspaceamap_share_protectieee80211_bar_tidfs_sysctlukbd_cnattachpxammc_card_detectpxaost_matchboot_filepte_l1_s_prot_uwfilt_sordetachknote_activatepsignalwsdisplay_console_confieee80211_regdomain_compare_cnconfig_pending_incrusb_task_threadamap_pp_establishauth_hash_gmac_aes_192uvm_pmr_nextszuvm_anon_initffs_reclaimbmtphy_causb_free_deviceusb_explorebufq_nscan_queuexscale_cpufuncsif_link_state_changelcd_max_brightnesspmap_virtual_spaceieee80211_add_wpaieee80211_eapol_key_check_micpage0_endieee80211_add_capinfobpfpolluvm_pmr_nfindszupdatepriohci_activatebmtphy_servicesched_kthreads_createuhid_cdwskbd_cnbellbintimevt100_decmodewi_seekfilt_soreadpmap_remove_allrtable_addmq_delistzeropageipsec_def_encrtable_deleteffs_nodealloccgsoftintr_establishpxaudc_detachuvm_pmr_removeip4_input6pdevinit__iordi3nsphytermatchuvm_pmr_findnextsegmentinetctlerrmapresetpriorityusbf_device_descriptorenoioctlwi_usb_start_threadaxen_ifmedia_stsrasops_vcons_copyrowsflslsigacts_poolexecsigsconfig_initicmp6_redirect_inputbuf_rb_bufs_RB_REMOVE_COLORrw_enteraue_read_macuvm_addr_destroysr_raid0_inituvm_pmr_size_RB_MINMAXnd6_ra_inputffs1_blkprefin6addr_loopbackuvm_objtree_RB_MINMAXttypendin6addr_linklocal_allroutersuvm_swap_freepagesqsphymatchnd6_dad_starttimerin_revarpinputstrlcpywskbd_get_backlightusbd_reload_device_descsmsc_read_regaxen_newbufext2fs_advlockknote_fdcloseusbd_get_devcntif_clone_detachpipe_rfiltopsin6_cksumcomcninitstrncmpcsrc_ptevfs_shutdowngetsockieee80211_get_deauthbs_notimpl_bs_c_4upl_startzssp_matchsyn_cache_respondif_creategrouppxa2x0_gpio_set_diruvm_iosbcheckreservepreemptbioattachieee80211_begin_scanpriq_opsunixdomainsmdscsibusattachugl_devsnsgphy_cdulminwihap_data_inputpxa2x0_lcd_free_screenproc0paddrrn_addmaskuvm_vnode_poolusb_attachbpf_bufsizeselscanpxa2x0_do_pendingsoo_polluvm_map_uaddr_esig_filtopsknote_processexitohci_device_bulk_transferukbd_cdzkbd_accessopspxaip_scwskbdopenpxa27x_fastbus_run_modettclosurl_rxeofipsec_soft_allocationssleep_setup_bus_dmamem_mapip6_fragmentnet_sysctlcom_cdusbf_devinfo_freewskbd_do_ioctlxscale_cache_cleanD_Euvm_pmr_size_RB_FINDudv_listdead_ioctlaue_initusb_match__wdccommand_startsdmmc_complete_xssysctl_iflistrasops_alloc_mattrvwakeupif_clonerswdcbit_bucketvgonewdc_probe_capspmap_initializedtcp6_ctlinputsched_init_runqueuesusb_allocmemif_linkstatesd_sizeufsspec_closene2000devsnd6_prefix_offlinkuvm_anon_dropswapif_start_lockeddl10019_mii_bitbang_readwi_detachigmp_inputkmemusagezapm_suspendswcr_sesnumlf_getblockautoconf_attdet_mtxtcp_rttdfltcleanerprocieee80211_parse_edca_params_bodysbappendstreamm_tag_copy_chainohci_handoversowrite_filtopssr_chunks_unwindstrncpysdreadsys_pselectupdatefatscue_memata_perrorvfs_getvfssr_alloc_resourcesaue_txeofffs_sync_vnodedeflateInit2_sr_raid6_discipline_initproc_stoprrticks_initbio_status_initusbd_set_port_featurebpfilter_createsysctl_lockax88190_mii_writereglockfpoolmq_dechainrasops_copycols_rotatedpledgereq_flagsieee80211_find_nodecpu_switchtohtonlsched_all_cpusin6_mask2lentcp_dooptionsdos2unixtimesys_sigactionsr_scsi_donewsdisplay_suspend_devicedeupdatusb_fill_di_taskzapm_get_eventSHA256Transformrndlock__negdi2in6_purgeaddrcpu_modelieee80211_input_ba_flusharm_dcache_align_maskcttyreadcd9660_unlockuserconf_cmdsural_taskwsdisplaycloseiophy_statusschedclockbpfioctlconfig_attachohci_alloc_sitdcue_rx_list_initzaurus_battery_life_c3000pxa2x0_bs_tagsubstrcmpdl10019_init_cardbmtphy_statususb_syncmemdisk_unbusysoisconnectedurlphydebugsdmmc_ccb_allocusb_block_freememVOP_PATHCONFumass_fixup_sonydk_mountrootassertwaitokscsi_minphyssdmmc_delayxscale_cpwaitvattr_nullsys_getsockoptufs_ihashuhidev_attachfrag6_nfragpacketspxapcic_pcmcia_functionsaxen_startsr_raid0_assemblevfs_sysctlcpu_get_controlVOP_READLINKbuf_mem_initumass_cbi_methodspxa2x0_intr_bootstrapnsphyter_funcsmii_submatchrasops_wronly_putcharohci_root_intr_transferwsdisplay_unset_cons_kbdmsdosfs_pathconfoldpidstimeout_wheelpxa2x0_setsoftintrarp_listbpf_m_xhalfumass_io_getaverunnablecd9660_getattrttyfreettysleeplcd_cduvm_pausedp8390_initzapm_bcintrunp_disposescsi_inquireufs_getattrBlowfish_encipherieee80211_mhz2ieeevfs_exportpxammc_scoop_capool_wait_gcsr_hotsparepoly1305_updateuvm_km_pgremoveex_region_plfscalesmsc_matchffs_alloccgblkpxaudc_disableip_optcopyvfs_registerscoop_mmc_matchieee80211_proto_attachsys_dupmcllowatmii_printieee80211_setup_ratescd9660vnode_filtopsbpfilterattachproc_stop_totimeout_todoswcr_initcpu_read_cache_configwsemul_vt100_scrollupzkbdsleeptvsr_ioctl_createraidpanicget_pc_str_offsetural_rxeofcue_rxeofL_cksumdataieee80211_channel_initmsdosfs_lockseltruewsdisplay_console_devicebpf_m_xwordmq_enlistscsi_xs_syncsoftdep_initializeunp_shutdownieee80211_tkip_encryptwi_resetdovutimensdummy_get_timecountext2fs_sysctlgeneric_bs_wm_4kthread_run_deferred_queuearc4_initpxa2x0_gpio_bootstrapwdreadlastdaycheck_execwi_usb_cdtcp_initsdmmc_start_xspcmcia_attachpte_l2_s_cache_mode_ptpool_request_initdeferred_config_queuedp8390_getmcafbuf_rb_bufs_RB_MINMAXnetisr_initipport_lastautowsmux_detach_sccom_raisedtrpxaudc_bus_methodsicsphy_statusip6_pcboptwinSlotCntvn_kqfilterext2fs_syncsched_stolenpte_l2_s_prot_maskudav_ioctlcrypto_registercache_purgevfszaurus_udc_activatepostsiguvm_mmapfilesys_pathconfcue_open_pipespxapcic_mem_allocin_addmultigetmicrotimebs_notimpl_bs_rm_8zssp_cdrasops_reconfigmaxthrsleepumass_clear_endpoint_stallwsmousekqfilterohci_setup_isocaue_newbufscsi_probedevaxe_ax88178_inittcp_templatemsdosfs_readohci_initcomopenusbd_setup_xferauth_hash_hmac_sha2_512_256afmapieee80211_tree_RB_MINMAXmtagpoolbcopywsmousecloseurl_tick_taskrtrefbufcache_releasecue_detachusbioctl_bus_dma_inrangekqueue_wakeuprasops_wronly_copyrowsip6_unknown_optuaddr_rnd_removetcp_reasssys_getfhext2fs_vgetrt_timer_timercomcnputcKERNEL_BASE_physSHA1Update_intwsemul_vt100_output_scs94cuio_applySipHash_Endscoop_cageneric_bs_rr_1axe_resetlcd_get_backlightdefrouter_addreqin6_clearscopend6_dad_ns_inputuvmpd_tunertisvalidusbd_set_addressne2000_readmemscoop_cdudav_openpipesffs_setblockipsec_expire_acquirekue_stopwsscreen_switchwaiticmp6_mtudisc_cloneinflateResetmemcmpwskbd_init_keymapnamecache_rb_cache_RB_REMOVE_COLORip6_dad_pendingieee80211_rate2plcpmsdosfs_createcd9660_startzkbd_hingepte_l2_l_prot_uwcomstartaes_xts_reinitcfroots_sizetickadjip6_splithdruvm_map_addr_augmenttcp_secret_initieee80211_recv_sa_query_reqsbreserveundefined_initip6_sendvrecycleieee80211_alloc_nodeblf_ecb_decryptcrcopyural_newstatewdcloseundefined_handlerssys_revokeusbf_get_xfer_statusural_free_rx_listsysctl_stringsys_rebootpxammc_host_maxblklenuvm_unmap_kill_entryext2fs_specvopsbufpooldl10019_mii_bitbang_writeproc_finish_waitwdccommandext_dist_code_bus_dmamap_load_buffersigonstackcpu_forkuaddr_kbootstrap_selectwi_write_data_ioscoop_checkdiskttylistwdopenuvm_vslockdeflateResetuvmfault_update_statscast5_setkeyttyoutputsr_raid5_wu_donekue_caexplicit_bzerousbf_cacd9660_tstamp_conv17wskbd_calxtphy_statustqphy_cdpxa2x0_wakeup_configcopyaddroutif_watchdog_taskpcmcia_scan_cispxa2x0_memctl_iohclockintrcpuset_add_allsystqmpVOP_READufs_ioctlffs_freefilein6ifa_ifpforlinklocallastdtimegetdisksys_setuid_wdc_ata_bio_startstart_updateudav_cdusbd_clear_port_featureusb_abort_task_threadufs_quota_free_blocks2senditsr_crypto_decryptbufq_fifo_destroylcd_bpp16_screencluster_writesr_raid5_createusbf_add_endpointhidkbd_decodeuvm_setpagesizepxa2x0_lcd_list_fonttcp_xmit_timerrn_add_radix_masksr_raid1_rwin6_recoverscopensphy_serviceaue_tickpxa2x0_gpio_get_bittimeout_add_tvtickmclpool_warnmsgscsi_pending_finishscsi_preventmmclosecd9660_accesssr_wu_getffs_statfsscoop_set_sdmmc_powercpuset_complementrijndael_set_keywdcprobeiophy_cdudp_recvspacea4x_bs_w_1km_allocfdropsr_block_putgf_initsyn_cache_unreachuserconf_histszsys_getrlimiticmp6_errcountbpf_attachdicmp6_ctloutputieee80211_ba_move_windowstuck_keyscpuset_issetufs_dirremoveaxen_devsrgephy_servicepxagpio_reg_writeChacha20_Poly1305_Updateif_attachsetuppipe_writesr_set_chunk_staterasops_wronly_erasecolsuvm_map_addr_RB_FINDin_pcblookup_listensbappendm_copybackif_idxmap_removepxammc_cdscsi_remove_linkuvm_swap_puticmpbmcastechoHMAC_SHA1_Initbufheadconfig_scanwi_get_nwkeypxa2x0_gpio_clear_bitkp_pageablesr_raid6_addiopmap_copy_page_funcpxa2x0_lcd_attach_subripsrciso_nchstatskue_txeofaxen_lock_miiural_amrr_startnlineswohci_rem_edether_ifattachinflateSync__wdccommand_donesdmmc_function_freeumass_adjust_transfersignal_initnsphyter_servicefill_drlistffs_updatewsmuxclosedp8390_getunix2dosfnspec_advlockmtdphy_cdmax1111_adc_valuefragtblraw_sendspacenullopzaurus_udc_is_hostsdmmc_intr_disableAES_CMAC_SetKeycomdiagextralocunsleepvop_generic_bmapwdprobescsi_xs_getmtdphy_funcsblf_encryptsched_proc_to_cpu_costohci_alloc_std_chainipintrpool_gc_schedgetnanouptimesdmmc_scsi_detachdes3_encryptmaxdmapural_alloc_rx_listusb_block_allocmemext2fs_symlinkip6_savecontroldevice_registerpxauart_activatebufcache_getanycleanbufsr_raid6_set_chunk_statend6_dad_stoptimertaskq_sys_mpq_to_bpte_l2_l_prot_krmountrootsdmmc_scansyn_cache_resetuhidev_openundefined_entryprocess_read_fpregsip_initreaddeohci_freexural_txtimecd9660_rrip_getnameufs_check_exportsysctl_rdintcd_interpret_sensein_mask2lenural_eeprom_readpxagpio_matchscsi_iopool_destroylodirtypagessr_ioctl_disciplinefindwin95VOP_WRITEsys_nanosleepusbf_free_bufferstart_init_execifq_start_taskifa_update_broadaddrnd6_addr_addifa_ifwithaddrclock_ymdhms_to_secsrootduidif_clone_attachsys_getfsstatohci_abort_xferbpfopencdstrategynetisr_intrdeflatePrimegpt_get_fstyperefcnt_relerandomwrite_filtopsnd6_slowtimo_chuvm_km_valloc_alignenc_xform_nullpriq_deq_commitm_extfree_poolip6_pullexthdrcpu_idle_entercomwritebuf_kva_starttuagg_subVOP_RENAMEauth_hash_gmac_aes_128cdclosesys_fchdirsr_crypto_readsdmmc_scsi_cmdgreen_onprocess0niq_enlistpxapcic_mem_freeieee80211_send_eapol_key_reqrandompidwd_cdurl_initusbf_open_pipe_ivalfilt_ttyrdetachsdmmc_mem_send_op_conduhidwrite_bus_dmamap_destroyvn_pollinet6swrouteswdosdirtemplatemainbus_cdpxa2x0_lcd_cnattachsys_mincorene2000_test_memapm_power_printieee80211_tree_RB_REMOVErasops8_putcharlastsecondswsmousedoopenwi_get_txpowerural_plcp_signaludav_stopusbd_error_strscdcef_caamphymatchscoop_set_headphonepxapcic_intrtcp_maxpersistidleudav_tx_list_initspec_ioctlzkbd_set_ledsufs_initproc_reparenta4x_bs_r_4uvm_exitfc_bmapcallsffs_initsdmmc_submatchcluster_wbuildsr_crypto_createpxa2x0_gpio_clear_intrscsi_ioh_setbootsyncuvm_initcdcef_matchaue_attachieee80211_crypto_attachsys_ioctlusbf_clear_endpoint_featureuvm_map_addr_RB_NFINDif_free_sadlsdmmc_attachfilt_bpfrdetachwsdisplay_emul_capxa2x0_clkman_configcompress2icmp6_initbs_notimpl_bs_rm_1uvm_mapent_free_insertfilt_ttywritepool_update_curpagehid_end_parsepxa2x0_gpio_intr_unmaskin_setsockaddrsrp_startupbpf_moveinwsemul_vt100_output_esc_spcostypevndbuf_pooluvm_page_physloadaxe_iffreset_entryuvm_pmr_remove_1strangewdcresetwdc_exec_xferip6_insert_jumbooptipintrqtuaggsr_raid5_intrusbf_add_stringusb_frag_freelistpxapcic_intr_disestabliship_slowtimordsizerijndaelKeySetupEncprocess_initializeip6_nexthdrrtdeletemsgpledge_swapctl__bss_startrtable_satoplenkue_rxeofrijndael128_encryptVOP_KQFILTERukphy_funcssys_msyncdeflate_compresswskbdreadsbappendrecordevcount_detachsd_capcmcia_function_disablesoftdep_fsync_mountdevinitmsgbufwsmouse_attachniq_initmemsetcuio_copydatapipe_free_kmempxa2x0_splxufs_getlbnsieee80211_get_actionphysiosr_ccb_donepcmcia_3cxem556_func0_cfe0in6_selecthlimupl_sendwdattachmii_phy_delete_mediapxauart_attachin6_unlink_ifaicmp_mtudisc_cloneuvm_pmr_insert_sizesodisconnect_spllowersys_setgroupsmainaue_csr_write_2lxtphy971_funcsrasops_add_fontohci_device_bulk_doneether_crc32_le_updateifih_rcmtdphymatchmsdosfs_bmaparrayukbd_apple_translatetimespecfixaxen_matchrasops_init_devcmapsr_raid1_set_chunk_stateural_set_basicratesip_flushieee80211_delete_keykue_startdp8390_configrasops_mapcharuvm_unmap_removepmap_alloc_l1icmp_errorwsmuxdevsusbf_transfer_completepxagpio_attachbs_notimpl_bs_sm_1upl_rx_list_inituvm_swap_markbaddes_set_keykqueueopssmsc_miibus_statchgvholdbufq_fifo_dequeueidgen32rt_if_removesr_minphysscsi_default_getghash_gfmulusbd_no_quirkm_adjsr_wu_donemld6_stop_listeninguao_shrinkpmap_map_chunkextent_alloc_subregion_with_descrppsratecheckkmemlimitbuf_rb_bufs_RB_PREVwsemul_local_translateamap_copybufq_drainphysical_endbio_statusuhidpollieee80211_ieee2mhzmq_initsched_wasidlesr_raid5_initieee80211_dup_bssuaddr_hint_destroylf_findoverlapsr_raid_start_stopfilt_msdosfsvnodelf_wakelockkv_anykue_attachhookdumpconfAES_CMAC_Initwi_rxeofwsdisplay_cons_kbd_pollcdead_badopblf_cbc_decryptcalcrusys_unlinkmainbusmatchin_scrubhostrt_setgatetcp_ack_on_pushpmap_growkernelext2fs_rmdirufs_chownrtmap_gcdofchmodatsysctl_intupl_tx_list_inituvm_shutdownkqueue_closewsdisplaystoppte_l2_s_cache_modeuvn_initstrlcatsysctl_int_arrbs_notimpl_bs_wm_8uvm_map_set_uaddrcdce_matchsoftintr_dispatchnd6_pooldisk_unlockufs_ihashremtaskq_destroycttywritegpt_chk_parts_bus_dmamap_createSHA256Inittcp_update_sndspacesr_crypto_doneurl_stop_tasksdmatchusb_freememudav_txeofproc0cdce_initufs_renameaxe_caext2gennumbersr_bio_ioctludav_attachuvm_map_entrybyaddrsr_already_assembledusbd_get_hid_descriptorrt_ifannouncemsgsoo_readwdc_scrub_xferscoop_resumeuvm_km_doputpageufs_opencopyout_statfspmap_modify_pvm_catsplxpxa2x0_rtc_setalarmtqphy_statuscluster_collectbufskp_dma_contigcd9660_isohashwi_write_data_usbumass_scsi_minphysuvm_swap_initpxagpio_intr0tcp_nowaue_miibus_statchgural_bbp_initunp_gcsys_clock_gettimeip6_hdrnestlimitcpuset_clearxscale_cache_syncI_rngfrag6_initbuf_replacevnodepte_l1_s_prot_kruvm_pmr_size_RB_NFINDuvm_mapent_addr_removetimeout_setrdreadcrfromxucred__subdi3srp_get_lockedwsdisplay_resetntohsmsgbuf_putchar_bus_dmamem_freesd_flushcd_setvolext2fs_mkdirohci_openpte_l2_s_coherentext2fs_direntersys_symlinkatmii_pollstatrlphy_cawdgetdisklabelrw_exitkv_pagedupfdopenidgen32_initifmedia_list_addpidhashcdcef_encaprtprefpxaohci_detachxscale_context_switchuvm_totalencdebugugl_sendicmp6_ratelimitsr_raid1_createsys_mkdiratdl10019_mii_bitbang_opssdmmc_io_attachdofstatatstart_inituhub_attachether_fakeaddrsysctl_tc_hardwaresmsc_rxeofscsi_ioc_ata_cmdtcp_mssdfltpriq_enquvm_swap_freedata_abort_handlerusbf_setup_xferbs_notimpl_bs_r_1axe_initsr_block_getuhidev_set_reportin_pcbdetachmsdosfs_vfsopststohzaue_ifmedia_updcd_sizettycheckoutqicmp6_mtudisc_callback_registerne_pcmcia_detachvm_map_unlock_read_lnaue_causb_explore_tasksrnd_event_spacesr_concat_rwpmap_clear_referencert_getmetricswdc_ata_bio_kill_xferin6_ifdetachcn_tabswaplist_insertsmsc_lock_miiip_forwardsensors_taskqextent_createrdclosebpf_freeddisklistin6_lifaddr_ioctlsys_fstatfsurl_txeofkue_devsbs_notimpl_bs_sr_8m_injectip6_mforwardingffs_isfreeblockseltrue_kqfilteruvm_map_lookup_entryaxen_cdicsphymatchBlowfish_expandstatebs_notimpl_bs_w_4dead_strategyswi_handlerwsevent_kqfilterusbf_new_devicespec_fsync__wdcwait_resetcom_pxaip_cadoacceptuvm_map_deallocateicmp_reflectieee80211_parse_wpazkbd_attachscsi_xsh_iohext2fs_reclaimnd6_rs_output_set_timoffs_ballocsys_getgroupssr_raid5_xorieee80211_node_attachsys_linkatuhub_cdwi_start_usbgeneric_bs_wm_1ip6_raw_ctloutputkernel_textufs_startsigstkinitohci_devd__end__nsphy_reseturl_sendcdce_encapnd6_rs_timeout_countufs_bmaparrayfragtbl8uvn_sync_lockrtable_getpcmcia_function_enableaes_ctr_setkeyrasops_vcons_alloc_attrifq_barrierpledge_sendfdurl_resetp2p_rtrequestusb_needs_exploreswaplist_findufs_quota_alloc_blocks2fc_fileextendsfilt_sigattachwsmouse_cdsdmmc_go_idle_stateVOP_FSYNCffs_sysctlipport_hilastautoarpinit_doneusb_wait_taskdoclockintruvm_anon_pageinspec_closecd9660_closeuvm_map_mkentrypxaost_cauvm_map_addr_RB_REMOVEsys_shutdowncngetczkbd_cdtc_adjfreqrnd_statesm_gethdrconfig_rootfoundcue_cdputcieee80211_phymode_namebufbackoffsysctl_rdstruct__divsi3uhidev_cdwsmousereadsr_raid1_initxscale_minidata_clean_sizeschedcpuurlphy_servicesbappendcontrolukbd_set_ledswsdisplay_screenstatea4x_bs_rm_1softdep_flushfilesipv4_inputm_getclrpool_headax88190_mediastatuswsmuxioctlsr_crypto_read_key_diskapm_matchipforwardingieee80211_get_cts_to_selfohci_device_isoc_transferusbd_open_pipe_ivalicmp6_redirect_timeoutif_rxr_ioctlpxa2x0_wakeup_statussyn_cache_lookupaxen_miibus_readregprtactiveksym_upcaseufs_makeinoderasops_copyrowsscsi_xs_ioip6_process_hopoptsusbd_find_edescwsdisplay_set_cons_kbdfilt_ttyreadsys_getpgidcom_common_putcswaplist_trimcache_lookupaxen_detachrdioctlrijndaelKeySetupDecuvm_objtree_RB_INSERTsysctl_tcurl_detachbs_notimpl_bs_rr_1sdmmc_intr_disestablishumass_scsi_sense_cbsys_pledgedp8390_intrrijndael_encryptrasops_do_cursorwsemul_vt100_handle_dcsieee80211_recv_mgmtaxe_detachwskbd_set_console_displaydumpsizesowwakeupsdmmc_io_read_multi_1ukbd_keydesctabirda_onsr_raid_inquirysmsc_setmacaddressextent_freeuvm_aiodone_daemonaddupc_tasksched_syncusbd_clear_hub_featureext2fs_vopscomclosepcmcia_print_ciseephy_attachsetsigvecurl_iffsys_sendmsguhidopenvn_marktextcleancachestrcmpsys_quotactluhidev_matchieee80211_get_hdrlensr_raid_startwutcp_mtudisc_increasesdmmc_card_attachulmaxin6_pcbconnectdehashkue_cduvm_pmemrange_addr_RB_INSERThook_disestablishexphy_funcsbpf_catchpacketffs_isblocksr_concat_createpxaip_cdzaurus_startusbd_find_quirkuvm_swap_allocpagesuvm_aobj_poolsys_adjfreqqsphy_funcsicmp6_reflectsetrunqueueudv_attachsettimecdce_rx_list_inituhub_intrarm_pcache_typertable_initdp8390_detachata_set_modemii_phy_auto_timeoutsyn_cache_getnetisrpxaudc_bulk_transferttyrubieee80211_get_ratevop_generic_islockedpxaudc_bulk_closeuaddr_hint_poolwsemul_vt100_output_stringwsscreen_attachm_pulldownbufcachepercentlcd_screen_listenc_xform_chacha20_poly1305pmap_initufs_rmdirrlphymatchieee80211_next_scanpmap_zero_page_funcarmv4_tlb_flushD_SEminsr_meta_native_writeip6_initconfig_detach_childrenrawcbsmsc_detachukbd_cngetcz_errmsgtcpcb_poolmii_bitbang_readregpxa2x0_cpuspeeduvm_map_addr_RB_INSERTBlowfish_stream2worduhidclosetimeout_add_msecipip_allowsys_polluvm_map_clip_endufs_makedirentryusbd_set_configuvm_mapent_mergeieee80211_recv_addba_reqm_defragrtable_l2setvnode_hold_listlastdosdateudav_unlock_miiscoop_timeoutbuf_rb_bufs_RB_NEXTufs_linksched_choosecpusys_mkfifozcallocural_read_eeprompcmcia_parse_cis_tuplein6_ifinitin6_leavegrouprtlabel_id2sasqphy_casddumpiminnet_tick_tosys_chflagsget_hw_ifidKQRELEdelaysdstartip6_hopopts_inputieee80211_media_initselfalsevt100_outputscsi_default_putsr_free_resourceswsemul_vt100_output_esc_percentcom_enable_debugportpage0_datavn_isunderusbd_get_port_statusuvm_pageoutpxa2x0_setiplpffindtypepdevnamesqsyncwi_setmultiuvn_clusterinitprocesscd9660_vptofhwi_attachusb_camii_phy_downraw_inituvmspace_forkknote_enqueuepoly1305_finishudpcksumtcp_sendspaceurl_csr_write_4dl10019_mii_writeregml_dechainuvm_pmemrange_addr_RB_REMOVE_COLORffs_oldfscompatieee80211_add_rsnrijndael_decryptwdcdetachmaxlocksperuidin6_matchlensys_madviseupl_openpipesscsibusdetachdisk_attachwskbd_displayioctlip6_clearpktoptsncpusarptfreebufadjustcom_detachieee80211_ccmp_encryptaxe_stopural_set_macaddrbs_notimpl_bs_w_2dead_printtcp_syn_hashohcixfereephy_serviceinphy_servicemii_media_tablesr_discipline_freewdstrategyttyprintfip_sendreaperprocsigcodeipip_inputdeflateCopyieee80211_send_group_msg2comttyne2000_detectbuf_undirtysysctl_tstringsr_meta_clearusbd_start_nextxscale_cache_cleanDfilt_ttywdetachamap_swap_offsys_sysarchallprocessBlowfish_decipherbio_validateigmp_initmii_phy_add_mediacpu_reset_needs_v4_MMU_disablecache_zapMD5Initcryptodesc_poolbus_space_write_raw_multi_2ffs_vfsopssysctl_mallocwihap_ioctlieee80211_outputlcd_burnerfrag6_slowtimouvm_pmr_insert_addruvm_map_hintwant_reschedpmap_bootstrap_pv_allocatorpxa2x0_gpio_intr_fixupieee80211_ioctlmsdosfs_mkdirkthread_create_deferreduhidevsubmatchrasops8_initcrc32_combinebufq_simple_nscanpxammc_intr_donedevid_freescsibusactivatend6_timercomcnpollcbioopenusbf_stall_pipeqsphy_servicepxaip_attachcd_patterns__cmpdi2sr_crypto_create_keyssd_ioctl_inquiryscsi_xsh_adduvm_pmemrange_addr_RB_FINDraw_detachscsi_xsh_runqueuepmap_get_pdeural_read_multiaxen_txeofbs_notimpl_bs_wr_1domainnamelenigmpctl_varsusbd_get_report_descriptorsd_thin_paramsip_rtaddrfiledesc_initurl_ifmedia_statuscue_csr_read_1vrelewi_set_pmwsmux_do_displayioctlohci_alloc_sedpxa2x0_lcd_setup_consolescsi_xs_errorprtrealloccheck_consoleapm_record_eventamap_freend6_rs_dev_statein6_domifattachwsdisplay_cnputczapm_restartusb_blk_nfreend6_prefix_lookuptc_getfrequencyaxen_ticksync_inactivespec_printusbf_start_nextukbd_apple_mba_mungeext2fs_lookupmsdosfs_openext2fs_linkvop_generic_revokeohci_hash_add_itdapm_activateieee80211_decapfilt_sigdetachfilt_seltruedetachext2fs_renameipsec_def_authsrp_gc_initusbd_setup_isoc_xferpxa2x0_bs_vaddrttywflushcd9660_rrip_offseturl_startwskbd_default_keyrepeat_datacomcnmodeclosefcomioctlumass_cbi_resetscsi_ioh_deqsoftdep_sync_metadataif_clone_lookupgetmicrouptimemii_tickpxa2x0_bus_dma_tagdisk_openpartip6_dad_countuvm_pager_dropclusterfilt_generic_detachpxa2x0_lcd_mmapip6_getmoptionsif_map_dtorsensor_task_unregisterzssp_ic_sendwdc_ioc_ata_cmdpcmcia_card_deactivatepxaudc_allocmpledge_ioctlwi_pcmcia_matchcd_get_parmszkbd_cngetcpmap_extractin_purgeaddrnd6_ifptomacwsmousedoioctlamap_unaddural_watchdogmsdosfsread_filtopslcd_cnattachuvm_pmr_insertcd9660_printsr_meta_saveohci_rhsc_enableif_congestionnfilescd9660_islockedin6if_do_dadcue_txeofaue_detachpipe_kqfilterdowait4ext2fs_openpmap_devmap_find_papmap_kenter_cacheusb_insert_transferaxe_matchrasops4_copycolsukbd_keymapdatasr_meta_validatestopprofclockbufq_nscan_destroynullioctlsys_getentropyrasops_getcharpte_l2_l_cache_modeisohashmclsizesparsediskfilt_wseventdetachwi_set_debugzkbd_onsdmmc_mem_single_write_blockbreadieee80211_node_copynd6_rs_outputamap_lookupipctl_varswsdisplay_suspendpmap_page_removert_timer_remove_allwskbddevprintzkbd_irquhid_intrwdc_output_bytesieee80211_classifyzkbd_modstateaxen_ax88179_initwsdisplay_closescreenieee80211_media_statusproc_stop_sweepiophy_capmap_set_pt_cache_modescsi_xs_exectcp_usrreqmichael_keyieee80211_setbasicratessd_interpret_senseuvm_map_pageable_pgonuvm_addr_invokeudp_usrreqifmedia_initusbf_open_pipertable_l2ext2fs_vfsopsuvm_mapent_freeext2fs_inactivedead_bmapif_getgroupmemberssoo_kqfilterml_enqueuecpu_startupusbd_set_hub_depthwsemul_vt100_output_dcs_dollaramap_refwdc_ioctlamphyattachapm_suspendsfdexpandtickscoredump_countsegs_elf32sr_wu_initwdc_ata_presentmsdosfs_closerd_detachpool_do_getext2fs_setattrapm_resumesysctl_clockratevn_rdwrohci_close_pipend6_need_cacheip6intrsyncer_maskwdc_default_write_raw_multi_2if_ih_removeuvm_pagedeactivateearly_clkmanufs_unlocktcp_ctloutputpxa2x0_turbo_modeukphy_statusnd6_listieee80211_derive_pmkidMD5Updateblktochrifmedia_setscsi_iopool_puttask_setpcmcia_function_initbio_lookuppmap_createuvm_map_extractsr_crypto_meta_opt_handlernd6_prelist_addufs_removesysctl_tc_choiceptsignalboottimecd9660_readlinkwsdisplay_set_console_kbdxscale_cpu_sleepVOP_ADVLOCKaxe_watchdogwskbd_mux_closefrag6_inputcompressBoundpmap_alias_distunpst_sendspacewsemul_vt100_output_escffs_indirtruncsmsc_cdieee80211_add_ratessr_raid5_rebuildpxapcic_mem_mapuvmspace_freetcp_rscalettwakeupext2fs_inode_poolffs_ino_poolmii_phy_statusmsgwsdisplay_internal_ioctlcpufunc_domainsswapdrum_getsdpif_input_queueVOP_PRINTfdshareuipc_setaddrsdmmc_intr_taskugl_tx_list_initicmpv6ctl_varszaurus_udc_matchrasops_vcons_unpack_attrcdstartsdmmc_stimeoutgf_premulfilt_generic_readwriteuserconf_disablevrefusb_detachipforward_rtohci_device_isoc_closeurl_int_miibus_writereguhidev_activatevt100_ansimodeAES_CMAC_Finalsr_uuid_formatrasops_lmasksd_cmd_rw16ghash_updateinpcb_pool_initializedsys_nosysat_pollallproccdevswsr_rebuildxscale_cache_flushDne2000_attachsys_mlockallusbf_config_endpointwskbdcloseuvm_sysctlstatintrgetsndiskmapopen_bus_dmamem_unmapsys_fchflagsnamei_poolpxa2x0_pi2c_readarp_poolsmsc_ifmedia_stszssp_caukphymatchpxa2x0_gpio_get_functionuvm_pager_putpledge_socketdiskmapcloseohci_device_bulk_abortudav_cain_canforwardrasops_unpack_attrieee80211_clean_cachedsmsc_unlock_miipxa2x0_bs_subregionohci_device_intr_abortieee80211_tree_RB_INSERTrasops_copycolswi_pcmcia_attachpmap_destroyip_oursscsi_mode_selectkernel_pt_listuvm_map_freelist_update_clearetherbroadcastaddrieee80211_rssadapt_updatestatscdcef_do_requestpte_l1_s_prot_urvfs_getnewfsiddiskstatslenaue_rxeofudp6_ctlinputitimerroundSHA512Finalaxen_miibus_writeregarm32_vector_inituvm_pmr_size_RB_PREVscsi_print_sensewskbd_update_layoutmmopenffs_inode_freeohci_device_intr_transferwdc_cdamphy_statusukbd_intrrtioctlkue_ctlpxaost_get_timecountscsi_xs_putuaddr_hint_functionsieee80211_tree_RB_INSERT_COLORprofprocswdc_free_xferip6_inputbuf_free_pagessleep_finish_signalicsphy_cdwi_usb_cmdrespsr_crypto_alloc_resourcesgeneric_armv4_bs_rm_2route_srcnet_tickbootduidspeedup_syncerigmp_sendpktif_setlladdrloop_clone_destroywdc_ata_bio_doneifmedia_baudrate_descriptionsv_putcsr_scsi_wu_getsdmmc_add_taskm_getptrukbd_caufsvnode_filtopsscoop_pcic_set_poweruvm_fault_unwireuserconf_common_attr_valsched_noidlesys_getitimerhid_get_datadonicewdcstartcpu_configuresr_rwip6_freemoptionssqphy_funcshidkbd_delayed_decodeieee80211_amrr_chooseusb_create_task_threadsieee80211_end_scancdce_txeofwsdisplay_common_attachne_pcmcia_matchbufhighpageswsfont_rotate_internalpmap_fault_fixupuaddr_poolrn_refinesgeneric_bs_rm_4hmac_opad_buffersockargshidkbd_ioctlwsdisplay_getactivescreenvop_generic_abortopsr_raid6_set_vol_statesetregsupl_rxeofsobindvmcmd_map_zerozkbd_pollpxagpio_intr1ml_enlistvfsinitupl_cacnclosetcp_do_rfc1323ip_fragsin_addhostifq_deq_rollbackwdc_dmawaitmii_phy_setmediakd_trylockhostidwi_alloc_nicmem_usbusbd_free_bufferuvm_pagermapoutsr_raid0_rwif_downallsys_kbindext2fs_vptofhnam2blkrw_statussr_raid6_assemblecoredump_writeseghdrs_elf32rt6_deleterouteip_maxqueuesysctl_ttyieee80211_chan2ieeeuhub_cazssp_initin_socktrimieee80211_recv_delbaext2fs_dinode_poolieee80211_node_cmprtallocsys_mprotectieee80211_std_rateset_11gwi_pcmcia_cadequeue_randomnessuvm_km_kmemalloc_plafilt_cd9660vnodecue_casyncer_maxdelaywsdisplay_getscreendeadprocml_filterstart_reaperif_rxr_info_ioctlunicode_to_latin2sys_fcntlvfs_free_addrlistsys_setrlimitsys_sigpendingloop_clone_creatediskmapwriteuvm_map_cleanuvm_pmr_get1pageicmp_redirtimeoutttyclosewdrestartzapm_charge_completepxa2x0_lcd_ioctlusbf_freememcomp_algo_deflatemaxvfsconfml_dequeuetimeout_addcpu_cdip6_forwardbufcache_adjustwskbd_set_backlightnumcachepxaudc_write_epNsr_bootkeyural_write_multiuvm_pagecountcpu_initclockscue_sendwskbdioctlmii_downcdcef_attachin_pcbhashbrelseext2fs_unmountpsratiosdminphysohci_device_isoc_methodswi_usb_tx_lock_tryaxe_unlock_miicpuset_delwsdisplay_switch3nd6_rs_output_timottyoutdevice_lookupwdc_pcmcia_prbpf_sysctl_lockedwi_usb_txeofsr_crypto_preparecdcef_start_timeoutcdminphysschedhzurlphy_carip6_inputtcp_totbackoffvdropuserconf_basesdmmc_mem_sd_initsr_raid5_rwlooutputcue_setmultisoisdisconnectedpxa2x0_bs_barrierxscale_cache_clean_addrif_putrevbitsdvd_read_disckeypmap_clean_pageuvm_aio_aiodonesr_ccb_rwpmap_clearbitieee80211_mgmt_outputcrypto_freereqsyn_cache_rmclrbitsuvn_putigmp_checktimerscsi_add_linkxscale_cache_clean_minidataieee80211_proto_detachpool_gc_pagesmii_phy_statuspcmcia_card_intrcommajordl10019_mii_resetrasops_list_fontcrypto_newsessiongeneric_armv4_bs_r_2pxaic_baseenc_xform_aes_xtssoclosesr_ccb_freescsi_detach_targetinstall_coproc_handler_staticwakeup_nsys_connectbuf_daemoncrsetskpcsdmmc_scsi_attachpxammc_bus_clockpxammc_bus_powerchacha20_reinitieee80211_bip_decapbufq_fifo_createohci_root_ctrl_transferipv6ctl_varsroute6_inputbs_notimpl_bs_w_8cdcef_stopcsr1board_startupsys_socketpaircnreaddounmountuvm_swap_allockthread_create_nowwskbd_pickfreehidkbd_bell_fn_argtcp_ackdrop_ppslim_countusbf_cdarm_picache_sizesr_map_rootttspeedtabkqueue_readcd9660_mountintr_barrieruserconf_maxdevcue_inituvm_pmemrange_addr_RB_INSERT_COLORfork_tfmratelxtphymatchsr_hotplug_registerpv_sizensgphymatchzkbdhalttvuvn_sync_qin_proto_cksum_outwskbd_activatewsdisplay_cons_pollmodewi_media_statusurl_miibus_statchgnd6_purgeaxen_unlock_miitcp_keepidleif_attachheadnextcwi_scan_timeoutuvm_wakeup_plaiszerodevpxaudc_matchauth_hash_hmac_ripemd_160_96umass_cageneric_bs_sr_4ifq_destroylf_freesys_fhstatnullmodemohci_hash_find_itdsys___get_tcbieee80211_amrr_node_initraw_recvspacediskerrwi_startcd_cdwsdisplay_screentype_pickwsdisplay_addscreen_printpxaudc_openieee80211_state_namesys_preadne_pcmcia_activatescsi_movewdc_pcmcia_detachkernel_pt_lookupkmem_mapcd9660_check_exportukbd_translateconfig_pending_decrqsphyattachaxe_startieee80211_input_print_tasksoqinsquediskstatscdce_attachudp_inputnchrtoblktblihashrn_search_mifq_congestionresettodrusbd_ref_decrufs_readdirsys_flockpvwi_usb_do_transmit_syncspec_badopmsdosfs_linkbufq_nscan_dequeuebs_notimpl_bs_c_1ohci_root_intr_methodssdmmc_check_cis_quirksicmpctl_varsigmpstatsuspend_randomnessmichael_finalvn_initialize_syncerdpipeselwakeupxscale_controlcd9660_quotactlsr_rebuild_starticmp_sendadjtimedeltacdce_watchdogsmsc_newbufrasops_vcons_erasecolspxagpio_intrNusbf_abort_pipewdc_ata_errieee80211_choose_rsnparamstime_uptimevm_min_kernel_addressuvm_pagealloc_pgcdce_intrsmsc_rx_list_initfilt_uhidreaduvn_wlistuvm_pmemrange_addr_RB_REMOVEsowakeupinsidetcp_autorcvbuf_incbufq_queuepxapcic_create_event_threadpxa2x0_lcd_stop_dmabs_notimpl_bs_r_4prefetch_abort_entrysigactsunsharetimeout_hardclock_updaterdattach_edataupl_detachrijndael128_decryptttkqfilterm_tag_deletecd9660_ihashremsensor_findip_fragmentfilt_timersys_statfsSHA1Finalsensordev_deinstallsched_nomigrationsinittimecountersys_sendsyslograwin6pcbtablepmap_protectkprintfdevice_unrefrc4_keysetupscsi_startuvm_pmr_addr_RB_REMOVE_COLORin_cksumvnode_poolzombprocessuao_shrink_convertvnode_free_listtcp_savetiusbf_matchuvm_pagereallocapm_battlowsensordev_countuvm_fault_unwire_lockedklist_invalidateuvm_km_createthread_enddes_check_keyrt_senddesyncsogetopthid_report_sizeusbf_endpoint_attributesuvm_unmaprd_matchusbd_ref_waitsr_crypto_calculate_check_hmac_sha1wsemul_vt100_attachpollscandomaininitvflushbuftime_secondip6_forward_rtwskbd_get_mapentryuvm_pmr_initrt_matchsr_hotspare_rebuild_callbacksbcreatecontrolsys_mlockpxa2x0_maxspeedieee80211_setup_nodebioioctldvd_read_structvdevgonehtonsbucketkqueue_writesys_syncieee80211_reset_scancominitaxen_resetenodevsr_raid0_discipline_initffs_mountfsin_delayed_cksumwsemul_vt100_edrtstatttvtimeoutkd_waitokabtstacktimingsafe_bcmpspeclisthbdwritecpu_idle_cycleversion_to_spcVOP_INACTIVEsdmmc_io_read_4zkbd_cawsmux_do_closepte_l1_c_protouvm_mapent_biastcp_syn_cachernd_event_idxwsemul_vt100_translatehalteephy_cainphy_caieee80211_std_rateset_11aaf2idx_maxkputcharbootargssys_getsidRMD160Initdisk_gonewi_write_record_usbcue_csr_read_2wdc_pcmcia_disk_device_interfacem_trailingspacefileheadrc4_cryptusbd_alloc_xferscoop_mmc_get_ocrpxaudc_ctrl_abortnextvnodeidcttypollsr_meta_initural_startrotatedfontskp_dma_zerosensor_task_ticksys_swapctlpxaohci_matchcpufunc_dfsrpxammc_attachbd_reqpxa2x0_probe_sdramrasops4_initbs_notimpl_bs_rm_2copypktoptsin_selectsrcrn_add_dupedkeymsgscpu_exitzapm_batt_lifeip6_initpktoptsuvn_getwsmux_add_muxbpfilter_destroyunp_attachohci_device_isoc_starttcp_syn_bucket_limitsys_renamesr_raid6_xorqfrag6_nfragsip6_log_timeeephy_statusinphy_statusxscale_cache_purgeDscsi_activate_targetuvm_km_valloc_waitufs_ihashinitunp_defersys_sigreturnlid_suspendsbflushscsi_link_closeipsec_require_pfsswapdevwd_cawsdisplayttykue_sendsr_raid5_openingsaxe_tick_taskvn_readnclrunegheadbwriteleavepgrpqsphy_cdarmv4_tlb_flushDkernel_pt_tablepmap_get_pde_pteuvmpageropsuvm_page_initohci_root_intr_closewsdisplay_common_detachsr_copy_internal_datacast5_decryptsdmmc_io_xchgxscale_setupnamecache_rb_cache_RB_INSERTpool_multi_free_niwsfont_locktcp_timer_funcsipqent_poolpxaip_attach_criticalif_attachdomainbpf_d_rcicmp_ratelimitieee80211_rssadapt_raise_ratesr_crypto_decrypt_keyusbf_iface_endpointuvm_km_page_initrttimer_pooladler32_combineieee80211_regdomain2flagadd_entropy_wordsax88190_mii_readregrgephy_load_dspcodepxa2x0_gpio_set_bitsosenduuid_enc_letaskq_initdosetrlimitpxa2x0_pi2c_getvoltageuvm_pmemrange_addr_RB_PREVrn_inituvm_objtree_RB_NEXTsr_scsi_probeloopattachdp8390_watchdogural_rxrateieee80211_save_iewdc_input_bytesusb_abort_task_thread_procRMD160Finalscsi_cmd_rw_decodeprocess_read_regschainlengthusb_fill_udc_taskpte_l1_s_prot_masksys_unlinkatural_disable_rf_tunettwakeupwrrn_lookupthrsleep_unlocksr_wu_release_ccbsrtmask_poolsmsc_write_reguserconf_show_attrsys_execvesdmmc_mem_send_cxd_datafdallocwsdisplayreadprfindin_hasmultiscsi_donechkvnlockhw_sysctltc_ticktockphtree_RB_MINMAXpxaudc_freexpmap_alloc_l2_buckettcp_syn_cache_limitnumvnodeszkbd_activatecomreaduvm_pagefreeext2fs_inode_allocswcr_encdecwsdisplay_switch2scoop_check_mcrbufq_fifo_queuein6_pcbbindif_idxmap_initicmp_do_exthdrreapercoredumpfilt_kqueuemalloc_roundupusbd_strpxaudc_bulk_donepipe_readpxa2x0_bs_freeuvm_map_addr_RB_INSERT_COLORifioctlsys_utimesusbd_do_requestnd6_storelladdrusbf_endpoint_addressrip_initsocreatepriq_allocusbd_find_idescpmap_cache_statemq_enqueueureadcaue_startufs_setattrrijndael128_setkeyieee80211com_headlogprimemhookzapm_batt_voltnd6_rs_initcast5_encryptsys_exitsbtrym_applyaxen_ifmedia_updxscale_maxspeedswcr_processudav_startaxe_lock_miiwdc_exec_commandpxaohci_caudv_lockbufqspxaudc_bulk_abortwdcintrcd_playHMAC_MD5_Updatesys_clock_getressdmmc_set_bus_widthaxe_attachsyn_cache_insertnsgphy_funcsrc4_getbytesswcr_authencttystats_initne_cdnd6_umaxtriesohci_device_intr_donedochflagsatusbf_get_stringpcmcia_intr_stringpte_l2_s_prot_kwnd6_debugip6_maxdynroutesuvm_map_piewindow_deflatein_prefixlen2maskcpu_cpuspeedcpufunc_iddefrtrlist_updateurl_csr_write_1_tr_initSHA1Transformesymusbf_schedsoftintrscoop_mmc_set_powerieee80211_defragcrypto_invokeosreleasesdmmc_free_ccbsVOP_RECLAIMscsi_probe_targetsr_raid1_set_vol_stateip6_getpcboptbuf_releasewsmux_evsrc_set_displayHMAC_MD5_Init__modsi3smsc_txeoftcpqe_poolpgrp0mainbussearchurl_watchdogbuf_flip_dmauserconf_changepxa2x0_lcd_new_screenuserconf_helpsr_ioctl_setstateufs_advlockicmp_initpcmcia_cis_read_1cdst_pteuvm_growinet_ntopvfinddevieee80211_node_cleanupugl_attachrt_msg1apm_handle_eventether_delmultirefcnt_takesave_rtesr_crypto_get_kdfmainbusattacharc4_taskexec_sigcode_mapsys_gettimeofdayipsec_soft_timeoutwdccommandshortwsevent_filtopsieee80211_rate2mediavcleanif_map_gciophy_servicecd_getvolsplassert_ctlsys_getresuidsys_fhopensr_crypto_ioctlzapm_battchkratedos2unixfnscsibussubmatchrtentry_poolbufq_restartzkbd_consopsuvm_km_pgremove_intrsafeext2fs_sbupdatein6_init_address_ltimesdefrtrlist_delsdmmc_mem_set_blocklensys_fchmoduvm_unmap_detachieee80211_recv_authupl_initusb_dev_quirkswskbd_srcopsdopselectuserconf_common_devpxa2x0_irq_handlerstartniq_enqueueusbd_devinfouvm_mapanonip6id_randomidvn_isdisksys_selectscoop_charge_batterydeflateParamsin_pcbpickportbadaddr_read_1vop_generic_lookuppxammc_functionsin6addr_intfacelocal_allnodeslogreaddead_lockieee80211_name2regdomaintcp_issphysical_freestartfc_largedistancesys_setitimerisofntransurl_attachnd_prefixsmsc_tx_list_initwsemul_vt100_resetvfs_unregistermii_phy_flowstatussmsc_ifmedia_upddisk_mapvt100_setnrcselwakeupffs_reloadifq_serializecnwriteumass_bbb_get_max_lunzkbd_keymapdatain_ouraddrpolloutuipc_usrreqnd6_na_inputrtl80x9_mediastatusvflush_vnodewsmouse_activateaes_key_unwraprip6_usrreqin6mask96coldpxaudc_ctrl_donecdcef_startunp_scansbappendaddrbufqs_mtxbpf_maxbufsizeextract_entropyufs_islockedusb_detach_wakeupffs_unmountne2000_detachffs_vopsdofutimenssys_pwriteisohashtblscoop_pcic_matchwihap_shutdownuvmspace_allocigmp_input_ifrevarpinputbufq_nscan_peeksdmmc_function_alloccd_pausecompresshashinitttstartumass_setup_transferwdwriteipsec_keep_invaliduao_detach_lockedpool_allocator_singlepledge_fcntlieee80211_parse_rsn_akmsdopentcp_tracemii_phy_resetip_getmoptionsdp8390_mediastatusin6mask32__moddi3rasops_doswitchdisk_countohci_confdpmap_page_protectdead_openscsi_detach_lunsr_ioctl_inqkue_setworddodup3userconf_attrwdc_kill_pendingbmtphymatchicmp6_redirect_outputifq_restart_taskroute_cbsys_futimenstaskq_createexphy_cdreadepcpuset_init_cpuscsi_init_inquirylxtphy_resettcp_slowtimoieee80211_std_rateset_11bamphy_cdcd_play_msfpmap_remove_pvtcp_newtcpcbsbchecklowmemswapmountffs_mapsearch_bpf_mtapsys_fhstatfself32_load_filesys_getpeernamepxapcic_io_mapieee80211_setup_htcapsieee80211_get_txkeyscsi_strvistcp_set_iss_tsmbpfwritedoingcachesys_getrusagescsi_probeapm_threadrasops_initauth_hash_hmac_sha2_256_128aue_reset_pegasus_IIuvm_map_addr_RB_MINMAXbufq_destroyusbd_get_cdescnd6_prunecomconscflagm_getffs_truncateuhidevprintmii_attachsdmmc_cdttylcloseconsbufppool_allocator_allocwdc_default_read_regchar_typeohci_free_sitdusbctlprintvn_closeudav_csr_writeuhid_do_readrt_timer_queue_countcdcef_initusbd_close_pipeusbd_deactivatewsdisplay_cfg_ioctlffs_writeieee80211_wep_set_keyfilt_sowdetachnd6_initip6_maxfragsm_extref_mtxlimfreedoutimensat__wdccommand_intruvm_km_free_wakeuprootvnodeifmedia_ioctlpxammc_host_ocruserconf_modifyusbf_setup_pipewi_usb_rxeof__one_cmpldi2spoofgptlabelcpufunc_nullopcd9660_ihashgetmii_phy_detachwskbd_add_mux__muldi3uhidev_caurl_lock_miiip_mtudisc_timeoutrandomopenin6addr_linklocal_allnodesamphy_capxaudc_attachusbf_allocmembufinitbootconfigscsi_quirk_patternsuserconf_lineslimit0uvm_md_constraintsif_attach_commonlcd_set_backlightpxa2x0_pi2c_openuniqdosnamesr_raid5_set_vol_stateinflateSetDictionarypfxrtr_lookupext2fs_mknodvttoif_tabwdc_pcmcia_activatebgetvppgrp_poolsr_concat_assemblesmsc_ioctlsd_cmd_rw12pledge_sendituvm_pmr_addr_RB_INSERT_COLORucred_poolxscale_cache_purgeD_rngcpufunc_ifsrip_insertoptionsdes3_setkeyarp_maxtriespmap_uareacd9660_bmapax88190_mii_bitbang_writeaue_eeprom_getwordukbd_cnbellphtree_RB_INSERTnaptimeufs_dirbadentryusbf_close_piperasops4_erasecolslogioctlicsphy_funcs_bus_dmamap_load_uiogeneric_bs_wr_1etheranyaddrstrlensensor_task_workinitialvnodesrasops15_putcharpriq_purgefilt_cd9660writeconfig_suspendzkbd_enablewsfont_initieee80211_parse_rsn_cipherwsdisplayparampool_page_freewdactivatewsmouse_inputcopystrsched_nmigrationswdc_do_resetsys_pipeural_setup_tx_descusb_detach_waitpxapcic_printpxa27x_run_modearm_pdcache_waysieee80211_encryptarp_rtrequesthw_vendorxscale_setup_minidataext2fs_reload_vnodeelf32_check_brandwi_cor_resetudp_initieee80211_recv_4way_msg3proc_trampolinepxaudc_read_ep0sys_rmdirdp8390_disablefilt_cd9660readcd9660_vfsopscpuset_copycdcef_methodsspec_accesssocantsendmorepxaintc_causb_rem_taskpte_l2_l_cache_maskcdactivateether_inputuvm_vsunlocklockstatus_splraisequotaoffpxa2x0_read_ccntcoredump_note_elf32fs_posix_sysctlif_slowtimosmsc_tickudbtablewi_setdefwdcattachufs_printfatentrypledge_dropwpathswi_update_statschacha20_cryptAES_CMAC_Updateusbd_printBCDsys_statukbd_apple_mungein_baddynamicieee80211_keyrunlineswpxaost_cdmsdosfs_symlinksys_symlinkicmp6_sysctlpool_p_insertclfreeconfig_found_smuhidread_filtopsusbd_interface2endpoint_descriptorfdreleaseuvm_swapout_threadsural_bbp_writetask_addusbf_add_interfaceknote_attachlcd_activateieee80211_tkip_decryptdp8390_ioctl__assertwsdisplay_emul_matchnd6_dad_ns_outputin6_prefixlen2maskscoop_akin_pulluppcmcia_megahertz_xjem1144_func0_cfe0uvm_pmemrange_use_insertudp6_outputieee80211_prfcn_devvpcom_activatewi_get_debugmaxfilesupl_devsuvm_pagecmpuvm_pageactivatein6_addr2scopeidgf_mapdma_alloc_bus_dmamap_load_rawif_ih_refffs_mountrootrd_cdrrw_statuspxaudc_write_ep0uvm_map_pageable_allsleep_finishipqtaskq_next_workdl10019_media_initpxa2x0_lcd_show_screenrn_fixup_nodesmsdosfs_strategycd9660_vopstimeout_delif_rtrequest_dummyural_media_changewsemul_vt100_elieee80211_chan2modeif_delgroupspec_strategyuvm_pglistfreeusbopenax88190_media_initext2fs_readsoo_statwskbd_cnpollckue_newbufuvm_map_isavailrusage_pooldisk_detachtask_delstrchrsystqscsi_plug_poolrgephy_causbf_host_resetnd6_allocateduvm_pmemrange_use_cmpaes_xts_encryptuvm_pmr_size_RB_INSERT_COLORauth_hash_gmac_aes_256crypto_driverssysctl_int_loweriftovt_tabtcp_backoffsys_chrootieee80211_rssadapt_lower_rateicmp6_redirtimeoutsoisconnectingarc4random_bufwsdisplay_pollcsr_wu_freeaobj_pagerlo0ifidxzaurus_battery_c3000uvn_iogeneric_armv4_bs_w_2MD5Transformmld6_inputgeneric_armv4_bs_sr_2rgephy_mii_phy_autoieee80211_rx_ba_timeoutbpf_d_listsr_wu_allocsyn_cache_cleanupip_pcboptsfc_purge__data_startpxapcic_mem_unmapfilt_timerattachifmedia_delete_instanceurl_caenc_xform_aes_gcmuvm_mapent_allocudav_miibus_writeregacphymatchicmp6statzssp_write_lz9jg18generic_bs_w_4inflateEndrt_checkgatebufcache_takesr_set_vol_statewsevent_pollsys_profilvmcmd_map_pagedvnugl_stopin6_pcbhashlookupwsdisplay_cdbpf_detachdVOP_UNLOCKpmap_uncache_pagesingle_thread_setsyn_cache_initieee80211_find_txnodecd9660_wchar2charip_ecn_egressether_ipmulticast_maxsr_raid6_createohci_checkrevuvm_init_limitsukphy_cdentropy_input_rotateusbf_softintr_establishin_pcbconnectVOP_POLLVOP_IOCTLsafepriunicode_to_latin7pxapcic_io_unmapuhidev_ioctlpxaohci_disablewdc_default_read_raw_multi_4ip6_copyexthdruao_swap_offmachinewi_cmd_ioVOP_CLOSEuvm_anallocin_pcbdisconnectzts_sync_ads784xuvm_vnp_terminatewi_usb_rxfrmsdmmc_io_read_1sys_getpiduaddr_rnd_functionsipmultipathunp_dropugl_matchuvm_map_advicetcp_mtudisctimeout_startupcue_matchrn_addroutesdactivatefilt_msdosfsdetachural_detachaxe_ax88772b_nodeidukbd_cnpollcdoreadlinkatdvd_read_manufactundstackconfig_activate_childrenpxaip_printip6_check_rh0hdrieee80211_input_printdomkdiratremrunqueueusb_fill_udf_tasksoo_closetcp_recvspaceuvm_meteruhidev_maxrepidpmap_needs_pte_synctcp_ackdrop_ppslimmaxthreadnd6_lookupin_insert_prefixieee80211_cache_sizescsi_iopool_runurl_openpipesukbd_countrylayoutzts_matchsys_getppidsr_raid_request_sensescsi_ioh_pendingmii_anaruaddr_rnd_selectrc4_skipVOP_READDIRdomainssdmmc_select_cardsd_cmd_rw6arm32_dma_range_intersectin4_cksumextent_alloc_subregionneedbufferwsemul_pickieee80211_get_addba_reqin6_ifattachtcp_rst_ppslim_lasticsphy_cawsdisplaystartbs_notimpl_bs_rr_4wsmouse_srcopsSipHash_Initohci_root_intr_doneip6_multipathusbd_get_device_descriptorpxapcic_submatchcd9660_initumass_fixup_yedataipsec_soft_bytesmichael_initnselcollemul_elf32usbd_open_pipeohci_softintrmsdosfs_lookupspec_pathconfhook_establishtcptv_keep_initsys_chdirext2fs_diremptysys_thrkilluserconf_cntext2fs_inode_freepxaip_capcmcia_ccr_writeapm_cdscsi_io_get_donexscale_cache_clean_sizebuf_objectpxaintc_cdip6_rr_pruneuao_grow_convertusbd_desc_iter_initsbcompresspmap_free_l1nd6_outputSHA512Lastcdevsw_lookuplogsoftcsys_adjtimerijndael_set_key_enc_onlyuiomoveiohci_device_clear_togglesr_ccb_allocwdstartwsmuxreadamap_splitrefspec_open_clonewskbd_do_opensoftnettqsd_thin_pagesnclruheadscsi_move_doneural_next_scanrasops_alloc_cattruvm_aio_biodonern_initheadusbd_get_descvop_generic_unlockrt_timer_adduvmspace_shareentropy_poolieee80211_print_essidroute_usrreqdeextendspec_vopspxapcic_event_threadieee80211_wep_encryptsr_raid6_openingsieee80211_recv_deauthsched_init_cpurasops_erasecolstcp_dropicmpstatudpctl_varsuvmpd_scanm_prependsys_getrtablesoftraid_casmsc_resetwsemul_vt100_output_scs96_percentinflateInit2_cd9660_pathconfax88190_stop_cardin_pcbrehashsyncer_delaynoin_arpinputzts_scalezts_caufs_accessin6_embedscopeif_alloc_sadlphpoolunix2winfnmsleepsdmmc_io_resetwsfont_unlockreassignbufip_freemoptionssr_meta_rwieee80211_release_nodesohasoutofbandbs_notimpl_bs_c_2nd6_dad_duplicated_bus_dmamap_unloadieee80211_free_allnodesmsdosfs_fhtovppte_l1_s_coherentbs_notimpl_bs_wr_4maxvnodesether_crc32_beinflateBackEndieee80211_add_ssidcpu_reset_address__explicit_bzero_hookpgfindsoftint_pendingtcp_ackdrop_ppslim_lastloadfirmwarerasops_cmapswcr_compdecip4_inputtcp_inputsysctl_dumpentryrtrequest_deletedkcksumwsdisplay_cnattachnd6_gctimerieee80211_ccmp_decrypturl_csr_write_2iptimerip_inputwi_set_txpoweraxe_ifmedia_updwdc_ata_ctrl_intrusbd_get_endpoint_descriptor_tr_tallyudp_ctlinputmii_detachsdmmc_io_send_op_condudav_rx_list_initpool_sethardlimitrasops4_do_cursorip_freefsys_sysctlvfs_lookupwdc_default_write_regrlphy_statuscpu_info_listicmp6_mtudisc_updatesun_nonamekmeminitnsphyterattachnd6_ns_inputdeflateEndmq_filterdevice_refffs_syncrd_root_imageusbf_task_threaduvm_map_submapsr_hotplug_callbackscnioctlufs_vinitsys___tforksr_ccb_getpool_primesdmmc_mem_scannsgphyattachdevid_allocm_extrefpgrphashtbldoppollifmedia_matchget_crc_tablestatclockwi_read_data_usbdvd_read_physicalrw_enter_writeuserconf_argbufpxa2x0_lcd_consoleMD5Update_intm_tag_copyinflate_tablepmap_l2ptp_ctorreaddisksectordata_abort_entryhid_get_itemrt_xaddrsmsdosfs_getattrip6_maxifdefroutersm_devgetwritedisklabelin_ifdetachmsdosfs_printkernel_pmap_storewsemul_vt100_opsin6_ifattach_loopbackstartprofclockohci_device_isoc_enternsphymatchupl_ioctlpte_l2_l_prot_kwundefinedinstruction_bouncesys_getresgidprocinitapm_userstandbysmsdosfs_readdirdead_ebadfextent_do_allocnd6_timer_taskpxaudc_enablewddetachsoo_ioctlswap_officmp_redirect_timeoutforkstatwi_card_identaue_miibus_writeregnet_ticksdl10019_mii_statchgicsphy_servicenull_setkeywi_send_packetigmp_sysctlin6mask64ohci_rhsc_ableifq_attachsoftclockieee80211_node_freetc_initupdate_modifierffs1_compat_writeieee80211_amsdu_decapblf_decryptswdevtdisk_lockscoop_pcic_readarc4random_uniformsbwaitufs_reclaimkv_intrsafedorefreshcredsscsi_xsh_set_tr_alignsr_meta_opt_handlersdwriteohci_device_intr_startxscale_minidata_clean_addrlcd_accessopswsmouse_cafilt_logreadsysctl_rdquada4x_bs_w_4uvm_vnp_setsizea4x_bs_rm_2Chacha20_Poly1305_Initvmcmdset_extendural_caaes_key_wrap_set_key_wrap_onlyzapm_batt_stateip6_use_deprecateduserconf_hist_intextent_alloc_regionsys_mknodpmap_proc_iflushext2fs_mountfskill_vmcmdsuhid_attachrasops_vcons_putcharzkbd_matchufs_mknodsbinsertoobin_lifaddr_ioctlknotelf_advlockpffinddomainsdmmc_ccb_freeeephy_resetwsmux_do_openfreeifq_is_serializeddorenameatwi_ioctlzts_disablelcd_attachffs_hashallocpxa2x0_ccnt_enableswstrategyuserconf_pnumscsibusprintnamecache_rb_cache_RB_NEXTrtl80x9_init_cardwsmuxkqfiltermbstatmtxsys_getpgrpukbd_ioctlusbf_add_config_descwsemul_vt100_console_emuldatasonewconnufs_direnterudav_csr_write1uhid_detachgeneric_armv4_bs_c_2pffindprotoudav_watchdogbold8x16_iso1uvm_pageallocsdmmc_io_enabletcp_saveti6wdctimeoutwsemul_vt100_initHMAC_SHA256_Updatenchrdevfrag6_freefundefinedinstructionuvm_pmr_use_incaue_cdnamecache_rb_cache_RB_INSERT_COLORuvm_map_vmspace_updateqsphy_ca